1TUCA

Alpha-spectrin src homology 3 domain, circular permutant, cut at s19-p20
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
MGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-SPECTRIN
publication title The order of secondary structure elements does not determine the structure of a protein but does affect its folding kinetics.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
total genus 10
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1996-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1tucA00
1Y0MA 1M8MA 2EPDA 2F2WA 3KFVA 1WXTA 2YDLA 3VRYA 1E6GA 2C0IA 4OMPA 1AWWA 1T0HA 4AFQC 2RQWA 1KIKA 4OMQA 2LZ6B 2A37A 3FJ5A 2E5KA 1WXUA 3H41A 3TSZA 3IQLA 2KNBB 5GJVB 2ED0A 5HCKA 2LP5A 2CH4A 2CREA 4ESRA 1OEBA 2HCKA 2HEQA 1H8KA 3LH5A 5I11A 1K0XA 4F16A 1ZUUA 1KSWA 1AZEA 2EYWA 1KJWA 2KRSA 4AG2C 2KR3A 4ZNXA 1AWXA 2FG0A 3H0IA 3NPFA 2EKHA 4HVVA 5IHKA 5FWCA 1M3AA 2CT4A 2JW4A 1UGVA 2J6FA 2O9SA 1RUWA 2JMCA 4DEXA 4OMNA 2EGCA 2RF0A 4J9EA 2DJQA 3I5SA 1VA7A 3RBBB 1Y57A 2BZ8A 5IXFA 2EGAA 1GCQA 1RLQC 1TUDA 2DLPA 2VVKA 4LUDA 2A28A 1WIEA 2YUOA 1I0CA 4JZ4A 3UA7A 2EYZA 4K11A 1SPKA 2DRMA 1AVZC 4WCIA 2PNIA 4OMLA 1JO8A 2EYYA 3I35A 2FRYA 3GBQA 1X2QA 2DMOA 3QWXX 1ARKA 4AFSC 2KBTA 2GQIA 1QWEA 1CKAA 1PNJA 1B3QA 2H8HA 2JS0A 2DVJA 1G83A 1KFZA 2D1XA 2G6FX 1WX6A 4D8DA 1YCSB 1YNZA 3EHQA 1AEYA 2GTOA 2KT8A 1FYNA 1SHFA 2J6KA 3UATA 3M0UA 1UG1A 4CC4B 3ZL7C 4RUGA 4JZ3A 2X3XD 4M4ZA 2L0AA 5FWBA 2KE9A 4A63B 3TSWA 1M30A 3UA6A 1NEBA 2LJ0A 2FPFA 2K9GA 2CDTA 2FPEA 1K0SA 4OMOA 4RTVA 3VS6A 1M3BA 4F14A 4IIOA 2M0YA 4J9CA 2GTJA 1AZGB 3I9QA 4LUEA 4EIKA 2LNHB 1WA7A 2DL3A 1OPKA 1HJDA 2SRCA 2P4RA 2BZXA 2SEMA 2EBPA 2KXCA 3NMZC 2RQVA 3REBB 1X69A 1VYUA 1YN8A 1QKXA 2HBWA 1UECA 2LQWA 5FW9A 2RN8A 1XOVA 4JPBW 3U23A 3VS7A 1X6BA 1NYFA 2DL7A 1WXBA 2I0NA 1VYVA 3QWYA 1BU1A 1QCFA 2DM1A 2EGEA 2EYXA 2F2XA 4RTTA 3VS4A 4E6RA 1FMKA 2BZYA 4JJBA 4ORZA 2D8HA 2KEAA 1ABQA 1Z9QA 4CC7A 1H3HA 2RPNA 1NLPC 4RTYA 1E7OA 1JXOA 3R6NA 2W0ZA 2OJ2A 2AKLA 2DNUA 2EQIA 1QLYA 4RTUA 1UTIA 2IIMA 2CT3A 2BTTA 2DL4A 2C0TA 1NEGA 4J9FA 2D8JA 4OMMA 3ULRB 3I5RA 1SRMA 2DILA 1W70A 1X6GA 3EG0A 4RTZA 1K9AA 2ABLA 2ECZA 1ZSGA 2DBKA 2O31A 4HVUA 2KROA 1S1NA 3EGUA 1W1FA 4Y92A 2FO0A 2JM9A 2KYBA 2CH4W 2L2PA 2RMOA 3M0TA 1K76A 3SHWA 2CUDA 1MV3A 3VS3A 1ZUYA 2K3BA 4Z89A 3VS0A 4J9IA 1OV3A 2DA9A 5I22A 1H92A 1JXMA 2LMJA 1VYTA 1M27C 1QKWA 4D8KA 3NHNA 2GGRA 2CSQA 1T3SA 1UHFA 1RLPC 1OOTA 4CC3A 1T3LA 2DL8A 2FPDA 2OI3A 1IO6A 1EFNA 1ZLMA 4R0KA 4KRTA 2KRMA 1JEGA 2LQNA 2PZ1A 2O9VA 4HVWA 2A36A 2L3QA 2MCNA 3EG3A 2AZSA 5IH2A 4CC2A 2MIOA 2K79A 2GNCA 2YUQA 1WFWA 2B86A 2VKNA 1PRMC 1PKSA 2XMFA 1YP5A 2J05A 3M0SA 2GBQA 1ZX6A 1JU5C 1K4US 1ZUKA 2EVRA 4JJDA 1TG0A 3UF4A 3CQTA 2RQUA 3VRZA 2CUBA 2V1QA 1NG2A 1YWPA 4J9GA 1V1CA 5IXBA 2DRKA 1W6XA 1GFCA 1B07A 2AKKA 3A98A 2F2VA 3RNJA 2AK5A 2J06A 4Z8AA 4QT7A 1GFDA 1UHCA 1SHGA 1NLOC 1PKTA 2FEIA 4F17A 5L23A 1K1ZA 2NWMA 2J6OA 3REAB 3PVLA 2LJ1A 1X27A 2YUNA 2W10A 4LE9A 1MV0B 2NUZA 5IHNA 4LN2A 2DL5A 1T0JA 2JS2A 2YUPA 2J7IA 2YSQA 1U5SA 1SSHA 2CSIA 1BB9A 3PE0A 1ZBJA 2KT1A 1UE9A 1GCPA 1NYGA 2ED1A 3H0FA 1I1JA 5ECAA 2MOXA 2KYMA 1UDLA 2HSPA 2KXDA 1BBZA 4RTXA 2M51A 2RQTA 4DEYA 1WYXA 2RQRA 3THKA 1MUZA 1WI7A 2JT4A 2QDLA 1Z9ZA 2ENMA 2LCSA 2L3PA 2KGTA 1WLPB 4RTWA 4AG1C 1GRIA 3NGPA 1G2BA 2LJ3A 3VS5A 3JV3A 5IHIA 1ABOA 4J9HA 2VWFA 2K7AA 4Z88A 2RNAA 1WDXA 1HD3A 1QWFA 3VS2A 1GBQA 2HDAA 1GL5A 2YT6A 1TUCA 4AFUC 1PHTA 3M0RA 2D0NA 3EG1A 3PVQA 1UUEA 1AOJA 3TVTA 2O2OA 3EG2A 2FRWA 2JM8A 2V1RA 1LCKA 1RI9A 3O5ZA 3C0CA 2DBMA 1UJ0A 2EW3A 2K6DA 5EC7A 1A0NB 1UJYA 1X2KA 2ROLA 1HSQA 5GJWB 1AWOA 1YWOA 4J9BA 2DYBA 1NM7A 3H0HA 2ESWA 1AWJA 1BK2A 4GBQA 2OAWA 1OPLA 2DE0X 1CKBA 1E6HA 2JMAA 2DX1A 1U06A 2X3WD 3VS1A 2LX7A 4HCKA 1PRLC 4IIMA 1N5ZA 3M0QA 1SEMA 4AFZC 2JTEA 2C0OA 1I07A 2DF6A 1U3OA 1PWTA 2KRNA 2A08A 4X1VA 1CSKA 3M0PA 1AD5A 1GBRA 1SRLA 3EHRA 1J3TA 2PTKA 1UFFA 4FSSA 2L3SA 4HXJA 1JQQA 2ROTA 4GLMA 4J9DA 3SEMA 2JXBA 4JJCA 2AZVA 4LNPA 1X43A 1M3CA 2K2MA 1GCQC 2O88A
chains in the Genus database with same CATH superfamily
3KFVA 2DFUA 1WXTA 3VRYA 1VQ4Q 1E6GA 1UGRB 2C0IA 2IPOB 2HQXA 3QO3A 2KI7A 1T0HA 3VYHB 4AFQC 2LZ6B 5HKCA 3MO8A 3RMQA 3TSZA 1QVFS 3IQLA 2KNBB 3OMGA 5HCKA 2CH4A 2V26A 4BD3A 2CREA 1NJIR 1NBEB 4FU6A 3CMAA 1NE8A 2MYSA 3QDRB 4FIBA 2RHXA 1KSWA 4X9CA 2EYWA 2KRSA 3MP8A 1AWXA 3QSUA 4M77B 3CD6T 4HVVA 5IHKA 2K5LA 3FB9A 4M78F 1D1CA 1RADB 5LJ5d 3OYMA 4OMNA 2KK4A 2EGCA 2GCXA 2E65A 9ATCB 1GXIE 2O01E 1Y57A 2BZ8A 4JRQA 2D9TA 3QDFA 3A8GB 3GNFB 3V7RA 5C0MA 2XU8A 2LQ8A 2VVKA 4LUDA 3SB2A 3JCMP 1B34B 4QVDA 1N8RU 2DRMA 4WCIA 3EGDA 5CR2A 3I35A 2FRYA 2BUDA 3X20B 3CC7A 3HPWA 3CC2Q 2DZ9A 1KFZA 4FCYA 1WX6A 3MP6A 1YCSB 4C0FA 3BDLA 1Y96A 1FYNA 1ZQ1A 2QEXQ 1BI3A 4HKEA 1UG1A 3META 3MEUA 3ZL7C 3TREA 4E7IA 1Q81C 3GNGA 2EFIA 2L0AA 3SDZA 1VQ9A 5M9OA 2CP5A 4RCBA 4C0DB 2CDTA 3CBMA 4KGVB 3S6WA 4M7DB 2L89A 3L42A 1M3BA 5GMKm 3I9QA 1WA7A 3CCLQ 3PFSA 1G3WA 5GAN4 4M75D 2LQWA 5FW9A 1VQ5A 2QK0A 3OYNA 5KCHA 2DD4A 4OP0A 1PCXA 2RN8A 1XOVA 3FC3A 3U23A 2DL7A 1VYVA 3CXCA 3QWYA 1BU1A 1VIFA 3G71A 3QIIA 1QCFA 2EGEA 2EYXA 2IVWA 1Q82R 2PUOB 3CCMQ 3QZ5B 1IZ6A 1QMCA 5J26A 4BI8B 2OTLT 4M7AB 4E6RA 4MMLA 4FM4B 1Q81R 1K8AC 2XDPA 4JS5A 4CC7A 2CP7A 3LX7A 3R6NA 2W0ZA 2OJ2A 3SWNA 1JRIA 2DNUA 1IGUA 2E6NA 1YITQ 4JJNK 3EG9A 1YCYA 2CT3A 1QP3A 1NEGA 4QQGA 5DY9A 2F69A 4OF1A 1WJRA 3JCMW 3CPWP 1VQ4T 3C95A 5CO7A 1U1SA 2EKOA 3JCMJ 3I5RA 3M5AA 2B8AA 2DILA 4DA4A 1ZSZA 1ZSGA 2O31A 2KROA 2DVEA 1QVGA 1W4SA 4C8QC 2DXCA 1M90R 5CKEA 2JM9A 4A53A 2L2PA 1K76A 3SHWA 4XU2A 2WSFE 1D09B 5I22A 1VQLT 2LMJA 1M27C 5C6SA 4PJOG 4C8QG 2GGRA 3N5BB 3MPUB 1RLPC 1YJNA 2XK0A 4F7UG 1YJWQ 4ZN1A 1T3LA 2LVMA 2QQRA 1ZLMA 1C1AA 4R0KA 2QGGA 4VUBA 3BE3A 5FU7B 1JEGA 1YI2T 4PFPA 5KYNA 3DKMA 1X6OA 3WXMB 4DBQA 4QVCA 4PKCC 3I55A 2B86A 1Q7YC 2XMFA 1YP5A 3CCQQ 1JU5C 4BE2A 2EVRA 4QKUA 2FB7A 4C92D 1OULA 2QAZA 2RHYA 4XTWA 1MMDA 3VRZA 3CEYA 2CUBA 4J9GA 1M5Q1 3CC2T 1GFCA 4M77D 4RKUE 4YTLA 2KY9A 3OS1A 5KYUB 4TVRA 1SHGA 5KE2A 1TU0B 3NTHA 5L23A 2EQUA 5D6WA 3V8LA 5GAMe 2NUZA 5IHNA 2DL5A 1T0JA 2YSQA 2CSIA 1BB9A 2A3LA 3PE0A 3SFMA 1TTHB 2BE7D 1GCPA 2L5QA 4LD6A 4QW2A 1YHQQ 4OGCA 2RI2A 3QPHA 1VQKQ 4PJOE 3H0FA 4C8QE 1H3ZA 5ECAA 2MOXA 5CQXA 2COYA 1VQ6A 2KXDA 4ELYC 2RQTA 2CP6A 1M1KU 2GFAA 3URGA 4XU0A 3CCJA 2KGTA 1WLPB 1GRIA 4PJLA 2XICA 2EJ9A 2DZCA 3MEWA 5IHIA 4LDVA 1C0MA 4MMKA 1M1GA 2EJFA 3CCMT 1QW1A 2KMTA 3EGXB 2R5AA 1QCOA 3JB9D 3CC4Q 2LDMA 4PJJA 2D0NA 2QG9B 3PVQA 1UUEA 1YITT 3CXCP 5LJ3j 5LL6S 4C0DC 3O5ZA 4EPCA 4M7DC 1H641 2DETA 3EH1A 3PTAA 2ROLA 5I21A 1YWOA 2XHCA 5CKFA 4O5VA 2ZPEB 1KQSS 4M7DG 4GBQA 4E7HA 1OPLA 2DE0X 1ACMB 3OYBA 2PVOB 1ZBXA 4M78D 3G6EA 5CVIA 2LX7A 6AT1B 2YWWA 4PJMA 4A4KA 3WVEB 4XTZA 4JRIA 3C12A 4ZN3A 1K73C 4M7AC 1GBRA 2X4XA 2HZYA 1YJWT 1QVGP 3OYKA 1TOVA 4GLMA 4J9DA 3QXEB 3SEMA 4CRIA 1M2VA 4JJCA 4XU3A 2AZVA 3CD6Q 3QG1A 4LNPA 1X43A 4LDXA 2K2MA 1GCQC 1TXQA 4ZGEB 2O88A 2VGNA 2R58A 4BE0A 1JJ2A 2YDLA 2CS7A 2QQ9A 1BI2A 4OB1B 2CZ0B 2NUTB 3E2UA 3CCQT 2QA4T 2LC4A 2EQJA 5CIUA 1VQNA 2A7YA 5FROA 3L2VA 3FJ5A 1N9RA 4AMCA 4C0GA 1WJQA 2E5KA 3H41A 1UB4A 3PMIA 2V8IA 3EFSA 5GAMg 5LJ5e 2M16A 1OEBA 5I2MA 2E41A 2HCKA 1KC8U 3CMEA 5I11A 4PLLA 2DXTA 2QGFB 1VQ7A 4AG2C 4ZNXA 4FT2A 2YRDA 4XU1A 2E64A 2J6FA 1RUWA 3CCEA 5HY6A 1SSFA 4J9EA 4BDZA 1VA7A 3RMSA 3JCMV 5GAMj 2QI2A 5FU7C 2FVUA 1TWBA 2QDYB 5IXFA 1YHQT 2MPXC 2KDSA 4EMKB 1QCNA 5AYFA 2YUOA 1D0ZA 3AT1B 4JZ4A 2EYZA 4K11A 4ME7A 1HK9A 1I5LA 4LDWA 3M55A 2PNIA 2DKGA 1YIJA 2E6ZA 2EAYA 5KYYB 3OW2S 2VUBA 3OYJA 4AFSC 1XJWB 4BI3A 1N27A 4M75A 3AHUA 4PJOB 4C8QB 3I56A 4D8DA 1YNZA 3EHQA 1AEYA 1UGPB 4F7UB 5GANh 5GAOq 2J6KA 4X9DA 1O9SA 4L5GA 2E10A 4LDYA 4JZ3A 3CC4T 2DTHA 4WF2A 4OB2B 1NEBA 2FPFA 1SF9A 2K9GA 2FPEA 4MDXA 3VS6A 4RTVA 5GAMf 3PIPA 2LTOA 3CMAQ 4E7JA 4IIOA 2M0YA 3RESA 4J9CA 4EIKA 4J5YA 2JJ9A 4KULA 1S72Q 1OPKA 1HJDA 2P4RA 3LLRA 2RQVA 3REBB 1PSEA 4E47A 4A4GA 1RAGB 1YN8A 1QKXA 4QQDA 3JB9F 4KGXB 1QVFA 4M7DF 2FZGB 1Q86C 1HXDA 1ZHIA 2BKDN 3J81E 1LOJA 4JPBW 4NOYA 3HL8A 1I81A 1K9MR 3P8BB 3EFOA 1F1BB 2I0NA 2DM1A 1VQ8T 3VS4A 1OYXA 4UC4A 3QYGB 1FMKA 3L2QA 4JJBA 4KH1B 4ORZA 1IXDA 1V76A 1NJIU 1Z9QA 3S3OA 1JXOA 1VQLQ 4LDUA 2EQIA 2ZPBB 1PC0A 2NUPA 4RTUA 3HP9A 3HKSA 2BTTA 2DL4A 2C0TA 1VQMA 2D6FA 2D8JA 1WPYA 4M7AF 4KH0B 2HNIA 3ME9A 4MZPA 2KSSA 3HFNA 4R55A 1WHMA 4OMMA 5GMKh 5LJ5g 2QTXA 3QHSA 1YI2Q 2OTJT 3EGDB 5GMKe 3DB4A 1SRMA 2RH2A 1G8XA 1WHLA 3FRNA 7AT1B 2DIQA 2DPPB 4GY5A 1M8VA 2LNVA 2DBKA 2HAXA 1Q86R 2FZKB 1VQ9Q 2LQKA 1D1BA 3TEEA 4C92A 3X28B 2XD0A 3CCSA 4Y92A 5CQYA 1JJ2P 2KYBA 4XTYA 4AT1B 5EG2A 1Y96B 1D3BA 3M0TA 5HK0A 2P0QA 3VS3A 1ZUYA 2DAQA 2K3BA 4Z89A 3VS0A 4M77A 1H92A 4WTOB 1V29B 1VYTA 3KUFA 3NHNA 3RKWA 1T3SA 1UHFA 2EQKA 2E70A 2FZCB 1VQ5Q 1IO6A 5HK3A 2LQNA 4HVWA 4E2FB 2M1HA 1R0CB 5IH2A 3QKJA 2RK2A 2MIOA 2K79A 1XQHA 2GNCA 3H8ZA 3OB9A 1PRMC 1YJ9Q 2MAMA 3CCRQ 4BACA 3BDUA 1K4US 2K3YA 4JJDA 3OYYA 1TG0A 3GLXA 3UF4A 5GANd 3NTKA 5J3BA 5GANg 2PUKB 1NG2A 1YWPA 4IUTA 1V1CA 1LPLA 1MGQA 1W6XA 1IB8A 3UWNA 1D1AA 4EMHA 3UT1A 1IGQA 3VV0A 3A98A 2F2VA 3RNJA 1TSFA 5DLQE 4QT7A 4EMGA 3OYGA 3LH0A 2ZPFB 3M4GA 5LJ5f 1W2BS 2O4XA 2NWMA 3CC2A 2J6OA 3SWNB 1VQOA 3PVLA 2YUNA 2W10A 3RR6A 5KYXA 2VV5A 3EG9B 2JS2A 3C94A 1Q82U 1ZBJA 4XTUA 2QEXA 1KQ2A 1MMNA 1Q81U 2K4YA 2ED1A 4KGZB 3CMAT 8AT1B 4B9XA 4EMKC 2KYMA 1NPRA 2RJEA 1VQPA 1S72T 4JLIA 4DBFA 4A54A 1WI7A 2JT4A 1G3SA 5D6YA 5LJ3h 4C8QD 2QDLA 2LCSA 1PD0A 2L3PA 4RTWA 2ZCFB 3VJPA 3NGPA 3ASKA 3VS5A 3CCLA 3OMCA 2P4TA 1WHHA 1ABOA 1XNIA 2A0FB 2K7AA 2RNAA 4M78A 1HD3A 3CBOA 3E1SA 4PJOC 3NTIA 2K2VA 3GP8A 3QYHB 2YT6A 4AFUC 1QVFP 1M90U 3M0RA 4N0AA 3CBPA 1VOMA 1JBMA 5CKHA 3EG1A 3JCMc 3UPUA 1FWZA 3TVTA 3HTRA 3BW1A 2O2OA 1K8AR 3EG2A 3CC7T 2JM8A 4MZMA 3CCVQ 5FRNA 2HQEA 2CYZB 2MWOA 4N4IA 5J39A 3LYIA 1NPPA 2EW3A 3P8HA 1RACB 5GJWB 1AWOA 5AT1B 3H0HA 2ESWA 1VQ9T 2RHIA 1KD1C 2K3XA 3OBYA 2QA4Q 5KYWA 3GOXA 3S3MA 2RJDA 1U06A 4HCKA 1N5ZA 3M0QA 1SEMA 2C0OA 2ZPHB 2E5QA 4QQ6A 5GAN7 1PWTA 4X1VA 3M0PA 3HRSA 1AD5A 2PTKA 2RO0A 4FSSA 1PSFA 3CCJQ 3RKYA 2XDDA 2ROTA 1VQ5T 4M75E 2AIRB 4JRPA 2JXBA 3JCMb 2YRCA 3PNWC 3V8KA 2EPDA 2DEQA 2DO3A 2DJZA 3V7SA 4OMPA 1AWWA 5IAYA 1YJ9T 4JLGA 3CCRT 3M56A 4A4EA 1Q7YR 1KD1R 1WXUA 2JNGA 5FU6C 3ZFJA 2E1HA 2L3RA 3H6ZA 3VUZA 2HEQA 1P92A 1FX7A 1H8KA 4C5HA 5KYUA 4E7KA 1ZUUA 1WGSA 1AZEA 2KR3A 4II1A 2FG0A 2Z0WA 5FWCA 1M3AA 4IUUA 2JW4A 1UGVA 3OS5A 4BUGA 5FRMA 1BCOA 3QUIA 4IUPA 2RF0A 4C5GA 4M7DD 5LJ3d 3P8DA 3G6EQ 1C6VX 3QZ9B 1TUDA 4IUVA 4LD9K 2A28A 3A8MB 4OGEA 4PLIA 3UA7A 3JSCA 1SPKA 4J6WA 1YJNT 1LNXA 1KQSA 2MF2A 4OMLA 1JO8A 1AT1B 1X2QA 1VQKA 3FIFA 1ARKA 5GAOl 1CKAA 1PNJA 3JB9H 2H8HA 1TH7A 2DVJA 2X9HA 3JCMQ 2KQWA 1G83A 2OAUA 1D0YA 1MNEA 2D1XA 1TS9A 2EIFA 3L1AA 3CCUQ 1I5OB 3I55T 5GAN2 2P0PA 1YFNA 1SHFA 2KVQG 3MKDA 4M7AD 2FL7A 1OX8A 1WQ7A 1N6AA 4PK4A 3OS2A 2DEUA 2I2LA 4RUGA 1M2VB 4E7SA 2X3XD 4M4ZA 2CKKA 5FLXE 1VQ8Q 3SWNC 2COWA 2KE9A 1X01A 4A63B 2RM4A 2HSEB 4C92E 3MEAA 5A0DA 1BKBA 3UA6A 3HRTA 3OSSC 1WHGA 4PJOF 4J6XA 4C8QF 2YHTA 1FMVA 3E9FA 3JCMh 4F7UF 3CCVT 5GMKi 2AT1B 3CMEQ 1KC8C 3CC4A 3JCMe 4M77E 1MHNA 2GTJA 1AZGB 1IREB 4XQ3A 2LNHB 2DL3A 5GAN6 2QYZA 2SRCA 5D7UA 2SEMA 2KXCA 3NMZC 1ZSZC 1VYUA 5D6XA 3CCEQ 1UECA 2MWPA 2OTJQ 3OY9A 3FJPA 2K5IA 1FMWA 3G4SA 2EYQA 1RI0A 1NYFA 1WXBA 2JUFA 2DTOA 1VUBA 1ZA1B 3A1PA 4M78G 4RTTA 2M9UA 4DOVA 1VQ6T 2BZYA 1KHCA 2XIDA 3QBYA 2DYIA 3BFMA 2HKQB 1OU8A 1YIJQ 4JDSA 1FXXA 1YBYA 1NLPC 3CCJT 1VIEA 1K73R 4E7LA 2CZ6B 3OYLA 1QLYA 4D6WA 1UTIA 1R77A 2G3RA 2IIMA 4IUQA 2FYKA 5CK9A 1BIAA 2K5FA 3I56Q 1QVPA 2PU9B 3FLGA 3LGFA 4N4GA 1W70A 1X6GA 3CD6A 4RTZA 1EIFA 1K9AA 3JB9J 3OW2A 3A5ZB 4M75B 1S1NA 3WVDB 2RHUA 3L2RA 3ER0A 4ATOA 1MV3A 3JCMX 1RAAB 4J9IA 4LXCA 3OYCA 1JXMA 2LT1A 4D8KA 2CSQA 1M9SA 5KH6A 3RDVA 3QJYA 2FPDA 4DBHA 3HSBA 4KRTA 1Q95G 2JTFA 4HCZA 3NFCA 5GANe 2K57A 1OI1A 3T9NA 4OB0B 2HQHA 3G6ET 2L3QA 2MCNA 3EG3A 2AZSA 4M78E 1I4K1 2E3HA 2YUQA 5A2QE 2MI6A 2E12A 2J05A 3X26B 2GBQA 1ZUKA 3SD4A 1RAEB 3CQTA 3G7ZA 2YLCA 3EFOB 5IXBA 2WSCE 2DERA 1B07A 1VQMQ 2RI3A 1KK7A 4F7UA 4C5EA 3CCUT 5A0GA 3J80E 1UEBA 1UHCA 3JCMd 1IHVA 3INZA 1TUGB 2VB6A 3RUXA 1KQSP 2FEIA 3JCMg 4F17A 3CPWS 1VQNT 5GAN8 1K9MU 4ZGJB 1MV0B 4CI0C 1RL2A 3RIRA 3JB9I 2YUPA 1U5SA 1WQWA 1N8RC 3CCSQ 2KT1A 5IT9E 1UE9A 3CMET 1NYGA 3GIBA 3UDCA 3CC7Q 1I1JA 3M4YA 2HL5C 1VQ7T 2OTLA 2HSPA 1R8OB 2NLUA 4RTXA 1BCMA 4DEYA 2RQRA 4C92B 2RD1A 2HL3A 3CCET 1Z9ZA 2ENMA 4MDWA 4AG1C 1D3BB 2VXFA 3V7CA 1G2BA 1U8RA 1S72A 1Y71A 1OX9A 3JV3A 2DD5A 5FU6B 2RHZA 4DOWA 3HHTB 4J7FA 3JRZA 1QWFA 1VQ4A 2BIVA 4PFZA 4JS4A 1Q86U 1GL5A 2X35A 1PHTA 2YXYA 2LX9A 2GF7A 1YIJT 5LJ5j 5GAN3 3D7SB 1N8RR 4BY6C 3OQ5A 2FRWA 1RABB 3OS0A 3LWHA 3A8HB 3C0CA 3TU4K 5GMKl 2DBMA 3FDRA 3I56T 1D0XA 3X24B 1VQLA 1X2KA 1HSQA 1VQOQ 4J9BA 1NM7A 3JCMf 3G71Q 1B34A 2X4WA 4ZTFA 1AWJA 1BK2A 3V8JA 2OAWA 3L2WA 1Q82C 2JMAA 1YI2A 2DX1A 3A8LB 3VS1A 4P5NA 4IIMA 2CP0A 3M53A 2YLBA 1MMAA 2LRQA 2O4XB 2EJGA 3M57A 1VQPQ 1ZA2B 2F1LA 1U3OA 2QXFA 1W2BA 3OW2P 5KYXB 2KRNA 2A08A 1SRLA 3EHRA 3M59A 1J3TA 1UFFA 4J7IA 5KCOA 1JQQA 3GPLA 2KAFA 2DTIA 4PJNA 4O6JA 1RAHB 1M2OA 1RAIB 1Y0MA 1M8MA 5GANj 2VASA 2F2WA 5CCAA 4M7DA 2CZ7B 1UGQB 2RQWA 8ATCB 4NL3A 1KIKA 4OMQA 3C4SA 2RI5A 2OX7A 4PNOA 1QP2A 2A37A 1M90C 4BI4A 2JOYA 3RERA 5GJVB 2ED0A 2LP5A 2X51A 4M75C 1RAFB 2HBPA 3PIOA 1ZSZB 3LWIA 4L6V5 4ESRA 5GAOp 3OBWA 1YJ9A 1EX4A 4M78B 1YJNQ 4ANJA 3CCRA 3MHXA 1VQMT 3OYHA 3LH5A 4PJOD 4XTXA 4HT8A 3G1JA 3Q1JA 1K0XA 3CXCS 2QTVA 4RG2A 4F16A 5LJ3e 2P84A 2IG0A 1BI0A 1KJWA 1NZ9A 2RJFA 4M75G 3H0IA 4RG8A 2HD0A 3NPFA 2EKHA 2M02A 2ATCB 3I55Q 4HCCA 2CT4A 4M7AA 2O9SA 2JMCA 4DEXA 4HCBA 4FSXA 1DJ7B 4XK8E 4J8OA 2DJQA 3I5SA 3RBBB 4KT0E 3CCST 3KXTA 1Y7XA 1I8FA 2EGAA 2AHJB 1GCQA 2CP3A 2E3IA 2R5MA 1RLQC 1BIBA 1OQKA 2DLPA 2DK3A 3MJXA 2QASA 3EAEA 1G5VA 1PM3A 5GANf 3CCMA 1WIEA 4PFOA 1I0CA 2ZPGB 1QQJA 1K8AU 1MMGA 1AVZC 2QQAA 3MCAB 2JZ2A 3E9GA 2PVDB 2EYYA 5KYWB 3GBQA 2DMOA 1G3YA 3QWXX 2KBTA 2GQIA 1QWEA 1YITA 1QVGS 1B3QA 2JS0A 2HKNA 3R6OA 5KE3A 1LJOA 4J83A 2DXUA 3O8VA 5DLOA 2G6FX 5GMKj 4GLKA 3VKIA 4PL6A 2GTOA 2KT8A 3UATA 4XAXB 3M0UA 1KHIA 1BYMA 4CC4B 3J7AF 5FWBA 5I2SA 3TSWA 1M30A 1VQ6Q 2JN0A 2LJ0A 4NL2A 2LT4A 2JTMA 1MNDA 3LW5E 3F70A 2VGMA 1M1KC 1K0SA 4OMOA 1G3TA 4F14A 4L59A 4LUEA 1U1TA 3S3NA 3VYGA 2BZXA 2X4JA 2EBPA 3EH2A 1KG1A 2WACA 1VQOT 1X69A 2LCLA 4ZGDB 3CCVA 1YJWA 2HBWA 3OYIA 3G71T 2P0KA 3LGLA 2ZZDA 2PQWA 3HFOA 4C92C 2XG8D 3ZEHA 4DQ2A 4C0ZA 3VS7A 4BDYA 1X6BA 2QEXT 1N9SA 5GAMh 4IURA 3RKXA 1Q7YU 4M77C 3H9NA 2F2XA 4JUVA 1VQPT 1KD1U 4C92G 3CCQA 2QA4A 2D8HA 3KBGA 2QQBA 2KEAA 1ABQA 1JB0E 1XTDA 1H3HA 4BB7A 2RPNA 4Y28E 4RTYA 1E7OA 3VUBA 2AKLA 4M77G 3M9QA 2RB6A 2E4HA 1M1KR 3TQ7P 3CCLT 4F7UE 2JVVA 3L2UA 2MMPA 4V2SA 1X75C 4J9FA 1W2BP 3ULRB 3X25B 4FT4A 5GAOn 4RMOA 4FW2A 1OZ3A 2VXEA 5CKBA 2YRVA 2FHDA 3EG0A 5LJ3g 2ABLA 2ECZA 3QJ6A 4BE1A 4HVUA 3EGUA 4HT9A 4FYXB 1W1FA 2LCCA 2RA2A 2FO0A 2CH4W 4X34A 1YHQA 2RMOA 2C06A 2CUDA 4B9WA 1WJSA 4KUIA 1OV3A 5GAN5 2DA9A 1Y07A 3PMTA 4M75F 1QKWA 1OOTA 2ZAEA 4CC3A 3EGXA 5A0LA 2DL8A 4E7ZA 2OI3A 1EFNA 2KRMA 2VYTA 2PZ1A 2O9VA 2R57A 1VQNQ 3G4SQ 2A36A 1KQ1A 4Q5WA 2H3JA 2RJCA 1EZZB 3DLLA 4FYYB 4CC2A 4Z02A 4BY6B 4Y91A 5GAOr 4FYWB 3OYFA 1WFWA 2VKNA 3DB3A 3JB9G 3TCJA 2H3EB 1PKSA 2ZGWA 3M0SA 1ZX6A 1M1FA 4R56A 1PG5B 1OZ2A 2VC8A 1OU9A 5CKDA 4B6MA 2RQUA 5CAIA 1VQ7Q 5GAOm 2V1QA 2V8JA 2F5KA 2CP2A 2DRKA 3ZBDA 5DM7R 4QVZA 2GFUA 2AKKA 4M78C 4A4HA 2AK5A 2J06A 4OMFB 4Z8AA 4OB3B 1GFDA 1WNLA 3OYEA 1IHWA 1NLOC 1PKTA 1UGSB 4N0AC 1K1ZA 2V8KA 3REAB 2LJ1A 1X27A 2D0QB 4JRKA 4LE9A 5LJ3f 4M7AG 3CCUA 4FW1A 4LN2A 2XI9A 3OSVA 2J7IA 2DIGA 3PT9A 1SSHA 4EDUA 2CGHA 2X4YA 2L8DA 4OVAA 4N4HA 4KBMB 3JAME 1VQ8A 1JJ2S 4MZTA 1LVKA 1UDLA 2WSEE 5GAMd 3OYAA 5LJ5h 1BBZA 1K73U 2M51A 1KC8R 1WYXA 3VU3C 3M58A 3OYDA 3THKA 1MUZA 2XDBA 2Y90A 2NUTA 3GF5A 3PGGA 3HRUA 2LJ3A 4J9HA 1WHJA 4M7DE 2VWFA 4Z88A 2Y4YA 4FL6A 3M54A 1WDXA 1WZOA 3VS2A 3EFRA 2BE9B 2EWNA 4C92F 2OTJA 1IRXA 1GBQA 2HDAA 1TUCA 2EQMA 1WHKA 1PD1A 1HYOA 2QQSA 3OA6A 1AOJA 3L2ZA 1VQKT 4M77F 3CPFA 2PVGB 2F5TX 1SG5A 2V1RA 4A4FA 2M0OA 1LCKA 1RI9A 4ELZC 1UJ0A 2ZPIB 1SKUB 4XTVA 2CZ1B 2K6DA 4F04B 5L8RE 4C5IA 5EC7A 4IKFA 1A0NB 1UJYA 4EMKA 4FYVB 2NYSA 4M7AE 2DYBA 4RCCA 4DBRA 2HMAA 1K9MC 3FEOA 2RK1A 3A8OB 2Y4XA 1CKBA 5KYYA 1E6HA 3MEVA 1NJIC 2X3WD 1R0BG 3E19A 2MK5A 1BI1A 1PRLC 4KUDK 2GQVA 4AFZC 3BY7A 1AHJB 2JTEA 1I07A 2DF6A 2OTLQ 4PJOA 5IN1A 4C8QA 3CPWA 1CSKA 2COZA 4ZTJA 2DXBA 4NS5A 3DLMA 2L3SA 4HXJA 1O75A 4J6YA 2XKOC 1B7TA 3MP1A 1M3CA 3G4ST 4HA8A 2NUPB 1M4ZA
chains in the Genus database with same CATH topology
1Y0MA 1M8MA 2EPDA 2F2WA 3KFVA 1WXTA 2YDLA 3VRYA 1E6GA 2C0IA 4OMPA 1AWWA 1T0HA 4AFQC 2RQWA 1KIKA 4OMQA 2LZ6B 2A37A 3FJ5A 2E5KA 1WXUA 3H41A 3TSZA 3IQLA 2KNBB 5GJVB 2ED0A 5HCKA 2LP5A 2CH4A 2CREA 4ESRA 1OEBA 2HCKA 2HEQA 1H8KA 3LH5A 5I11A 1K0XA 4F16A 1ZUUA 1KSWA 1AZEA 2EYWA 1KJWA 2KRSA 4AG2C 2KR3A 4ZNXA 1AWXA 2FG0A 3H0IA 3NPFA 2EKHA 4HVVA 5IHKA 5FWCA 1M3AA 2CT4A 2JW4A 1UGVA 2J6FA 2O9SA 1RUWA 2JMCA 4DEXA 4OMNA 2EGCA 2RF0A 4J9EA 2DJQA 3I5SA 1VA7A 3RBBB 1Y57A 2BZ8A 5IXFA 2EGAA 1GCQA 1RLQC 1TUDA 2DLPA 2VVKA 4LUDA 2A28A 1WIEA 2YUOA 1I0CA 4JZ4A 3UA7A 2EYZA 4K11A 1SPKA 2DRMA 1AVZC 4WCIA 2PNIA 4OMLA 1JO8A 2EYYA 3I35A 2FRYA 3GBQA 1X2QA 2DMOA 3QWXX 1ARKA 4AFSC 2KBTA 2GQIA 1QWEA 1CKAA 1PNJA 1B3QA 2H8HA 2JS0A 2DVJA 1G83A 1KFZA 2D1XA 2G6FX 1WX6A 4D8DA 1YCSB 1YNZA 3EHQA 1AEYA 2GTOA 2KT8A 1FYNA 1SHFA 2J6KA 3UATA 3M0UA 1UG1A 4CC4B 3ZL7C 4RUGA 4JZ3A 2X3XD 4M4ZA 2L0AA 5FWBA 2KE9A 4A63B 3TSWA 1M30A 3UA6A 1NEBA 2LJ0A 2FPFA 2K9GA 2CDTA 2FPEA 1K0SA 4OMOA 4RTVA 3VS6A 1M3BA 4F14A 4IIOA 2M0YA 4J9CA 2GTJA 1AZGB 3I9QA 4LUEA 4EIKA 2LNHB 1WA7A 2DL3A 1OPKA 1HJDA 2SRCA 2P4RA 2BZXA 2SEMA 2EBPA 2KXCA 3NMZC 2RQVA 3REBB 1X69A 1VYUA 1YN8A 1QKXA 2HBWA 1UECA 2LQWA 5FW9A 2RN8A 1XOVA 4JPBW 3U23A 3VS7A 1X6BA 1NYFA 2DL7A 1WXBA 2I0NA 1VYVA 3QWYA 1BU1A 1QCFA 2DM1A 2EGEA 2EYXA 2F2XA 4RTTA 3VS4A 4E6RA 1FMKA 2BZYA 4JJBA 4ORZA 2D8HA 2KEAA 1ABQA 1Z9QA 4CC7A 1H3HA 2RPNA 1NLPC 4RTYA 1E7OA 1JXOA 3R6NA 2W0ZA 2OJ2A 2AKLA 2DNUA 2EQIA 1QLYA 4RTUA 1UTIA 2IIMA 2CT3A 2BTTA 2DL4A 2C0TA 1NEGA 4J9FA 2D8JA 4OMMA 3ULRB 3I5RA 1SRMA 2DILA 1W70A 1X6GA 3EG0A 4RTZA 1K9AA 2ABLA 2ECZA 1ZSGA 2DBKA 2O31A 4HVUA 2KROA 1S1NA 3EGUA 1W1FA 4Y92A 2FO0A 2JM9A 2KYBA 2CH4W 2L2PA 2RMOA 3M0TA 1K76A 3SHWA 2CUDA 1MV3A 3VS3A 1ZUYA 2K3BA 4Z89A 3VS0A 4J9IA 1OV3A 2DA9A 5I22A 1H92A 1JXMA 2LMJA 1VYTA 1M27C 1QKWA 4D8KA 3NHNA 2GGRA 2CSQA 1T3SA 1UHFA 1RLPC 1OOTA 4CC3A 1T3LA 2DL8A 2FPDA 2OI3A 1IO6A 1EFNA 1ZLMA 4R0KA 4KRTA 2KRMA 1JEGA 2LQNA 2PZ1A 2O9VA 4HVWA 2A36A 2L3QA 2MCNA 3EG3A 2AZSA 5IH2A 4CC2A 2MIOA 2K79A 2GNCA 2YUQA 1WFWA 2B86A 2VKNA 1PRMC 1PKSA 2XMFA 1YP5A 2J05A 3M0SA 2GBQA 1ZX6A 1JU5C 1K4US 1ZUKA 2EVRA 4JJDA 1TG0A 3UF4A 3CQTA 2RQUA 3VRZA 2CUBA 2V1QA 1NG2A 1YWPA 4J9GA 1V1CA 5IXBA 2DRKA 1W6XA 1GFCA 1B07A 2AKKA 3A98A 2F2VA 3RNJA 2AK5A 2J06A 4Z8AA 4QT7A 1GFDA 1UHCA 1SHGA 1NLOC 1PKTA 2FEIA 4F17A 5L23A 1K1ZA 2NWMA 2J6OA 3REAB 3PVLA 2LJ1A 1X27A 2YUNA 2W10A 4LE9A 1MV0B 2NUZA 5IHNA 4LN2A 2DL5A 1T0JA 2JS2A 2YUPA 2J7IA 2YSQA 1U5SA 1SSHA 2CSIA 1BB9A 3PE0A 1ZBJA 2KT1A 1UE9A 1GCPA 1NYGA 2ED1A 3H0FA 1I1JA 5ECAA 2MOXA 2KYMA 1UDLA 2HSPA 2KXDA 1BBZA 4RTXA 2M51A 2RQTA 4DEYA 1WYXA 2RQRA 3THKA 1MUZA 1WI7A 2JT4A 2QDLA 1Z9ZA 2ENMA 2LCSA 2L3PA 2KGTA 1WLPB 4RTWA 4AG1C 1GRIA 3NGPA 1G2BA 2LJ3A 3VS5A 3JV3A 5IHIA 1ABOA 4J9HA 2VWFA 2K7AA 4Z88A 2RNAA 1WDXA 1HD3A 1QWFA 3VS2A 1GBQA 2HDAA 1GL5A 2YT6A 1TUCA 4AFUC 1PHTA 3M0RA 2D0NA 3EG1A 3PVQA 1UUEA 1AOJA 3TVTA 2O2OA 3EG2A 2FRWA 2JM8A 2V1RA 1LCKA 1RI9A 3O5ZA 3C0CA 2DBMA 1UJ0A 2EW3A 2K6DA 5EC7A 1A0NB 1UJYA 1X2KA 2ROLA 1HSQA 5GJWB 1AWOA 1YWOA 4J9BA 2DYBA 1NM7A 3H0HA 2ESWA 1AWJA 1BK2A 4GBQA 2OAWA 1OPLA 2DE0X 1CKBA 1E6HA 2JMAA 2DX1A 1U06A 2X3WD 3VS1A 2LX7A 4HCKA 1PRLC 4IIMA 1N5ZA 3M0QA 1SEMA 4AFZC 2JTEA 2C0OA 1I07A 2DF6A 1U3OA 1PWTA 2KRNA 2A08A 4X1VA 1CSKA 3M0PA 1AD5A 1GBRA 1SRLA 3EHRA 1J3TA 2PTKA 1UFFA 4FSSA 2L3SA 4HXJA 1JQQA 2ROTA 4GLMA 4J9DA 3SEMA 2JXBA 4JJCA 2AZVA 4LNPA 1X43A 1M3CA 2K2MA 1GCQC 2O88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0M A;  1M8M A;  2EPD A;  2F2W A;  3KFV A;  1WXT A;  2YDL A;  3VRY A;  1E6G A;  2C0I A;  4OMP A;  1AWW A;  1T0H A;  4AFQ C;  2RQW A;  1KIK A;  4OMQ A;  2LZ6 B;  2A37 A;  3FJ5 A;  2E5K A;  1WXU A;  3H41 A;  3TSZ A;  3IQL A;  2KNB B;  5GJV B;  2ED0 A;  5HCK A;  2LP5 A;  2CH4 A;  2CRE A;  4ESR A;  1OEB A;  2HCK A;  2HEQ A;  1H8K A;  3LH5 A;  5I11 A;  1K0X A;  4F16 A;  1ZUU A;  1KSW A;  1AZE A;  2EYW A;  1KJW A;  2KRS A;  4AG2 C;  2KR3 A;  4ZNX A;  1AWX A;  2FG0 A;  3H0I A;  3NPF A;  2EKH A;  4HVV A;  5IHK A;  5FWC A;  1M3A A;  2CT4 A;  2JW4 A;  1UGV A;  2J6F A;  2O9S A;  1RUW A;  2JMC A;  4DEX A;  4OMN A;  2EGC A;  2RF0 A;  4J9E A;  2DJQ A;  3I5S A;  1VA7 A;  3RBB B;  1Y57 A;  2BZ8 A;  5IXF A;  2EGA A;  1GCQ A;  1RLQ C;  1TUD A;  2DLP A;  2VVK A;  4LUD A;  2A28 A;  1WIE A;  2YUO A;  1I0C A;  4JZ4 A;  3UA7 A;  2EYZ A;  4K11 A;  1SPK A;  2DRM A;  1AVZ C;  4WCI A;  2PNI A;  4OML A;  1JO8 A;  2EYY A;  3I35 A;  2FRY A;  3GBQ A;  1X2Q A;  2DMO A;  3QWX X;  1ARK A;  4AFS C;  2KBT A;  2GQI A;  1QWE A;  1CKA A;  1PNJ A;  1B3Q A;  2H8H A;  2JS0 A;  2DVJ A;  1G83 A;  1KFZ A;  2D1X A;  2G6F X;  1WX6 A;  4D8D A;  1YCS B;  1YNZ A;  3EHQ A;  1AEY A;  2GTO A;  2KT8 A;  1FYN A;  1SHF A;  2J6K A;  3UAT A;  3M0U A;  1UG1 A;  4CC4 B;  3ZL7 C;  4RUG A;  4JZ3 A;  2X3X D;  4M4Z A;  2L0A A;  5FWB A;  2KE9 A;  4A63 B;  3TSW A;  1M30 A;  3UA6 A;  1NEB A;  2LJ0 A;  2FPF A;  2K9G A;  2CDT A;  2FPE A;  1K0S A;  4OMO A;  4RTV A;  3VS6 A;  1M3B A;  4F14 A;  4IIO A;  2M0Y A;  4J9C A;  2GTJ A;  1AZG B;  3I9Q A;  4LUE A;  4EIK A;  2LNH B;  1WA7 A;  2DL3 A;  1OPK A;  1HJD A;  2SRC A;  2P4R A;  2BZX A;  2SEM A;  2EBP A;  2KXC A;  3NMZ C;  2RQV A;  3REB B;  1X69 A;  1VYU A;  1YN8 A;  1QKX A;  2HBW A;  1UEC A;  2LQW A;  5FW9 A;  2RN8 A;  1XOV A;  4JPB W;  3U23 A;  3VS7 A;  1X6B A;  1NYF A;  2DL7 A;  1WXB A;  2I0N A;  1VYV A;  3QWY A;  1BU1 A;  1QCF A;  2DM1 A;  2EGE A;  2EYX A;  2F2X A;  4RTT A;  3VS4 A;  4E6R A;  1FMK A;  2BZY A;  4JJB A;  4ORZ A;  2D8H A;  2KEA A;  1ABQ A;  1Z9Q A;  4CC7 A;  1H3H A;  2RPN A;  1NLP C;  4RTY A;  1E7O A;  1JXO A;  3R6N A;  2W0Z A;  2OJ2 A;  2AKL A;  2DNU A;  2EQI A;  1QLY A;  4RTU A;  1UTI A;  2IIM A;  2CT3 A;  2BTT A;  2DL4 A;  2C0T A;  1NEG A;  4J9F A;  2D8J A;  4OMM A;  3ULR B;  3I5R A;  1SRM A;  2DIL A;  1W70 A;  1X6G A;  3EG0 A;  4RTZ A;  1K9A A;  2ABL A;  2ECZ A;  1ZSG A;  2DBK A;  2O31 A;  4HVU A;  2KRO A;  1S1N A;  3EGU A;  1W1F A;  4Y92 A;  2FO0 A;  2JM9 A;  2KYB A;  2CH4 W;  2L2P A;  2RMO A;  3M0T A;  1K76 A;  3SHW A;  2CUD A;  1MV3 A;  3VS3 A;  1ZUY A;  2K3B A;  4Z89 A;  3VS0 A;  4J9I A;  1OV3 A;  2DA9 A;  5I22 A;  1H92 A;  1JXM A;  2LMJ A;  1VYT A;  1M27 C;  1QKW A;  4D8K A;  3NHN A;  2GGR A;  2CSQ A;  1T3S A;  1UHF A;  1RLP C;  1OOT A;  4CC3 A;  1T3L A;  2DL8 A;  2FPD A;  2OI3 A;  1IO6 A;  1EFN A;  1ZLM A;  4R0K A;  4KRT A;  2KRM A;  1JEG A;  2LQN A;  2PZ1 A;  2O9V A;  4HVW A;  2A36 A;  2L3Q A;  2MCN A;  3EG3 A;  2AZS A;  5IH2 A;  4CC2 A;  2MIO A;  2K79 A;  2GNC A;  2YUQ A;  1WFW A;  2B86 A;  2VKN A;  1PRM C;  1PKS A;  2XMF A;  1YP5 A;  2J05 A;  3M0S A;  2GBQ A;  1ZX6 A;  1JU5 C;  1K4U S;  1ZUK A;  2EVR A;  4JJD A;  1TG0 A;  3UF4 A;  3CQT A;  2RQU A;  3VRZ A;  2CUB A;  2V1Q A;  1NG2 A;  1YWP A;  4J9G A;  1V1C A;  5IXB A;  2DRK A;  1W6X A;  1GFC A;  1B07 A;  2AKK A;  3A98 A;  2F2V A;  3RNJ A;  2AK5 A;  2J06 A;  4Z8A A;  4QT7 A;  1GFD A;  1UHC A;  1SHG A;  1NLO C;  1PKT A;  2FEI A;  4F17 A;  5L23 A;  1K1Z A;  2NWM A;  2J6O A;  3REA B;  3PVL A;  2LJ1 A;  1X27 A;  2YUN A;  2W10 A;  4LE9 A;  1MV0 B;  2NUZ A;  5IHN A;  4LN2 A;  2DL5 A;  1T0J A;  2JS2 A;  2YUP A;  2J7I A;  2YSQ A;  1U5S A;  1SSH A;  2CSI A;  1BB9 A;  3PE0 A;  1ZBJ A;  2KT1 A;  1UE9 A;  1GCP A;  1NYG A;  2ED1 A;  3H0F A;  1I1J A;  5ECA A;  2MOX A;  2KYM A;  1UDL A;  2HSP A;  2KXD A;  1BBZ A;  4RTX A;  2M51 A;  2RQT A;  4DEY A;  1WYX A;  2RQR A;  3THK A;  1MUZ A;  1WI7 A;  2JT4 A;  2QDL A;  1Z9Z A;  2ENM A;  2LCS A;  2L3P A;  2KGT A;  1WLP B;  4RTW A;  4AG1 C;  1GRI A;  3NGP A;  1G2B A;  2LJ3 A;  3VS5 A;  3JV3 A;  5IHI A;  1ABO A;  4J9H A;  2VWF A;  2K7A A;  4Z88 A;  2RNA A;  1WDX A;  1HD3 A;  1QWF A;  3VS2 A;  1GBQ A;  2HDA A;  1GL5 A;  2YT6 A;  1TUC A;  4AFU C;  1PHT A;  3M0R A;  2D0N A;  3EG1 A;  3PVQ A;  1UUE A;  1AOJ A;  3TVT A;  2O2O A;  3EG2 A;  2FRW A;  2JM8 A;  2V1R A;  1LCK A;  1RI9 A;  3O5Z A;  3C0C A;  2DBM A;  1UJ0 A;  2EW3 A;  2K6D A;  5EC7 A;  1A0N B;  1UJY A;  1X2K A;  2ROL A;  1HSQ A;  5GJW B;  1AWO A;  1YWO A;  4J9B A;  2DYB A;  1NM7 A;  3H0H A;  2ESW A;  1AWJ A;  1BK2 A;  4GBQ A;  2OAW A;  1OPL A;  2DE0 X;  1CKB A;  1E6H A;  2JMA A;  2DX1 A;  1U06 A;  2X3W D;  3VS1 A;  2LX7 A;  4HCK A;  1PRL C;  4IIM A;  1N5Z A;  3M0Q A;  1SEM A;  4AFZ C;  2JTE A;  2C0O A;  1I07 A;  2DF6 A;  1U3O A;  1PWT A;  2KRN A;  2A08 A;  4X1V A;  1CSK A;  3M0P A;  1AD5 A;  1GBR A;  1SRL A;  3EHR A;  1J3T A;  2PTK A;  1UFF A;  4FSS A;  2L3S A;  4HXJ A;  1JQQ A;  2ROT A;  4GLM A;  4J9D A;  3SEM A;  2JXB A;  4JJC A;  2AZV A;  4LNP A;  1X43 A;  1M3C A;  2K2M A;  1GCQ C;  2O88 A; 
#chains in the Genus database with same CATH topology
 3KFV A;  2DFU A;  1WXT A;  3VRY A;  1VQ4 Q;  1E6G A;  1UGR B;  2C0I A;  2IPO B;  2HQX A;  3QO3 A;  2KI7 A;  1T0H A;  3VYH B;  4AFQ C;  2LZ6 B;  5HKC A;  3MO8 A;  3RMQ A;  3TSZ A;  1QVF S;  3IQL A;  2KNB B;  3OMG A;  5HCK A;  2CH4 A;  2V26 A;  4BD3 A;  2CRE A;  1NJI R;  1NBE B;  4FU6 A;  3CMA A;  1NE8 A;  2MYS A;  3QDR B;  4FIB A;  2RHX A;  1KSW A;  4X9C A;  2EYW A;  2KRS A;  3MP8 A;  1AWX A;  3QSU A;  4M77 B;  3CD6 T;  4HVV A;  5IHK A;  2K5L A;  3FB9 A;  4M78 F;  1D1C A;  1RAD B;  5LJ5 d;  3OYM A;  4OMN A;  2KK4 A;  2EGC A;  2GCX A;  2E65 A;  9ATC B;  1GXI E;  2O01 E;  1Y57 A;  2BZ8 A;  4JRQ A;  2D9T A;  3QDF A;  3A8G B;  3GNF B;  3V7R A;  5C0M A;  2XU8 A;  2LQ8 A;  2VVK A;  4LUD A;  3SB2 A;  3JCM P;  1B34 B;  4QVD A;  1N8R U;  2DRM A;  4WCI A;  3EGD A;  5CR2 A;  3I35 A;  2FRY A;  2BUD A;  3X20 B;  3CC7 A;  3HPW A;  3CC2 Q;  2DZ9 A;  1KFZ A;  4FCY A;  1WX6 A;  3MP6 A;  1YCS B;  4C0F A;  3BDL A;  1Y96 A;  1FYN A;  1ZQ1 A;  2QEX Q;  1BI3 A;  4HKE A;  1UG1 A;  3MET A;  3MEU A;  3ZL7 C;  3TRE A;  4E7I A;  1Q81 C;  3GNG A;  2EFI A;  2L0A A;  3SDZ A;  1VQ9 A;  5M9O A;  2CP5 A;  4RCB A;  4C0D B;  2CDT A;  3CBM A;  4KGV B;  3S6W A;  4M7D B;  2L89 A;  3L42 A;  1M3B A;  5GMK m;  3I9Q A;  1WA7 A;  3CCL Q;  3PFS A;  1G3W A;  5GAN 4;  4M75 D;  2LQW A;  5FW9 A;  1VQ5 A;  2QK0 A;  3OYN A;  5KCH A;  2DD4 A;  4OP0 A;  1PCX A;  2RN8 A;  1XOV A;  3FC3 A;  3U23 A;  2DL7 A;  1VYV A;  3CXC A;  3QWY A;  1BU1 A;  1VIF A;  3G71 A;  3QII A;  1QCF A;  2EGE A;  2EYX A;  2IVW A;  1Q82 R;  2PUO B;  3CCM Q;  3QZ5 B;  1IZ6 A;  1QMC A;  5J26 A;  4BI8 B;  2OTL T;  4M7A B;  4E6R A;  4MML A;  4FM4 B;  1Q81 R;  1K8A C;  2XDP A;  4JS5 A;  4CC7 A;  2CP7 A;  3LX7 A;  3R6N A;  2W0Z A;  2OJ2 A;  3SWN A;  1JRI A;  2DNU A;  1IGU A;  2E6N A;  1YIT Q;  4JJN K;  3EG9 A;  1YCY A;  2CT3 A;  1QP3 A;  1NEG A;  4QQG A;  5DY9 A;  2F69 A;  4OF1 A;  1WJR A;  3JCM W;  3CPW P;  1VQ4 T;  3C95 A;  5CO7 A;  1U1S A;  2EKO A;  3JCM J;  3I5R A;  3M5A A;  2B8A A;  2DIL A;  4DA4 A;  1ZSZ A;  1ZSG A;  2O31 A;  2KRO A;  2DVE A;  1QVG A;  1W4S A;  4C8Q C;  2DXC A;  1M90 R;  5CKE A;  2JM9 A;  4A53 A;  2L2P A;  1K76 A;  3SHW A;  4XU2 A;  2WSF E;  1D09 B;  5I22 A;  1VQL T;  2LMJ A;  1M27 C;  5C6S A;  4PJO G;  4C8Q G;  2GGR A;  3N5B B;  3MPU B;  1RLP C;  1YJN A;  2XK0 A;  4F7U G;  1YJW Q;  4ZN1 A;  1T3L A;  2LVM A;  2QQR A;  1ZLM A;  1C1A A;  4R0K A;  2QGG A;  4VUB A;  3BE3 A;  5FU7 B;  1JEG A;  1YI2 T;  4PFP A;  5KYN A;  3DKM A;  1X6O A;  3WXM B;  4DBQ A;  4QVC A;  4PKC C;  3I55 A;  2B86 A;  1Q7Y C;  2XMF A;  1YP5 A;  3CCQ Q;  1JU5 C;  4BE2 A;  2EVR A;  4QKU A;  2FB7 A;  4C92 D;  1OUL A;  2QAZ A;  2RHY A;  4XTW A;  1MMD A;  3VRZ A;  3CEY A;  2CUB A;  4J9G A;  1M5Q 1;  3CC2 T;  1GFC A;  4M77 D;  4RKU E;  4YTL A;  2KY9 A;  3OS1 A;  5KYU B;  4TVR A;  1SHG A;  5KE2 A;  1TU0 B;  3NTH A;  5L23 A;  2EQU A;  5D6W A;  3V8L A;  5GAM e;  2NUZ A;  5IHN A;  2DL5 A;  1T0J A;  2YSQ A;  2CSI A;  1BB9 A;  2A3L A;  3PE0 A;  3SFM A;  1TTH B;  2BE7 D;  1GCP A;  2L5Q A;  4LD6 A;  4QW2 A;  1YHQ Q;  4OGC A;  2RI2 A;  3QPH A;  1VQK Q;  4PJO E;  3H0F A;  4C8Q E;  1H3Z A;  5ECA A;  2MOX A;  5CQX A;  2COY A;  1VQ6 A;  2KXD A;  4ELY C;  2RQT A;  2CP6 A;  1M1K U;  2GFA A;  3URG A;  4XU0 A;  3CCJ A;  2KGT A;  1WLP B;  1GRI A;  4PJL A;  2XIC A;  2EJ9 A;  2DZC A;  3MEW A;  5IHI A;  4LDV A;  1C0M A;  4MMK A;  1M1G A;  2EJF A;  3CCM T;  1QW1 A;  2KMT A;  3EGX B;  2R5A A;  1QCO A;  3JB9 D;  3CC4 Q;  2LDM A;  4PJJ A;  2D0N A;  2QG9 B;  3PVQ A;  1UUE A;  1YIT T;  3CXC P;  5LJ3 j;  5LL6 S;  4C0D C;  3O5Z A;  4EPC A;  4M7D C;  1H64 1;  2DET A;  3EH1 A;  3PTA A;  2ROL A;  5I21 A;  1YWO A;  2XHC A;  5CKF A;  4O5V A;  2ZPE B;  1KQS S;  4M7D G;  4GBQ A;  4E7H A;  1OPL A;  2DE0 X;  1ACM B;  3OYB A;  2PVO B;  1ZBX A;  4M78 D;  3G6E A;  5CVI A;  2LX7 A;  6AT1 B;  2YWW A;  4PJM A;  4A4K A;  3WVE B;  4XTZ A;  4JRI A;  3C12 A;  4ZN3 A;  1K73 C;  4M7A C;  1GBR A;  2X4X A;  2HZY A;  1YJW T;  1QVG P;  3OYK A;  1TOV A;  4GLM A;  4J9D A;  3QXE B;  3SEM A;  4CRI A;  1M2V A;  4JJC A;  4XU3 A;  2AZV A;  3CD6 Q;  3QG1 A;  4LNP A;  1X43 A;  4LDX A;  2K2M A;  1GCQ C;  1TXQ A;  4ZGE B;  2O88 A;  2VGN A;  2R58 A;  4BE0 A;  1JJ2 A;  2YDL A;  2CS7 A;  2QQ9 A;  1BI2 A;  4OB1 B;  2CZ0 B;  2NUT B;  3E2U A;  3CCQ T;  2QA4 T;  2LC4 A;  2EQJ A;  5CIU A;  1VQN A;  2A7Y A;  5FRO A;  3L2V A;  3FJ5 A;  1N9R A;  4AMC A;  4C0G A;  1WJQ A;  2E5K A;  3H41 A;  1UB4 A;  3PMI A;  2V8I A;  3EFS A;  5GAM g;  5LJ5 e;  2M16 A;  1OEB A;  5I2M A;  2E41 A;  2HCK A;  1KC8 U;  3CME A;  5I11 A;  4PLL A;  2DXT A;  2QGF B;  1VQ7 A;  4AG2 C;  4ZNX A;  4FT2 A;  2YRD A;  4XU1 A;  2E64 A;  2J6F A;  1RUW A;  3CCE A;  5HY6 A;  1SSF A;  4J9E A;  4BDZ A;  1VA7 A;  3RMS A;  3JCM V;  5GAM j;  2QI2 A;  5FU7 C;  2FVU A;  1TWB A;  2QDY B;  5IXF A;  1YHQ T;  2MPX C;  2KDS A;  4EMK B;  1QCN A;  5AYF A;  2YUO A;  1D0Z A;  3AT1 B;  4JZ4 A;  2EYZ A;  4K11 A;  4ME7 A;  1HK9 A;  1I5L A;  4LDW A;  3M55 A;  2PNI A;  2DKG A;  1YIJ A;  2E6Z A;  2EAY A;  5KYY B;  3OW2 S;  2VUB A;  3OYJ A;  4AFS C;  1XJW B;  4BI3 A;  1N27 A;  4M75 A;  3AHU A;  4PJO B;  4C8Q B;  3I56 A;  4D8D A;  1YNZ A;  3EHQ A;  1AEY A;  1UGP B;  4F7U B;  5GAN h;  5GAO q;  2J6K A;  4X9D A;  1O9S A;  4L5G A;  2E10 A;  4LDY A;  4JZ3 A;  3CC4 T;  2DTH A;  4WF2 A;  4OB2 B;  1NEB A;  2FPF A;  1SF9 A;  2K9G A;  2FPE A;  4MDX A;  3VS6 A;  4RTV A;  5GAM f;  3PIP A;  2LTO A;  3CMA Q;  4E7J A;  4IIO A;  2M0Y A;  3RES A;  4J9C A;  4EIK A;  4J5Y A;  2JJ9 A;  4KUL A;  1S72 Q;  1OPK A;  1HJD A;  2P4R A;  3LLR A;  2RQV A;  3REB B;  1PSE A;  4E47 A;  4A4G A;  1RAG B;  1YN8 A;  1QKX A;  4QQD A;  3JB9 F;  4KGX B;  1QVF A;  4M7D F;  2FZG B;  1Q86 C;  1HXD A;  1ZHI A;  2BKD N;  3J81 E;  1LOJ A;  4JPB W;  4NOY A;  3HL8 A;  1I81 A;  1K9M R;  3P8B B;  3EFO A;  1F1B B;  2I0N A;  2DM1 A;  1VQ8 T;  3VS4 A;  1OYX A;  4UC4 A;  3QYG B;  1FMK A;  3L2Q A;  4JJB A;  4KH1 B;  4ORZ A;  1IXD A;  1V76 A;  1NJI U;  1Z9Q A;  3S3O A;  1JXO A;  1VQL Q;  4LDU A;  2EQI A;  2ZPB B;  1PC0 A;  2NUP A;  4RTU A;  3HP9 A;  3HKS A;  2BTT A;  2DL4 A;  2C0T A;  1VQM A;  2D6F A;  2D8J A;  1WPY A;  4M7A F;  4KH0 B;  2HNI A;  3ME9 A;  4MZP A;  2KSS A;  3HFN A;  4R55 A;  1WHM A;  4OMM A;  5GMK h;  5LJ5 g;  2QTX A;  3QHS A;  1YI2 Q;  2OTJ T;  3EGD B;  5GMK e;  3DB4 A;  1SRM A;  2RH2 A;  1G8X A;  1WHL A;  3FRN A;  7AT1 B;  2DIQ A;  2DPP B;  4GY5 A;  1M8V A;  2LNV A;  2DBK A;  2HAX A;  1Q86 R;  2FZK B;  1VQ9 Q;  2LQK A;  1D1B A;  3TEE A;  4C92 A;  3X28 B;  2XD0 A;  3CCS A;  4Y92 A;  5CQY A;  1JJ2 P;  2KYB A;  4XTY A;  4AT1 B;  5EG2 A;  1Y96 B;  1D3B A;  3M0T A;  5HK0 A;  2P0Q A;  3VS3 A;  1ZUY A;  2DAQ A;  2K3B A;  4Z89 A;  3VS0 A;  4M77 A;  1H92 A;  4WTO B;  1V29 B;  1VYT A;  3KUF A;  3NHN A;  3RKW A;  1T3S A;  1UHF A;  2EQK A;  2E70 A;  2FZC B;  1VQ5 Q;  1IO6 A;  5HK3 A;  2LQN A;  4HVW A;  4E2F B;  2M1H A;  1R0C B;  5IH2 A;  3QKJ A;  2RK2 A;  2MIO A;  2K79 A;  1XQH A;  2GNC A;  3H8Z A;  3OB9 A;  1PRM C;  1YJ9 Q;  2MAM A;  3CCR Q;  4BAC A;  3BDU A;  1K4U S;  2K3Y A;  4JJD A;  3OYY A;  1TG0 A;  3GLX A;  3UF4 A;  5GAN d;  3NTK A;  5J3B A;  5GAN g;  2PUK B;  1NG2 A;  1YWP A;  4IUT A;  1V1C A;  1LPL A;  1MGQ A;  1W6X A;  1IB8 A;  3UWN A;  1D1A A;  4EMH A;  3UT1 A;  1IGQ A;  3VV0 A;  3A98 A;  2F2V A;  3RNJ A;  1TSF A;  5DLQ E;  4QT7 A;  4EMG A;  3OYG A;  3LH0 A;  2ZPF B;  3M4G A;  5LJ5 f;  1W2B S;  2O4X A;  2NWM A;  3CC2 A;  2J6O A;  3SWN B;  1VQO A;  3PVL A;  2YUN A;  2W10 A;  3RR6 A;  5KYX A;  2VV5 A;  3EG9 B;  2JS2 A;  3C94 A;  1Q82 U;  1ZBJ A;  4XTU A;  2QEX A;  1KQ2 A;  1MMN A;  1Q81 U;  2K4Y A;  2ED1 A;  4KGZ B;  3CMA T;  8AT1 B;  4B9X A;  4EMK C;  2KYM A;  1NPR A;  2RJE A;  1VQP A;  1S72 T;  4JLI A;  4DBF A;  4A54 A;  1WI7 A;  2JT4 A;  1G3S A;  5D6Y A;  5LJ3 h;  4C8Q D;  2QDL A;  2LCS A;  1PD0 A;  2L3P A;  4RTW A;  2ZCF B;  3VJP A;  3NGP A;  3ASK A;  3VS5 A;  3CCL A;  3OMC A;  2P4T A;  1WHH A;  1ABO A;  1XNI A;  2A0F B;  2K7A A;  2RNA A;  4M78 A;  1HD3 A;  3CBO A;  3E1S A;  4PJO C;  3NTI A;  2K2V A;  3GP8 A;  3QYH B;  2YT6 A;  4AFU C;  1QVF P;  1M90 U;  3M0R A;  4N0A A;  3CBP A;  1VOM A;  1JBM A;  5CKH A;  3EG1 A;  3JCM c;  3UPU A;  1FWZ A;  3TVT A;  3HTR A;  3BW1 A;  2O2O A;  1K8A R;  3EG2 A;  3CC7 T;  2JM8 A;  4MZM A;  3CCV Q;  5FRN A;  2HQE A;  2CYZ B;  2MWO A;  4N4I A;  5J39 A;  3LYI A;  1NPP A;  2EW3 A;  3P8H A;  1RAC B;  5GJW B;  1AWO A;  5AT1 B;  3H0H A;  2ESW A;  1VQ9 T;  2RHI A;  1KD1 C;  2K3X A;  3OBY A;  2QA4 Q;  5KYW A;  3GOX A;  3S3M A;  2RJD A;  1U06 A;  4HCK A;  1N5Z A;  3M0Q A;  1SEM A;  2C0O A;  2ZPH B;  2E5Q A;  4QQ6 A;  5GAN 7;  1PWT A;  4X1V A;  3M0P A;  3HRS A;  1AD5 A;  2PTK A;  2RO0 A;  4FSS A;  1PSF A;  3CCJ Q;  3RKY A;  2XDD A;  2ROT A;  1VQ5 T;  4M75 E;  2AIR B;  4JRP A;  2JXB A;  3JCM b;  2YRC A;  3PNW C;  3V8K A;  2EPD A;  2DEQ A;  2DO3 A;  2DJZ A;  3V7S A;  4OMP A;  1AWW A;  5IAY A;  1YJ9 T;  4JLG A;  3CCR T;  3M56 A;  4A4E A;  1Q7Y R;  1KD1 R;  1WXU A;  2JNG A;  5FU6 C;  3ZFJ A;  2E1H A;  2L3R A;  3H6Z A;  3VUZ A;  2HEQ A;  1P92 A;  1FX7 A;  1H8K A;  4C5H A;  5KYU A;  4E7K A;  1ZUU A;  1WGS A;  1AZE A;  2KR3 A;  4II1 A;  2FG0 A;  2Z0W A;  5FWC A;  1M3A A;  4IUU A;  2JW4 A;  1UGV A;  3OS5 A;  4BUG A;  5FRM A;  1BCO A;  3QUI A;  4IUP A;  2RF0 A;  4C5G A;  4M7D D;  5LJ3 d;  3P8D A;  3G6E Q;  1C6V X;  3QZ9 B;  1TUD A;  4IUV A;  4LD9 K;  2A28 A;  3A8M B;  4OGE A;  4PLI A;  3UA7 A;  3JSC A;  1SPK A;  4J6W A;  1YJN T;  1LNX A;  1KQS A;  2MF2 A;  4OML A;  1JO8 A;  1AT1 B;  1X2Q A;  1VQK A;  3FIF A;  1ARK A;  5GAO l;  1CKA A;  1PNJ A;  3JB9 H;  2H8H A;  1TH7 A;  2DVJ A;  2X9H A;  3JCM Q;  2KQW A;  1G83 A;  2OAU A;  1D0Y A;  1MNE A;  2D1X A;  1TS9 A;  2EIF A;  3L1A A;  3CCU Q;  1I5O B;  3I55 T;  5GAN 2;  2P0P A;  1YFN A;  1SHF A;  2KVQ G;  3MKD A;  4M7A D;  2FL7 A;  1OX8 A;  1WQ7 A;  1N6A A;  4PK4 A;  3OS2 A;  2DEU A;  2I2L A;  4RUG A;  1M2V B;  4E7S A;  2X3X D;  4M4Z A;  2CKK A;  5FLX E;  1VQ8 Q;  3SWN C;  2COW A;  2KE9 A;  1X01 A;  4A63 B;  2RM4 A;  2HSE B;  4C92 E;  3MEA A;  5A0D A;  1BKB A;  3UA6 A;  3HRT A;  3OSS C;  1WHG A;  4PJO F;  4J6X A;  4C8Q F;  2YHT A;  1FMV A;  3E9F A;  3JCM h;  4F7U F;  3CCV T;  5GMK i;  2AT1 B;  3CME Q;  1KC8 C;  3CC4 A;  3JCM e;  4M77 E;  1MHN A;  2GTJ A;  1AZG B;  1IRE B;  4XQ3 A;  2LNH B;  2DL3 A;  5GAN 6;  2QYZ A;  2SRC A;  5D7U A;  2SEM A;  2KXC A;  3NMZ C;  1ZSZ C;  1VYU A;  5D6X A;  3CCE Q;  1UEC A;  2MWP A;  2OTJ Q;  3OY9 A;  3FJP A;  2K5I A;  1FMW A;  3G4S A;  2EYQ A;  1RI0 A;  1NYF A;  1WXB A;  2JUF A;  2DTO A;  1VUB A;  1ZA1 B;  3A1P A;  4M78 G;  4RTT A;  2M9U A;  4DOV A;  1VQ6 T;  2BZY A;  1KHC A;  2XID A;  3QBY A;  2DYI A;  3BFM A;  2HKQ B;  1OU8 A;  1YIJ Q;  4JDS A;  1FXX A;  1YBY A;  1NLP C;  3CCJ T;  1VIE A;  1K73 R;  4E7L A;  2CZ6 B;  3OYL A;  1QLY A;  4D6W A;  1UTI A;  1R77 A;  2G3R A;  2IIM A;  4IUQ A;  2FYK A;  5CK9 A;  1BIA A;  2K5F A;  3I56 Q;  1QVP A;  2PU9 B;  3FLG A;  3LGF A;  4N4G A;  1W70 A;  1X6G A;  3CD6 A;  4RTZ A;  1EIF A;  1K9A A;  3JB9 J;  3OW2 A;  3A5Z B;  4M75 B;  1S1N A;  3WVD B;  2RHU A;  3L2R A;  3ER0 A;  4ATO A;  1MV3 A;  3JCM X;  1RAA B;  4J9I A;  4LXC A;  3OYC A;  1JXM A;  2LT1 A;  4D8K A;  2CSQ A;  1M9S A;  5KH6 A;  3RDV A;  3QJY A;  2FPD A;  4DBH A;  3HSB A;  4KRT A;  1Q95 G;  2JTF A;  4HCZ A;  3NFC A;  5GAN e;  2K57 A;  1OI1 A;  3T9N A;  4OB0 B;  2HQH A;  3G6E T;  2L3Q A;  2MCN A;  3EG3 A;  2AZS A;  4M78 E;  1I4K 1;  2E3H A;  2YUQ A;  5A2Q E;  2MI6 A;  2E12 A;  2J05 A;  3X26 B;  2GBQ A;  1ZUK A;  3SD4 A;  1RAE B;  3CQT A;  3G7Z A;  2YLC A;  3EFO B;  5IXB A;  2WSC E;  2DER A;  1B07 A;  1VQM Q;  2RI3 A;  1KK7 A;  4F7U A;  4C5E A;  3CCU T;  5A0G A;  3J80 E;  1UEB A;  1UHC A;  3JCM d;  1IHV A;  3INZ A;  1TUG B;  2VB6 A;  3RUX A;  1KQS P;  2FEI A;  3JCM g;  4F17 A;  3CPW S;  1VQN T;  5GAN 8;  1K9M U;  4ZGJ B;  1MV0 B;  4CI0 C;  1RL2 A;  3RIR A;  3JB9 I;  2YUP A;  1U5S A;  1WQW A;  1N8R C;  3CCS Q;  2KT1 A;  5IT9 E;  1UE9 A;  3CME T;  1NYG A;  3GIB A;  3UDC A;  3CC7 Q;  1I1J A;  3M4Y A;  2HL5 C;  1VQ7 T;  2OTL A;  2HSP A;  1R8O B;  2NLU A;  4RTX A;  1BCM A;  4DEY A;  2RQR A;  4C92 B;  2RD1 A;  2HL3 A;  3CCE T;  1Z9Z A;  2ENM A;  4MDW A;  4AG1 C;  1D3B B;  2VXF A;  3V7C A;  1G2B A;  1U8R A;  1S72 A;  1Y71 A;  1OX9 A;  3JV3 A;  2DD5 A;  5FU6 B;  2RHZ A;  4DOW A;  3HHT B;  4J7F A;  3JRZ A;  1QWF A;  1VQ4 A;  2BIV A;  4PFZ A;  4JS4 A;  1Q86 U;  1GL5 A;  2X35 A;  1PHT A;  2YXY A;  2LX9 A;  2GF7 A;  1YIJ T;  5LJ5 j;  5GAN 3;  3D7S B;  1N8R R;  4BY6 C;  3OQ5 A;  2FRW A;  1RAB B;  3OS0 A;  3LWH A;  3A8H B;  3C0C A;  3TU4 K;  5GMK l;  2DBM A;  3FDR A;  3I56 T;  1D0X A;  3X24 B;  1VQL A;  1X2K A;  1HSQ A;  1VQO Q;  4J9B A;  1NM7 A;  3JCM f;  3G71 Q;  1B34 A;  2X4W A;  4ZTF A;  1AWJ A;  1BK2 A;  3V8J A;  2OAW A;  3L2W A;  1Q82 C;  2JMA A;  1YI2 A;  2DX1 A;  3A8L B;  3VS1 A;  4P5N A;  4IIM A;  2CP0 A;  3M53 A;  2YLB A;  1MMA A;  2LRQ A;  2O4X B;  2EJG A;  3M57 A;  1VQP Q;  1ZA2 B;  2F1L A;  1U3O A;  2QXF A;  1W2B A;  3OW2 P;  5KYX B;  2KRN A;  2A08 A;  1SRL A;  3EHR A;  3M59 A;  1J3T A;  1UFF A;  4J7I A;  5KCO A;  1JQQ A;  3GPL A;  2KAF A;  2DTI A;  4PJN A;  4O6J A;  1RAH B;  1M2O A;  1RAI B;  1Y0M A;  1M8M A;  5GAN j;  2VAS A;  2F2W A;  5CCA A;  4M7D A;  2CZ7 B;  1UGQ B;  2RQW A;  8ATC B;  4NL3 A;  1KIK A;  4OMQ A;  3C4S A;  2RI5 A;  2OX7 A;  4PNO A;  1QP2 A;  2A37 A;  1M90 C;  4BI4 A;  2JOY A;  3RER A;  5GJV B;  2ED0 A;  2LP5 A;  2X51 A;  4M75 C;  1RAF B;  2HBP A;  3PIO A;  1ZSZ B;  3LWI A;  4L6V 5;  4ESR A;  5GAO p;  3OBW A;  1YJ9 A;  1EX4 A;  4M78 B;  1YJN Q;  4ANJ A;  3CCR A;  3MHX A;  1VQM T;  3OYH A;  3LH5 A;  4PJO D;  4XTX A;  4HT8 A;  3G1J A;  3Q1J A;  1K0X A;  3CXC S;  2QTV A;  4RG2 A;  4F16 A;  5LJ3 e;  2P84 A;  2IG0 A;  1BI0 A;  1KJW A;  1NZ9 A;  2RJF A;  4M75 G;  3H0I A;  4RG8 A;  2HD0 A;  3NPF A;  2EKH A;  2M02 A;  2ATC B;  3I55 Q;  4HCC A;  2CT4 A;  4M7A A;  2O9S A;  2JMC A;  4DEX A;  4HCB A;  4FSX A;  1DJ7 B;  4XK8 E;  4J8O A;  2DJQ A;  3I5S A;  3RBB B;  4KT0 E;  3CCS T;  3KXT A;  1Y7X A;  1I8F A;  2EGA A;  2AHJ B;  1GCQ A;  2CP3 A;  2E3I A;  2R5M A;  1RLQ C;  1BIB A;  1OQK A;  2DLP A;  2DK3 A;  3MJX A;  2QAS A;  3EAE A;  1G5V A;  1PM3 A;  5GAN f;  3CCM A;  1WIE A;  4PFO A;  1I0C A;  2ZPG B;  1QQJ A;  1K8A U;  1MMG A;  1AVZ C;  2QQA A;  3MCA B;  2JZ2 A;  3E9G A;  2PVD B;  2EYY A;  5KYW B;  3GBQ A;  2DMO A;  1G3Y A;  3QWX X;  2KBT A;  2GQI A;  1QWE A;  1YIT A;  1QVG S;  1B3Q A;  2JS0 A;  2HKN A;  3R6O A;  5KE3 A;  1LJO A;  4J83 A;  2DXU A;  3O8V A;  5DLO A;  2G6F X;  5GMK j;  4GLK A;  3VKI A;  4PL6 A;  2GTO A;  2KT8 A;  3UAT A;  4XAX B;  3M0U A;  1KHI A;  1BYM A;  4CC4 B;  3J7A F;  5FWB A;  5I2S A;  3TSW A;  1M30 A;  1VQ6 Q;  2JN0 A;  2LJ0 A;  4NL2 A;  2LT4 A;  2JTM A;  1MND A;  3LW5 E;  3F70 A;  2VGM A;  1M1K C;  1K0S A;  4OMO A;  1G3T A;  4F14 A;  4L59 A;  4LUE A;  1U1T A;  3S3N A;  3VYG A;  2BZX A;  2X4J A;  2EBP A;  3EH2 A;  1KG1 A;  2WAC A;  1VQO T;  1X69 A;  2LCL A;  4ZGD B;  3CCV A;  1YJW A;  2HBW A;  3OYI A;  3G71 T;  2P0K A;  3LGL A;  2ZZD A;  2PQW A;  3HFO A;  4C92 C;  2XG8 D;  3ZEH A;  4DQ2 A;  4C0Z A;  3VS7 A;  4BDY A;  1X6B A;  2QEX T;  1N9S A;  5GAM h;  4IUR A;  3RKX A;  1Q7Y U;  4M77 C;  3H9N A;  2F2X A;  4JUV A;  1VQP T;  1KD1 U;  4C92 G;  3CCQ A;  2QA4 A;  2D8H A;  3KBG A;  2QQB A;  2KEA A;  1ABQ A;  1JB0 E;  1XTD A;  1H3H A;  4BB7 A;  2RPN A;  4Y28 E;  4RTY A;  1E7O A;  3VUB A;  2AKL A;  4M77 G;  3M9Q A;  2RB6 A;  2E4H A;  1M1K R;  3TQ7 P;  3CCL T;  4F7U E;  2JVV A;  3L2U A;  2MMP A;  4V2S A;  1X75 C;  4J9F A;  1W2B P;  3ULR B;  3X25 B;  4FT4 A;  5GAO n;  4RMO A;  4FW2 A;  1OZ3 A;  2VXE A;  5CKB A;  2YRV A;  2FHD A;  3EG0 A;  5LJ3 g;  2ABL A;  2ECZ A;  3QJ6 A;  4BE1 A;  4HVU A;  3EGU A;  4HT9 A;  4FYX B;  1W1F A;  2LCC A;  2RA2 A;  2FO0 A;  2CH4 W;  4X34 A;  1YHQ A;  2RMO A;  2C06 A;  2CUD A;  4B9W A;  1WJS A;  4KUI A;  1OV3 A;  5GAN 5;  2DA9 A;  1Y07 A;  3PMT A;  4M75 F;  1QKW A;  1OOT A;  2ZAE A;  4CC3 A;  3EGX A;  5A0L A;  2DL8 A;  4E7Z A;  2OI3 A;  1EFN A;  2KRM A;  2VYT A;  2PZ1 A;  2O9V A;  2R57 A;  1VQN Q;  3G4S Q;  2A36 A;  1KQ1 A;  4Q5W A;  2H3J A;  2RJC A;  1EZZ B;  3DLL A;  4FYY B;  4CC2 A;  4Z02 A;  4BY6 B;  4Y91 A;  5GAO r;  4FYW B;  3OYF A;  1WFW A;  2VKN A;  3DB3 A;  3JB9 G;  3TCJ A;  2H3E B;  1PKS A;  2ZGW A;  3M0S A;  1ZX6 A;  1M1F A;  4R56 A;  1PG5 B;  1OZ2 A;  2VC8 A;  1OU9 A;  5CKD A;  4B6M A;  2RQU A;  5CAI A;  1VQ7 Q;  5GAO m;  2V1Q A;  2V8J A;  2F5K A;  2CP2 A;  2DRK A;  3ZBD A;  5DM7 R;  4QVZ A;  2GFU A;  2AKK A;  4M78 C;  4A4H A;  2AK5 A;  2J06 A;  4OMF B;  4Z8A A;  4OB3 B;  1GFD A;  1WNL A;  3OYE A;  1IHW A;  1NLO C;  1PKT A;  1UGS B;  4N0A C;  1K1Z A;  2V8K A;  3REA B;  2LJ1 A;  1X27 A;  2D0Q B;  4JRK A;  4LE9 A;  5LJ3 f;  4M7A G;  3CCU A;  4FW1 A;  4LN2 A;  2XI9 A;  3OSV A;  2J7I A;  2DIG A;  3PT9 A;  1SSH A;  4EDU A;  2CGH A;  2X4Y A;  2L8D A;  4OVA A;  4N4H A;  4KBM B;  3JAM E;  1VQ8 A;  1JJ2 S;  4MZT A;  1LVK A;  1UDL A;  2WSE E;  5GAM d;  3OYA A;  5LJ5 h;  1BBZ A;  1K73 U;  2M51 A;  1KC8 R;  1WYX A;  3VU3 C;  3M58 A;  3OYD A;  3THK A;  1MUZ A;  2XDB A;  2Y90 A;  2NUT A;  3GF5 A;  3PGG A;  3HRU A;  2LJ3 A;  4J9H A;  1WHJ A;  4M7D E;  2VWF A;  4Z88 A;  2Y4Y A;  4FL6 A;  3M54 A;  1WDX A;  1WZO A;  3VS2 A;  3EFR A;  2BE9 B;  2EWN A;  4C92 F;  2OTJ A;  1IRX A;  1GBQ A;  2HDA A;  1TUC A;  2EQM A;  1WHK A;  1PD1 A;  1HYO A;  2QQS A;  3OA6 A;  1AOJ A;  3L2Z A;  1VQK T;  4M77 F;  3CPF A;  2PVG B;  2F5T X;  1SG5 A;  2V1R A;  4A4F A;  2M0O A;  1LCK A;  1RI9 A;  4ELZ C;  1UJ0 A;  2ZPI B;  1SKU B;  4XTV A;  2CZ1 B;  2K6D A;  4F04 B;  5L8R E;  4C5I A;  5EC7 A;  4IKF A;  1A0N B;  1UJY A;  4EMK A;  4FYV B;  2NYS A;  4M7A E;  2DYB A;  4RCC A;  4DBR A;  2HMA A;  1K9M C;  3FEO A;  2RK1 A;  3A8O B;  2Y4X A;  1CKB A;  5KYY A;  1E6H A;  3MEV A;  1NJI C;  2X3W D;  1R0B G;  3E19 A;  2MK5 A;  1BI1 A;  1PRL C;  4KUD K;  2GQV A;  4AFZ C;  3BY7 A;  1AHJ B;  2JTE A;  1I07 A;  2DF6 A;  2OTL Q;  4PJO A;  5IN1 A;  4C8Q A;  3CPW A;  1CSK A;  2COZ A;  4ZTJ A;  2DXB A;  4NS5 A;  3DLM A;  2L3S A;  4HXJ A;  1O75 A;  4J6Y A;  2XKO C;  1B7T A;  3MP1 A;  1M3C A;  3G4S T;  4HA8 A;  2NUP B;  1M4Z A; 
#chains in the Genus database with same CATH homology
 1Y0M A;  1M8M A;  2EPD A;  2F2W A;  3KFV A;  1WXT A;  2YDL A;  3VRY A;  1E6G A;  2C0I A;  4OMP A;  1AWW A;  1T0H A;  4AFQ C;  2RQW A;  1KIK A;  4OMQ A;  2LZ6 B;  2A37 A;  3FJ5 A;  2E5K A;  1WXU A;  3H41 A;  3TSZ A;  3IQL A;  2KNB B;  5GJV B;  2ED0 A;  5HCK A;  2LP5 A;  2CH4 A;  2CRE A;  4ESR A;  1OEB A;  2HCK A;  2HEQ A;  1H8K A;  3LH5 A;  5I11 A;  1K0X A;  4F16 A;  1ZUU A;  1KSW A;  1AZE A;  2EYW A;  1KJW A;  2KRS A;  4AG2 C;  2KR3 A;  4ZNX A;  1AWX A;  2FG0 A;  3H0I A;  3NPF A;  2EKH A;  4HVV A;  5IHK A;  5FWC A;  1M3A A;  2CT4 A;  2JW4 A;  1UGV A;  2J6F A;  2O9S A;  1RUW A;  2JMC A;  4DEX A;  4OMN A;  2EGC A;  2RF0 A;  4J9E A;  2DJQ A;  3I5S A;  1VA7 A;  3RBB B;  1Y57 A;  2BZ8 A;  5IXF A;  2EGA A;  1GCQ A;  1RLQ C;  1TUD A;  2DLP A;  2VVK A;  4LUD A;  2A28 A;  1WIE A;  2YUO A;  1I0C A;  4JZ4 A;  3UA7 A;  2EYZ A;  4K11 A;  1SPK A;  2DRM A;  1AVZ C;  4WCI A;  2PNI A;  4OML A;  1JO8 A;  2EYY A;  3I35 A;  2FRY A;  3GBQ A;  1X2Q A;  2DMO A;  3QWX X;  1ARK A;  4AFS C;  2KBT A;  2GQI A;  1QWE A;  1CKA A;  1PNJ A;  1B3Q A;  2H8H A;  2JS0 A;  2DVJ A;  1G83 A;  1KFZ A;  2D1X A;  2G6F X;  1WX6 A;  4D8D A;  1YCS B;  1YNZ A;  3EHQ A;  1AEY A;  2GTO A;  2KT8 A;  1FYN A;  1SHF A;  2J6K A;  3UAT A;  3M0U A;  1UG1 A;  4CC4 B;  3ZL7 C;  4RUG A;  4JZ3 A;  2X3X D;  4M4Z A;  2L0A A;  5FWB A;  2KE9 A;  4A63 B;  3TSW A;  1M30 A;  3UA6 A;  1NEB A;  2LJ0 A;  2FPF A;  2K9G A;  2CDT A;  2FPE A;  1K0S A;  4OMO A;  4RTV A;  3VS6 A;  1M3B A;  4F14 A;  4IIO A;  2M0Y A;  4J9C A;  2GTJ A;  1AZG B;  3I9Q A;  4LUE A;  4EIK A;  2LNH B;  1WA7 A;  2DL3 A;  1OPK A;  1HJD A;  2SRC A;  2P4R A;  2BZX A;  2SEM A;  2EBP A;  2KXC A;  3NMZ C;  2RQV A;  3REB B;  1X69 A;  1VYU A;  1YN8 A;  1QKX A;  2HBW A;  1UEC A;  2LQW A;  5FW9 A;  2RN8 A;  1XOV A;  4JPB W;  3U23 A;  3VS7 A;  1X6B A;  1NYF A;  2DL7 A;  1WXB A;  2I0N A;  1VYV A;  3QWY A;  1BU1 A;  1QCF A;  2DM1 A;  2EGE A;  2EYX A;  2F2X A;  4RTT A;  3VS4 A;  4E6R A;  1FMK A;  2BZY A;  4JJB A;  4ORZ A;  2D8H A;  2KEA A;  1ABQ A;  1Z9Q A;  4CC7 A;  1H3H A;  2RPN A;  1NLP C;  4RTY A;  1E7O A;  1JXO A;  3R6N A;  2W0Z A;  2OJ2 A;  2AKL A;  2DNU A;  2EQI A;  1QLY A;  4RTU A;  1UTI A;  2IIM A;  2CT3 A;  2BTT A;  2DL4 A;  2C0T A;  1NEG A;  4J9F A;  2D8J A;  4OMM A;  3ULR B;  3I5R A;  1SRM A;  2DIL A;  1W70 A;  1X6G A;  3EG0 A;  4RTZ A;  1K9A A;  2ABL A;  2ECZ A;  1ZSG A;  2DBK A;  2O31 A;  4HVU A;  2KRO A;  1S1N A;  3EGU A;  1W1F A;  4Y92 A;  2FO0 A;  2JM9 A;  2KYB A;  2CH4 W;  2L2P A;  2RMO A;  3M0T A;  1K76 A;  3SHW A;  2CUD A;  1MV3 A;  3VS3 A;  1ZUY A;  2K3B A;  4Z89 A;  3VS0 A;  4J9I A;  1OV3 A;  2DA9 A;  5I22 A;  1H92 A;  1JXM A;  2LMJ A;  1VYT A;  1M27 C;  1QKW A;  4D8K A;  3NHN A;  2GGR A;  2CSQ A;  1T3S A;  1UHF A;  1RLP C;  1OOT A;  4CC3 A;  1T3L A;  2DL8 A;  2FPD A;  2OI3 A;  1IO6 A;  1EFN A;  1ZLM A;  4R0K A;  4KRT A;  2KRM A;  1JEG A;  2LQN A;  2PZ1 A;  2O9V A;  4HVW A;  2A36 A;  2L3Q A;  2MCN A;  3EG3 A;  2AZS A;  5IH2 A;  4CC2 A;  2MIO A;  2K79 A;  2GNC A;  2YUQ A;  1WFW A;  2B86 A;  2VKN A;  1PRM C;  1PKS A;  2XMF A;  1YP5 A;  2J05 A;  3M0S A;  2GBQ A;  1ZX6 A;  1JU5 C;  1K4U S;  1ZUK A;  2EVR A;  4JJD A;  1TG0 A;  3UF4 A;  3CQT A;  2RQU A;  3VRZ A;  2CUB A;  2V1Q A;  1NG2 A;  1YWP A;  4J9G A;  1V1C A;  5IXB A;  2DRK A;  1W6X A;  1GFC A;  1B07 A;  2AKK A;  3A98 A;  2F2V A;  3RNJ A;  2AK5 A;  2J06 A;  4Z8A A;  4QT7 A;  1GFD A;  1UHC A;  1SHG A;  1NLO C;  1PKT A;  2FEI A;  4F17 A;  5L23 A;  1K1Z A;  2NWM A;  2J6O A;  3REA B;  3PVL A;  2LJ1 A;  1X27 A;  2YUN A;  2W10 A;  4LE9 A;  1MV0 B;  2NUZ A;  5IHN A;  4LN2 A;  2DL5 A;  1T0J A;  2JS2 A;  2YUP A;  2J7I A;  2YSQ A;  1U5S A;  1SSH A;  2CSI A;  1BB9 A;  3PE0 A;  1ZBJ A;  2KT1 A;  1UE9 A;  1GCP A;  1NYG A;  2ED1 A;  3H0F A;  1I1J A;  5ECA A;  2MOX A;  2KYM A;  1UDL A;  2HSP A;  2KXD A;  1BBZ A;  4RTX A;  2M51 A;  2RQT A;  4DEY A;  1WYX A;  2RQR A;  3THK A;  1MUZ A;  1WI7 A;  2JT4 A;  2QDL A;  1Z9Z A;  2ENM A;  2LCS A;  2L3P A;  2KGT A;  1WLP B;  4RTW A;  4AG1 C;  1GRI A;  3NGP A;  1G2B A;  2LJ3 A;  3VS5 A;  3JV3 A;  5IHI A;  1ABO A;  4J9H A;  2VWF A;  2K7A A;  4Z88 A;  2RNA A;  1WDX A;  1HD3 A;  1QWF A;  3VS2 A;  1GBQ A;  2HDA A;  1GL5 A;  2YT6 A;  1TUC A;  4AFU C;  1PHT A;  3M0R A;  2D0N A;  3EG1 A;  3PVQ A;  1UUE A;  1AOJ A;  3TVT A;  2O2O A;  3EG2 A;  2FRW A;  2JM8 A;  2V1R A;  1LCK A;  1RI9 A;  3O5Z A;  3C0C A;  2DBM A;  1UJ0 A;  2EW3 A;  2K6D A;  5EC7 A;  1A0N B;  1UJY A;  1X2K A;  2ROL A;  1HSQ A;  5GJW B;  1AWO A;  1YWO A;  4J9B A;  2DYB A;  1NM7 A;  3H0H A;  2ESW A;  1AWJ A;  1BK2 A;  4GBQ A;  2OAW A;  1OPL A;  2DE0 X;  1CKB A;  1E6H A;  2JMA A;  2DX1 A;  1U06 A;  2X3W D;  3VS1 A;  2LX7 A;  4HCK A;  1PRL C;  4IIM A;  1N5Z A;  3M0Q A;  1SEM A;  4AFZ C;  2JTE A;  2C0O A;  1I07 A;  2DF6 A;  1U3O A;  1PWT A;  2KRN A;  2A08 A;  4X1V A;  1CSK A;  3M0P A;  1AD5 A;  1GBR A;  1SRL A;  3EHR A;  1J3T A;  2PTK A;  1UFF A;  4FSS A;  2L3S A;  4HXJ A;  1JQQ A;  2ROT A;  4GLM A;  4J9D A;  3SEM A;  2JXB A;  4JJC A;  2AZV A;  4LNP A;  1X43 A;  1M3C A;  2K2M A;  1GCQ C;  2O88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...