1TU4A

Crystal structure of rab5-gdp complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
GNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Rab5-Rabaptin5 interaction in endocytosis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5A
total genus 56
structure length 169
sequence length 169
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tu4A00
2V54A 5FBVB 3WYFA 2ZYUX 2ZQ5A 2CNWA 2QSYA 3JVVA 4HAWA 3QKTA 2XNDA 5CM8B 1NJFA 3HR7A 4QGFA 1E9RA 1ZM4A 2XZOA 3U7EB 4E22A 1AQUA 2G3YA 2IEYA 3NBFA 5F2EA 4CEJB 1OH8A 2WPDD 3IPXA 2JASA 1FL9A 1ZD9A 3TUJC 2ZJ8A 1GILA 3MG9A 4C4PA 4LWZA 1Q12A 1VG9B 4OHWA 2CCKA 2EFDB 3NTUA 4W9MC 3BXZA 2IF2A 4QKQA 4DDTA 4C2TA 2J45A 2IYSA 1SKYB 4ZKEA 4Z8YA 1Z08A 1SVKA 3AQ4A 1D2EA 4POAA 4GZLA 1NN3A 4WA7A 4I99A 3T06B 2DB3A 3ZIAA 2VEDA 5HZKA 2IUTA 1W36D 1ZNWA 1UDWA 1ZU4A 3LO5A 3BWDD 3LFUA 3EZ7A 2ERXA 3B9QA 4ZKDA 1NIJA 1ETUA 4AIIA 3THYA 2J7KA 2YOHA 1G1MA 4K46A 2FJUA 2J7PA 2ZSBA 4BFWA 3F5FA 3UWKA 1P9NA 1ZNYA 3QXCA 3MUFA 4KYIB 1G5TA 1WA5A 4LJ9A 4KCGA 4QC2A 1XU4A 3QPVA 4G0NA 1CJTC 3P4YA 3DM9B 4MITA 3R8FA 2PBRA 4OHYA 5AJWA 1XZQA 2ORIA 4DWJA 3I1FA 4IFBA 1Q57A 3QEOA 5F9FA 3TQCA 2Z6VA 2Q6TA 4LC0A 1XPRA 2ODEA 2VH5R 1NVUQ 2BJWA 2W6JA 2GJSA 4YMUA 2ZR9A 221PA 2EVWX 3FDIA 3KTAB 4QBFA 1X6VA 1GDDA 1P6XA 4LJ4A 1SXJE 3GLFA 1KI6B 1P2SA 4CEIA 4W5WA 3PITA 3W90A 1FUKA 2KE5A 2ERYA 2O8CB 2WWGA 3L8ZA 4DLXA 4UXJA 4BFTA 3RRZA 3QUSA 4YDSA 3OEEA 3U3KA 4B35A 1E9DA 2V7QD 1E1QD 3BAFA 2WJIA 5BW8A 3BFKA 1JEEA 5DLQC 3OEHA 4M21A 3PQCA 4CT5A 1AJEA 4R9UC 3AGPA 4L4UA 1IXRC 1SXJB 3VU9B 1BOFA 2O0KA 2IA5A 4A0GA 1ZD1A 1DAIA 3SYKA 4NYMR 5JWHA 3L0OA 5CYPA 2CVHA 1R8SA 5GJWC 1JNYA 3K0CC 4F4IA 5CK5A 5IHPA 5FUWA 3M0EA 1P7CA 3N2IA 3LQQA 2OFWA 5L8VA 3GLIA 2GETA 5EE1A 4EPXA 5AWFC 4EQ6A 4KO8A 3VR4A 1KMQA 1EFRD 1G17A 1K8RA 2BVNA 1DO0A 3GLFB 4HUQB 4Q4LA 2ZAMA 1WB9A 3JZMA 4QBHA 3A1SA 3Q5DA 3EZ9A 2N1BA 5JRJA 2ANCA 2GK7A 2QMOA 4NCHA 1YZKA 2ZJZA 4TWZA 1L8QA 4BFSA 3RLFA 2XGJA 5IT5A 4B32A 4QJ3A 2ZETA 3KZ1E 1F2TB 2JGNA 1XX6A 1YZUA 2BIFA 4FW9A 4RY2A 1M34E 1ZAKA 2VA8A 3BGWA 3QXSA 4QHTA 4RFVA 1G5RA 3U60B 3AV0B 4TYWA 3ONWA 2MSCB 4TT3D 4HDOB 2JLWA 2XNDD 2ODBA 1AN0A 4G5OA 1QDEA 1FQKA 2JJ1A 2GEVA 3SC3A 3KL4A 2IL1A 3B5JA 5J4VA 1UBEA 2I1VB 1ZM3A 1ZYUA 4O2LA 4V0NA 1CLUA 4MRSA 1ONBA 1SULA 3GLIB 2WJJA 2V1UA 4FWIB 5M04A 2ONJA 4EQ6B 1KDTA 3IPYA 4OYHA 1Z28A 3GLHE 4ERNA 1Z07A 1VCMA 3OE7D 3X1XA 4M1KA 4DLTA 2IXEA 3FPAA 3AVXA 2OZEA 3K9LA 1KNXA 1OFTA 3QG1A 3CWZA 4BFYA 4PR0A 1KI4A 4NH0A 4AK9A 4Q1AA 3TAHA 5C2JB 2HT6A 1P4SA 3QKSA 4H1VA 4UXIA 3C5CA 1Z63A 5AUPB 3ETLA 5EP4A 5EQTA 4HB4A 3IUYA 4NONA 2YKGA 2VP5A 3GLHA 1RRCA 3KKNA 2IT1A 3GLIE 4LDJA 4YONB 4C7OB 5KTYA 1B23P 3QBTA 4RZUA 3REGA 4Q9HA 3GEEA 4A9AA 3L0IB 1ZM2A 2RKOA 4IDOA 1L4UA 2O0JA 2FSGA 3C4JA 3NC0C 3RS7A 2CK3D 3HYTA 3ECCA 4A2QA 2PCJA 4IXMA 1RW4A 4P4UA 4Q4HB 1G8GA 4HATA 1VIYA 2HF9A 3AF0A 2XTMA 4URUR 3Q3JB 2H92A 3EIHA 2GXQA 1TL7C 2EYQA 3LA6A 4ASUA 3CX7A 3NVAA 1FMJA 2YWEA 1H8EA 3NDPA 4MUAA 4B44A 1XTJA 2BJVA 4QHYA 2AWOA 4NZYA 3X1WA 4IOLA 2FEMA 1KYIA 1UM8A 2QTHA 1CJVC 2J0UA 5HE8A 1TX4B 4S2EA 1P3JA 2BOVA 1COWD 2BMJA 4JJKA 4WBSA 4Y0VA 4A4DA 4ZDIA 4R2IA 5D3MA 3KQNA 1A1VA 2Q3FA 2IHBA 4OQXA 1J8MF 1QBKC 2ZUBA 4C30A 3BE4A 2JATA 2V7QA 1KJZA 6Q21A 3WNBA 4AKIA 1G3IA 3REFA 2OLJA 5FR1A 1J90A 5EXPA 5L3RA 2ZI3A 3WRYC 4FD2A 3RWMB 3ZQ6A 3DL0A 1T0HB 2I1QA 4QM6A 2JDIA 2JLVA 2V6IA 3ND8A 3QVUA 3E1SA 3TQFA 1YJ5A 4ON9A 4OQFA 2HT1A 1SVLA 4JS0A 1CS4C 1OFIA 3KJIA 5KNDA 1AS2A 1E2DA 2Q0HA 3QJYA 2ZRBA 3X2SA 4L8GA 4ARZB 1XTKA 2XJ4A 3PXGA 3LVQE 4BLPA 3K53A 5FTNA 3FKSA 2R8RA 1NKSA 3CNNA 1W4AA 2J0UB 4FINA 4L9SA 4D0GA 2CLCX 1E99A 4Q1FA 1S0UA 2G1JA 5KSYA 2WWYA 3I62A 3KFVA 3GEIA 1G20E 3K0EA 5D3MB 1Z8FA 3W6PA 5FBQB 2EWVA 2OCBA 4KXFB 4UNSA 2AXNA 4KBGA 4B73A 4OHXA 4Z8XA 1OF1A 2OLKA 2PMDA 4JVNA 2JJ8A 5A4JA 4PC6A 4D4JA 4XSHA 4UNQA 3A6PC 3TMKA 5KSOA 4B2LA 2QQ0A 2W00A 3DDCA 3LVRE 4F93B 2O0HA 1YR9A 1Z06A 3C5HA 1Z6AA 3NEJA 4PHFA 3L2OB 2IYWA 4Z51A 4HZUA 2O8FA 4DSNA 3VR6A 2ZRFA 5FPHA 3DOEA 3U61B 5A5GA 1KGDA 3CX6A 3CX8A 5IRCD 2BM0A 2YOGA 1XZPA 1QHYA 1G21E 4TQ9A 3TIFA 2ZE8A 3PIRA 1TF7A 1R0ZA 2YC4C 4BLSA 1TTTA 1SVWA 3G0HA 3P20A 2DYKA 2ZSAA 4HLQB 5LB4A 2ANBA 2WHXA 2WV9A 2FPKA 1HQCA 1SXJC 2BEKA 4IDNA 3VNVA 2PT7A 1P9WA 2GCOB 4G5QA 2J59A 1DAEA 1VG1A 4RKEA 3THOA 3BH7A 1DEKA 2HEIA 1LW7A 2C96A 4B3CA 2QTVB 4DLRA 5GADl 3ZLJA 3AM1A 4B76A 1G3UA 3CF0A 3P32A 4KV9A 3I73A 4V0OA 5EZ6B 3VNUA 1IBRA 4YQFA 1YU9A 4EFNA 1W1WA 3FB4A 2QRNA 4PZZA 1RRPA 4TLAA 3EPHA 1G5PA 2IYXA 5CITA 1FPMA 5CB8A 1G6HA 3FTQA 3I4LA 3HDTA 1TQ6A 4BFVA 2QSZA 1S2MA 4DCNA 2D7CA 1KKLA 4P31A 2BV3A 2A5GA 2FMXA 1SHZA 4PC1A 1LS6A 2J9RA 2D06A 1Z47A 5FH9A 4MDEA 1R0XA 1W0KD 1UKEA 2GESA 3DHWC 4DHEA 3K0FA 3BERA 1TQDA 4ESVA 1ZM9A 1XTQA 1VG0B 2FDCA 1VHLA 1E69A 3JVUA 2ZRCA 3EASA 4WW0A 5AJXA 3TE6A 1BMFD 2QTFA 5HPYB 4TQUS 4DCSA 2VSXA 3QKUA 2P2LA 1YVDA 4TL6A 3SQWA 2CJWB 1OPXA 3HU2A 3FE2A 4JMPA 5CDFE 4NP6A 3RHFA 4V0MA 1UKVY 2BBWA 2NO6A 4HAXA 4L15A 2C99A 2ZI7A 3LX5A 3Q8XB 4GSYA 2B7BA 1P61B 4W5JA 1GP2A 1QHHA 1NMZA 1Z6XA 3ADDA 4LYAA 1KZ7B 2WWFA 3ZJYA 2RCNA 1DPFA 1JAIA 4TLBA 3HPQA 2NZJA 1JXMA 5C18A 5L3SA 1PUJA 3RS2A 4Q7MB 1KI3A 1H65A 2H57A 2J46A 5FL7D 1UAAA 2L0XA 1GFIA 2G83A 2P65A 3TKLA 1QRAA 2HCJB 2FWRA 5J47A 4Q47A 3SJZA 2ZREA 1OHHD 1RRFA 2W2TA 5BYKA 4TYYA 1H8ED 3CRQA 4P0TA 721PA 4IEEA 1IQPA 1KDPA 1ZP6A 4OL0A 4BECA 3ZVMA 5JSZA 2XOKD 2QE7A 4QBGB 2FNAA 4LHXA 2QBYB 1OB5A 2YOFA 1AZTA 2NO9A 2Z5FA 4LZZA 4PANA 3KX2A 4A8JC 4N0EA 1G7RA 4DLYA 2FSHA 2REXB 2ZS8A 1N6NA 1XD9A 4TMKA 1R8QA 4A0HA 2NO1A 1E2NA 4KYUA 5HCNA 1KI9A 3R8CA 2XB2A 3FHTA 4ZIRB 4Q4AA 3EPLA 4ZDKA 2Q3MA 1N2CE 4KBFA 2K5UA 2XAUA 3BK7A 3T35A 3PEVA 4KITB 2O52A 3UKDA 5F98A 2AD1A 1JR6A 1QHIA 2FSIA 3BB1A 3CO5A 2JLXA 1Z2CA 4MH0R 1I2DA 2R6DA 4A6PA 1UJ2A 621PA 3KUDA 1FMLA 4D80A 3QSYA 2BBOA 2QM7A 3SHFA 2RGDA 2DFKB 1E3MA 3AUXA 4PXAA 4JT2A 1S9DA 4F91B 2NG1A 2IYQA 1RFLA 1IJFA 3DOFA 3ZZUA 1D2MA 5JRZA 4DUGA 3WYAA 4M0LA 2RGCA 3LBNA 3PUYA 2F3TA 4QFMA 2ZYTX 3FHCB 4TTRA 4B3BA 2WTUA 3RWOA 2A5DA 2BEJA 4Q9JA 2OT3B 2IYTA 4JVLA 1K5GA 2XTNA 2CHGA 2MSEB 2VF7A 5K8TA 4D4MA 2OXRA 1XD2B 4ASUD 3G5UA 4JLMA 1S1MA 2F9MA 3GMTA 3HWSA 3GD7A 4PC7A 4DZZA 1MABA 3KXLA 3BC1A 1IOZA 2CXXA 1HEIA 2EFHB 2EYUA 1NY6A 2Z83A 3G82C 4KODA 3THXA 2G0NA 3OIYA 4LJ7A 4NYIQ 4RD3A 3GFTA 4G5RA 1GG2A 4M1SA 4QXAA 3ZS8A 1A4RA 4C7OA 2QMEA 4XOIA 2GDJA 3J81k 4I81A 4NYJR 1W0JA 2OHFA 2JLYA 5DIFA 4Q02A 4ZI3A 4FMCF 4Q03A 1YR6A 2Q9AA 2P6NA 5FPYA 3TW8B 3H84A 1G8HA 3ZVLA 2ZJAA 4Q4HA 5J4LA 4AY2A 3T15A 4MRNA 4LK2A 4F38A 1E9BA 1BYUA 1IJEA 1XRJA 3IIMA 1UKZA 4JLBA 4BGDA 2H1LA 1ZCBA 3MMPA 1EFUA 2RMKA 5CJPA 4B2IA 2IHYA 2SHKA 3VR3A 1E9SA 4I1SA 4QRHA 4YC7A 4A0FA 2G9NA 4LGMA 3VHXA 3LWNA 2IS6A 3OAAA 4OI1A 1M8PA 3ASZA 821PA 3DZ8A 4D0LB 1QHXA 2N42A 1OSNA 1T3LA 1AS3A 5DSZA 2PJRA 4TLCA 2O8BA 1Q21A 4CYMA 4G01B 1DG3A 1F48A 4FCTA 4V0KA 2BWJA 1W5SA 5IK2D 1KZGB 1W5TA 3QF4B 3SN6A 4YMSA 4ZCMA 4AG5A 1YRAA 4BZQA 2FE4A 2QAGB 2GZDA 1E0SA 3QI2A 1EFRA 4F4JA 4Q9KA 2HXSA 3IGFA 1P60A 2OCPA 3E2IA 5GJCA 2EU8A 3AVOA 3FYHA 1XMVA 2ORWA 1T5IA 1G41A 3LV8A 2J87A 4MRPA 1JJVA 4BLRA 1V43A 2ZE6A 2IYUA 1PUIA 1DAMA 5E3HA 4OK5A 4DLUA 3Q72A 3TLXA 1NG9A 4QG7A 3BH0A 4AKEA 5FPKA 5KYKA 3KTAA 1EG7A 4DSTA 3BB4A 2X77A 1NI3A 1KI6A 1ZD8A 5KOYA 1A82A 4HAUA 5GVRA 4B2PA 1ZM7A 2QT0A 4G1UC 4I4LA 2GTPA 4B6EA 2J0VA 3KQHA 1CRQA 3AVQA 4WXPA 1NF3A 2ZVQX 1ZCAA 2GJKA 4E07A 4QJ5A 3IKJA 2GK6A 1KO7A 4PAOA 4BASA 1ODFA 5FI0B 5FI1B 1PLLA 2YHSA 3IILA 1E2GA 1F5NA 2QROA 5KNCA 5AJZA 1II9A 3NHBA 5F9HA 2QENA 4NCIA 3QKRB 2LWIA 3BH6A 3K9GA 3T12A 4GDFA 4HI0E 4OHVA 4LX0A 4HEJA 4M8NE 4M9SA 1E0JA 2W6ID 5EE3A 2QAGA 4IW3B 1GOTA 1QHNA 2PL3A 4ITRC 3CR7A 5EE9A 4PHTA 1HE8B 1NRJB 1VDZA 3V4RA 1E2JA 1KJWA 1GITA 4QNRA 1NIPA 5CM9C 3T1OA 4OK6A 3A1TA 4D4KA 1T91A 2VL7A 2VSFA 3W9YA 3KB2A 3ICEA 4NCNA 3SFZA 1XXHE 4C0QC 2P6RA 1Q1QA 2GHIA 3AF1A 1J7KA 4TYQA 2Z43A 1C1YA 4OQLA 4WZBE 3WHKA 4E03A 3B1ZA 4M1OA 4GL2A 1Z0JA 1NSFA 3B2EA 4Q1CA 4AC9A 2F6RA 2J3EA 5G3ZA 3Q85A 4NHOA 1JECA 3R9IA 1YRBA 4JT4A 2ZI4A 2GCOA 4PPGA 4B3DA 4YDHB 5E7JA 3T5DA 4NU0A 4PZYA 4AURA 1OIXA 3HPRA 2VO1A 4O25A 3GFOA 3MLEA 5DH9A 2GCNA 1DO2A 4GI7A 4LCBA 1EGAA 3W8NA 4EPRA 2QPAA 3M4YA 4JLPA 1BO6A 1WF3A 2WICA 1ZC3A 2ZRNA 5TV2A 2WWHA 2KWIA 2GVDC 5CLLA 3KJEA 1MOZA 4RSGA 3BJIC 4MRVA 4Z54A 2JLZA 4BEJA 2GEDA 2OXCA 4KFRA 2ZAOA 3AP3A 3UMSA 3CBQA 3PENA 2O8EA 4FCVA 3IBYA 2RHMA 4LV5B 1KHTA 1E79A 3B8HA 3C7KA 2GXUA 1MRSA 2ZRJA 3MSXA 1UBFA 2C98A 4D2IA 3IDQA 4MKGA 1DAFA 1YKSA 3CB4A 3W6OA 1SXJD 3B1YA 1CRPA 3NKVA 1JR3E 4DIEA 1Z3IX 1O87A 3Q9LA 4A15A 1N25A 2FF7A 1DARA 2CJWA 2A5JA 3AVWA 4ZO4A 2AFIE 1PLKA 3CF6R 1UFQA 2F1JA 1ZIPA 2W2XA 4ZI2A 4IEIA 1E2QA 3I92A 3EA0A 4LV8B 1XEXA 5E4FA 1M74A 2FFAA 1S9HA 2DPXA 3VFDA 3GQBA 1KO8A 3RS3A 1XB2A 4RD0A 3HR8A 2B7CA 2PH1A 1Q1BA 1ZRHA 2QY9A 1RYFA 4IRUB 4O0MA 1KMHB 1ZUHA 3VHLB 5BXQC 2NPFA 4MYCA 2MSDB 1XTIA 1XPUA 3H1TA 5FPSA 1NMYA 4XTCS 2FFBA 4KVGA 4D25A 1IN6A 4HDQB 2O8EB 2FV8A 1Y63A 1Z83A 4QGGA 2JJ1D 2GAOA 2AN9A 1V5WA 3IEUA 4BZXA 5D3QA 5FOWA 1W4RA 4O3MA 5HCIA 4HB0A 1KO4A 2QUZA 2IS1A 4RFSB 2HXYA 3U7FB 5KDLA 1RJ9A 4I1VA 4Q18A 1Z22A 2QA5A 1NY5A 3MFYA 2ZI5A 5FTMA 5JEEA 4RD2A 2HJVA 4BRUA 3LXXA 1FP6A 1AQYA 4LUCA 5IDVA 1E2FA 1ELOA 1VHTA 3KKMA 1NMXA 1OLOA 1Z0DA 2IBMA 3PUWA 4UJ5A 4MGIR 3H2YA 3ZDQA 2HYDA 1TUIA 3DEFA 1XD8A 4UNNA 1L2TA 1H8HA 1E2KA 2PZGA 2GRJA 4EKDA 1MKYA 3A37A 2JAQA 5L3QB 1JR3A 2A30A 3WHLA 2FU5C 2P5SA 1U2RA 1IN4A 1S4QA 1G4AE 1CBUA 2IW3A 4A0RA 1G8YA 5EE0A 1M7GA 1CF4A 4LBWA 1XTSA 4JBWA 4G3XA 1W4BA 1IXSB 1XTRA 3S1AB 3I32A 2XJ9A 2AX4A 3M6AA 3NIBA 1SVSA 4LHWA 4P4SB 1JQJC 1GRNA 3CNOA 3OIWA 2F7SA 4TT3A 1LFDB 4DBLC 1FNNA 1RJ9B 1U0LA 4QGAA 4BWYA 2MMGA 1NVVR 3U6KA 4DT1A 1OW3B 5FOTA 3VAAA 4B3GA 4CEHB 4Q7KA 1RC8A 3L0SA 3TH5A 1Q3TA 4URWR 2ECKA 1QF9A 1SZPA 2WMOB 2XSZD 2VHTA 2OESA 3I72A 4PX9A 5AUNB 3NC1C 2Y8EA 2F1RA 521PA 3LD9A 1JALA 1P9RA 1F2UB 1UADA 1J2JA 2KBEA 4PSAA 4HAYA 4P4TA 2OEPA 4LYJA 3RRYA 4QNMA 3N2EA 3LH5A 4A36A 3OE7A 5JJKA 2QAJA 1DADA 1ZNXA 2OBNA 4DEYA 3ZVRA 2O8DA 4KI0A 4DIDA 2TMKA 2BBTA 3CRMA 3VKGA 2Q21A 2AKAB 2ZEJA 3BS4A 3KUCA 1EFTA 3W5JA 1HV8A 2OBLA 2ODWA 2G0TA 3B85A 3A8TA 2XZPA 2XB4A 4IOMA 3IHWA 1PJRA 1Z0AA 5SZJA 1KY2A 2R6AA 2R2AA 1SVOA 4BUJA 2D2FA 2UZIR 2V6JA 3K9HA 1NLZA 4GMDA 4ZDJA 4TYNA 3EWSA 4XTRA 4BFUA 1NBMD 3E70C 4BE7B 5DNYB 1EWRA 4TZ6A 1VCIA 3LY5A 3W34A 2HV8A 4DT1B 1KK0A 4CT4B 3I8SA 2JIZA 4URZR 2IC5A 2ZJOA 4LYFA 5EP1A 3SOPA 4XSGA 3B60A 3FKQA 2X19A 2JCSA 1KSFX 1UKYA 3CPJB 4FCWA 2ZYVX 3X1YA 4PPQA 3U4QB 3DZDA 2REOA 4KJZA 4F92B 3D7MA 3TAUA 3WBJA 2E9SA 3NH6A 1D6JA 4WIAA 5HZHA 5EUQB 3QF7A 421PA 3RANA 3THWB 2YWHA 3WP1B 4EJSC 3BB3A 3PG5A 2FOLA 3SJBA 1NSTA 4PO9A 5FR2A 1LV7A 1IY1A 1QHGA 3MJHA 2H16A 5TARA 4CEJA 5GJBA 3MWKA 1XMJA 3WMFA 4BRWA 4R71A 2GF0A 3FMOB 4L5BA 3A4LA 4D81A 3O8CA 2R9VA 4HAZA 1T3HA 3KKPA 3MCAA 4K81B 5BN5A 3A1WA 2HYIC 3LNCA 2C9YA 1EFCA 1M6NA 5BWMA 5FOVA 2ZXUA 1JJ7A 2JDID 4JVMA 4LYHA 2IEZA 1Y3AA 4NYIR 5CIQA 3IEVA 3R9XA 5C1BA 3U7HB 3ZD7A 4HDCA 1QHSA 4LHVA 1JB1A 2ZUDA 3AF4A 3U4QA 4N1AA 2VHCA 3SHWA 1DS6A 1G64A 4IVPA 1FZQA 2QMUA 1NVWQ 2ZE7A 1SHKA 3A1VA 2E87A 4FXPA 3DKPA 3GLGB 3EWAA 1R5OA 2H17A 1KIMA 4WXRA 4DLVA 4DUGD 1QVRA 2FA9A 1D9ZA 5AR1A 5AUOB 3KQUA 2XXAA 1KDOA 1A7JA 1G291 1ZIOA 4XWOA 2CNWD 2F9LA 1T3SA 1G18A 5CLQA 4CW7A 1ESMA 2R65A 3EC2A 5TMPA 2ZRIA 3SI7A 3D8BA 3P1JA 4BFXA 3EA5A 1EESA 1WP9A 4CEIB 1TPZA 3AKCA 3R9WA 2X8AA 1LB1B 3W6NA 2C9CA 2NQ2C 3KJHA 5GVSA 4AD8A 1G3RA 4EFMA 1QG4A 2J0QA 1U9IC 1E2PA 1CR4A 1JPNA 2C9OA 2REBA 2AL7A 1W0JD 3NXSA 2NPIA 1WDTA 2ZTSA 1W48A 3DVLA 2X1VA 3VX4A 3OFND 4MYTA 1WXQA 3TSWA 1VECA 2BCGY 3CWQA 1G7TA 1SXJA 3DMNA 3AVVA 1MT0A 2PJZA 1G8PA 4IOJA 1N6KA 4LJ5A 3SU8A 3OEHD 4B74A 4A1FA 1B0UA 5LD2C 2RB4A 2G88A 4DCVA 5LDDC 2AD5A 2J7PD 2JJ2A 4PHGA 1W36C 1TNDA 3A36A 4LBVA 2IWHA 4GP7A 1CR2A 1GIAA 1NN5A 1Q20A 3OIVA 5E95A 1RIFA 1OV4A 3DPUA 5LPNA 2OE2A 2IK8A 2VLIA 4CDGA 4L16A 4OQNA 2V9PA 2W6JD 3RSLA 5P21A 4DC9A 4P32A 2DWOA 4DJTA 3EW9A 2H7VA 1N6OA 1T8TA 1PVOA 1NJGA 1EXMA 2XOKA 5HE9A 2XTZA 4LJAA 4JBXA 2QP9X 3SDZA 1P2UA 2VP6A 3U3MA 3GPLA 2PX3A 3EPJA 1R4AA 3FKSD 3B7GA 5DI3B 4LBYA 1OE0A 3UATA 3HP1A 2H18A 2V1XA 3SE0A 5K8LA 4LY6A 3I61A 1KSHA 1II8B 2R44A 3CRW1 1XEWY 4FMBB 2Q9CA 4V03A 1AGPA 1E1QA 2C04A 2CL0X 4TLDA 1SKQA 2RHDA 4Z1MA 5BYJA 4ACBA 3VMFA 1E96A 2YC2C 3SQXA 2CL7X 1GAJA 4NKRA 5JWOA 4R2HA 1KSGA 1I4LD 1JI0A 4QOSA 2P6UA 1WRBA 3NG1A 4ABYA 4F4CA 4JSYA 2IYZA 2QRZA 4QHSA 1BS1A 1JR3D 1VYUA 4Q21A 3OAAD 4M22A 1FQJA 3GJXC 1X1SA 3K70C 2NO0A 1YE8A 1KSJA 4IDPA 5KPJA 2KJQA 1GKIA 4RFSA 1M1YE 4KVAA 1US8B 2DHRA 4Q19A 2H8KA 1NLYA 2MMCA 3A1UA 4IKEA 1ZNZA 2ZRKA 4I1UA 2EWWA 2AK3A 2ONKA 3AGQA 4TL9A 1KK1A 4MDFA 2AXPA 3QKSB 4W5HA 2IS2A 2O8BB 5SZKB 2ZVPX 1LF5A 3IHLA 3P27A 1AM4D 4MYHA 3TVDA 4DLSA 2W6IA 2NOAA 3RS5A 4C0SA 3L8YA 2NGRA 4PQYA 1E2MA 3UG7A 1VCNA 2NIPA 2UKDA 4Q01A 3SJAA 2KB0A 4CZ2A 4KFUA 1F3OA 4IDQA 2VP0A 2BKUA 5DHFA 8OHMA 3I8XA 4PSKA 3GJ6A 3W8RA 2AFHE 5TVKA 2CHQA 5L3QA 3ZD6A 4DEXA 2RGNC 4NDZA 4A2WA 1HT2E 4LSGA 5JECA 3Q7PA 2AK2A 1UBGA 2VBCA 1PLJA 4GP6A 2OILA 2IXFA 3U44B 4II7A 4B3XA 2FX3A 1E9FA 4EPTA 1TMKA 1UF9A 2A5YB 5FOSA 2ODNA 4KU4A 1Z6YA 1R5NA 2WSSD 4MUBA 4MRRA 4TYPA 4JKIA 2IWRA 5B30A 3PJRA 2QP3A 1P2TA 2DFLA 2RGAA 4GT1A 4AI6A 1US8A 2V55B 1MO6A 2ZYWX 3A4MA 3FVQA 1NN1A 3TR0A 3KQKA 2F1IA 2CDNA 2ATVA 1T6NA 1U8AA 4WOPA 3CH4B 1MR3F 4DB4A 2D4HA 2FSFA 2QNRA 5BN3A 4PFSA 5FBWB 3FMPB 4PAQA 3LLMA 2V3CC 2UVQA 2RGXA 4GNKA 2FG5A 2OM2A 1N6HA 1VMAA 2FN4A 2FZ4A 2RGBA 1CJUC 3QG5A 2WIBA 1OFHA 2F43A 4BPBA 4HLUA 4C0HA 2GVZC 2XNSA 1E79D 2ZE5A 2QORA 1XJQA 4Q1DA 2O8DB 2LKCA 1FUUA 3GFPA 3B13B 4PO1A 3ZYCA 4TMXA 3RS0A 2R6CA 3Q7QA 3L43A 3QOFA 3U44A 1N0UA 4ARZA 1N6RA 2WZQA 3SZRA 1FTSA 2ZUCA 1YQTA 1GZSA 1BYIA 2C77A 3MWLA 5TDHA 3T1TA 2O8CA 1XEWX 4TSFD 1E2EA 3U7GA 4DRZA 4C0AC 4MGKR 3P4XA 1G19A 4IVQA 2VHQA 4AWXA 2QI9C 4JL5A 4JYCA 3TBKA 4D4LA 5C4MA 4NPHA 2P67A 3PEWA 4TL7A 1OH7A 2EFEB 1KDRA 3CPHA 1XDBA 3WXMA 4QGHA 4XD7A 3UK6A 3CONA 4MGYR 3H4MA 1YHNA 4UNPA 2DFTA 4OBEA 5B57C 3RSOA 4KFTA 4GOXA 1OKKD 4O2RA 1IHUA 4QL3A 3RDPA 5J40A 4B3FX 1YZGA 1SVMA 1I4DD 4A6XA 2ZPTX 4GMXA 2BBSA 2IYVA 3AKEA 1ZMXA 3THWA 1LS1A 3LBHA 4LPSA 4A92A 2WVJA 2F43B 2YJTD 4M4SA 3KXIA 2A5FA 4RD4A 2PLRA 1LF0A 5AJYA 2UZ3A 2ATXA 4HZUB 5G53C 3RYTC 2O8FB 1MO5A 2A7QA 3K0AA 4BLTA 4PSVA 4F7WA 1JXOA 4LJ8A 1OXTA 1KAGA 1Z29A 3WBKA 4A82A 4BLQA 1LTQA 5B2ZA 2W2VA 5G40A 1NG1A 2GA8A 1A2BA 2ZM5A 1X1RA 2IS4A 2LKDA 4PPNA 4KLNA 3O8DA 4V02A 4MGZR 1VKJA 4NBSA 1D2NA 5BN4A 2WPDA 2QMHA 1ZVQA 1XEXB 5L3VA 1Q1EA 2WMNB 4IJMA 3GLFE 5AK0A 3ZGXA 2CE7A 2OG2A 3EXAA 4DSUA 2VQSA 4IXNA 5HKKA 1KMHA 3AF2A 3VKWA 1GRQA 3V9PA 3KJGA 2XITA 3LBIA 1X8KA 1W49A 5IF9A 2C5LA 1CR0A 2PCLA 2I3BA 2ZS7A 3RAPR 2GWHA 2G1KA 1R6BX 4RJLA 1I2MA 5HKKD 1GTVA 5EUMA 5JHGB 4B47A 1Z0IA 3FMIA 4LI0A 1XNJA 5FOXA 1YR8A 4MKIA 4GZMA 5GJVC 2XXAB 3K0FB 2QT1A 2QZ4A 3CZQA 4EAQA 5JS7A 1AIPA 2XSZA 2ZRGA 3UWOA 3AH8A 1XFAA 1CJKC 1NN0A 3QQ5A 4WZAE 4EPYA 2VP4A 4C2UA 1EX7A 4G5SA 3OFNA 5CYOA 4B6FA 4DXAA 1ZBDA 1K6MA 3C16C 3QNUA 4XVQA 3N5CA 4EIWA 3LW8A 3IQWA 1VYTA 1D8TA 3LXRA 4JBYA 1UBCA 4XWAA 1ZU5A 1XF9A 1OIVA 1R2QA 2N46A 4H1UA 1ESNA 1KO5A 4IVRA 2AKYA 1GWNA 2VP2A 4NL4H 2DBYA 4MQBA 3AEZA 4DDVA 4RD1A 3RS4A 2J41A 4QJ4A 4AKGA 4Q1BA 1MRNA 3MJRA 1XCGB 1W47A 1Z2AA 2ZR0A 2FEOA 4JL6A 2ZJBA 1CJMA 5L3SB 4JLKA 1U94A 3GCGA 5EP2A 2DR3A 4DDWA 1U98A 1XMSA 3KQLA 1KI1A 3ZS9A 4J0QA 2RGNA 3QPWA 2GKSA 5DO9A 4EFLA 5J4KA 1W0KA 3MWYW 3JZAA 5JJIA 2B21A 4LRWA 3LRPA 4A2PA 3IQXA 4QM7A 2ZS9A 1DE0A 3U5ZB 5H68A 2CLSA 1OHHA 1VG8A 4PC3A 2DWPA 3DMDA 3N70A 3AP2A 1X86B 1OXSC 4M1MA 1OH5A 3TK1A 5J4HA 5JHHB 4M1YA 4W7SA 1CEEA 3OZXA 3TW4A 1W36B 1O3YA 3KKQA 1BMFA 1GNRA 2PLFA 2KI5A 3D31A 3RABA 4XIGS 2WSMA 3RVBA 1XCPA 2W0SA 5FUXA 3LDAA 2B8WA 3K70D 1GM5A 2IF0A 3NEYA 4E09A 3RNLA 5C46F 1TAGA 2KBFA 1E9EA 1E32A 3KDSE 5CB6A 1N0VC 2VHJA 3SFVA 3ZZTA 1RYHA 2PEYA 2YWGA 4V0LA 2QU8A 4EUNA 5LD2B 3W3ZB 3T1VA 4PPFA 1II0A 3SBDA 1E94E 1N5LA 2R62A 1II8A 2GJAA 3IO5A 1NL3A 2XZLA 2D7DA 1E2HA 3PUVA 4B71A 3CNLA 5G3YA 2H5EA 2WWIA 4IFEA 1J70A 1GRRA 4YMWA 1KI2A 5AJVB 5C4GB 4MKFA 4JLOA 3AUYA 2BDTA 4C0LA 3FFAA 4RD6A 5DE3A 1YZNA 3GJ4A 3AF3A 4DSOA 3T34A 4BLOA 3PUXA 3ASYA 4EPVA 1XD2A 3BOSA 5FUVA 1WQ1R 2R6GA 2WSSA 2ZRLA 3NBYC 2OAQ1 1WMSA 4BEBA 2WOJA 3VTKA 3K09A 3SR0A 3NBZC 3QXXA 2NMVA 2C8VA 4NTZA 1G8FA 3OF5A 3HU1A 2JLUA 1JBKA 1UPTA 1AS0A 3PUZA 1Z0KA 2NO7A 3M1IA 4RCZA 3FGNA 2EFGA 2JLSA 2QQEA 2RAPA 2QGNA 1HQYE 4C3ZA 3T1QA 4HUTA 1EK0A 5FUYA 1QVAA 2J1LA 1W7AA 3RRNA 1GL7A 2A9KA 2ZJYA 4US2R 3UANA 2VPPA 5KSPA 4FWTA 1UEJA 4DCTA 1OYWA 5ANRB 1AKEA 4KSCA 1P5ZB 4EJSB 1WBBA 5KU1A 2YV5A 3VR2A 4JL8A 1D9XA 2BKEA 3PV0A 4WZ6A 3R7WA 1U99A 4KSBA 2WWWA 1JPJA 2OFOA 3QENA 2CE2X 1IONA 2CK3A 4Q4JA 4URXR 4TTPA 2E1RA 2ZITA 1BIFA 1ZC4A 2DCUA 5AUQA 5G41A 4GPTA 2HJGA 1E98A 1L4YA 1CTQA 1AZSC 4M2LA 3KB1A 4S35A 5DISB 3QXJA 2ZROA 3QBVA 1RKBA 3K8YA 2ZJ2A 3B82A 3BBPA 4RZ2A 1GL6A 4AKHA 5JEDA 4P3YA 1IN8A 3K9NA 4V0ME 3UG6A 5JI3E 2D62A 4LPKA 1BKDR 1XXHA 5KUTA 4BZPA 5H8WA 3AVTA 2BMEA 4XD7D 4UKDA 4OI4A 2HLDD 3B1WA 1OXUA 5FBRB 3TSOA 4Q5IA 4GRAA 3EZ2A 2ZI6A 4IDHA 4AYXA 1TUEA 3SYNA 5IK2A 3CM0A 1IAQA 1S1CA 2GEUA 4X8MA 4HLCA 2QEQA 4LOAA 5KDOA 1E9CA 2VYFA 4TN1A 1NNEA 5LBIA 5TXGA 3I5YA 1FNMA 4OJQA 2B6HA 1I4TD 1WCV1 2HF8A 1P75A 5ELXA 1TU4A 4WVFA 1AA9A 3PEUA 3FWYA 1A2KC 1HA3A 1BH2A 4GOJA 5F3WB 1LY1A 1CR1A 5JI2E 4Q66C 1Z6GA 2WM9B 3CF2A 3O8RA 2BM1A 2WKRA 1C4OA 4ZCIA 1TEXA 1NVXQ 1KTVA 4UNRA 1E2LA 3CH5A 3EARA 1NLFA 2PZEA 4KHZA 3LQRA 1YZLA 1DAGA 2F3RA 2OUKA 1OB2A 4JIMA 4RCYA 2ZRMA 5A0FA 1R7RA 4LJYA 1U90A 3NH9A 5JZVA 1Z6TA 3CRVA 2JJ2D 1XXHB 5KSZA 4E5UA 4M1WA 4TLEA 3W5IA 5K8IA 3L0PA 4B48A 4ZV4A 3L82B 3CW2A 3NWJA 1M7BA 2JEOA 5DYGA 5SZIA 1N6PA 3AKYA 1TEVA 4HLUC 2CEAA 2D74A 1TF2A 3V4FA 4R7ZA 5FTKA 3EAQA 5JSZB 4OKSA 4XVUA 1E0AA 2ZRPA 2P3SA 4Q48A 2GZAA 3EPKA 2FFQA 1M7HA 2QBYA 4JLNA 3AVYA 4ILEA 1N5IA 4HLDA 1G3MA 2ZI9A 1G9XA 2ZRHA 5J5CA 1KO1A 1SKYE 3GLGE 2VTKA 2FPLA 1Q44A 4IOKA 2QP4A 5EP3A 3CIOA 2KSQA 5CJ2A 4BQSA 1HY3A 2BMDA 3QIAA 5EE5B 4D6PA 4ZCLA 2NTYC 3H0KA 3CKLA 4PHHA 4Q4AB 2YYZA 4MYUA 2QPTA 5JFGA 3UIEA 4Q7JB 1W46A 4JSTA 2PMKA 3F8TA 1KY3A 5DI3A 2A2ZA 1HTWA 2ZSDA 3X1DA 3ICQB 1U0HC 2X2FA 2IXGA 4GBMA 1COWA 4PTLA 5JS8A 4ACAA 4LV6A 2R6FA 2VRWA 1Q3HA 3LLUA 3WMEA 3GJ5A 4JKYA 1U0JA 3E5HA 4JJZA 3EX7C 1DBSA 3WRXC 1GSIA 1EWQA 1R5BA 2DFNA 1XJ0A 3DO6A 3RC3A 4B43A 3UPUA 4JLDA 3DKVA 3QY0A 3U3RA 1T5LA 1TF5A 1KI7A 1OYYA 3K70B 3AVUA 4Q9IA 3D3QA 4LBZA 5B58C 3TRFA 2WJYA 2OO7A 4HUQA 2ZU0C 4L9WA 4AYWA 1RZ3A 121PA 3B6EA 1XEFA 1DTSA 1SVIA 1TQ4A 2JIZD 3EG5A 5SZHB 4YXWD 1AK2A 5FBLB 2RGEA 3C8UA 1F2TA 1OJLA 1GKUB 3OEED 2OSBA 2WIAA 3THXB 3QPUA 4I1OA 4PC2A 1VIAA 2G6BA 1E1RA 1CKEA 3A58B 3SBEA 3PCRB 4NYMQ 1MV5A 3VKHA 2XEXA 1RE0A 2AHOA 4CIDA 1FP7A 3B1VA 5UKDA 4C0BA 4TMZA 1VYVA 2J5XA 1C9KA 1GL9B 3EZ6A 4PZLA 1G16A 3WP0A 1XPOA 5JCPA 2CL6X 4UXHA 4KLZA 4CGZA 3PR1A 1Q1ZA 3WYGA 5H70A 2GXAA 3RRMA 2CMKA 4N0DA 3ZVNA 4D26A 5KNBA 1U8ZA 4HSEA 3MD0A 4M9ZA 2YVUA 3U2QA 4PQRA 4BFZA 4OI0A 2QGZA 3PVSA 1ZUIA 1N6IA 3AKDA 4M1TA 2VIIA 2GJ9A 1P2VA 5DGXA 1IM2A 1OT3A 2EQBA 2FH5B 1OXXK 2QM8A 1D5CA 3PFIA 5CIWA 4B75A 2JA1A 1FFHA 2QN6A 1HT1E 2CHVA 2GBLC 3GJ0A 3LX8A 5BQ5A 1AKYA 4YLGA 5TB5A 1JEDA 2PEZA 1CU1A 4GFDA 3VQTA 4C0JA 1K5DA 1RPZA 2ZR7A 3QF4A 4C9BA 2QL6A 2WKQA 1UDXA 3U3OA 4DLWA 4CRWB 1PV4A 1IXZA 3MRSA 1X8LA 3CLVA 2FGJA 4NE2A 1G7SA 5DN6A 2FPMA 3T5GA 4K8OA 1MO3A 4HB2A 4JLJA 5KHOC 4US1R 1W44A 2D3WA 2QAGC 2QPOA 2IUSA 1IY0A 1T0JB 4QBIA 4UQOA 1U81A 2ORVA 1Q22A 4M53A 4PAMA 4B34A 5E7IA 4A8JA 4M9QA 1RVDA 2VP9A 1ZJ6A 5J4YA 3GP8A 5CK4A 2C03A 4KAXA 1IY2A 3IIJA 5DHAA 3X1ZA 3MGCA 3U3JA 3S1AA 5FFMA 1N0WA 4TQAA 1Z0FA 3WNCA 4TMTA 4P4SA 2AR7A 2JLQA 4TZ0A 3NDBB 3F3YA 2D2EA 2BMFA 4Z1MD 4D82A 5TY0A 2YNMA 5KDDA 2NZ8A 2GCPA 4CEHA 3THYB 3C14C 4DVGA 4URYR 3K1JA 3I5XA 1DVRA 1VPLA 2EFCB 3QKRA 4YMVA 4FI3C 4NCJA 1HUQA 2ZRAA 3HU3A 2P0EA 3Q5EA 3BORA 1E9AA 1RRGA 5EZ5A 3AB3A 2RH5A 2GILA 3F0TA 5E7MA 1EX6A 3SNHA 1ZUNB 5FPTA 1DAHA 2GZHA 1KK2A 4TMVA 4FIDA 4WAUA 1G4UR 2IX3A 2ZANA 4U00A 2GF9A 3WMGA 1DOAA 3K0AB 4EDHA 2WJHA 4B33A 2VF8A 1DELA 1QZXA 2BC9A 4A8JB 1XWIA 4LHZA 4FMDF 1R0YA 2W0MA 2Z4RA 1YR7A 3HYRA 2CVFA 4EJSA 3B1XA 2GNOA 2JLRA 4XVRA 4YMTA 1Q0UA 2PT5A 2ZU6A 1HE1C 2GBLA 3R7WB 1CIPA 4LC1A 3LAWA 1DAKA 1CULC 3EC1A 1OXVA 5FTLA 3C15C 2WBLC 4R98A 3K0SA 1X8JA 4OK3A 1S3GA 2HCBA 5JBQA 2C95A 2YWFA 3OIUA 4LJ6A 2QG6A 1CXZA 3CUEF 3CRRA 3NBXX 1NBMA 3P26A 3VU9A 1LVGA 3CZPA 3FOZA 1XMIA 2EW1A 4OI2A 1PZNA 4XH9B 2V8OA 3QE0A 1T8UA 5EXXA 1T9HA 2IYRA 2HUPA 1YZQA 1NP6A 2HDNB 2WAXA 3KFXA 5DI9A 1GUAA 1OFUX 1OKKA 4JZKA 2IUUA 2IYLD 1N5KA 4FMCB 4ESHA 4XWKA 2J0SA 4CVNA 1A5TA 1GNQA 1KAOA 3UMRA 5HR5A 2AWNA 5FL3A 1NBME 2Q9BA 3C41J 4GOKA 3MAAC 2WWXA 4RZ3A 3VX3A 3WY9A 5JCZA 2DWQA 2Q3HA 3ADCA 1EFHA 3UMFA 1WE2A 2OCYC 2WKPA 2GAAA 4D0NA 4U02A 1Z5ZA 4FN5A 4Q1EA 3GJ7A 3O47A 1P72A 1KKMA 3NHAA 5FOUA 4OHZA 1N6LA 1SGWA 4KFSA 1CP2A 1HYQA 2G77B 2ZSFA 3KKOA 1KJYA 3MWJA 2WJVA 3QXHA 1XCMA 3KXKA 1M2OB 3O8BA 2O5VA 4MKHA 4YXWA 1FOEB 2CLDX 2B8TA 3QVVA 3R20A 2FFHA 5JWRA 4RKFA 3K0CA 3ADBA 1AGRA 4Q7LA 1JQLB 3SJCA 1H8HD 3CPEA 3WNDA 1GVNB 2P5TB 3TSZA 3TGPA 5KO2A 4URVR 4US0R 5KPDA 1NVVQ 5FL7A 1J99A 2V4ZA 3TVTA 1OIWA 3UXMA 2YINC 3RC8A 5H1YA 4DLZA 4HZIA 1G6OA 5DN6D 5K8UA 1FW6A 5JJLA 4P33A 1YZTA 3GLGA 1ZINA 1FTNA 3B78A 2Z4SA 4DCUA 4MA4A 2WJGA 3FFBA 3FHOA 5LB2A 3QEJA 3V00A 1HURA 1S8FA 4TTQA 4NCKA 2C78A 1XBTA 1F6BA 4X8OA 4HB3A 2F1HA 2F55A 1L7VC 4Q00A 3PEYA 2OBMA 3W3AA 4RVCA 2I4IA 1R10A 4RZXA 1J8YF 4H9GA 3EIEA 3TUIC 4Y0AA 3ZIAD 1W2HA 3SS8A 3OESA 3GLHB 1WBDA 2CCGA 4X8LA 3GJ8A 3IO3A 1S3SA 1QHHB 3SEAA 3ZQJA 4JLAA 1SQ5A 1E6CA 3ZH9B 4AYTA 3TR5A 4ZDWA 1T4GA 5HTKA 4M9XA 4NYJQ 1P62B 4DKXA 4U7DA 4X8HA 4G5GA 1JAHA 3TUZC 1G3QA 1KOFA 1XJCA 3LW7A 3H86A 3OHMA 2BCJQ 2C2HA 2XX3A 3B9PA 3ZZ0A 1E4YA 5EJEA 1TU3A 2CBZA 2Z0MA 1FX0B 3K09C 3IIKA 1IN7A 1XP8A 2WOOA 3ADKA 5JMTA 2W58A 1HH4A 1U8YA 4DDUA 1P73A 4TL8A 1KI8A 4TSFA 4CF7A 2IYYA 4AG6A 1E1RD 4C0KA 4FMDB 5CDFA 4UJ3A 3SYLA 1U9IA 2A3RA 4NMMA 2GXSA 1E4VA 2BHRA 2PX0A 3EZFA 4ZPXA 3BIFA 2ASEA 3CR8A 2CCJA 4IHQA 1E0KA 3A4NA 3AVPA 1MO4A 2ZRDA 3BFXA 1MH1A 2ZSEA 1F2UA 3TNFA 1IN5A 3VR1A 2RGGA 4OJKA 5EXTA 3VR5A 1G7CA 1R0WA 4PO8A 5JLJA 4HYYA 4ZIRA 4Q9LA 1KK3A 1QG2A 3HJNA 2A78A 2ZJ5A 3GJ3A 4HAVA 2HLDA 1N5JA 3BFVA 1TADA 2W83A 3AP1A 1E2IA 4LHYA 3T61A 1DG1G 2GJ8A 1ZW6A 1ANKA 5DYIA 2OFXA 4JLVA 3ND9A 1TQ2A 1N3BA 5B64A 2X2EA 1F60A 3EIQA 1X3SA 2OCAA 1S96A 1FX0A 1GNPA 3FMFA 3BRWD 4TMWA 3GEHA 2WAYA 1UEIA 3DM5A 5EXSA 2FGKA 4PQFA 4JYBA 1KNQA 3D6TB 3IBGA 2VSOA 3I3SR 4OQMA 1VTKA 2YZ2A 1VCOA 2DY1A 4N3NA 1LNZA 2FZLA 4JVSB 4Q4JB 1NKTA 3U6BA 4U5XA 5FTJA 4EPWA 2LCFA 2OAP1 1GKYA 1W4CA 1W2GA 2PZFA 3TJZA 4XJXA 2VHUA 4DB2A 2B92A 3BD9A 2QE7D 1OH6A 2OV2A 1MABB 2ZIAA
chains in the Genus database with same CATH superfamily
3PDCA 1KXZA 1HQKA 1DXQA 1G20B 2P0YA 2Q3DA 2ZYUX 3HE3A 2QSYA 3JVVA 2Y77A 4K9OA 2CDAA 5DTEA 3QKTA 4FGLA 5CM8B 4NXMB 3FTEA 4EFDA 3G2JA 2BE9A 3HR7A 4D3FA 4HQFA 4QGFA 7MHTA 1TGVA 3AINA 4N7JA 4E22A 1HQDA 1LTHR 1W19A 2ZUFA 4R1OA 4D5EA 5CLJA 3HGQA 5LWQA 1YB1A 4GIBA 3U9TA 1ZD9A 1ISGA 2GO7A 5DYYA 1GG9A 2ZJ8A 4HVAA 2Y1OA 3EEIA 3DEYX 3IP3A 3NIGB 5D5PA 4EG6A 5AVZA 2ZT5A 4RF4A 4YT4A 1EFKA 4LWZA 2ASVA 1VG9B 1A2OA 4W9MC 1P4GA 1L3BA 1RP1A 4FD3A 3DW3X 5IF9A 4YO7A 2W2PA 5JO9A 4QKQA 3KQWA 4DDTA 5EMHA 1WEKA 2PZAA 2BUBA 2DLDA 2IYSA 1SKYB 3PX3A 4ZKEA 5C9ZA 4NE7A 2QTVA 3AR2A 1D2EA 4R01A 2RKWA 1PVDA 4HP8A 4AS2A 4EX6A 5LQKA 3KS9A 4I99A 3IA2A 3ABZA 1EVZA 5HZKA 2IUTA 3ROFA 3ZIUA 5JSFA 2A59A 5B3KA 4ZHQF 1VPDA 3DP9A 4PZEA 1C29B 2ERXA 3B9QA 3EA4A 3MMZA 5G0VA 1PBTA 3U80A 5F2NA 4AIIA 3THYA 1G1MA 1ACMA 2JAHA 2O6HA 3IMEA 4C04A 1L6RA 3HRHA 5D51S 3WDSA 1SC3A 3QXCA 1OA0A 2W70A 4KCGA 3RSGA 1ZK2A 2PE5A 3AL0C 1FYDA 2ZBRA 3A6KA 4OQPA 1O4WA 3LVBA 3NRJA 4G0NA 1GZ3A 2AMJA 2H5IA 5ENVA 5CBKA 5AVVA 1DHTA 1SG6A 1XKTA 5GAJA 2DP4E 4YMHA 1ZHOA 1ZUNA 1NNLA 1DIGA 1IB6A 1KVTA 1XZQA 1JDUA 1YS1X 2I4NA 3I1FA 4IFBA 2GEJA 4UMEA 4JQYA 3SDSA 5U9CA 5B7GA 2VEOA 2Q6TA 3P19A 3NKFA 5LIPA 3G59A 2Y92A 2W6JA 1Z45A 1AURA 2GJSA 3E58A 3FDIA 1GQFA 4K9PA 4KPUA 1RWVA 4QBFA 5CNJA 4F1KA 5LVAA 3A25A 3GLFA 1P2SA 5ALWA 4ENPA 1AMNA 4WUVA 2WWGA 3R5HA 3N8KA 3E9RA 4Z0HO 5SV2A 4UXJA 2P1RA 3HKBA 1QQAA 4G4IA 3QUSA 4NEHB 4EY6A 2APJA 2O2IA 5JQGA 5IVPA 5DZSA 1L4FA 1R9GA 1TA0A 1RM4A 2I4TA 2VJDA 2ZDHA 3OEEA 2BFCA 4YRJA 3U3KA 4B35A 5LLTA 2V7QD 1N7JA 1E1QD 1Q6YA 2OHIA 4TM8A 4U9HS 4JODA 1PG5A 3ANLA 3OZCA 4D9NA 1JTVA 3IDSA 2D1QA 1SRRA 4DJ5X 4JI3B 4A0GA 4H18A 2CKDA 4PO3X 3PPIA 3INGA 4OM8A 4NYMR 2PTGA 5J43A 4MEJA 1F8GA 3L0OA 2CVHA 1UQUA 3K0CC 2OHJA 2RAUA 4OXKA 1W88A 2AJDA 4I3FA 3REQA 2ORED 5IHPA 3ANTA 4K03A 3LQQA 3MERA 4ANFA 4BCCA 5LMZA 1J00A 5BSEA 3CG0A 3HVHA 5JG7A 4KO8A 1F8UA 4EDFA 1K8RA 1SBCA 3LQFA 3NWPA 4DJJA 1LK0A 1ZOSA 3QLVA 1BHSA 1YWGO 3C3YA 4B2YA 4GOMD 4HUJA 2V03A 2O50A 3MTGA 4QBHA 2DXIA 1SHTX 2QL9A 3OX1A 1VRCA 2UAGA 4GX0A 2ANCA 2GK7A 5BOSB 2WFZA 1FW8A 2ZJZA 1EP9A 5I7RA 5BO5A 4KNWA 5JQGB 1MC4A 1OI2A 4JGIA 2SKEA 4R8LA 1Q6ZA 4QJ3A 2Q5QA 1V4VA 3KZ1E 3K2QA 4S04A 1LNSA 1XX6A 2BIFA 3L7MA 5NLLA 4M6WB 5ED4A 3R23A 5FI3A 3PT5A 4RFVA 1F2VA 4QXPA 1XQ9A 2MSCB 4GLLA 4TT3D 4M1ZA 4HDOB 4MWGA 1PFGA 2VWGA 1A9PA 4H17A 4Z53A 4G5OA 1AN0A 1QHEA 4IQGA 2JJ1A 1V1RA 4QTXA 3MINB 5B1DA 4EUEA 3B5JA 1KMNA 4V38A 4CCWA 3E6AA 4KE7A 3BTOA 1ZM3A 3JX9A 5HGJA 4CLXA 4F5YA 1YXMA 1X13A 3I2HA 2IPLA 3KPWA 2JEYA 2JKZA 3HC7A 4MRSA 4X00A 5DYWA 4GX1A 3GLIB 1XQWA 2WJJA 1P2GA 1WU7A 3HBAA 4UOQA 3JQBA 4R6XA 2ONJA 3BWXA 3O4RA 3FIJA 4X1YA 3B7PA 4YIKA 3ZE1B 2B61A 4ERNA 3HABA 1Z07A 2HPVA 4FYHA 3IODA 3X1XA 2GGSA 3FPAA 1J6UA 4PINA 3K9LA 1NQVA 1CG6A 4NCAA 3CRZA 2H1CA 2Y4NA 5MN4A 5C81A 1I5OA 1A0OA 2DECA 4QDXA 3V1MA 1KI4A 3VU3A 1E7QA 1K8QA 4P86A 4WRRA 5LJLA 4MPRA 1QRDA 4Q1AA 1BNCA 5HRUA 4D79A 3R0IA 1MNAA 3QKSA 4UXIA 3G0IA 4ZK6A 2P62A 2YYSA 4RK4A 2NU7A 1WS6A 3ETLA 3MJVA 1RYNA 4FE3A 5AJHA 2X0DA 2HTEA 1VLHA 3HJUA 2YKGA 1X1EA 2C8KA 4FFOA 4AJHA 1T1GA 2C2ZA 3EVTA 3JY6A 4V0QA 1BOOA 2PGIA 4LDJA 1MG5A 2CHUA 4YONB 3WDKA 2X42A 3JWHA 1R6DA 1K0UA 3QBTA 3SEZA 1RPNA 4O4IF 3AHFA 3HFGA 3PGA1 4M88A 4XGIA 3GEEA 4LCEA 4A9AA 7REQA 1ZM2A 4NSNA 2RKOA 3OSUA 3R6LA 1L4UA 4CQJA 1U5BB 2IV7A 4XIYA 3VOSA 2BFFA 3KZOA 5TRTA 3HYTA 4A2QA 4G1CA 4U7WA 1AN9A 4IXMA 3P0RA 4P4GA 4J1SA 4HATA 4B85A 2PQMA 5JAUA 2CUTA 5JD6A 1P2DA 3CEHA 3EVDA 3OZDA 3OZ7A 3EIHA 4MW7A 3U31A 4AFNA 1O94A 4MVJD 3ECAA 4WUTA 1ZR4A 1E5VA 4XX0B 2OC4A 4X1YB 4MUAA 4W63A 2FTKE 1XTJA 2Z3ZA 3AR7A 3BFJA 2GD1O 5J2TA 2HX1A 1P4HA 4OP1A 3UWPA 4LZAA 4JHXA 3VUEA 3O9ZA 5BR1A 4MO9A 4B4VA 1TLFA 4KWHA 1J0XO 3ESAA 1MG0A 1U2EA 2F9FA 4R2IA 1ZLXA 1KMIY 1KFEB 1O57A 3BVPA 4ZZ2A 1W25A 1A1VA 4NOLA 1TAUA 1DJNA 2HMWA 2GOYA 1DAOA 2NU7B 1IWBB 4JROA 1AO3A 1KJZA 1R6XA 1Y48E 3Q3VA 3WNBA 4ZMRA 4EF5A 1SU8A 5FR1A 3VGPA 1JKFA 4Z9AA 4I8XA 2XCLA 3SF8A 3ODPA 5IDQA 4O5OA 2ZI3A 5KWIA 3WRYC 1JDVA 4TTJA 2MYTA 4DWWA 1ORHA 4FTWA 2I1QA 3GLKA 2JDIA 4TKMA 2FCAA 4C4ZA 3HBNA 3ND8A 1FNSA 3IXLA 3VR3D 1VA4A 3WXBA 4BLUA 3VM6A 1E2DA 3RIMA 1KOJA 4AZ0B 4GQBA 5IXSA 5TEWA 2NXEA 3PXGA 4DANA 1Q7TA 1M0SA 3MT7A 4IDAA 3BZUA 5FTNA 3LGAA 3FPJA 4JEIA 1U2ZA 3LT4A 4J29A 4GXTA 2P2YA 3UGQA 4KVZA 4X91A 4B7CA 1JF8A 1T9KA 3OQ6A 4JC8A 4D0GA 3KJXA 3TW6A 1PK9A 2CLCX 3DJFA 1S0UA 4Q1FA 3KFVA 3FZYA 2UYCA 3O38A 3K0EA 1R0SA 3RFUA 1CUBA 1Z8FA 1E1NA 2GBPA 1ICEA 3U16A 4Q4CA 4TS9A 3O75A 4BB9A 2EWVA 4KXFB 4JH0A 2I2BA 4KBGA 1G42A 3LCMA 1R8XA 3AEYA 3D3WA 3WGHA 2GPJA 4O4LB 1OF1A 3JCZA 1HZZA 5A4JA 2HMTA 4UPEA 3KQQA 3KHKA 1BEUB 3LP6A 4JDPA 3T7IA 4ZYLA 4LHEA 3A6PC 1EZZA 4P7JA 5BSVA 2YFKA 5CT8A 2X76A 2QQ0A 2W00A 2PUWA 1U4OA 1U8EA 4QXOA 2IUFA 2QDKA 2Q2NA 2O0HA 4KW7A 1K27A 1Z06A 1E3WA 3IR5A 4F6CA 4R8RA 3OLCX 3GGSA 4PHFA 2IYWA 3BWMA 1JSXA 4Z51A 5JNTA 2QUJA 2ZRFA 3DOEA 3RYCA 3IV9A 4ZD6A 4K88A 2QTRA 4X61A 1UBNA 2YBDA 3KR1A 4ALNA 1I3KA 1XZPA 2UYGA 4RMHA 4IF6A 3KQOA 5U4QA 2JFPA 2XVMA 4RY0A 1MZVA 4HYQA 4HL6A 2NZVG 3S2YA 4BLSA 3RGGA 1SVWA 3G0HA 3WMXA 3H2JA 4N3BA 2ZSAA 5LB4A 2ANBA 2BEKA 3F74A 1AKQA 3EQZA 3H4TA 2PD6A 1I13A 2J3DA 1VG1A 1JDPA 1PU2A 3IKLA 3JYOA 1RYYA 3BH7A 4RKEA 4YCBA 2NZYA 3V1KA 3OKPA 2VG8A 3MUOA 2YV4A 2R6ZA 2C96A 2I87A 2RGYA 4QDTA 2OFFA 3I4CA 1JZQA 3H9JA 3A06A 3EGOA 3L1UA 3M6VA 4J0KA 4MINA 3TLKA 1UXHA 3QX3A 3VNUA 3OKAA 4BP8A 4I1YA 2LD4A 4PZZA 1KC3A 1QGDA 4I4CA 3QW4B 3OSZA 2WHPA 1RHKA 4CKWA 1QX3A 2JGJA 3I4LA 3HDTA 2V6FA 4C78A 3B6MA 4ZQFA 2PUHA 5ERXA 3TWOA 3ZCVA 4BFVA 1S2MA 2D7CA 2FMKA 2R7AA 4J16A 3MWEB 3WIOA 2A5GA 2BFWA 4YHHB 2QLFA 5DHQA 3BKWA 1XUOA 1EE1A 4D0SA 1Z47A 1P6QA 2EW2A 4XYLA 4R9SA 4GGPA 3RARA 1TPYA 1ZMTA 1TQDA 1X39A 4QXRA 1ZM9A 3R3HA 4K9RA 4LWQA 4ESVA 2ZWIA 4U4AA 4NULA 3WSTA 5AJXA 5HPYB 4TQUS 5EMNA 2VSXA 4GPAA 3QKUA 1GZUA 4J6FA 2P2LA 3KQVA 4QT4A 3RFTA 2OL4A 4ER0A 2VQFB 3SQWA 2E48A 1FDVA 4CUZA 4CN9A 3F96A 3FE2A 3QWBA 4NP6A 4X6LA 3RHFA 2QRPA 1H3FA 2VWHA 3EIOA 1JKJB 1KKUA 2IYFA 1PKXA 4D98A 4C4AA 3OOSA 3E9YA 5HHTA 1K5HA 2C99A 3FM9A 5E1DA 1KEVA 3L4BA 3LX5A 3RTBA 4AJLA 4MVJI 4FS3A 4J76A 2FW6A 4NEQA 3L6UA 2C7PA 5JCJD 4WXHA 1G55A 1GXSB 2FPUA 2CJFA 3Q0IA 1JIIA 3M4JA 1NMZA 4ND2A 5I7FA 1QH0A 2AFIA 1DPFA 2G5CA 4HRYA 4TLBA 4UQPA 1KAMA 5AT1A 3PSHA 2FFJA 1PUJA 3UUEA 4GE3A 4UBMA 2CJXA 4H08A 2HDWA 1Y3IA 1W0CA 1KI3A 1H65A 1ZIXA 3JYPA 4L4ZA 2D5CA 2J46A 1U2SA 1HTBA 2OHGA 1T34A 1WZIA 3F6YA 2G83A 1J25A 2P65A 4R4JA 4WACA 3RE1A 1QRAA 3T0GA 2FWRA 3TKLA 4JY7A 5J47A 2XQIA 2ZREA 4ISCA 5CDUA 1FQWA 2BMWA 3IAM6 3UKJA 4NS1A 5AXCA 5JDCC 2H31A 1TYDE 3U7RA 2GR9A 3JWIA 2NYRA 2QLMA 3DXZA 3FLAA 2QJFA 4X1KB 4XQ9A 4BNJA 4BECA 2X0KA 3H83A 1C8KA 3GZTB 4M55A 3Q88A 3AHHA 5BSFA 2QE7A 3DZGA 3KU4A 1RWKA 2WTMA 4CF3A 3U4MA 1TT5B 4LHXA 1RRKA 1FFCA 3JD4A 4YJ2F 1QOZA 1U2GA 2Z5FA 1AZTA 5DGIA 4C7MA 1SR8A 3RKUA 2V96A 4PANA 3PL1A 3DYIA 2X7XA 4A8JC 4EM6A 1R4MA 4HQNA 2FSHA 2QX9A 4PRYA 1CUHA 1N6NA 4TMKA 1HDIA 3HY4A 5KIAA 2GBFA 4UU8A 4F0JA 5IEJA 4PPYA 4R8VA 4DAOA 4J4BA 1TOAA 2WUEA 5E2IA 2Q3MA 1NFRA 2OAGA 1Z4LA 1RVV1 2P69A 2XAUA 3T35A 2C0CA 3GP3A 3TLZA 2AD1A 5LA6B 4F45A 1JR6A 1CVLA 3BB1A 2RHOA 3SF0A 1VKHA 1I3LA 3INYA 4YQZA 4AY6A 1IATA 4A6PA 1EAMA 1UJ2A 3DL2A 3E7PA 1SU7A 4EY5A 5LKAA 3QSYA 2QRGA 3CKKA 1L1FA 1EPUA 2ENUA 3MPUA 5ALGA 2X9NA 4KUEA 2QT9A 3RTCA 1MB9A 3EXHB 3FLMA 2IU0A 3TW8A 1F51E 3OJXA 4N76A 3LWBA 5KQMA 4GRIA 2Z2YA 3H2ZA 2YJGA 1J9ZA 3B5IA 1WY7A 2J9YB 5JRZA 2E89A 5EEHA 4H6WA 3WYAA 1P1RA 2RGCA 3LBNA 4TTRA 3BWYA 3IUQA 2QF7A 1N57A 3FHCB 3IKVA 1Z5UA 1NAIA 2PUJA 2XNJA 1M34A 2BEJA 3L4BC 3RWOA 4Q9JA 4BZWA 2OT3B 3OTGA 4MR7A 3UJ3X 4AXBA 1JHPA 1C14A 3G1TA 3UPDA 1XALA 3ZE7A 1TZMA 2FQXA 3F98A 4BKOA 3FGOA 4D4MA 2OXRA 4ZQBA 1WP4A 3MTQA 4MUGA 4QQFA 5E38A 5I9MA 1K6EA 2INGX 4JLMA 3GMTA 4Y2JA 4XWGA 5F2KA 2IX9A 1MABA 2XMZA 4YQEA 2A92A 2YDYA 3FYUC 2EZUA 2EFHB 4O8CA 3V46A 1OFUA 2YZMA 5IJZA 1RMYA 3THXA 1M2NA 3SFTA 4B9EA 3F97A 4X65B 4OQYA 1E6LA 3DVAB 3HP7A 4RTNA 1RQGA 3ZJ5A 3T7RA 1O8BA 2BM8A 3I9OA 4BP9A 2QMEA 1XZFA 3W5AA 2H54A 4IWNA 4OQDA 2ST1A 4I81A 3UHJA 3W9SA 2JLYA 1JSCA 3A3KA 2PGAA 3KJNA 3KP1A 3WWDA 4Z86A 1RHJA 3HCFA 2VNKA 3IEKA 2PH5A 3I8OA 5BWCA 4PG4A 1TO6A 4V39A 3G8DA 2BKAA 3ZVLA 4BNGA 4N39A 1TECE 1SC9A 4F38A 3H7IA 1GTL1 1ATZA 2QRVB 3VU8A 3UYLA 1WNTA 1UIMA 4FHEA 4BGDA 2P9GA 1EFUA 4S3MA 3AHCA 1TUBA 5KMGB 1KRWA 5TF0A 2PXHA 1BWRA 2SHKA 2DLNA 3FVVA 4TKUB 3VR3A 1YUBA 2A1UA 1QIEA 4QRHA 3UJBA 2PVSA 2BSQA 5ALHA 3LZDA 4Y1RB 2OG1A 3ORRA 2UZ1B 1Z6PA 3OAAA 3BQNB 4QQKA 1NJ5A 3VZCA 2Z9DA 5B3AA 2XCTB 3DZ8A 4KREA 2N42A 1GGVA 3I6MA 4EABA 1UJ6A 4QARA 1AS3A 4IJWA 2VSNA 2QZZA 1N8NA 4YJGA 3S28A 4MV9A 3B5EA 4G4GA 3SXPA 3EUAA 4X1IA 3TRHA 4AMZA 4C14A 4H7FA 1ST2A 1XO1A 4LQDA 5KHAA 1XN4A 5KQLA 4ZXFA 1W5SA 1E4OA 3P71T 4YMSA 2Y3IA 3ETEA 2FPPB 1KERA 4HWKA 3LQ4A 4KIFA 1QORA 3RI3A 1PQPA 3CUYA 3H87A 1Z13A 2OCPA 4MVJH 1C9NA 1UPFA 2EU8A 2JVJA 5DN9A 2OAEA 1ZMRA 2GZ1A 3D0QA 5AI0A 1DAMA 3TLXA 4X1OA 2HRDA 3BH0A 5JXJA 5M5BA 3K96A 1EG7A 4DSTA 3BB4A 4YLEA 2HSGA 5FNVA 2JNWA 3C7CB 3DO8A 1KI6A 4U6NA 3G0DA 1ZM7A 3IE2A 2IRWA 2MYNA 3NS7A 2WV7A 3L6RA 2QT0A 4G1UC 4LRUA 1ABEA 2A0WA 2WUDA 3D8TA 3N6VA 4INZA 4LVOA 2PMEA 2J0VA 4B6EA 3KQHA 4WXPA 5JROA 2D6FA 1ZCAA 3E5NA 2W2LD 1CV2A 5KTMA 1BXRB 4QJ5A 4XR4A 1WXXA 4YP6A 3DDSA 3X1MA 1CF9A 3IKJA 4PAOA 4XSVA 3SYRA 1ODFA 2RK3A 4A27A 5FI0B 1SQ6A 5BW5A 3OJCA 1NZFA 2X1MA 5FI1B 1T9GR 3IILA 5GIOE 3ZEAA 1TA9A 4RA6A 1E2GA 2WHYA 2YXBA 2XB6A 1II9A 4MIOA 1CQIA 5AJZA 3VC2A 3T5TA 2QENA 3OWHA 4NCIA 4OJYA 2CW5A 2GN6A 2LWIA 3K9GA 4ZODA 3SS7X 1RP7A 3PFNA 5JZ9A 3OX2A 1E0JA 1QZTA 2PLWA 3K9WA 1V25A 2PL1A 4I55F 1QHNA 2PL3A 3GA7A 4BDTA 1AVTA 3EG9A 3DBRA 1Z35A 4XWYA 1WULS 1NRJB 3FLBA 6REQA 2R86A 1J24A 3CNQS 1SD5A 3P9KA 3OBBA 3T1OA 1IUKA 3A1TA 5KQRA 2DT8A 2VSFA 4HGPA 3P9CA 4RAQA 1VL8A 4A1OA 3EQ9A 3D7LA 4AJOA 4BQNA 4C0QC 2V6BA 4YLYA 2P6RA 3IUEA 2ZIGA 1J7KA 1NJ6A 1B15A 4XGRA 3I1JA 1SKMA 1DL5A 4YAUA 1C1YA 1FFDA 4OQLA 3WHKA 3Q0EA 4YWJA 3ZD8A 2F3SA 4E03A 3IQDB 1LTKA 3B1ZA 4JFAA 1NSFA 3B2EA 4GR9A 3NUZA 4NBVA 4UAUA 5G3ZA 4KZKA 3TJMA 3PC8C 1AKUA 4ZT5A 3OHSX 1QFMA 1T4CA 4OP2A 1MHPA 4PPGA 4LOKA 2HZBA 1FTQA 1XF1A 4HGZA 5E7JA 5BUCA 3IDZA 3OQJA 5FO1A 2YRXA 3DTYA 4UVHA 3AR9A 4BVEA 5JC1A 4GI7A 4LCBA 5EWLB 3UUFA 3N2GA 3RJ9A 4JLPA 3VGJA 5AW7A 2MJLA 5EKTA 1ZC3A 5IM4F 3D6FA 2P9BA 4R83A 2W22A 1PFWA 3MXOA 4RSGA 3BJIC 1MAVA 1E1CA 4YYZA 4MRVA 2I2WA 5H59A 5BQ5A 1U9JA 3N87A 2JLZA 2GEDA 2Z6UA 4O2BA 4KFRA 2ZAOA 3AP3A 4MR9B 1NXWA 3PXEA 3GJYA 5AHWA 1N34B 4QOFA 3KQYA 5TPZD 3WB9A 1T0BA 4AJEA 4LV5B 5K8VA 1E79A 5MDHA 4OAQA 5AOCA 2W8ZA 2AG1A 3RM3A 2B78A 5JYDA 2VTBA 2C98A 4GVLA 5GY7A 1D04A 3DHVA 2X2PA 2P3LA 5THKA 4YPOA 1P5HA 1SXJD 3B1YA 4XUDA 4E21A 2WT9A 4QYWA 4HDSA 2V5AA 4MRMA 4OQQA 5HUHA 1A04A 2EKDA 2PZJA 3TO5A 3KC2A 3C0KA 1DARA 1T43A 2C4TA 2QV7A 4IJ5A 4BVFA 2A5JA 2Q62A 3CF6R 4HRAA 1UFQA 2R8PA 3N2LA 1Y7PA 1XQXA 3ZZMA 3SZGA 3EXEA 4EELA 4GBJA 4LY3A 2V9CA 5E4FA 1ORIA 2GEBA 3HI4A 4O33A 4R2KA 4PRKA 2AB0A 2D1YA 3GQBA 1TLTA 1EDOA 1W85B 3QU5A 1XB2A 3W4JA 4ZZ1A 1X92A 3TZKA 3E61A 4IH9A 1ZRHA 1ODLA 1RYFA 3FYUB 4TWBA 1OZGA 3RAFC 4ND5A 1ORTA 1VP3A 2RIPA 4O1HA 3KCQA 4Y8VA 3ZHTA 4AZTA 1O94D 3GBPA 4MVJA 5FPSA 1C1XB 1BX3A 1IHPA 2PBZA 5FQOA 4CKBA 2J4CA 1SCAA 2O8EB 4Q93A 3RODA 3HBMA 5C5IA 1R9JA 2DETA 1EJBA 4KYTA 3A4TA 1J0DA 1GUYA 3G13A 1V5WA 4G24A 5TE9A 1KYWA 3PUKA 4K26A 1SFRA 3PPYA 4KACA 3UJPA 1ZITA 2YCLA 4HQRA 3HKEB 3GJQA 4HGYA 1KO4A 4GX5A 3ZQKA 4P80A 2VF4X 2HXYA 4C3VA 3IXMA 1R00A 3W77A 3U7FB 3HUTA 1T3GA 3AETB 1XQ6A 1N2CA 5DRTA 4MUNA 2HJ9A 3A2KA 2D13A 2BZ0A 4NBTA 3LUCA 3PTZA 4RD2A 1P81A 1Z75A 2TSYB 1FP6A 4CE6A 4LUCA 3WI7A 1KEEB 3EGDB 3K1AB 5DHUA 5EIAA 2IYNA 3RSQA 5GGYA 5ECGC 3RVKA 1TQ8A 1Z0DA 4JC0A 1RS0A 4L5CA 4WASA 1GG5A 3EGCA 5DM2A 3ZDQA 3GARA 2HYDA 1FSGA 4XFJA 4AB1A 3ICCA 3DEFA 4UNNA 1SIOA 3AOGA 5KCZA 1L2TA 3BWEA 1E2KA 3WRVA 4EKDA 1EVQA 2BGRA 3UUGA 2WTAA 4WFJA 1IMOA 1JR3A 4ZC8A 5L3QB 1KAHA 2ID9A 4J9VA 4J2TA 2CXSA 4CQMD 3E7FA 1TCCA 5MHTA 1IN4A 1S4QA 13PKA 2GZMA 1VOTA 3OZUA 1XTVA 3P9SA 4B3JA 2Q3LA 5CH3A 4I5IA 5J5AA 1XDUA 2ZJ6A 5GPBA 1IL0A 2VOJA 4NU6A 4ZCPA 1GY8A 3N7UA 4HEHA 4LYGA 1XTSA 3ZKWB 4MW6A 4OSPA 1V7QA 1RXEA 1F6DA 3VUFA 2NTVA 1XWFA 2HBYA 2W6QA 2HQRA 4WLUA 4BBZA 2AX4A 1O0SA 4R41A 3PK0A 3SC2B 3NAZA 4E4YA 2FWMX 2A9PA 2F7SA 2G9QA 3FUXA 4TT3A 4B09A 3AETA 1XNGA 5A05A 4UTZA 2XDQA 2BKXA 2Q45A 3K2EA 4QGAA 4EY4A 2IELA 1RRVA 3U6KA 3DOIA 2XW6A 3VAAA 1OLXB 3FYDA 1AKNA 1J20A 4Q7KA 2PUVA 4LNUB 4TTTS 5EZQA 2OZLB 3I04M 1QF9A 1SZPA 2WMOB 4URWR 2E5FA 3V4OA 1QVWA 3NC1C 1U3DA 2Y0PA 4Z4FA 3ODGA 1FJXA 1P9RA 4DR6B 4EB8A 3T1YB 3BICA 1XELA 3OURA 1HWYA 4I1IA 1IMJA 2VR1A 2XMGA 4LYJA 3RRYA 4QNMA 2NUAB 3LH5A 4JJFA 3F8WA 4G41A 5I9NA 3PFCA 4DEYA 1WZEA 1WY5A 2LRHA 3QEAZ 1IBKB 4KI0A 1YBMA 3NHLA 3H2HA 2C07A 3DBLA 3UNXA 4YRDA 3UWMA 5LQDA 3RD5A 3VKGA 1L5VA 1CZLA 2H1HA 2DU8A 2QWXA 3IPRA 4GOLD 1PJAA 1QIDA 1VLQA 2ODWA 2G0TA 4MGEA 3ZKWA 2E4XA 2GD0A 3T7DA 5EIEA 1PYGA 2NM0A 4FYXA 3A8TA 1HT0A 2DKOA 1YDGA 1Q17A 3HVIA 1QYVA 2Q4DA 3C48A 1JHAA 4DGSA 3DXFA 1J8VA 2BGTA 1PX0A 5DV9A 4BUJA 2D2FA 5TT1A 2XMRA 2Z3WA 4GKKB 1GGFA 3PYLA 4JU9A 4TYNA 4XTRA 5EZYF 4BE7B 1EWRA 4TZ6A 1DQPA 1VDMA 3ECSA 2HV8A 2J9FA 5ARCA 1OAAA 4CT4B 1HE5A 4NV3A 4URZR 2IC5A 3TAXA 4WXMA 3DPSA 1J49A 1DWUA 1GA6A 2XUQA 3GDFA 3L0CA 3MS2A 4RKRA 1KSFX 5I45A 1CY6A 2ZYVX 4NABA 3DZDA 2D5IA 3N74A 3D7MA 4HGOA 5E6SB 5MFPA 2E9SA 4WIAA 1N2HA 421PA 1PR1A 3I37X 4OJMX 2YWHA 3QPCA 5TS3A 3WP1B 4EJSC 2IUEA 2VWQA 2FOLA 1SC1A 3SJBA 4RTJA 1OWPA 3UVEA 4ZVMA 2OA0A 1YONA 1LDEA 1OA1A 2O2SA 1P4AA 3D3NA 5TARA 1K9SA 1DWQA 4CEJA 3MWKA 1PWZA 2D1SA 1RCTE 3PC3A 1JFFB 1K89A 1SVUA 2UZ0A 2HA5A 3H5AA 1SAYA 1TGYA 4MKRA 5K1ZA 4BRWA 4L5BA 3FMOB 2ZIWB 3ZLVA 3RF7A 5A5FA 1R37A 1TC2A 1I3CA 2ZK7A 3EVZA 2VRBA 3AIIA 5KVVA 1OBCA 3ZDCA 3MCAA 2C9YA 1M6NA 3IVAA 1UOQA 5CVEA 3KZVA 1TM2A 5JAHA 3L4KA 1U2GC 1YAHA 2E0IA 1MAUA 1MC1A 4Q3NA 2AR9A 4OQZA 1JKJA 1FJGB 2JDID 2IEZA 1Y3AA 2PYZA 3A1CA 3SM9A 4RA9B 3UHFA 3IEVA 1YE3A 1MO2A 1NUAA 5KVCA 4RMGA 1SCIA 1MV8A 4BNDB 1GSAA 5C1BA 1V2HE 2A9QA 4HF7A 5EIBD 3RYIB 2R8BA 4LHVA 2PIAA 3T7EA 1GTG1 1T2AA 1ETHA 3IUSA 3OT5A 3DULA 4EZEA 1PK7A 3BAZA 4MQUA 3PB3A 2JS7A 3U3ZA 4EKEA 4BO1A 2Z30A 4M1EA 1FBNA 3CV3A 2Y93A 1U7ZA 2BE7A 5AW4A 2QMUA 3AB8A 1TIKA 1YFZA 3WK7A 1NVWQ 1RI3A 3A1VA 4FYJA 4FXPA 4PS1A 3EWAA 5H80A 2H06A 2JRLA 4EATA 1RXYA 1UBSB 1NVTA 5T7BA 4CU2A 1D9ZA 4U2EA 5L4NA 2PBFA 3GRFA 1ITZA 7GPBA 1A7JA 4NJMB 1B0ZA 3SGLA 3I2GA 1RNLA 5AVWA 4K9LA 3RUHA 4IMIB 2CNWD 2OQRA 2OMKA 5JALA 3NU1A 1G18A 5CLQA 2H7CA 1MLDA 3NBAA 3NNDA 3AY6A 3ZH2A 3WZMA 2UUCB 2I54A 3B6KA 4Q12A 1NT2A 4MCJA 3T3DA 2QUHA 5F4ZA 3CF4A 3NORA 3SI7A 1XP5A 3CLUD 2Q4BA 3Q87B 5FAXA 3WO1A 4BFXA 1BX1A 3EA5A 3QBEA 5IULC 1V5IA 3EMVA 4MS1A 5HMMA 3Q6MA 1ND5A 4HX5A 2X8AA 4L50A 5E6RB 1N9GB 1OWMA 1GPBA 3A05A 3T4PA 4RA9A 3DMRA 4EFMA 1G3RA 2ZATA 2HU5A 4MV1A 2VH2A 4J3NA 3ZUGA 5LP6A 1NRXA 3FPBA 1E2PA 1RC0A 3N7TA 1HDEA 2REBA 2QQGA 4B0PA 1BXKA 1HZZC 5BVHA 5HJEA 3NXSA 3HB1A 5FULA 2G36A 1WDTA 1L5NA 3CLRC 2XT9A 3VX4A 2PX4A 5TIIA 5BV8A 1LBQA 5E9WA 4WY5A 3GAMA 5K3EA 1ZH2A 1JKIA 3X44A 4KN6A 4MCHA 1VECA 3CWQA 4OHCA 3AVVA 1K2VN 3BUSA 3DMNA 1MT0A 4E3WA 4X92A 3M34A 2E6KA 5BWBA 2OP1A 4C88A 4PN7A 4IIUA 4LJ5A 4MW0A 5IN5A 3C6QA 1LCIA 4K6MA 4AO7A 4LZOA 2W8BB 3Q98A 1H2FA 4A1FA 4MYDA 1GPH1 4ZQHA 3TVYA 2AD5A 3TLEA 3KEMA 3DL7A 4CIYA 1NTRA 2IWHA 4KQEA 2PSEA 1CR2A 1NUUA 1BFKA 1QIGA 1ZGCA 2PYIA 2VFAA 2ZFUA 1WUIS 3OIVA 1RIFA 1KMCA 3ESYA 3MSCA 5HIIA 1E5XA 1JQBA 4CUKA 2VLIA 4H0CA 3JQ7B 1SCKA 3EC7A 2WZBA 1QH1A 2DWOA 5AW2A 3W2GA 4YXWD 4W6ZA 1P0PA 3WO0A 1ZOIA 1N6OA 4XUCA 3DKIA 1PVOA 2JKYA 1CNMA 3VJLA 4WY2A 4CR8A 1AXRA 1UXOA 4LYYA 5D3KA 5IASA 4PLVA 4NMLA 1BW9B 4ZOLA 5HE9A 2QP9X 4YV0A 5BV2P 1PKEA 2GDZA 2Z4TA 2I8AA 3UW1A 5LZ7A 3TFQA 2VP6A 4HJXA 3KKZA 3RVLA 3HU5A 2V6MA 2VDLB 3L0YA 2VJMA 3UHAA 1OE0A 1RPJA 3UATA 3HP1A 1TB4A 3VZPA 3I6ZA 3SE0A 4LY6A 3I61A 2MOKA 4C7BA 4WKPA 1II8B 2R44A 8AT1A 4TVOA 1V11A 1GGHA 1XEWY 4FMBB 4Z1MA 4TLDA 2DPYA 3TOCA 2WDZA 3HO8A 2X9QA 5T3UA 2P7IA 3VMFA 3RRJA 1E96A 1K63A 2VPXA 3M4ZA 2YC2C 5BV0A 5G1PA 4D3DA 3TRDA 1CPYA 4R2HA 3SZLA 1I4LD 1TYCA 2OCIA 4BB5A 4F3TA 2YQ5A 2IYZA 5EVJA 1JR3D 4Q21A 1FQJA 1A9SA 3ELUA 3EDCA 5DEIA 1N1MA 3PI7A 4WJLA 2XWSA 5BSKA 5ALIA 1K98A 2QTBA 3ETHA 4UVEA 1JQAA 4RFSA 4KVAA 1ZQ9A 2IYEA 5C31A 3HTXA 4F84A 3N39C 2H8KA 3O4IA 4N8DA 4Q19A 3OY2A 1OAOA 3GLUA 5ELMA 5I7AA 4YAKA 1ZNZA 1ECPA 4F96A 2EWWA 1I3OA 5CFNA 1VL1A 2FEWB 1I80A 1TMOA 2QVGA 3CRNA 1EZ1A 2AXPA 3QKSB 4ISBA 4P3XA 5EERA 5EZYB 5SZKB 3A6LA 3IHLA 3R3XA 1DIRA 1KZ1A 1WVIA 1CJCA 3TD6A 2TMDA 3I09A 5JBNA 3L8YA 5LLDA 1XCBA 2J3QA 1KVQA 1Y0BA 2Z9BA 3L7JA 1NFQA 4RLQA 2H0AA 2EP7A 2YFHA 3W04A 3HWWA 1T13A 4CZ2A 2CN1A 5C0OE 1DKUA 2BKUA 5AKGA 4LQLA 1W9HA 1DMSA 4ER3A 1YR1A 1B0AA 1V8BA 3PSAA 3H9EO 4PLHA 5TVKA 4AX8A 1K75A 1IUNA 1U5CA 3WIDA 2B25A 2Q6IA 4NDZA 2EKLA 3V5NA 1LA2A 1HT2E 3OCZA 4L07A 1JSLA 1VKNA 4LSGA 3SX0A 5JECA 3TSCA 1Q84A 1P7WA 1UBGA 1UBUS 2VBCA 3STYA 1DHRA 4Z49A 2ZTVA 2J08A 3EDRA 2NP7A 4UCQA 3E15A 1UWCA 5A4IS 4B3SB 1Z5OA 1X3LA 2D8MA 3LBAA 1T5TA 3Q3CA 3OPMA 1THMA 1UF9A 2A5YB 1T26A 3KALA 2ODNA 1BXGA 4KU4A 3DTNA 4GVPA 4MRRA 4YCDA 5CEJA 3ZWQA 3A2MA 4JKIA 2IWRA 2OZPA 5B30A 2QP3A 2RCYA 2NUPA 1P2TA 3RWBA 2OXFA 3ZWBA 4BV8A 1GR1A 2JHGA 2WB2A 2ZRQA 2VDNB 1DOZA 1T5DX 3CYFA 1BGWA 1B1CA 1Y8ZA 3LM8A 2WC1A 2FZVA 1YO6A 5LQCA 2VPTA 2ZXEA 4I4TA 4QPJC 2HHLA 1BDBA 5KEIA 3DZBA 1ZH0A 3D8HA 3FUCA 1JR4A 3N8HA 3OM1A 4J7AA 3GK3A 5IANA 1BCRB 2QVLA 4XDHA 2Q0QA 4AMVA 3FMPB 4C87A 2OXEA 3HUEA 2VK2A 2V3CC 2RGXA 1I1QB 4GNKA 1VMAA 3NNSA 4CCYA 2QAIA 2FZ4A 1X7XB 5CFMA 4FYPA 1CJUC 2RGBA 4MQ5A 2VZ8A 1Z4OA 4C0HA 5JNUA 5LQUA 1E79D 3D3JA 3TEJA 1KU6A 4ZZ3A 2FZ5A 4Q1DA 2I4RA 4JCOA 3ZDZB 1WMEA 3CLHA 3NX4A 5LP6C 3Q7QA 3COJA 3HJAA 4LE2A 1PFUA 3QOFA 3ZHQA 1N0UA 3TMAA 2YYAA 2OVBA 4OM7A 3U19A 1YQTA 3U9LA 1CE8A 1HR0B 5HQ3B