1TUBB

Tubulin alpha-beta dimer, electron diffraction
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
427
structure length
427
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUBULIN
publication title Structure of the alpha beta tubulin dimer by electron crystallography.
pubmed doi rcsb
molecule tags Microtubules
total genus 88
structure length 427
sequence length 427
ec nomenclature
pdb deposition date 1997-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1tubB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 1tubB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 1tubB01
4I4TA 5JH7B 3RB8A 4O2BB 1TUBA 3RYFA 4O4LB 5JVDA 4KWEA 3N2GA 4I50A 4O4HB 4WBNB 3UT5A 4EB6B 3HKBB 5M7EA 3JASA 4X1IA 3RYHB 1W59A 1W5EA 1TVKA 5IYZB 4F6RB 5MN6A 4EI9A 1JFFB 4TUYA 2RHLA 5FNVA 1W5BA 5CB4B 4LNUA 4ZOLA 4EI7A 3M89A 1RLUA 3VOBA 3RYIB 3HKEA 5KMGB 3ZBQA 5LA6A 4IIJA 3VPAA 4DRXB 1FFXB 5CA0B 3JALB 4YJ2B 3JATB 4X1YB 4FFBB 2VAWA 3HKCB 1OFUA 4EI8A 4I55B 4TV8A 3C8LA 3V3TA 2BTOA 3WGMA 1SA0A 3JAWB 4X1KB 5EZYB 3E22B 5CA1B 5JH7A 4U3JB 4O2BA 5GONB 5IJ0A 3RYCB 2GVIA 4HNAB 4TV9A 5J2TB 5KX5B 4O4HA 1W581 5LOVA 5IJ9B 4X20B 5J2UB 4EB6A 5JCOC 3HKBA 3N2KB 3RYHA 5LP6B 3JAKB 5LYJB 5IYZA 2Q1YA 1JFFA 4I4TB 5EIBC 1RQ2A 1TUBB 5CB4A 2RHHA 1FSZA 5C8YB 5MN5A 4U39A 3N2GB 3RYIA 3HKDA 5KMGA 5JQGB 4B45A 3WGKA 1FFXA 4O4JB 2R751 3JARB 1Z5VA 3CB2A 4O2AB 4YJ3B 5ITZA 4YJ2A 3JATA 4X1YA 4FFBA 5BMVA 3HKCA 2BTQA 2VXYA 4I55A 3E22A 4IHJA 3HKEB 4O4IB 3ZIDA 5LXTB 4O4LA 5LA6B 3M8KA 5EIBD 5MN4A 3JAWA 5EZYA 5CA1A 5JCOA 4U3JA 4WBNA 5EYPB 4ZHQB 5GONA 1RQ7A 4XCQA 4ZI7B 4F6RA 4HNAA 5J2TA 5KX5A 4B46A 5J2UA 3RYFB 3N2KA 5JVDB 1W5FA 3VO9A 5LYJA 2XKBA 2VAMA 1Z5WA 5LP6C 4I50B 3UT5B 5IJ0B 2XKAA 3JASB 4X1IB 4DRXA 1TVKB 5C8YA 4TV9B 2VAPA 5CA0A 2RHOA 4TUYB 3JALA 5JQGA 5LOVB 5FNVB 4LNUB 4ZOLB 4O4JA 3JARA 3WGLA 4YJ3A 4O2AA 3VO8A 3VOAA 3R4VA 4IIJB 3WGNA 4M8IA 4X1KA 3HKDB 4O4IA 4DXDA 5LXTA 1W5AA 2Q1XA 3RYCA 4TV8B 5ITZB 3WGJA 2RHJA 5IJ9A 5EYPA 4X20A 4ZHQA 2R6R1 5BMVB 3ZBPA 2BTQB 5LP6A 4E6EA 3JAKA 4ZI7A 1SA0B 4IHJB
chains in the Genus database with same CATH superfamily
2FF5A 1ILWA 2IODA 4MS1A 1RHMA 2GS9A 2FFJA 4N5HX 2ZSEA 1NDHA 5IH7A 1GO2A 4HUTA 5DBEX 3H5LA 3FTFA 3BA6A 4D96A 2A33A 2PUWA 2P11A 4C21A 1I0IA 4Q7QA 1Q22A 3IEIA 3K58A 2VTKA 2KTUA 1XTUA 3COJA 2E4YA 2HA4A 5HM6A 4N5MA 3F1LA 5E6SA 4FB5A 4DUGD 1XVAA 1XVUA 3F90A 1A95A 2DT8A 1M90H 1NJIW 5BQFA 5BSKA 2AIRA 5BXYA 3GT7A 3T9EA 3B82A 3OUSA 1QPZA 1HDEA 1ZJJA 4MB2A 2BBWA 3FBTA 5DHTA 2EILB 3II6X 4V0QA 1JECA 4GE0A 2W0SA 4M3NA 3BRWA 1RPOA 3LIIA 1K6EA 3D01A 2VYQA 4FLFA 2RB4A 3R3SA 1JU4A 3A6KA 5FBZA 3OU2A 2IH5A 4LN1A 3ZMTA 4NYMQ 4KLCA 2XMRA 4ZHQA 3LX4A 2HS3A 5JAQA 1OYYA 3LCUA 1LDYA 5FPTA 4W5TA 1KMIY 4J49A 2GK6A 4ZZ1A 2H7VA 1THTA 1VLJA 3MERA 4Q93A 1XQ1A 8ADHA 5JWPA 1O95C 2PUJA 1AXEA 3DL4A 3R76A 4KQHA 1IMJA 4MVXA 2VF7A 1ZLYA 1N6IA 2AJLI 2GYWA 2J5BA 4D46A 4ZBMA 1RHQA 4YCCA 1UF9A 2CBZA 3CRNA 3U1BA 5HKBA 5EJ7A 4RV5A 1Z16A 3DULA 3ZGXA 2MYPA 3WY9A 1G3RA 1I2CA 3IPCA 1CEEA 2EV9A 3E81A 2FN3A 1FU7A 4LWOA 1BCRA 3FOWA 4MJXA 4H27A 2PEYA 4LPKA 1E1YA 1XZEA 1WD7A 2C2KA 2FW6A 1FLDA 3W6UA 4KI7A 1WW8A 4DRYA 3CZQA 3ZCCA 4XKJA 2JGUA 3NALA 3WMXA 1NU8A 5B3JC 2A79B 4H16A 3M99B 5H4HA 3R0PA 1BHJA 4OO3A 4MV0A 1X92A 3RFVA 4X3MA 1E9SA 1G42A 3LCRA 4UVIA 2A84A 3GRKA 3SCZA 3R7FA 5T7BA 1SBHA 1Z18A 4J7UA 2V1XA 2Q3FA 2NADA 3BK1A 4QBKA 4DR7B 2OA0A 4C14A 4ZYUA 3O4VA 4I5DA 3NYRA 1HNNA 3GYQA 2W6JA 3JX9A 2XXAA 1OILA 1PL6A 2VDQB 3RSFA 4CMCA 1HR0B 2W9XA 5KU7A 3DVAA 1SKUA 1JA8A 1R4NA 4FK5C 2H4HA 3IRVA 3T4PA 2O48X 2AJTA 4F11A 2HLPA 1DKLA 3D4PA 4CETA 1X80A 2P1RA 4CM7A 4EHHA 4WLNA 1PD0A 2NZWA 2INGX 2XCUA 2DOSA 4GQAA 4F9FA 1O2DA 4RZ3A 1JNXX 4UMFA 2OTJV 4WA7A 5AVYA 3DOHA 4L85A 2ZK7A 1V3VA 1O97C 4IICA 3FB5C 4DEVA 1SA0B 2PZAA 2XYGA 2YXEA 3QTLA 5JAHA 2QVZX 2XQKA 4EW2A 4EZEA 1SG0A 5B30A 2C4KA 2ZI5A 2IGTA 3BF7A 3PHBE 3F67A 1RAFA 5HP7A 1OMOA 2DMRA 2YS7A 2ZANA 4PNPA 4Q7EA 1XWFA 4WKOA 3ZWKA 4PLFA 1WWKA 1AD2A 3UA4A 5AI5A 4ZC1A 1K9VF 3PXUA 2OENG 4BUZA 3ZE9A 3QQPA 3U4HA 4HSGA 1W76A 4PLTA 2I6RA 1SXPA 1IOLA 4YVFA 4DR4O 3IBCA 1EVZA 4LFCB 2WF9A 4OFXA 4BAYA 3BB3A 2SICE 4PQRA 1VRWA 1XTKA 2OLEA 1RAEA 1IEXA 4V1CA 1VBNA 2P2GA 3DOEA 2X6RA 1QCCA 2DULA 4F3NA 1JFTA 4B0OA 2XGMA 1CJBA 4CHGA 3MWJA 4NRDA 5EE1A 1DE0A 2H1FA 4EDHA 3D8BA 1CSEE 1NH2D 3IP6A 5EBLC 1RWNA 3KZCA 4RPLA 1ETHA 3FGNA 4LYEA 3GDWA 3ESRA 2ZWOA 4WI1A 2C7PA 4DUYO 1EVEA 2IPXA 1JHZA 4AM8A 3UAGA 5JH7A 1UUFA 1A5TA 4ZPJA 2HJ9A 2QTNA 3CC4V 4AD8A 5IKEA 1D1SA 1HNWB 1NVPD 4IYRA 4UNQA 1ILEA 1WB6A 1MVOA 2GF0A 2GJAA 1XL1A 1T6BY 1IL0A 5LHGA 3HDYA 2Q6VA 2PE5A 1XMOB 2BELA 4IG4A 4KQ9A 3U3DA 4WCVA 3N6RA 1NTKH 2EFEB 1I80A 2NVBA 4XARA 5I7UA 4Y2SA 10MHA 4JLAA 4HFNA 3U4IA 1HLDA 4J4HA 1YCDA 5H8WA 3KUDA 5ICSA 1Z2DA 2VUUA 5AXDA 3CX5F 3VR6D 4AILC 4R1OA 4V0NA 3K8YA 4CL3A 3S70A 5CU7A 3EPHA 3UUWA 4A0GA 1JDVA 3VDXA 1J22A 4P84A 3BBPA 5CG2A 3H16A 3KAPA 4CM4B 1E96A 3JVHA 4OPMA 1DC3A 5JRJA 3OEEG 3LWRC 3VR4H 3ZJ4A 4EA6A 1QIIA 1KD1H 1WTCA 2P35A 2VOJA 3UAVA 4XJTA 3RE3A 2IPAB 3GJYA 5FPPA 4D42A 2C00A 2H6EA 3BRCA 3JSNA 2C2GA 5K0CA 4M7WA 1FUEA 4G56A 3LHSA 2B98A 1YQQA 4OJMX 3HCEA 1ZGAA 3CF6R 2V7QA 1AA9A 5L4NA 3CMMA 1S7GA 3Q3VA 3ZPXA 1N2ZA 2RG1A 4RV4A 3AG2C 6CHYA 4N9QA 1TFUA 2WTXA 3TX2A 2QTCA 2CK3A 1BRMA 1SUAA 3JXEA 4PX2A 3ZWVA 3JARA 1FYFA 5L45A 1G4YB 3W6PA 1ZP6A 2ZXEA 3JPYA 2PYDA 2PS9A 4RBNA 5CBPB 4K5QA 4JIMA 3KJZA 2FN7A 1I36A 3K71B 3P0EA 4M9CA 3EZYA 1MJHA 5FBVB 1KBHA 1JQDA 4JT9A 2CXRA 1REQA 3VV2A 2EJUA 4XLZA 4AMZA 4EG4A 4GICA 4CUKA 3NFYA 4KFUA 4DY4A 6Q21A 1JHVA 3QV2A 3I9FA 1Q2XA 4J16A 1YVPA 3AUAA 2CD9A 1ST2A 4GLOA 4G5GA 1JV2B 3AG6A 3GLTA 2X6QA 3RW9A 1L4MA 4IF6A 1E69A 3EWAA 3WGTA 2BMEA 2ZSIA 1WU8A 1US8B 2FGYA 4TS1A 2BGLA 3P9SA 1WIWA 1EFLA 3AI7A 3TRKA 1QR2A 5L3VA 5DULA 4CW7A 1U0LA 3S03A 3WQHA 4BR6A 1JI3A 2DH5A 1WUJS 3FFTA 1VL5A 2Q9AA 5A03A 3IEMA 4OX9Y 3H3XA 2CFSA 3K53A 1FRZA 3PN1A 3D5TA 2BDEA 4Q7JB 2PH5A 2RKBA 3PC6A 2PT5A 3IUEA 2NU6A 3CZCA 3HBMA 4DZTA 1P5HA 1J9EA 2APJA 3K9GA 1CQJB 3OAAA 3CEMA 4LF9B 2IUFA 1L4HA 4ZIRA 3ZHBA 4CM8A 3L8CA 4KE8A 2QAGB 4K9PA 4R1UA 4UD2A 2EX0A 4YAOA 1URPA 5CBKA 1HPLA 4PFKA 4JWKA 1KP9A 3NYWA 3JRWA 4F60A 2PO7A 3MWFA 1I7QB 3N05A 5FOWA 1YS2X 2WAXA 2D3OW 2XUHA 4QFBA 1R6XA 5DVZA 1E4EA 5AVKA 1EX6A 1XPOA 5PGMA 1K6IA 1DAKA 1NBOA 4ZVMA 1J5PA 4FFWA 2X0KA 3I34X 5FWXB 3F8WA 5DH9A 2IHTA 1ZOSA 3AEXA 3NOQA 4DMUB 4BKMA 2AKEA 2GKOA 5AUQA 2MR6A 1QHYA 2XAJA 1B73A 1LK0A 2AJDA 4PAGA 4J94A 3ENZA 2ILMA 4BGVA 2IYOA 5G0WA 3MTJA 2DBYA 1ECCA 3HCDA 3TD3A 3PD7A 4WBNA 3PRHA 5JRDS 4RK7A 1N34O 3ZRSA 3S55A 5F33A 1EFRA 3VNBA 2CUKA 3HFGA 1A8PA 1M2VA 2AOUB 3IGFA 3EAFA 4W5WA 4Q9LA 8ABPA 3H1FA 1EAMA 2V98A 5AKJA 3K1YA 3ANNA 3CCRV 2TSYB 5KYYB 2XV1A 3PBKA 2ZOSA 2O2DA 1Q19A 3IAS1 2JLCA 2MIIA 2PXAA 5C1OA 4C5BA 1B06A 4R5HA 4MI1A 2ICAA 2E85A 3U9SA 3TZBA 1PSWA 4Q34A 4UHCA 1PYOA 1J8YF 4KL8S 5BNWA 3LDHA 4MQFA 3ZTTA 5CA0F 2QR4A 1JW9B 1E1CB 3DZKA 5CA1B 3DC5A 1PO7A 3NDRA 1FX0B 2X8AA 4R3NA 3OVMA 2C5SA 3F4LA 3DDNA 3O75A 2J1LA 1CBUA 2OZKA 1KWKA 2HWKA 2Q3MA 2CXOA 1SQSA 5IU6A 4AJLA 1TJPB 4WJKB 2A8YA 5DNWA 3UV3A 3ZV4A 1G3UA 2GM4A 1S5PA 3DHNA 1WM1A 4Z6KA 1U5AA 4ZT4A 5HMMA 2ZWMA 5K0BA 2H7CA 3N2LA 1BXGB 2HDNB 4BQPA 5EOVA 5KHHA 1L5SA 1Y4SA 4MS3B 5GADl 1U3TA 3NHWA 1KI8A 3D81A 2NX2A 3BM5A 3UOGA 1R6NA 2QTWB 5GJWC 1NXXA 1LD3A 1TT7A 4FMCB 4UHEA 1KC8W 1VSVA 4BHTA 3OT5A 2BFDB 4C05A 3L84A 1NBMG 1NVAA 1XEXA 4JZKA 1K0UA 3HFJA 1LJLA 1X1EA 3JALB 1KU0A 1W94A 1EG7A 1WHSB 4D7TA 3W1VA 1SA0A 1NDUA 1HE1C 4YDSA 4NZ9A 3GFPA 1N32O 4LXUA 4E03A 1UWCA 2ADQB 4Y6PA 1M57C 1LLUA 3PX3A 3IQGX 1S3SA 4IUDS 4QLOA 3QYJA 4PCUA 4FLEA 1QAOA 2V5AA 4KZPA 1PDWA 4ZU1X 4HRYA 1XBLA 3M6AA 4JY7A 2YNMA 4NYJQ 2V54A 5DASA 1U1DA 3SIRA 1H8HD 4TRJA 2QLLA 2ZS9A 3EVKA 3SZOA 1S2GA 4ZHVA 2W11A 3O3OB 4YO8A 5KZMB 2WY2D 2X7XA 1VCHA 4O0MA 3J81N 2QA4F 4L9AA 1N8TA 2WP0A 2OY0A 1SPBS 2E89A 1PEDA 1E2BA 4NOJA 5DRYA 3OIYA 1NAIA 3E8XA 3BC1A 5KMGB 3NTLA 5ALTA 2DFTA 2J9FB 2XRMA 4CCAA 1M0WA 1PS0A 3Q85A 4PU0A 1V55C 2XE8A 2D5AA 1OX6A 3KKMA 3O92A 4Q3BA 3R24A 2O52A 4LECA 2BI4A 1VP3A 4X3OA 2I87A 5I7AA 5SY9A 3JZIA 4K8RB 5CVDA 3K70D 2QROA 1HEUA 2X5OA 5L7WA 1FFHA 2RIPA 3E0XA 1LB1B 5DHSA 3GFSA 4CZZA 3TEMA 1FMTA 1E1RG 2RH8A 1AUXA 2HWYA 1LW6E 1FNKA 2GKSA 5HHTA 4FMDB 3TE6A 3BZBA 1S77D 2I6QA 2A3NA 2EAUA 4KR6A 3RTAA 3NGLA 4WGGA 3K0FB 4F6EA 4QEZA 2UUCO 3ZI0A 4UUOA 2OGSA 1P2DA 1ZL8B 3R5FA 2WVGA 4ZT6A 3M84A 1JQAA 2NSLA 3HB5X 3FAZA 2A7XA 3EVZA 1JHOA 3Q7SA 4CV3A 3U61B 4PAOA 2OYCA 2X42A 1YMQA 2MHCA 3L9XA 4EVSA 1HI9A 2D1RA 5H16A 5FI3A 2WHEA 1XZGA 2WT8A 4PG5A 2QRVA 4UHFA 2E5WA 2HRZA 1LDNA 2H2FA 1I3LA 3K1AB 4BLSA 1P5JA 4P34A 2R8EA 3SJ7A 4Z86A 4CM4A 5BOSB 2QG6A 4YAFA 4RKYA 2WILA 4X5OA 4P4SB 1UBKS 4RIEA 4W5OA 1X7PA 2P9TA 2O2IA 4IUBS 3P20A 4NTZA 1JSRA 3V8VA 1ZD4A 1C0KA 1UZMA 4JELA 5LQJA 1E79A 2JLSA 2XUPA 4Q39A 3BJIC 3AR9A 3JZFA 4OAQA 3DLBA 2YWJA 5ESXA 4PYNA 3G49A 5LU8A 4G1FA 3C9TA 1DBQA 5K09A 2VCEA 2KS6A 1PR9A 2GF2A 3PUXA 3BAFA 2G67A 1ZR4A 1NKTA 2VSYA 2MYUA 4PNEA 5CA0B 5LQDA 3WJPA 3H2KA 1SXGA 2QYHA 5CBPA 5CB0A 3O8OB 2XWBF 1AI6A 5HXUA 2Q27A 1QNMA 5FBQB 4R01A 4F4CA 2PSDA 4GL2A 3FCXA 2NR5A 1LLFA 4C4ZA 4MV8A 5BNFA 3FVVA 3FOCA 2EHDA 1EQ2A 1UPGA 1Y1RA 4HQLA 1JBKA 4QYIB 2HCTA 3JQBA 2XIJA 1KGDA 2YXHA 1DKPA 3CT6A 4RD6A 2FSFA 3FJ1A 5ALNA 1ZQ9A 4QQ8A 2VZ8A 3V5NA 1ZJ6A 3BMNA 1V1RB 2NU9B 2XUOA 1G7TA 1V5EA 5J63A 4EITA 4OIMA 4NK5A 4JSYA 4RTNA 5A6VA 1US8A 3KXLA 1GUDA 3D6MA 4OSPA 1X13A 3W5AA 2BMWA 4EHKA 3E7DA 2BKUA 2PLAA 4HXFB 4L4ZA 4NXNO 4B62A 1C8LA 3EOZA 4ZANA 2YC0A 2YWBA 1N6NA 3DUFB 3D59A 1WCV1 4JI5O 3TGUH 3MWLA 5HQTA 3J7TA 4XVRA 4CM1A 1MB9A 2QPOA 2VP3A 3IUJA 4ZOEA 5FNVF 2JD0A 2QV0A 4BNZA 4YONB 3X2EA 1H93A 1MENA 1CQJA 3RYFB 3HI6A 2OD7A 1C2YA 1JU9A 1E9BA 3OCYA 4HVTA 5EEHA 1T2UA 4DJDC 4BJ6A 2NYRA 4ZYZA 1ZN8A 4AJOA 4XRGA 1NF9A 1T5BA 2QAGA 2UXNA 4AU1A 3Q2IA 1K7XB 2G4VA 3HWUA 2DWQA 1PEYA 1HH4A 3T5AA 1C81A 3FPKA 1K34A 4KUGA 1RYFA 4EHNA 1AQ6A 5DT2A 3ZEAA 4FIZA 2Q9LA 1ZK1A 4Y7DA 1KQGA 3E8HA 2I6GA 3IKLA 5JIBA 1QB8A 2E37A 2VP5A 4DR2O 4U7PB 2NVWA 1OAPA 5AI6A 3KKNA 2Q0SA 4TWRA 4ROSA 3BL6A 4XWWA 3L18A 1B0ZA 5FWXA 4LCEA 1GU1A 2FQYA 5B2FA 2LPMA 3IURA 2ZB4A 3QVUA 2FN4A 4O2AB 2GEKA 1AB5A 3FKSG 3QBJA 2ZT6A 2WLMA 2B7BA 1NSFA 1YDFA 1QVRA 3R66A 1IJEA 2GHIA 3AEUA 1YQWA 4ZV7A 2IS6A 2C57A 4DSOA 4G5OA 1XUQA 4ZODA 3CM0A 2QLTA 1P4AA 1VB3A 3BMOB 3OKCA 5EIXA 2VBGA 1H2ZA 3E5RA 3FZGA 3SGLA 4E5MA 3I9NA 5AQ1A 2HSWA 3KWJA 1UEXC 1ZAKA 4ZHWA 4HYEA 4XZ3A 3R7NA 1UPFA 3CCSV 5IY5C 2ZNIA 5FTKA 1KMHB 2QTMA 5KYYA 5AHRA 1ZUIA 3EEYA 3KEOA 4EPXA 4CS2A 1N1MA 2OQRA 1SM4A 3QBTA 1NP3A 3QX9A 2P67A 2VF5X 3IDFA 3W5JA 1T9GR 2GILA 3EVAA 4A16A 4B2LA 5CA1A 1W5SA 1FX0A 3CBQA 3CVVA 1HL3A 2F43B 1YTFB 1K8AH 3RS9A 5ESWA 1E7WA 2WWIA 3QTTA 3U7QB 2AXQA 5TC4A 1BHO1 5TY0A 3ET4A 2HXYA 5AVZA 4PLHA 4HF7A 2QSYA 3AWDA 3EVEA 3M1YA 3TLMA 1E98A 2M6YA 1BXGA 4D74A 3AYZB 3KQVA 3IBSA 3D2AA 2ZINA 1B41A 4J0GA 4MS3A 3VR5H 5FLXN 1PFKA 2JDIA 4B7KA 2JCVA 3AFOA 2EFYA 1KZ9A 3MIIA 3Q5DA 4HRXA 1G1MA 1TVCA 1NWCA 3MG9A 4RK5A 2QTHA 4K6CA 2QTOA 5LD2C 2CSLA 2OP1A 3KSMA 4RV9A 4XDKA 2Z3ZA 5K3AA 3SPHA 1S8NA 5K7SA 2QRKA 4X45A 2O3TA 3B13B 4AZ3B 2XLBA 5C37A 4F2WA 4ZI7B 3ER9A 4R31A 4MQEB 2XMSA 1CJCA 2RG7A 2Q0HA 1V39A 2EQ5A 4LZZA 3FTDA 3JTEA 1XE3A 4HZUB 1GSOA 3LQ1A 1VQPF 3WLSA 2ARHA 4PLYA 4FIDA 3HWSA 4B6JA 2HHJA 4QGFA 1NATA 3RYCA 1PN3A 5JLAA 4G4ZA 2NPIA 4P7FA 2Y69C 2WYVA 3GUHA 4M1EA 4KTVE 3FPFA 3GGOA 1FVOA 2GWHA 3SYOA 1KBOA 1F7YA 4IH9A 3I55F 1CF9A 1T0UA 2OCLA 2HPAA 3OM9A 3PDJA 4DRXB 1R0BA 2H8CA 1PV2A 1X1RA 3N53A 2F62A 3LP5A 4B4KA 1AKNA 4JJ7A 4K8XA 1BQ3A 3C3EA 3PICA 4IDEA 1VJ5A 4KACA 5DM0A 2BTEA 4L22A 4KSCA 1ZGZA 3F3KA 2COKA 5KMGA 3E3LA 2J9FA 4GI5A 5EMKA 4BLTA 2RCVA 4U7HA 1CK4A 3QELA 5EXTA 4BFZA 1GZ4A 2FP3A 1CY1A 4BYMA 2WNSA 1O54A 3DV2A 4J3FA 1OKKD 2AS0A 4L8VA 3DW1X 3QNEA 3DVSX 1EBUA 4B9AA 2H5LA 2CJXA 5KJ1A 4JIGA 1KVTA 3SGIA 5T4HA 4N0EA 4X8OA 1CE8B 4EVIA 5LA6A 4WPGA 2J4FA 3K0FA 5C81A 2KJQA 5ALVA 2PTGA 1ZL8A 1KJZA 5AW3A 2C8VA 1YL6A 4FVMA 4MH0R 1T36B 2HRYA 2ZI7A 1U1EA 2F1IA 4RVNA 3L70H 3T5PA 4IHJA 3TWOA 1P74A 3L8MA 1S02A 4C3UA 4JN6B 1QE3A 4BFLA 1DADA 2VNSA 3K1AA 3U0VA 2R7MA 2P65A 1ZFNA 3ICOA 4RQFA 1ND6A 3ZV5A 3BGOS 2NZXA 2VN8A 1LBHA 2RK6A 5JH7F 3KJXA 3N8IA 4P4SA 5L6MB 1SIBE 3VSAA 3IOYA 2IOQA 4M1WA 3FJYA 2IIVA 4QNNA 2IHZA 4UM8B 1XZIA 3RUCA 2B9EA 4LG1A 3C9RA 3WMFA 1JTFA 1JDZA 1EQUA 5SYNA 3FB7C 4TROA 2ZTSA 2EBUA 3ZDRA 1P39A 4IXDA 4LS3A 3CEPB 3EHEA 4K6MA 2H17A 4TRNA 1IY8A 3AUFA 4BO4A 4XFKA 5AK5A 4YRGA 4KV9A 1NTOA 4WFQA 3EUAA 2W2MA 2QM4A 1R3DA 4R2JA 2ITDC 5IABA 5BNZA 2C2OA 2JHGA 3DMHA 4GZRB 1G9TA 1OH6A 2FB9A 2Z30A 1ONSA 4HH4A 2W37A 1ZLXA 3E7WA 3VU3A 4IFTA 1U8FO 1VF7A 4K9KA 4B73A 3CNBA 3OZ7A 2RI6A 3O9MA 1XKTA 2VWJA 3O8OA 3PNPA 3OM0A 4UBMA 2QUIA 3LXUX 2CXSA 1DC5A 1LPBB 5JHHB 1FSPA 4RVGA 2QTTA 3WRYC 3T3EA 3JQQA 4HO1X 2CXQA 1HK7A 2QW0X 5I8WA 2FVXA 1GZ0A 1K27A 1E9DA 4NY1A 5BUZA 2JI4A 1Q20A 1K4MA 2W0MA 1ZOIA 4G89A 4G86A 1FXHA 2AHZA 1UFQA 4WECA 4QYIA 4P3KA 1D3AA 1YDWA 2C8JA 1A88A 4M0FA 2GJ9A 3FDIA 1U1FA 2KG7B 2XUGA 3S27A 2H18A 2RONA 4TWAA 5DCUA 3RUFA 2WHXA 2NU9A 5ERYA 4KN5A 4PN7A 4CH6A 4GOLD 4XDJA 1AN0A 3GJXC 4ZOAA 1D7OA 2XNSA 5K3EA 2I3AA 4R1TA 3K0AB 3LDAA 4JGSA 2P22C 1TQ6A 3DL0A 1JSCA 4FR5A 2UXBB 4IUCS 4OXRA 3A3NA 2BE7A 1GGFA 2CUGA 3PQFA 3K0HA 3KXKA 4XFDA 4UDXX 1TQHA 2G5CA 3B8EA 4OLFA 1IDN1 1U8YA 1UI9A 1YR2A 2ZYDA 4BUJA 4JC8A 3WLFA 4X88A 3D0KA 5THKA 4TUYB 2O5CA 3SE0A 4K8OA 3L0PA 1IFXA 3PC3A 4WOBA 4M8IA 4MMXB 1SCQA 3GFVA 4ZK6A 3KQSA 4LF4B 1XN1A 5KTOA 5E2IA 3ZCPA 4EH1A 4W5QA 4MCJA 1Z5UA 3G0OA 3HV0A 3M2TA 4TL9A 2OB2A 3RYFA 1KWGA 3VGPA 1H0HA 1EGAA 3IUSA 3LQ4A 4Z4EA 4I4CA 3O26A 4D56A 4HDQB 5JWHA 1V5IA 1UM9B 3QVTA 1ZMTA 3CRRA 2PX0A 3T1HB 1SCBA 4W5RA 3AHFA 3GVHA 4H3VA 2H6LA 1Y4UA 3LWNA 4G81A 5E4TA 3GIDA 1UKCA 2F1RA 3GBPA 4FUQA 1C3XA 1E6WA 4LZPA 2R5FA 3BERA 1JDTA 1B0AA 1KU6A 3BGIA 3NGXA 2DFDA 3TLJA 3THXA 5FORA 4X94A 2EKQA 5JDCC 1XAIA 4UCTA 1KQOA 2C5BA 1DVRA 1MOFA 3BORA 3Q3HA 1Z4PX 1KI4A 4UCQA 3GA5A 2I91A 1P1RA 5CHEA 1ST3A 1TLFA 5LWHA 3EMVA 2C3YA 4YP9A 4O2AA 1R16A 1P17A 4H7DA 2DWEC 1KZ1A 2ZDIA 4M54A 5CDTA 1QHTA 3ENNA 5I9MA 1MSDA 3GGDA 2PMBA 2XCRB 2XNHA 4MUXA 2QBYA 4OHMA 2OORA 4ZYLA 5D84A 3N8NA 1ADBA 5CLGA 3CCMF 3N2NA 3KQKA 1CS0B 3DDHA 1UXGA 1SBTA 3NDBB 2EX3A 4B6QA 4V1CB 2P41A 2GZMA 1NQXA 5B1DA 4DN6A 4WCFB 2XTZA 3NNSA 3LE8A 3UAOA 2R7AA 1NYTA 2G5GX 2O1WA 3VKHA 4NMWA 3ZDEA 1ZA1A 2WA4A 1QU9A 1UXIA 4Y0NA 4BLPA 2OG2A 1DX9A 4AHCA 1KMHA 2B36A 3AOEA 4KYTA 5FV7A 3V4PB 3MJRA 3HJCA 1XZQA 2JFZA 1KYOF 4C8GA 1YB6A 1SQ0A 4KLRA 1PXWA 2CLEB 1KKLA 5EPUA 4HAUA 3KYCB 2WF8A 1Q7EA 1VQ7F 3WKAA 2L19A 3L4JA 4H7JA 3AVQA 4GRIA 1EB8A 1L8OA 4DUZB 4HDMB 3E15A 4XWTA 4WZBB 5H6QA 4KXYA 3L1VA 1SB8A 2Q46A 4KWEA 3CCEF 1AM4D 5TPZA 2F43A 4JHLA 4D81A 2OBLA 4NAVA 4M1OA 4Q9HA 5FWAA 4WBNF 1RLUA 2OO5A 2O2CA 1W36D 2LZ0A 1SF9A 2G9IA 3GA7A 4R8SA 2GZHA 3U7QA 1TEZA 3MCZA 1BEUB 2BKAA 3M6UA 4C43A 5JD3A 4TYWA 4HP8A 3AR5A 4DR1B 1U63A 1KYYA 4UVBA 3MYRA 3UYLA 1Y42X 3P0JA 3R8FA 5IJZA 5JSHA 3I2FA 3AP1A 2O19A 4GWGA 1Z5VA 1F51E 2F1MA 4CKZA 3N2EA 2WKWA 3WB9A 4C0LA 5A7HA 4P1ZA 2CKDA 5DLYA 3RUDA 1ZNXA 3UATA 4YT2A 2BMAA 5GGXA 2PTHA 2HFKA 4RTRA 1GPAA 4OYYA 3D3QA 4GKBA 2QEQA 1VSBA 2VA8A 2XDAA 4EYSA 2Q7XA 3EE6A 1HWYA 1HOTA 5BNIA 5JSFA 4CTOA 1J9GA 3GQVA 3ND8A 4ZI7A 4MQEA 2C9DA 3UGKA 3UJHA 1F1JA 2VHYA 3NYQA 4MHTA 2EG9A 2QM8A 3OH8A 3KR1A 3T3OA 1QYDA 2PAAA 5LVAA 4NP6A 4HZUA 3CX4A 3CVUA 1UK9A 4WESA 4OI4A 2QDOA 1LTQA 3S0WA 1UEJA 1MW9X 4RCZA 3EZGA 2D54A 2JLUA 3WR5A 1NNI1 2LCAA 2WV9A 3UPTA 4QOSA 3DLPX 1D2NA 4W9MC 3NR7A 4E6PA 1QS0B 1EA5A 2Z83A 4QNRA 3ENWA 2QMZA 1SU8A 1LDBA 1UKYA 3HY4A 4P2BA 1RRMA 1D03A 2BM9A 4KFCA 4ILEA 2FXVA 1MMMA 1Z45A 1R4MB 2SCUB 2XY4A 1NVTA 5ERXA 2GRJA 2C98A 4I1IA 3FMGA 4C7JA 4N6OA 1ULHA 1C1DA 1PEAA 1IUNA 4GNRA 5EKUA 2IP4A 5FOUA 3GJ6A 2ZF8A 5HY1A 1CJSA 2Q3EA 1QHGA 2EP7A 2WB2A 2R1VB 2IF0A 3H11A 1RR6A 3L7NA 3CH7A 4UZEA 4EYQA 4UTXA 1E32A 1Z6PA 4HB2A 2WPDD 4RW0A 4F4FA 3ZIAD 4OF4A 3FZNA 4TT3D 2AC2A 5AWFC 4X7BA 1F0YA 2ZBDA 3VHXB 3LFOA 3JD4A 3PR1A 1OI3A 5F1OA 1QP0A 3EXEB 2QV7A 1MRNA 4MKIA 2O20A 2OFOA 4LFBB 4JAVA 2DWPA 5EJFA 2J7KA 4OQ4A 2XD4A 2LCFA 1NXWA 5KYGA 2J6HA 2R96A 3SHWA 3AETB 5KB3A 2J3IA 3KUKA 5J1SB 1Z8DA 1CE8A 4F85A 4IHQA 2R8PA 1PV1A 2PL9A 1GMGA 1UZAA 2IRWA 3GJ0A 4WFEA 1IRXA 4JFAA 4Q5IA 5IJAA 3B1KA 1Q1EA 2MYTA 3R8XA 2NU6B 2NP6A 4RVFA 4E5DA 1BKSB 1T36A 5IXYA 5LL6P 1TF7A 2CL7X 2QLJA 3EQZA 4YR9A 3BFJA 2XADA 3OM8A 4EEZA 4KFRA 1RRGA 1GNQA 4OKNA 4ZIRB 3G85A 2CCGA 1NUUA 3HJFA 3WLNA 4CM8B 3ZHRA 2OG1A 3G5MA 2Q7GA 3SLKA 1WKCA 1VF6C 1FRVA 4QQNA 3DBIA 1DJNA 1ADCA 3P0IA 3ABMB 3EVNA 3QK7A 2WK1A 3I4CA 3NBFA 2UZ4A 2B2NA 2MOKA 4MVWA 3PSHA 1QP7A 5K6AA 4CF3A 1E4EB 3RS2A 1ZMXA 2OZVA 3KOYA 4C0XA 2JFNA 2MSNA 4B40A 1DO2A 2P68A 3OW2F 4RL4A 3SF0A 3BIWA 1K97A 4B0PA 1V4VA 4IKOA 2B30A 3U11A 4WZBE 3OT7A 2KI5A 4Z49A 3PJRA 3K9SA 2D1SA 1JOYA 4XJXA 2FK8A 4PPQA 3ADDA 4OXIA 1SKVA 4OA8A 3UUGA 4AS1A 4JZ2A 1PT6A 5CT6A 2BGGA 3GMDA 1OXBB 4HLUC 4DA8A 3ZE1B 1NM5C 5BSMA 2ASVA 3C4JA 1NT2B 1B14A 2PN1A 4BKPA 1C7ZA 2ZUTA 2IXGA 3F1KA 2WAAA 4DQDA 1GARA 4WBNB 2OHVA 4MGYR 2CVZA 1QR9A 1XZFA 3GN1A 3GA0A 1C0LA 4J0DA 2FNAA 1P7BA 2VRZA 1VQ6F 1M2VB 3OLQA 2FJUA 3Q3IA 1TQ8A 1F51A 4IZIA 4PINA 3MGKA 4QQFA 2KG7A 3GVPA 2J9GA 3HLYA 1VIMA 4JVSB 2IWHA 4KRGA 4IDHA 1YDMA 1WSAA 2B20A 1FXSA 2GK4A 3K0AA 3RC1A 2Z57A 3Q0TA 3V8MA 4MQFB 3U13A 3U17A 2CDYA 4EUHA 1N2OA 3CC7V 5H70A 3B85A 3ZNPA 4LNUB 3R0JA 3IEUA 2WWTA 5GPBA 3FAVA 1ZISA 2PG3A 3S2GA 3AG3B 3UWKA 1DTOA 5KA5A 4DSUA 4WFBV 4RHYA 4YDRA 4HEHA 2NYUA 3H6HA 2OHWA 4TUYA 2DYRB 2PZFA 3AHCA 1FW6A 3DEIA 4ENWA 1IC6A 2HIMA 4ZVTA 4L8GA 1AT1A 1OCZB 4LF6B 2B92A 1M83A 4UFPA 1A5BB 1YK0A 4PSDA 4LHSA 5ILGA 1QVAA 4H4CA 4JDPA 5GONB 2ZSKA 5CURA 4E88A 2AMVA 2DQ4A 2IHBA 2DM6A 4C76A 1RAHA 1RQGA 4K0RA 4TSRA 1SOAA 4HGYA 4EO9A 3K9AA 4MQMA 2F1JA 5LYYA 3HACA 1XEXB 4RK4A 2JIBA 3GELA 3HXTA 1UM9A 3FYSA 4H9GA 1G8AA 2X1MA 5L3CA 3L6EA 3KYBA 4N4AA 2PUDA 3HB9A 1WUHS 5DEIA 4DHEA 1B8NA 2XNDG 3Q0IA 5IWCA 3QOWA 3ORFA 2C2BA 4YXWD 1UDCA 4IXTA 1CUUA 5BR1A 1AN9A 2FZEA 2VPWA 1L9KA 3R5XA 1M1ZA 5JAOA 2PA0A 2VJMB 3AP2A 3KU4A 4QRIA 3NTQA 4MVJI 3OTGA 4I1VA 3OX3A 4EI2A 2WWRA 1NC1A 2I4IA 2PZMA 4QSMA 1F1BA 5JADA 4F93B 5IHXA 1ZOPA 2B2CA 3U7GA 4BATA 4R2HA 1UL1X 3TL6A 2IEBA 3TIIA 1CQWA 4RGBA 5J2TF 3ZTWA 1R6AA 5BV1A 4LVNA 1O9BA 1BVRA 4XASA 3M82A 3LSTA 1CS0A 2GLUA 3LUHA 1KXJA 1ZGJA 5IARA 3GEIA 5DEDA 4PAMA 2BHRA 3R5KA 4WKCA 4U7FA 1HT2E 4ZVNA 4WCFA 1XHLA 5TIIA 1ZD8A 2OFWA 1JG4A 1NMZA 3FR7A 1JN0A 4UNIA 4ND1A 2PCLA 3CX3A 1EM6A 2GEFA 2H59A 1TVKB 4GPZA 4H7EA 5K0LA 1NC3A 2YINC 4PO8A 5ALMA 1JLKA 2CJYA 3WL4A 4A1FA 1ZXLA 3ROGA 2V7PA 4PLPA 5DX8A 2YN2A 1UEIA 3RWRD 4D0RA 5BN4B 4OBWA 4MOWA 1A3CA 3RA6A 3KYCA 3S8EA 2JIOA 1Z0DA 1WV0A 3EIHA 4HDMA 1NLMA 3CE2A 2VPIA 3HU2A 4WZBA 1LS6A 4ASUD 4XVQA 4B6PA 3NQ41 3KOWA 1ZIOA 3COSA 2DW4A 1LPMA 1PK7A 3VA7A 5DF1A 4US2R 1XWIA 3ZXSA 2M32A 1QQ5A 2OCCB 5KDDA 1U9YA 1NX6A 3NHJA 1ZHFA 1VLMA 3Q3GE 5DTJA 1WSDA 3H1HH 1YHQV 3ME5A 3KVVA 3ER6A 1XZLA 2KMLA 3OZGA 4IMPA 2QRVB 5SICE 2VSQA 2HQSA 4PLVA 1W1UA 2B1JA 1U0TA 1E92A 1ZVJA 1M7GA 3F5DA 3C98A 5BY1A 2XT9A 4Y30A 2WSSD 1PVDA 1Z4IA 3VC3A 2BR5A 1MO4A 4DC0A 1OCOC 1UT5A 3L79A 1NUHA 2QRZA 1TA4A 4CEHA 5CA1F 1GUFA 1Z28A 1F7VA 2ENWA 1UDAA 4AWAA 5D3MB 4IDAA 5H83A 1XKXA 4NYIR 3F9IA 3GCGA 3BQNB 4D6XA 4YP1A 3WWZA 4P7KA 2QUJA 5UKDA 1AS0A 1I4DD 5J9FA 2QYTA 5EJ5A 2A6PA 3G5TA 2TRSB 3JSAA 1AG9A 2Q8PA 1RQLA 2QLFA 2GT1A 1NJ5A 5ICCA 2HT6A 2ERCA 2ZD9A 5CH3A 1PF7E 1QS0A 3B3QA 4FMCF 1KEVA 1EXMA 3U44A 2P6OA 4IXWA 3ILSA 4A5SA 2VH2A 4JTCB 1YR9A 1R4MA 2SCUA 1SB9A 4LOJA 2R9AA 3MSCA 5FL7A 5BW4A 3OO0A 1R88A 1Z8NA 1A69A 1VQ1A 4LOIA 4E3ZA 4KLAA 4ZCQA 2PPLA 5D5PA 4MV5A 3M5CA 5EP1A 1OYWA 5DRTA 2R1VA 3BMNB 5I9SA 1JQJC 4AY6A 5KTTA 3OZWA 5HILA 4FZ5A 4X6UA 2FP4B 4TSFD 2J9YB 2UYNB 4BVTA 3KBBA 4LJ4A 5B12A 3QEKA 1AGRA 1JR3D 3VHXA 1NNSA 4LXGA 3AEYA 3IPRA 3ZW9A 3EXEA 4BZZA 4E30A 1NNEA 3ZIUA 3R74A 1R9MA 3BD7A 1P4GA 1AGYA 1WRBA 2FR8C 1JIJA 1CF2O 3LOUA 4XIFA 3BJRA 4RQAA 3AETA 3MAAC 2PZJA 2XUAA 3TOVA 2HLDA 3CA8A 2P3OA 2GH1A 4JGBA 4I9FA 2PD3A 1D1PA 2J9XB 1IXMA 3HGMA 1E7RA 3HZZA 1VXRA 1O94C 3VQTA 3IL2A 2HMUA 3QYFA 1C7FA 4IS3A 5LZ7A 1VL1A 3RVSA 4Q1AA 1ZI8A 1XAGA 2VEOA 4DR6O 1GRRA 4OHPA 1T2VA 5A6SB 1P80A 1JLMA 1AURA 1GIAA 4A27A 5FBLB 3CCLV 3DMYA 4ENRA 5J2TB 2P6YA 4X61A 2DF8A 2EYQA 1ATIA 4QGGA 5C8YB 4KV7A 1NDQA 5A0FA 4AIIA 5LU9A 2ETXA 5JS8A 5KPJA 1ARZA 2DE0X 3NHRA 4LEIA 4E22A 1B16A 4FMDF 5LA6F 3F78A 3CCUF 4MWGA 2WLLA 3BB4A 1GD1O 1VQLF 2IYLD 4RSRA 3GY0A 5AXCA 5NULA 4DKXA 4PPFA 3FPCA 5KVQA 4HMOA 2NZ2A 2C9OA 3GJZA 1SVLA 2UUOA 2I8AA 2KQUA 1WP9A 5LP6A 4IH1A 5BSWA 3JZAA 4DADA 3M3HA 4LZJA 3PR3A 1E58A 1PR1A 4IHJF 4NCHA 1CY4A 1NT2A 3F0DA 3AEUB 4FE7A 2W58A 4DV7O 3WMEA 3HKCB 3GLQA 2VF2A 2RGNA 1HYHA 3DQZA 2WMNB 2ZXWB 3O3MB 3C7DB 3U7FB 3TZQA 3ZGLA 2BGWA 3LWVC 1HF3A 2C82A 3WIUA 2XQFA 3DMRA 5EHIA 1COWD 1QYIA 4BMYA 4B6EA 2BBTA 2ZVJA 2Y6VA 1PZHA 5EHXA 5DHUA 3DNPA 1KTIA 1H6BA 2JJ2G 1GLGA 4PZZA 2JIRA 2ZM6B 4JYYA 1C9JA 5I3CA 5DECA 4FJ1A 1K7SN 3RBVA 3C1OA 1RHJA 4KQ2A 3A6DA 2IQIA 3IHLA 1E6MA 2FZVA 4UBNA 2YWCA 3BXFA 5AJZA 3UANA 1GAQA 1LEHA 4LNUA 3K4PA 4MPRA 5LUBA 4HT3B 1Z68A 3F5WC 2EDAA 1NYRA 2RB5A 4MUMA 4QHSA 2JVJA 2FQQA 3DEHA 4IZ6A 1PL0A 4B5CA 2AX3A 4D4MA 3OMIB 3EXHA 3WQSB 4L5YA 3UPUA 3A9UA 3KHKA 4FEYA 4EENA 3I5YA 1OU0A 2C31A 3LA6A 5F2VO 2VRCA 1EJBA 4CM9A 1RYDA 4LSZA 4LDZA 3G7SA 1JAYA 3JPWA 5JAUA 4KDRA 5GONA 2WOJA 5G02A 3VPCA 4WZAE 1Q15A 2DSNA 3MWKA 2QVXX 2MW2B 5IZCC 1HZZC 2PV0A 3SKXA 4GXQA 5T4EA 3FUWA 3WFZA 3FM9A 1TTTA 1UP7A 4JOQA 2ZPAA 4WCDA 1H2LA 3CJQA 4U5QA 4J9YB 5BWOA 3TDNA 3VO1A 2ST1A 4TQUS 2MR5A 4JLPA 4DDKA 1FRFS 2PKEA 4U8HA 2FW7A 3P0RA 3LX8A 2JFUA 2Z6QA 3I3SR 4F2PA 3AHDA 1RI3A 2VBFA 2VJMA 3VYRB 2HC9A 5KAIZ 3RYCB 3WS7A 1W581 3LKVA 1YBVA 3W5HA 3SMVA 4BO1A 1U9JA 2X58A 1VHTA 3IQFA 4M8KA 1FUKA 4DCVA 3K0TA 4XSGA 4K3AA 1N7JA 4JEMA 3PEEA 1AKMA 3AJ9A 4NVPA 4CI0B 5H7XA 4BZWA 5K2MA 4L4UA 3A1SA 4UOEA 3C5HA 2H8KA 5D85A 1DNPA 4TPKA 3EF0A 2IUYA 3LWPC 2FPLA 1IB6A 3L6DA 4QKQA 1ZK3A 4ZVSA 4A4DA 3G9XA 2YUIA 2SNIE 4AZVA 3PJSK 3EY9A 4PY2A 1H2SB 3K1JA 1ZL0A 4NNPA 3NNDA 4EKWA 3PFCA 2ZI4A 3D8HA 3QKSB 3ZY2A 2NSYA 1OT5A 1N0NA 3ZJTA 2V6BA 3QELB 2QQGA 3FPGA 1YB4A 1TVKA 5AVRA 4PC3A 1XVTA 1SZXA 3ZZTA 3RS7A 4DLTA 1PJZA 4HQFA 4B7AA 4S12A 1GFSA 1YJCA 1JFRA 3CEJA 4EHAA 4LHYA 3RSLA 3B6MA 2DPLA 4L76A 3G6KA 4O2AF 4FCWA 5BN4A 2VF4X 4BKQA 3O9VA 4GKKB 5BUCA 3ZCUA 1T1JA 1Q5OA 1V54C 1LPPA 5CB6A 2YZ2A 1PJAA 1UMCB 5DN9A 1L7PA 5LA6B 1F6DA 2HJWA 2XWJI 3OTWA 2UU9O 3LYBA 1N1EA 2BD0A 4ZC8A 4FFSA 3LC7O 3VX4A 2CVQA 1HE2A 7YASA 4WINA 1PV0A 1X3LA 3UM9A 4IHJB 3HY6A 5C5EA 1DL5A 3QY0A 5F98A 3ZNNA 4C4TA 3ITKA 1V48A 2EBOA 4MWCA 5FUBA 1SZDA 2EIJC 2PRZA 2EQAA 2VJKA 2WMDA 4UMVA 4CIDA 4J8PA 4FFBB 1Z17A 2P4VA 4P54A 4IHAA 2ZDGA 1K8YB 1YJ9V 3W3AD 2RGEA 3OQ1A 2AEEA 2NIPA 3LT1A 1RD4A 5DCYA 1QCZA 1L4BA 1NOJA 4EG3A 3O38A 1Z83A 2AVNA 4O5OA 1ZD3A 1UXJA 4R1QA 2O3QA 3QVXA 3RA5A 5KNDA 2ZAGA 5D3MA 3FKJA 2EX1A 2ZAOA 1ONOA 2I6XA 4Y9UA 5DYNA 3RC8A 1U28C 2QHXA 3GOQA 4PZAA 1GKUB 2DFVA 2CHQA 4C03A 1W48A 2OB1A 3CD6V 2ZIAA 1Q7YW 1U97A 3A1UA 1TFRA 4TTTS 1NZJA 2RHMA 2ONCA 4QC2A 3JVVA 5TSDA 2B5OA 2RGYA 3GQBB 5HQ3B 5HE9A 3N07A 2DPHA 1NSYA 1V8PA 3ABUA 1UPBA 1Z2GA 2IHUA 3AEIA 2BOVA 4OEHA 2Y71A 4RZQA 3J81M 1UAAA 1MNAA 3K0KA 1T5LA 1OFGA 2X9LA 4G8CA 1Y6FA 3NBUA 3S8YA 2HTEA 2VJDA 1R3KC 1L5MA 2YJTD 1Z3CA 5AKYA 1ODCA 5CVVA 4EEXA 2GKGA 5BURA 2QW8A 1U6IA 4WZAA 4GDFA 4DV0B 2XX3A 1UZNA 5EK0A 4JI7O 3WLLA 1MORA 3H0CA 4ZI7F 1FMJA 3V4VB 4FOPA 1JMKC 3EDRA 2LP7A 3PGVA 1Q0PA 2C88A 4ZZIA 3M49A 4KCGA 2PJZA 4QBHA 2R9IA 2FP4A 4UQOA 2UYNA 1N6PA 3NWJA 1DG9A 4PGAA 4H3KB 3NBKA 1PJ3A 5IJWA 4QLAA 1AQUA 3MMPA 5EXXA 3WI7A 3GRFA 4B33A 2A06H 5DW3A 4X62B 1T8PA 3A4LA 2GCGA 2A7WA 3GFBA 1QMPA 1CZUA 2DPGA 2JZNA 3JAKA 1KY5A 5AW2A 3TVTA 3F5SA 4H1WA 1CR6A 4MQ6A 2BZSA 4IGGA 2DJ5A 3ESDA 5G40A 1OXXK 4ITRC 1ZH8A 4DNFA 1BOFA 4F8YA 3WK8A 5AKEA 4NR1A 1FPQA 1YI1A 3A1NA 1QLWA 2CFCA 1X15A 3P9CA 3UZUA 1YRHA 3F71A 2G1PA 2QNRA 3JYHA 3GNLA 4NOLA 1R00A 1KYWA 1EE9A 3OIGA 2REOA 4DQ0A 3K0GA 5LSAA 3K5WA 2R84A 3JSLA 2ORWA 5A6SA 2Z1FA 3RIHA 1WLYA 4IEFB 4YWHA 1LQTA 4ICGA 1PK9A 1CUJA 4EGJA 2R6JA 5J2TA 2X14A 4OBEA 1JFSA 5C8YA 2BSQA 3I4FA 3W7WA 4FONA 1UZUA 4RJKA 2ZE8A 5BSTA 1XWWA 4OFZA 3THXB 2HCBA 3LX6A 1YT5A 3RGGA 4BEBA 2YWFA 2N47A 4FX5A 5A5DA 1OZAA 3VOBA 1C7IA 2NAFA 1C1XB 2RHGB 4CWAA 2QN8A 2BEWB 2O8EB 5CITA 1GZUA 6NULA 4OV6B 4OSOA 1RMTA 3BREA 3N2KB 1CC1S 4CTKA 5KDOA 2QBYB 2WPDG 1HT0A 3ES9A 5KVVA 3NBQA 3PUVA 2JVDA 3GP8A 4NARA 1F8YA 3HKCA 4EOGA 3W5IA 3CLRC 3PDHA 3A2NA 4HNUA 3TCUA 3QBEA 5GIPC 1VE5A 2P8JA 2M2IA 3QY9A 2NUBA 3VQWA 1PZXA 3TXSA 5BWCA 4AJKA 4YK7A 1NUPA 3AG1C 1WB5A 1TYZA 1MZVA 2OD9A 3I0MA 2ZRAA 5TT1A 3GFRA 3ABTA 3M70A 4I4NA 4EFEA 3VZBA 3OJ0A 1FTGA 1WBBA 1BMDA 4N5NA 3MJDA 4OL0A 4JYCA 1K0FA 3V7WA 3G02A 3I6QA 4LY3A 3I5UA 4H31A 1RJWA 4UUJC 3O83A 4BFVA 2GJ8A 4INPA 3WSVA 2NTJA 5CT8A 3ZR4B 1AZWA 1JVNA 2BFMA 4BVSA 1I5YA 1X0VA 2B8TA 4LJLA 5D3ZA 1U3FA 5GVRA 1OAKA 3TD2A 2VPZA 3TQTA 3WK4A 4U7WA 2ZJYA 2J07A 2RKOA 1MG5A 1CJVC 3OCUA 1RI1A 1WHTB 4F3YA 5E7QA 4BXOA 2UYQA 3LY5A 1EZ4A 3M0EA 4NXMB 2DP4E 5G3ZA 3GMTA 3ZJYA 5CD9A 1S0UA 3KQWA 2QSAA 1VIYA 1XL0A 2EXXA 3OMLA 1C1HA 4QGSA 3DBLB 1CKEA 4JGGA 2F23A 3QXXA 4RY2A 1UK6A 3G80A 3LFUA 4DL9A 4JXJA 4Q16A 1U7XA 2JIZD 4N6NA 4E09A 3N58A 4MCAA 3CPSA 1H3FA 4ZAGA 1N33B 1VB5A 3RADC 1DJPA 3K09C 2CD7A 2I4OA 1ZIDA 4K9NA 5BZBA 5DLQC 3QQ5A 1RLGA 1ROPA 5H59A 3TGPA 1MJGM 3WDMA 2JD2A 1Y1QA 1VI6A 2CZWA 5GTHZ 2HV9A 2EL9A 1N3IA 4NBKA 4Q66C 2YQZA 4HNQA 3B9PA 3FHLA 4TUYF 4C0WA 2X2FA 4WESB 2W6CX 4H6VA 4RS3A 1N2XA 2FRDC 2QD3A 1WOMA 4Y9SA 1KGSA 3VO9A 4CKBA 4P4LA 2JK1A 1AB6A 4IOMA 1WB9A 1GNTA 1C3OB 4YECA 3NC4A 3C3TA 4DIEA 2I0FA 4G41A 3AEQB 1HP8A 4FR2A 4FM9A 3TW0A 4NU6A 1ZLZA 2HYDA 6AT1A 2YIBA 4QATA 3SJUA 1KDVA 4FT2A 1Q81H 2WAOA 1PI3A 2FH5B 3ACCA 5TNXA 4B2PA 3BA8A 1C1DB 3OJCA 2WLKA 4BLOA 5AK3A 4IMIB 3QKSA 5CK5A 1QAHA 5IAKA 1K68A 3AYXB 4JBWA 3O85A 3H11B 1NTRA 4UXHA 4X64B 3LL7A 5K8LA 1G8FA 1BCCH 2G28A 5KVCA 5HZHA 2P2NA 2J3QA 3H6KA 5LMNO 5AKHA 3RHZA 1PR0A 4C4SA 1IY9A 4TKLA 1XA4A 1VQ8F 2E74B 3IEWA 1QANA 4BU0A 1DHTA 2A5JA 1X52A 1Y8ZA 3J7AU 4N8SA 3QLJA 5KYKA 3TKYA 3NCHA 3GDFA 4PYOA 2PWYA 1UMCA 5JRZA 1KO7A 4ZV9A 2VQDA 1ACLA 4LR3A 2JPDA 5KS2A 4FFVA 5F76A 4LRUA 4DSZA 4MP3A 1SCKA 3ND9A 1DRUA 4RNCA 2IXBA 2Z6AA 1Z29A 4L73A 1KRHA 2VBCA 1CEQA 3JQPA 2FOXA 3F6CA 1ZXBA 4KQXA 1G5QA 3U1VA 1T6NA 4GZ3A 3S7TA 1FNNA 3QPBA 3B1FA 2OOKA 4QEDA 3AR4A 4BV2A 4F4LA 5FUMA 1PF5A 1N2IA 4X8LA 4KRXA 5ALEA 4L6IA 1T0BA 3MJFA 5L3QB 5FLXM 4F8JA 2AXTZ 2IYPA 5EQFA 2HU5A 1YKGA 2F9MA 3TUZC 3IUMA 4MS2A 5CVJA 5L6LB 3BWXA 3KOUA 4FFBA 4PRKA 3TB6A 4F2HA 1PNMA 4YRDA 2G82A 4Z1MD 3SDSA 3R65A 4C7UA 3H86A 3I83A 1PNLA 1R5OA 1B00A 4OREX 1T2DA 4D9CA 3TRJA 1MB4A 4YUVA 1Y81A 2FFBA 3SLRA 3TBHA 4UATA 2OWEA 4K26A 4URWR 3H1EA 1Z88A 3C3AA 1E9CA 1UFYA 3I76A 2ZKLA 1RWOA 4G4GA 4BB5A 4PYIA 3RM3A 1HE8B 4Z4HA 4K9SA 4ZICA 3ERCA 2Q1SA 4F84A 3AERB 4G24A 2A92A 4WBSA 3ROKA 2OM6A 3HXOA 4R5MA 3BD8A 3LSYA 2YRXA 3GQBA 5HQ3A 5TQVA 1J0XO 1JLSA 4Q9DA 3R77A 4KHZA 1POWA 5KUMA 3G5AA 4MVRA 3TQSA 2VKQA 3OPXA 5DU2A 5HTKA 4P0TA 1DB3A 2ZBRA 4OP2A 4GRDA 2BHSA 1V9CA 4AN0A 1UXHA 3X1KA 1DIBA 1U3LA 1Y0BA 1E3JA 3KUUA 2NOAA 4HS9A 5FTMA 3IB3A 2XAGA 1BFKA 3ZQ6A 5K3BA 1SVNA 1NVKA 3QEJA 2WIJA 3ODGA 4TZKA 1GTSA 3Q8WA 4RTQA 3CF0A 4Y9RA 4UHDA 3UXHA 3OY2A 1FEZA 1CUDA 4KXXA 2ZLBA 1A1SA 4TQ9A 4GOOD 4P81A 1D9XA 1UJMA 4G0QA 3NP7A 4G1BA 3E83A 4D0GA 4R6ZA 1W0KA 4AMUA 1TTQB 4FGUA 4HGZA 3DHWC 2AHOA 2ARKA 4XJVA 2L17A 3WZLA 1KARA 3FAVB 5TVKA 5AVWA 3HPRA 3Q4GA 2P1ZA 3MLBA 4NECA 2FPOA 3OQMA 5AT1A 1SU4A 4LX0A 1BMFD 4KHPO 1CN7A 3QSGA 2BM1A 2I55A 1A2QA 1BKYA 4IVNA 3CURA 2WE7A 1HYBA 1AB3A 1ULUA 2P27A 1NF3A 1HRDA 1FVHA 2HVKC 4AMBA 4YFYA 2C7VA 4MUKA 1L0NH 5LDGA 2PS1A 3L40A 4G1VA 1I08A 5FA5A 3AB7A 4DA0A 4R1NA 1Z6QA 1FS4A 4YROA 1HBJA 2AQKA 5EMMA 5HW0A 2CB9A 4G0NA 4AJEA 3WO0A 3CN9A 2R6DA 1EVKA 3D4BA 4IL5A 1DUVG 3IAHA 4KIWA 4Z9FA 4FXPA 4S3MA 5JD5A 1NW6A 3HO1A 1L5YA 3LP8A 1GV1A 2V0GA 1RM5A 3GLGB 2H1WA 3LPDA 2DT4A 5K8UA 4FN5A 5HKKA 3O8BA 4PZDA 1Y9ZA 4UCOA 3KPJA 4J91A 3P94A 1OAOA 5DBFA 2CWWA 3HP4A 4HTFB 3JR7A 2VDVE 3H7AA 3FWPA 3ZGYA 5GIOE 1C1XA 3WA6A 4CG2A 2NTNA 3S1AA 2BEWA 3EQ8A 3OURA 2O8EA 4ROTA 1VL6A 3N2KA 3NDPA 1HKUA 1RJEA 4ND3A 3C39A 1CD5A 3FNQA 1SVUA 1KZYC 1B3BA 2BI7A 2UUPA 1U04A 1RPZA 1Y6JA 5F7XA 1XDWA 5IDXA 1ZHOA 2UUAB 2AWNA 1Z4QA 4GYKA 2JCXA 4YRKA 2X4LA 2BT4A 1X19A 2GPYA 1QH0A 5CEFA 1XL6A 3GDOA 5D01A 2IVFA 1SETA 2P9GA 4IIBA 3EGIA 4CIBA 1RJGA 2C1XA 3QIVA 4ALKA 4B3XA 2HJHA 3LBNA 4JI0B 2I9PA 1W0JD 3A6ZA 5H3HA 3C3CA 1NXQA 3ZO8A 2CLKB 4BY9D 1JXQA 2QD4A 5LP6F 1KP3A 3IOEA 5H81A 4DV6O 3NBMA 1Z8FA 5KSOA 3PFHA 4P7BA 2JEUA 3I6ZA 1IWOA 4KMSA 3STUA 1GQ2A 3QO5A 3G8BA 5IYBO 4GZ5A 3IE0A 2B9ZA 2NXCA 3NHZA 1WHTA 1WXFA 2ZPTX 4KLNA 1H2YA 1SUCA 3GFOA 1MA3A 3P9NA 3FDZB 1KHTA 3G2QA 1G6OA 1XDUA 4KQKA 1V3QE 4DMCA 4WMLA 1YC5A 4HV4A 3DBLA 4OAPA 3PZRA 4PO3X 1A7AA 3LHIA 4N3AA 1GNVA 4BW9A 3CVOA 4U2DA 2VDMB 3ZVLA 2FSVA 1F0KA 2M6RA 3DS8A 4DG9A 1RXWA 2ODEA 2VNKA 2PY5A 1SVIA 4CUJA 5B58C 5A5GA 2PLNA 4UM5A 1BFUA 4X63A 4CEHB 4RXMA 2O8BB 5HWSA 3MUOA 3DFUA 1P81A 3ZWCA 2XWPA 3TVDA 4YRTA 1MU0A 2VGNA 3EXG2 1SCIA 3M4YA 3D0RA 4DSTA 2GETA 3HTNA 2QGFA 4X1KA 3UV6A 3V2UA 2RNBA 4KR9A 3N4YA 1R0LA 2KTVA 2ETVA 4U6QA 3MBIA 4U6SA 3LXRA 1MB3A 1UJ2A 1K7FB 1ZM9A 5CXSA 4F9TA 5GONF 4JVOA 1C3OA 4R40B 4FXOA 1E5TA 3V3KA 4PYMA 3AEQA 2OCHA 3CIFA 1OTXA 1SZPA 1ACJA 1KQSF 4IWXA 1PGQA 3HVKA 2V45A 3U44B 3EMKA 2ZSDA 3DXYA 2I34A 1PWHA 4LMAA 1WCYA 5LZ4A 2CKMA 2CLIB 3DMPA 3P5SA 2WTNA 3TBFA 2PI5A 1MIHA 2ABWA 2ZJ7A 1H9CA 3FPJA 3UF0A 1B15A 4OA5A 3GFTA 1FNDA 5AOCA 3BEDA 1URFA 2IKQA 3D6HA 5EJ9A 1PP4A 2IZ0A 5IVHA 4JAUA 4LC0A 3LDFA 1CXZB 5T6BA 3RUHA 1JSXA 3CJRA 3GLGE 2B8WA 4ALLA 2P9CA 4AWXA 4URZR 5BSEA 1G4HA 2IK8A 3PRYA 1QRSA 3VH4A 4II2A 3F4KA 3M6MD 2GD6A 1XXLA 3DYBA 4NPCA 4A0HA 4XRRA 1TX4B 3BG5A 2ZIGA 3NLLA 4LTMA 1GU0A 1JI0A 4UDOA 4RKRA 3SQOA 1VJCA 2IYZA 5JJ5A 4BQIA 2ZP1A 2Q6IA 3EEIA 3FIJA 4KX5A 2ZYVX 4H3SA 3ZE2B 3OSZA 3RFXA 5JXJA 4EZIA 1UADA 1WOYA 2X19A 2EC5A 4ALJA 1GKKA 2VAVA 3I32A 2N1BA 2BEJA 3VC2A 2OYQA 2OE2A 4HJRA 4OBXA 2DHDA 4GMKA 5BQ3A 1Y3BE 4B5KA 2JLBA 2A1TR 2BFFB 3D6TB 5AJUA 1Q86H 1E2JA 1VK3A 1MNGA 1M7BA 1TYCA 4DLUA 4Y1GA 4K3UA 5L3QA 4NZZA 4JYBA 2OXFA 1Q0TA 1YZVA 9ABPA 7ADHA 3T35A 1HV8A 4H08A 2RAPA 2D5LA 3ZY4A 1H8HG 4GBMA 4YY3B 1QLEC 3QFSA 1NMUB 2B8NA 3FBGA 4NONA 1T4BA 3QA9A 4MW9A 4L75A 2WLLB 5K1ZA 1W4AA 4UTVA 4O63O 2SHKA 4WFHA 3EPLA 3KHTA 3JYOA 4J0JA 1AY0A 1QRAA 2Z43A 3CNEA 4UE3S 5DTEA 2H4XA 1PW5A 2ACKA 2Y1WA 5IJ0A 3G0BA 3A1EA 4BX0A 4L8FA 5LP6B 3OQNA 3U9TA 3AERA 4PF1A 2DPYA 3AMVA 3LDUA 5EC1C 1EFCA 2XF8A 1EHCA 1E6EA 2GK3A 1IV4A 1FUUA 4QUAA 2HU8A 4CG1A 4JODA 3GROA 1TJ5A 1DAHA 4WJLA 2AG5A 1XYGA 2Y1EA 3LIPA 3VRHA 1K98A 3V8RA 4GPBA 4RNDB 3A1VA 1KKCA 1CJMA 3A27A 4LF5B 3IGAC 2PSSA 1L3IA 2FZ4A 3FFMA 1I5OA 1AOXA 2D1QA 1QMGA 5F7ZA 2QKCA 5E3IA 3W5VA 3E1YA 2ORYA 3QEBZ 1XMQO 1KR5A 3NMUC 4BYGA 5E4YA 3UOAB 1C9DB 4HWRA 1VOTA 2RK3A 1E20A 4RZ2A 1T15A 1KEEB 2LW7A 1ZGBA 2O57A 4Y6SA 3LX5A 3TJRA 3MLEA 1G8YA 3AF1A 4K46A 4C3ZA 1UIRA 1R1BA 2IUTA 2DBRA 3BD9A 3GP3A 3VOTA 3AY0A 2GZRA 4L07A 3WC4A 2JEXA 4DWWA 1JDSA 2Z0MA 3EXHB 1QZZA 4Q4CA 1NG9A 4NYIQ 1P4JA 4G28B 3NO4A 1NURA 2G4CA 1EZJA 3ECAA 1L4UA 4JI2O 4OMUA 5FBKA 3HVUA 4UM9B 5FL3A 2HTFA 3L8GA 1E9RA 5DYTA 2KGWA 1H85A 1SXJD 4RGQA 3GIWA 5HA5A 1FW8A 3NVIB 3L8HA 1QV9A 1XTSA 5JZ9A 1SQBH 3B53X 2QAJA 4YMTA 5HQJA 4N7MA 3OJFA 4AJ1A 3TAXA 3PPYA 1Y6RA 2ZSJA 3AXTA 3FI9A 4I6EA 3F2IA 2BRUC 2BFPA 3MINA 3KSDO 5EJMA 2VO1A 3Q7PA 3AW9A 2DHQA 3GLGA 2HBZA 4KPEC 1T8WA 1SUEA 3A6GA 1V8ZA 3SDLA 1UCFA 1OROA 3UW3A 1V7CA 2QG9A 3ZHSA 2HHCA 2D2FA 5GTIZ 2E2WA 3FFBA 4P7JA 3VQYA 1OWLA 1FOEB 2IXEA 4HTFA 1A2BA 2E5LB 1A50B 4ZMBA 2E87A 5C52B 1WKVA 2FMLA 4YCDA 1PM9A 4DV2B 1F2VA 3IIKA 2D5BA 4UFOA 1ZUWA 3WA7A 3AXSA 4G0WA 3N2GA 1IEVA 3DHYA 1U7TA 4B6GA 3NHLA 2YS8A 3MGBA 8ATCA 1M2WA 1SQ6A 3D54D 1OA0A 3WLKX 1G8KA 1Q1AA 4F1JA 2IZOA 1UXOA 1FFDA 1RIIA 5K51A 5C8YF 1YBMA 2ET6A 3MLAA 1I9CA 2GK7A 2PVCA 3EGOA 2LCIA 2OCAA 1ORHA 4ZCLA 4AXXA 3THYA 3V7UA 1GGEA 4JEHA 1QIGA 5FUXA 1K8ZB 3REGA 2PI4A 4HD8A 3HYNA 5HKAA 4EUKA 4Y98A 3FUTA 5LMUO 1TEHA 3FTCA 1KL7A 2O4CA 3MJ4A 1BEZA 3IDOA 4Q37A 1M0SA 4ZHSA 1OXMA 1UBUS 4MI3A 2G0AA 2PSFA 5EPEA 4DEYA 3A10A 1OCCC 2BZGA 2VDWB 3C3KA 1KK0A 3A0RB 3DE5X 4DM7A 3P2EA 1L1EA 1U8TA 2BKVA 1GGKA 3NUZA 3FMOB 1OU4A 3A1WA 1PX0A 2C59A 1EGMB 5KNBH 1KMCA 4ZREA 2JFYA 5JC1A 3AQ4A 4HEA1 3ABQB 3N6VA 1ISPA 2OBNA 2GNAA 3TRHA 1ZAYA 1DC8A 5KREA 4FM0A 3FDZA 4YFVA 1Z74A 1HURA 3C8MA 1ESEA 1LK5A 1GZ6A 4ENSA 5JCOC 1P9OA 1VKZA 4BQOA 3T7TA 4BX9A 1YFJA 1A1VA 2R44A 4LYGA 2OFFA 1EK2A 1I01A 3RIMA 4XM0A 4UQLA 3HB4X 1T5DX 3LCVB 4MMZB 1MCZA 3G1WA 4EJFA 4LJRA 1CF4A 3F6PA 2G72A 5KEIA 4B83A 3K59A 3P52A 1RZRA 4Y6RA 1FP2A 4C30A 4COOA 3T9BA 1JMVA 4R4JA 3U3XA 3KKLA 5DHFA 2O8BA 2G1JA 2DYSB 3SYQA 1CEXA 3KB1A 3BMQA 1BIFA 5LZ9A 4FYJA 5GJVC 4C8IA 2XIQA 3OP4A 4BO9A 2A9VA 2C9ZA 2OLJA 1ISIA 5JSQA 3LP6A 1U9CA 5CCDA 5KQRA 5CFQA 2PH1A 2IDMA 3HBLA 4UAGA 2H2HA 1LBSA 1TM2A 1WNFA 1P61B 1CTQA 3TN7A 1T3TA 4CMJA 4II7A 2B4TO 3H5AA 4R40A 4NQRA 2H2GA 3C7AA 4MQ4A 3GBVA 1GLVA 3RAFC 3RNLA 4DCOA 2O8FA 4ND8B 5CDYA 1W49A 3L1HA 1VL2A 1YZUA 3QOYA 4W4KA 3VYVA 3UJNA 1GT6A 3H5NA 1TMKA 1M8KA 2BEKA 5LMZA 4WZAB 3ZMSA 1JEQB 3NC0C 1FJXA 2Z1MA 3ZBTA 1RSZA 3KCQA 4J1TA 1IUPA 1DTEA 5KUTA 3NHSA 1T8UA 4L5IA 2JL1A 4LW8A 3V1KA 2DHRA 1W2BU 4MIOA 4Y2QA 4RUFA 2WF6A 1MXFA 4NI5A 1CXZA 2QP4A 1NASA 3GLIB 2C4HA 3JQCA 3DF9A 3UK0A 4EECA 5KI6A 3VYSB 1QH1B 2PUBA 1FMLA 1N36O 3OM1A 1PJBA 5EIFA 1D9ZA 1IM5A 1RXIA 3U5TA 3DFZA 2Q3LA 1TJNA 1NGSA 3A37A 3HK2A 3U1TA 1IJFA 4KUEA 2UYKA 3JAKB 2YIAA 1HDRA 2FEAA 4G0UA 1U43A 2DQYA 1OX4B 4EJSB 5C46F 3W1EA 5L9AA 1LQ2A 1SXIA 2VQSA 1WZEA 1R5BA 4G4WA 4HDNB 4PFJA 4J0KA 1II0A 2H2WA 4G63A 3QVKA 3OFJA 1K5SA 3IFSA 1IXSB 2W2LA 3R1IA 3DPIA 1XU4A 1DFGA 4HB3A 3T9FA 2QZPA 3EYWA 2BFFA 2M1ZA 4JNKA 5DKFA 5JU6A 2CNWD 5CB8A 3SQLA 2XOEA 1RYEA 4DLNA 3IUYA 3UGQA 1Y80A 1E6KA 5AFSA 4YRRA 5EJGA 5FOTA 2XQJA 4FSHA 4K2HA 4D8YA 1SBQA 1NOKA 4BN0A 3D0QA 2NMUA 2YXBA 4OM8A 3DFIA 1IN5A 2DCUA 2CHUA 2AFVA 4B4UA 1G5TA 3DDOA 2JAPA 3LL4A 4CLEA 1ZM2A 4YYZA 1G7RA 3ZDQA 3H9EO 4JI3B 2Z5GA 3U0BA 2GN8A 4CYMA 3U3JA 2GTIA 3IHTA 1H4VB 3CTPA 3MJVA 5HBGA 4AW9A 1DWQA 4TL7A 5JEEA 3SJCA 1FTQA 4NMHA 2FR0A 1NI4B 5FLYA 3U0ZA 4RZHA 2ZB2A 2EBHX 2VZLA 4UVCA 4FNGA 4HYTA 3MD9A 2R1UA 3V1YA 3PIRA 4BX3A 4P86A 1A4XA 1DKRA 2O8DB 4EFNA 3VU1A 4IJ6A 4FZRA 2HV8A 2ZJBA 3AUSA 5AW9A 5A04A 1L5HB 3A36A 4AKEA 1P8AA 1GU7A 1VMIA 3HCPA 2OXEA 3PL1A 1EZVH 5JPDA 4PV1B 1X1DA 2W8ZA 2GD1O 3HKBB 4YLGA 3CMEF 2DTXA 2K5UA 4Z0HO 4FBMA 3NT5A 2V0NA 5FPRA 2Q28A 4HFJA 1SUBA 2P7HA 3DWFA 4C2BA 2IELA 3PXBA 2IXAA 1LWNA 3P9PA 1PG2A 5DP2A 2UXDB 1Q5PA 4AO7A 3FSRA 1ZN9A 2QA4V 3LT4A 4PZ9A 1VFPA 4H4DA 1O8BA 4RHUA 3L7LA 3BK7A 5HY4A 3O84A 3LWZA 2W48A 4OVKA 3CYPB 3S5UA 3H3FA 3BH6A 4PGFA 2LQTA 3RRJA 5ALQA 2J6IA 1KECA 2JJ1D 2WJAA 3H05A 3BIOA 2G1AA 2IQQA 1L5GB 4JVMA 3OTHA 5I5EA 2V3WA 3FOBA 1GM9A 1KEEA 3KSZO 3Q1KA 3I61A 2EIKC 1VA5A 2NO4A 2IH3C 1Y9EA 1WBJB 2C5GA 1MO6A 1HDOA 1GVNB 3S3XA 1JFLA 1ZRHA 4DC9A 1BHSA 2JGLA 1VQOF 5A9RA 1E8MA 4BXOB 3PSAA 4MKFA 5C4IA 2ZJ1A 4BN5A 3NVKE 2PX4A 2B69A 4XR4A 2RCNA 2B61A 2VQEO 4BIOA 1I4WA 1BE6A 1MKYA 4MWEA 4MHOA 3H9CA 2GN6A 2Z58A 5ALUA 3ETQA 3W5CA 1QU2A 1FX1A 1NAHA 1SVOA 3EA5A 5IUJC 1U7ZA 2OIGA 3TFWA 2IYTA 3DHVA 1O5IA 2ZQZA 3EBLA 4DA7A 1KOFA 3QVMA 2OQVA 1U0HC 3D36A 1Y74A 1Z06A 4F0JA 3GLIE 1YQDA 2VYFA 2AXEA 3AT1A 2O0HA 4DLAA 4M88A 5LQNA 2QXTA 2ZJ3A 3PEWA 1M2NA 1E4VA 3GF4A 2XWSA 4HNSA 2FW1A 4RQOA 3IR7A 3DDUA 3W79A 2UZAA 5DN6A 1KPIA 3OIUA 3YASA 4IDDA 1G2QA 1WJGA 4MJ3A 4RMHA 2DUUA 4CKBB 1M33A 1WXIA 1G7CA 4NYKA 5K0ZA 4KXVA 3O8RA 5DNCA 5EHNA 1KRWA 1FVFA 2FDRA 4HAYA 2HMSA 5J4KA 4D45A 1GM5A 1RAIA 3M1LA 4J10A 1NE2A 1SCUB 3S3TA 2P78A 4UUNA 3NP9A 4PXAA 3I04M 4C29A 1Z7WA 1GL3A 2TECE 1RAGA 3OJEA 3AY3A 3QE3A 2P4QA 3KLPX 3RBXA 3MTIA 3ESQA 3S40A 1X39A 4PVCA 5AUPB 2WUFA 4NHEA 3VR2D 2RB9A 1HRKA 4ML3A 2X7HA 5JCXA 2FJPA 2V7EA 3AY6A 2D13A 3OHSX 4GMXA 2HAEA 5I4CA 1OI7A 3WGJA 1HDYA 2FZCA 2J08A 3C41J 2XTMA 1MABG 1QRTA 2QDXA 5B6PA 1T3ZA 4C4WC 4R9NA 4ZYYA 5ECYA 1FYWA 4LHVA 2E49A 1EP2B 4ENUA 1ZR2A 1S0VA 3ZQ4A 1UPUA 2VDWA 3I5DA 5CCXA 3HDTA 3A0RA 1VHLA 2Q9CA 2HHHB 3QLVA 5GQSA 4L7VA 4RJTA 1H2MA 1JZTA 4JQZA 4L6CA 4QNMA 5DSTA 2AMTA 1XX6A 1RKVA 5TQ0B 3RJ5A 4DTCA 1UBHS 3VR6H 2PX2A 1EI9A 3CGGA 1Z0UA 2EW1A 4NOKA 2XCTB 2EGUA 3BVOA 3SPIA 3IJPA 3VI6A 4IKPA 1A27A 3IKVA 3ZXYA 4HWPA 1JLLA 4WGFA 3MILA 4AROA 2XQVA 4TTSA 3VYTC 1QIDA 2PEZA 3L5KA 5CFPA 4FYIA 1OAAA 3SSAA 4DYHA 5F5NA 1GTRA 3BZUA 2X6CA 2CW4A 4JLDA 3SQDA 2QT0A 1IQRA 4L1KA 2PBFA 3MGAA 2QR3A 1T8RA 1YBFA 3GZJA 4QTYA 5JJBA 4IZHA 3MCAB 3CPWU 2QENA 2HJFC 3AGKA 2VHXA 4HYQA 1YHYA 1U3PA 2PQ6A 1LTHR 5K1XA 2HEIA 1J49A 1ODSA 1AIPA 3DC7A 1XKLA 4DA4A 4DQUA 4AUKA 4GMDA 1SC5B 3X1DA 3HU5A 3IR5A 4KG7A 3RS5A 4D57A 4I1SA 5LBIA 2Z8YA 2VHEA 3LRXA 4D5GA 3T1QA 2J7PD 5DNYB 4AY4A 3DE6X 4AK9A 2BSXA 4UULA 2C84A 5F2NA 2Q2WA 3MQWA 2CMFA 2ZIWB 3NAGA 2QQFA 1ECGA 2G25A 1WY5A 5L3ZA 4I5FA 4DQVA 2OZLB 4LQDA 4ND8A 4X6LA 1KFBB 1TO1E 1VRCA 4KR7A 2IF2A 1CS4C 3D7KA 1A71A 4R9UC 5GP1A 1E66A 3DOCA 4CKWB 4RY0A 2C8LA 1JEQA 3AM4A 3QHDA 1E63A 1NV9A 5HUQA 4LI3X 3KDSE 3EX7C 4RTSA 4GAEA 2VOEA 3GNQA 5HKOA 1PFUA 2Z2IA 4TZZA 1E5DA 4WNIA 1A98A 3L7JA 2YVAA 4OYHA 2OTMA 5C0OE 3FYEB 4QPZA 2OPHA 2GARA 4C5AA 3GLIA 4B3SB 3WL8A 2WJWA 1GVHA 1DRVA 5AO9A 1KAHA 1JYFA 1QH1A 1Q8RA 1AI4A 3IPAA 2J30A 1YZYA 4PANA 4DQKA 1VL0A 4ND5A 4RD3A 2X3FA 5FHQA 1OX4A 4EJSA 3WB2A 2NW6A 3FNHA 3EARA 4KTTE 2LWIA 2VJQA 1KJIA 4HDNA 1N7GA 2RK4A 3RSHA 1DU4A 5GV8A 3VNAA 1JG3A 3RT9A 3L6BA 2R60A 1Q17A 1VPDA 2VNJA 3QXSA 3R6DA 3LF2A 2IBTA 3SR0A 5BR8B 5TX7A 2IEZA 1YTLA 4BNJA 4EI9A 4JL8A 3UMJA 5ENDA 4CZ2A 1XBIA 1GKLA 3F6BX 3NEAA 2CJPA 2GSDA 3JD0A 3P2MA 5TGDA 3E7PA 5B3SC 2QUAA 4EP1A 2OSVA 3K6SA 2XUZA 4JYMA 4KE7A 3HEMA 2FWJA 3TSOA 3OFND 4L5BA 1MH9A 3QITA 4IMJB 3OQBA 2O0LA 5CYFA 2B2XA 3DLCA 2XVMA 2AXPA 3AK3A 4PSCA 1QONA 5BV7A 6ABPA 1Y48E 4PWZA 4KXWA 3GPDG 4Q1BA 1P2GA 1VP9A 3TNJA 1JQ0A 2VA9A 3C16C 4J0EA 4GQBA 2BFEA 1IZYA 4UW9A 3QXCA 4LOAA 1ZD2P 2BR4A 4MDFA 5B2EA 4HWOA 3MRXA 1IPHA 2K4MA 5JY1A 3B3AA 4IO1A 2QR5A 4B17A 1NI4A 2C5LA 1G64A 3L73H 4M6WB 4U63A 4JAAA 4LPSA 3ICWA 3ZQJA 3S1AB 1H8ED 1M0EA 5JZOA 1HQCA 2VXCA 4XQ9A 4KUMA 2JAOA 4QVKA 3KQMA 2O8DA 1W34A 3Q11A 4QIHA 3I9JA 5JI3E 3ZIAG 1VQPV 1NJIH 2L69A 2A9RA 1L5HA 4TT3G 2AI1A 3KV1A 3G4SV 2EATA 2J8ZA 1B2RA 3EXAA 5C34B 4DXWA 1UBMS 3AU9A 3TXXA 3QI2A 1O95A 3HKBA 2Y99A 3G5UA 3HKDA 2XBUA 3UWOA 1QP8A 2BOCC 4QHTA 3M1IA 4G0MA 5F3DA 4DCTA 2R1TB 2CY0A 4N5LA 4UUQA 4LISA 4MAMA 3IT0A 3D7LA 2WHQA 3UMVA 5C7OO 3PNMA 2GFHA 2RGCA 4BQFA 5B8FA 1A9PA 3J80A 2UZ1B 1PJ2A 5ALJA 2DB3A 3EULA 2Q4RA 3TQQA 1W4CA 3IC7A 4UVDA 5ARCA 1V6AA 1NFQA 1EBOA 5G0VA 1COMA 3FGOA 1N6KA 3OC6A 2LIVA 2PMPA 2GLXA 4DMMA 1FDRA 3DMGA 4EJ2A 2F3RA 4CT0A 1OHHA 1ZWKA 3TK1A 1OWMA 3MW8A 1UK7A 4W1RA 1S76D 1ECFA 4BZPA 2CYAA 5JBIA 2ZVPX 2GBLC 1Q6YA 1ID1A 1WA8A 5CB4F 5CJPA 2C0QA 3H19A 1N0UA 1JJ2U 3ETJA 3QOFA 3K04A 5DX0A 3PKJA 3TCNA 3MWDB 5BXZA 2J4DA 2W6QA 2IYWA 1Z0KA 2AW5A 5THQA 3FHTA 3USCS 1RYZA 3IP3A 3H8SA 4K6FA 4AICA 4ME6A 5B1BC 3S02A 3JVDA 3RFRA 4JR2A 3HGTA 4DM4A 3OIDA 1RXEA 3Q0EA 2QVLA 3T1CA 2AN5A 2QL5A 4B4VA 3SR3A 3MAQA 1FXKC 3D6VA 4C4XA 1UT6A 5EJEA 5F12A 2AFHB 5JSYA 2MMGA 1K6JA 5FTJA 4YASA 1NJ1A 2QL9A 3L0YA 3KIZA 2QYSA 2H4FA 3W90A 1SVWA 3B7WA 1N0VC 4W6ZA 4BEWA 3BYQA 1VBFA 2F17A 3EPKA 2HWWA 3OJWA 4DY6A 3OD1A 4IXMA 1SQQH 4M1KA 3TLAA 4GZ6A 3RBAA 1YR7A 2DETA 3TMAA 5ICGA 3B6NA 3A1CA 2AUMA 1N92A 1PTJC 3RJZA 3F0EA 1P6XA 4B7UA 3SE7A 4JK3A 3KUXA 4M49A 1YS7A 4X1KB 1QZ3A 2ZXUA 4FU0A 4KYUA 1HNXO 1UZLA 3SFZA 1JCHA 1DEHA 1M57B 4I6JA 5HCNA 4KQFA 5FPYA 1BHAA 1UMDB 3F98A 1BW9B 5TISZ 3NTUA 1UQTA 4FYVA 3PGLA 1HNZO 2R0QC 1SK9A 2G17A 1HLPA 1S96A 3K79A 1VZ2A 2NYVA 4U7GA 1GN3A 1GA1A 2C96A 3RI3A 4EABA 4DPMA 1SCUA 1RCTE 2QM0A 4GSKA 1YKSA 1QZUA 1Z2NX 3GRRA 3C6BA 5EI5A 3EBOA 1R3LC 2NN3C 2RARA 3CVWA 3WJ1A 2DN9A 2Y1KA 3TO5A 1NBEA 5H68A 2E76B 2C03A 3TXAA 3KPWA 1AHHA 2VYVD 4EPYA 4Y2XA 4CMIB 2IYSA 3WKBA 1MLDA 2KG4A 5K8JB 2BGNA 4LQLA 3D3JA 2PU5A 3ENQA 3CLUC 3B1ZA 4WFJA 1ZW1A 2ODPA 4B74A 1ZMBA 4JUBA 5AVXA 1IIBA 3A8TA 1B8OA 3GJ3A 1VKJA 1H9AA 3JQFA 2E4ZA 3USZA 2C2XA 4L08A 5K4GA 2ZJ8A 5ISMA 3Q7QA 4LC9A 1Z4OA 2J6CA 1G4UR 2QR2A 2Z08A 2OZPA 3LOQA 1AJQA 4MVJM 1PZEA 4DB4A 1KTVA 3B4SA 5DMHA 1H2EA 4MRNA 2OTLF 4WZZA 5FJIA 2H48A 5AVVA 4CH5A 2ZB8A 4REOA 2I80A 1P72A 1RYBA 3HTXA 5TQ0A 3PGXA 1GPLA 1Q12A 4WZ6A 4YXWG 2Q99A 4DYDA 4IRXA 4KWHA 3GG9A 2HK7A 2YY6A 2F6RA 4GOMD 3UH1A 1GITA 5DMXA 5TXGA 1S1MA 1VRVA 2AFRA 3GEBA 5BQOA 2I62A 2WJ4A 4LQCA 3ANTA 1XLWA 2RHRA 2IT1A 2I8LA 3U7EB 1JJAA 1BDMA 2PUHA 1FJHA 3SZ3A 1Y5LA 3ZZMA 3W7AA 3L4EA 3U40A 1F3OA 3AVXA 4B3RO 3IMEA 4DB2A 4R1LA 4DDVA 3GEEA 1RHRA 3RSQA 5ALFA 4M8LA 1RFLA 5EC2C 1IPFA 1V95