1TUBB

Tubulin alpha-beta dimer, electron diffraction
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
427
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Microtubules
molecule keywords TUBULIN
publication title Structure of the alpha beta tubulin dimer by electron crystallography.
pubmed doi rcsb
total genus 88
structure length 427
sequence length 427
ec nomenclature
pdb deposition date 1997-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1tubB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1tubB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1tubB01
5FNVA 5GONB 4YJ3A 3E22A 4O2BB 1RQ2A 5J2UB 2RHLA 5JCOC 1TUBA 5CA1B 3WGLA 2VAPA 4TUYA 4TV8B 4IIJA 4O2AA 1RLUA 1W5FA 5JVDA 5KMGA 4EI8A 3JAWA 5LA6B 3HKBB 4O4IA 5EZYA 1W5EA 3JAKA 3ZIDA 4DXDA 3HKDB 4O4LB 4YJ3B 4O4JA 5J2TB 5LXTA 5IYZB 4E6EA 4FFBB 1W5AA 1W59A 4DRXB 5MN5A 4ZHQA 1RQ7A 5MN6A 3M89A 4ZOLA 5LP6B 1FSZA 2BTQA 2VAWA 3JALA 3UT5B 4I50B 3JAWB 1W5BA 2RHHA 5IJ9B 3RYFB 5ITZA 5IJ0A 3VO8A 3N2GB 3JATB 4YJ2B 5CA0A 3HKCA 3N2KB 4ZHQB 3WGJA 5LYJA 1TVKA 2BTQB 4X1IA 5LOVA 3VO9A 3ZBPA 3RYIA 2R6R1 4O4HA 4WBNB 2R751 3JARA 5CB4A 5EIBD 5KX5A 5FNVB 2VXYA 4M8IA 3E22B 4IHJA 5BMVA 3WGKA 3ZBQA 1TUBB 3RYHA 4XCQA 3R4VA 5LYJB 5LOVB 1Z5WA 4B46A 4TV9A 4TUYB 4IIJB 4I4TA 4O2AB 5MN4A 5JVDB 4KWEA 5KMGB 4ZI7A 2RHJA 4EB6A 4U39A 4O4IB 5JQGA 5EZYB 3JAKB 5EYPA 5C8YA 5JH7A 2BTOA 4O4JB 3WGNA 3HKEA 5BMVB 5LXTB 2VAMA 4I55A 4F6RA 1JFFA 4ZOLB 3RYCA 1FFXA 3JALB 3JASA 3VOBA 2RHOA 3RB8A 1SA0A 3VPAA 5C8YB 4O2BA 5ITZB 5IJ0B 5JH7B 5J2UA 1OFUA 4EI9A 1W581 3HKEB 3M8KA 5CA0B 3VOAA 3HKCB 4LNUA 4TV8A 1JFFB 3RYCB 4B45A 1TVKB 4U3JA 4X1IB 5LA6A 3HKBA 3RYIB 3WGMA 4O4HB 3HKDA 4O4LA 3JARB 5CB4B 5J2TA 5KX5B 5IYZA 4FFBA 4X20A 2GVIA 4IHJB 4DRXA 4X1KA 4HNAA 2Q1XA 4LNUB 3C8LA 5LP6A 3RYHB 4U3JB 3UT5A 4I50A 4TV9B 2XKAA 5M7EA 4I4TB 5JCOA 4X1YA 5IJ9A 4ZI7B 3RYFA 3V3TA 4EB6B 3CB2A 1Z5VA 2XKBA 3N2GA 5JQGB 3JATA 5EYPB 5EIBC 5GONA 4YJ2A 4X20B 3N2KA 4EI7A 4X1KB 4HNAB 5CA1A 4I55B 4F6RB 4X1YB 4WBNA 1FFXB 3JASB 2Q1YA 1SA0B 5LP6C
chains in the Genus database with same CATH superfamily
2RGUA 3JWGA 4ISCA 1VYTA 4MKHA 4W6QA 2JIRA 2BGLA 3CRZA 2V6BA 1NBWB 2FX2A 4JCCA 5KNDH 1KEWA 4J94A 4F60A 1Q82W 3EVCA 3VO8A 2DAPA 4FFOA 5TPZD 2AJDA 3A4VA 3GLHA 1DQSA 3AIOA 3WO0A 3RVBA 1M1YE 1NLYA 1DJOA 1QRUA 2BFFB 1UXKA 2CEAA 5BP7A 1M6WA 3DR3A 5TS3A 2QPLA 3D3JA 1VSVA 3F6PA 2CTQA 5FLXM 4YBRA 3WYFA 4B7EA 2FZVA 5ISMA 1YA6A 4CMEC 1I33A 1FVHA 1DBVO 7REQA 5EI5A 1R1BA 3BIJA 1F8YA 1Q19A 4KKXB 1BU5A 4ZCPA 4B6JA 1SBYA 2EDCA 1GTSA 3LSSA 3Q85A 4J76A 1S9HA 1RU3A 5B5SA 2ECPA 1Z6GA 4Y2UA 3AM4A 5IEJA 2TSYB 2B20A 3NOQA 2KG7A 1FTYA 1X8LA 2PUDA 3RANA 1N5MA 3ASNC 3RRZA 3V4LA 2R86A 3DMHA 1QFMA 1QSGA 5JJLA 2QAIA 1HY3A 2ZBRA 2G9ZA 4KRFA 4UQLA 1S2OA 2G17A 1R0WA 2E18A 4UB8Z 3RFFA 2R96A 3CW8X 1EG7A 3VBEA 5TMPA 1D0VA 4DT1B 1YACA 1YQQA 4P6VF 5GZ6A 1X7DA 3NAGA 2ZBQA 3S0YA 1T2EA 3F3SA 4AC9A 2I65A 1TT5B 2R7MA 5C7LO 3P30A 4DW0A 2IQIA 5BSMA 4UEWA 3WHKA 2RIPA 2AK2A 4A27A 3O8LA 4FMDB 1AJPA 3SGLA 4EAAA 5GJCA 3TQSA 1Q6UA 3C3AA 4GBMA 3K9LA 2AFRA 2ZBUA 3KUXA 1V3UA 5ED4A 4JIGA 1SDSA 1QLHA 2EHJA 3TINA 4UBOA 1XPRA 4KITB 3N2YA 4Q3CA 3JQ9A 2A0KA 4BEWA 1D5CA 4QD3A 5J9PC 2RHHA 3PEVA 4YRSA 3JWJA 3ZQUA 4J0QA 1GTG1 1KI7A 3IIIA 3DXYA 4DMHA 1SC5B 3JWEA 3KBBA 1PK8A 1JFSA 4MQ4A 1VQOV 1O5OA 4S35A 4PTLA 2V54A 5CVEA 4U63A 2O8FB 4MB2A 5D2CA 5CXUA 1U2QA 2YFKA 1HRDA 1ODSA 1FYWA 4REQB 1E1KA 2XHEA 1KEKA 2GZ2A 1PL7A 4AMGA 4CIXA 2AEEA 2O8DB 3KLNA 4OAPA 4YRNA 5HKOA 1I6KA 3R7WA 2VDOB 1G8AA 3FNGA 4YJHA 5DM2A 4P0QB 4GPZA 2ERYA 1V6SA 3THXA 3HR7A 2HV9A 5HNKA 1WETA 3P2MA 3T1YO 1YF2A 1GPLA 1O6FA 1RI2A 1YRLA 4F46A 3F0DA 3OTOB 3EWIA 4MYSA 4UHDA 3KBOA 4B48A 5LU8A 2PX8A 5DGTA 5LJIA 1EWQA 3HMKA 5KREA 3KP1A 4EKGA 3FX7A 4FXOA 3RSFA 3I73A 2N0SA 3FMPB 3Q3VA 3FOEC 2D3WA 5DJ5A 4G9BA 4IFBA 3JZIA 1MW8X 1NULA 4WADA 4PA7A 1X7OA 4MV8A 1JEQB 4DA4A 2LNDA 1Z0FA 1OLUA 1I24A 3RVSA 2QZ4A 1XJ5A 2OZLA 1B0PA 2B5UA 1BDMA 3CYQA 2B94A 1UK7A 2AR7A 4W9RA 3UFXA 3PC8A 4JXJA 3I53A 5A5DA 4EEKA 1ZAKA 4P5DA 4EYKA 1AUVA 3K9HA 1LK7A 5AM5A 4ZVSA 4F3RA 1RHKA 1CEZA 1HNWB 3VYSC 3EH1A 4MUKA 1H6BA 3GAMA 1I6WA 1RWBA 3O94A 4LEIA 2KB1A 1IQRA 2DZDA 2FE4A 5ESWA 2GVZC 4WH0A 3H0EA 2XKJE 4KI7A 1BH6A 5FL7G 2GRAA 3EY9A 4LRWA 2V9YA 1DKPA 4JYAO 3NVKE 4ZARA 5HEKA 5BMVA 2QE6A 6LDHA 4JX8A 2WSLA 1S5LZ 4R8LA 3KKEA 5C4MA 2ZSUA 4PN7A 2Z0AA 4FS8A 1J09A 3BMXA 4PZAA 3R2JA 1E9AA 3PX7A 2XMCA 5I9SA 3IPRA 4G1UC 5CXXA 5SYMA 4KR2A 2IIBA 5JCZA 3GLHB 5E4JA 3DTTA 5K6AC 1T26A 3GJ3A 3AP2A 1SQ5A 3TIVA 3HC7A 4PPGA 1U0SY 5JFTA 1E63A 3ET5A 2HKIA 3DXZA 3UHFA 4AO8A 1HURA 3QELA 3PT5A 2H2IA 2XBLA 2QA4F 5A5VA 1BXRA 3VKWA 1CUJA 1JQBA 2QMOA 2XUDA 1ADGA 4LISA 2W6JA 2Z6UA 3NALA 2OCBA 4LCEA 4HEHA 1K7EB 1NP7A 5D7BA 4CGZA 5CH5A 3QFFA 5GVSA 3KPUA 4F38A 1ESEA 2G8NA 1XMOB 1T2UA 2PV0A 1JJVA 1ZI8A 3LPNA 3HO8A 4KNWA 4BECA 4HWTA 4IHAA 4N0PA 1II8A 3GLFA 4J8PA 1HWYA 2QTWB 1QR8A 1U0JA 4BNGA 2Z6QA 1SHLA 2V6GA 5D1NA 2KG7B 3RT9A 3BK1A 1MQSA 1GPH1 4GUAA 4B4WA 4X60A 4I2VA 3C9RA 4JB8A 4PLZA 2YHUA 1Z5OA 4PLTA 3KZIZ 3LOPA 1EB8A 4MW7A 3TZKA 1DO2A 4R01A 2VP9A 1Q0ZA 5ITSA 3EVNA 4LW8A 4PG5A 2HJSA 2BCCH 2CLOB 2BBSA 1QYRA 1QQCA 2PJDA 4I1PA 3IO5A 4JGGA 1EE1A 1X14A 1ZRHA 3N6VA 3QBVA 1YBFA 5B5EZ 2QN6A 2X5OA 1LFAA 4YCJA 4NS1A 4OIMA 3SC3A 1R4AA 2WA1A 4MITA 4OGQB 4YGYA 2G40A 2FFQA 3AJDA 3A4TA 1KRWA 4YLEA 4M60A 1BS1A 2J87A 1P3JA 4HAUA 4EJ2A 4JI2B 4MV5A 2BMAA 1SKUA 2CLSA 5GAJA 4C0KA 1YBHA 1U02A 1YE8A 3GH3A 3PLAE 4RK6A 3P26A 4I6JA 1R3IC 4OQQA 5TEWA 1QOZA 1E9BA 4UC0A 2OXTA 1HQCA 2GHTA 2IBMA 1R6DA 4ZKIA 1VTKA 3M83A 1DIAA 2PMDA 4U7DA 2NZJA 5KYTA 2AN4A 4YYEA 3KL2A 4EJSC 4LYEA 2ITDC 2PUEA 1YVPA 1OILA 3DEKA 5TR9A 3QVMA 5C53B 2NSJA 1AGPA 4KGDA 1DK1A 3GJ7A 2ISSD 1I94B 3DDNA 1VLVA 1CJCA 1V47A 3E48A 4FEGA 3LX6A 3S5JA 4GI7A 1ZWIC 1QORA 3QKWA 3CLRD 1Y42X 5JJCA 1X39A 8ADHA 4P2BA 3Q3IA 2EG5A 3F6BX 1KEZA 4BNMA 4C9BA 1HE4A 5U4XA 4YJHB 4QVIA 3THXB 3LUDA 5H5JA 2WM9B 2OK7A 4Z1VA 4TTSA 1YB7A 2F67A 4U7GA 1SQVH 3UT6A 1NTZH 3ZWMA 1S4QA 3IQXA 2NUAA 3L8FA 2YWDA 1BC5A 4IGKA 3TOVA 1UFOA 4X84A 5DIFA 1SBIA 5K3OA 1GNRA 2ZK7A 5AW9A 3F5SA 1HDJA 2Z9BA 4XIJA 5FLXN 3ICOA 4NVPA 5DWVA 1I2BA 1YHQF 1OLUB 4AJ9A 1YIJF 3GF4A 5TJ9A 2HS0A 4US2R 2C7GA 2OZLB 3RFCA 3N70A 3O03A 2EWMA 1KI8A 2ONJA 2GEVA 3USCS 2GBGA 5JVDA 1E0JA 3UFXB 1U2DA 3O8QA 2JEYA 4EZBA 5I3ZA 3KB8A 2DM6A 5K7SA 4NQ3A 1TJ3A 1J8FA 1Z07A 1QV7A 4GQBA 4W7SA 4MJ7A 1EVYA 1QP0A 2YNMA 3HA5A 3R0JA 5K01A 4HGNA 2O05A 3DG9A 3DHVA 3OY7A 3L1JA 1H65A 1VQ8V 1NUPA 1I3CA 1TVMA 9ATCA 2HWKA 2X7JA 3D0RA 3H2GA 3E9EA 4FQ8A 1KEPA 4ZXFA 1PUIA 5EP3A 1QLEB 2IT1A 2QI9F 1CV2A 4KVZA 1JAZA 2WU0A 2XCOA 2NU9A 2OZBA 3WB0A 2P91A 4JS0A 1JTEA 4DYVA 1OU4A 1YB6A 4D4IA 4CR6A 3RROA 2G77B 1ZSNA 3QE4A 4NEQA 2FRDA 4JC0A 4QICA 1DT9A 3T1OA 3P2KA 5KU7A 1XDZA 1RHQA 2Y1DA 2QM8A 3FFQA 1YASA 3C3PA 4X97A 4IL5A 4C0HA 4RSRA 3DOFA 4AX8A 3SC6A 2DETA 2WTMA 4P4LA 1G291 3QELB 4GYKA 4EX6A 5K0ZA 1W1WA 1BXRB 3AKYA 5DP2A 2IQQA 3AEZA 3VMFA 1LTHR 4ETIA 3TJZA 2QA4V 5D5PA 1NF8A 3B3FA 4WNAA 2CZQA 1LU9A 5SZHB 4FSHA 5CCBA 4ZC1A 1TUGA 1VQNF 3EIUA 4XJTA 3U0BA 2AN1A 3RODA 4X1OA 3OLZA 3F9CA 1II8B 3D1LA 3GLFB 2HWXA 4G8CA 4MVSA 4F92B 4MGIR 3G02A 2QBYA 1GTZA 2Q1XA 3TN7A 1VH8A 1U7UA 4QIHA 3ILSA 1SQ6A 1NH2B 4UUQA 2JZNA 3FG9A 5F2EA 5FTMA 2G07A 4KSBA 4LDQA 4N3GA 2QJRA 4DKJA 1W4CA 3IDQA 2BI8A 1R0RE 1EK0A 3UJ6A 7MDHA 1BTOA 3SM3A 4OEHA 1ACJA 1Z5UA 2O2ZA 2QV7A 3AJRA 2HK6A 3W5IA 2YVQA 4FKBA 2Y9MB 5K6AA 3KKMA 5K4HA 4ARCA 2ZRPA 2ADMA 5LOVA 3T95A 5TXGA 3AEXA 4E5VA 5AICA 2WNIA 3AZPA 4H7FA 1JDUA 2RGCA 3VU1A 3ILVA 1R6TA 1Q7YH 1TGVA 5JS1A 2KBFA 1VCMA 3NUZA 5IVKA 2VPQA 2F43G 2ZDGA 2XWQA 2BL4A 2XYQA 1QDEA 4IJ5A 2ZRKA 4JBHA 1R27A 3ESCA 5HUQA 1IHYA 2NN4A 5P8WA 2XMRA 2VYVA 1VOTA 2C2WA 2FDRA 2DP4E 3VI3B 3KYDA 1EU1A 4UAJA 1RYDA 1QNMA 3I3SR 4Q1VA 2C9BA 2V0NA 4BMSA 3WJPA 3PS9A 3PNLA 2CHVA 4B47A 5HIIA 1EZ4A 3G6KA 3C3YA 2QWRB 4KLCA 4WY8A 1YQTA 2CF6A 1HNNA 4IGIA 3INTA 3L7OA 4KGXA 4PI2A 5G4VC 3VR6H 2H3OA 1KYWA 2EARA 1QJCA 4UQOA 4YAWA 3FBAA 2EKLA 3BAAA 3AOEC 4H13B 1ZSPA 2DC1A 4ABTA 3TL3A 4MPDA 3DDWA 2WM3A 3UJ8A 1YCGA 1FX1A 1KZ6A 1UJ6A 2J6IA 3PJRA 1MKYA 2JBHA 2W8BC 2JK5C 2MMCA 2BUBA 2PY6A 4IO1A 1ONNA 5EA2A 4WKNA 3KD3A 3L2OB 2HK7A 3LA8A 1T0IA 1L8XA 1Q1AA 4PZ0A 4IGGA 1PGNA 3CG0A 3AF2A 1M57C 1U2RA 2PI4A 3DC5A 5JAUA 4N5IX 4DY4A 1EBFA 4EJSA 5KOIA 1ZSVA 4B32A 3KYBA 3NTVA 1UXGA 2J3DA 5JAQA 1YXMA 3N8HA 3QPVA 3FROA 3RNLA 4MYCA 3L4JA 4R40B 4LYDA 1YZ3A 3BGSA 2GEDA 4FK8A 1YHQV 5JVDB 3ASUA 3DVRX 1RKQA 1T8UA 2IM9A 3KO8A 2B6HA 1Y3IA 3O8QB 2IZ1A 3SKYA 1AN0A 4DQKA 4IXWA 4JUBA 5IYDO 4YECA 2B1IA 1VEWA 2ZWOA 1S3SA 3DW3X 2CFOA 2ZJOA 3MYRA 2VR1A 2EYQA 1D2GA 3K57A 3UO3A 2PZSA 3I9JA 1MG5A 4QM7A 4MUIA 4NZ9A 5G41A 4C89A 4H59A 4AB1A 4HNQA 1EVLA 3GJXC 2GZMA 2HTEA 1XNQB 2D1FA 4DLPA 3WYBA 2QP4A 3OT5A 2NSYA 4ZPXA 1RRGA 1ORIA 2O14A 4GSYA 4UULA 5EB1B 3W7XA 4O2BF 1D6SA 5F23A 3UAWA 1J0AA 4Y0AA 2FI1A 3E5NA 3ELCA 2I3GA 3UW3A 4EG3A 4AY5A 1AGXA 2I6GA 2NSDA 4ZWNA 4IQGA 2JEZA 1UPAA 2QI2A 5CG1A 4NE9A 3OECA 2BFOA 5LYYA 4C5BA 4YHBA 5B6IA 1ZBQA 2OILA 5LB2A 4WZBB 3NVDA 3KIPA 5EFOA 1LK0A 1F0YA 1Z88A 2O7QA 1JQ5A 2JARA 3DWIA 4LHYA 3RK4A 4YCMA 2BGTA 1AKUA 1SH7A 4RJJA 2H7CA 5AXDA 4I14A 1UC8A 1T5TA 5AKEA 3KCXA 2RBGA 2QE7G 3WU2Z 4D43A 3G7NA 4WFBV 2GWHA 4RSHA 4W6ZA 1SHTX 2YCBA 3UXMA 1NI4A 1IZ7A 4C4XA 1AGYA 4O25A 1BIFA 1QIEA 2Q7OE 3VYSB 3FTFA 4UCXA 4YUXA 1LEHA 1AUPA 1UAYA 2RB9A 3FPFA 2G25A 4MUBA 1C7JA 4IX9A 4UMVA 1HFJA 2CT8A 4EVIA 1VQNV 1EQ2A 3K3WA 2ZIVB 4S1NA 1V0JA 3B78A 1I6MA 1DXYA 2WIGA 2FPUA 1KS2A 2QBYB 2GZHA 1UPUA 5CFOA 4NZPA 3V4OA 4PSAA 4C2BA 4I5DA 1MQAA 3CXRA 3CXCU 1OR8A 4DQLA 1KO7A 4X6YA 4QTZA 5JBIA 1T9GS 1AJNA 3S2ZA 4V1CA 2ECOA 4Y6GB 1WDMA 3OU6A 2MSKA 4C43A 3ABZA 1V3TA 1W46A 3SYMA 2YIJA 2WWHA 2GD1O 1RIFA 1MOSA 2AXNA 1JHPA 2LPMA 3HA7A 3LKZA 2DMRA 4B2YA 3IOMA 3EFOB 4YIKA 5LZ5A 3ORSA 1VIDA 2QMEA 4CF5A 2Z4SA 3KT6A 4GX0A 1WTAA 3JU3A 4L8WB 2E4ZA 2OD9A 1SQPH 2PFSA 1VA5A 1R1MA 2G08A 2QKCA 2BYTA 3F46A 1BCCH 2IUFA 4X64O 5FBQB 1QWSA 4YAFA 5FORA 5IVDA 1MX9A 1BXKA 2JZCA 3CN9A 3KYDB 3X1KA 3CX4A 4E4TA 3K6RA 1AA9A 2NZVG 1IWBB 3ZBQA 3TEMA 1ZH6A 1R3KC 4F5EA 1XZDA 1E3JA 4WESA 2IDMA 3GFOA 1J42A 5LZ9A 1IMOA 2QVCA 1F3LA 1UXIA 3TSYA 3B6NA 4FB4A 4RPGA 1EFVA 5C8YB 4TMVA 4L87A 1NOIA 2AC7A 5E9AA 3U7FB 1F51E 4GM1A 2OEPA 3HABA 2ZETA 5LU9A 3QKIA 2QKAA 3HJCA 4BCDA 4CMHA 1B0AA 1T5IA 1E2EA 3QUWA 3GTZA 1AT1A 1RLIA 1H5UA 2NNWB 4YQEA 3CV3A 3Q7RA 3ZK9A 4B2PA 3J81k 4P84A 4G4VA 3TL2A 2H59A 2B4QA 1NUHA 2LBTA 4HQOA 5CIQA 3KZXA 1ZAYA 2F2TA 2VNKA 1AQ6A 4IDQA 1PNQA 3A6KA 1UMKA 1ZK1A 1NT4A 3O65A 2P5SA 2WLNA 5EE1A 5J59A 5DCYA 1ISSA 1KEEA 1BCSA 5KHOC 4OOFA 1TQDA 4IDEA 3QOFA 3ZX6A 1ROPA 1WZEA 4E3ZA 1KK1A 3GFVA 3MCAA 3CYOA 5HXZA 3NXSA 2IIVA 3L6CA 2ZRAA 2JBAB 4G0UA 2H8GA 2PH1A 2JCSA 3KWLA 5FAKA 2RB4A 4EJSB 2H9AA 3WOVA 3T7IA 5MGNA 4P53A 3ZXYA 1XRGA 1DBRA 4Q82A 5FOSA 2ZLBA 4M36A 4GW3A 2QB5A 1IVSA 3DPUA 3FUTA 5K3CA 5M34A 3L7IA 4BN5A 4G1FA 2G1UA 3OCWA 4Y2YA 421PA 5GIPE 3FFMA 1COZA 4L3OA 3T38A 1Z6ZA 1ZVJA 5AW0A 3EJ6A 3T9CA 1VK3A 3S06A 1RWNA 1QFZA 5I9LA 3WDLA 1EEHA 1UDRA 2ZJ6A 3KHTA 5LA6F 3AU8A 3AOEA 3T52A 3D5TA 3TSOA 4YUVA 1UJ5A 2EJCA 3LLMA 1AKWA 4FFNA 3QVNA 3HBFA 2OSVA 1YMQA 2WJVA 3IEUA 1XCPA 4MROA 4QU9A 2BKAA 1WSAA 4NXMB 2EW2A 1E79D 1R6NA 4YXWG 4HRVA 1YRQA 3GGJA 1JPUA 1BA3A 2EJVA 4ZALA 4JX9A 4UDNA 4IIVA 1KJIA 4GX5A 4TQ9A 1ORVA 4Y2VA 4DCSA 2R87A 4Y6RA 5CHEA 1Q17A 1X7WA 3TKAA 1F06A 3EZ6A 3FZYA 4F5DA 2I4IA 2VHYA 3SXUA 3Q5EA 3E1GA 3BQNB 1UT6A 1RM0A 4YR9A 1UKBA 1G8FA 2YS6A 4IPTA 2O6HA 4JJEA 4RV9A 2X1HA 3VOSA 3G1UA 4DCMA 2GBCA 1E7RA 3FTNA 2HRDA 2P6JA 3GUHA 3V4SA 1LQTA 3PA6A 1ZG3A 3TOZA 3CE2A 4R7TA 4WGFA 4FT4A 5IWCA 4WLOA 4OSOA 5A5FA 5BUZA 3LA6A 4I50F 3AWIA 5CT8A 2R6JA 3D7MA 4XQ0A 4IDBA 4N0DA 3T5BA 3M9LA 3CBGA 4HWOA 2BTUA 3X1XA 3HG7A 4C0LA 3VOUA 2H1RA 5TX7A 2DOKA 4Q66C 4ZZ1A 4UHKA 3CIFA 1VP9A 3TAHA 4DAEA 2ZU0C 2YOFA 3AVTA 4BT4A 1Y67A 3L0IB 3GA7A 2YC4C 3NHMA 3B1JA 3L0YA 3LUKA 4UCVA 1YAHA 1L5MA 2D74A 1H5NA 2B4RO 1XQ9A 1DBSA 2CVLA 3OCXA 3T80A 2JL1A 4G4JA 2C83A 4CH6A 4KFUA 1FJ2A 5C31A 3IDOA 4HAOA 4GQAA 1A69A 3H3JA 4OFXA 1RM4A 1YDGA 1FNNA 5HSGA 1S2GA 2QXYA 2PVSA 4ECEA 3KAKA 3IMPA 3OOEA 1V3QE 4W63A 2XWPA 1INLA 4DFDA 2VVTA 4BRWA 1KU0A 4FHZA 3RSCA 3FDIA 3J7AR 2B69A 5FTLA 1RBQA 5E8JA 1GN8A 2TMGA 3K2EA 3RARA 2DULA 4L0DA 3LWNA 4R7ZA 5B66Z 1THMA 3DZCA 2Z43A 2QX9A 1DLJA 4E1AA 4MVOA 1YNOA 5HFJA 2XUHA 2OP1A 4BO1A 2HHHO 3WSTA 2WMNB 1CS0A 1Z6PA 2HSDA 3HYLA 3WGMA 1GL7A 4PELA 3LKVA 3U61B 4URYR 4IL6Z 2YDXA 2VDJA 4WESB 2UXDB 4MXDA 1C7ZA 1TJ5A 1XVIA 1A2BA 3N0XA 4HLNA 4NXNB 2HCJB 3I05A 1R6VA 5EJEA 3R09A 2QVYX 4HAIA 3TO5A 1WLSA 4LF5B 1Q3KA 2A94A 1OQAA 1O94A 3SG0A 2AT1A 2HTFA 1UPBA 4ARVA 4H0LB 5MFPA 2IYZA 1LGYA 3REOA 2JB9A 3A3YA 1B14A 4H0FA 2BHSA 4MW4A 4RANA 4Q15A 3DSQA 3VPBA 4LMBA 1W7AA 1F4LA 1SUDA 2GFQA 3MAJA 4JB3A 4L27A 2P30A 4N0EA 4DK1A 4AXXA 4OB6A 2Y68A 2LKDA 3N7AA 1YBMA 1U1FA 1AQYA 1KEEB 2GCPA 2AYYA 4QYTA 2ZVJA 1NVMB 4NPHA 2WSSG 1HTWA 1HH4A 5KJ1A 1N32O 4E1BA 1C3OA 3VGJA 2H1OA 4AUNA 5TS2A 2GWRA 3L7NA 2JH9A 4I99A 1BNCA 1UPCA 2WE7A 3ICPA 4Z9FA 4R6ZA 2D6FA 1FDUA 3GDFA 2CNWD 1TEHA 2DTXA 3MC1A 3GYQA 1XCLA 1H69A 1V37A 3GPDG 3ICVA 4JHLA 3AK3A 5KUTA 2UYNA 1TU3A 1VKHA 2Z08A 2HK8A 3FOAA 1M8PA 4DXWA 1X9GA 3ML1A 4LP8A 4R1PA 3Q8MA 5TC4A 1OJHA 1Z22A 2NO0A 1YXBA 1SM4A 3RAJA 3FTEA 4NYMR 1N33B 4YO8A 3TJRA 1IX9A 1WKCA 4TL7A 2UU9B 1JGTA 1GGKA 4B7UA 2CXHA 2YX1A 2JG3A 3G8DA 3IIMA 4FYYA 3VAZA 1ADJA 1Z2NX 1M34A 3T9AA 4LCKA 1XK6A 4FFMA 4G4IA 3VTIC 1NMUB 1EHIA 5FKJA 1XTQA 4LXGA 1N2SA 4XKJA 2AS0A 2QUKA 1L8LA 4FLZA 3LDDA 4CW7A 4DPKA 3IQZA 1Z7BA 2A9KA 4WKPA 1M57B 2I71A 4K40A 3A37A 3TBFA 1ZKMA 1X7WB 4LVUA 2FEOA 4AZWA 1Y5MA 4R8VA 3V33A 3SXUB 1F2TA 2OKGA 2OYRA 4TSFA 3AESA 3BF8A 3NHSA 2VP6A 2PLAA 3GLIE 3BTSA 5B3AA 1JAHA 2ACWA 1GYPA 1FU7A 4DWWA 4K9LA 3DV0A 4TXJA 4MVUA 1P33A 3VR0A 4MVJD 1OYYA 4C6HA 3KALA 4O1IA 3KV1A 4QPZA 4UOZA 1HEYA 3LWVC 3T9DA 5AQEA 5C4IA 2Q7GA 1BRTA 2GZSA 2M2IA 3RU7A 1J4AA 6Q21A 5FA6A 3R9XA 1BQ4A 3OFNG 2CY0A 4P54A 1TIKA 4ZT2A 2EIMC 3GT7A 2XNDD 2UZHA 4DQVA 3OIGA 3K0TA 3B8MA 3UMJA 4ZJZA 1QH9A 3FD6A 1QFYA 1WXDA 4KGVA 3C8LA 4HZGA 4OMCA 2VP2A 1SXJC 4EI2A 4E46A 4DR3B 1OTYA 3GLQA 1WP4A 3GEEA 2HJFC 1A0OA 4Y2HA 4LC0A 2F9MA 2FFHA 4GX2A 4ZI2A 4LRQA 1ZOLA 4O5OA 2CFRA 1K73W 4FOTA 3E0QA 1YJCA 4MTXA 5E3JA 3V2UA 3JQ9C 1AE1A 2QSUA 1QNFA 2VBGA 3PITA 3G23A 2QTTA 3E89A 4CETA 5FPTA 3ZU2A 5JZMA 4Z1MG 3HO6A 4RFSA 3S2UA 1R5BA 2NSHA 4KH1A 1KJQA 1Z56C 5A04A 2PGGA 4FWTA 3I8SA 3SJBA 3RSZA 1P73A 2K2QB 1UFQA 3KJKA 5HUJA 4F4CA 1UBHS 1XKXA 4D3FA 4DSUA 3DD5A 4ZEVA 5EE9A 3UEOA 2ZM5A 3L7CA 5KINB 3VA7A 2HJVA 5DLEA 5GONB 1TUBA 4Q1AA 3OU7A 5J4KA 1Z8HA 2QJWA 2EFHB 1Y9JA 2PD6A 3LAWA 4DV4B 1NFRA 2X1MA 4IRMA 3D7RA 1MC1A 1F8XA 1CEQA 2FSVA 1K89A 5DM1A 621PA 4A23A 2P22C 1PNTA 1QBKC 3AI2A 2DQSA 2FEAA 3JD2A 4IFIA 1TM7E 1JKJA 1CQPA 3D6UA 3S81A 4QULA 2HRUA 5ESRA 5EXTA 1DIHA 2CCGA 4PBSA 1MAWA 1KKUA 1VQOF 1SRYA 2I6XA 1N75A 1VB5A 4G4ZA 1SIWA 5EPEA 4MICA 5LZ8A 4EB3A 3WO1A 4LJ6A 4H60A 1JG6A 5TVKA 2PKWA 2A84A 1WSDA 3N6RA 3UMFA 3ROXA 3C7AA 4P2ZA 4AW9A 1PS0A 1C3EA 2JFGA 4NTYA 3PC8C 2IKSA 2D2XA 4TRJA 2HS4A 4RTOA 1I1OA 4QUIA 4XA8A 1M7HA 2IYFA 3AR4A 4JEMA 1S5HC 1D04A 1SXIA 4LH7A 2NZ8A 3K08A 4XOIA 3CCEF 3N8KA 3PIRA 1DIOB 3B51X 4C07A 1R0KA 2G28A 4G5SA 1ECBA 2ECFA 3W7BA 1C3OB 3TAXA 1K6IA 1PT8A 4DAOA 1QTNA 1VHQA 1HK7A 5HZMA 5H81A 4HX5A 2EP5A 1JZSA 1RBYA 1YQXA 1KAQA 5TF4A 3CNQS 4AJIA 3FOBA 3I45A 4DV1B 2UYNB 4KSCA 2V8BA 4WACA 4Q03A 2IFTA 4P3OA 1QGUA 3RUCA 4Q4AA 3W8DA 3OCUA 4LBEC 3FKSA 2QWPB 3WMWA 3CPWU 1KTVA 4LBVA 1DMSA 4YV1A 1P8AA 2H00A 3E5RA 5EEHA 3PHBE 4RHYA 5ALIA 1F8FA 2W2OA 4OM8A 5G40A 3BL8A 4ZGWA 3UK0A 2ACVA 2EP8A 2HVKC 1M34B 4UFOA 1XP8A 1E2QA 4C88A 1AV6A 1K8AW 1WXEA 3ZU4A 4NHOA 4NHEA 2VT7A 4IYHA 2A0WA 2WYWA 3GY0A 3ZXUB 2G82A 4KN8A 4JQSA 5TT1A 1UBRS 3RF7A 2P3QA 4QU0A 1V55C 3ET4A 4R9RA 3TNDA 1MRNA 2B1RA 5EGSA 1T13A 5HRCA 4QJFB 2AN9A 5D1HA 3IHWA 1FQKA 4X7MA 5B7QA 3NM5A 3IVCA 2IXBA 3L82B 3RF6A 1MEOA 1Y5RA 3AESB 4RSGA 2LW1A 1K8QA 1Z7EA 2AXPA 1FFSA 1QRTA 1RTKA 1YZNA 1YNSA 1DZ3A 4EUEA 3AEYA 5BNWA 3DV0B 1UKAA 4X1KA 1IWPB 4G97A 4PHHA 2EV9A 3CX6A 2VK4A 3O3MB 2YFQA 3EZYA 2X6RA 1HG0A 3V8MA 3HPRA 3QE9Y 1KE1A 4L7QA 4XDYA 3ENZA 2PL9A 1PL6A 3L1UA 5KJ6A 1SKBA 1K86A 3E9QA 1UR5A 2X2FA 4DXDA 3QF4A 3UAVA 5LP1A 3RV3A 5DECA 4QHYA 1QGYA 3A2MA 4U6SA 4C6RA 3GFTA 2VSXA 2FWRA 5IDXA 2QX7A 1ISPA 2OO3A 2G67A 1GG9A 3Q7PA 2P79A 3NT5A 2ODBA 1R5OA 2W4QA 1Y6RA 2IHVA 2FSSA 1NYTA 1Q6ZA 2NOAA 1UF9A 1KMCA 1NQAO 2UUOA 3PHHA 4R1OA 1FMCA 5DHPA 3SBEA 3BJRA 1WPQA 3QIVA 2IGTA 2QI9C 2NT4A 3BWBA 2XYPA 1ZIXA 4TM7A 3NATA 2DWDC 1QAOA 1EDOA 5NULA 2WPNA 3GEIA 4RFSB 2ZIOA 4UAVA 4D25A 5IKOA 5BWMA 5HTKA 1H8HD 1NXPA 1QTRA 4FVMA 2OHFA 3OAAA 4LXHA 4IHQA 3VPFA 1FQWA 2PKEA 2ZJ1A 1KXZA 3BWYA 5DLYA 2MR5A 4FLVA 1D1SA 3OQJA 3BBPA 1ITZA 3FI0A 1GLNA 3SEAA 4Q1EA 1NJ2A 4ROTA 4LYAA 3FR7A 4GMXA 3GRPA 1XTJA 3N05A 3LCUA 4RF3A 2P5UA 1UJ2A 3QVXA 5DW3A 4V03A 3O0TA 2AMTA 2DHEA 1P75A 1SXJA 1IDOA 1ND6A 3PR1A 1TUBB 2O2SA 3L4EA 4ZD6A 1RKUA 2ATEA 1YS2X 2B99A 1IRXA 5JPIA 3A0HZ 4FDUA 1PNRA 4QELA 5AI6A 4UCWA 1FX0A 1JMVA 2FP3A 3E53A 1VJ1A 1V8FA 3K2IA 5TLSA 3NKLA 3OO0A 4QA9A 5C5DA 4MRAA 4O1MA 3WK4A 2OGUA 4XI9A 4BO4A 2R9RB 1JKJB 3EF0A 1TW2A 4ND8A 4PI0A 2P7TC 2DWQA 2JEOA 4KYTA 2VWQA 1FSSA 2BP7A 4LX0A 3LOUA 2J3QA 3ZHQA 2XRFA 1LNQA 4KRGA 2Y3IA 3BSSA 2Q4RA 3CY6A 2PZLA 3M1IA 3PK0A 1T0KB 1U2DC 3EARA 2ODMA 3WNBA 2DYSC 3MQ2A 4QQKA 4W4TA 4W1PA 1VQMF 3F5TA 4DR2O 1XK7A 4E4RA 1N9KA 2EINC 4MAFA 2W71A 2JRCA 1R9JA 2JIQA 4OHBA 4PFJA 4BY9E 1U7DA 4O2LA 2IOQA 4HQFA 5AI8A 5H3LA 2YNMC 2RG1A 4R3WA 4JBNA 2Q7XA 2W2LA 1EGVB 3CCEV 1TB4A 3PHLA 2GHRA 3WGQA 2C0QA 4LOIA 1T36A 2PWBA 2F1RA 3IP1A 2H5LA 4B71A 1Z82A 4OUKX 1OXVA 2FOXA 1GX1A 4B3MO 2QTNA 2IIQA 2FHPA 2H11A 1E62A 1ZR4A 4F72A 1RLUA 1LSSA 2FRDC 1QGUB 3AXTA 4Q4AB 1I5RA 5C3MA 1P60A 1WM1A 1CUIA 1P31A 2BE7A 3W5UA 4HBGA 5KQSA 1C7EA 1Q7CA 3IE0A 1NQUA 1HE8B 3ETEA 3DBRB 2V96A 3QVOA 3VH1A 2HA5A 2ONYA 1GA4A 3DEYX 4ZQBA 3JCZA 4X45A 1Q0UA 3TRFA 2HQOA 3LY8A 2GEKA 4GI5A 4I1UA 4DUZB 1ODJA 3UA4A 4BV9A 3ESDA 2QTVA 1G20E 3IIEA 3NGMA 2AL7A 2I80A 1HW7A 1VQ8F 3HVJA 3LP6A 1TAQA 4PLFA 2C2KA 3BEOA 4KAJA 2WF7A 5L95A 1QZTA 2J7PA 3RS0A 4LDRA 3M6IA 2JHCA 1FFGA 3EWSA 2RHTA 1L4EA 3W77A 3TNJA 2WOJA 1E3EA 2SICE 3GFBA 2H8EA 3CMAF 3ETDA 3B7PA 1PT5A 4KYUA 1DBQA 2VJOA 4CG1A 1BFDA 3MG9A 3TTYA 2R6GA 5L6LB 3LMEA 1ISIA 3LO5A 2KHZA 2XCUA 2QT1A 3R0ZA 1H0SA 1SK8A 3T7SA 4JI4O 5E9JA 1DLBA 4OYYA 3G0DA 2GD0A 3ZR4B 1FYVA 1M5TA 3WK7A 3C24A 1WU8A 4LECA 1K4KA 5CM9C 2P4VA 4BRZA 3SQOA 3ZWVA 3QF4B 2CLMB 4UBLA 2WHXA 4FT2A 3DAHA 1ZUHA 3IMEA 3ZLTA 1GGFA 4MW0A 2ZRLA 3D54D 2YV1A 4Y9TA 4LZWA 2C5SA 1US6A 3AERA 1GZ7A 4OXKA 2OR3A 4TVKA 2I7XA 5LCXA 5I45A 1JPJA 3FNFA 3I23A 3NHPA 4URUR 2I7VA 4U2GA 5IJ9A 1GPMA 7REQB 4XVUA 1L1RA 1XO1A 1ZJYA 1CBUA 3CMEF 1SKQA 3WIOA 4WFHA 3CUEF 1IULA 1EAYA 3UMBA 5CBGA 1KIMA 4IDNA 1UWKA 4ZYVA 4CU5A 3UKOA 2OCIA 5B3SC 3TDMA 4XB1A 2IP1A 4LHSA 1Y66A 3ORYA 1Q50A 1QM5A 3V32A 1M2JA 3FF1A 1XRNA 1ZRSA 4MRVA 1XVUA 2V3CC 4U0KA 4WWHA 2JVKA 4BDSA 2CZWA 5JIBA 2YFHA 1FD9A 5EZ5A 1JEOA 4IUBS 2OWDA 3QENA 1WD5A 4BO0A 2YEVA 4U5XA 4C20A 2EIMB 2QRVA 3ZMZA 4QNNA 4DNQA 1SC3A 2AW3A 2QA5A 3QBTA 4B09A 3AF3A 2WW8A 1SXJB 4KOAA 5GWXA 1XZQA 1ISJA 3W9BA 2IS1A 3S55A 3E8BA 2YIAA 1R16A 3SOZA 1Q21A 1TYZA 5JZVA 2K5UA 1FX0B 4RMJA 2CJWA 5KVVA 1J21A 3H5NA 3FMVA 2PKRA 5GM2A 4M88A 3OQ6A 4IM7A 3QVKA 4CTJA 1XR3A 3TLJA 5ECYA 3BEHA 4GOKA 4LDJA 4ND8B 3FY4A 1JG3A 2XADA 3AU9A 1FNDA 1MORA 1V4BA 2VPYA 4JITA 3U9LA 1MOPA 4N3CA 3A1FA 4EHDA 1QCCA 2R8EA 2YN4A 3SAJA 4QLAA 1W52X 2Y0IA 4D42A 1NX9A 3CB4A 3PX2A 2JGMA 3OLVA 2WPDD 3FNEA 4IH4A 1ORRA 2Y4NA 4OXYA 5EAZA 1C1HA 4UHCA 1VQMV 3R7WB 2ONZA 3BA9A 1VI6A 5BY2A 3U6BA 1V8DA 4L6CA 3RS4A 4YI5A 4TL9A 1T36B 1DG9A 1GO2A 2ZJ5A 5YASA 1AURA 3R3ZA 3WHIA 1M90H 1P3DA 1WR8A 5DTQA 1COWA 1X52A 5BWLA 1YKFA 3ZY3A 3LUGA 3P52A 2F23A 2JLZA 4P4GA 1UBGA 1QONA 1PR5A 3L8EA 2ZUUA 3RHZA 3AFNA 2FMIA 2YYEA 4HAVA 1GG2A 2KJQA 2DPLA 4I9QA 1Y63A 3RQSA 3D9QX 3FDFA 1QIFA 3ITDA 1XUOA 3HFSA 2E5WA 4UDYX 3DFFA 3GA5A 5DYGA 4K2HA 1PV2A 2GUGA 2CD9A 3D8UA 3S1AA 2GHQA 1TZBA 4Y67A 5L3RA 2QTVB 1SULA 4EFKA 3M5CA 3TZ6A 2D2VA 1VHJA 2AQ8A 3ZTYA 4MGEA 1OBVA 2G5PA 3O8BA 5CB6A 2DBZA 2IXEA 3U37A 3NVKI 1HNZO 3A0UA 2CJXA 3B6KA 5C3UA 2EFGA 5CBHA 1DTWA 2I8CA 1K5GA 1PT6A 4RULA 3JARA 3PI6A 3ZHBA 3NR2A 2F4VO 3EGDA 1M1NA 4YBZA 4EF5A 3CMAV 3BWDD 5BMVB 1Z8DA 1D8TA 4WL0A 1Z83A 1P2DA 2AEFA 2QRNA 3CZ4A 1P5JA 2AWNA 3A04A 2JK1A 5F7JA 1UEXC 4KAFA 3DCIA 3DMRA 3MJSA 4YAJA 2F62A 3C1UA 1K98A 2ODPA 4Q19A 5HOEA 2QW1A 4PGFA 1N2XA 3ZWQA 1Y1TA 3W5DA 5EUBA 2CNNA 3A06A 4YMIA 7MHTA 1E6EA 4ZV4A 3UVEA 1K68A 1NP3A 3S5UA 5IJ9B 1OIWA 2J6BA 2YMMA 1TYAE 1V55B 1ULHA 5EHQA 3E8XA 1VQ4F 5A3VA 4B5LA 4U02A 4JQZA 3CMEV 3ZLJA 2JW5A 4J7UA 4JLBA 1XXHE 3L5OA 1IWOA 2OTMA 1OW3B 1QX3A 4AL4A 5BUSA 3DA8A 2PN1A 2GBIA 1N8SA 4HUJA 3T99A 1ZN2A 1ZD1A 4A26A 3WHPA 1YFJA 2BEKA 3K9AA 4EFEA 2XKAA 2V7BA 4UD2A 1CDEA 3U3OA 3IAAA 2H2GA 2YEVB 1JY8A 2EZPA 4XFDA 1DBIA 3DC6A 1KERA 4Z51A 3UCXA 1XL4A 1B16A 3GARA 2O50A 4L02A 4X6LA 1A76A 1XHEA 1LPPA 1N8RW 1MEJA 2CYCA 4YRQA 4PS1A 3C8MA 3SSAA 1YJ5A 1UOEA 2AE1A 2FPOA 4DA9A 4RY9A 3W5VA 2XQIA 4YAIA 2Q1TA 3QQPA 4DLSA 2CJWB 2PH7A 3SJQC 3A9TA 1RQNA 2IH1C 4DQXA 2VPXA 1AZTA 4MDYA 4GKAA 2ZRBA 3R44A 3QU2A 2W2NA 3CXUA 2HIAA 4PTYA 3U3XA 1P9NA 4PRZA 4O2BA 2PU5A 4XUEA 2OHIA 1M8KA 1JKXA 4B3TB 1AA6A 1MNQA 3A27A 5JCOA 2L69A 2CW5A 4DABA 2EAUA 1GSIA 4RVUA 5HR5A 4LY3A 2FUG6 3OD4A 5KU1A 1CLEA 2O7VA 4WF9V 4L4SA 3RSQA 1UBEA 1D2NA 3LLCA 3WKAA 1N6OA 4HLCA 1CZLA 1UJ4A 4G89A 4LXIA 3PFIA 3VZPA 4RE6A 4Q7QA 4ZGGA 4I0XA 4IDCA 2DCUA 5L3SA 2HL6A 3BWMA 3WQSB 1TXGA 3ZV5A 3ONFA 4CT4B 3KOOA 3ZDRA 3GMIA 1SCJA 3LDCA 1W2BF 1Q86W 4N49A 1NX6A 2OB1A 3EDRA 3SK0A 4P93A 4HWRA 3UCEA 3K5PA 3MMXA 3ZMUA 1Z4KA 1E5TA 3BRCA 4KREA 3GDOA 2HP3A 4BNDA 2F59A 2PLRA 5FTWA 2P78A 2QW0X 2OHHA 2YS7A 3TS1A 3VJRA 2NUAB 1XL0A 5A7GA 4ILKA 3RVPA 3LBNA 3IJ4A 1XALA 1FF9A 5JMWA 4QOIA 4CH4A 2ZBPA 2JDIA 2IH3C 2H4JA 1IBLO 2WWVD 1U43A 1G8SA 5JAMA 2DJVA 3UT0A 2XMBA 3SJAA 1WJZA 5F78A 3KEQA 1W59A 3JVEA 4EMSA 4JA0A 1SIOA 1M83A 2GV9A 2DYSB 3WICA 4G8DA 4X8MA 4FKZA 2HRZA 2EINB 3S1AB 3O8DA 5CT9A 2P4QA 1K34A 4WNCA 1OV4A 1LSOA 1BMTA 5CLQA 1JLRA 3PA8A 1P7ZA 3ZKAA 4F4LA 2J3IA 3ONDA 4G0WA 2DPXA 1D2MA 4GKVA 1HE2A 3RB8A 3HDTA 4FIDA 3F98A 5EMKA 4HX9A 2J5QA 3QFRA 3RC9A 3ZHSA 4WAUA 3P2IA 3JARB 4JTAB 3CSXA 1N36B 2E7ZA 2D3OW 1ZICA 4P0TA 3U19A 4YP5A 3EGDB 1M1NB 2NU9B 1MJFA 4H6XA 2IEGA 2ZJ0A 2W6JD 4RNDB 4XCXA 2ZFUA 3ZN2A 6YASA 2BBTA 3T7AA 3LC7O 4AJ4A 4QGHA 5IZ4A 1OI3A 4H15A 4INZA 4ZVTA 1Q7RA 3KDAA 3FRIA 5EC8A 1AD2A 1VYUA 2WYHA 2LRHA 1PR1A 2C9MA 4PFKA 1AIPA 2IOFA 4TLBA 1GO1A 3Q9SA 5E7QA 4EY5A 5LZ2A 3AUSA 3U4QA 1GLVA 1QRSA 2Z5UA 4JKYA 2I87A 4AY3A 2WLSA 4L3VA 2XVAA 4B3DA 1JMYA 2XAFA 2P9TA 5TF0A 3R40A 3VMFB 1FLNA 1HT2E 3IDFA 3SBXA 2BFNA 2JK0A 4WNAB 5CFPA 4GH5A 2ID8A 3HGTA 2BLNA 4B3RB 4XQGA 4FZRA 1JALA 1DAIA 2RHMA 3MJDA 4L7VA 1UKCA 5HUHA 2QKYA 4GKKO 2JJ2G 1AG9A 1U98A 1VQ4V 3L02A 4U4AA 1EFPA 3F67A 1MV5A 1Y7HA 3B9PA 3PQEA 1V1MA 2WUFA 1UBCA 3QYAA 3HU2A 3Q8WA 4U9HS 1GQQA 3Q8LA 2WU4A 1YBAA 3DTVA 4E1VA 1PNMA 3H6HA 3OA0A 1EWTA 3PSHA 4BZQA 1C0KA 3IP3A 2OO5C 5HHTA 1YE5A 3NC4A 1VQLF 2OG2A 2IK8A 4GGPA 1O94C 2G09A 5JQWA 4TQDA 4BV2A 2QRPA 5LOVB 1NVKA 3KOMA 3BIXA 3KQMA 3OBWA 1JSXA 4JBXA 1OHHG 1BS9A 1I51A 4C4RA 3GNLA 2RGNC 4MO9A 2EWCA 2DLCX 1ZD8A 3KDSE 4KWTA 1JJBA 3VVBA 4CU2A 3KHSA 5LA6A 1CS4C 4J1NA 1PIWA 1E1RG 1JYFA 1PK7A 4BKUA 4TMFA 4IMJB 4ZZ2A 1HDZA 3O7MA 4V0OA 2Q4BA 4JNKA 2PDAA 2B8WA 2ATIA 3PUYA 2ZYIA 2P67A 3TBHA 3DXFA 4O2BB 2COUA 2V6IA 3DFZA 2X13A 3F6YA 1V2GA 3GJ5A 4JD5A 4JAVC 3O7WA 5B3SB 3RW9A 1MBZA 1GUFA 5EUCA 2WA2A 3U5ZB 2ZRMA 3R4CA 2C8LA 5FWAA 3DFMA 1RAFA 3GJQA 2XMSA 1M75A 3PNSA 1U3TA 3AETA 4N40A 2JNWA 4B3GA 4RIGA 1U11A 1BHSA 3WWEA 1MJHA 4UNNA 4L22A 5IH7A 2V9ZA 3VJLA 4MT8A 3BXEA 4PLHA 1BW9A 2NUBA 2VYCA 1CRLA 3P9KA 1D6JA 1T5OA 2V59A 1OI4A 4C14A 2VF4X 3FPHA 3ZQ6A 3BVPA 1YZUA 1SELA 5JJEB 3G7UA 1U63A 1TM2A 5L3SB 4RK1A 1L5FA 5JJJB 2WZBA 2YIBA 3DMPA 1QHYA 2C4UA 3KXIA 1CLIA 3PVZA 1X0XA 1A9RA 2CXPA 1EH5A 3DL7A 1RE0A 1Z5PA 2GGSA 3SHTA 3IUPA 1T1GA 3IR5A 2BKEA 2Y76A 2QN2A 4I50A 4TTQA 1AXEA 2EX4A 3QMVA 4BNDB 1P0FA 4RY8A 1GGEA 2ZANA 3H2YA 3D3NA 3OW2F 2A1IA 3PEYA 3PC7A 2PUTA 3TKYA 2FFJA 1FUKA 1W0JA 1H0RA 4HLDA 5F4BA 2GO7A 4U1RA 3U3DA 2H51A 4H6VA 2DR2A 4FYMA 4FJ2A 4PCUA 3PPXA 5KTYA 4QVKA 3U9SA 3VX4A 2YUIA 4TLLB 4C3UA 1QE0A 3BG5A 4HQNA 3T06B 4OMDA 1Z26A 3WV4A 3PB3A 3AEUA 3P9CA 1ZL0A 4RDIA 2EG9A 3I2YX 1AX9A 1GV0A 2CB0A 4BE7B 3PD1A 3PL1A 1H2XA 4PV1B 4GC9A 3WWDA 2HO5A 3D7LA 4TRMA 3BA6A 1HEUA 3O9MA 1CUEA 1R3LC 4IHJF 4OHKA 2HFEC 1Z0ZA 1K6EA 1YVUA 2FQ1A 7AT1A 5B1BC 2F6RA 3AY0A 4E33A 5B1YA 2O5EA 4E2FA 2C0PA 1RLTA 4YDQA 4UVEA 4D3XA 3AUUA 4JR2A 4BWAA 4BP8A 2EX0A 4A6DA 2XAQA 4AKTA 3BHNA 3ER9A 4ND5A 4MKXA 4PBRA 5DBEX 2QN1A 4P3YA 2Y99A 1WVGA 2WMOB 5AH0A 5ECGC 1PLJA 4C01A 2DFLA 4NRDA 4K87A 2G0AA 3E8HA 3UY4A 3W5HA 4M55A 2XTZA 4LBWA 2QLFA 1SHZA 5IT4A 2YUTA 2G9QA 3QBJA 4BWYA 1IY8A 1EEXB 4YHHB 3TNFA 1HDYA 3TQHA 1I2ZA 1PUXA 3DMYA 4DR4O 3A0RA 1RRKA 3F7YC 4QDKA 3SJBC 5CEFA 3C41J 1NUUA 1NI4B 4CYMA 2VNIA 2BR4A 1R9MA 2Y1EA 4RTMA 4PNPA 4P33A 2GH1A 3NQ41 2IWRA 5DBIA 1V6CA 1JR3A 4BBAA 4BW5A 2TYSB 3MTBA 3E83A 3KVVA 4UVIA 5A1TA 3WWOA 1G1AA 2E0IA 4RZ3A 4DYHA 1J2TA 3OQOA 1XDGA 3R0PA 4P83A 4Z8YA 4QKQA 2JEXA 3SMVA 1EFPB 5FI0B 3EUEA 3CNOA 1V35A 4NVRA 1V1MB 2PXHA 4WKGA 1G21E 1M2FA 5LQKA 3C4JA 1F1BA 3TQIA 1H9BA 2FSVC 3WJAA 1NJ8A 1RCUA 1KQSF 3DTVB 4F12A 2HIHA 5HF5A 1ZLXA 1JPXA 2OGZA 3C1AA 4NBWA 4QIWF 4ZMSA 4RV5A 2FU5C 1JIVA 3SQWA 4V1CB 1Y89A 2P2YA 3M2PA 4K7JA 4LKOA 3DWFA 1U3WA 2ZTVA 3I1IA 4GE0A 3ZO8A 1SOVA 1DFGA 1TA4A 3ZCRA 3H8SA 3F49S 2A3QA 1Q81H 1VQLV 2A9JA 3CUVA 4M8KA 1S76D 4RV4A 1K2VN 4E32A 5JT1A 4B35A 1AQLA 4QDOA 3WLPA 3VJMA 4CN9A 3EGOA 1P8JA 5LA6B 1WZIA 4XVHA 4CLEA 2OT3B 3R3HA 2FH5B 4S1WA 4FKMA 3UF0A 5K1XA 5CDUA 2CK3D 3D3EA 1GKFA 3ICEA 4M9SA 3RKRA 4RMHA 3FNIA 2ETNA 4MMXB 4F3CA 3HZRA 2PZ8A 1DFIA 1VJDA 2CD7A 3NORA 5BMOA 2DHDA 4FIPC 1N6LA 1NQXA 1ENPA 4M4SA 5EXDA 2A5FA 4KQ1A 1TD9A 5AVRA 3DDHA 5AP9A 1IM2A 5B1OA 3V4VB 1Q91A 3AUJB 4CG0A 2ZJFA 5K0EA 2RSLA 3T4PA 3Q2IA 2P68A 4RE5A 2KM1A 4NU6A 1QU3A 1EFVB 3O8NA 2PX3A 3DKPA 3CR8A 1BW9B 4IJWA 2OO5A 1SVKA 1I3OA 2XF2A 1B2LA 1R4NA 4FGSA 2NU6A 3AI7A 2I9KA 5ECWA 3BH6A 3H16A 2QTBA 1IMJA 1IZ9A 5ECDA 4YUWA 1TF2A 3H83A 4RHXA 3GYBA 4LRSB 1BA2A 2B25A 2FRVA 2OBLA 4L4XA 4TXLA 2VSYA 1RLJA 2ANCA 1RKBA 2RGNA 1XYGA 4Q39A 1DUSA 3GRYA 1MN6A 4I50B 3OE7A 4YASA 4JT2A 4HCJA 4OP2A 3N2ZB 2NPFA 1N2EA 2HIMA 4I19A 1NI3A 5F7XA 5KNBH 2EBFX 4WLUA 3OLCX 1TKRA 2J7KA 3LW8A 1BCSB 1V7ZA 5HXAA 4PRKA 2IYPA 4NBVA 2I1VB 3PUXA 2JLRA 3IOYA 5FA5A 1XI1A 3DCYA 2QLJA 3AL2A 4O4JF 1RJGA 1KETA 1XCGB 2H1HA 3U0VA 3MCAB 5IM5A 3TB6A 2OG1A 4JAVA 3DT6A 5KZMB 4DUGA 1HTBA 2AG6A 4Z0PA 1ZJ5A 5DBOA 4DYDA 2XYGA 3ZW9A 2PGDA 3DF7A 3E7PA 4L15A 1JJAA 1IBMO 3WK9A 3AF0A 3HWWA 1QFSA 2JCYA 4NTZA 4DXAA 3AEUB 1MO3A 3T35A 5HKAA 1D09A 1VHDA 3ADKA 2XSZA 4IV5A 5CT4A 3RQIA 2XQVA 1ZXBA 4P30A 3PF8A 2OP0A 3SBDA 1MJGM 1W41A 1JU3A 1U0EA 3GVIA 3OEHA 1CY2A 5DXFA 3L8MA 3LM8A 2Y66A 2DHCA 1GN4A 2PL3A 3V6LA 4BX3A 1HX7A 1MJNA 5HILA 4K6MA 5JC1A 1BMFA 1IV2A 1CG6A 5TARA 4PQGA 3MOSA 3Q8KA 4B3CA 4HAWA 1L6IA 1I08A 5J9FA 4UNPA 1KRHA 1VP7A 1SCKA 1DC3A 1LDEA 1K7FB 3AIIA 1T5SA 1YJ9V 4YFYA 5EQFA 2AI1A 2J0EA 3IP7A 3G85A 3TM5A 4BP3A 4WVFA 4XAQA 1XTTA 3TG8A 3EHEA 2LKCA 1KYTA 1OB2A 3WYEA 3ELUA 2ZI5A 1T9ZA 1U04A 2EDAA 1VRWA 5LMZA 5HWEA 3HS3A 3HZZA 1TCVA 5KAIZ 3DEIA 2IHKA 3OQIA 4RXMA 3FSJX 1FUEA 2EZ8A 4MVYA 3KUUA 5DASA 2AF4C 2ZJZA 3G0CA 4LF8O 3A0RB 3KQUA 4U2BA 3H9UA 2VH5R 3CA8A 1EE9A 4FBLA 1GZSA 3RRJA 6REQA 2JFQA 1U8AA 1KBZA 3L49A 1NXQA 4Q4JA 3QA9A 4OVKA 2VK8A 2HNAA 2LCFA 3BGOS 5KYUA 1NYLA 2C96A 1SGWA 2JLWA 2CYBA 1H4VB 1EGAA 4YRPA 3ZYZA 1GA6A 2OM6A 1OFUA 3CF4G 4GYYA 1K5HA 3U13A 1KQ3A 4R83A 2E4AA 1JTVA 5FWYA 1DINA 1WXHA 4R7CA 5DHTA 4ZU1X 5FTJA 2QTCA 4EPVA 2XGJA 2OFPA 3M6XA 2J3JA 4GWKA 4D3SA 1IB0A 4RD3A 4Z7JA 4IINA 1PS8A 3H1EA 4YACA 5AK0A 3ENNA 3UWDA 1CUXA 4H31A 2GN8A 4ZYWA 1V9LA 4HAMA 3FWNA 4FGKA 3SF0A 2HRBA 1AZLA 1Z17A 3SHOA 1P5ZB 1QIMA 2HPHA 1XUQA 5FPOA 5DT9A 1R6XA 3D7KA 4H44B 4MV0A 1TUEA 3MIIA 3QFHA 3B48A 3NIFB 3WSVA 4UFNA 4JJ4A 4EA7A 4MVJM 2UZAA 5DX1A 2VATA 1PEKE 4UV8A 1AGNA 2H0RA 2QN9A 3SP1A 1ISFA 4JTCB 2JGAA 2ZUCA 4ER3A 2DBRA 3KWJA 4EG1A 1LDGA 3GWKC 1WUJS 1CS0B 2H1SA 3ZRWA 3RT3C 1OFUX 3SX0A 4A03A 4DV5O 1EN6A 3KAPA 2FX3A 2QWXA 1KAHA 2JI7A 3V7EA 3WLJA 5IVHA 4ARSA 2DYKA 3F8SA 3UUWA 1N0UA 2HCTA 3TZHA 4KRXA 3Q9NA 1OFGA 2YH2A 1JYEA 2PS9A 3BL5A 1Q1NA 3WB1A 1R4NB 1DE0A 2NU6B 1GR0A 3M6WA 2RGYA 3AG3B 3PE6A 1DCMA 3Q0IA 2FZCA 4MVCA 2Q5JA 5B6JA 3UJNA 1W4ZA 3F7TA 4NK4A 3I72A 3DVSX 1XFDA 3T5CA 4I5SA 4DG8A 2OCKA 4FN5A 1KH1A 3B3QA 1OSNA 1M73E 4R05A 5DE3A 3OIUA 5EJIA 1X7PA 1IJEA 3FGNA 4X6UA 2GJ8A 4URWR 2XLCA 1QGOA 2GA9A 2PUJA 3LGXA 2ORED 1GSOA 2RC6A 2JHFA 4INJA 1Z45A 3HTXA 1YL6A 1LBHA 4KGZA 3B7GA 1DGSA 2X8JA 1Q3HA 1WPRA 1H1TA 4LK3A 5JAIA 3CZPA 1VL2A 2QL9A 1RI5A 1U5CA 4CM9D 3ANXA 4M38A 5D7NA 1ISRA 4GI1A 4F21A 1J20A 1HKUA 1QKKA 4K2AA 1BGYH 3T94A 4G5QA 4P3NA 3P19A 3QPCA 4EARA 4BEBA 5A71A 4MKGA 3REQA 4D92A 5C37A 4LJ4A 1NUAA 2G72A 4NNPA 3AY7A 3AR3A 4OHPA 4ZT4A 3R3UA 3D59A 4PD4F 3W04A 1DCTA 4PA9A 3K1ZA 2X9QA 2HNKA 2EQ5A 3LCMA 2WD9A 4ZV7A 1E64A 1UDBA 2QL7A 5IHPA 2JLBA 2PNFA 2YW2A 3D4PA 1ZC3A 4KUEA 1BN7A 3DV9A 4PAQA 3L01A 1E69A 4S24A 2NG1A 1GFIA 4ZHWA 2I7CA 4XVCA 2H2DA 5FNZA 1PAUA 3B5EA 1OMOA 4KLRA 4OXRA 2O2YA 3I6ZA 4RHFA 5AXAA 5F33A 2IP4A 4TPKA 1OD6A 4CIBA 1ZM9A 1JAIA 1PPJH 2PGAA 4HMQA 4DIBA 5DBFA 2HMTA 3F5FA 4Q00A 3ABSB 4E15A 1R7RA 2WTUA 4AMYA 1HKHA 2JAUA 2ZUVA 4EITA 3P5SA 3ZGYA 4P3XA 5SY9A 4RKFA 4MJLA 2JC3A 1V9PA 1KO8A 4IO0A 3JPYA 4ZZ0A 2FEPA 1W3EX 1K33A 1F2TB 3C8ZA 1Z4MA 5IT9M 3WL8A 2QDXA 1G8GA 4WW0A 2P06A 1FP6A 3OLQA 4C4WC 3K05A 4ENUA 3EZGA 5CUQA 1PNOA 1A8SA 2NP7A 4MV4A 3OQIB 2V4MA 4ZOLF 2NXJA 3U4IA 2FJ0A 2GJKA 2X0LA 3H11A 3NWPA 3PDCA 1TZ2A 2IOHA 3IT2A 4NZMA 2FW7A 6REQB 2RJZA 2XUIA 4Q4JB 1VBNA 3R9XB 3Q3CA 4A15A 3RM3A 4ZQEA 5BSRA 3N87A 4PVDA 2P9CA 5B1BB 1TI7A 4RUEA 5KYUB 4CR7A 3KPWA 3M5PA 5DTIA 3KG2A 3REGA 2AHZA 3PQ5A 3K2QA 3GJ0A 4NG4A 4DYLA 4P98A 5THXA 1K4CC 5FWYB 4DV3O 1DLIA 4LFBO 4JU9A 4RA9A 3RREA 3WAJA 1JEYA 4Q24A 1LC3A 3NV7A 3TLMA 1CZHA 4JJKA 4HG2A 1Y1LA 1WLYA 3GG2A 1YR3A 3E70C 3O1JC 3W3AH 3TUZC 3U3JA 2GPWA 4OJNA 2H0AA 2MDTA 5DHQA 4QFBA 4DM7A 1V96A 2C88A 2FC3A 2XQJA 1FNJA 4J91A 4L07A 3LDTA 5LGNA 2Q5ZA 2WJIA 4UW9A 3C8HA 3RYCA 4Y7DA 1QAMA 2WNSA 2R60A 2GJ4A 2B4YA 5FH9A 3Q3EA 1XQVA 1MDFA 3HM9A 2HG5C 3VQWA 2NMUA 1E1MA 3TAUA 4DNOA 3NMUF 1TUEB 1FCJA 2GB4A 4OI0A 4OATA 1HXHA 4JJZA 4I4CA 2PYDA 4QC2A 3MT8A 3Q6NA 1L7BA 3HSYA 2Q6OA 1O94D 3LW7A 4KQCA 3EGCA 5I7AA 3ZRWB 4Z7QB 4PQYA 5BQXA 3K1TA 2W0XA 3FGZA 2BHLA 2W6CX 4JZKA 4IZOA 1TFRA 5LQAA 5CD1A 2W6IG 1XIVA 3HVRA 3T0GA 4NU0A 1ZD2P 1WOYA 2D5IA 3B40A 3UANA 3ONNA 3D7NA 2P7IA 3RU9A 3CX7A 3EGVA 3NUGA 5CB0A 5LVAA 3W7UA 1GTL1 3D4NA 3SXJA 4FYHA 4Q7JB 4XGRA 4YP7A 1XRMA 2HKOA 1JLSA 3AOGA 5DGIA 5KNLA 4ZRMA 3FMGA 5NLLA 3V2GA 4LZPA 4MHSA 3NBMA 3TCKA 2OV2A 4R69A 2RGAA 4YRAA 2ZJAA 1XP5A 2BUAA 1KBQA 4DTIA 2XUAA 2J0QA 4G4XA 2HMYB 4G56A 3WOHA 5AVOA 4QLOA 3GFSA 2X8JB 4ENQA 3KNZA 3MHHC 4PLPA 1OOEA 4DLKA 3H18A 1RTTA 4EA9A 1PQPA 4P5EA 1MZVA 5DVZA 1DC8A 4U6NA 3S28A 2AG5A 3WLIA 3AUFA 4KG7A 4IOLA 1FJGO 1F3OA 1JDTA 4XWKA 4JBLA 2PTMA 3T3HA 3TQCA 3REQB 1QR9A 3ZZUA 3NIGB 5JLAA 1IQUA 2O8BA 2CXQA 5K1ZA 3HL0A 1IN6A 3H1FA 1FFBA 2POCA 4DV2O 4ANFA 3HKDA 4NAVA 1Y8AA 4D0GA 3L06A 1GUZA 3H5VA 2CJYA 3M70A 2WLTA 3RJMA 1CHDA 4I3HA 2FW8A 1P84F 1S2LA 2FSGA 4EMTA 1DKOA 1V1JA 4Q7MB 4ZV9A 2A0YA 3BJIC 2Y1WA 2QGNA 3V7UA 3UOWA 4C0WA 3TF5A 1CUGA 3OPMA 4DIDA 3GGPA 3OE4A 3LRPA 4K9QA 3MJVA 4LHZA 1O77A 4TSFD 1SEPA 1UEJA 1ZH0A 2OQRA 5IBRA 3AF6A 2C8JA 2PZJA 3BMNA 4BIMA 3W9SA 4IT5A 1UKEA 5FPSA 2FGJA 4XRRA 4AY2A 2PSDA 3WIUA 3SS8A 3RFTA 3TXSA 4C4SA 2R97A 2IYRA 1CR1A 3PZBA 5BV8A 2QS9A 4F6RA 2ZOSA 1E5QA 1GZDA 2WHPA 1ECLA 2QR3A 2C5EA 3KTFA 1I01A 5H9CA 4WN9A 4OKNA 1BHQ1 4XIFA 2YJ4A 4BT3A 1L5NA 3DMFA 1X8XA 1KJWA 3R7BA 2XNSA 4X1KB 2Q3DA 4Y1GA 3WL7A 3WDMA 3H11B 1IEXA 1VCIA 3X1WA 4PE5B 2WJJA 1GAXA 3BZUA 1EUCA 1BZKA 1Z6YA 1N4AA 3BVOA 3W2FA 1KQGA 3QY0A 1VPLA 1KP2A 1NG9A 4C30A 2GDZA 3BFJA 2HLDA 4FE7A 3ELBA 4PPYA 2B34A 2FUKA 1G5RA 1OXKB 5AKXA 5ALEA 4EFLA 3GQVA 1E1DA 1TM1E 2YQZA 3H42B 4UMDA 2MJLA 3C1TA 3O4JA 1ZN7A 3URMA 1S3IA 1XEWY 3VVMA 2BGUA 5DDIP 1UC9A 4RA9B 1I32A 4J0HA 2BH9A 4D8VA 3W34A 4OI2A 2FPIA 5F3WB 3T1QA 4WZAA 3NOXA 4IUCS 2JAQA 4D4LA 3HWSA 5FOUA 1M5IA 2EBOA 3C6ZA 4HNUA 1DNPA 4OK6A 3QRWA 1SOAA 2PZKA 2OHWA 1Y1PA 4IXTA 4CKWA 2YDYA 2PZEA 2CV0A 5JCOC 3ZCVA 1XA4A 5LWQA 2HU8A 3LWBA 3KLPX 2QRUA 2LUOA 5EHXA 4KLNA 1E92A 4QUAA 2DPHA 3U4CA 3OE5A 1VXOA 3ON1A 5BVHA 5JPDA 4N6OA 4H16A 4WASA 1JQLB 2RH4A 1X19A 3B2QA 2EEPA 4GLXA 2WFMA 4FCVA 1KJ9A 1D0SA 3MNFA 5KYKA 4LR3A 2BMEA 4JGBA 5CNIA 2AN3A 3OONA 2C2HA 4UOEA 2QZJA 3QEOA 2JFZA 2ZIUB 4EBFA 3MTAA 5DYTA 5BRAA 1NLFA 4FMTA 4H6WA 3O4HA 2EOAA 1GU1A 1C2YA 3H7IA 2FMUA 1NW7A 3DHNA 4QT0A 2A86A 1A88A 5M5BA 2C3MA 3ZKWA 4F11A 2BZ0A 4HXYA 3TYXA 3LZCA 5ED0A 3RS3A 2G04A 1Q1EA 5LIRA 3DBIA 4J0JA 5HIMA 2D7CA 1Z18A 1E6CA 4NR0A 3UOAB 2YY5A 3DTYA 1R8SA 2FZEA 2BP7B 2ZJ7A 3AVOA 3LGSA 2IH5A 3SJAC 5AKKA 3Q11A 1CEEA 4HUQA 2HA4A 1JRLA 2YKGA 2IU4A 4Z9AA 1U2TA 2LTAA 5E4YA 4R31A 4IDFA 2IYWA 2PMEA 5AHWA 4YAOA 2ZAGA 1W75A 3AG7A 1JQ0A 5EB0A 3TRHA 4DJFC 4NK5A 3SC4A 3BDIA 1DHTA 2RNBA 3CISA 1P4JA 5IT9N 3RU2A 2P2SA 1G38A 3GCWA 4B33A 2F3TA 4K8RB 2HBZA 1XL6A 2G38A 2A5YB 2F8MA 1FSPA 5ANRB 4PZCA 5HA5A 2FZKA 1HYBA 3DOUA 3BC1A 2JCBA 2O8BB 3TLZA 4S05A 3ZD8A 2ZE8A 3E9DA 3E84A 4URZR 4AJ1A 2WJHA 2UXXA 3HKDB 3R7FA 4EH1A 4CCWA 3DMDA 4KR6A 1UAGA 3H1LH 2OBMA 1E1QD 5GJWC 3IT3A 2RBEA 5DM60 3WR5A 2B92A 3PHIA 1VG0B 4L4RA 5GQSA 2VZ9A 1HDIA 2RH9B 1D2EA 1USGA 1MNGA 3IODA 1Z25A 1XDSA 4JI0B 3K5OA 3QG5A 4PA4A 4DEYA 3KEGA 1XX6A 1BN6A 4JV5B 1YZTA 3DV2A 1RKXA 1XLVA 2JAWA 1C7FA 1KI3A 2W6OA 1R1DA 3ESYA 4Z0TA 1E6LA 4ZQIA 1X1SA 3PCXA 1N8TA 3DVLA 4LZJA 2JI4A 2FN4A 1O6CA 4BB6A 5JBNA 1Z5VA 3V4ZA 1NMZA 1DBWA 2REXB 1PD0A 3WMFA 3RC1A 3WK5A 3GUUA 4F6RB 3F6MA 5EVCA 1WKVA 3ZRXA 5D85A 1C1YA 4WHMA 1GAEO 3ZIDA 2PF4E 5E2BA 1JB9A 1WUTA 4OAOA 1B7GO 3BK2A 3BHJA 2HX0A 4RU1A 2NM0A 1PLLA 1U97A 2PS1A 2WIDA 4KHPO 4ERHA 3QWFA 9LDTA 2QMQA 4PO8A 5B37A 3ZJVA 4QSMA 1S5PA 1ISMA 3WGUA 2WYOA 4RDCA 2WD7A 1U65A 4OK3A 1CB0A 3K3PA 2VQEO 2JFHA 4RX1A 1L5VA 2INGX 2V5UA 2AEMA 4AAYA 2FVYA 1N57A 1PDWA 1WPGA 3MBKA 3ZE9A 1GPJA 2ODAA 5F12A 5BR8O 2Y6UA 4CBCA 4DWOA 1CUDA 1YOVA 3AERB 2FF5A 4UUNA 3OR7C 2ZRFA 1H2EA 3FE2A 4ZJYA 3GFQA 5GAPK 2LP4Y 4ZYZA 4RF5A 1JD1A 2B8EA 1UP6A 1ZN9A 3OAAD 4CTNA 3OEEA 4BVHA 2IRWA 3RVQA 3FYDA 2FPIB 1V5FA 3SJCA 2WF9A 1GVNB 1MXFA 2AOVA 1NZDA 5ADVA 2YHBA 4FQ7A 4WZAB 5LL6Y 5BYKA 1P17A 2QSYA 2KKWA 3A3OA 2ZZNA 2LFRA 3ZJ5A 3DOEA 2CNDA 2BBOA 4K3VA 3T4ZA 4UCQA 2P8JA 1KD1H 2PUFA 3BM5A 3FSGA 4IX1A 1C7IA 3A6GA 1OPRA 1SXJD 2R48A 1KI2A 4CKWB 4P4UA 5H82A 4R71A 1GKUB 3IB6A 1KXJA 3KKYA 1QGED 1EFRA 2I66A 1OASA 2NXNA 3HU1A 1U9JA 3MERA 5BVHB 3NTXA 4XARA 1I0LA 5SYNA 4LZOA 4X8OA 4ZT5A 3AUYA 4ZO7A 2FY8A 2QRVB 4RTSA 2QUZA 4DCVA 1K2WA 5DH9A 3LDFA 3QXHA 2WF5A 1FA9A 4HNAA 3DC7A 4FLWA 3DGEC 4J1TC 5FEMA 1PWYE 4RKYA 3FUUA 1N7JA 1K8AH 3R5XA 4ARBA 2AVNA 4F7WA 2P11A 4QECA 2WJ3A 4I9FA 4CT0A 4X44A 3KVRA 4A4DA 2O54A 2IITA 1B6TA 3OJLA 1JSRA 5DWDA 1EUQA 5TY0A 1ZGJA 3UH1A 1A77A 3ZKWB 5A03A 2RE8A 4HGRA 2GZAA 4P4SA 3OKCA 1JILA 5B1EA 1X3SA 1ZPDA 4GU5A 4Q3LA 2DHRA 1G7TA 5D3QA 1WRBA 4UHEA 2MQEA 2W2LD 4W7IA 3ETGA 5FO1A 2D1YA 4XOUA 5DSTA 1IK4A 4D74A 1C0LA 3SYTA 4HUQB 1UMDA 4M7RA 3APQA 1QF7A 1CC1S 1Q82H 2A1TS 4LWOA 4MS3A 5HZKA 2D1SA 1RMYA 3BTOA 3JTEA 2GK4A 2OCXA 5JQGF 1G19A 3BOSA 3IAM1 3BB3A 1A9ZA 3ZMVA 2XIQA 4WLFA 1AKEA 4CCAA 4NDZA 2PRSA 5KTRA 1UWVA 3L7KA 4X90A 4HTFA 3SPXA 5L7WA 2PRIA 4DZRA 5J2TF 4OG2A 3JZFA 3BICA 3D0OA 3WIBA 4UUAA 3S0WA 3CH6A 2BZSA 1R0ZA 3ELYA 5TT0A 3LYHA 3VR3A 1O1YA 3AVQA 4HOYA 3LIPA 1J24A 3LQRA 3AQIA 4LRUA 2VQFO 2DEUA 2DFPA 3FLBA 4KKVA 1CZUA 3DWEX 2C9CA 3V9PA 1EVEA 3DR5A 4UCOA 2QMZA 3KR2A 3UG6A 2Y0EA 4HDQB 1Z6QA 1CZNA 1Q83A 2PA0A 2ZRHA 3QO5A 4DB4A 4BO8A 1QQBA 2CC2A 3UKJA 2XMZA 1VL1A 5AW4A 3QPDA 2J7PD 1BVHA 1ATZA 5FOXA 1NBEA 2YV4A 1ZLZA 1GKKA 1J2YA 4U8GA 3ZVMA 5F73A 5JD3A 4K28A 3Q9LA 1BE1A 4RESA 4LF7O 4KQ6A 3TD9A 4U7FA 3EH2A 4OHOA 3E22A 4ZDWA 1SBQA 4NOMA 3HVUA 5KS2A 1A1VA 2FSHA 1W5EA 4NTWA 4F2DA 3ENKA 4DWJA 3GLGA 2PK3A 1SZXA 1QP7A 3L6EA 3M4YA 2BLLA 1A27A 4P22A 2WJPA 1LRKA 2X2EA 2P9EA 4Q21A 2JGUA 5I7SA 1XMSA 1C4OA 1G6OA 1WG8A 2I34A 1DTWB 3EFBA 3I5MA 1X9IA 3FIJA 3MCQA 1WMBA 4CEIA 3PQ6A 4KZPA 3DPSA 2FPPA 3L6OO 2C95A 4WA8A 5M29A 1LDBA 2CSLA 4B87A 3UHJA 5KJFA 2IVZA 1FMLA 4PA3A 2RBKA 4PX9A 3BABA 4JB2A 2ISCA 1UJCA 5J58A 5K8IA 1SFRA 2WD7B 1NVFA 4UBKA 2OCGA 4AMVA 1S8OA 2YY6A 4ZVNA 2LIPA 3JCMM 3VZQA 3FD8A 4OB8A 1Y7IA 5A7HA 1E4EA 5BOSA 1PGJA 3IEQA 5KWJA 1W29A 3OQMA 3PF9A 2B7CA 1U90A 2HEGA 5CCDA 3E9NA 3V1MA 1L5OA 1SZPA 3U4DA 1GFWA 1YOVB 1NH2D 3M6VA 2A5LA 2P77A 3ZNOA 3D64A 1TU4A 2HQSC 1TCUA 7YASA 2A0XA 2ZJ4A 2PLWA 5AVJA 4ZCRA 4JNCA 5KVQA 3TDKA 2OHOA 3WL4A 2Q0QA 1UJMA 3OZBA 3HBAA 3SY8A 2R8YA 1JXOA 1XZ8A 1O8CA 1EFHA 4FLMA 2FDCA 3K9QO 2W43A 2W6QA 2YJNA 4YMTA 2XKKA 1U8CB 3WNCA 3IBSA 2J59A 1JL3A 4E88A 4NDNE 1OXUA 4J7CA 4LNAA 4GP6A 4KN9S 3AR6A 3CNBA 4WFKA 5KOYA 2DXIA 3WGLA 3AG3C 3JQAA 5K0TA 4L28A 4ALMA 3QUQA 4RO2A 5HBRA 1NW8A 3CINA 2VF2A 1KY5A 3DT8A 4TT3A 4W99A 1IOZA 1P81A 1G8YA 1NDHA 2VHJA 3E4CA 2XWJI 3QY9A 1SNYA 5ICMA 1MOQA 2WLLA 4UXNA 2X3FA 3G1WA 4HKTA 4ZU6X 4IHJA 5AM2A 5CNKA 2RHRA 5MN4A 2P3LA 4KIGA 1LPSA 3ES9A 5JYDA 1XHFA 2B4AA 2QN8A 2WM2A 3LUCA 4MW9A 5CIWA 5DHRA 5J4YA 3BD9A 5GGXA 3VSEA 2AJTA 5AT1A 4YAUA 1PJTA 2IEYA 3E4DA 1PEDA 5H3HA 4AK9A 1ZX3A 2IJHA 2OCHA 1N4CA 1OCRC 5KHJA 4H3VA 5ALRA 1WP9A 3V1LA 3R7AA 4NB5A 5GGYA 2XDYA 2F48A 5LBIA 2GETA 2ZYAA 1EVIA 4HADA 2ODTX 3FDZA 4FFKA 5K1PA 4JENA 4E94A 1S8FA 1GGNA 3FUCA 1CF4A 1G6HA 3ROEA 5EG5A 3RLIA 4BAUA 4MS3B 3IPLA 4KH0A 1RRCA 5E1MA 1TA9A 5FI3A 3CWQA 1XQ6A 3CUKA 3AZOA 4I0XB 2XY4A 1QZXA 3CHYA 3DGEA 3NIDB 4J1TA 5DNDA 4IKOA 3TFWA 1WY7A 4HTFB 2UUCO 4JROA 2V4UA 1QZZA 3EZ9A 1HLDA 4NS4A 4MI3A 2QQ0A 2HY7A 4TL8A 2FFBA 4UKDA 1XMJA 1RPNA 1K6XA 3MFYA 3U4GA 2OTJV 3QXXA 3QLUA 1FLDA 3F90A 2CNLA 4X3OA 4D9EA 5BN1A 5INTA 5IBCA 2C4HA 5CLIA 3TSAA 1U8FO 2ZKOA 2IW3A 4IDAA 3A2LA 2YNMD 4D7AA 1NJ6A 1GUDA 3WPWA 2PJUA 3KWFA 3VI4B 4H7PA 2W0FC 2BTQA 3L1VA 4II2A 1FW6A 4Q1FA 4FFPA 4ODIA 4PGHA 2Q27A 3LT5A 4DDHA 4MWZA 5E7IA 5T5QA 4DGSA 3KJXA 1Q12A 5KTTA 4M8IA 3E22B 1F48A 1YVRA 1Y3DE 3RIGA 2J9XB 4Y98A 1HETA 1AU9A 1LNZA 1P0PA 3VXKA 2X9GA 3GLGB 3O21A 5AJHA 3JXEA 2DT4A 3TVTA 1CWUA 3MGBA 4DLVA 3GYGA 5AW6A 4B3JA 1UBKS 2Q99A 1EYZA 3L46A 3TSCA 3LQ2A 1A96A 3QVTA 1N1EA 1LSUA 5JAHA 4ZVMA 5EUQB 5KQGA 4CEIB 1AILA 4X1YA 2C77A 5B1IA 2C03A 1BVUA 1ESDA 2FPPB 1YJ9F 2G1JA 3L8GA 1MD9A 2WD8A 4GLJA 3ERCA 1XZLA 3MLEA 3FSEA 2CLLB 2J3HA 4MKRA 1A7AA 1RWPA 2JJ8A 3AHDA 1WU7A 4RHTA 1OWPA 4BP9A 4TTVA 5JJBA 2OCAA 2XE8A 4I1VA 3FPSA 3VJKA 4AKIA 5BOSB 2R7NA 5HS4A 3U4QB 2CE7A 2QIPA 2XTJA 4FOLA 2VDVE 3CRAA 1IATA 5DHUA 3PRJA 3P4EA 3EVEA 4Q20A 4ZK7A 2GEFA 4J75A 2YHSA 5BV0A 4DA6A 1WA8A 1RXIA 4BQOA 1W57A 1G42A 4MWDA 4RVFA 2FX5A 4NENA 1PGQA 2DWPA 4KE8A 2Y8EA 3DE3X 5L3BA 5JNWA 2FWNA 2DE0X 1G5FA 4HMOA 1ETHA 721PA 2EGGA 4AJHA 3B6ZA 5EJGA 5F5LA 1WXWA 2QRJA 1K7XB 3DBHA 4R68A 5JMOA 1YZHA 1IQPA 5FLEX 2PSHA 5JHGB 3ITKA 3QNEA 4BYGA 3ZS8A 1GZ0A 4O4JA 2R4TA 3AW9A 4BXOA 2MYUA 3HLYA 3CVVA 4C7VA 3ZN0A 1SAYA 3R6WA 2HI0A 1WIWA 4XCVA 4F7DA 4FWBA 4YCAA 4OY3A 1LI4A 1ZOPA 4AQYB 4AWAA 4QBIA 4GVLA 1W9HA 1LDYA 4Z4EA 2IDJA 5K2OA 3UM9A 2VPWA 5FPHA 2JJ1G 5DK6A 1DEOA 4KPFC 5B58T 4MINA 3GUCA 1IJBA 5DGDA 4U7TB 1KVQA 3JQAB 3K5LA 3INRA 1MT0A 3RT7A 2NR5A 4RGYA 3NYQA 2CF5A 1P29A 2VYVD 4PXSA 2GQ0A 4R9UC 3NR7A 3EFEA 4QXAA 5ELXA 3RS8A 1WNSA 5IUNC 4KTTE 1JJIA 4CKEA 4P32A 2FG6C 4KC0A 3IV6A 2NVBA 5CLGA 3G2JA 2WLLB 3RCBA 4YR7A 4IHJB 2DQYA 7ADHA 4AYTA 2FPKA 1QYDA 1W47A 3A6LA 4ZVPA 2HQSA 5DXJA 2C4MA 2QYSA 4B3HA 1R8QA 1CCWA 1MFPA 3F8WA 3F1KA 5K5EA 1ORHA 2Q4PA 1M2KA 1NYRA 3N74A 4ZOQI 3UJBA 1PZNA 1RMQA 2O2JA 1GILA 2DJIA 4LV8B 2XEDA 1CUFA 4HSEA 2UVDA 1NUTA 5K0FA 2C31A 3AETB 4YUAA 2R1ZA 4FOOA 5TSDA 4PSVA 4QXPA 1COMA 3FDZB 1JIJA 1NI8A 2NZUG 1NMQA 1SK9A 4F1JA 4FCWA 4XDZA 4M1SA 2UXNA 4ZHQF 1AUOA 3R3YA 2OA0A 4LF4B 1PF5A 5EC1C 2ZZKA 1OU0A 4WQMA 3QU9A 4DJAA 4LOKA 2QL6A 2C9ZA 1PFYA 2GM4A 3NIWA 1ZM3A 4G2NA 1IV3A 2JDID 9LDBA 4KW7A 3CJRA 4N1AA 4BR6A 4JI6B 2HJHA 3IFXA 3LJKA 3VQXA 3ZX4A 4D8UA 3NWOA 2WWXA 4UAUA 3RVMA 4YIOA 4RF2A 3N8GA 3NMUC 1K08A 1PS9A 1GCGA 1Q92A 3GPBA 3H3FA 2PX0A 1KP3A 1XTPA 2RN9A 4J90A 4U7OA 2ORVA 3CNEA 2Z04A 3C7CB 3MD0A 3SLGA 1K3TA 1GFZA 1SOUA 2BKLA 3LF2A 1GOTA 4X93A 1NASA 3EVBA 3HEAA 3H2KA 4L8VA 1AO3A 2RGDA 1HG1A 4TUYF 5BYBA 1E96A 2RHJA 4ED9A 2HYDA 3DXXA 4UHHA 3OLXA 5IXJA 2X6TA 1I3KA 4RGQA 2HVYD 1X3LA 1W30A