1TUBB

Tubulin alpha-beta dimer, electron diffraction
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
427
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the alpha beta tubulin dimer by electron crystallography.
pubmed doi rcsb
molecule tags Microtubules
molecule keywords TUBULIN
total genus 88
structure length 427
sequence length 427
ec nomenclature
pdb deposition date 1997-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1tubB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1tubB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1tubB01
5KMGA 3RYIA 5J2UA 5CA1B 5C8YB 3RYHA 3WGMA 4YJ3B 5LOVB 5MN5A 1TUBB 4WBNB 3RYHB 5EIBD 3WGJA 3E22B 5JVDB 3ZBQA 5M7EA 3VO8A 3JATA 4O2BB 3E22A 3C8LA 4LNUB 1Z5WA 3N2GB 5LA6A 5LOVA 3JAKA 5JQGA 3JALB 4O2AA 5ITZA 1FSZA 3M89A 4ZI7A 2VXYA 1FFXB 5JQGB 1SA0A 5CB4A 4FFBB 3HKDA 4U3JB 4ZI7B 5MN6A 4EI8A 4IIJB 5J2TB 2VAWA 3RYFA 3M8KA 3JAKB 1W59A 4I50B 4X20A 4XCQA 2Q1YA 3R4VA 1SA0B 4YJ3A 5CB4B 1FFXA 3JASA 3N2KB 5LXTB 5KX5B 5IYZB 5KMGB 4M8IA 5J2TA 1RQ7A 3JASB 3HKEA 3HKBB 5LXTA 1W5BA 3HKCA 3WGNA 4X1KA 2VAMA 4X20B 5CA0A 2BTQA 3WGKA 4X1IA 5LYJA 4O4LB 5JVDA 5IJ0A 4O4HA 5JCOA 3JALA 4KWEA 2RHHA 2BTQB 3JARB 3CB2A 4ZHQB 4X1YB 3ZIDA 3HKBA 4TUYB 5LP6B 1RQ2A 3JARA 5CA0B 5ITZB 4IIJA 4U39A 4TUYA 4O4LA 5LP6A 5LYJB 4O4JB 4YJ2B 5IJ9B 5JH7A 1W5AA 5BMVB 3HKDB 1TUBA 5EIBC 5EYPB 2R6R1 4I55B 2RHOA 4TV8A 5IYZA 4IHJA 5KX5A 4EB6B 4I55A 3WGLA 3JAWA 3VO9A 3HKEB 4O4IB 4IHJB 5BMVA 1Z5VA 2R751 3UT5B 4DXDA 2XKAA 5MN4A 5J2UB 3RYIB 4X1IB 4HNAB 5FNVB 1W5FA 4I4TB 3VOAA 3RYCB 4FFBA 4X1KB 1W581 2RHLA 3HKCB 4DRXB 4EB6A 5CA1A 3VOBA 3VPAA 4O4HB 4O4IA 4DRXA 2Q1XA 1TVKA 4TV9A 5GONA 4LNUA 3UT5A 4ZOLA 5EZYB 4F6RA 4EI9A 4ZHQA 4EI7A 3N2GA 5LA6B 1OFUA 4I4TA 2GVIA 5LP6C 4B45A 4TV9B 4O2AB 4O2BA 3N2KA 3ZBPA 5EYPA 4TV8B 1JFFA 3RB8A 5JH7B 4O4JA 5IJ9A 4YJ2A 1TVKB 5GONB 4F6RB 3V3TA 4B46A 1JFFB 5JCOC 4ZOLB 5EZYA 2XKBA 3RYFB 1W5EA 5IJ0B 4I50A 2VAPA 4WBNA 4U3JA 2BTOA 3JAWB 4HNAA 5FNVA 4X1YA 4E6EA 5C8YA 3RYCA 3JATB 1RLUA 2RHJA
chains in the Genus database with same CATH superfamily
2QPAA 3SLRA 5BO5A 2H7VA 2H92A 2ORYA 1TXGA 421PA 2GEBA 3PI6A 3DMNA 4ESVA 2LGJA 2HQBA 3OMNB 1U28C 4GE0A 4JJ7A 5DISB 4LJ4A 1JE0A 5EBWC 3HEBA 2OO7A 2EZUA 4RV5A 2SECE 2X9GA 5FT9A 1F51A 3SIUA 1ZOOA 2ZVJA 3IE0A 1QGYA 1VZ3A 4JLUA 3WGGA 2F67A 3GEEA 1NVWQ 4TLMB 3S8YA 4DXWA 4RGQA 4C08A 1ZN8A 2C5GA 3OY2A 4UTZA 1OH7A 5HJ5A 2XQJA 4WDRA 2RGXA 2W71A 3M89A 4WERA 4WX2B 3V9PA 4TKZA 5IJAA 2W2KB 4ZC8A 1GNRA 4XH9B 2WDZA 3ZQJA 4PSVA 3KEOA 1FNDA 2C9DA 4JJ4A 1YTUA 1FE8A 3EZXA 5IYDO 3RVZA 1S8FA 4RX1A 1KOLA 4DSUA 1KA9H 5JNUA 1UAAA 3NHSA 4KQWA 3X0DA 5D85A 3ZX4A 3V1TC 4RD3A 2BMDA 2CE2X 2GV9A 3FVTA 4LI3X 1MHPA 1SOAA 1GEGA 4A9AA 1KEKA 3QE0A 4IXWA 2BKVA 1GZDA 4LXTA 4NYJQ 3RRFA 3WYFA 4HBGA 1UFKA 1PN3A 1SIBE 2O4CA 2PH1A 3TNJA 4D4KA 3SDBA 3GFGA 1ISMA 1FDOA 1FZQA 1R4MA 4W9NC 2P3SA 4IZOA 3E48A 4IL6Z 4TKLA 1WMSA 3KELA 2OCBA 3JALA 3Q3IA 1UADA 3PFHA 4RF5A 2JBAA 2BLLA 3B6EA 3NOVA 5I01A 3B2EE 5GIPE 2YIBD 1PNOA 1QQBA 3QNEA 3I04M 2CLDX 4B6RA 5HOEA 1H6BA 1RQ2A 3VYSC 1ODTC 4XAQA 1NLMA 3Q7RA 5J59A 3WIVA 2HEGA 2BGJA 2QG6A 1CJKC 4PAMA 3MJRA 1B2RA 4UHEA 4D0GA 1KHHA 3EGDB 1CUXA 5EE0A 2UXBO 1BVYF 1W4AA 4QGBA 4J9ZB 4EZEA 4MRVA 1KBZA 1ONPA 4YMWA 1A4IA 2CLOB 2H2IA 4JI3O 3X2EA 5HWSA 2QP9X 4RTRA 3X2SA 2WJ4A 4EFMA 3B6KA 4PPQA 1JYFA 2C4TA 3GNLA 4TSRA 1X9IA 1A7KA 3KZ1E 4IDBA 4YXWD 4CR6A 3T3NA 1J07A 3JQPA 1DV1A 2J9RA 1CT9A 3AFIA 4K8XA 1Y3DE 2UYNB 4ZZ0A 5CB6A 2VHTA 4MVJA 2VDOB 3H9CA 3UJPA 1TT5A 2PVPA 4HF7A 2OAQ1 3GUUA 4Q05A 1E0KA 3EGXA 1EZJA 3FUTA 3TTWA 1NMXA 1B0AA 3B7GA 1NQTA 3G9TA 3P0FA 2IH1C 2B4KA 3DOIA 1ZJ5A 3ET4A 2J3LA 5EO3A 5AVKA 4TL6A 4DC9A 1FDVA 5C7LO 5I7OA 1WEHA 2W2MA 1P2BA 3LAWA 4JUCA 4TT3G 4OI1A 4TKMA 1U2GA 1F4NA 5JD5A 4C0SA 1WCYA 4IG4A 4DG8A 1XXHE 4XGIA 4LH6A 4YMSA 4WADA 1QIEA 2FXIA 3GU3A 3L8YA 4WIAA 1ZGZA 3RNOA 2YXLA 2WHQA 3IR7A 2J67A 2BEUA 3UB4A 5FLXA 5G4LA 1XTVA 2ZI4A 3QVKA 5BRNA 3UWDA 1SZQA 2YNMD 3HCFA 2YOFA 2VXCA 2NNUA 1LPMA 3FY4A 4KI7A 5E0OA 3V7NA 3MJTA 4IXTA 4NWOB 1LWOA 1S4QA 4MW4A 1FDSA 4GPTA 1NW4A 1OROA 4DV7B 1WEKA 1AHHA 2AUMA 1V39A 2FLWA 3GJ4A 5L3VA 5H80A 2G83A 3T5AA 3FOZA 3UPUA 4HY3A 3O93A 3R0QA 3LT0A 3I72A 1FU4A 3WY9A 2IW3A 1XQ9A 2A0LA 2H8EA 1H3FA 3CSXA 2PY5A 1WE2A 3DZCA 3UFBA 1JDPA 1RKBA 3CKLA 1SEPA 4N23A 1KYOF 5JJEB 3I01A 5E6UA 3W9BA 2GCGA 2WQ7A 4A8TA 1LF5A 5SV2A 1QMGA 1KD1H 3FYTA 2L42A 4QEZA 4DCPA 2O05A 2HDNB 5JSUA 1SR8A 4KREA 2BD0A 4OAPA 3Q12A 4UJ3A 3IE1A 3K2QA 4KP4A 1K0FA 4GI5A 4U7GA 1NQXA 1KFEB 4M54A 4OL0A 1O5TA 1K89A 1J0EA 3M84A 1SCBA 1DIAA 3C8LA 4HQNA 5EIHA 1E2EA 1T8WA 2RAVA 4PGAA 2YIBA 3CT6A 1XKQA 2WYVA 2EIMB 4WFBV 5GOTA 1XI2A 4ATNA 1FTWA 4AP5A 3ZN2A 2ZRGA 5BNZA 3W9UA 4Y2RA 1NM5A 4MV7A 3H4IA 3EVGA 4TMVA 1SPBS 3WGVA 1CRLA 2QNBA 2ZUSA 4N21A 1U2ZA 2Q2NA 5DCUA 2GPYA 4ME6A 3CCLV 1GT91 4WI1A 1QE0A 3FRHA 5FFNA 2CYBA 4ZI7B 2PM8A 3K9GA 5K8CA 1FYWA 1XDWA 1YJQA 3AR7A 4B80A 4EHFA 4S04A 4Q48A 2Y0BA 1U6KA 2QENA 3IO5A 2QRQA 3W04A 5LGNA 4E2FA 2YJZA 4FYXA 4D9NA 1IY9A 4TLCA 2IW5A 3SAJA 1H93A 3B2QA 3INNA 2W4IA 4L9AA 4LZOA 1C3JA 3OHPA 1OKKA 4RDHA 3SVLA 1XZ8A 1ID1A 1X1RA 2HSDA 2Z4RA 5BV7A 1SCUB 2OHHA 4J7CA 2PUEA 3OT5A 3O0DA 4AMVA 2H9YA 2YZ2A 3B3FA 3EY4A 2PMCA 3MTAA 5B1EA 1C4OA 5JJ5A 4F85A 1APBA 1XEQA 2II6A 3Q1LA 5SYMA 2X23A 2ZUUA 4LXQA 3H2HA 4KWEA 1ONBA 2MYNA 3LKZA 4OG2A 2EIMC 3CIFA 3HWUA 2FB5A 4ASUG 2GM9A 3N59A 4LFAB 3VR5A 3O9MA 2HA6A 3WGZA 1YQUA 3MHHC 5FULA 4UFOA 3OQVA 4EBBA 4EX7A 1Z75A 2FSPA 3FNFA 5HM6A 5CCEA 1XTSA 1UIMA 1WDWB 2VAVA 1G2OA 1P2FA 5KAIZ 2WJ3A 3A05A 1XRJA 2GO1A 3E5HA 4DIDA 1BVUA 3BQMB 4EA9A 2FMKA 4CS3A 1JQAA 2D8MA 3WICA 4CCWA 3KQHA 1B93A 2VXBA 4L4SA 2GCOA 2ILMA 3NEJA 4PS0A 3DBHA 3U81A 1V2GA 3TR0A 2ZAIA 4U2BA 1TT7A 4UEWA 3C9SA 3O31A 1E2MA 4G5GA 3OONA 4PQFA 3KSBC 3D00A 4QGAA 2XZLA 1B8VA 2CLLB 5CXSA 1BHO1 4JTCB 1XVLA 2Q46A 3KKYA 3NC1C 2OXTA 5AVSA 5KDDA 3HR0A 4PAWA 5FO0A 2VPIA 3BTUA 1OU0A 2PRIA 3DPIA 4H0FA 4GBMA 4DEXA 4DQDA 1DT3A 2CYCA 2CZGA 2I34A 2Q45A 2R65A 3IKMB 5G0WA 2AW9A 2K87A 3MRTA 4HRAA 1DZIA 4TVKA 1YB7A 3DBLA 3KHUA 2WV7A 1C3EA 4LE2A 4OA5A 3S99A 4KYVA 4F2WA 3C24A 1SVWA 4LAFA 2DYSC 3SPCA 2BYTA 3V3TA 2I3AA 4B46A 3CZCA 4Z4IA 2NZXA 1OPRA 3U7QA 1YWGO 1F2TB 4RQBA 3NP9A 4D96A 3CCUF 1MOQA 1NJFA 5BNTA 4AJHA 1NXSA 1QQTA 3R7FA 3ZLUA 4F93B 4M7WA 2D13A 3SXJA 3QQPA 3DYVA 1DRWA 2BSXA 4TYQA 5IMBA 4G4XA 1T0BA 3NX4A 4ITUA 4Y18A 2OFXA 1GO0A 4U7TB 5BSWA 1QP4A 3HABA 3WGQA 3I1IA 1Z15A 3DFIA 3NGMA 3PYMA 2V6MA 2R6HA 3H5TA 3CLHA 3L82B 4K9LA 3ECSA 1FDIA 2ETNA 1RT9A 5HF6A 4QTXA 1JH8A 4IV0A 5L51A 3QH4A 1Q6YA 2X8LA 4R1SA 1RFLA 1GH6A 1XKTA 1HLFA 3IEXA 3NAMA 5IY5B 1JXAA 3VTKA 2AR9A 3AHEA 4E09A 3DLBA 2A9OA 3EPLA 5KOJA 3T4DA 1AKQA 5AW0A 1FNBA 1KR2A 4CKWB 1PR6A 3I2HA 1DMRA 5ICMA 3S70A 3JSNA 3ZP7A 4I9WA 1TYDE 2FVYA 3GG9A 3RYFA 3CE6A 3ZN0A 1S72V 1CXZA 1F9AA 2RDMA 3OIGA 3AHHA 4LHXA 2D1FA 4RA6B 1Q7CA 4PZAA 3SMVA 5JSZB 3AZPA 5INTA 1E66A 4GH5A 1RYNA 5EZQA 1EFLA 5AK0A 3MPUA 3GVIA 3M33A 1KSFX 4RENA 4PDVA 2HMTA 2Y1OA 3NIWA 3QVMA 2AXNA 3K6SA 3IUJA 3SPGA 3E3OA 1GO2A 621PA 2RAFA 4UDYX 3CHXA 3K1TA 3N58A 4EARA 4TYMA 3LIIA 1UJ6A 5JW6A 3QI7A 5BOSB 2DPLA 3ER6A 3RG8A 3A3KA 2ZBGA 4IICA 4BDTA 2R60A 2RGYA 2VO1A 4UQPA 3ZRXA 2V96A 4AKEA 4TTRA 4ENTA 3E2PA 4YTEA 5EY5B 4C2AA 1KVSA 2VUUA 3KLPX 3WVNA 3PC6A 1C8BA 4MJLA 2AIFA 1QSGA 3CBGA 5A71A 3WWEA 1R3UA 3HU5A 5FKJA 4LA4A 3VR4A 4Q21A 3HXMA 2OUIA 3C6XA 1I0ZA 1Z45A 2R70A 2OTJV 2EHDA 3EXEA 3KUKA 5K0SA 1GZ5A 4ZJYA 5ALQA 3SFTA 3IHLA 3UW3A 4B71A 4L50A 3T7AA 1WOMA 4IR7A 5C4IA 4GOXA 1FSPA 2QT0A 4RIIA 3ICWA 4RXMA 1Y9AA 2I1QA 3KZNA 1O94D 2YASA 3HCRA 4CG1A 1H8HG 3AG3C 3LC2O 1L6RA 4L27A 5K99A 1MU0A 2E75B 3RVRA 5K0TA 4QDKA 3U7GA 3LT5A 4E5UA 3TTVA 2IS6A 2IYLD 3BF7A 1JAHA 1W76A 4Q1AA 1W7AA 2CXUA 1R8JA 3NWEA 3LLVA 3BSFA 1UBTS 2O7RA 3U11A 2GJ9A 3LWBA 4ZVPA 1EM6A 1JJOA 1PS9A 4PBRA 4ALMA 4YGXB 1J2YA 5A9RA 2IJIA 1TVEA 2C0QA 4EI7A 4NVPA 5EHNA 1WRBA 4B9AA 3HCBA 1VH8A 2N47A 1QWOA 1UDXA 3V7FA 1XRRA 1GRNA 3AP1A 4XD7A 2EKPA 3GEHA 3G5UA 4E88A 2ISQA 4FCWA 4AP6A 1G1MA 4MGEA 4PHFA 3L40A 3WL6A 5J4KA 2YHIB 3B6NA 1Y76A 1XEAA 2CVHA 3CHYA 4JY7A 1AA6A 3ORRA 4TKUB 4OQEA 3T35A 2E3CA 4NU5A 4RD1A 4QGSA 3KHTA 3WB2A 2ZJZA 3WWYA 1U9JA 3GJQA 3OZDA 4EOGA 4DV6O 2QG9A 4HQFA 3B82A 1ZVVA 1V2HE 4PGGA 1O96B 4QNHB 2JGJA 1XFAA 5JRJA 1LBQA 6LDHA 3DEAA 2YV1A 4NATA 1GN9A 2JLRA 1SZPA 3ASVA 3RIEA 2YZMA 4YJ3B 2IKSA 4XDYA 1X7XA 2FX2A 3QWAA 3SQMA 3FB5C 1GD1O 3RYHB 1J00A 2QGZA 5KHAA 5EJ6A 1QO0A 3DDZX 5D01A 3BQ9A 1KAHA 4JT2A 4NYIR 2GDJA 2OGWA 3GI1A 4QJ3A 2VP3A 3DM5A 4G4IA 2FN9A 4DMUB 2NLJC 1JHYA 3KIZA 1QK4A 3COZA 3GB7C 4XJSA 1TU0A 2RHCA 3BCHA 4XWGA 3T9CA 3W5IA 1YZNA 4AJ4A 1B15A 5IZCA 1G9SA 1OBCA 3I2JA 4WK0B 3JALB 1QDLB 4H3VA 1X39A 1QLNA 3OCXA 4BBJA 1Y8CA 1Q3TA 3QYFA 4RYDA 3KOZA 3CRAA 4BJ5A 5AUPB 4CL8A 1D1QA 3OFJA 1E0SA 1NX9A 2Q6OA 3G9XA 1Y7PA 5DW0A 4IINA 4XSVA 1ISHA 2AXQA 1LQUA 3UQZA 2P6JA 3M8KA 4FFLA 1S3IA 3X1JA 4UBKA 2FJPA 5DM6V 2ZU6A 3H3FA 4LUCA 5F5XA 3HN7A 1ESEA 1S2LA 2Z6VA 2VRCD 1NVFA 4W7SA 1XNGA 5FPSA 4C4PA 4OJNA 4Z49A 1RXEA 1XTIA 4D44A 4B3FX 1G21E 2P9EA 4ZVMA 5IXJA 5T57A 2XMRA 1NBME 3BN3A 3X3HA 3X2FA 1WHTB 3V4VB 4RVCA 2FN4A 3MMXA 3PUWA 3HK2A 5CLJA 1T9BA 2EKLA 3IA2A 1ZBQA 4JLKA 3MCUA 3DVAA 2D5BA 2RJOA 3D3WB 4IFEA 3DE6X 4ZAGA 1JLSA 2AXPA 3CR7A 5COBA 3T12A 4J41A 2DM6A 2JBHA 2ZTLA 2J3MA 3REFA 1SQ6A 4M0MA 3X1WA 5JBNA 3G8AA 2CV1A 1AI5A 2H16A 4TTIA 1CP9A 1CDDA 3HJUA 1QU2A 4QGFA 2WHEA 3BWVA 1EHYA 3TX2A 5IAAA 1O08A 1TAUA 1DRKA 2BZ0A 2EQBA 2X4LA 4B6OA 3AEQB 3KCYA 1SKYE 1V5FA 4IIJA 3IP8A 3KVRA 3EXG1 4MW0A 2YWXA 3K08A 1RXWA 1VIAA 1JDBC 4FLFA 4JFRA 1O0CA 1REQB 1H38A 3BEHA 1I3LA 1KPGA 4YDRA 1Y9ZA 2YFQA 4XOUA 2ZQ5A 3AWDA 3IDOA 5ALNA 2X5NA 4DWWA 2Q1WA 5IAJA 5BQXA 2QTAA 1EFDN 2J6HA 3CSSA 3FPBA 3OF2A 4G8CA 4BLPA 2ZM5A 2AN9A 2MHCA 2WYIA 4HQKA 3LTNC 1BQEA 1GQOA 2QVYX 1NTOA 2FW1A 1DKNA 1RYMA 1DK1A 3D4NA 3GDOA 4M6WB 3UQYS 3V00A 2ECKA 3GWZA 3C9TA 1L4GA 1N5DA 2RJNA 3AYXB 3KLBA 3DBLB 1W4RA 3LIPA 4MUAA 3K20A 4X7MA 2EJWA 1KKUA 2WUVA 3E15A 3WNDA 2ZQZA 2ODNA 3N75A 1C7JA 4UNQA 5E4JA 5EPEA 5AJWA 2PKEA 3MN1A 2R68A 2FZKA 5AVOA 1U2GC 3ZK7A 5CFPA 2AOWA 2CKDA 3QKWA 1BGXT 1NN1A 4UPEA 1UL1X 4B6GA 1E5DA 3LC7O 1DRUA 3T61A 1KYYA 4NBVA 1NXWA 3H2GA 3ZR4B 2P79A 1NASA 3KQOA 1L3CA 3PDJA 5E7JA 3N2YA 5JAZA 2CJXA 2C8LA 1AY0A 4TYPA 5F1OA 3UC9A 1YO6A 5JYCA 2H65A 4KQGA 1GPWB 4EUNA 1T4BA 1FRVA 5HVNA 2L6LA 1EB8A 3C1UA 3SPJA 4DR5B 1NBWB 1DX6A 3DZJA 3N05A 2CTPA 4D8XA 1VL6A 3B3QA 4H59A 3V33A 4CT4B 1AC5A 3T1YB 1A9RA 1H2BA 1QCDA 1QHXA 3PD0A 3ER9A 1I4LD 4OHCA 4E6EA 1RQLA 1EZZA 3TFQA 3WO1A 3U3ZA 5A6SA 2FEOA 3D02A 2C54A 2FUEA 4MVMA 5KMGA 4DUYB 1Z06A 1H2AS 1VFPA 2F9MA 2O7VA 3SN6A 3S3WA 4HLQB 1XHFA 2OT5A 3U7RA 3H7IA 4V1CB 3PC2A 3IMFA 4OATA 1U3CA 3RVKA 4PNEA 4E6PA 3T5TA 5TQVA 1QLEC 4EQ6A 2OGUA 2IV7A 1C9JA 3IVGA 1FDUA 1T8RA 2JVJA 3HJGA 5AHXA 4DMKA 4BXOB 1DBPA 2F8MA 2HEIA 1F8FA 3OX4A 4G26A 4GHWA 4I08A 5ICFA 4BVBA 4AS1A 3TD3A 1RAHA 4QE3A 4YRZA 3AHJA 4U2KA 3VISA 5HE9A 4ZCMA 3CG6A 2K1SA 1X80B 3ANYB 3L02A 2B1IA 1DHRA 4JB0A 3ZHUA 1T9KA 5EJ4A 2ZYSA 6AT1A 2L69A 3W78A 2N05A 4GKJB 2CK3G 4DAEA 3E86A 5B2EA 1MB0A 4CFYA 5C53B 1IN5A 3ZDRA 3UGQA 2NZJA 4OQLA 2NU8A 3UMSA 2R84A 1TC2A 2A1IA 3LT4A 1EQAA 2JJ1D 2PT5A 3CZRA 3SS7X 1Y4AE 2ZI6A 3NBYC 5BSEA 2VK2A 4GSLA 3F5QA 1HF3A 3RVMA 1C3LA 4WZBE 3UK1A 3HBFA 2RSLA 4J3JA 4HDKA 4A1FA 4LOLA 1B74A 2ZU0C 3F4KA 4EYKA 3RAEC 4MTGA 3IVXA 4UB6Z 2PQ6A 3L84A 4I66A 4LI0A 1AQUA 4PG5A 3TKLA 2YJ3A 5IVIA 4GOND 3TW0A 1JILA 1R66A 4AO6A 4BU0A 2PL1A 3IEKA 1IAVA 2B92A 1D2HA 3ZHQA 3Q2KA 3UAZA 3ORQA 5ESDA 4D9FA 4C87A 2CSUA 2V3WA 3J80N 1AN9A 3E27A 2L26A 1R6KA 1RP1A 3PCRB 4NI5A 4DV2O 4N5HX 4ESEA 3E7DA 1G6UA 5H3LA 3SYQA 3PGA1 1QQAA 1NFFA 3HY3A 4FMDF 2VR1A 3AWIA 3PLAC 3CN9A 3GLHB 3PLRA 2WJVA 5EMHA 4RLQA 4DCOA 2O8CA 4RIHA 3VOSA 2QL6A 3GRFA 3W3AH 1I2MA 2VNIA 3ETCA 5BVGB 4RLFA 1VJGA 1TMYA 3CC4F 2OB1A 3LUBA 3Q3VA 2RKWA 3DOUA 1KDPA 2VHYA 3GELA 1N9GB 1LX7A 3H19A 3JTEA 3KP1A 1PLKA 3LKBA 4GP7A 4HK4A 2CL7X 4PPGA 5JZSA 1QLJA 1U1IA 3CX6A 4GQBA 1JHAA 3K6JA 3SVTA 2XY4A 3R3JA 2BC9A 3FYDA 4PDMA 1HFKA 1RJEA 1NVBA 1M2WA 1Z8DA 1E98A 2B7BA 4MCHA 5TB5A 5T4BA 4AD8A 3VNUA 2QN2A 5LQNA 4HFMA 1PGQA 2HQOA 4LNUA 1DBQA 2WTNA 2HFEC 4FZ0A 3SDLA 2F43A 2W6MA 3E7WA 2Z2XA 3G2IA 4XWTA 4F56A 4F86A 2P35A 2ZT9B 4R40B 2KGWA 3HJWC 4GU5A 4S1WA 1RM4A 1EG7A 1ELOA 1SK9A 2I8AA 3O26A 2YJ4A 1UP6A 3TXYA 3L75H 2R7NA 3UHPA 2E85A 3ITDA 4AULA 4AIIA 1OB2A 5J9FA 4WAUA 5CK5A 1CQPA 3TZKA 1UI9A 3OPQA 3WAKA 5J2TF 1MFZA 3I2GA 2CB0A 3NKLA 1RYFA 1QO7A 4FHEA 1KS2A 1XLVA 2CEAA 4NF2A 2B9ZA 4W4TA 3K3WA 4NXMB 2X0KA 5G1OA 4CM1A 5TNXA 1I36A 3BX1A 1K7FB 3EMKA 2HGSA 1A95A 4R84A 1V8OA 1KYWA 4UCOA 3EXHB 5PNTA 5GAPK 1ZN7A 1Y3AA 4JVNA 3VU8A 5JXJA 3X2QC 1MZEA 4D6XA 1X7OA 3OZTA 4B3IA 5CM2Z 4HEJA 3LDCA 5HP8A 1CJVC 2ZBDA 5JEDA 1FSGA 4FMCF 3FUUA 1SM4A 1PW7A 1GA6A 4FTWA 1YHQF 3RM3A 3STUA 4G63A 1YOVB 4XGKA 1CUIA 5HRAA 2ZIOA 3CC2F 1JLKA 2VWHA 2XDAA 1GWNA 1L5KA 3ZWAA 5A7GA 3LM8A 4G88A 3H5VA 4HI0E 3KSDO 2HJRA 4BFZA 4U3JB 2NVUB 1ODJA 1UP7A 2OYSA 3ESXA 1GCAA 2A0YA 3LLCA 3TPFA 5JJBA 1VK3A 1U2RA 4XDGA 1PNVA 1Z74A 2REQB 4WKCA 4X8LA 1N1GA 1ONIA 1DAPA 4AJOA 1SC6A 2HBQA 2VNAA 3HRKA 3PVCA 3DCNA 3S28A 3DGEA 1ZGGA 2A1UB 2BE3A 4RPJA 1QBZA 4WN3A 4CUKA 3BMNA 4ALLA 5K3EA 1E9RA 2EGHA 4GI3A 3B6ZA 2EARA 4U0JA 2IG8A 1NUAA 1OCRC 3S2SA 2OGZA 3ZI7A 4XARA 2EKBA 4NMXB 4BVHA 5BW4A 2JDIG 1V8BA 5LUBA 4PFQA 1P6XA 1UJBA 3WFIA 1JDTA 2I7VA 2BTQA 3NYWA 3RJ9A 3S1AB 5IU6A 1AMUA 1N8RW 1HW7A 4KGZA 4R5HA 5AM0A 1Z2DA 2WWXA 4TRNA 1VL0A 1EMDA 4M89A 4Y1RB 3WGUA 2ATKC 1I7PA 3C6KA 1G38A 2VA9A 1SWVA 2YS8A 3OBYA 3L9WA 4UZSA 1EFRA 1UFYA 4W4KA 3NRCA 1B0ZA 4KQKA 4ADSG 4CGZA 1OFUX 4DCJA 4EM6A 4W8OA 3FDFA 2P2NA 3HP1A 2QGFA 4MQ5A 4B7CA 2ZSUA 1ACJA 5K3FB 2AFIE 3B1FA 3A14A 3NVKE 4QXRA 2GYYA 3MCZA 4RE5A 1FFBA 4DILA 2Q0HA 4EJSC 3OOHA 5JASA 1U8FO 1QQ5A 3F5FA 1FRZA 1CXZB 4D0NA 2V7VA 1BT8A 3O6VA 4YYZA 4EG0A 1CR4A 4S3MA 4QWWA 5BNIA 4RXUA 4F3CA 2C20A 3APOA 3I3OA 2Q9UA 1AP5A 1Q15A 4G8JA 3GRPA 4TMFA 3OE5A 1A77A 2VT2A 1Z8NA 2XQFA 3HCAA 4JVMA 4XTCS 4MTFA 5HCUA 3ZI0A 5EXSA 1VL2A 3QY0A 4FPXA 4BGIA 1NKTA 1HE4A 4L78A 3GDGA 3NEPX 5I4IA 1E62A 1JBKA 2GSWA 5CG2A 2YC2C 1AZWA 3M99B 1TO1E 1EWKA 1GARA 4X61A 3HCNA 5IM4A 4C6HA 4LEIA 2WMDA 4AHCA 1T24A 1R73A 3F1KA 1LW7A 1UBNA 3L05A 3NGLA 4GDMA 1I1QB 5AM3A 4MVJI 2DECA 1EFCA 2I2CA 1U3TA 5LMNO 1IV4A 1DQPA 1ULSA 2GBLC 5CBPA 4D92A 2AOVA 5DN6G 5EZ6B 2Y4TA 1DC7A 3G1UA 2MU1A 2P6PA 2BMWA 3ZHTA 4X1OA 1DHTA 2FKXA 4EEZA 3OZRA 4X8MA 1F9EA 4CC6A 3G23A 3JQ7A 1C7ZA 2QPLA 3AEIA 3WLJA 3STXA 1YVRA 2JGNA 4EH1A 2QYOA 5C0OE 4U63A 1T34A 4Z3OA 4HQ0A 1MV5A 3LBIA 3D8RA 4NEQA 5JJJB 4IMJB 5GGYA 4A8PA 1P44A 3FF1A 3G6KA 4BVTA 1U3DA 2QDXA 3OX1A 4OHVA 3FWYA 5ULLA 2UDPA 4E5YA 5KU1A 3IIEA 3G2MA 1YVDA 4HRXA 5AIBA 1AS3A 1JXQA 1NYRA 3UA3A 2REOA 5LMCA 4YUXA 3O8CA 1PNRA 4BV9A 3RSFA 2HSZA 2O1WA 1QFXA 3OH8A 3VTFA 4B8ZA 1VP3A 2NSJA 2L35A 3L0YA 5JAOA 4PA4A 1LBHA 2V7WA 5E9QA 1VG0B 2O6HA 1TJPB 4QXMA 4EBFA 2D7DA 1RHJA 2PWZA 2WF7A 3HLYA 1HETA 2I67A 3O21A 1L4YA 3BT7A 3AG4C 2XMZA 4CG0A 4DIBA 3AHIA 3QPWA 2VH5R 3HB4X 1KQSF 1DLBA 4DSZA 3TZQA 2G9RA 1K4DC 4K3AA 1UUFA 4U8HA 1AA9A 2JHPA 4XDHA 4PHCA 4EG3A 3VQYA 3G5LA 5FBRB 3LMEA 1WNTA 1KAEA 5JDCA 2QI9F 2QEXF 1U1DA 3BD9A 3T7TA 2XUFA 3E2MA 3I4FA 4YBRA 1K4CC 4D8VA 4FLYA 1CUVA 4K6CA 2JIMA 4F4FA 1ACLA 3R3WA 6PFKA 3C7KA 3D2BA 2H2DA 3PPVA 4WLVA 1J8QA 6CHYA 1XD2B 2CNOA 3I23A 5LZ7A 4EJMA 4RY9A 1EN4A 4Q15A 4R05A 4ER0A 4KQJA 4LOJA 1W5BA 2EF1A 3G17A 3NT2A 3W8DA 4JLPA 4BX0A 3WLPA 1KQFA 3VZRA 1SU4A 4K86A 4DIEA 2FRVA 2KG7B 4LTNA 1N34B 3EPRA 1XNRB 3GJ3A 2EBHX 3F6MA 1BTOA 3B60A 1I32A 2JHGA 2DQZA 3VKFA 1Z0JA 1T2AA 5BSUA 3KEQA 4EB0A 3KKPA 4ZHQB 1E8MA 4MVJD 4NHEA 3DUWA 4OSEA 3FNRA 4M8KA 2P2DA 5IUKC 5IX8A 5JPDA 1CY7A 1E3IA 1FPQA 4YALA 5D3MB 5E8RA 1VF6A 2ID7A 3S2YA 2ZB7A 2PAAA 1Z2PX 1PWZA 1GNSA 4CH5A 1YR2A 1YGPA 1KIFA 2FQ1A 1GFZA 3TLGA 2A5LA 1WM1A 4C7XA 4K9RA 2JKYA 4KAFA 2XOXA 4PO8A 3SR0A 5JQWA 1DADA 2IOFA 4TVOA 3UXMA 4ENQA 4NSNA 1PL7A 2VRBA 2A0UA 4QLOA 4BJHB 1IN6A 2G9UA 5KX5A 1VM6A 3F5MA 4P54A 3OP4A 2JAPA 5BSVA 3MVEA 3QEAZ 2GJKA 3L0SA 2ORVA 3QHPA 4FC6A 5DGHA 1TDJA 2LW1A 2HV8A 4C3UA 2YNMA 3ZCCA 1RAIA 2AI2A 3CH5A 3NHYA 1B00A 4MS4B 2CLKB 4HWPA 3DC2A 3UWMA 3T4XA 2EWVA 2HXYA 4K6KA 4RH0A 3UUWA 2QLNA 5JRDS 1H5QA 1XCGB 2EX1A 3WK7A 3CEHA 1QNMA 1AKRA 2JDID 5JDIC 2PI5A 2QQ0A 1NQWA 2PNFA 2IAFA 3ONFA 4EI9A 3JXEA 3ZWVA 3PE6A 3RFVA 5JNTA 4FJ1A 1NQVA 1GPUA 2AE1A 3TPZA 1XZQA 1YZGA 4BO4A 3WNBA 1T3TA 3WL4A 3F0DA 3K79A 2YHUA 3TM5A 3ZH9B 4RPGA 1UBLS 3LVBA 3D7MA 1JFFA 3OO1A 4LBZA 1TMKA 3EDOA 4B2PA 2XVZA 4OXRA 4KVFA 4NXMO 1USUA 2C5AA 1D6MA 2WG0A 3CSDA 3IJEB 3T2MA 2HJSA 3LUPA 4G4SO 5AVJA 4DQ0A 2CMHA 1JA0A 4FOSA 4E5VA 3G4SF 1UK6A 5SZHB 4ZYWA 2CUKA 3GDHA 4FC7A 2VQFO 1NU6A 1PJZA 2C1EA 3SC2B 3AUFA 3NALA 2Q5HA 4M7OA 5I7RA 2P8SA 2O3RA 4OSPA 5HF8A 3ELUA 2V74B 1WKBA 1NYQA 3WMFA 2ZJ6A 1NR5A 1WW2A 4YPFA 4AICA 1VQ6F 3HXPA 1QHNA 2CWWA 1A82A 4M86A 2E4WA 3ZWPA 5IANA 4DZZA 1K3UB 3ONEA 2HRDA 2O2EA 5CT8A 1RD4A 3GZTB 4F6LA 4NH0A 5T8KA 3RVOA 2ZREA 3F0GA 1F8YA 4ZYUA 3PRHA 2P7HA 4LVNA 1IYZA 5T64A 3B8EA 1MCZA 1T1RA 4FFWA 4RD2A 3MK31 2GN4A 5EXXA 1YIDA 2REQA 1R6AA 1W6RA 5JQGA 5CNIA 2LBTA 3RT3C 3W6OA 5CB8A 4G0WA 1SUAA 1F2UB 3QBJA 5F7JA 3ZDYB 1PT5A 4EATA 1L9XA 3IO3A 2WR8A 2XTMA 3PPXA 2WLLB 4W1RA 1YR1A 5CFZA 1O4VA 4HAYA 1RC8A 1KO5A 3LHIA 4DQUA 2WF6A 4IRMA 5AVWA 1J0XO 4MCJA 2JG3A 1BIFA 3W8NA 3E4CA 4YNBA 3I5XA 1SQFA 1X86B 5D7NA 2EG9A 1T9GR 1TEXA 2QNIA 4FN5A 4EO7A 4AAYA 4I9NA 4H7FA 4CH3A 2XUPA 5I8PA 3OGIB 5A9GA 1DZ3A 3B6MA 1Z2AA 2PZKA 2H2FA 3BZBA 2ATIA 3GFVA 3RLIA 1T5HX 3WLLA 2Q41A 3HVRA 3GUVA 3SLGA 4GI1A 4ENRA 1OY1A 3E9EA 2XOKA 4Y1EA 2JIZD 2LDBA 2AW5A 5EUQB 3RWBA 2C61A 2R4UA 4XZ3A 2JDIA 4RAQA 1KP3A 3AKZA 4MVQA 4Q4CA 1J70A 4E2WA 4CF7A 2AK2A 4TXHA 5GVSA 3Q8MA 3UAXA 1MXHA 4RSRA 1GZ6A 4IX9A 3DGFC 4Y2PA 1U0SY 2OECA 4H6XA 3W2IA 3OU7A 4F60A 3H97A 5AHRA 1I01A 3D6HA 3PDCA 5TX7A 2PFSA 2JGIA 3RFRA 3EIHA 2UYKA 3TK1A 2H2WA 2K7FA 2HRBA 1X7WB 3UWSA 4IQGA 3S2FA 1IM5A 5J1TB 5C1PA 4KR7A 3LYLA 3N2NA 1NI5A 5CYFA 5LYYA 3DHVA 5IYZA 1T1IA 3V4FA 2X0RA 3Q7QA 1NOKA 4UTRA 5JS6A 4JAAA 5GIPC 3VO9A 2C5HA 1UBJS 3QTLA 4OMUA 5IW8A 5JU6A 1YSCA 5AVUA 3TBFA 2WD9A 1RBZA 5MN4A 4A6DA 5BZBA 3G6EF 3I9LA 4Z51A 1W5FA 3ZDEA 2YN0A 1G3MA 3VOAA 2IJJA 2BDUA 3E0QA 4EVQA 1HT3A 4PGMA 3B8HA 3ZOPA 5H9WA 3PHGA 5CYPA 1L4BA 4KYTA 2FWPA 2VLBA 3D4IA 5C5CA 2V3CC 1M34B 1LUVA 3MGBA 5EZYB 5C9ZA 2C2BA 4TOIA 2J1LA 2YI8A 1V41E 1WKCA 2ZIXA 3BORA 3JWPA 3LF1A 3NM5A 2L18A 2Q3LA 2VKTA 4KH1A 3TW4A 3QG5A 3D7RA 1N5IA 3G0BA 3HY4A 4AKHA 3RGWS 4QHTA 5ARDA 3BZUA 4HBNA 2BM8A 4WN9B 3UMMA 4FBLA 3E81A 1JF8A 3CPQA 2BI8A 2P9CA 2PUVA 4UCFA 3HNRA 4ZI7F 2PQ2A 2G1AA 2LGQA 3REOA 4ND2A 2PTMA 2PAFA 1Y9JA 3LQRA 3FCSB 1NMYA 1RP7A 5BURA 4TZZA 5KJFA 1H1LA 4E5MA 3L4KA 1JIXA 2D0PB 1OU4A 3CJTA 1P9NA 2DBYA 2PO5A 2BOBC 1QKJA 5B1BB 1W34A 1WMBA 1SUPA 1I3CA 2QJFA 3D7SA 4XR9A 2BFFA 4GKKO 4RQAA 1SD2A 1V9LA 3CH7A 3GMSA 3TRIA 2O48X 4J0JA 3K05A 8LDHA 4KHPB 3G02A 3O90A 3CF4G 1E1MA 2QUIA 1QS0A 3FRJA 1VA4A 5DHFA 3V3KA 2XE8A 1Q7GA 3JCMM 1M6WA 1R5BA 2A7XA 1JYSA 2HL6A 2H5LA 2I7DA 2JFNA 3GC6A 3OM9A 4MRPA 5E3IA 1Z0AA 2GESA 5B3AA 1SG0A 4DIUA 3MZ0A 4UMDA 3KJGA 4GI2A 3Q3JB 2Y2UA 2GAIA 3LZ6A 4JROA 4ETNA 3K2XA 4R8MA 2WOJA 5JJNB 3OTOO 4M1ZA 2BM0A 4P83A 1JE1A 4HAUA 2ZE6A 4CC5A 4IFIA 2NP7A 4FWBA 2HP8A 3AM3A 1D1SA 2F1IA 2CZQA 1X80A 1IEVA 4EFLA 1H1LB 4P7KA 3INTA 2F3QA 4R83A 1I4EB 5ENZA 4G84A 5IP5A 3FVRA 5K0LA 3TD4A 3GLHA 2EBWA 3W06A 4B3RB 5TGZA 2YZKA 3IULA 4P7JA 4B6JA 1BWSA 4G86A 1CK2A 5F9HA 2LNDA 2H9IA 1IULA 4L5CA 4RU1A 4V1CI 2FMHA 5DGTA 3K7EA 4CMIA 2RKOA 3UAWA 1IBLO 3ZRVA 3IP9A 1Z3IX 3HKCA 4R8RA 3ADBA 1P0QA 1P33A 3AEKA 3M3DA 4C0KA 4OQMA 3HBJA 2X9LA 3ELDA 1BCCH 3FMPB 2C92A 2ZSHA 3S0YA 2A92A 3QLJA 2EIJC 2DFTA 1TCAA 2OFWA 3NHAA 4GMKA 4LQLA 4EYQA 5KWVA 3ZVKA 4XB1A 2FLVA 2FHPA 3BJIC 3U19A 2BIFA 1RXIA 3TVDA 2J6IA 4AKIA 1QCYA 1E2BA 4D0RA 4ZHYB 2V65A 2GLTA 5HGJA 5I8ZA 3OLWA 4PZ9A 1H2HA 2C9YA 4MV4A 2QJ1A 1JHQA 4TMWA 4YLGA 5EPOA 5SYNA 5DV9A 1GGKA 2RHMA 1AB5A 3IIKA 4QJBA 4TXMA 3BHJA 2G4CA 4Y0VA 1AR5A 3OUZA 4R9VA 4RIFA 3ZD9A 1SIUA 1G9TA 4Z0HO 2WSLA 2VJQA 3EBPA 5JMPA 2R97A 2IXTA 1ID8A 3JQAA 3OY7A 4EJFA 4O6VA 3R6TA 3GD5A 2Q99A 1TW2A 3FSGA 2ZBQA 3PC4A 4IRUB 5DBGA 5H59A 3G7UA 2WPDG 1I13A 1MX5A 2W6IA 4AJLA 4NG4A 4I81A 2E9SA 4ER3A 4C20A 4YRSA 2FRXA 3COVA 2QR4A 4LZWA 5EQDA 3ZU3A 5IDWA 3WA6A 3L41A 1WJGA 5FOVA 3GEGA 5LQKA 4V38A 3THWA 3RUIA 2O1XA 5DBIA 4KVAA 4E4TA 3W6UA 3GCZA 1AG9A 3ACCA 2FPWA 2H0RA 3HRHA 1Y63A 4AFNA 1AGXA 4NCBA 1BGVA 3B8MA 1Q14A 4OX9B 1WS6A 3AU8A 3ML0A 3I52A 1D4OA 2ZIUB 3OIYA 4ZO4A 3VQTA 2QBYB 5BVHB 2FZLA 2OORA 3IR6A 1E1DA 4RFLA 3W1VA 1UF9A 3ESRA 3PUZA 4XEUA 2PJUA 3H6HA 1K2VN 2C0CA 1U7HA 3BXFA 3UHFA 3L72H 3B3AA 4OXKA 2VYCA 1USIA 4W1SA 1AILA 2DUJA 4ZOLB 2X9VA 3GP5A 2DSNA 3FTDA 1ZWLA 3EOAI 1M2GA 4F4IA 1VQPV 2OENG 2AFHE 2VQSA 4DV5O 4RQEA 2W6PA 2YN4A 3S40A 3CW9A 1S3FA 1QH1A 4OK6A 4TTQA 4UM9D 1G5FA 1MLDA 3ZYCA 1TM2A 1RXUA 3A11A 4OU4A 2B2CA 1A69A 2Y48A 4DCGA 5BUZA 5J58A 3QENA 2NTVA 1QJCA 3FWZA 5ALOA 3QWFA 3KQVA 3AGKA 3FOFC 2YICA 1MDFA 2ANBA 4EF4A 2O8DA 5EXEA 1RQGA 2G0AA 4V0KA 1V6AA 4XA8A 3STLC 1YRQA 4G1VA 4KKVA 3T5DA 3OJEA 1D2EA 3AM4A 4M55A 4F45A 1QNFA 1TPZA 3C6QA 4TL9A 3U7FB 2XAHA 3BTSA 3QKSB 4OFZA 3P30A 4YV2A 1BCSB 3LD9A 3U6KA 2PMEA 1R9JA 3NOQA 4YDHB 4RZ3A 1XMOO 2VEDA 1EDZA 4D3ZA 3DKVA 4MRSA 3RVJA 5HUQA 1OZAA 2F6RA 4DMFA 4BQSA 1THTA 5K09A 3VNAA 4LOHA 5K6AA 3A3NA 1YVEI 2C07A 4Z0PA 1Y6XA 3ZDXB 3OZUA 1F0NA 3B53X 6YASA 3N7UA 3VBBA 5E0KB 3AEKB 4H7KA 5C52B 1SCNE 4L28A 4P5EA 3RAFC 4I9HA 3NTRA 4HZGA 4RETA 4XB6B 3L6OO 3ROEA 4B3TB 3TTXA 4E2ZA 3L04A 1OXVA 2I6QA 3U7JA 3KQSA 2V0GA 3BHIA 1FYXA 1XWWA 4JU8A 1T5TA 2NU7B 1Y8ZA 3D2CA 1IB6A 2AMFA 2HZ7A 2PGIA 2TS1A 1IEWA 3QNWA 4ITVA 4JB8A 4JVOA 1NY6A 2FWJA 2AVNA 1P91A 1VJDA 3MS2A 1E9AA 1YKSA 3KQPA 3QPVA 4JUFA 4Q4HA 4YO8A 3A4LA 1EFTA 1R27A 5KAPA 4PD4F 1PZMA 2XUOA 1C50A 4OBBA 4P08A 3ZVNA 1IHOA 2FNAA 3R3ZA 4XUEA 2IUTA 1ZY2A 2GFQA 4IDGA 1EEHA 3HTXA 5EJGA 1G5TA 4YAKA 1PIWA 1T15A 4E5NA 2GN0A 3DE7X 4NK4A 3F7YC 2XGOA 2JLCA 1TK3A 4K87A 2P06A 5DI3B 4B4WA 4Q82A 4HEA1 3ZE2B 5CEJA 1RTKA 4O4JB 4LECA 1C30B 1GL9B 1YOBA 3GUHA 3OTIA 1QU7A 3P0ZA 3G13A 4FYWA 3LG2A 2F62A 3O8OA 2A9VA 4FSDA 3K9WA 1D6NA 3HUUA 2D1SA 4G23A 4Y7DA 1LCIA 3LHKA 2HRZA 1DQRA 5CR9A 9MHTA 1Q21A 2HRRA 2PXXA 1LKZA 1YMQA 5DFAA 4NOKA 2OM6A 3RAGA 5KCMA 2CSLA 1KPIA 4FT2A 4NVRA 2HJHA 4QQ8A 4Y6QA 4ZCIA 3QNUA 5TPWB 1RM0A 5KNBH 4UBIA 2XRZA 3Q8LA 5GADl 1Q0PA 5C18A 3A70A 4ICGA 1X77A 3B20A 2MINA 3ULKA 3QOWA 4P9NA 3UAYA 3E8FA 1GZ3A 4B6PA 1SZCA 1V9SA 2NACA 2Y1FA 1HURA 2Y4NA 4HQ6A 1R4NA 4EHAA 5AVQA 4PRLA 1CRWG 2PD3A 3FPSA 1Y5NA 1D03A 3USZA 1EFHA 1II8B 1U2TA 3MG9A 4M3NA 4OQPA 5B1IA 3FIUA 1KDRA 1I9GA 1ZD9A 5DZSA 3ZBPA 4O2BA 1E7QA 2YFYA 3FX2A 2FWIA 4XPIB 4E5KA 3B5IA 4D4MA 3AR3A 1AHIA 5KVSA 5JH7B 4ENVA 3EXEB 2M32A 1YZLA 4TWIA 1G8MA 1XNQO 1Q7EA 4DAOA 5K1XA 1EJ6A 1Y8QB 4LYFA 3SF0A 4C76A 4QECA 4S05A 1HL7A 3KUXA 2PV7A 4E08A 1P7WA 1P2UA 3OBIA 5HQTA 4XX1A 4Y0AA 4OQDA 3PVSA 4C6SA 1W41A 2C9BA 2CLSA 3LL7A 4WCFA 4HT3B 4BN5A 1CRPA 2HNBA 1IY2A 3MJHA 2A5GA 4LZJA 3V8NA 3R6DA 2BGMA 3F0FA 1KJ8A 4DANA 1XU9A 1YJAA 5JI2E 4OIMA 4RJLA 3MPOA 4UPDA 3LU1A 4EW1A 2YWFA 1JJAA 5EIBD 3S02A 3JQ6A 3MGGA 3RUFA 3TW8A 4IIEA 3DEFA 5FJJA 4E11A 2JPDA 4FFDA 2QHXA 2EOAA 5LU8A 5AOVA 2GO7A 4AIRA 1XAIA 1X6VA 2XVXA 3D36A 1ILEA 1P2DA 3LHDA 3T9EA 1CEEA 1BJRE 4NBLA 1LI4A 2XE4A 2ZSEA 1SQSA 4ZVKA 4PHTA 1OJHA 1FP6A 5CPFA 5KVQA 4F2GA 4PLWA 5C8YF 5DNCA 1BCRA 3MUEA 1WA5A 3VTIC 2ZUCA 4YCSA 1LFAA 3SBDA 4ON9A 4UQLA 3WLOA 3K73O 3D5EA 4JT4A 1YHYA 4GR4A 1EVIA 3OFND 5FL3A 2J45A 1JAYA 1PUIA 4ZICA 4YIHA 1ZSPA 1Q1EA 2PBZA 2Q5LA 3JQ8A 1G7SA 5JDCC 3BRQA 4GECA 4YV0A 5JLJA 5EIXA 2CXPA 1E69A 3RNLA 1JQDA 1NJ2A 1L5NA 5KX5B 2ZRBA 2A0KA 3DA8A 3DOJA 2RH5A 3JTMA 4NG5A 3AB8A 1VKOA 3DYIA 4KXRA 4A8JB 2O7SA 1PF7E 4D3XA 4QXOA 1UJCA 3KOWA 3W7TA 3B12A 4BO6A 2BVNA 5JPCA 1CF9A 3NK7A 3W9SA 3O47A 4A26A 2QM3A 1RMTA 3KKOA 4DMCA 1PD0A 2V4UA 4GVLA 4HMQA 4TRMA 4ZO8A 4D9HA 2HK6A 3DZIA 3VZDA 5I45A 1ZSYA 3MTGA 3EWIA 1U7ZA 2W48A 4X9XA 4JOSA 3DW3X 4CQLA 3NHRA 3O9VA 4YYEA 1YACA 1D3AA 2WWVD 3RR2A 3G89A 4AX8A 4UM9B 3N6RA 3WRXC 2QQEA 2A86A 4NNPA 2QE7G 2C99A 2QL5A 4F84A 2QXTA 1KFBB 1EN6A 1RRKA 2GJ8A 2MSDB 3ZX6A 2WM9B 4KXXA 1IZ9A 4DDVA 4ZDJA 3ENQA 1K8AW 2BHNA 1OOEA 3SJZA 1JW9B 1CF4A 1EE9A 1E1RG 3H5WA 2XA9A 1F51E 1YHNA 3UAOA 3OQ1A 3R2JA 3IPRA 3LGXA 2C2KA 4JLAA 2Z04A 3KKNA 4AN1A 2YJ6A 5BMVA 1GQSA 2MOKA 1DKOA 4BMCA 1VQKV 2OHFA 4ZTZB 5M34A 3IC5A 3K0FA 4YJHA 4B47A 5DM70 1HG0A 2IHVA 1VB3A 3A9TA 1IH8A 2NSYA 3D4BA 4GC5A 3RSCA 1V96A 4GKKB 2IHBA 4LGCA 2IYWA 2B35A 3M6WA 5DRTA 1FYFA 2YIVX 3VYTC 3MMSA 4GEKA 4LFCO 4UDNA 5A2QM 1IFXA 3HMKA 4YB8A 4M36A 2MJLA 4OQZA 1JJBA 3TOSA 3UTDA 1QDEA 1HLDA 2UYJA 3L1KA 3EEQA 2X1LA 1CUEA 2E4YA 3CNHA 4ZVSA 1Q77A 4QATA 4FYVA 1A96A 3EJWA 4ZV4A 1SZDA 1TZKA 1QV7A 1Q3KA 2KQUA 1MH1A 3AOEC 4MV3A 4BNKA 2O8FA 1JHXA 2P6MA 1BHBA 2E6UX 5AI4A 4Y2JA 2OC4A 1S8OA 4KE6A 2ZJOA 1MQ8B 2G7ZA 3OIUA 2G28A 3VC7A 2GB4A 1MQAA 4U7OA 4TXNA 2WZQA 4R2KA 5ALJA 4BS9A 1ZX3A 2Z57A 1BHJA 2QL9A 3JVIA 3LDHA 5DT2A 4I50A 3LWNA 1A9SA 3DXFA 2IJGX 2BBTA 3B9PA 1E7WA 1T1JA 4M46A 4XTRA 4JASA 2P9YA 3O38A 4YAOA 2I6XA 2YOGA 3CO0S 3EASA 4WOCA 1FPOA 1XV5A 3GAAA 2R9AA 2B82A 5BV2P 5KU7A 3ENVA 3GTZA 1X2BA 4K81B 4OBXA 2IITA 4DCMA 2BF7A 4J07A 2ZB3A 3OZGA 4YI5A 2LP7A 1Q7YH 3O84A 1SBIA 4PC6A 1A5AB 3GV0A 1NW6A 5AYVA 3OD5A 2H1SA 4JUIA 4OM8A 2KQXA 3QWIA 4NZYA 4ZVUA 2KPOA 2V7EA 1PEAA 2GPWA 3GUZA 3HYRA 3Q9LA 3WLHA 1UJWB 4LTMA 2LIPA 3HCWA 2HIAA 3PXCX 4ZVVA 5CT6A 4D9IA 4UTPA 2VHQA 2BFOA 2YYZA 3B2EA 1K88A 4DNQA 2JFFA 3E3NA 2E0IA 1EG2A 2I1WA 3RTBA 4A6XA 3RTCA 4C1NA 2GZSA 3SYTA 4ZDIA 3GT4A 5ENDA 4BP3A 5DGDA 3DGEC 1JIJA 2OHWA 5ALRA 3RUAA 1KY5A 1M0WA 2I6TA 3QBTA 2ZIWB 4AQDA 2EHJA 3FJYA 4KLNA 5DBEX 2XAJA 3EZ6A 3RU9A 4AWXA 2ZFUA 3H86A 3P9CA 4TWKA 1VHQA 4DPLA 1ILWA 4EECA 3RTEA 3KM0A 4AQ7A 1B14A 4UVCA 1OIVA 2Y93A 1ZHOA 2O19A 3IMEA 2AWOA 2UVQA 3MTBA 5FWNA 5ES3A 3FB7C 3IVCA 3JWIA 3LLMA 1GKLA 3B40A 5CBKA 3CLTD 4JODA 3R76A 2NGRA 3P10A 1LSOA 2VJYA 3TAUA 3LNCA 3Q9NA 4CZZA 2AZ2A 2XDQB 3TM4A 2DYRB 5KHLB 1LDYA 3K14A 2ZB4A 3HZRA 5BN1A 2WJPA 2G67A 2LD4A 4ODIA 3T1HB 1EUZA 4MKIA 5HQJA 1V8FA 3CKYA 2M6RA 2Y67A 3NH9A 4LK2A 4O5OA 3TZHA 3VR6D 2G7MC 1TKCA 1WXHA 1MOZA 3IAS1 4DUPA 5L9AA 1SS3A 3M5WA 1UKBA 2AT1A 2JH8A 2X5XA 1U9ZA 1LC3A 2ECOA 3BMOB 3M6XA 2F3UA 4HGOA 3KJXA 1J7KA 4WFAV 3MC1A 1KAOA 4HNRA 4YV1A 1BE0A 1FP4B 2BKLA 4P32A 4C21A 4G1EB 1YR7A 4QXPA 1RZ3A 2ZJ7A 1S8AA 1YCDA 1YJNV 3IX7A 4OHBA 1W4BA 3KXPA 1EX6A 1UFQA 4YJKA 5CFRA 2TMYA 3HGTA 1DQNA 2XDQA 3EG9A 3KL2A 3P0IA 4HXFB 4MO9A 1QQ7A 2VQDA 2Y0PA 3E9RA 3NHKA 1LS6A 2BCCH 2RHLA 2H08A 3W8EA 1K9MH 1C0PA 5MGNA 3NTLA 1EESA 2XMDA 1YBFA 5KUTA 2ZSFA 4E13A 1W36C 3VOTA 4B4UA 2QWQB 1O95C 1SC5B 2GPBA 3B09A 2K5UA 3MJDA 2VDWB 2QVXX 3FDXA 3ZDQA 1YL6A 4DUYO 2OBBA 1PFQA 5DECA 4ZQFA 4WA7A 4TV9B 3HQ4O 4UNSA 1SUEA 5LB4A 1L1FA 2JFQA 2VP6A 3IFSA 1CVLA 5JAUA 3PX7A 2ZCVA 1EVZA 1GGMA 3EVTA 3T1YO 3I5DA 1R16A 3CNBA 4HNGA 1T0AA 1C8LA 1CJBA 4FD2A 4AKSA 4HL6A 4LBEC 4HSEA 4TLDA 1O0BA 3C3TA 1NUHA 2QN7A 3BOSA 2P8JA 1DAEA 3TQQA 1FYJA 1RCTE 1Z5OA 2AFVA 1MW8X 1E2NA 2DH6A 2EW8A 2PTHA 4TT3D 1RQPA 3MS7A 1JT2A 1J20A 2C83A 5J2UF 2BFPA 3DEJA 3EG9B 4RH3A 2AZTA 4WQMA 2NZYA 1V5IA 4RSMA 4AJIA 3EW7A 1UMDA 2Q4EA 4LMBA 1G66A 3JR7A 4KO2S 5U1PA 1X0XA 3RVDA 3BFXA 1K92A 3TX6A 1SQ0A 3R09A 1UEIA 3GMDA 4L8GA 4FYJA 1FJXA 1AMNA 2ARKA 2UZAA 4F4LA 2GBOA 2M9MA 4H6WA 4R16A 5D1HA 3UYKA 2I6UA 2ZJAA 1PJ4A 3ZBQA 4DMGA 5A3RA 2YZNA 1TD9A 3GT0A 2F93B 4R6XA 3LCJA 1XWFA 4BYGA 4MTXA 3C45A 4OLHA 2E82A 4DQKA 1L5LA 1X7ZB 3EXIA 2W2TA 3EGVA 3H3XA 3RE1A 4CT5A 2DZDA 3QV1A 4IIUA 1SO8A 5AK4A 1B76A 2IHUA 5FTJA 2IYAA 3MTQA 3AU9A 2DMRA 4FOPA 1HLPA 1RJDA 1S8NA 3OUUA 1W73A 4IHKA 2PWPA 4NCAA 3D4LA 5DNVA 4EA6A 3PQ2A 3BL5A 3QXHA 4MGIR 2POCA 1KKLA 1XMQO 2ID8A 2MSNA 3PUVA 3V4SA 2KHZA 1YVUA 4G0VA 1KBHA 4OUDB 1ZYUA 2H1CA 5FPYA 3IAM1 1ETHA 1C0EA 3PA8A 1TMGE 3T99A 4LCUC 3O8DA 4ML3A 5EXPA 3COJA 1OXKB 2H4ZA 1DDGA 1ZDMA 1NJ8A 1D2NA 3DV0A 4HJXA 5CFNA 5IF3A 3WAJA 3ABZA 2DN9A 3H1IH 1NZDA 2PMKA 2QTSA 2DFKB 2H3EA 3WB9A 5DMXA 3RGGA 1ZESA 3BKWA 1ND5A 3U7EB 2QRVB 4V03A 1PV0A 2VH2A 3WU2Z 2UUAB 2BKXA 3ESBA 2LCFA 5ECGC 5BQOA 4QIWF 1YJWV 1P7GA 2HMYB 2WTBA 4KK4A 4YUWA 1QZXA 3AJEA 1ZHHA 3NVIB 1G2PA 4XQ0A 4B83A 2O8BA 3UH1A 2IW1A 1CY0A 2CNWD 4WF9V 2EJBA 3ZXXA 2P6OA 2VJOA 2AF3C 4FFPA 4GLFA 3UCXA 1T2VA 3H9QA 1XEXA 1IIRA 2Q62A 3WJ2A 3UVEA 1Y5IA 2M1XA 5E6RB 1HL3A 3DLTA 1T2CA 1U96A 4HAZA 4TT3A 3PFKA 3LC0A 1Z6QA 2PSFA 1SGWA 4FHGA 2ISCA 4G0YA 2O3TA 2PZMA 1HEUA 4UJ5A 3RQSA 3TD9A 4RNCA 3WDMA 1C14A 1SKBA 2M6LA 3JX9A 1Q7YW 1T1EA 2NZ2A 5IVHA 1ZD2P 4HDMB 1KP2A 1V55B 3FBWA 3QG1A 1N8KA 2ZIZA 2ZI9A 5J1SB 5ARBA 3FFAA 5CNKA 2WLIA 4U9IS 3TLCA 4B3TO 3LDFA 5H68A 2AJBA 3K5PA 1Y4SA 1I3NA 4WLOA 3SMQA 4II7A 3RG2A 1DKLA 3P9SA 4QU5A 2XCTB 5LNK1 1OT3A 2I2WA 3NHLA 1UPAA 1VEWA 4GRAA 3RASA 1YDHA 1P5ZB 4FR5A 1EUYA 2WPDA 2AH5A 1C2YA 1NLZA 4M22A 1J5XA 4Y6LA 1MQ9A 4K1LA 4WZBA 4BCDA 5FWXB 1FRQA 3WAGA 2ZG6A 4J6EA 1CEYA 3VX3A 5GONF 3KQUA 3FD6A 1I7DA 1GGVA 3DTYA 3K58A 1X8LA 1DBIA 4LDZA 4KBGA 3FCEA 2VYND 1R0LA 5ALFA 2NVUA 5AKEA 3WWDA 1EXNA 2CF6A 1N33O 4KCGA 2ZRFA 4LDPA 4UCWA 1RIIA 3DW1X 1GK9A 4FHFA 4LMRA 5BUSA 2IOYA 2IVZA 5IAOA 4LF9O 1NATA 3NPAA 2WSSA 2OCLA 3A6EA 4RD4A 1F60A 3H2YA 2Y99A 1XN1A 1JX6A 1ZVMA 1OGYA 1GMGA 3OEED 1XZMA 4M8LA 1YS1X 4PQRA 1AGNA 2DHCA 3EMDA 4W8HA 3DF7A 1TK2A 3WGMA 5HOQA 1SELA 5JD4A 3TTYA 4P7BA 3RC9A 3ZMZA 1KK0A 3O92A 2AN3A 1T5LA 1XQXA 4TWZA 2IZ7A 3TE6A 3PUYA 2NUAB 2GM4A 3OM0A 3RT1A 1L5QA 3B1WA 4Y9TA 4R2IA 3SYKA 1VXRA 1EBBA 1T4MA 3BHPA 4HAIA 4YJFA 4OH7A 3SR3A 4URXR 5C3UA 3A0UA 4KAAA 1NLFA 4S0ZA 1NM5C 3TAXA 2BFWA 2FW9A 1L0BA 1LPAB 3H1FA 2QVCA 1BCSA 5KSPA 4Q6GA 2BJHA 3FCAA 3MCVA 3MFQA 3P2JA 3R5JA 5U4QA 3VZCA 3AUUA 3BHNA 4QTUB 1NVTA 4ZAZA 3BPZA 2P1RA 3RIMA 1RLTA 1USWA 3IBCA 5KNDA 1WXEA 3E05A 3HWX1 4GICA 1V11B 2JFWA 3A9VA 4YMGA 3GYBA 3KAJA 3PFWO 3O82A 4IDOA 2QMUA 2YXZA 4YXWA 3DXRA 4B76A 4BWYA 5C32A 3E1YA 1DDOA 3ZJTA 5CXXA 2PFGA 1TZBA 3B3JA 1B1AA 2GH1A 3FROA 4AKTA 4BW9A 1JB9A 2YIDA 3MJSA 8ATCA 4S35A 1NKVA 4CMGA 4BFXA 1N0VC 1NNEA 2ZI3A 3OICA 4PS1A 2ETXA 2FQQA 4G8DA 5AKIA 2WWTA 4C1BA 1WW3A 2WSSG 4JI6O 5EJMA 3ZHBA 3CNNA 3CZMA 1HQYE 4N39A 2VLIA 4DSTA 3PF8A 2BTQB 3L8EA 1S6YA 4JX8A 4HHEA 1R4AA 1QUEA 1Q0ZA 4BFYA 3PYXA 1TJ3A 1SUIA 1FDWA 3AX6A 4A03A 4CMEC 3C5EA 1O6ZA 3L43A 4FYPA 1NYTA 1EDBA 2AD5A 2WP0A 4NE2A 1M90H 1NMEA 2C88A 3AKCA 3ESZA 3K15A 1DWQA 4WNIA 3U62A 3C9RA 4Z4CA 1Z63A 3DHNA 2X6AA 4D7SA 5EXDA 5HIIA 1UC9A 3FYCA 4BLRA 5B7QA 1M2JA 2IQQA 4BLQA 3DT8A 1RHRA 4MWEA 1P39A 2AQ8A 2H59A 3H2SA 3N8IA 1X25A 3O2JA 2O0LA 4DA7A 2EW1A 2FR0A 3MOIA 4HOYA 3TCXB 1OWPA 4PSDA 2FU5C 5E1BA 4LJ5A 2K6GA 2M98A 4KP7A 1R6UA 3FLAA 4EW2A 5ADWA 1KJ9A 1JRLA 1AB3A 4GBJA 1RPOA 3UW1A 2LJ2A 2I66A 3ESYA 5ILGA 3VNQA 2N46A 3IEMA 4YCJA 2ORED 4GP6A 2O8VA 1A32A 2D7JA 2FFBA 4P33A 3W7AA 4PELA 3WLMA 3VKVA 1EVJA 3GVCA 3PYLA 2DW4A 2K1EA 1ZL8A 3TB6A 3UGJA 2BZSA 4QYMA 3ZU6A 1BZKA 1T6NA 1TA4A 2XMQA 1SXJC 1YI8A 1Z7YA 3AIMA 3CSUA 3CCCA 1FSSA 3G1WA 2V59A 1RWPA 5FOXA 1G21A 4DLLA 4N01A 4O2AB 1WUYA 3VA7A 4JOBA 4UEOA 2O4UX 4BB0A 2EP5A 2C7VA 3RWMB 4HS9A 5FL7G 1OLXA 3ZMUA 4FFKA 1XMOB 2WA4A 1X7PA 1ADGA 3PC7A 3QFTA 2NV0A 4UM8B 3IKFA 4UUOA 4DMLA 1VG8A 4OGKA 5HUHA 2BH2A 2PYLA 1XQ8A 1WUTA 5B1AC 1K9SA 2WEKA 4CNQA 1PP9H 2H48A 1NQOA 3WFVA 3EAGA 3C5WP 5DCVA 3G2PA 2FUKA 4JDPA 4MI1A 4OU5A 4PG4A 3GLQA 4PU0A 4XB2A 1GOTA 1P19A 2TMKA 1N6KA 3WS7A 4AJ2A 3SYLA 1NVUQ 2J9GA 4X62B 2H7XA 5JG7A 4GR9A 1L7RA 4PXSA 5JNVA 2EX0A 2GAJA 1PBTA 3OAAA 4LQ4A 4IO1A 4MV5A 3TQTA 3VC3A 1SVKA 2OLEA 2OA0A 1DCTA 3ZE8A 5K0CA 1RZRD 1ADYA 4J0HA 3H1EA 5DM1A 3QU2A 1N6PA 1Q0QA 1JJIA 3KYIB 4LRYA 4OQNA 2OIEA 2QK4A 2K4MA 3AERA 1I51A 1R0YA 3FLBA 3FKSD 3NNSA 1LUAA 3RS8A 1EFAA 1C3XA 3QPUA 2C4NA 2HREA 1YJWF 2C4UA 2P0YA 5KQGA 2E5WA 3HSKA 5M2QA 3VMFA 2ZDGA 4H31A 1L2TA 2DPYA 3IEPA 4MCAA 2D5IA 2FFJA 5J9PC 5JFTA 3PXAA 4RIGA 2P6YA 4HMOA 3K9AA 2ZTMA 4JN6B 1NVKA 5FTKA 3S2GA 3CIOA 3U4AA 1Q8RA 2QRJA 2QRPA 4OCZA 4QJ5A 4PLYA 2Z1NA 1AQLA 3OQIB 3NBXX 3PV0A 5F78A 3ROTA 4DPMA 5TJ9A 4LJ7A 4AY2A 2A5JA 1O3YA 1YRAA 1ZMOA 2GOYA 4ENPA 5IFKA 1GTRA 1YMVA 2WIGA 2D0OB 1E2KA 1E96A 4YY3O 1TQ4A 3EZFA 4XSGA 3ZGLA 4TMKA 4NMMA 4IDPA 1Y6JA 2W43A 2XCOA 3PXXA 1R7RA 4ZC1A 4GGMX 3PRJA 3PR3A 3WNCA 2PZJA 4C03A 5KDLA 3R77A 4EVRA 2ZXWC 1GX1A 4Z3DA 4RADA 521PA 4TKVA 3RREA 5JBQA 1YJCA 2Q0SA 1ULUA 2W8BB 1LBSA 2X3YA 3A4NA 5WRFA 3K70B 1X7DA 1GGFA 3O4JA 4P9OA 2GUWA 2YCLA 5I4BA 4D57A 1F8UA 1PR5A 1PTJA 2GZ3A 3SU8A 4BQFA 1JJVA 2ZXEA 3FPGA 3NATA 4W6QA 4TT8A 3URKA 3O2QB 3F3KA 3OSZA 1IBCA 2PO7A 1XRMA 3EIFA 3CCVF 3HC7A 3NIDB 3PPIA 3ROXA 3SF8B 1F2TA 1ESCA 2X77A 1M34E 3DBVO 5GM1A 2O8DB 4EKWA 2DPMA 3QFFA 4D80A 1ZRSA 3H99A 2AJCA 3K8YA 5BSMA 2UVPA 1Z5PA 3MWLA 3MD9A 1PNMA 4KSCA 3DXYA 4S1OA 1E2HA 1LDNA 2BI7A 3IQHX 2XVAA 4DK0A 3AVQA 4NS4A 3VIUA 3GJ0A 2BHSA 4H9GA 4JL8A 5BN5A 4DREA 2WV9A 4Y3UA 1IBLB 3M81A 2BGRA 4ZV7A 4G09A 1LFDB 2V9YA 1U8AA 2AC7A 4J3FA 1SQQH 1KFCB 4TWRA 3WYEA 4E1VA 4U0KA 1QBKC 1VQOF 2Z1TA 4X63A 2XB2A 3UO2A 5D5PA 4LWOA 3ROZA 5BXZA 3N76A 2UUPA 4NQ3A 1RPJA 2H31A 3IPAA 2DBZA 1VLZA 1YASA 2ZSAA 2AEMA 3O9ZA 3PE4A 4HKTA 3SKYA 2QD4A 1FEZA 3I09A 3HJFA 1G59A 4B81A 3HA5A 2CMFA 1L5YA 2I29A 4GX0A 1E9SA 2AJDA 3C3YA 2PZSA 1VQVA 3UBMA 2VF7A 5HBRA 5JISA 1C1DB 2JI6A 3PDWA 3OMAB 1DKPA 3LHSA 1FXVA 1WULS 1PZGA 4EJSB 3BY6A 1J06A 1E2LA 1OXSC 4GYWA 1Q1BA 3UJBA 4UHBA 4FK8A 1KPHA 1D07A 1CY8A 4HLDA 4JA2A 3JAWB 4D3FA 4RESA 3SC2A 5J3JA 3C6BA 3LK6A 1ADBA 1SRYA 2BSKB 3LWOC 1Z4JA 4QPDA 2ZJ8A 3DLPX 3NR2A 3WJPA 4E46A 4DLPA 4MK4A 2I6FA 5SY6A 3SXPA 3RYHA 4C7OA 3SJQC 2DC1A 3SYAA 5LOVB 1W4ZA 3DLCA 4U1RA 4UBOA 2LTAA 2W2QA 5MDHA 4IG9A 4MLCA 4CCAA 1A88A 5KNDD 5BWNA 1NT2B 4D9EA 3NAQA 1M2OB 3JS5A 4P3PA 4UOEA 1AMOA 4GM4A 3CRZA 1KJYA 3PXBA 2CZWA 1T9ZA 5LZ2A 4AW9A 2FX3A 2WSIA 1VCNA 5IKPA 5JCJA 5JAHA 1VE5A 2HA7A 3PHJA 4Z3KA 5L6LB 1Q86W 4RVHA 4MV8A 4BGVA 4QLBA 3RVYA 5H4HA 1MVNA 4EIWA 3MBKA 1QH8B 5JQGB 3KJNA 1HNXB 1P1KA 2IDZA 4G8BA 4Z8XA 4U00A 2ZSJA 3FOEC 4ERXA 4TQAA 3I6ZA 5DBFA 4G6ZA 5DEDA 3T7SA 3KU1A 2WT9A 3CPSA 2YIJA 1LQ2A 3DE0X 4P2GA 3BUSA 4RHXA 4UTXA 3KEGA 4WASA 5EJFA 3KSRA 3M9LA 2X86A 1ZFNA 1ABEA 3PJSK 2NXJA 4XCQA 3PUJA 4JT8A 4BQNA 5AVRA 3R4VA 1MOPA 1VQNV 4J2OA 4PYIA 3MAAC 5AFSA 2QEXV 2X5KO 3GGPA 3K9CA 2IU3A 1N7JA 3UYLA 2W6JD 3BGDA 3NRBA 4O2LA 2QY6A 1DUVG 5IKXA 4QIHA 1EDOA 3HKBB 1Q2UA 5FO1A 4FIZA 4X65B 3Q8KA 4DLKA 2ZKLA 3F98A 1GAEO 2OCDA 3FDZA 1TRKA 1JHMA 3HVIA 3N0VA 4UMFA 4JI1B 4UC0A 5L4SA 3I6BA 1C1XB 2MSWA 4DARA 3JVEA 2EZTA 1S1MA 1MGOA 1J23A 1FS4A 1RP3B 1DAGA 2RMKA 4UBJA 1NJ5A 1XZKA 2QRUA 5GM2A 1H5NA 3G8YA 1VGVA 3ILYA 4PLPA 1WAMA 3UGTA 3WMGA 1IY1A 2BPOA 5C7YA 2C9MA 2QZSA 4MW6A 4O4LA 1B8OA 4IM7A 3ZHXA 1BMFD 3MB8A 4HGPA 1O89A 1JR2A 1KU0A 2HS0A 3DEIA 4Q02A 3M49A 4ZAYA 3SPIA 2C2AA 1L4NA 3ASYA 3H0KA 2HWWA 3R7NA 3PNPA 4L4XA 4DIOA 2KTUA 3U48A 4CV1A 3LUAA 5FAXA 3WKCA 2FN8A 3QVTA 5DK6A 2RK6A 2Q3MA 4AZWA 3N6VA 3I5UA 1M74A 4JGBA 4HDCA 4ND5A 4CM9A 4EL0A 5K3FA 4DQLA 4ZQHA 3SD7A 5LQMA 2HJFC 5EIWA 1UZNA 4UREA 4HNAB 2V7PA 2CHUA 4MR9A 1A9XB 3RYCB 3NW9A 2ZB8A 3ZHRA 1JSXA 2PX4A 3F7VC 1FNJA 3PDUA 1EEXB 4IIGA 5C81A 5FX2A 3I42A 3BMXA 3QKIA 1N6HA 2I71A 2PA0A 2WYHA 5FADA 1MMMA 2WJJA 2VSOA 4L5YA 2P5SA 2ARHA 4D0LB 1CJMA 1BGWA 3LCCA 1FFTB 1RPNA 3A8TA 2I3ZA 3HCCA 1MVOA 3FBGA 4L3WA 2FEKA 3ROFA 1KJQA 2JVIA 3UJHA 1YMUA 4QM7A 4IDDA 5B8FA 3FDJA 4FHCA 2HYIC 3I2FA 4CM8B 5DTIA 1JZSA 2YCBA 1JPUA 3H9EO 4IIHA 1ZR4A 2GLUA 1KKCA 4HO1X 3SSOA 2GCNA 3J7TA 1XROA 1DGQA 3NEAA 4GE3A 1XMJA 2OBNA 3IKTA 1UKYA 4AJ1A 1CDOA 2Y77A 1DTSA 1ZITA 1KYTA 1EJ0A 3W1EA 5JYEA 3STYA 1JDJA 4GBGA 3KQTA 4C7UA 2QN8A 1DO2A 3BJZA 1DLJA 4ZQCB 4E32A 4LYAA 4FBGA 1AXRA 1GCOA 5DOVA 4B1FA 1ITZA 4E03A 4YP6A 4KZKA 4MVYA 2XCSB 1FVXA 5JVDB 1RADA 1T4GA 3LPNA 4QNNA 3OPVA 3VPBA 5JZBA 3BF8A 1O5IA 2EULA 4JI4B 4I7ZB 1MT0A 1Q0HA 2P5YA 4KRXA 3G0GA 2VDWA 4HDOB 4M9CA 4UEQA 1RHKA 3R7DA 1XCJA 4UARA 1T9GS 1Y74A 5BV8A 3EY9A 4GL2A 3PN1A 2OV3A 3BBLA 3ICPA 4MZXA 2X5OA 2CUTA 1R3DA 5KNCH 3AESA 3SHFA 3UAVA 3GLGB 3K1JA 1FSZA 1PYOA 1JIKA 3CURA 1A7AA 4O4JF 3R7SA 1R8QA 5FUYA 3RODA 2G07A 1FFWA 5AJUA 2A88A 1V95A 2AJLI 1GGNA 2W0MA 1LEHA 3O4RA 3PLAE 1BXRB 2VHVA 5DWQA 2YR0A 3OOJA 1ZHFA 4EELA 1X94A 3AW8A 3EUWA 3T1HO 2M7WA 2EILB 1CE8B 3JZMA 1NPTO 1PL0A 2HADA 1WXWA 4MYHA 4NRDA 2RIRA 3TSWA 4EYOA 2P41A 3H9JA 5B1OA 1DEOA 2PZLA 3QLVA 2HV9A 1UODA 2FW0A 3B78A 3LRXA 3MYRA 4LXGA 4WVLA 4PIVA 1JSLA 4LF9B 2G08A 3U40A 4F8YA 1AP6A 5TXGA 5GV8A 4UCVA 2J0EA 3OZFA 1NXVA 4G2KA 1ODIA 3IKLA 3P9XA 4PW0A 1NKSA 2XEXA 4FE4A 4Q1VA 4BEVA 5C46F 5AXAA 2ZBEA 2JKVA 2HO5A 1GU7A 1GQQA 1XCMA 2WIJA 4XQCA 2YY5A 4ND7A 1MZFA 4ZARA 1HUQA 2YUIA 4WNAB 1ZINA 2PLFA 4JAVC 2GHYA 3T9AA 1NH2B 2FR8A 3G67A 2VJKA 1ZL8B 2N75A 3N70A 3V7YA 1FFYA 4Y1FA 4Q9DA 4JLBA 3P2IA 4B3GA 4QREA 3MEQA 2D2IA 3S68A 3UMCA 2QUJA 2QTCA 3TIGA 1NN5A 1N75A 3CX7A 2XASA 3AW9A 3STVA 1PE0A 3RRZA 5LOVF 4HGNA 3BSYA 4C7BA 2Z83A 4KNVA 4IOMA 3DDUA 1LD3A 3RW9A 3ENWA 4NU8X 4YEDA 2L0XA 3DC6A 3OKPA 3U39A 3B8NA 4B62A 1QFJA 3NLLA 2F43G 1OZ0A 3PKZA 3TG2A 1K97A 1VIBA 2WWRA 3HWRA 2R44A 2XKAA 4UNRA 3IDAA 1HE3A 5CVTA 3HPLC 2HWYA 4XCXA 3CRMA 2CK3A 3Q6MA 1HX7A 1QZZA 2IY8A 3S5UA 2IF0A 4WA8A 3TR6A 4Q9IA 4F9FA 3ZPXA 3HCEA 1ZLYA 5FQNA 1PT6A 5DYGA 2RAPA 3UGKA 1PUXA 4AN4A 1KXJA 3H5OA 4F06A 4F12A 4FM9A 3HXKA 5H9VA 2PHNA 5LJIA 4YRBA 2A30A 1W46A 2PR2A 3OCWA 3CNLA 4XWOA 7AT1A 1AUQA 2CGNA 1CLUA 1JALA 1VPEA 1FNNA 2ANCA 2RGUA 3EC2A 4KNWA 4MLDA 5ALXA 1X1TA 5JRZA 4LJSA 4KOAA 4QPNA 3ADPA 1FSFA 4YJ3F 5C5EA 3NXSA 2O0MA 4BRWA 3IVAA 1GTVA 5FOWA 1PK8A 3AEUB 4GMHA 1ADCA 1KSHA 1QHFA 2R6FA 4LN1A 1Y67A 3ZWNA 1ST2A 1SXJD 1YBVA 3K5WA 1A8QA 1G20E 2GTHA 3ZU2A 4ER7A 5KUMA 3P19A 1JQEA 4EG7A 3DFZA 3TS1A 1OX6A 1YDXA 1I4TD 1VMAA 3NIGB 4RSHA 1KL7A 3FNEA 3RAPR 4EYGA 3WJQA 2OFOA 4TYYA 1QQCA 3LE8A 1V54B 1PHPA 5UKDA 4GT1A 5GZ6A 1K7EB 1G18A 2D06A 4A2PA 1HEYA 3C43A 3R5FA 1V1RA 3C3CA 5TGTA 5EC1C 1VMIA 4HTAA 1BHSA 5C8VA 1T8YA 2DYRC 1CQXA 4ZCRA 1SVMA 2RGRA 1VXOA 4R40A 3U9LA 1V7ZA 5DB4A 5IN5A 4RQUA 2EZ4A 2NTYC 2HQRA 1NRWA 2D8AA 2HVKC 2VRCA 1OLSB 2XAAA 2I76A 3UJ3X 4CDRA 5IJWA 1U0FA 4Y2SA 4O2AA 3SJ7A 4KL1A 1C9YA 2DPGA 3PWSA 2C98A 1FZTA 1OWMA 5ITSA 5NLLA 1GHTA 1MAVA 1QU9A 3ASOC 1UXHA 2BEVB 1J25A 4UDXX 4UZEA 2GCEA 4JU9A 3NASA 3U56A 1OI3A 1AQNA 2V5VA 2Z6QA 1Z8HA 4P8RA 5FWAA 2ZJBA 1YB5A 3I62A 3JAKB 4YC7A 1JHZA 2FSFA 1G4UR 3VAZA 4A23A 5FYDA 4S1NA 3IP6A 1VQ6V 3EVEA 4EHDA 5KX5F 1QP7A 1CP2A 3TQCA 1U0HC 2XAQA 3QI2A 4JP3A 4U4AA 5BQFA 4JX9A 1USKA 2CHSA 1Z0SA 1W2GA 2IHTA 2CWDA 2PX2A 3L7KA 1Q22A 3QW2A 2PGGA 1CR6A 3MMZA 2PGLA 3ZQ6A 1L4UA 1HDJA 3H1BA 1JA9A 3IJRA 3GRYA 3WTCA 3QYJA 3WYGA 1YS7A 1I9CA 3RWRD 1U2SA 1EAYA 1E9EA 1KAGA 4LFBO 1KI3A 4IYRA 5DT9A 3WLQA 1RI2A 4B34A 5B58C 1VLHA 2DPXA 2VBCA 2EQAA 2YINC 3IQEA 3L7OA 2I6RA 1VCOA 3N3AC 3Q9UA 2OL4A 1XK7A 3GFFA 4Z0TA 5FWYA 4CFSA 3C41J 1G42A 5B3KA 1HZJA 3P4EA 1YE5A 2OE2A 3UN1A 2DCUA 2YHAA 2X6TA 4MJXA 4DV6B 5AW5A 2OV6A 2CTWA 2HA0A 2OXFA 3H6GA 4JR1A 4Q3EA 5G40A 1OQAA 2NQ8A 1QIDA 4HDMA 3QX8A 3I4LA 1CULC 1UXIA 2YVKA 2JZOA 3OEHG 4HAWA 5CT9A 2QWRB 4MB6A 3WG7B 5BV1A 2VKQA 2V8BA 1JR9A 4IQ4A 2IYRA 4D6PA 3WK6A 4HX2A 1V4NA 1ZKMA 5CJJA 1EVLA 3KSZO 2GXSA 1IJBA 4L16A 1P74A 4QDUA 3S2UA 3CPWF 5A3SA 4YY3B 1DAOA 5BW5A 3ML1A 4MWOA 1WQ3A 1GJRA 2ZIGA 5IKOA 1XE3A 2O2JA 1SHTX 3ED5A 2HKIA 1RI1A 1RQRA 4Q47A 5G0SA 2IUUA 4IXNA 3AV0B 4Y6PA 3BHMA 4MNTA 1OIXA 3OZAA 3SQDA 4B4VA 5CU7A 4MR7B 4O2RA 4B40A 4NZZA 5GONA 3HDVA 3T9FA 1VYTA 3AK3A 3IP7A 3OWXA 1JVBA 4QDXA 1CHNA 1U6IA 2VZ9A 4WKOA 2KW5A 1CZOA 2J9YB 3BE8A 3GG2A 2JI8A 5DYNA 2PUGA 1XTKA 3LWQC 5F7ZA 3SYMA 3EMVA 2IWHA 1L1QA 2G71A 4IGAA 5IABA 4RMGA 3KLOA 4UAJA 4WZAB 4ZVRA 1P73A 4KACA 4MPPA 3HBMA 5REQB 1HQDA 1U99A 2BEWB 2O52A 4QXAA 3RFXA 8GPBA 2CXXA 3UJNA 2FG5A 2PL9A 2JJ1G 4WCFB 2LQTA 5A9SA 3WG7C 4ABMA 4IEEA 4MH0R 3I73A 5LZ4A 2YWJA 4UVDA 4NOLA 4EL5A 1Z56C 2YYYA 1JYEA 4CZ2A 1LU9A 1UPBA 5C8YB 3SZUA 1A7UA 3S81A 4LNAA 4CI0B 1C3OB 2Q1UA 4TZKA 2B8JA 4TS4A 3TL3A 3MWKA 5LD2C 3KXIA 2CTRA 3L0DA 2QAGA 4BMVA 3RVSA 3D8UA 4XGQA 4CFZA 4OXNA 4G0OA 1W1UA 3KKZA 2XJ4A 2FFRA 3FMIA 5DPMA 4WEQA 3UB2A 4B6QA 3ZCXA 4CM4B 2GM5A 1R6NA 1YQNA 5AMXA 5ESRA 4EPWA 1SKUA 4PDLA 1U0OC 1ZXBA 2P9FA 3Q10A 4HYQA 1NS1A 3RV3A 4BO2A 2DETA 4JIMA 3DS8A 2H5IA 2FGYA 4DV0O 1HY3A 1Q5PA 3AGQA 3NDIA 3THOA 3QMVA 5CB4A 4MW1A 4FFBB 6GPBA 3OGCC 1UZLA 3NQ41 4QJ4A 4I5IA 2JLSA 3GQBB 2PGAA 3TQSA 3MBOA 3K0EA 5F23A 1FTQA 4AY6A 3LCMA 2Q7HA 3GWGA 2DYKA 1J0CA 3NWBA 3NETA 4QBTA 1XQ6A 5CVCA 5A4MS 1JG1A 1ZJ6A 2YKGA 3GZNA 3KJFA 1K5GA 4IZIA 1ZJWA 4PAQA 1ZWIC 4LJ8A 4X8HA 3ZWQA 4GR5A 4G1MB 1J8VA 4ES6A 2R00C 5AK6A 1Z6PA 3RJMA 3R9IA 3EZ7A 1Q92A 4BAYA 2J3QA 2K2QB 3W3ZB 2XIQA 2QAGB 4KRGA 1TM5E 2LCAA 2DH5A 3IH5A 2PGXA 3MDOA 3VH3A 5HXUA 1E1QD 5L45A 4HH3C 1RYHA 1ZG3A 5E4FA 4ETMA 5KTSA 2C9OA 1MO6A </