1TUBB

Tubulin alpha-beta dimer, electron diffraction
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
427
structure length
427
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUBULIN
publication title Structure of the alpha beta tubulin dimer by electron crystallography.
pubmed doi rcsb
molecule tags Microtubules
total genus 88
structure length 427
sequence length 427
ec nomenclature
pdb deposition date 1997-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1tubB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1tubB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1tubB01
3E22A 4EI7A 2RHLA 4O2AA 3VO8A 4I55B 3RYCB 5FNVB 3HKEA 4DRXB 3WGJA 3WGNA 3HKCB 1Z5VA 4F6RB 1W5FA 4TUYA 4HNAA 5JVDB 1TVKA 3JAWA 4ZHQA 5J2TA 1W5EA 3R4VA 3HKEB 4LNUA 3CB2A 5JH7B 2XKBA 2R6R1 5JCOC 3M89A 1FFXA 4O4HA 5GONA 5MN5A 4HNAB 1RQ7A 1TVKB 3RYCA 4E6EA 4ZHQB 5J2TB 4YJ2B 4TV9A 4IHJB 5CB4A 4X20B 4LNUB 2VAMA 3M8KA 3UT5A 1FFXB 4O4HB 4EI9A 5GONB 1Z5WA 3JASA 2VAWA 5JVDA 2RHOA 2RHHA 1JFFA 5EYPA 4TV9B 5CB4B 2BTOA 5JH7A 5LA6A 3UT5B 5LP6B 1FSZA 3WGKA 5M7EA 5IJ0A 1SA0A 4B46A 3JAKA 3JASB 5EZYA 3VOAA 4ZOLA 5J2UB 1JFFB 5EYPB 4YJ2A 4IHJA 4X20A 5MN6A 3ZBQA 3JALA 4O2BA 5LA6B 3VOBA 5IJ0B 2VAPA 1SA0B 1TUBA 2BTQA 3VPAA 3JAKB 3N2KA 5EZYB 4ZOLB 4WBNA 3HKDA 2Q1XA 3RYHB 1W5AA 5JQGA 1OFUA 4X1YA 4O2BB 4I4TA 3JALB 5IJ9A 4X1KA 5LP6A 3C8LA 4I50A 4KWEA 3HKBA 5LOVB 5IYZA 1TUBB 5EIBC 2BTQB 3JARA 5BMVA 5KX5B 3N2KB 5J2UA 4WBNB 2Q1YA 3HKDB 4DXDA 4FFBA 5JQGB 3RYIB 5C8YA 4X1YB 4I4TB 5IJ9B 4X1KB 4I50B 2GVIA 3HKBB 3JATA 5IYZB 3JARB 5BMVB 3RYHA 5CA0B 3N2GB 4O4IA 4FFBB 5KMGA 4YJ3A 1W581 5C8YB 4U3JA 4U39A 5LOVA 2XKAA 3JATB 5KX5A 5LYJA 4EB6A 3VO9A 4IIJA 4X1IA 5JCOA 4O4IB 5KMGB 3RYIA 4YJ3B 5EIBD 1RLUA 5MN4A 4U3JB 4O4JB 2R751 5LXTB 1RQ2A 3RB8A 5LYJB 5CA1A 4EB6B 5CA0A 4IIJB 3N2GA 4X1IB 3E22B 4O2AB 5ITZA 4XCQA 4ZI7A 1W59A 4TV8A 3RYFA 5CA1B 4O4LA 4TUYB 3WGMA 5LP6C 3V3TA 2RHJA 3ZIDA 4EI8A 1W5BA 4I55A 5ITZB 3WGLA 3JAWB 2VXYA 5FNVA 4B45A 4ZI7B 4DRXA 4TV8B 3RYFB 4O4JA 4M8IA 5LXTA 3HKCA 3ZBPA 4F6RA 4O4LB
chains in the Genus database with same CATH superfamily
5LZ7A 3V9PA 4F92B 1U2QA 3WLJA 4ZK7A 1PU2A 4RGYA 5JZOA 4PX3A 4AQYB 1G60A 2WHEA 3IKLA 1JJAA 4DR2O 3KQVA 1UEIA 2VEDA 4M0PA 4NV0A 3COWA 3USZA 1B14A 3ZQJA 2J3EA 3HEBA 4G5YA 1Q14A 2QTGA 4DTCA 3K9QO 3JASB 2P91A 1H2SB 1OCRC 4A8HA 2P5YA 1XZBA 5GV8A 3SLRA 1TZ2A 4R7ZA 1AN0A 3AY3A 5DM2A 3KAQA 2HSZA 2J5KA 3TNYA 5A06A 4IAOA 4MEBA 3KL2A 4N47A 3DL4A 2I2CA 1K5HA 1RWOA 3WGYA 3VVLA 2NV6A 1QQ7A 3ELCA 2OD9A 3BTUA 1T2EA 1XCGB 2H57A 4BO5A 3ZYCA 5I51A 3GLHB 4TQDA 2QN6A 1I24A 3ZQ6A 4KFCA 3QJGA 3BCRA 2EILB 4J94A 1UPXA 5FEUA 4I99A 2QQ0A 2FW9A 3ROKA 5A3SA 1R0LA 3OCJA 1EAYA 2OP1A 1FFDA 1DRUA 3R76A 2ZTVA 2QP9X 2OORA 4CDNA 2HP3A 3VOBA 2FUCA 2TMKA 4WK4B 3RU9A 4MOWA 3CPWF 2E1RA 6GPBA 4RJ2A 4AUKA 5C52B 3FB1A 5KS2A 1HPLA 4JLOA 3DG9A 1SBQA 1DOZA 1S77D 4UJ3A 4X91A 3GV0A 2HWYA 1J9GA 2Q6KA 2X8JB 1VQOV 1F51E 4YDRA 4LVCA 1QPZA 3GLQA 5E7JA 4V0RA 1FF9A 3BWVA 1YKGA 4A0RA 4Q37A 3PD0A 1DIGA 1L7MA 4LQ4A 4O2AA 4X54A 2RCVA 3G0HA 5AVKA 2FH5B 4QBKA 5JOQA 1JR6A 2C00A 5LLSA 5LQSA 4QPPA 5K2OA 1TC2A 2CNKA 4QU9A 4DBLC 1AQUA 4A9AA 1KJ9A 1U0FA 3CRZA 3BBPA 1WSAA 1WB9A 2RB5A 1M7BA 4QGFA 3L4EA 1M57B 5KX5B 4JJZA 1ZN7A 4UDXX 3SVTA 4FDMA 1Y3FE 3M83A 4MT8A 5CA0B 1OXKB 1RRKA 1KETA 3ACCA 3Q3CA 1MQ9A 3W0LB 5EVCA 1TT5B 3HDJA 1NJIH 4B17A 3LQ4A 2MSWA 4YAEA 3B6KA 2OZKA 1WDMA 4QRDA 1C9NA 4O2AF 1KU9A 3ETLA 4GECA 3HXKA 2FA9A 4FGWA 2AN9A 3RUEA 1J0DA 4PLGA 3KDSE 4RBNA 2PSEA 4B4DA 2GPSA 3JR7A 2P41A 1WA8A 3T3IA 1I80A 3TSAA 4HQLA 4YJFB 1BGWA 1UJ4A 1Z17A 4P4SB 1SA0A 1MB4A 3LDFA 1WCIB 1EXMA 4NPHA 3VTFA 4NZZA 1AKRA 2BZ1A 3QY9A 4KQ6A 4PGAA 1R9JA 3BXEA 1JH9A 3RASA 4MUMA 4DLYA 1E2NA 3MSCA 2CTWA 2EZTA 3O90A 3RADC 2VDRB 3ZQKA 3UVEA 4OGQB 2C1ZA 3N0WA 5HUHA 3TJRA 4ZXPA 4JA0A 4F60A 5I47A 2IQ5A 5LDGA 4BO2A 4D57A 5JPDA 1QU2A 2C4TA 2OCBA 1U5CA 2WIDA 3W4JA 4H31A 1YJ5A 2ANBA 2QK4A 4F04A 4DR6B 1O77A 1UXKA 1LBIA 4M7OA 4MCJA 2BFBA 4JASB 4MARA 2FGJA 1U97A 1QF9A 2FWMX 4EOGA 1LU9A 1HT1E 1BFUA 2QWOB 3Q7RA 4FFOA 1OHHA 1J2JA 2PBZA 2HFKA 3K1AB 3A36A 1ZCFA 5JSKA 3SP1A 3CNNA 4PSKA 1M6HA 4YRGA 2G17A 3OE7A 3WVNA 4RY8A 2XYHA 4ZVOA 3P9KA 2UYJA 1XDGA 3DJFA 4I4NA 5FOUA 1EFLA 4EKDA 4F6CA 5FTLA 3DEJA 1AF4A 4F84A 1K8XB 2XWJI 4JOBA 2A58A 2BO1A 2R9IA 1PT5A 1QYXA 1HYHA 2RGUA 3U3MA 1Y5LA 5IYDO 5AO9A 2FRVA 1PYDA 2ROQA 1ZWIC 1NI3A 3A6HA 3MJTA 1EB8A 2H52A 3C9TA 5K0GA 1VRCA 1F1BA 4TSRA 3PFCA 1G8HA 2CVFA 4NNPA 2ORED 1KVUA 1NUQA 2CHUA 3G71V 3ADCA 4EJMA 2VUIB 4TL8A 5JJJB 1X7XB 4KB5A 4YYEA 1GZHB 2VCEA 4P6VF 4UFNA 1MX5A 3TRFA 1NTRA 5B4TA 4D9KA 2AXPA 1L7AA 2QG9A 3MWJA 2YIMA 2IZ6A 4LBYA 1P7GA 5M34A 1YOBA 5C2JB 1QLEC 3UPDA 2RIPA 4UVAA 2E82A 1VE3A 3B6IA 2JLXA 2M6YA 1Z5PA 4B84A 1KZ1A 5JC1A 2HHLA 4I1IA 2DFKB 1H3NA 1ZG3A 3IDFA 4YXFA 4WN9A 4REOA 1FUYB 1N1GA 1UFYA 3UAXA 4GM4A 4FMPA 4X1IA 2AK2A 2CF5A 2QW8A 5LNK1 3ZU3A 3CC4F 3UO3A 4CKBA 3N5CA 1EN6A 4BRSA 3K35A 2C03A 2CDNA 2ZGVA 4B3FX 3RVZA 1SK9A 4KWIA 3IBGA 3OZCA 3FUUA 4LJ9A 3SEAA 4LY0A 3A9CA 3WTCA 4MZDA 4K9SA 2JEUA 3OA2A 3RLFA 2X76A 3DE3X 4YMTA 3ICEA 3K0EA 2JGKA 1QVAA 4OQPA 2HP0A 3M9WA 2VNAA 1OZAA 2Y0DA 8LDHA 1JDZA 2ZSJA 3AOGA 1A72A 1U3LA 3IJEB 4J9ZB 2QYOA 4P0TA 2YH2A 4ENQA 3H11B 3ITEA 4FFSA 3PEWA 3RVQA 4ZXFA 1CZNA 4BVKA 1P0MA 2JC3A 4MMXB 1K66A 3M3DA 3SNKA 3ETCA 3QKRB 4XD7D 5IJ0B 4YJGB 2BF4A 3IMFA 1M2EA 2IYPA 3X0DA 2JRCA 4NCBA 1U2DA 5GAJA 1DTWB 1CUCA 1QU3A 1G64A 2HLDG 1MO4A 3QENA 3RK0A 4CTMA 4DJEC 1EUDA 1I2CA 4HXFB 4KUGA 2DY0A 5DHAA 4TXLA 2H1OA 1ZR2A 5BUZA 2F1HA 1QH1B 3E9ZA 4Q7MB 1VCOA 5LZ4A 1E9FA 5TPZA 2ZVZA 2C61A 4P3YA 2WB4A 5THXA 2Q4PA 3JTMA 4YXWG 1V9LA 4A8JA 1RSOB 4JQOA 4LMBA 3H5RA 3HBMA 5AG2A 2ZJ8A 5D6NA 4CKEA 1N4CA 1ZRMA 4YVFA 1IAQA 1N7IA 5HQ3B 1FMLA 3TNLA 4MCIA 4IIDA 4BFTA 3AHEA 2IBMA 4F2HA 4TMYA 4ND6A 1XK7A 1VE7A 3AM4A 2R72A 2VHZA 2YMQA 3QA9A 3DC5A 1WA5A 2CXQA 3RA5A 5JZMA 5IYZA 3K5IA 4U7OA 2RG7A 3RW0A 1WXIA 4F2PA 4TL7A 4S1PA 3KVRA 2J9GA 2EIKC 1K6IA 2OBNA 2ZNJA 4ZN6A 2XEXA 3REOA 3HWSA 4KMSA 1IURA 5HDBB 4Y30A 4BUZA 4H35A 1QB7A 3P9RA 4FR5A 5EG5A 3CQ9A 1XE3A 1UKVY 4KQ2A 2C1EA 3GO4A 2DULA 1ZK3A 1PQ4A 1GUYA 4DLNA 1WMFA 2Q7EA 3T3NA 1MRSA 1PV4A 4XQ9A 4WXHA 2OV1A 3PDWA 1OCOB 4IHKA 5A3RA 2BFEB 1T0KB 4CLEA 3LSYA 1P45A 8ADHA 1AZLA 2XPCA 4CMGA 2R1VB 3OZXA 3AL3A 3GJ5A 5EI5A 4HN4B 4CTJA 5L6MB 2EZ4A 2ID9A 3MINB 2O2IA 1JVMA 3TR0A 5AKXA 2W6IG 1U2GC 1XBIA 5IYZF 2UXXA 2OPHA 2O5VA 4JENA 1D1QA 2YIBA 3I52A 2V98A 1F2UA 1GHTA 5KHOC 1W34A 4F2GA 2YWEA 3RS7A 4WXEA 5DK6A 1MN6A 2HCJB 3TZ6A 2D2IA 2AVDA 1Y8RA 1L0LH 1JDJA 4DY4A 3AB3A 1Z0DA 2KB0A 4M8KA 2DWDC 2I76A 2H92A 4YQYA 4E94A 4OI2A 1N33O 4Q4AB 3ICOA 1O5TA 4A0QA 4RFSA 1ZUD1 4G8JA 4HDAA 3NHJA 1Z0KA 2OBLA 1PZHA 2R70A 1UMDA 3BM5A 1C0KA 1NW5A 3OQJA 1IJFA 4ZYUA 4FCTA 4DR4O 1RWMA 3VPHA 4XWYA 4BL5A 1VLJA 1GRCA 2EW1A 3OHPA 1Y6FA 3KKKA 4M76B 3RNLA 1B43A 2IEGA 4EI2A 1XVIA 3I8OA 3RIHA 4DYVA 2X58A 3H3JA 4LTNA 2G80A 3RWMB 4YRRA 3GEDA 1CF4A 2OQ2A 2R8EA 4LNAA 1FIUA 1US8A 4XYLA 2BOBC 3SJBC 3JCZA 5BURA 3PJEA 4ZT2A 2DCMA 3FCYA 3JATA 1DKUA 3DZFA 4PDMA 2WZCA 3RYHA 1H22A 3UBTA 5JLAA 2G5TA 1P1BA 4EB6A 1XTSA 1XZCA 5EFZA 4M8LA 3Q3VA 3CBQA 4YUVA 3HY4A 1Z06A 1JX9A 4CGZA 1OILA 3EW9A 4IDDA 3SM3A 3D0RA 4ZYXA 2IUYA 3K8ZA 2XDQA 5C3UA 1JQJC 1RBQA 1YDEA 4J75A 4L5JA 2Y1OA 3S29A 3PS9A 2QI9C 1G9SA 2Z08A 3VC7A 3TRIA 1GKLA 4FLXA 3COVA 4N5LA 1E6MA 1T1IA 4MB2A 1CUJA 2C59A 2CXOA 3ZWYA 4LMAA 3N0XA 4G5HA 2XQJA 2QRVA 4AFNA 3H9EO 1QHHA 4I50A 5AVMA 4CEIB 2HT6A 5LQDA 5K2MA 4FSHA 5HY2A 4MUYA 6ABPA 2BM8A 1AQNA 3TIXB 4QJ4A 2FI1A 5IW8A 3ROZA 4Z2YA 3ZHXA 4YHBA 4XYMA 4K6FA 2CJWB 4KTVE 4BQRA 4A2CA 4EHKA 1D03A 1JAXA 4LKOA 3DAGA 4V0KA 2ZRLA 4IIXA 2BEWB 1NXVA 2F8TA 2PTMA 1A1SA 2I7CA 3SJAC 1VGRA 1JG2A 4Q9AA 4L4SA 1I1QB 3NYQA 1Q0SA 2NO9A 1V7ZA 4XCXA 4QT4A 2G3YA 1MIOB 3I04A 3SS7X 5EMLA 1RWXA 2XVYA 3K0CA 3CKLA 3AFNA 3BD6A 4Z7NB 2FF7A 2LDBA 4AS2A 3OKCA 4KAFA 2GEUA 1R0YA 4I50F 1EUYA 1ZJZA 1VXRA 3U9TA 4F4HA 1JDBC 1WZIA 2FDCA 3RWOA 4C3VA 1NNSA 4R16A 4U7WA 3IUBA 2P79A 2Y8EA 3OAAD 1NVDA 4R54A 5EZ6B 4YRAA 3UCFA 2Y1EA 1HSOA 1SXJA 2RSLA 3SKVA 4BJ3A 3FFQA 4JP3A 1E66A 1MF7A 1YB2A 2B2XA 2OFXA 1CP2A 2ZIFA 2GEVA 3L72H 4MPDA 2DN9A 3W2TA 3L7CA 1SCQA 3E5MA 1IXYA 4P5EA 1JKMA 1YRLA 5EWMB 4UCFA 4GX0A 1T9CA 4DVGA 4GOMD 2NUAA 4M1TA 4EYKA 1RJDA 2J09A 2VP2A 2OK7A 1EWRA 4QGGA 4YREA 4JUFA 4ARAA 3E5HA 4KFSA 1QU9A 4HLNA 5A4AA 2CL6X 2YOGA 3NANA 1T1GA 3DULA 5EB0A 1RKUA 3DFMA 3KR0A 1RJEA 3QTTA 1QYVA 3FOWA 1LD3A 5EXXA 4XCVA 4DFDA 3DM5A 2JI6A 1GLVA 1Q5OA 4UFZA 2LRHA 4N5MA 3HYNA 1K0UA 4G8DA 1C0IA 4WZZA 1PV0A 1NYRA 2BZ0A 1X1SA 2QTVA 4RVOA 4E2YA 2HMVA 2PZKA 2HX1A 4YY3B 3I55V 1SCAA 2CXNA 2QPLA 4LGCA 1ZQ1A 4NULA 4CCAA 3QMPA 4YRTA 5TSDA 1HUQA 2HA4A 1DELA 4TWJA 1H8HD 1P0QA 2P9BA 4CQLA 3D1VA 4DLWA 2I6GA 4NJMB 1MZEA 3V7WA 1NNI1 4GOND 4MS2A 3C6BA 2SBTA 1SH7A 3P52A 3GPIA 2IZZA 3QPDA 1DFIA 2WLNA 2J6BA 4A2QA 2PVSA 3LYAA 2R66A 2RDCA 4IFEA 5AI8A 4GPAA 1FYXA 4ERNA 1YQTA 5GONB 1CZOA 4UU1A 3OPYI 4HAYA 2FUG1 1OJ7A 3I23A 3X2FA 3O0DA 4ZEMA 4Q93A 5JAPA 4KDCA 3VU3A 2VHEA 3U5TA 1M90W 1B7GO 4II3A 4R3UC 3EZNA 1YKFA 1P44A 5B6PA 5E0OA 4Q12A 3B5JA 3LT2A 4FOTA 2VYVD 4JB2A 2NAFA 2HEIA 1KI9A 3D3IA 1JIQA 1Z62A 4ZJPA 3H17A 5I5GA 4MUNA 1AUQA 4DUGD 1UXIA 2YFHA 1H7MA 1Q2UA 1N2XA 1WU7A 1L1EA 4LE1A 5JCXA 4FLZA 5FHRA 1NRJB 1ACMA 2X1VA 4INPA 3LOQA 4J9VA 4WFFA 3HU5A 2AMTA 2Z5VA 1VF7A 4MH0R 2GCOA 1CUUA 5E9QA 3SJQC 3VHRA 2MYUA 2XRMA 4M88A 3OEEA 4Q4JB 1V6AA 3OW2U 1S89A 3ES9A 4EY4A 3M89A 4CH4A 1YQWA 2HA2A 1DIBA 3K06A 4PLHA 3TOXA 4G5FA 2HS4A 4LIPD 1Y1PA 3EVGA 3E84A 1FEZA 2HA5A 3MVEA 3V4PB 3EXFB 1TUEA 2EZ9A 4I5FA 5DXJA 1F8UA 4R0VA 3DFKA 3OT1A 2QM7A 1D6SA 2JJ1D 4Q9LA 4DNFA 1WSBA 3U2QA 4ZHYB 5BXQC 4OREX 3OM1A 5DTRA 4MJ3A 1U8AA 2O7SA 3E3AA 4DM3A 1Y4DE 2VI5A 3NW9A 1MDFA 1W0JA 1D0SA 2FPUA 1EWVA 3ZY5A 4GYYA 3EOBI 2Q6IA 2P9TA 5EHGA 5A5DA 4BT2A 5AXDA 3MBOA 2CWDA 4OHRA 3IMKA 2VF7A 3DBVO 4H6PA 1FP6A 2EHJA 2PIAA 1RT9A 1VMGA 3F78A 4OJMX 1ZJ6A 4FM0A 3LLCA 4EZBA 1E1MA 1BEEA 1Y9AA 3STWA 3U7IA 3H97A 2B30A 1VM6A 4LWZA 2QOEA 2GN2A 3IP7A 4WLUA 1HQDA 3A1DA 2F3RA 2HXSA 5JSYA 3ZBUA 5AW1A 3MWDB 4TT3A 3H8SA 4I5EA 1XROA 1D2NA 3B1JA 2R84A 4ILEA 1RPZA 8OHMA 1L8OA 4AIRA 1E0AA 3S0HA 1KEKA 1YC2A 3EZGA 3DS8A 3MMZA 2IODA 1VLQA 3E18A 2OAEA 3EA4A 2QL9A 5CUQA 3O0TA 3PTLA 4GOOD 5EB1B 4P33A 1UDWA 2Y76A 1IK4A 1J2UA 2QN1A 3FDZB 4URZR 4TQGA 1FMFA 5JASA 1C3VA 1PVDA 3PENA 1SU6A 5M7EA 1Q50A 5CDTA 4BE9A 3KYCA 4NFSA 3TOSA 1WB7A 5B3JA 4TTTS 4F9GA 1B41A 1DMRA 2GEDA 4OP1A 4QG3A 2ZWMA 3OCCA 3ZRVA 1KF0A 4R9UC 2BLLA 2LGQA 1XPUA 3AL2A 4KLZA 5L4LA 3Q6MA 3IIJA 3NIBA 1BGYH 2H3HA 4RJJA 4DJFC 4BO0A 2HZ7A 5K9ZA 1WPBA 1GNRA 1ZUHA 4A0GA 2FN7A 2F59A 1FVOA 3N3AC 3WGIA 2XDWA 1MA0A 3ENNA 3KZVA 5HXAA 5TGDA 2XUPA 5HY0A 3DFUA 4DM7A 1POXA 1XAHA 5KIAA 1J0BA 2UXDO 1NU8A 2C9BA 1MOFA 3H9VA 5B3SC 3DYVA 2YW2A 1S3FA 3TDNA 2BUBA 4RQFA 4C08A 4C2UA 2HU5A 2JCVA 3CUEF 4Q21A 1X70A 3BK1A 3SYCA 1NVVQ 2GRAA 1T2AA 4MQMA 4X8MA 1RCTE 2Z5FA 4LYAA 3HKBA 4X90A 1N6HA 2DHCA 2QQFA 1K6EA 4YV0A 3CMAV 2WPDG 4QYIA 3THWB 1SUEA 4Z9YA 3H4IA 3NDPA 3MERA 1DB3A 2IL1A 1T0AA 1R6TA 1ORWA 3U40A 3RUDA 4MCAA 3MOSA 2HRUA 3BK7A 3PZBA 3CFYA 4B7CA 3LD9A 4FYHA 4YAGA 2H2WA 2PSHA 5CGZA 3G4SF 5GZ3A 1HM5A 3QNEA 4OCZA 3C5WP 5LUAA 3PNMA 4F38A 4ZYTA 3PPWA 2D06A 2J3JA 3EH2A 4C8GA 4UOEA 4MYCA 1AC5A 3R3WA 3F3KA 2H5LA 3ROEA 2N74A 1TA0A 1NP3A 3WFVA 1U81A 3WFZA 2BY4A 4ZDJA 1O6CA 1VQ7F 3WP1B 1JR3A 5EUCA 1L4BA 4U7FA 1KC8H 1TCUA 4RORA 3EPJA 2FR0A 3G82C 3EN0A 5CLGA 2AFVA 4BPRA 5AKLA 1M2OB 1TKCA 3FTQA 4LWOA 1E0KA 1JEYA 1NVFA 2VJOA 3BMQB 3RAJA 1RC8A 2E85A 2ZCEA 1YB4A 5G02A 4JOQA 5A6SB 2YZ7A 4YRDA 5A0TA 2ZF8A 1ELOA 3A4IA 2E5FA 2YC4C 3NCTA 2ZREA 4QFBA 2WFLB 3JRXA 2P6JA 2JI9A 2KG7B 1F3OA 4BAUA 3ZRWA 1VIVA 2J3KA 1BC5A 1L5YA 1RLMA 3VISA 3W6ZA 1JFRA 2HNAA 3ZEAA 3WOVA 5CH3A 1B6RA 3HKEB 1NT2A 2PBFA 1BKYA 4I5DA 4IF6A 1W0KA 5C37A 3ABLB 1G20E 4YO7A 5KTKA 3CW9A 2DQYA 3IODA 1WNFA 4IH4A 1I3OA 2XXAB 3H1HH 2IU0A 2H00A 5JALA 4OB7A 1HNZB 1SHZA 4ARIA 3EF0A 2OV2A 4KX5A 1AB3A 4ZT3A 1R5JA 1NVEA 5A4DA 2ADFA 4PFSA 2ZYRA 4Q4CA 5C5EA 1RFYA 4RIGA 4RVFA 3FMVA 4C6HA 4B6RA 4JJ8A 1ARZA 1MX1A 5AFSA 3WRYA 3SEFA 3CH7A 5YASA 1S4QA 5CHEA 1OWLA 4C0WA 1HDYA 3ZWVA 1VKRA 4F21A 1K8ZB 2YQ5A 3IEIA 2D59A 1DWQA 4FGUA 4RTQA 2Y0CA 3K09A 1SKAA 4DCGA 3TXAA 4XYBA 3C6KA 3E9YA 1SUSA 1RI3A 1G20B 4U7TB 2Y1WA 2ZZNA 4INOA 2W6NA 4HFJA 4Y2PA 4B3IA 2X0KA 1IQPA 2BKXA 3TR5A 3KPJA 4KP7A 2G82A 1Y1QA 1VCMA 2JEOA 1QR6A 2HCBA 4ALMA 1AR4A 3LWRC 1FC0A 1Q7RA 2JANA 5CYOA 1KVTA 2OE2A 4FZ0A 3D0OA 1G5QA 4WOKA 3Q4HB 4QDOA 3QE2A 2XNDD 4GQAA 4P93A 4O1MA 2W2MA 4DADA 4WERA 4OJYA 4IMJB 4OAOA 1CR1A 4EYQA 2P6MA 3D6VA 1FP1D 3VC3A 3C8MA 3WIBA 4DDHA 3L71H 4I3GA 3R40A 1ZJJA 4WY8A 3BE6A 3GVIA 3BWMA 3JVIA 3M5WA 4DMCA 2WA3A 4M99A 3DE6X 3AF1A 4RY9A 2E55A 1NR7A 2CHFA 4CT5A 3COYA 3MB5A 1FNCA 3R0JA 1MB0A 2UZ1B 2Q6OA 4G1EB 4UHFA 4TTPA 1U94A 2AHYA 4LJ7A 2JEXA 3DOUA 3FR8A 4X6YA 2QBYA 1ZM3A 3ERNA 4K87A 5LC1A 5AW7A 2O0MA 3QKSA 2FPLA 5EZYA 2CSUA 3PVCA 4PS1A 1YZUA 3VKUA 2IOFK 1W55A 2M1XA 1K7SN 2ZUCA 2C8KA 1NSFA 3QH4A 4URWR 4IIBA 4OL9A 3T3EA 1VGVA 1Q7CA 3V7NA 1IBRA 2C8JA 1GSAA 1UR5A 1H9AA 2JHCA 1KMNA 1HDJA 3HN7A 4N7RA 2V5AA 1W2BU 3FNEA 4EEZA 4X8LA 1KEZA 4DR3B 4QUJA 3VNUA 5CIWA 4FIDA 3OC0A 1R6DA 1I4EB 2HTEA 3VR2A 3B7WA 3W2FA 2J0QA 4RVUA 1MR3F 2FQQA 2A1TS 3WWCA 2H8KA 4YONB 5DFAA 1OCRB 2A67A 4KPGA 4CMIA 4GPD1 1XMVA 4XLZA 2KBEA 3CE2A 4AJ2A 3QE9Y 5HFJA 3D3WB 5EZYF 1GPBA 4JBGA 3W9SA 4AQ7A 1P29A 1OYVA 1MPTA 3VI4B 3PXCX 3AKEA 4X41A 7MHTA 4OD0A 2P5SA 4WFBV 2NUPB 3C87A 5ELXA 2W8ZA 4HX2A 2OZLB 1YHZA 3EZXA 1FUUA 4KGVA 1II9A 5K3BA 4DMUB 1S3GA 4S35A 1P73A 4GM1A 2H48A 3A0RA 1Z6XA 2YY5A 2BCCH 2ZWOA 4NYIQ 4E31A 1TIPA 1MG0A 1BG6A 5IXSA 3FHOA 2HO4A 1V8FA 1GUDA 2B7LA 5AVUA 2VJQA 4DBLE 1R8JA 1AKNA 4NZNA 4JBIA 2YZNA 3VO8A 4DQ0A 4PLPA 1IH8A 4HH0A 3EGEA 2VRWA 4QJ5A 4OOFA 5E4FA 2CMGA 1XMPA 4J29A 2LW1A 5CFPA 4IR7A 3LUAA 1WETA 3C1AA 2E4WA 3THYA 1DMSA 2J5QA 1OASA 1ZOSA 4PPFA 3GXOA 3ETDA 1VG9B 3FI9A 3CW2A 2XNKA 5C8YA 3L1IA 4HVCA 2HDNB 4R2WA 2VT7A 5A03A 3SDSA 3JQRA 2RBKA 1M4UA 2LUOA 4ZVSA 1H85A 3GJSA 3RTGA 1Y6JA 4TYPA 2PI5A 3SEZA 3USES 2H8CA 2ID7A 1KDYA 1ZD1A 3R7WA 3R9XB 3N7AA 3ABKC 3SJ7A 1CY6A 4AI6A 1TQ4A 4HUTA 3TVDA 4Y1RB 1PT7A 3SYQA 3PT5A 1H0KA 1AQJA 4GLBA 1HOXA 2PT9A 3IEQA 4RD1A 1PBTA 1Z8HA 4K05A 1TM3E 3D59A 1YDWA 1TI7A 1YQUA 4LYFA 1GYRA 4C05A 1GTVA 3A9VA 1YJ9F 3VMFA 2O5RA 2VS0A 1CHNA 4HNGA 1G5RA 2IJIA 2C3MA 2CBXA 4RF5A 5C8YF 2CB9A 3BA6A 4D42A 3UA4A 5LP6A 1I7FA 4D9JA 4CV0A 4LHSA 4N0EA 1O87A 1SXGA 1HYGA 4R6ZA 2AIRA 3M6IA 2W5UA 2VJBA 1NMUB 3R0XA 1PVVA 4C04A 2Z58A 2PKYX 4IT5A 4UE3S 3SI7A 3T9AA 3ZC3A 1VQ8V 1SELA 4ZDKA 3X2QC 3NO4A 1GP2A 1XR3A 5J59A 2FGYA 4HFMA 2BHNA 2FAXA 1R5BA 3SZGA 4RUKA 1M8FA 1QQ6A 3ZY3A 3GEEA 1P91A 1P8AA 2MSEB 4TV8F 4J1NA 3ZQ4A 5TQ2A 4B32A 2B34A 2CL7X 2IOYA 3FHCB 3KYDA 4BJ5A 3QO5A 2P3OA 4LXYA 1VDZA 1K89A 4Q48A 1W85B 4FU0A 4RETA 4DLUA 4J7CA 4DHEA 1EEHA 3WB2A 2NSDA 5T4FA 3AG4B 1KS9A 3RU7A 4YPVA 4XGRA 2GAIA 1SPBS 1T5OA 4TMWA 1F6WA 1FTSA 3JQGB 5LP6F 4IHJA 5HYVA 2DYSC 2SECE 4ICIA 5G41A 2XI4A 2PUEA 4BLRA 4HMPA 3VNRA 4P3OA 1VIBA 4FIPC 3Q6IA 3WL7A 3BDIA 1CQXA 2HGSA 4C81A 5P21A 4MKFA 4AWXA 2V9CA 3UTCA 1NVAA 2KB1A 2HA7A 3S1AA 1ZH0A 8ABPA 1G8YA 1M75A 5LYJB 5CA1A 4J7ZA 1IY2A 1JXOA 1INLA 1Y6RA 4RQTA 4BX3A 1WOYA 5LVAA 2GXAA 4ENRA 1W73A 2CDBA 3VBCA 3VYUC 3U62A 4DN6A 3CX3A 4MLZA 4HY3A 5LBUA 4WCFC 1B15A 1JEDA 1CQZA 5BN4A 1Z47A 4KO8A 4F6RA 1GPWB 4DC0A 1TJYA 3HB3B 1LY1A 3IIIA 4E13A 3SM9A 3ICPA 3H18A 4RPCA 1CRWG 2CV2A 1W46A 3WI7A 4RQOA 1H38A 2BM9A 1MDBA 1MHPA 5ALEA 5G3ZA 4IHJF 2ODPA 3WQRA 3IAM6 1V16B 4QO7A 4MAFA 3UJ3X 2FK7A 1LTHR 1VHJA 2PS0A 3MTGA 1O2DA 1V5IA 3OE4A 3T8YA 1BH6A 2R1UA 3ZWPA 3C8LA 3NVKI 3NASA 3MTIA 3T1TA 3R0VA 1MD9A 1V7QA 5BNWA 2I22A 3OTFA 4X44A 2AFHE 2YV3A 5HFAA 4B87A 3TW6A 3K5WA 1DWOA 2B2CA 1BGVA 2FWAA 5CA1F 1A1VA 2YMLA 4MRRA 3HZOA 1VQ6F 2QRMA 3TDMA 1RJFA 3LGSA 1C8KA 3QMWA 4D8YA 4MV6A 1EESA 4TVOA 3BQ9A 2P4HX 1RZVA 4DWVA 3L0BA 3ZY6A 1RXCA 1XOUA 4Y2TA 3ROGA 4UUOA 3TMYA 1QLEB 4PRZA 1E79A 5JZVA 3KVVA 4QX6A 4R2JA 5D3KA 3VGJA 4W7HA 2DR2A 1YS4A 4CRWB 2IWRA 3WADA 2D2XA 2X0JA 3OFJA 1OXUA 3IPRA 1BD3A 1U1IA 3FX7A 5M2QA 3C3DA 4AZSA 4HH4A 2WQZA 4MS1B 5CPFA 2PN1A 3S5UA 4C4TA 3QY0A 3GUUA 3PD7A 1VLHA 1BX1A 1RQXA 3SVZA 4EA6A 1U3DA 3K2QA 4HZIA 1TQ8A 2AFHB 5DNUA 3RC7A 2LKCA 3G49A 3QI7A 2XASA 3S2ZA 3AWDA 1W93A 2ZJ6A 3G1TA 2R9VA 4IKOA 3IDAA 4KYVA 4BDSA 3BWCA 4QREA 2OK8A 2IDJA 1UBFA 3EXHA 4AC9A 1J70A 2QX9A 3WKBA 1KI7A 5IVIA 1DBWA 2BP7A 1E2PA 3F3YA 4FLYA 3GFRA 1ILEA 2JIMA 3HB5X 1A7KA 1KS2A 3RU3A 2Z2YA 3HYTA 1H42A 4WI1A 1YKSA 2R4TA 3HDQA 1H23A 2QU7A 4MKGA 1KZ7B 3TTXA 3KR9A 1OU0A 2A3RA 4CF4A 4OMFG 4LXGA 1EFHA 3GBPA 4WVFA 2BH9A 4X9QA 1EX1A 3HACA 1P3Y1 2YFQA 3A3YA 4JI5O 4CN9A 1L7DA 3T3MB 1TLTA 1K3EA 1ZMOA 4JI1B 3UG6A 3NDJA 4F3KA 3PYMA 4LZOA 1C1XB 1SKQA 3PFHA 2CWWA 5EWJA 5B36A 5DWVA 4CHTA 2XW6A 3FLEA 2BM0A 6REQA 1PF7E 4EYSA 1C0EA 1L0NH 1EM8A 1X77A 2JCSA 5AI4A 5L3ZA 5K4HA 3JYQA 1T0UA 3N2GA 3LCVB 4G0QA 3V55A 5A9RA 1KEEA 3CVUA 4RJKA 1SR8A 4DV6O 3J80A 2HBRA 4NC9A 3ZOKA 1WSDA 4F91B 2CY0A 1LBTA 2E87A 1N32O 2ZAIA 1OC4A 3WGHA 3M6FA 3E53A 4BU0A 2YYAA 3BWYA 4OMCA 2XH8A 3WIVA 2ZRMA 5M3BA 1YQQA 1OTHA 5BRAA 4GZ5A 2VEOA 1FYFA 1N92A 3PC2A 4KH1A 3AGPA 4UDNA 4J10A 3PDIB 3FI0A 1GQOA 1J90A 1GG8A 5IJ9A 4YDQA 4D3XA 4UCWA 1C8BA 1MPXA 4H3VA 4H4CA 3I28A 3LXMA 2NTJA 3WKEA 5HM8A 4IH9A 5L3SA 3WYAA 5JHHB 2I67A 3QJYA 4WLNA 1ZNWA 1XRNA 1SZPA 1Y6ZA 1SHJA 2ZVQX 4OXXA 1DKMA 2NX2A 1UDCA 1OGYA 1LS1A 4FFKA 4F8YA 1HV8A 1WZCA 4FD3A 3D4IA 1MZPA 4FFVA 2CHEA 3RIGA 4M21A 2XB2A 5MHTA 4GL2A 4EGCB 1E2FA 2AD1A 2PH5A 1P6UA 3H1EA 3QBVA 5EEHA 3PC4A 1E1LA 1NKTA 1QX4A 4Z51A 1NRIA 4FNOA 1QB8A 4CNQA 4FJCC 3PR3A 2GXQA 3H9QA 2PL1A 5H16A 3A2NA 1SKUA 1XL0A 2Q7OE 3H2ZA 3W2EA 2CJPA 4WLEA 1IJKA 3ZI7A 2WTBA 4BEVA 2R9AA 4QPCA 1C3OA 4B2IA 1UZMA 4F2WA 2IW1A 2XMBA 4CEHA 3E7DA 2HA0A 1TM5E 4ZQEA 1VCHA 4TOIA 3HRHA 4GEKA 1Q77A 1DC5A 3EC2A 4U2EA 3BS4A 1PJCA 1K97A 1CEEA 3DSRA 5KNBH 2UVQA 4FUTA 2I99A 2PKQP 3RS4A 3E22A 3ON1A 2JJ8A 4EJ2A 1K75A 4YRLA 4N18A 5JEEA 3G79A 2BGGA 1CZUA 4PYKA 1KR5A 2OQRA 3DM9B 1WF6A 3HJAA 5AD1A 1P1FA 1QG4A 1Z2DA 2QD5A 4HDNB 1SBIA 4AZWA 3LGXA 2HRDA 4TV9B 5ARDA 5HNKA 1DQSA 1X8JA 3CR3C 3VQXA 3A1UA 2AC7A 4JIGA 4HZUA 4MVXA 3JQBC 4QPDA 1DX4A 3GPCA 4P4UA 4I1UA 2P67A 4OHPA 3LWOC 4C22A 2BGUA 4H1UA 5ESDA 1TPZA 1JUDA 3R7FA 3M7IA 2MTBA 5BSWA 1KQNA 1BCRA 3ER6A 1C7QA 1AE1A 4MGZR 5TC4A 4KE7A 5AMXA 1YV9A 1G3MA 1YT5A 2GM5A 3KWLA 2YEVA 2IYWA 4NEQA 1XZDA 3KAKA 1C9KA 3BQNB 2AFRA 1GN2A 4WRRA 1DJMA 1OTYA 1P0PA 1SOUA 2JZNA 2OO5C 1JSZA 1NNLA 2WLKA 1G7SA 3ZV6A 1SIOA 3O3CA 1N33B 1J4AA 2ZSKA 1R3LC 1E2UA 3TOVA 3SZOA 4AL4A 4GPTA 3MRVA 3SWWA 4DXAA 1OHHG 4JITA 5H80A 3WR5A 2YHSA 2G9NA 3CF6R 4DR4B 3DLHA 1WXWA 1EGMB 3OE7G 2AJCA 3KU1A 2VRCA 3T4ZA 1AGPA 4GPBA 3D54A 2MW2B 2MYNA 2RH5A 1F6DA 5HIJA 4N21A 3NATA 3D2CA 4I7EA 4Q3OA 1NM5A 2M32A 4XTRA 4YAFA 3D6TB 3BD8A 5CEJA 1CIPA 2RK3A 4Y2HA 2UVPA 5C8DA 3GRFA 5EKUA 2C97A 3PB3A 2QSYA 3OOWA 2UUBO 4QHYA 5F76A 4A6PA 3T35A 5CXSA 4ABMA 4NKGB 4TWKA 3QHAA 4YI3A 2H08A 3L79A 4X24A 1XMOB 2D0IA 4G5XA 1H2YA 1RM1B 3R5XA 3GGPA 2WKSA 2R62A 2Q67A 3DT9A 3QVSA 2BFDA 3O4IA 4QWWA 4GU5A 1Q7YH 4AROA 3ZNPA 4KP4A 2WM2A 3P2MA 1T36B 3K1JA 3LWNA 2D3WA 1PP9H 1V7PC 1ZONA 3PIDA 3SSNA 2YXNA 1QRDA 3IUEA 4KOEC 4GMXA 1YMUA 3GBSA 3N86A 1D2CA 4KO1S 1G0OA 4AKGA 3G0CA 2E49A 3QELB 4PM4A 1BHO1 1Q81W 3E7FA 1XWWA 2Q5EA 3S2GA 4D3YA 3RFCA 3ZEDA 5I9SA 3LBIA 1F8YA 1H2NA 4OXYA 4DV4O 1EFPB 3B8EA 3GN2A 3VJRA 3ZHTA 3BERA 5JR3A 3SYRA 4TMVA 3K5OA 5CBGA 3RYTC 4C30A 5FAKA 1LQTA 3V9AA 4ARUA 2DXIA 1TO6A 4BMXA 5C5DA 1QXSA 3H3XA 4BECA 1O94A 3TTSA 2VRZA 1GN3A 3DNFA 3HJCA 5CM8B 2JS7A 2GEBA 4RM2A 2DBZA 5BV2P 4DL9A 3R74A 3RF6A 1MGPA 1SUPA 1HA3A 4ZAWA 3C3AA 3I92A 8ATCA 4J16C 4DIEA 1GKYA 1U8XX 3H4VA 3DAPA 1G6UA 2UYOA 3Q7SA 4UATA 1L5ZA 5FLXN 2EDAA 1JHZA 5KHKA 4FPXA 1V11A 2V7QD 1SJ9A 1FS6A 1HDEA 1Z7EA 3F8WA 5BVHB 2ZT6A 1Z4OA 4L3VA 1GSIA 1B6TA 1ATZA 2PRIA 5EIXA 3EDYA 1T43A 4XAQA 2OHIA 1FXUA 3GJ7A 2FDXA 3PKJA 1ATIA 4YV2A 3N2LA 4EHDA 2W93A 3M84A 1KDRA 4LF9O 3AF0A 2HJRA 1MEJA 3LTNC 3MGGA 3DNPA 2HQRA 2PU7A 5JCZA 5KYUA 4TS9A 1KARA 3G2JA 1ZL8A 4X6LA 2OBMA 3E0XA 2TMGA 1R4NB 1QGYA 1OXXK 3RDPA 4LG1A 1FU7A 2NTVA 4ZT6A 3PDCA 4E5KA 2QTHA 1JR2A 2G9RA 1A9ZA 2FWIA 3BH0A 3JQFA 4FFBA 3AJRA 3Q85A 3FIJA 1GDHA 5LYYA 1JMVA 2NXEA 4GGOA 2B4TO 3Q8MA 3VQVA 3B70A 4Z86A 5HBRA 1K7DA 1EFRA 1XB2A 2AI1A 1K2VN 2K9PA 2DC1A 3TCKA 2GKOA 4ZI3A 5HJ2A 2XMCA 1UC9A 4L5YA 1P0IA 4N65A 4JB3A 2GZ3A 1W76A 2GFIA 4DBVO 1EFVA 3QX8A 3KK0A 1QYCA 2OECA 2M6KA 5SYNA 1X9IA 1TK9A 5FUVA 2HPVA 1Q7EA 4PSAA 1NJSA 5EXSA 5D2CA 3KWMA 2HMYB 2WPNA 5BT9A 4UVGA 3P0FA 2PMBA 1ZK4A 1NUTA 1E5QA 3I05A 3KWJA 4ZBMA 2VP3A 3QX3A 4C0HA 5FR1A 3DZHA 1KMCA 3OM9A 4RCYA 4ND3A 1KBZA 1T8YA 2WJAA 1ZI8A 1EHYA 1JBKA 1H0HA 2IX3A 4YO8A 2C7PA 2K5UA 4RD0A 1D2HA 2UZ0A 5EHIA 4EX7A 3SYPA 4EPXA 1ISIA 1RYHA 2HJ9A 4L15A 4HADA 3ZDQA 4ON9A 4KRGA 1DC8A 1KK3A 5KNDH 4PO3X 3F5MA 2HLNA 3AG2C 1U8FO 4P53A 13PKA 1R8XA 4NPCA 2G04A 1XKLA 4ASUG 2O3RA 5IKOA 1Q82W 1T9BA 2HDOA 2ZRNA 2AEFA 4DLTA 3RS0A 3FTNA 4GXRA 2N42A 1OOEA 3ONDA 4TLAA 4H3KB 1LZKA 5LIRA 3ZHUA 1Q6ZA 4TYMA 1FXKC 4OY3A 3ZKWA 4E3ZA 1SG9A 2NMVA 4CLXA 2YVLA 5BN1A 1FDWA 4LOKA 5EJIA 5GPBA 1K5PA 3SZLA 4F7WA 1IC6A 2JS3A 1OWPA 3OQHA 1DQYA 5G4LA 1NZ6A 2D00A 4GBJA 1OX4A 4CKCB 5HFNA 4RY2A 1R18A 3NJ4A 4KMMA 3O8RA 5KNCH 2IITA 1CDZA 5JISA 1Y1KE 3ZZNA 2C54A 1XCJA 2YL2A 5KSYA 5JTUA 3BFKA 3AZPA 4H3HB 3CH6A 4BWGA 5ENZA 4QYMA 4HPJB 3A2FA 5BZBA 2VTVA 3PI6A 4RENA 2H2FA 3ZZ1A 4XIFA 3ZDZB 4GM0A 1CUSA 1GKIA 2E37A 2O2EA 4WNAA 4OIFA 2GDSA 3HPRA 2XA2A 2Z9CA 3DO6A 1UJ6A 5F2VO 3PX3A 2YI9A 1ZH8A 2GHQA 3EVCA 4YUZA 1Q1GA 1EM1A 2XZDA 4PG4A 1MW8X 1ZPDA 3K79A 4B34A 2A5LA 1TC1A 1Z2AA 4EJSA 3SXUB 4D8TA 1QFZA 4RTMA 3GVMA 3NOOA 1JBEA 3SQXA 4WEQA 4DWOA 3A32A 1KH1A 4AP6A 1SNYA 3CN9A 1THGA 4TRNA 1B0AA 1BXGB 3W2IA 4HTFA 1M1YE 4JCCA 5DNWA 2ATVA 2QG6A 1Z83A 3IPYA 1PEKE 5JRJA 1M1NA 3TLKA 3LY5A 2AIFA 5B3SB 2RKBA 2PLNA 4Z1MD 1HTBA 5KYXA 3QRWA 3CJTA 4EI7A 3WGOA 4BNGA 2FPIA 5E2AA 1ORHA 3VR5H 1IUOA 2Q2QA 4YCCA 3NU1A 1YJBA 3Q9NA 5KHHA 3EIUA 3E1SA 4URXR 3AI3A 3MYYA 3UWMA 4JLNA 5JNRA 5CB4F 2IY8A 3KSBC 4V24A 4FVMA 4A0HA 3O26A 3NH9A 1H2RS 5LQJA 1WNTA 1ZCJA 3SOPA 2AEMA 1M0SA 2Z9DA 1DUSA 3VZPA 2L0XA 4J90A 2J9FA 4X3LA 1ZA1A 3T3OA 3M8AA 4R8VA 1M1YB 2GJSA 5KJ6A 1E94E 5DT9A 4DR1B 3OX4A 5BSEA 4HBZA 1Y5MA 2YIDA 2JEYA 2Z5LA 2QZSA 3ENWA 3F1LA 4BO7A 3OFKA 4R2KA 5CLFA 3I4LA 3WHIA 4CM9D 2AKEA 1J9ZA 4YCDA 4IEFB 2CFCA 5ILGA 1KQSU 3VUEA 1KI4A 2X13A 3HXMA 2F8LA 4D0GA 2WW8A 3QVXA 5C51B 4G67A 3AY7A 3CB2A 1Z18A 5FYDA 3PP8A 2Y9PB 2EIMB 5BV8A 2DFTA 4YCMA 3ZJ4A 1TZCA 4P30A 3Q3IA 3LLSA 3UJ8A 2ERCA 2FFQA 2VOEA 4LF4B 2NSHA 4TPKA 4ACBA 4FDTA 3DBLB 3HVUA 1DTEA 2QDKA 3R3VA 2BJHA 2UXDB 3MAGA 3B2EA 3SDBA 2ZVYA 3K15A 3GRAA 4PFJA 4LY3A 3FYUC 3KG2A 1J24A 2O3TA 1MA1A 3C7CB 3TUJC 3WKCA 4C4PA 3PXUA 1B3QA 5E2IA 4OU4A 1Z38A 2XA1A 3AG6A 3CS3A 3IUYA 1G16A 1UIMA 4TLLB 3TQRA 2UYPA 3TINA 5IKEA 2QJTA 4ZAVA 5KNDA 3LDAA 4ZOQI 2I29A 4KVZA 1ORVA 3G2MA 2W6OA 3NGMA 1VQVA 1DC6A 2XXBA 5FJJA 4JK3A 4OLAA 2BE3A 4KXUA 1S9DA 4RC9A 2YRWA 1RI2A 4NAUA 1XK6A 4MVJH 2VDQB 3GUVA 1ZD4A 1HDCA 1HL7A 3L5KA 2P2DA 4UD2A 1H2EA 4ZOCA 1QC5B 3I0MA 1JJ2F 1QCDA 3G8AA 3P5SA 4MRMB 2AKAB 1NQ5A 1YDFA 2QNRA 4V1CB 4I6EA 2Y1FA 1U65A 3F8TA 1CRQA 2BIFA 3U7QA 4DA4A 1XQ8A 1U2TA 2IYVA 1IVNA 4UBKA 4D9MA 1UQUA 1Y7LA 2KKWA 2XCRB 4GMKA 2C83A 2VQ6A 2WLJA 3FD9A 5IK2D 2JFPA 4YIKA 5EMJA 1G8AA 2B78A 4TKLA 3QYPA 5CDSA 1GL7A 2QRGA 3WA6A 2VHWA 5JNLA 2HU7A 4J42A 1OLUA 1N5KA 3WJQA 4EL0A 1QKIA 3QBTA 4A73A 3OEEG 1MMMA 3AF4A 1J42A 3LDTA 4F11A 5IT9M 2IEBA 3TZBA 3UFBA 4ZK6A 4H7KA 3JV7A 4FGJA 2EBFX 2WG2A 1K98A 4I4TA 3HJWC 2OEPA 1X9HA 3OZFA 3X1MA 3BXHA 5CBPB 1GNPA 3KOOA 2VJPA 2QKCA 3WB9A 5FUWA 1EXVA 3DO5A 3TMAA 2N05A 1JJFA 3CUKA 2Q6AA 3TXQA 4J1QA 5A9TA 3I72A 4CF6A 4NZOA 3IQFA 1LDNA 3MBMA 3SDLA 1I36A 1KFJB 3NNNA 1CUFA 2GO7A 2MINA 2JH8A 4OXKA 5IG2A 2Q46A 3AHGA 1R4MB 3H4TA 1GKFA 2OTMA 3AHIA 2I4LA 3WGJA 4HUJA 3HR7A 1ZX3A 4WFEA 4C4WC 3I3FA 1FDSA 2B0CA 2FCAA 4OM7A 4JL8A 3LXUX 1XEFA 1XC7A 3WMFA 5ALVA 2WYVA 4ZQGA 3VR5A 5B37A 4UV9A 4EHIA 3ROMA 1AK1A 4FLVA 1D4AA 1OWOA 4YP6A 3VYSC 4I4TF 5EZ5A 4YDHB 3ZE9A 1CSEE 4K3VA 4HDOB 5B7GA 3G2PA 4V0ME 3I73A 1WW8A 1SUDA 3K1YA 4N6NA 4WZBE 9GPBA 2IH5A 3O91A 4YUXA 5BWNA 2Q3JA 1VKOA 3ZE0B 2HIGA 3VO9A 3L02A 4TT3G 3OMWA 4X94A 4OM8A 1KSJA 3K3WA 2C2GA 3BPZA 3O9MA 2X6BA 2Z1MA 4RPIA 1MJHA 1V5WA 3T9FA 2IYTA 3HNPA 4MWTA 1Q19A 3SAJA 3GU3A 2JDID 3AEYA 2RJZA 3AUUA 4TZ6A 2FFAA 2ZE8A 4L6AA 5EBWC 3ESZA 4HMQA 4YMSA 1YOVA 4B31A 5ITSA 1US6A 1LFDB 2KX7A 3AZOA 3LUHA 2YMPA 3U44B 1PLLA 3GELA 1SD1A 5EMHA 3P0RA 3NDRA 3JY6A 4KW7A 1XA3A 2V7PA 1N1MA 3VU0A 2VQEO 4RDXA 2CZWA 4FZ5A 2JIBA 4U7GA 4O2BB 4AO6A 3WDMA 2CZCA 3B20A 3C7KA 3M33A 3OTWA 3TFWA 4WZBB 4M9ZA 1VQPF 6NULA 4GI3A 5I8WA 4NEGA 2DBYA 3O7WA 2JH9A 2IAFA 5U4QA 4OO3A 2GERA 2Q7XA 3LHIA 4MYUA 2W8BA 4JQSA 3MBKA 4AUMA 2QXTA 4IOMA 1A2QA 3M6UA 1BZKA 1RW4A 1THMA 4KCGA 3EFFK 1AXRA 2RHBA 4KQ9A 4NAHA 1HRDA 3O84A 4CIYA 4GPIB 3IGAC 2ZAUA 1ZR4A 5IM5A 2DQ4A 1YI2V 4FEAA 1S2IA 1KO8A 1RCUA 5BR7A 1DAKA 1KFBB 5DK4A 4P9OA 1E7SA 2BE7A 2IHUA 1YJWF 3GHYA 3B3AA 1KK0A 2R8OA 3G9TA 1U7WA 5TB5A 3KEFA 1N0JA 5UKDA 4FE7A 3D8SA 5FWXA 3WDSA 2GQ0A 2Q5IA 2PJUA 1E58A 1E9VA 3GGOA 2QXUA 3I6BA 1U4SA 2DFDA 2HW8A 2G9ZA 1IOWA 4TXMA 1KIAA 3P30A 3FG9A 1M8KA 1S2GA 3BFJA 3V1NA 4KIFA 1M1KH 2HMSA 4BIOA 2Q9BA 3QFFA 4NTYA 1N7HA 3ABKB 4MVJA 1X42A 1Y4SA 2V0NA 2JFZA 3QEOA 1MRNA 4CM8A 1W581 4MV4A 4ZEOA 1Q0QA 3KSDO 2HAEA 3K0FA 1WU8A 1V5EA 5JCOA 1SXHA 3QUSA 2C82A 3MWYW 1DBFA 4XR9A 3SE0A 3DXRB 3CRQA 2XGSA 4RV9A 2XQIA 2E9SA 3K1TA 3CYPB 3J81N 4PICA 2NLOA 2BFOA 4LBZA 4EUNA 4E30A 2BJWA 2C1XA 1MO2A 2F55A 2GXSA 1U28C 3CPEA 2CVHA 1TTTA 1C0PA 2I6FA 4YDSA 2CNOA 1FTWA 3UTDA 2A2ZA 4NU8X 1Q2XA 2IU4A 3WLPA 3NPAA 1DJLA 6LDHA 4PHHA 3UW3A 1NXTA 1WQ4A 1O3YA 1RTTA 2ALJA 5GZ1A 4FS8A 4E5YA 2YN4A 1DWPA 1UP7A 4LJ5A 4HB3A 3C5HA 1G8FA 1V5FA 3HG7A 1ZC3A 4MVJF 1XJ5A 2EJVA 4QDXA 4HWTA 5AVVA 1CRZA 1HE8B 1ULSA 3X2QB 3WU2Z 3TLXA 3UICA 1E2LA 1M8JA 2HF2A 3TJZA 3KOZA 4LFBB 4RE6A 4EKEA 1YB7A 4I9WA 2Z01A 3S0WA 5EESA 4NUTA 4NBNA 1A9OA 4EA7A 4MAMA 2Q0XA 4JLAA 4BX0A 4RVHA 3T80A 1URPA 2H59A 2IZOA 3W04A 3IQHX 3QUCA 1L5LA 5IYCO 1GQRA 1NVTA 5DSTA 1KAGA 1QAQA 4LCKA 3NBXX 3HBLA 4QM7A 1KJYA 2A57A 4QOHA 2DYSB 4HJXA 4RQBA 2HR1A 1SC1A 1AX9A 1JV2B 4LJSA 2Z2ZA 1NBEA 2QLBA 2JFOA 2YNMD 4D8WA 4TSFG 1XVTA 1HZZC 2IUEA 1UBNA 1W0KG 4IDEA 2FP4B 4CQMB 2GESA 3ZJZA 1VE5A 3DDNA 3B3QA 1E2BA 4WFIA 3KVYA 4MJXA 4FTWA 3VYUB 1GCGA 3R8XA 2B1GA 2VQFO 3M1LA 2E18A 3O4RA 4O2LA 4J1TC 2RQ6A 2ORIA 2XCOA 4IIJA 2G83A 3O8CA 3IHTA 4TTIA 3MJCA 4IVNA 2JLSA 2YNMC 4XM2A 1IRXA 1W59A 3DZBA 3QEMA 2CNBA 3RGWS 2IQIA 1PNQA 3LUPA 2KHZA 2IZ5A 4E1BA 1GCAA 2UYGA 4TS1A 3O8OB 2OCCC 5BRNA 1L4FA 1IB0A 1W8IA 1N2HA 3EIEA 3NWOA 5BN5B 3LY8A 4LPSA 3L4BC 1Q1EA 3K4HA 1ORQC 5K6RA 4F3TA 2C3PA 1XP8A 3H1GA 1Z4NA 4NTXA 1Z68A 1V25A 1DCTA 1KNJA 3UJNA 3IB6A 2Z8ZA 5EXTA 1DCMA 2EFEB 4D81A 2VQDA 5DU2A 2YRXA 4P2ZA 4L78A 2I4TA 1ZSVA 4YRZA 4UU8A 2Z0AA 3EDMA 4IIJF 3W05A 4HFNA 3QLJA 2J4CA 4PR0A 3WJRA 2OGZA 4MV5A 1HT2E 2AF4C 1B26A 5JDCC 1HGXA 1ML3A 4R7GA 4AW9A 1PGNA 3OC6A 3HABA 2YV2A 4OPMA 2QA4V 1QWOA 2V8BA 1TUIA 4JYBA 5KU7A 2UYKA 2IYSA 5EIWA 4I3HA 4DT1A 2E4UA 5I7VA 5A2QN 3KB8A 1KO1A 4J41A 5D5QA 1XD2B 1L9KA 3S8MA 4MICA 4UPDA 5E8RA 1UAYA 2ONZA 2BBOA 3EXG1 4MYDA 3A6JA 5EC8A 4H3SA 3BJRA 1XSEA 4WD3A 5EP1A 3UNXA 5E3IA 2B9ZA 2GS9A 2V6BA 5ALUA 4B4WA 4DQDA 3SQMA 1N8SA 2Q69A 1IN4A 3S7ZA 2V4DA 1KB9F 4AJHA 3RTDA 1UBEA 4HQFA 3DVSX 3OPYB 1VSQA 2C20A 3X1DA 4BIZA 3RSQA 1L4HA 4CGYA 1COZA 4G1UC 4JZ2A 2ETNA 1DFHA 1S5PA 2ZQ5A 4PZLA 1G4HA 5CLHA 3RSSA 4WW0A 2FMHA 4J0GA 2P3SA 4LR3A 3F2VA 4P7KA 5ITZB 2C8VA 3R41A 4L6IA 2EP7A 1Q15A 1WX1A 1IDN1 1JLKA 1OUMA 3D7RA 4IXWA 3NC0C 4MS3A 2YBEA 1SKVA 1BU8A 2F9FA 4L02A 5BQPA 1ZLXA 4H7HA 2R6R1 3J7TA 4Z4CA 4L9SA 4YUWA 1E5VA 2F3QA 2NZJA 5EERA 4DR2B 1V95A 4XDHA 2J32A 4R6WA 3H9UA 4X5OA 2Q0SA 5DX8A 2QN8A 4ZVLA 3GFQA 4QDKA 5HK8A 1J6UA 2QL5A 3FB7C 4JYYA 3D4NA 1XJ0A 3CWCA 3LYUA 1GPH1 3UWKA 4HNQA 3U3ZA 3HCPA 1KDVA 5AJTA 2R6DA 5T8KA 1HQKA 3M6WA 5A1TA 4BWVA 1DF5A 5EKTA 1ZO8A 4DXWA 4Z0NA 2WUGA 3H2SA 3K03A 2GN8A 3T5BA 2YWBA 3MMNA 4G09A 4B3HA 4TV8A 4WY5A 2B82A 1M6NA 3GFFA 5CX1A 4DE5A 1K06A 3WK9A 1SCUA 2Z3VA 4S1OA 1FFTB 1PDOA 4FNGA 2CLLB 5IABA 4IDGA 1H2WA 2PWYA 3RWRD 1PV2A 4E5NA 1U2PA 4TYQA 2QRJA 4DOMA 3DVAA 1WJZA 3LUKA 1D6NA 5IJWA 4JNCA 4Q4HB 1EB9A 2TYSB 2UYQA 4Q03A 1EKXA 2RH9B 2I9PA 3L0OA 2HJHA 4K1XA 1QGAA 1USKA 1RPNA 1JIIA 2DWEC 3PHLA 4GRIA 1NIJA 3UCEA 2Z1EA 3F67A 5K0SA 5LLDA 4HDQB 1R10A 4YJ3A 2ECPA 4JI5B 1OBFO 3ZGLA 1MJGM 5LJIA 2F1MA 2ZE6A 2Q8NA 1VA4A 4B3CA 3KT0A 3P2YA 1WHTA 4M0KA 3FPJA 1IM8A 3CC2F 3BTVA 4L22A 3LBFA 3E35A 2RJNA 2QVLA 4CQMD 2YMMA 4KBYA 3FKJA 1OA0A 4MKZA 4I55F 3GJ4A 1V96A 5AM0A 3ZIAA 2IS1A 2NU9B 2AOVA 1ID8A 1WLEA 3KQSA 5KVVA 1D5NA 4K28A 3M6AA 4K7JA 4IP0A 2WU3A 1N32B 1IN7A 3T7SA 1G1XB 4Q9IA 4NXMO 1V3UA 2HK8A 3NBFA 2VAPA 3P9SA 5JSZB 2ZUWA 1YS1X 4UQPA 1ZIYA 3GAFA 3B2NA 2H2HA 4YJ3F 5T4EA 2ZBPA 2GOYA 1JXQA 4JP1A 5F7JA 1QVVA 4DCMA 1H48A 4U00A 2HJWA 2OHFA 2O8DA 5JYBA 1F7UA 4LEIA 1NT4A 3IQZA 3UXMA 1KVRA 1OLSB 3EIXA 3FYTA 3TKAA 3EGXB 4PC6A 3AR4A 4LY6A 4Z8XA 1M2VA 1YRWA 1Y89A 3E9EA 3QLEA 4R83A 4U6NA 2V6FA 2V58A 2ZUSA 2ZVJA 4XLLA 2AV6A 1NE2A 3WLFA 1PQUA 5H02A 2HQOA 4R8KA 1K5QA 2VCYA 2VRNA 2XNCA 2W2OA 4ZI5A 4WJKB 4HOYA 4FB5A 4R2HA 1UAGA 3QWAA 4BC1A 3FBWA 1U0OC 5BSTA 4M1OA 3GNLA 2BSKB 1E4YA 2FG6C 2JAXA 2F6RA 1EDZA 1Z5GA 5JH7A 3BZBA 3O6VA 1DAOA 2HADA 5CDFA 1C1HA 2N48A 4HGZA 1YIAA 2IHTA 5PNTA 3ZK7A 3N6XA 2DMRA 4QATA 3CLSC 4WADA 2D5IA 4D9BA 3TD3A 3BKXA 2NVOA 1TCVA 1PNKA 2JAUA 4N76A 3RFTA 4F5YA 3E20B 3Q12A 1CIVA 3F6EX 2IJKA 4XX1A 1RVDA 4HGRA 1PQWA 1A97A 3T7DA 3DP7A 2UZ4A 1DX6A 3LDGA 3WTBA 3V4ZA 2Q5HA 3T5MA 1R1MA 1VYUA 1G7CA 3RANA 5EWLA 4UV8A 4BWYA 4F5WA 2EJRA 3H1AA 1NW8A 4INZA 2VJNA 5HS6A 2YY7A 3WLIA 3NLLA 5MN5A 5JH7F 3TD2A 3PSHA 5KQGA 5J4VA 5HE9A 1RPAA 5D87A 1UODA 2WAXA 3ACDA 3DTTA 1WXDA 2QWXA 4BB0A 4BMVA 3JQAA 1DBQA 2DT5A 5ED0A 3GA0A 3DB1A 1CCWA 3S2FA 4KJXA 3VQWA 9ATCA 2X40A 1JDUA 5E79Z 1Z0AA 3EQZA 2OKCA 2XUHA 4JI8O 5HXUA 3ZS9A 4Q9HA 1KVSA 5ER9A 2AN5A 1T6NA 4H13B 1XZPA 5DN6G 4ZARA 3WL8A 4OHXA 1L5OA 1A8PA 5T67A 3Q88A 1V3TA 4FR2A 4PA4A 5FRDA 3WPWA 4BKOA 1W29A 3FVWA 1M73E 1L4YA 2AI3A 3W5DA 3SS9X 3PQCA 3DDOA 1B6SA 2J7KA 1OR8A 4LF8O 3QU4A 1TW2A 4PYOA 1GV1A 3HPQA 1E79G 1MMFB 3G8YA 4IWYA 1YZNA 1HFKA 2P2ZA 4R98A 1RPJA 4JBYA 1YJXA 5IH7A 4MCHA 1AU9A 4OA5A 1KHHA 4GGMX 2AQKA 1NMSA 4JSRA 3VX4A 3WNDA 4V39A 3VU1A 4WUVA 3URMA 1LW7A 2H0AA 3HKDB 4M1QA 1AO0A 4IVRA 2OYCA 1GQFA 1ONOA 3PQ4A 2ABWA 2O0KA 1ITZA 1IZ9A 1Y66A 1ZVVA 2DG2A 3MMXA 4KN5A 4FGKA 3B38A 1VYTA 3LO8A 3LWZA 1CR2A 1IY1A 2AUMA 2CKMA 2FSUA 2PD3A 3V34A 3WKDA 4DV0O 1J25A 1YBVA 2C3UA 3RC2A 3CCMF 1S5JA 3ZMUA 2QB5A 3B1ZA 1B73A 1SBTA 3ZGNA 3P32A 4K2HA 3M6VA 4WWHA 2EIKB 3UK0A 2OGUA 4XH9B 2P0EA 4AXXA 2QL7A 3TQTA 3PWKA 4I2NA 1P1RA 2D4AA 5AOCA 2UUBB 3G6EV 1W9HA 3FGNA 3B51X 1ESMA 2G06A 2G38A 3SNHA 3ESAA 1LWOA 1T5DX 4EW6A 4I19A 4IYIA 4OK6A 1E1QA 1QO9A 2CDCA 4C43A 3FF4A 3A1FA 3C90A 1T2DA 2NU6B 1J0XO 2QPOA 4GNKA 1NUSA 2QE6A 4QIHA 3H42B 1VQMV 2IEAA 4MS4B 4G0NA 4WOCA 1WLYA 2VN8A 3INYA 2IS2A 3TCUA 4QAJA 2X0DA 3GQVA 1XPRA 2XUJA 2BFWA 3PGLA 3HPLC 5I9IA 3GDFA 3IDSA 3PC8A 4NLLA 1J8YF 1KJZA 4HS4A 1RM0A 1F9EA 2WSSD 3U6KA 4BV3A 1BNCA 2XUOA 4TVSA 2ZKOA 2X6RA 3OTHA 4IKPA 4JOCA 5EE5B 4I5IA 1ZSYA 2JI4A 3ENZA 2ZJ0A 5LQMA 2W98A 1CR0A 5HOEA 3FCSB 1D5CA 1VI6A 3KOYA 2VDVE 3VCZA 3B1KA 4RKQA 4OLBA 4MQBA 2O8CA 2EL7A 1KE2A 4US1R 5IBQA 2AC4A 2H18A 2CTRA 1N3LA 1VIDA 2QUBA 2AN4A 1FYWA 4OJNA 1LBQA 1AS0A 2ZB2A 2F93B 1KYWA 4LV8B 5KWEA 4D02A 4C4AA 3E82A 2WSBA 4NK4A 1XOIA 4BZZA 1JSLA 4YQZA 5AM1A 1C7IA 1U0RA 5G0VA 3RWBA 1QLHA 4S2EA 4CDRA 3JWGA 5K09A 3AR6A 2Q0QA 3QWFA 3LV8A 5CBHA 2E75B 1NBAA 2J4FA 4S05A 1J7HA 1YITF 3CWZA 4OBEA 1WPRA 2ZCUA 2GM3A 4NX2A 1A4XA 3ECSA 4D98A 2DQ3A 1ADYA 3D1JA 5F1KA 2RHLA 5CN0A 1CDDA 5FR2A 3KQPA 4OHFA 8GPBA 1UBMS 1XRGA 1JEQB 2FWNA 4PLFA 3CCEF 4ZGBA 4BB5A 2OXTA 4BNWA 3HYRA 3LVBA 1L5MA 3I2IA 4WCVA 1SG6A 5E9WA 5JANA 3KR1A 5FO0A 1SN7A 4I0XB 3HXPA 4XWKA 3A6FA 2BEUA 1IZ3A 4GRAA 4LF9B 1PJ8A 2IXDA 5KHGA 2WJGA 4B3RO 1T9KA 3QNWA 4YHHO 4MVRA 2Z56A 2FOLA 3AG2B 4QBIA 4X95A 2CNNA 1LI7A 3NHYA 3SC4A 3RT7A 3UM7A 1GN6A 2H4FA 4L73A 3F9CA 4E5UA 1A9SA 4G0WA 3WJAA 2GNPA 4BMZA 4G4JA 1DKLA 3C4JA 3G88A 3Q7PA 4K8XA 3AEKA 3Q8WA 1Y3CE 2YQ4A 1FXKB 1Q91A 2ZYUX 1MX9A 1O1YA 2P6UA 1YE5A 2PRYA 3THXB 3QUQA 1JOYA 3DXXA 4MHSA 3C8DA 3HVJA 3AH8A 5KSOA 3EIWA 1UH5A 4ZJZA 1IL0A 2QTOA 4JBHA 1QIKA 2ODWA 3CCUV 4MW2A 4EQ6B 1NHGA 1NMZA 5JT1A 1XZKA 1MVNA 1SOAA 1G7RA 2AUTA 4NENA 1R0WA 2DFLA 3M82A 5G40A 1IWPB 3ANNA 3DKIA 3QHQA 4PZUA 1P7ZA 3FUTA 5K6AA 4L08A 3ZV5A 4QTUB 3TW8B 2KI5A 1TJNA 1GM5A 5KUMA 3FETA 4Y8VA 3WFJA 1T35A 2QQ5A 4Q3CA 4ETMA 3G6BA 3QU5A 2CYBA 2HK7A 1W87A 1IDOA 1KGDA 3RYIA 4JC5A 1F8XA 2DPGA 5JG7A 1NQAO 2V03A 4YFYA 5HMLA 5ELLA 2AOTA 1SUAA 1KYVA 3PIRA 1UDRA 4KOAA 1JDBB 2IYQA 1B06A 5JWPA 4RD4A 2YV5A 2BRUA 2PYJA 4U5XA 3ISTA 4NICA 1V8ZA 1XTJA 4KNVA 3GGCA 1VHQA 4JVLA 1M8PA 4FZ1A 1WXQA 2IYXA 1DO2A 1K8AW 2YDXA 1PL8A 2H9AA 2LO1A 4DUPA 2GSMB 1B6GA 2ZJ2A 4E4TA 1X7DA 3ZHRA 4IJKA 3LKDA 1QJCA 3ZY4A 2AE1A 4EVQA 2B3TA 3ZU5A 1N2SA 3ZDFA 1YHQV 1KP2A 1ZGHA 1V48A 4U63A 3U80A 5BQXA 1FX0B 2O8EA 2HU8A 2HMWA 2R68A 4OATA 2LJ2A 1UMCB 2WSYB 3AVXA 3G6KA 4REQB 2GKSA 4POAA 2HL6A 2OT3B 3B9PA 4QVKA 3BGIA 3MJRA 2BKUA 2BGTA 2ITCC 5KOHA 4HDMB 2EFCB 1XRSB 1PFUA 4EPVA 1A9XA 4B6FA 1QMPA 1W2GA 5C3MA 2JHFA 4B2YA 4C03A 3BL5A 4IDFA 3NBZC 2FVXA 1RRMA 4GSYA 4GUAA 4Q7LA 2R6GA 1W30A 4EFBA 2A88A 2OBFA 4N6GA 4MQEA 2QM3A 1CUAA 1Z7WA 3KT6A 3UG7A 4UU0A 3VHXA 2X8LA 3EXIB 3UAWA 1UAAA 1R27A 1KMHA 5AXCA 2AW3A 3WNVA 1N34O 2AEEA 4L5CA 3PUVA 4A7PA 4R40A 3LKVA 5HGJA 4ID3A 3D9QX 1SQBH 4CFZA 4IM7A 1QG0A 3KUUA 2JRLA 4JJIA 4DM4A 2JVIA 3JQ6A 2BOVA 2OORC 1XF1A 4DW1A 2V97A 1PP4A 3SOZA 1P4HA 3GLGE 3Q41A 5KNBA 1M2HA 4O5OA 5FF9A 1GJRA 5EJMA 4PN3A 1I2BA 2A30A 2BCEA 1PL6A 1O0CA 2V9PA 1DXHA 4E4YA 2QVCA 3O8NA 3WE7A 4MVYA 4J3NA 4LV5B 2I8CA 4JHLA 3WHLA 4H0FA 1M6WA 4M1MA 4YMHA 2ADOA 1HKHA 1V47A 3A9UA 4B85A 3SQNA 2HYDA 3DDCA 1C5KA 2QR5A 3SPHA 3FYUB 3T5AA 3ER8A 3OJLA 4HH3C 2XX3A 3PA6A 3F2IA 3EZ6A 3UJAA 4WZAE 3IYLW 4F1WA 3V1TC 1N2CE 1QH8B 2GA9A 4Q1AA 3TEJA 4AXBA 1IULA 1CF9A 4UNPA 4AUNA 3FTFA 3PDJA 4TMZA 1RJ9B 1JHPA 2O3SA 3AY0A 4QUDA 4AJPA 3U0VA 1PW5A 3GLGB 2I6RA 4ARZA 2R7LA 1R5OA 3K0HA 1YB6A 2G5PA 4PSDA 1ZD8A 4LCJA 3NCHA 1O54A 1P6XA 5HM6A 3LK6A 2EW2A 3IMEA 5DJ5A 4AY6A 1M2NA 4QBGB 3MMPA 4EEKA 3ILXA 1PKXA 5LQRA 4DA8A 2B83A 1LPMA 1YE3A 4EPWA 3IKVA 4MVQA 3D43A 3IUJA 2O2JA 1GXSA 2ZTMA 4Y3UA 1F4PA 3ZMTA 4WZAB 1N2CB 1U7UA 3VZDA 1Q11A 1K6JA 5C4GB 3KHTA 2PF4E 1DHRA 2EGUA 2ISSD 4BHTA 4LRTB 5CG1A 2PNJA 3TSCA 3IT1A 3N2EA 4LF5O 1ONPA 5EE0A 5ECWA 2O2SA 3HCDA 5L40A 2FTKE 3EVNA 4RHUA 3R8CA 4Q3AA 2IJHA 5DX1A 3OZIA 2A9HA 5JO9A 1MNGA 1EFRG 3E2IA 4WIAA 1TM4E 4J8PA 3IIKA 1NG9A 3D2BA 4AT1A 4R8MA 2CE2X 4RK5A 3JS5A 4R8CA 2D0DA 4OBXA 1X7GA 3AU9A 3VHQA 2R96A 3WNQA 3C6XA 3HL0A 3Q9UA 4DIMA 5CFOA 1UJMA 3R9WA 1Y63A 1E6CA 1C7JA 3EFOB 4N40A 4MQLA 3EVBA 1NJ2A 1QZZA 2GM4A 1T5IA 5LPNA 4AO8A 5DMHA 4RE5A 3L7BA 1C4XA 5GM2A 3OQPA 1HNWO 3A3PA 4UAUA 2DHDA 3AB7A 3I9JA 2M2IA 4RHAA 3DMRA 4OGGA 2V7GA 1ENOA 4JMPA 5C1BA 3FDIA 1QQCA 3PD1A 3K6SB 2WRZA 1DT9A 3D7MA 4H18A 3ICXA 3MW8A 1NE7A 4PRLA 3BA8A 2A0YA 3RH0A 3DNMA 4CCWA 5F5NA 3VYSB 2VZLA 4JFAA 5DHQA 2L6LA 5TARA 2HLDD 2YXEA 1I4WA 2EQAA 3TOZA 1BN7A 4DJDC 3UFXB 1PL7A 5CB4A 5LKRA 3LCCA 2GN0A 2UVDA 4TKUB 2QU8A 3OX1A 2EIHA 2G71A 4XM1A 3IVGA 2ENWA 1VL5A 4JEIA 3B78A 3EWNA 4YXWD 2CTQA 1GTJ1 4NJEB 1ZJ5A 4JDUA 1OAPA 3OJEA 2C92A 1R0SA 3BFXA 5JS8A 4BNMA 5D84A 3WG9A 1FQJA 1SQ5A 5CLQA 4PIVA 1E3QA 4FFRA 4PA9A 1CNMA 3U4CA 2RK6A 2C5AA 3LPNA 3GMDA 3RG2A 1Z26A 5IF3A 1RWBA 1FFHA 3JSNA 2Z1DA 2WAMA 1KNXA 4V3BA 4CV1A 2YDYA 2EZOA 4FBGA 2P7IA 2PR2A 6Q21A 1BH2A 1GD1O 2HRYA 2R86A 1NBHA 5KHJA 4EYGA 4G85A 4Z4GA 3B6MA 1PK8A 4MJ7A 2ZUDA 1GPYA 2QLTA 2UZIR 3OLYA 1HDRA 4U3FH 3DE0X 3NEAA 1FRQA 1N8RH 2OL4A 1IYZA 4C7BA 3GRYA 2P11A 3GLSA 2V4MA 2IW5A 2ZAGA 1AOXA 4QE3A 2WIBA 3D4BA 4FMCF 2J3LA 1BX3A 5A5EA 3G5AA 4W63A 5T6BA 2QE7A 1PS0A 1R50A 2P2NA 3VNBA 4TL9A 1G9XA 4MGYR 1P1HA 1E7KA 2YXHA 2LPMA 4CE6A 3RREA 2NO6A 4ZAZA 2C2OA 2WJ6A 2W6ID 2CKDA 3FPLA 1D9ZA 4KZPA 4E7OA 3CNLA 3IVRA 5LU9A 1QVZA 1U2DC 2A92A 3WB0A 3ORRA 2O3JA 3V4LA 3IEUA 3CCFA 2FG7C 3FNGA 4EENA 2EYUA 4BWAA 1WP8A 2HRRA 4MVWA 4YP0A 1RXVA 1T8PA 4WFHA 2Q1WA 4PZCA 1VL1A 2JFNA 4BNVA 2IYNA 2VDOB 3FB4A 2Q6LA 3BJMA 4OHOA 4DJJA 3WBKA 1DQNA 1WCWA 1LSSA 1SVSA 3M34A 3WG7C 4G89A 4A8JC 3IJ4A 2HRBA 5CVEA 3OOYA 5JQWA 4NHOA 4ILKA 1DJNA 1VQLF 3OF5A 3S3XA 1BQ4A 4P98A 3JYNA 5IAJA 4MR9B 2X0IA 3LUBA 2E3JA 4GBED 5TF0A 2JJMA 2WUWE 1O6GA 3G8DA 3PGVA 3VZSA 4PW0A 4JB0A 3VKVA 3H05A 4NCHA 4DMFA 2ZJ3A 3HVIA 2EJCA 1Z2NX 3H1TA 2QMOA 4P35A 4RZHA 5TEVA 4FMDF 1M9NA 4CEJB 1CS0B 2DTEA 3I8SA 4KQFA 5AJVB 2HQSA 4DSNA 1MABA 4YAUA 1FNKA 1KTIA 2Z1TA 3DMFA 5K1PA 3UWOA 4O29A 3NHRA 1LV7A 2RGBA 5DLEA 4WL0A 1ZK1A 4NU0A 2CXUA 4OFWA 5DIFA 2FFJA 5FTJA 5JJ5A 3CC4V 4A92A 4RDIA 2OLEA 3KOWA 3MFQA 2ZVDA 3V97A 4E0BA 1T4BA 2IE0A 1NTMH 2Q4OA 1WS6A 4YPOA 3E03A 5DBGA 5KUTA 1L1QA 1P8JA 3AM3A 3SN6A 4K8OA 5JCJD 2BKAA 3GXBA 1Z82A 3AJ8A 3FKQA 4GS5A 1D2GA 3SF8B 5KNCA 4CM4A 4ASUD 5F9FA 5B6JA 4LYGA 4FFDA 1AUXA 3RJTA 1N7JA 4DY6A 1TJ4A 1K73H 3JAMA 4OK5A 3WYBA 3RQIA 3FSGA 2UXCO 2RGEA 3KKLA 5BR1A 4HNSA 1H3FA 4PV1B 1W5TA 2LTAA 3J7AC 3RSCA 2XADA 3E27A 1W5FA 4ZVKA 1FVXA 3F7MA 3EC1A 1W5EA 4MB6A 4DBZA 3EX7C 3K0TA 1ODJA 2FXVA 1ESNA 3OLCX 4EGQA 2WSLA 4RTPA 3EEOA 4FK5C 2CXXA 3MUFA 5J9PC 1T15A 1GNTA 3CF0A 5C93A 3SF0A 3OPQA 4RK0A 1FUIA 3V8MA 5JIBA 1T4CA 5LOVB 3WRXA 1Y4MA 4D25A 4BZXA 3NHFA 3A4LA 4E51A 3GZNB 2UU9O 4UCOA 1FPQA 5FWNA 2OCCB 1M83A 1J5EO 4OXSA 1W0JG 1S72F 4OGFA 2LIVA 5C8VA 4AX8A 3BJZA 2P30A 2VPQA 4MI9A 1NPDA 3U60B 3E7WA 2GB4A 3UK1A 1ZSPA 3D7NA 2VDWA 4OQNA 2KSQA 2VDMB 3W6NA 1Z0JA 3I3OA 2WQ7A 3GVPA 5I7SA 4KQ1A 3OOSA 3J7AR 3PEUA 4DDMA 1VQNF 4QUKA 3D4OA 4LBEC 2XBUA 1X7WB 4F4JA 1XQ6A 3PXEA 2J87A 3BHPA 3K9FC 2VPTA 3INGA 4MUXA 3FYCA 4UZEA 1LI5A 3L73H 4EB3A 2BOCC 1RE1A 5E1BA 4PI0A 1CY2A 5ALDA 1ZNYA 5FBWB 3KWFA 3RC9A 2FETA 3GLRA 3CSDA 1EXWA 3T5TA 1JN0A 1OFUX 3GI1A 5HCUA 4I1PA 3U39A 1BS9A 3QX9A 3LY9A 2G70A 4P38A 2V3CC 2SICE 2PLAA 3RARA 3B3FA 4L3WA 2JL1A 4RVCA 2ATXA 2OB2A 2VCHA 3WA7A 5LUBA 3AESA 5ALWA 5KA5A 3DKRA 3B8HA 1EP3B 4R2MA 2OZPA 3VAYA 1BVHA 1EQAA 4HSGA 4RDCA 3I62A 3RC3A 2ZDIA 5ICEA 4ZOAA 1QANA 4MWDA 2I65A 3UKDA 3TJMA 4OV6B 4LCEA 3W9UA 1ONNA 2R00A 5M5BA 2FPPB 4LOIA 2O2ZA 2LV8A 3DUWA 1EA5A 2IYEA 3UXEA 3F5QA 3IV9A 3K0CC 2EC5A 2HK6A 4DWWA 1I01A 3R9IA 2NPFA 3CIOA 1GQ2A 2ALEA 3AHFA 1JDNA 1BDJA 1M7GA 1L4NA 3ONVA 1BMFA 3M1AA 4O4LA 1UWCA 1G6HA 2X1LA 1YI8A 4K2AA 1A98A 2A59A 1U0BB 1HLDA 4N54A 4EFLA 4L16A 2EW8A 1V1MA 5JVDB 2PTHA 1SXJC 3BN3A 4FZRA 2ODBA 2ZB4A 3OJ0A 4TLEA 4ALNA 4O5AA 1QAHA 5C4MA 2QTNA 4GBGA 5K0LA 1BWQA 3OWXA 5AOBA 3ZY2A 1KECA 2X23A 4E22A 1SIWA 2B61A 3UAYA 5ALKA 4U9IS 4E2XA 4B3BA 1U11A 2YJZA 4JL5A 1HK7A 3ZDRA 4DSOA 5FV4A 3H19A 2Q3FA 2WLSA 2KLBA 1PGOA 3ZJVA 1Q7GA 4TQUS 2K2WA 1UM9B 3CH5A 3V2HA 1Z4IA 4F3RA 3MA0A 4O4LF 1Y8QA 4KKXB 1L3IA 4YRFA 5TQVA 4OQYA 4NSNA 1C7EA 1DAHA 1WKBA 4B5CA 2A84A 4UBJA 5BQFA 2WD7A 1HSZA 5DSXA 2XIJA 2P69A 2SCUB 3SHVA 2HA6A 3ITDA 1UMBA 2P6RA 1PN3A 1G42A 2GN4A 4G5QA 4BP1A 4MV8A 3KTOA 2QNIA 3A1WA 2XCUA 1SO8A 2PU5A 3MB8A 3OKAA 3UMRA 2RI6A 1KY5A 5K3OA 3SGLA 5CIQA 3ZVLA 1P2FA 1E7WA 3MRSA 3AV0B 2GBLA 4RJLA 4Q7JB 1M1XB 4KGDA 1DEAA 5AUPB 1FLNA 3TIVA 1SZQA 1U2ZA 4QOIA 3GFSA 4HGNA 5A4KA 1O0SA 2P3QA 5CJJA 4BO8A 3FHLA 2Z6AA 1MQAA 3HDHA 4V0OA 1RADA 4GH5A 3LSSA 3V8RA 2J6IA 5DI3B 3KDAA 5KVCA 5JAIA 1SERA 1KFEB 5KVQA 4BNUA 4FNMA 2VHUA 3V1LA 4RD6A 4IS3A 3TTTA 5AK5A 3BL6A 4RA9B 1OH5A 4GMFA 4ZKEA 4ZHQB 2EKPA 3LC0A 3HI4A 4QSHA 3ZVKA 2HFEC 5FUYA 5MFZA 1X39A 3U48A 2XYPA 2QM8A 2OFPA 1CLUA 1S2NA 3PU6A 4QBTA 4WCFB 5EKSA 4RIEA 2YX1A 1KEWA 5CGQB 2V65A 4H6VA 5AJZA 4A5UB 3CUWA 3ERCA 4RPHA 5KYGA 4FYVA 1I10A 1MENA 1XYVA 5KJCA 3UAZA 3WIEA 3PNLA 4E6PA 4UXHA 1VL6A 1E4EB 1FY2A 3K5MA 1V0JA 4EHBA 1LEHA 4YAIA 3ZWOA 4N39A 2B4QA 4P7FA 2C2BA 4LGYA 5A9SB 2UUPA 2FMLA 4AYXA 4NMHA 2JI8A 2VPIA 4JQZA 1GMGA 1A7JA 1QVGU 2R7KA 2V3VA 4PPQA 1OTXA 4EW1A 2GZ2A 2WP0A 1ZH4A 4N41A 2P40A 1NFRA 1Q1AA 1Z5OA 1I5RA 2GNAA 1M0EA 4MYSA 5NULA 2IGBA 1GKUB 1GTL1 3B89A 2EJUA 2IPXA 4QSMA 5DCUA 4FZ3A 4DDTA 2WUEA 4YP9A 2RE8A 4IG4A 4OOEA 4RA6B 5AK6A 3TL2A 2ZUBA 5JNSA 3FDJA 4AJKA 4D99A 4KNYA 4CTOA 3LF1A 2QT1A 3DMDA 2BPOA 3NETA 2O6LA 2PUCA 3GZTB 3V6MA 3N2KA 3NVAA 5FP0A 2NIPA 4BVFA 3QLVA 3EEYA 1HF3A 1UJNA 4X1YB 2FPSA 3MBIA 2X6QA 4RMHA 2R5FA 1VA5A 5LWHA 1K33A 3ASZA 3EHBB 1L4KA 3N6VA 1OW3B 1EZ1A 4CUKA 1CDOA 4RMNA 1PR4A 3H8WA 1JU3A 4U6SA 3IOMA 3O4FA 2X5JO 1RXEA 2I3AA 4TUYB 1B00A 2AR9A 1WCYA 3FMOB 2WD8A 3DZ8A 3MQ4A 5IHXA 2QP4A 3SYLA 1U8ZA