1TUCA

Alpha-spectrin src homology 3 domain, circular permutant, cut at s19-p20
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
b'MGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-SPECTRIN
molecule tags Cytoskeleton
source organism Gallus gallus
publication title The order of secondary structure elements does not determine the structure of a protein but does affect its folding kinetics.
pubmed doi rcsb
total genus 10
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1996-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1tucA00
3TSWA 2MOXA 2RN8A 1E6HA 4RTUA 3M0UA 2YUOA 1E7OA 3VS6A 1K1ZA 1OPLA 1YNZA 1NLOC 1WXTA 2KYBA 3ZL7C 4J9DA 2W10A 1K9AA 3EG3A 3M0RA 1OPKA 1T3LA 1CSKA 2KROA 1WYXA 4HXJA 2VVKA 1NYFA 2K2MA 2M51A 2HCKA 4F14A 1WFWA 2SRCA 2DYBA 1NG2A 2D8HA 2KE9A 3NPFA 2EGCA 2FRWA 1GFCA 1JEGA 1RI9A 2K7AA 1JXMA 4JJBA 2DA9A 2EGEA 2CDTA 2CUDA 4OMPA 3VS3A 2ESWA 3O5ZA 2C0TA 2A36A 1N5ZA 3REAB 2JM9A 4LUDA 1PRMC 2D0NA 3EG2A 1Y0MA 3SHWA 2QDLA 4IIMA 4AFQC 3NMZC 3H0IA 1GRIA 1AEYA 3EG1A 2AKKA 1NM7A 1V1CA 1UJYA 2FPFA 1AWOA 1SEMA 4E6RA 3NGPA 1CKAA 2DMOA 1W70A 1YWOA 2J6KA 4LN2A 2J6OA 2OAWA 2EVRA 3VRZA 1K76A 4AG1C 1IO6A 1SRMA 2DL7A 1ZX6A 1OOTA 4JZ4A 1JXOA 3EHRA 1Z9ZA 1ZUKA 3KFVA 2L0AA 3QWYA 2A08A 4IIOA 4F17A 1OV3A 4ORZA 2LCSA 3TSZA 2JMAA 1PHTA 2W0ZA 1ABQA 1M27C 2DM1A 2V1QA 1X6GA 5I22A 1SSHA 2HDAA 1NLPC 2OI3A 2RMOA 1ZLMA 2YUNA 1BB9A 3M0SA 2FPDA 3UATA 1I07A 2J6FA 1M8MA 2YSQA 4Z89A 4J9GA 5FW9A 4A63B 2RQRA 3FJ5A 4QT7A 3REBB 1BBZA 1WX6A 3EG0A 2KNBB 1W1FA 1NEGA 1NEBA 1X2KA 2FO0A 5GJVB 4LE9A 2YT6A 4RTWA 1WA7A 5IHIA 1X2QA 4OMMA 2CUBA 2DLPA 3VS4A 4HVVA 2DE0X 1NYGA 1UG1A 4Y92A 2AK5A 2LX7A 2F2WA 1UJ0A 1B3QA 1H8KA 4CC4B 1WI7A 1ZUYA 1QWFA 5ECAA 1QCFA 2RQTA 1XOVA 1YN8A 5IXFA 1FYNA 1UTIA 1PNJA 2GNCA 2BZXA 1X43A 1ARKA 2G6FX 2AZSA 1GFDA 2LQNA 2GGRA 2H8HA 4KRTA 1VYUA 2JM8A 2P4RA 2FPEA 2J05A 4D8KA 1U06A 2RNAA 1AWXA 3JV3A 1UE9A 1KIKA 1AD5A 1T0JA 1ZSGA 1U3OA 4OMOA 2JT4A 1WIEA 2DJQA 2HBWA 2KT1A 2LJ1A 2EPDA 5IHKA 2CT3A 2I0NA 1KJWA 3RBBB 4D8DA 2L2PA 1E6GA 3U23A 2A37A 4X1VA 1ZUUA 5IXBA 1ABOA 1G2BA 3NHNA 4AFSC 1UDLA 2L3SA 2AKLA 3GBQA 1X27A 2ROTA 2A28A 3I9QA 1UHCA 1HD3A 4AFUC 2KT8A 1KFZA 2EW3A 2KBTA 2F2VA 1JQQA 4ZNXA 2O31A 1WLPB 1YWPA 2LQWA 2EYXA 2CSIA 2XMFA 2O88A 2LJ0A 2LMJA 3M0TA 2M0YA 1WDXA 4M4ZA 2EKHA 2K6DA 1HJDA 1MV0B 2EYZA 1QWEA 2ED0A 1M30A 1TUCA 2SEMA 2CSQA 3UF4A 4JZ3A 1VYTA 4DEXA 1B07A 1M3AA 2C0IA 2LP5A 2KRNA 4J9HA 4OMNA 3VS5A 3UA6A 2X3XD 1K4US 4JJCA 2JTEA 2D8JA 2JS2A 1YCSB 1UUEA 3UA7A 2KGTA 1BK2A 4K11A 5L23A 4CC7A 2CH4A 2FG0A 1J3TA 1GCPA 2DL3A 2CH4W 1M3CA 5I11A 1SHFA 2RF0A 2DX1A 2L3QA 1AZGB 1Z9QA 2V1RA 1FMKA 2YUPA 4J9CA 2KR3A 4Z88A 2AZVA 4F16A 3THKA 2BZ8A 2ECZA 3H41A 1T0HA 3PVQA 4OMQA 2DILA 4GBQA 4HVWA 5EC7A 5HCKA 4ESRA 2YDLA 1H92A 2D1XA 1GL5A 2B86A 1UFFA 1PWTA 2JXBA 3M0QA 2YUQA 1K0XA 1RLPC 4RTTA 4Z8AA 3A98A 1AWWA 2VWFA 2HEQA 2GTJA 4OMLA 2DNUA 2ENMA 1A0NB 1AZEA 4RTXA 1K0SA 2PTKA 2NUZA 2L3PA 4J9BA 1HSQA 1I0CA 3VS0A 3CQTA 2DRKA 2EGAA 1G83A 4GLMA 2PZ1A 2ABLA 1JU5C 4AG2C 1UGVA 2DL5A 1WXUA 2RQVA 1X69A 1UHFA 2CT4A 2KYMA 1MV3A 1GCQA 2DBKA 2VKNA 3IQLA 4CC2A 1TUDA 5FWBA 1QKXA 1QKWA 2EQIA 2O9SA 2RPNA 2IIMA 1AVZC 1T3SA 2KXDA 2OJ2A 2JMCA 4RTYA 3I35A 1PKSA 2EYYA 3I5SA 1SPKA 1PKTA 2GTOA 1H3HA 2K9GA 1ZBJA 2FEIA 1M3BA 3TVTA 2KRSA 2X3WD 1BU1A 4LUEA 2J7IA 5GJWB 2DL4A 1VA7A 2ROLA 2J06A 2O9VA 1EFNA 1GBRA 1WXBA 3R6NA 1GCQC 1X6BA 3EHQA 2DVJA 2GQIA 2MIOA 4HVUA 2DRMA 3PE0A 2BZYA 1TG0A 4JPBW 5IHNA 2KXCA 2O2OA 3H0FA 4WCIA 3SEMA 1SRLA 3I5RA 2EBPA 3QWXX 1MUZA 1QLYA 2GBQA 1RUWA 2PNIA 3C0CA 3VS2A 4CC3A 4EIKA 1AWJA 4RUGA 2KEAA 3VRYA 2HSPA 1RLQC 1W6XA 4J9IA 2E5KA 2K79A 1AOJA 4J9FA 3VS7A 2DL8A 2K3BA 3M0PA 1U5SA 3RNJA 1PRLC 1I1JA 5FWCA 1JO8A 1UECA 3H0HA 1SHGA 4DEYA 3ULRB 1CKBA 4AFZC 1Y57A 2DBMA 2RQUA 4FSSA 1S1NA 2NWMA 2JS0A 2CREA 3PVLA 4LNPA 1LCKA 2RQWA 3LH5A 4RTVA 1OEBA 1VYVA 3EGUA 2EYWA 2ED1A 4HCKA 4J9EA 4R0KA 3VS1A 4JJDA 2KRMA 5IH2A 2LZ6B 2BTTA 2DF6A 1GBQA 4RTZA 2MCNA 2JW4A 2LJ3A 2C0OA 2LNHB 2F2XA 1KSWA 2FRYA 1YP5A
chains in the Genus database with same CATH superfamily
1YJ9A 2P84A 1NE8A 3CCEA 3LW5E 4LDXA 2FZCB 4OB0B 2RN8A 3RKXA 2YUOA 3EH2A 1K1ZA 3CPWA 1NLOC 2KYBA 2CS7A 4J9DA 4M78D 3EG3A 5KYYA 5GAN2 1CSKA 3CCJQ 2VVKA 2M51A 2Y4XA 3RUXA 5HKCA 1TH7A 1BCOA 2HCKA 5LJ5j 4M75B 1B34A 2KE9A 4BDZA 2PVDB 3FLGA 5GAMe 2EGCA 3C94A 3G4SQ 2RI2A 2DA9A 2BKDN 3O5ZA 3G4SA 4E47A 2X35A 2GCXA 3MPUB 3REAB 5J3BA 5GANe 2EWNA 4BE2A 3CCUT 5KE3A 3ZBDA 1MNEA 1YITQ 1GRIA 2AKKA 3OYGA 2YRCA 2FPFA 1UJYA 5EG2A 2DZ9A 1CKAA 1VQ6Q 1YWOA 2RJFA 3E1SA 4LN2A 2LTOA 3JCMh 4NL2A 1D0XA 4BE1A 1SF9A 4JZ4A 5A0DA 3S3MA 1VQ8Q 3WXMB 2NYSA 3CCEQ 5A0GA 4ORZA 2LX9A 2LCSA 2HQEA 3CCST 1VQ4A 3CMAT 8AT1B 2JMAA 2ZPIB 3OYEA 3H6ZA 2W0ZA 3I56T 5KYNA 2R5MA 4KBMB 1M27C 4PFZA 2RJCA 4M7AD 3JCMc 1X6GA 1C1AA 5I22A 1NLPC 2OI3A 1Y07A 3EGXA 4BI4A 3OYMA 1Y96B 2RJDA 3MO8A 3QJYA 5FLXE 4M77B 2MYSA 2M16A 2P0QA 3R6OA 3OW2S 2YSQA 3D7SB 2KSSA 3QHSA 3JB9D 1KQSS 3FJ5A 5GMKh 1BBZA 3OBWA 1P92A 3HRTA 3KUFA 4FU6A 4RTWA 4FYWB 2RB6A 2MK5A 4OMMA 2LT4A 3VS4A 1BKBA 4HVVA 4PFPA 2DE0X 2AK5A 2LX7A 2MMPA 6AT1B 2EKOA 4J7FA 1B3QA 1YI2T 2DO3A 3CC4Q 2AT1B 4M78B 2DXBA 1OZ3A 1QCFA 1XOVA 3QDFA 2OTJQ 2EQMA 5IXFA 2OTLT 3PMTA 1KD1U 2COYA 1ARKA 3HSBA 2XHCA 1OX9A 1GFDA 5GAOn 1JRIA 2JM8A 2P4RA 3JV3A 1WPYA 1QVFP 4JJNK 1ZSGA 1VQ6T 1R8OB 3A8OB 1Q82U 1WQ7A 1JJ2S 4GY5A 5LJ3h 2QEXQ 3VJPA 4IUPA 3HRSA 2I0NA 3RBBB 1WGSA 4D8DA 2ZPFB 2L2PA 4QW2A 3KXTA 2K5FA 4Y91A 2QQSA 2CP3A 1MMNA 3CEYA 3NHNA 4AFSC 5LJ3e 2L3SA 2QI2A 1LPLA 2ROTA 2LQ8A 2A28A 5CKDA 4C0GA 1D0ZA 2EIFA 2KT8A 4E7ZA 5FROA 1WJSA 3G71A 1Q86C 4M7DB 4MZMA 3G71Q 1WLPB 1K73U 1YWPA 1VQ5Q 4E7IA 1VQ9T 4QVCA 2F5KA 2LJ0A 1OULA 1NBEB 1VIEA 4EMKA 1WDXA 5FU6C 4QQDA 3CCRQ 2K6DA 1MV0B 4QVZA 3INZA 2SEMA 3EFSA 2CSQA 1VYTA 1D3BB 1N8RU 2X4WA 2VUBA 1RAAB 3UA6A 1VOMA 2QTXA 2JTEA 1UGSB 1YCSB 1FXXA 3UA7A 1O9SA 2KGTA 4K11A 1R77A 2CH4A 1KC8C 1IB8A 2OTJT 2FHDA 5KH6A 4J6XA 1Z9QA 2LQKA 3PNWC 4BDYA 2YUPA 4A4EA 2IG0A 2KR3A 1Y96A 1TXQA 3THKA 2BZ8A 3GOXA 4OMQA 8ATCB 3CC4A 1BI3A 3OA6A 5EC7A 3CCVT 3JB9G 1GL5A 2A0FB 2YUQA 2KK4A 3CBPA 1AWWA 2VWFA 4XU1A 4M77G 2HEQA 1UGPB 3LH0A 2YHTA 4WF2A 3ZEHA 2QEXT 3F70A 1A0NB 4IUUA 1K0SA 2OX7A 2NUZA 4J9BA 2EFIA 1I0CA 3HFNA 3VS0A 3MEWA 3RMQA 4RG8A 2VC8A 3CQTA 4N4HA 4GLMA 2PZ1A 3OYIA 4B9XA 1VQ7A 3GNGA 2DXTA 2CT4A 3TREA 2KYMA 1W2BP 2VKNA 3IQLA 4CC2A 1TUDA 1QKXA 3NTKA 4M7DG 3QPHA 4LDUA 2EQIA 3HPWA 1VQ4Q 2E6ZA 1T3SA 2KXDA 5J39A 2HQHA 2LT1A 1X75C 1KD1R 4M7DD 5KYUB 1TU0B 1M3BA 3CCUA 3MHXA 2KRSA 3MEVA 2CYZB 4LUEA 2K5LA 2DL4A 2QXFA 2A7YA 2J06A 2O9VA 4MZTA 1GCQC 1X6BA 4LDYA 2O4XA 3EHQA 1LNXA 2BZYA 5KYXA 2CP5A 5D6XA 2KXCA 2O2OA 4J7IA 3QWXX 1MUZA 2EAYA 4M7DA 3V8LA 1VQ8T 1RUWA 2PNIA 3LGFA 1AWJA 1QW1A 2DKGA 2HSPA 1RLQC 1W6XA 3CC2Q 5GAOq 1JJ2P 1AOJA 2DL8A 2K3BA 4TVRA 2BE9B 3LLRA 1U5SA 3P8DA 2RD1A 4CRIA 1BYMA 1UECA 4DEYA 3X26B 3BDLA 3QXEB 3JCMV 4M75D 2QQ9A 2LCCA 1Q81R 1VQNQ 4ZGEB 4LXCA 3VKIA 1D3BA 4A4KA 3GF5A 4R56A 3EGUA 4M78F 3J7AF 1X01A 5GAMg 2ED1A 4HCKA 2QK0A 4J9EA 2XI9A 2KRMA 4F7UB 4NOYA 2JW4A 3JAME 2VXFA 3NFCA 3DLLA 3OYHA 1SKUB 3C12A 4X34A 1G3SA 2MWPA 4RTUA 3I55Q 3M0UA 2ZPGB 1OPLA 3P8HA 2XK0A 2NUTB 2W10A 1OPKA 3Q1JA 4BB7A 4QQGA 1M90U 2CP6A 3QO3A 1UB4A 3L2WA 4PLLA 1RABB 1WHMA 2LC4A 3JCMJ 1WFWA 2SRCA 5D7UA 2DYBA 3CCET 1NG2A 2D8HA 1M90R 3NPFA 4OGEA 4DBFA 1ZQ1A 1GFCA 2H3EB 2K7AA 2HL3A 2EGEA 2CDTA 2E65A 2LNVA 2DETA 3QIIA 1QVPA 3VS3A 3JCMW 3OYFA 2V8KA 3SD4A 4LUDA 1PRMC 2E41A 4IIMA 2DTHA 4AFQC 3CD6A 2E12A 4HCCA 3QYHB 3L2RA 2IVWA 3A5ZB 4PJNA 1M1FA 5CR2A 1V1CA 1IRXA 2CZ6B 2COZA 3DB4A 5FU6B 3CPFA 1W70A 2J6KA 1KC8U 4M78C 4QKUA 1NPPA 1I4K1 5GAOl 1IO6A 2DD4A 3I55A 1VQ9A 2DL7A 1ZX6A 1JXOA 3EHRA 3KFVA 1YIJT 3QWYA 2A08A 4IIOA 1OV3A 3CMET 3TSZA 3EG9B 2MAMA 1ABQA 3SWNC 2V1QA 2RMOA 5AT1B 2YUNA 3CXCS 3M0SA 2FPDA 1G5VA 3I55T 1RAGB 2LDMA 2YLCA 1I07A 2J6FA 3RERA 4IUVA 5GAMd 1U1SA 4XTXA 5FW9A 4A63B 3L2ZA 4V2SA 2KNBB 2YT6A 5IHIA 5GAOm 1X2QA 1I81A 1HK9A 5GMKj 3VUBA 2JZ2A 2QG9B 3OS0A 1I5OB 1IZ6A 2F2WA 1VQKA 2K3YA 4CC4B 1WI7A 3CCSA 3M59A 1NJIC 3OW2A 1QWFA 4L5GA 2AIRB 5ECAA 2FZGB 1YN8A 4C92B 1D0YA 4M75G 1FYNA 2GNCA 1X43A 2P0KA 2G6FX 2DERA 3UT1A 1OX8A 2GGRA 4DBHA 1VYUA 3QDRB 2J05A 3PIOA 3AT1B 3OYNA 1AWXA 3WVDB 1UE9A 2HAXA 2CKKA 2JOYA 1AD5A 4C0FA 1KIKA 3SWNB 5GAMf 4OMOA 1D1AA 1V76A 2JT4A 5CIUA 1WIEA 2DJQA 3TCJA 1QCOA 4FIBA 4FT2A 4FCYA 1Y7XA 4XTWA 4II1A 5GAN6 1H3ZA 1TS9A 1IGUA 3OS1A 2YRDA 3JCMg 2V8IA 4C8QF 2A37A 4X1VA 1ZUUA 1YJNQ 1G2BA 4J83A 3SWNA 3CCLQ 1GXIE 2OTLA 3M55A 3MCAB 2EW3A 2KBTA 5HK3A 4M7AA 2O31A 2LQWA 1QVGA 2EYXA 4F7UE 5GAN7 4LDVA 2CSIA 3MJXA 5LJ5h 1N27A 5KYWB 4C5HA 3A8MB 2KY9A 3JCMX 3OW2P 2M0YA 1YI2A 3CCQQ 1HJDA 2EYZA 5GMKi 2ED0A 4RCBA 3JRZA 1TUCA 1K73C 4PJOG 3UF4A 4DEXA 1B07A 2E4HA 2ZPBB 3OYYA 4RMOA 2C0IA 2LP5A 5D6YA 1VQMQ 2KRNA 2LCLA 2R58A 4J5YA 1K4US 1U1TA 1PD1A 3OSVA 5GANf 2D8JA 2JS2A 5GAN5 2RI3A 1UUEA 4C0DC 4HKEA 5L23A 4CC7A 2BE7D 2CH4W 3EG9A 1KQSA 5I11A 4KUIA 3GP8A 1S72Q 5J26A 5FRMA 4KT0E 2JVVA 3V7CA 2QGFB 1VQNT 1FX7A 4M7AB 4F16A 2ECZA 3X25B 1T0HA 3TU4K 3OYLA 4JRQA 3M9QA 2XDPA 4PJOE 1YI2Q 4GBQA 5CKHA 2ZPEB 4ESRA 1H92A 4KULA 3UWNA 1UFFA 2JXBA 3M0QA 4J6YA 1Q7YC 1RLPC 4Z8AA 3S3NA 4ELZC 1KG1A 1FWZA 2OAUA 3G1JA 3HFOA 4C8QD 2QQAA 4RTXA 1UEBA 5C0MA 7AT1B 4M77A 1YJNA 2RA2A 2X51A 2PU9B 1G83A 3VYHB 1M2VB 1BCMA 4QQ6A 1JU5C 2DXUA 3TQ7P 3EGXB 4QVDA 5KYXB 4EMKC 1X69A 2E70A 2E5QA 4PJOA 3PT9A 1YIJA 1I5LA 4ME7A 1GCQA 4N4IA 4OP0A 1QQJA 3QSUA 3FB9A 2VGNA 1KHIA 1QKWA 2IIMA 2OJ2A 5I21A 2GTOA 4Y28E 1M9SA 1K9MU 2X4JA 3TVTA 4C8QG 4P5NA 5KCOA 3OYCA 3NTIA 2RJEA 3OQ5A 2WACA 3QJ6A 1GBRA 2JNGA 3RKYA 2L89A 4KUDK 3DB3A 4M77C 1PC0A 4KH0B 4XAXB 2DRMA 3CD6Q 1M1KU 2Y90A 4FYXB 1VQKQ 4JPBW 1Q86U 2RM4A 3OYKA 3H0FA 4WCIA 1JJ2A 3OSSC 3OYJA 5DY9A 2EJGA 1XNIA 1TWBA 4JS4A 2ZAEA 4XTZA 4A53A 3VYGA 2OTJA 4RCCA 3CMEA 2GBQA 3LGLA 3NTHA 3C0CA 2HKQB 3GNFB 5CKFA 1WHKA 4HCZA 1RAIB 2FVUA 1N8RC 4C92G 4J9IA 4KGXB 2K5IA 2BIVA 3E9GA 3M0PA 4FYVB 1ZA2B 3PGGA 4BD3A 1VQPQ 3RNJA 3PIPA 1VQ5A 5FWCA 5GAN8 4PJOD 5GANj 4AFZC 1Y57A 4WTOB 2DBMA 2RQUA 3V8KA 1AT1B 2JS0A 2MPXC 2CREA 4LNPA 5LJ3d 1G8XA 4KGZB 4BI3A 2JN0A 1WHJA 2M9UA 3CPWS 4A4HA 1W2BS 5GAMh 5IH2A 1PSFA 2R57A 3CCVA 5C6SA 2DF6A 1GBQA 2MCNA 2LJ3A 3CMAQ 3BFMA 2C0OA 3BE3A 1QP3A 3X20B 3TSWA 3FIFA 2MOXA 3A8LB 1X6OA 3QUIA 4NS5A 4RKUE 3VS6A 4ANJA 1YNZA 1WXTA 1RL2A 1K9AA 3M0RA 4BY6B 4F7UF 2KROA 1VQ6A 1WYXA 3V7SA 5I2SA 4M7AC 2K2VA 1LVKA 3I56A 2M0OA 2RH2A 1M2VA 4PJMA 3JCMP 3LWIA 2CZ7B 4C5EA 2XKOC 3EFRA 1ZHIA 1JXMA 4OF1A 4JJBA 2CUDA 1KQ2A 3H9NA 2ESWA 1M4ZA 4OMFB 3V8JA 1N5ZA 1UGQB 1Q95G 4C92E 3EG2A 3SHWA 2HZYA 2QDLA 1YJWT 1R0BG 3NMZC 4PJOB 3CBOA 3META 2G3RA 2XIDA 3EG1A 4OGCA 2XD0A 4E7KA 4E6RA 3NGPA 4IURA 1YJ9T 1IGQA 5DLQE 2MWOA 3FRNA 3GLXA 3TEEA 4Q5WA 3CC2T 3CXCA 1KD1C 3CCUQ 1WHHA 4C0ZA 2OAWA 2WSEE 2E6NA 5CAIA 2WSCE 1K76A 4N0AC 1XTDA 4AG1C 4C92D 1OOTA 2QA4T 2D9TA 2PUKB 4F17A 4XK8E 1VQ8A 1VQOA 1BIAA 3ASKA 4EPCA 1AHJB 2P4TA 1XQHA 3MP1A 3OYAA 1NZ9A 3CBMA 4N4GA 1SSHA 3SB2A 2GFAA 2O01E 1VQ7Q 3UATA 4M75F 3EH1A 1HYOA 2CP0A 1YITA 3CXCP 1Q86R 1ACMB 5LJ5f 4M7DE 1M8MA 5GANh 5CQYA 5LJ3f 4J9GA 2VYTA 3J81E 2M02A 4QT7A 1WX6A 1VQPT 1LJOA 1W1FA 1NEGA 1NEBA 1X2KA 4LE9A 3UPUA 1WA7A 4IKFA 2CUBA 2RHUA 5CVIA 1NYGA 4L59A 4Y92A 3KBGA 3JCMe 1UJ0A 1OU8A 1H8KA 2M1HA 5GMKm 2E64A 2GF7A 5D6WA 1RAFB 1TTHB 1O75A 5CQXA 1N6AA 3CMEQ 2I2LA 1UTIA 1PNJA 2BZXA 3E9FA 1TUGB 3OY9A 2LQNA 4E7HA 3WVEB 4ZGJB 4C8QE 2DK3A 4KRTA 1DJ7B 2RNAA 2Y4YA 1YJ9Q 1M1KC 4BY6C 3L1AA 2HD0A 1B34B 4PJOC 5A0LA 3CMAA 2HBWA 4JRIA 2CZ1B 5FU7B 2KT1A 2LJ1A 2JJ9A 3CCVQ 2EPDA 5IHKA 3HTRA 1JBMA 2HKNA 2DPPB 3CCRT 4KH1B 3CCRA 5IXBA 1RAEB 4M78A 1UDLA 2AKLA 3LYIA 4O6JA 2CP7A 1X27A 2R5AA 2NUPA 4JDSA 3V7RA 4ZN3A 1HD3A 4AFUC 2RO0A 1KFZA 1YIJQ 2KI7A 4ZNXA 2YRVA 2XMFA 3N5BB 4L6V5 3JCMf 4DQ2A 2EKHA 4VUBA 1K73R 5GMKe 2L8DA 4JLIA 3JB9H 1BIBA 4JZ3A 3CCQT 2V8JA 1M3AA 4X9CA 5CCAA 4MZPA 1TSFA 4OMNA 2D0QB 2QEXA 4M78E 4FM4B 3QZ9B 2X3XD 4JJCA 3J80E 1MMAA 1VQ5T 4XU3A 1BK2A 1J3TA 1GCPA 2DL3A 1M3CA 2O4XB 1SHFA 2DX1A 4M77E 2L3QA 4PLIA 1FMKA 2ZZDA 2MI6A 4PFOA 4Z88A 2JTFA 5LJ3j 2QQRA 4ZTJA 5GANg 3QKJA 2DILA 4HT8A 3JCMd 2QQBA 1RADB 2D1XA 2B86A 2KAFA 2F1LA 5L8RE 5GAN3 4RTTA 2KMTA 1C0MA 5GANd 3A98A 5CO7A 4XTVA 1YCYA 3HKSA 1EZZB 5DM7R 2GTJA 4OMLA 3P8BB 2QAZA 2XICA 2DNUA 1OI1A 2ENMA 2VGMA 1MMGA 3SFMA 5IAYA 3E2UA 2DTIA 4PJOF 2DTOA 3MP6A 1HSQA 3CCQA 2XG8D 1SG5A 2DRKA 3CD6T 2EGAA 1VQ4T 4M75A 3GIBA 4AG2C 1UGVA 3HP9A 2DL5A 3ER0A 1WXUA 2RQVA 3M56A 3FC3A 3LX7A 1QP2A 4M75C 3LWHA 4GLKA 1MV3A 1S72T 1K8AR 1W4SA 3M5AA 5AYFA 3CCMA 3AHUA 4BACA 2EJ9A 1IHWA 4RTYA 5IN1A 2EYYA 4NL3A 2DEUA 1K8AU 1M8VA 2A3LA 2H3JA 3HRUA 2K9GA 2RHIA 3SDZA 4F04B 2X3WD 2YXYA 1YJWA 5HY6A 1KHCA 2RHYA 4FT4A 4M77D 1RAHB 2ROLA 1VA7A 1R0CB 1S72A 2F5TX 4AT1B 1VIFA 4M75E 1G3YA 1V29B 3PTAA 3RESA 1K9MR 1MHNA 1OQKA 4PL6A 4LD9K 2XU8A 2EQUA 1PM3A 3PE0A 2BUDA 1JB0E 2PUOB 1TG0A 4C0DB 4FW1A 2E1HA 5IHNA 4YTLA 3C95A 4EMGA 1N9RA 3C4SA 4XQ3A 1SRLA 2MF2A 2VB6A 3L2QA 1QLYA 3VS2A 4CC3A 1M2OA 2EYQA 4RUGA 2FZKB 2KEAA 4ZN1A 4M7AE 4FL6A 4C8QB 2E5KA 4J9FA 3VS7A 4C5GA 1I8FA 4MMKA 2AHJB 1QVFS 3EFOB 1Q81U 3CC7Q 4M7AF 1JO8A 2E3IA 2DZCA 4PKCC 2OTLQ 2COWA 1KQ1A 2FB7A 2L5QA 3X28B 1PD0A 2QTVA 2QDYB 5FRNA 3G4ST 4RTVA 1VYVA 4B9WA 2EYWA 3BDUA 4OB2B 1VQKT 3VS1A 4A54A 2BTTA 1K8AC 1VQMT 5CK9A 5IT9E 2CP2A 4B6MA 2F2XA 1D09B 1YP5A 2JTMA 4E7SA 2NLUA 1IREB 1E6HA 1E7OA 2VXEA 1PCXA 5A2QE 3CCJT 4E7LA 3ZL7C 3OMCA 5DLOA 2DVEA 2WSFE 4RG2A 2PQWA 1T3LA 4HXJA 1NYFA 2K2MA 1WJQA 5KYWA 3CCSQ 4F14A 1OZ2A 3QYGB 2DEQA 1TOVA 3I56Q 1C6VX 1Q7YU 1ZSZB 3CCMT 4E2FB 2FRWA 1WNLA 1JEGA 1RI9A 4XU0A 1M1GA 3CCJA 2GQVA 1IXDA 2V26A 2YLBA 4OMPA 2LRQA 4OVAA 1Q7YR 2C0TA 1N8RR 2A36A 4XTUA 4BE0A 2JM9A 2D0NA 1Y0MA 3FJPA 2HNIA 2HMAA 4FYYB 9ATCB 3H0IA 1AEYA 2HBPA 3MEAA 1IHVA 1NM7A 1AWOA 2NUTA 1SEMA 2DMOA 5LL6S 2P0PA 1WHLA 4J6WA 5GAN4 5KCHA 2KDSA 2CGHA 2J6OA 1U8RA 1PG5B 2EVRA 1D1BA 3VRZA 3OBYA 2QA4A 1SRMA 3M57A 1Z9ZA 1ZUKA 3CC4T 2L0AA 3G71T 3FDRA 3BY7A 3CPWP 1VQ9Q 2DFUA 2QA4Q 4M7AG 1PHTA 4ZGDB 1WQWA 3HHTB 2LVMA 1WZOA 2DM1A 5GAOp 1RACB 1RI0A 3ZFJA 2HDAA 1ZLMA 1H641 1BB9A 4FW2A 1VQPA 1M1KR 4OB1B 2RHZA 1YHQA 3MEUA 3M4YA 3OYDA 3L42A 2JUFA 4Z89A 3EFOA 2RQRA 3REBB 3A8HB 3EG0A 1M5Q1 2K3XA 5M9OA 2KVQG 3UDCA 5GJVB 2FO0A 1WHGA 3OYBA 2DLPA 4D6WA 2PVGB 5KYUA 3CC7A 1UG1A 2EQKA 4A4FA 3RDVA 3G6EA 3DLMA 1VQOT 3VU3C 2DIGA 1ZUYA 2X9HA 2K57A 5LJ3g 4JS5A 2RQTA 3JB9F 1ZSZC 3JCMb 1QVFA 3M58A 2DAQA 5KYYB 2AZSA 3FEOA 2QGGA 2H8HA 2B8AA 3M54A 4HCBA 2FPEA 1VQLQ 4D8KA 4O5VA 3JCMQ 1U06A 1BI1A 1T0JA 1U3OA 1UGRB 3RIRA 1QVGP 4PNOA 4JLGA 3EAEA 2C06A 2KQWA 2RK1A 1QVGS 3JB9I 1YJWQ 4C5IA 2CT3A 1KJWA 5LJ5e 2VASA 1E6GA 1W2BA 3U23A 5LJ5d 3RR6A 2FYKA 3GPLA 1ABOA 1KK7A 1VQNA 3GBQA 3CCMQ 1HXDA 1ZSZA 3HL8A 1UHCA 3I9QA 3RMSA 1NJIR 4PJLA 2F2VA 1JQQA 1OYXA 4IUTA 4ATOA 3L2UA 1PSEA 2O88A 1YJNT 3X24B 2LMJA 3M0TA 2DXCA 3A1PA 4M4ZA 4C92C 3CC2A 4Z02A 4CI0C 1QWEA 4KGVB 1M30A 4C92A 3L2VA 4ZTFA 4C8QC 1KQSP 3O8VA 4FSXA 3JSCA 1Q81C 2DJZA 4J9HA 2ZGWA 4MMLA 2NUPB 3VS5A 1VQ7T 3OS2A 3OB9A 1ZA1B 4OB3B 1VQLA 2FG0A 2RHXA 4XTYA 1FMWA 1KC8R 2ZCFB 2RF0A 2F69A 3E19A 3G6ET 2VV5A 2XDBA 2DIQA 1AZGB 2V1RA 4PJJA 1WJRA 1VQMA 2DYIA 1SSFA 3OMGA 4J9CA 2AZVA 4LDWA 4A4GA 2HL5C 3H41A 3PVQA 1F1BB 1YHQT 2XDDA 4HVWA 5HCKA 2YDLA 2D6FA 1PWTA 1VQLT 4M7DC 3M53A 1K0XA 5GMKl 4DBQA 3PMIA 1K9MC 4N0AA 2X4XA 1AZEA 3G7ZA 3CCLA 3MKDA 1BI2A 3ME9A 2PTKA 2L3PA 3CCLT 1M90C 3S6WA 5GAOr 5LJ5g 4MDXA 5CKEA 4F7UG 4R55A 2ABLA 2RK2A 2K4YA 3MP8A 1UHFA 3EGDA 2DD5A 4M77F 4JRKA 2GFUA 1G3WA 4UC4A 2DBKA 1Y71A 4IUQA 2HSEB 5FWBA 1Q82C 3S3OA 2CZ0B 5KE2A 2O9SA 1MNDA 2RPNA 1YFNA 3RKWA 1AVZC 3T9NA 2IPOB 2JMCA 3I35A 1PKSA 3I5SA 5FU7C 1SPKA 1PKTA 1H3HA 5CKBA 3VV0A 1VUBA 4XU2A 4LD6A 3URGA 1ZBJA 2FEIA 4PK4A 3OS5A 1BU1A 4DOVA 3H8ZA 2J7IA 5GJWB 3M4GA 3VUZA 4M78G 1QMCA 1MMDA 1EFNA 3QG1A 4HT9A 1WXBA 1B7TA 3R6NA 5GAMj 2FL7A 2DVJA 2GQIA 4BI8B 2MIOA 4HVUA 3BW1A 3QZ5B 3G6EQ 1G3TA 4E7JA 1XJWB 4DBRA 3SEMA 3I5RA 2L3RA 4M7DF 2EBPA 3EGDB 1EX4A 2E3HA 4DA4A 3QBYA 4C92F 4JUVA 1ZBXA 4EIKA 1FMVA 3VRYA 2RI5A 4EMKB 4DOWA 2K79A 4F7UA 1YHQQ 1NJIU 1QCNA 1PRLC 1EIFA 3JB9J 1I1JA 1YITT 4ELYC 1N9SA 3H0HA 1SHGA 3ULRB 1CKBA 2PVOB 4EDUA 2ZPHB 3A8GB 4MDWA 3CC7T 4FSSA 2QASA 1BI0A 2X4YA 1S1NA 2ATCB 2NWMA 3DKMA 3PVLA 2Z0WA 1LCKA 1LOJA 2RQWA 4BUGA 3LH5A 4HA8A 2E10A 3PFSA 4EMHA 1YBYA 4AMCA 2YWWA 1OEBA 1NPRA 4J8OA 4R0KA 1MGQA 4JJDA 4C8QA 5HK0A 2LZ6B 5I2MA 2EQJA 1OU9A 1Q82R 4JRPA 2QYZA 4X9DA 4RTZA 2EJFA 2HQXA 2LNHB 1D1CA 1KSWA 1VQOQ 2FRYA
chains in the Genus database with same CATH topology
3TSWA 2MOXA 2RN8A 1E6HA 4RTUA 3M0UA 2YUOA 1E7OA 3VS6A 1K1ZA 1OPLA 1YNZA 1NLOC 1WXTA 2KYBA 3ZL7C 4J9DA 2W10A 1K9AA 3EG3A 3M0RA 1OPKA 1T3LA 1CSKA 2KROA 1WYXA 4HXJA 2VVKA 1NYFA 2K2MA 2M51A 2HCKA 4F14A 1WFWA 2SRCA 2DYBA 1NG2A 2D8HA 2KE9A 3NPFA 2EGCA 2FRWA 1GFCA 1JEGA 1RI9A 2K7AA 1JXMA 4JJBA 2DA9A 2EGEA 2CDTA 2CUDA 4OMPA 3VS3A 2ESWA 3O5ZA 2C0TA 2A36A 1N5ZA 3REAB 2JM9A 4LUDA 1PRMC 2D0NA 3EG2A 1Y0MA 3SHWA 2QDLA 4IIMA 4AFQC 3NMZC 3H0IA 1GRIA 1AEYA 3EG1A 2AKKA 1NM7A 1V1CA 1UJYA 2FPFA 1AWOA 1SEMA 4E6RA 3NGPA 1CKAA 2DMOA 1W70A 1YWOA 2J6KA 4LN2A 2J6OA 2OAWA 2EVRA 3VRZA 1K76A 4AG1C 1IO6A 1SRMA 2DL7A 1ZX6A 1OOTA 4JZ4A 1JXOA 3EHRA 1Z9ZA 1ZUKA 3KFVA 2L0AA 3QWYA 2A08A 4IIOA 4F17A 1OV3A 4ORZA 2LCSA 3TSZA 2JMAA 1PHTA 2W0ZA 1ABQA 1M27C 2DM1A 2V1QA 1X6GA 5I22A 1SSHA 2HDAA 1NLPC 2OI3A 2RMOA 1ZLMA 2YUNA 1BB9A 3M0SA 2FPDA 3UATA 1I07A 2J6FA 1M8MA 2YSQA 4Z89A 4J9GA 5FW9A 4A63B 2RQRA 3FJ5A 4QT7A 3REBB 1BBZA 1WX6A 3EG0A 2KNBB 1W1FA 1NEGA 1NEBA 1X2KA 2FO0A 5GJVB 4LE9A 2YT6A 4RTWA 1WA7A 5IHIA 1X2QA 4OMMA 2CUBA 2DLPA 3VS4A 4HVVA 2DE0X 1NYGA 1UG1A 4Y92A 2AK5A 2LX7A 2F2WA 1UJ0A 1B3QA 1H8KA 4CC4B 1WI7A 1ZUYA 1QWFA 5ECAA 1QCFA 2RQTA 1XOVA 1YN8A 5IXFA 1FYNA 1UTIA 1PNJA 2GNCA 2BZXA 1X43A 1ARKA 2G6FX 2AZSA 1GFDA 2LQNA 2GGRA 2H8HA 4KRTA 1VYUA 2JM8A 2P4RA 2FPEA 2J05A 4D8KA 1U06A 2RNAA 1AWXA 3JV3A 1UE9A 1KIKA 1AD5A 1T0JA 1ZSGA 1U3OA 4OMOA 2JT4A 1WIEA 2DJQA 2HBWA 2KT1A 2LJ1A 2EPDA 5IHKA 2CT3A 2I0NA 1KJWA 3RBBB 4D8DA 2L2PA 1E6GA 3U23A 2A37A 4X1VA 1ZUUA 5IXBA 1ABOA 1G2BA 3NHNA 4AFSC 1UDLA 2L3SA 2AKLA 3GBQA 1X27A 2ROTA 2A28A 3I9QA 1UHCA 1HD3A 4AFUC 2KT8A 1KFZA 2EW3A 2KBTA 2F2VA 1JQQA 4ZNXA 2O31A 1WLPB 1YWPA 2LQWA 2EYXA 2CSIA 2XMFA 2O88A 2LJ0A 2LMJA 3M0TA 2M0YA 1WDXA 4M4ZA 2EKHA 2K6DA 1HJDA 1MV0B 2EYZA 1QWEA 2ED0A 1M30A 1TUCA 2SEMA 2CSQA 3UF4A 4JZ3A 1VYTA 4DEXA 1B07A 1M3AA 2C0IA 2LP5A 2KRNA 4J9HA 4OMNA 3VS5A 3UA6A 2X3XD 1K4US 4JJCA 2JTEA 2D8JA 2JS2A 1YCSB 1UUEA 3UA7A 2KGTA 1BK2A 4K11A 5L23A 4CC7A 2CH4A 2FG0A 1J3TA 1GCPA 2DL3A 2CH4W 1M3CA 5I11A 1SHFA 2RF0A 2DX1A 2L3QA 1AZGB 1Z9QA 2V1RA 1FMKA 2YUPA 4J9CA 2KR3A 4Z88A 2AZVA 4F16A 3THKA 2BZ8A 2ECZA 3H41A 1T0HA 3PVQA 4OMQA 2DILA 4GBQA 4HVWA 5EC7A 5HCKA 4ESRA 2YDLA 1H92A 2D1XA 1GL5A 2B86A 1UFFA 1PWTA 2JXBA 3M0QA 2YUQA 1K0XA 1RLPC 4RTTA 4Z8AA 3A98A 1AWWA 2VWFA 2HEQA 2GTJA 4OMLA 2DNUA 2ENMA 1A0NB 1AZEA 4RTXA 1K0SA 2PTKA 2NUZA 2L3PA 4J9BA 1HSQA 1I0CA 3VS0A 3CQTA 2DRKA 2EGAA 1G83A 4GLMA 2PZ1A 2ABLA 1JU5C 4AG2C 1UGVA 2DL5A 1WXUA 2RQVA 1X69A 1UHFA 2CT4A 2KYMA 1MV3A 1GCQA 2DBKA 2VKNA 3IQLA 4CC2A 1TUDA 5FWBA 1QKXA 1QKWA 2EQIA 2O9SA 2RPNA 2IIMA 1AVZC 1T3SA 2KXDA 2OJ2A 2JMCA 4RTYA 3I35A 1PKSA 2EYYA 3I5SA 1SPKA 1PKTA 2GTOA 1H3HA 2K9GA 1ZBJA 2FEIA 1M3BA 3TVTA 2KRSA 2X3WD 1BU1A 4LUEA 2J7IA 5GJWB 2DL4A 1VA7A 2ROLA 2J06A 2O9VA 1EFNA 1GBRA 1WXBA 3R6NA 1GCQC 1X6BA 3EHQA 2DVJA 2GQIA 2MIOA 4HVUA 2DRMA 3PE0A 2BZYA 1TG0A 4JPBW 5IHNA 2KXCA 2O2OA 3H0FA 4WCIA 3SEMA 1SRLA 3I5RA 2EBPA 3QWXX 1MUZA 1QLYA 2GBQA 1RUWA 2PNIA 3C0CA 3VS2A 4CC3A 4EIKA 1AWJA 4RUGA 2KEAA 3VRYA 2HSPA 1RLQC 1W6XA 4J9IA 2E5KA 2K79A 1AOJA 4J9FA 3VS7A 2DL8A 2K3BA 3M0PA 1U5SA 3RNJA 1PRLC 1I1JA 5FWCA 1JO8A 1UECA 3H0HA 1SHGA 4DEYA 3ULRB 1CKBA 4AFZC 1Y57A 2DBMA 2RQUA 4FSSA 1S1NA 2NWMA 2JS0A 2CREA 3PVLA 4LNPA 1LCKA 2RQWA 3LH5A 4RTVA 1OEBA 1VYVA 3EGUA 2EYWA 2ED1A 4HCKA 4J9EA 4R0KA 3VS1A 4JJDA 2KRMA 5IH2A 2LZ6B 2BTTA 2DF6A 1GBQA 4RTZA 2MCNA 2JW4A 2LJ3A 2C0OA 2LNHB 2F2XA 1KSWA 2FRYA 1YP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSW A;  2MOX A;  2RN8 A;  1E6H A;  4RTU A;  3M0U A;  2YUO A;  1E7O A;  3VS6 A;  1K1Z A;  1OPL A;  1YNZ A;  1NLO C;  1WXT A;  2KYB A;  3ZL7 C;  4J9D A;  2W10 A;  1K9A A;  3EG3 A;  3M0R A;  1OPK A;  1T3L A;  1CSK A;  2KRO A;  1WYX A;  4HXJ A;  2VVK A;  1NYF A;  2K2M A;  2M51 A;  2HCK A;  4F14 A;  1WFW A;  2SRC A;  2DYB A;  1NG2 A;  2D8H A;  2KE9 A;  3NPF A;  2EGC A;  2FRW A;  1GFC A;  1JEG A;  1RI9 A;  2K7A A;  1JXM A;  4JJB A;  2DA9 A;  2EGE A;  2CDT A;  2CUD A;  4OMP A;  3VS3 A;  2ESW A;  3O5Z A;  2C0T A;  2A36 A;  1N5Z A;  3REA B;  2JM9 A;  4LUD A;  1PRM C;  2D0N A;  3EG2 A;  1Y0M A;  3SHW A;  2QDL A;  4IIM A;  4AFQ C;  3NMZ C;  3H0I A;  1GRI A;  1AEY A;  3EG1 A;  2AKK A;  1NM7 A;  1V1C A;  1UJY A;  2FPF A;  1AWO A;  1SEM A;  4E6R A;  3NGP A;  1CKA A;  2DMO A;  1W70 A;  1YWO A;  2J6K A;  4LN2 A;  2J6O A;  2OAW A;  2EVR A;  3VRZ A;  1K76 A;  4AG1 C;  1IO6 A;  1SRM A;  2DL7 A;  1ZX6 A;  1OOT A;  4JZ4 A;  1JXO A;  3EHR A;  1Z9Z A;  1ZUK A;  3KFV A;  2L0A A;  3QWY A;  2A08 A;  4IIO A;  4F17 A;  1OV3 A;  4ORZ A;  2LCS A;  3TSZ A;  2JMA A;  1PHT A;  2W0Z A;  1ABQ A;  1M27 C;  2DM1 A;  2V1Q A;  1X6G A;  5I22 A;  1SSH A;  2HDA A;  1NLP C;  2OI3 A;  2RMO A;  1ZLM A;  2YUN A;  1BB9 A;  3M0S A;  2FPD A;  3UAT A;  1I07 A;  2J6F A;  1M8M A;  2YSQ A;  4Z89 A;  4J9G A;  5FW9 A;  4A63 B;  2RQR A;  3FJ5 A;  4QT7 A;  3REB B;  1BBZ A;  1WX6 A;  3EG0 A;  2KNB B;  1W1F A;  1NEG A;  1NEB A;  1X2K A;  2FO0 A;  5GJV B;  4LE9 A;  2YT6 A;  4RTW A;  1WA7 A;  5IHI A;  1X2Q A;  4OMM A;  2CUB A;  2DLP A;  3VS4 A;  4HVV A;  2DE0 X;  1NYG A;  1UG1 A;  4Y92 A;  2AK5 A;  2LX7 A;  2F2W A;  1UJ0 A;  1B3Q A;  1H8K A;  4CC4 B;  1WI7 A;  1ZUY A;  1QWF A;  5ECA A;  1QCF A;  2RQT A;  1XOV A;  1YN8 A;  5IXF A;  1FYN A;  1UTI A;  1PNJ A;  2GNC A;  2BZX A;  1X43 A;  1ARK A;  2G6F X;  2AZS A;  1GFD A;  2LQN A;  2GGR A;  2H8H A;  4KRT A;  1VYU A;  2JM8 A;  2P4R A;  2FPE A;  2J05 A;  4D8K A;  1U06 A;  2RNA A;  1AWX A;  3JV3 A;  1UE9 A;  1KIK A;  1AD5 A;  1T0J A;  1ZSG A;  1U3O A;  4OMO A;  2JT4 A;  1WIE A;  2DJQ A;  2HBW A;  2KT1 A;  2LJ1 A;  2EPD A;  5IHK A;  2CT3 A;  2I0N A;  1KJW A;  3RBB B;  4D8D A;  2L2P A;  1E6G A;  3U23 A;  2A37 A;  4X1V A;  1ZUU A;  5IXB A;  1ABO A;  1G2B A;  3NHN A;  4AFS C;  1UDL A;  2L3S A;  2AKL A;  3GBQ A;  1X27 A;  2ROT A;  2A28 A;  3I9Q A;  1UHC A;  1HD3 A;  4AFU C;  2KT8 A;  1KFZ A;  2EW3 A;  2KBT A;  2F2V A;  1JQQ A;  4ZNX A;  2O31 A;  1WLP B;  1YWP A;  2LQW A;  2EYX A;  2CSI A;  2XMF A;  2O88 A;  2LJ0 A;  2LMJ A;  3M0T A;  2M0Y A;  1WDX A;  4M4Z A;  2EKH A;  2K6D A;  1HJD A;  1MV0 B;  2EYZ A;  1QWE A;  2ED0 A;  1M30 A;  1TUC A;  2SEM A;  2CSQ A;  3UF4 A;  4JZ3 A;  1VYT A;  4DEX A;  1B07 A;  1M3A A;  2C0I A;  2LP5 A;  2KRN A;  4J9H A;  4OMN A;  3VS5 A;  3UA6 A;  2X3X D;  1K4U S;  4JJC A;  2JTE A;  2D8J A;  2JS2 A;  1YCS B;  1UUE A;  3UA7 A;  2KGT A;  1BK2 A;  4K11 A;  5L23 A;  4CC7 A;  2CH4 A;  2FG0 A;  1J3T A;  1GCP A;  2DL3 A;  2CH4 W;  1M3C A;  5I11 A;  1SHF A;  2RF0 A;  2DX1 A;  2L3Q A;  1AZG B;  1Z9Q A;  2V1R A;  1FMK A;  2YUP A;  4J9C A;  2KR3 A;  4Z88 A;  2AZV A;  4F16 A;  3THK A;  2BZ8 A;  2ECZ A;  3H41 A;  1T0H A;  3PVQ A;  4OMQ A;  2DIL A;  4GBQ A;  4HVW A;  5EC7 A;  5HCK A;  4ESR A;  2YDL A;  1H92 A;  2D1X A;  1GL5 A;  2B86 A;  1UFF A;  1PWT A;  2JXB A;  3M0Q A;  2YUQ A;  1K0X A;  1RLP C;  4RTT A;  4Z8A A;  3A98 A;  1AWW A;  2VWF A;  2HEQ A;  2GTJ A;  4OML A;  2DNU A;  2ENM A;  1A0N B;  1AZE A;  4RTX A;  1K0S A;  2PTK A;  2NUZ A;  2L3P A;  4J9B A;  1HSQ A;  1I0C A;  3VS0 A;  3CQT A;  2DRK A;  2EGA A;  1G83 A;  4GLM A;  2PZ1 A;  2ABL A;  1JU5 C;  4AG2 C;  1UGV A;  2DL5 A;  1WXU A;  2RQV A;  1X69 A;  1UHF A;  2CT4 A;  2KYM A;  1MV3 A;  1GCQ A;  2DBK A;  2VKN A;  3IQL A;  4CC2 A;  1TUD A;  5FWB A;  1QKX A;  1QKW A;  2EQI A;  2O9S A;  2RPN A;  2IIM A;  1AVZ C;  1T3S A;  2KXD A;  2OJ2 A;  2JMC A;  4RTY A;  3I35 A;  1PKS A;  2EYY A;  3I5S A;  1SPK A;  1PKT A;  2GTO A;  1H3H A;  2K9G A;  1ZBJ A;  2FEI A;  1M3B A;  3TVT A;  2KRS A;  2X3W D;  1BU1 A;  4LUE A;  2J7I A;  5GJW B;  2DL4 A;  1VA7 A;  2ROL A;  2J06 A;  2O9V A;  1EFN A;  1GBR A;  1WXB A;  3R6N A;  1GCQ C;  1X6B A;  3EHQ A;  2DVJ A;  2GQI A;  2MIO A;  4HVU A;  2DRM A;  3PE0 A;  2BZY A;  1TG0 A;  4JPB W;  5IHN A;  2KXC A;  2O2O A;  3H0F A;  4WCI A;  3SEM A;  1SRL A;  3I5R A;  2EBP A;  3QWX X;  1MUZ A;  1QLY A;  2GBQ A;  1RUW A;  2PNI A;  3C0C A;  3VS2 A;  4CC3 A;  4EIK A;  1AWJ A;  4RUG A;  2KEA A;  3VRY A;  2HSP A;  1RLQ C;  1W6X A;  4J9I A;  2E5K A;  2K79 A;  1AOJ A;  4J9F A;  3VS7 A;  2DL8 A;  2K3B A;  3M0P A;  1U5S A;  3RNJ A;  1PRL C;  1I1J A;  5FWC A;  1JO8 A;  1UEC A;  3H0H A;  1SHG A;  4DEY A;  3ULR B;  1CKB A;  4AFZ C;  1Y57 A;  2DBM A;  2RQU A;  4FSS A;  1S1N A;  2NWM A;  2JS0 A;  2CRE A;  3PVL A;  4LNP A;  1LCK A;  2RQW A;  3LH5 A;  4RTV A;  1OEB A;  1VYV A;  3EGU A;  2EYW A;  2ED1 A;  4HCK A;  4J9E A;  4R0K A;  3VS1 A;  4JJD A;  2KRM A;  5IH2 A;  2LZ6 B;  2BTT A;  2DF6 A;  1GBQ A;  4RTZ A;  2MCN A;  2JW4 A;  2LJ3 A;  2C0O A;  2LNH B;  2F2X A;  1KSW A;  2FRY A;  1YP5 A; 
#chains in the Genus database with same CATH topology
 1YJ9 A;  2P84 A;  1NE8 A;  3CCE A;  3LW5 E;  4LDX A;  2FZC B;  4OB0 B;  2RN8 A;  3RKX A;  2YUO A;  3EH2 A;  1K1Z A;  3CPW A;  1NLO C;  2KYB A;  2CS7 A;  4J9D A;  4M78 D;  3EG3 A;  5KYY A;  5GAN 2;  1CSK A;  3CCJ Q;  2VVK A;  2M51 A;  2Y4X A;  3RUX A;  5HKC A;  1TH7 A;  1BCO A;  2HCK A;  5LJ5 j;  4M75 B;  1B34 A;  2KE9 A;  4BDZ A;  2PVD B;  3FLG A;  5GAM e;  2EGC A;  3C94 A;  3G4S Q;  2RI2 A;  2DA9 A;  2BKD N;  3O5Z A;  3G4S A;  4E47 A;  2X35 A;  2GCX A;  3MPU B;  3REA B;  5J3B A;  5GAN e;  2EWN A;  4BE2 A;  3CCU T;  5KE3 A;  3ZBD A;  1MNE A;  1YIT Q;  1GRI A;  2AKK A;  3OYG A;  2YRC A;  2FPF A;  1UJY A;  5EG2 A;  2DZ9 A;  1CKA A;  1VQ6 Q;  1YWO A;  2RJF A;  3E1S A;  4LN2 A;  2LTO A;  3JCM h;  4NL2 A;  1D0X A;  4BE1 A;  1SF9 A;  4JZ4 A;  5A0D A;  3S3M A;  1VQ8 Q;  3WXM B;  2NYS A;  3CCE Q;  5A0G A;  4ORZ A;  2LX9 A;  2LCS A;  2HQE A;  3CCS T;  1VQ4 A;  3CMA T;  8AT1 B;  2JMA A;  2ZPI B;  3OYE A;  3H6Z A;  2W0Z A;  3I56 T;  5KYN A;  2R5M A;  4KBM B;  1M27 C;  4PFZ A;  2RJC A;  4M7A D;  3JCM c;  1X6G A;  1C1A A;  5I22 A;  1NLP C;  2OI3 A;  1Y07 A;  3EGX A;  4BI4 A;  3OYM A;  1Y96 B;  2RJD A;  3MO8 A;  3QJY A;  5FLX E;  4M77 B;  2MYS A;  2M16 A;  2P0Q A;  3R6O A;  3OW2 S;  2YSQ A;  3D7S B;  2KSS A;  3QHS A;  3JB9 D;  1KQS S;  3FJ5 A;  5GMK h;  1BBZ A;  3OBW A;  1P92 A;  3HRT A;  3KUF A;  4FU6 A;  4RTW A;  4FYW B;  2RB6 A;  2MK5 A;  4OMM A;  2LT4 A;  3VS4 A;  1BKB A;  4HVV A;  4PFP A;  2DE0 X;  2AK5 A;  2LX7 A;  2MMP A;  6AT1 B;  2EKO A;  4J7F A;  1B3Q A;  1YI2 T;  2DO3 A;  3CC4 Q;  2AT1 B;  4M78 B;  2DXB A;  1OZ3 A;  1QCF A;  1XOV A;  3QDF A;  2OTJ Q;  2EQM A;  5IXF A;  2OTL T;  3PMT A;  1KD1 U;  2COY A;  1ARK A;  3HSB A;  2XHC A;  1OX9 A;  1GFD A;  5GAO n;  1JRI A;  2JM8 A;  2P4R A;  3JV3 A;  1WPY A;  1QVF P;  4JJN K;  1ZSG A;  1VQ6 T;  1R8O B;  3A8O B;  1Q82 U;  1WQ7 A;  1JJ2 S;  4GY5 A;  5LJ3 h;  2QEX Q;  3VJP A;  4IUP A;  3HRS A;  2I0N A;  3RBB B;  1WGS A;  4D8D A;  2ZPF B;  2L2P A;  4QW2 A;  3KXT A;  2K5F A;  4Y91 A;  2QQS A;  2CP3 A;  1MMN A;  3CEY A;  3NHN A;  4AFS C;  5LJ3 e;  2L3S A;  2QI2 A;  1LPL A;  2ROT A;  2LQ8 A;  2A28 A;  5CKD A;  4C0G A;  1D0Z A;  2EIF A;  2KT8 A;  4E7Z A;  5FRO A;  1WJS A;  3G71 A;  1Q86 C;  4M7D B;  4MZM A;  3G71 Q;  1WLP B;  1K73 U;  1YWP A;  1VQ5 Q;  4E7I A;  1VQ9 T;  4QVC A;  2F5K A;  2LJ0 A;  1OUL A;  1NBE B;  1VIE A;  4EMK A;  1WDX A;  5FU6 C;  4QQD A;  3CCR Q;  2K6D A;  1MV0 B;  4QVZ A;  3INZ A;  2SEM A;  3EFS A;  2CSQ A;  1VYT A;  1D3B B;  1N8R U;  2X4W A;  2VUB A;  1RAA B;  3UA6 A;  1VOM A;  2QTX A;  2JTE A;  1UGS B;  1YCS B;  1FXX A;  3UA7 A;  1O9S A;  2KGT A;  4K11 A;  1R77 A;  2CH4 A;  1KC8 C;  1IB8 A;  2OTJ T;  2FHD A;  5KH6 A;  4J6X A;  1Z9Q A;  2LQK A;  3PNW C;  4BDY A;  2YUP A;  4A4E A;  2IG0 A;  2KR3 A;  1Y96 A;  1TXQ A;  3THK A;  2BZ8 A;  3GOX A;  4OMQ A;  8ATC B;  3CC4 A;  1BI3 A;  3OA6 A;  5EC7 A;  3CCV T;  3JB9 G;  1GL5 A;  2A0F B;  2YUQ A;  2KK4 A;  3CBP A;  1AWW A;  2VWF A;  4XU1 A;  4M77 G;  2HEQ A;  1UGP B;  3LH0 A;  2YHT A;  4WF2 A;  3ZEH A;  2QEX T;  3F70 A;  1A0N B;  4IUU A;  1K0S A;  2OX7 A;  2NUZ A;  4J9B A;  2EFI A;  1I0C A;  3HFN A;  3VS0 A;  3MEW A;  3RMQ A;  4RG8 A;  2VC8 A;  3CQT A;  4N4H A;  4GLM A;  2PZ1 A;  3OYI A;  4B9X A;  1VQ7 A;  3GNG A;  2DXT A;  2CT4 A;  3TRE A;  2KYM A;  1W2B P;  2VKN A;  3IQL A;  4CC2 A;  1TUD A;  1QKX A;  3NTK A;  4M7D G;  3QPH A;  4LDU A;  2EQI A;  3HPW A;  1VQ4 Q;  2E6Z A;  1T3S A;  2KXD A;  5J39 A;  2HQH A;  2LT1 A;  1X75 C;  1KD1 R;  4M7D D;  5KYU B;  1TU0 B;  1M3B A;  3CCU A;  3MHX A;  2KRS A;  3MEV A;  2CYZ B;  4LUE A;  2K5L A;  2DL4 A;  2QXF A;  2A7Y A;  2J06 A;  2O9V A;  4MZT A;  1GCQ C;  1X6B A;  4LDY A;  2O4X A;  3EHQ A;  1LNX A;  2BZY A;  5KYX A;  2CP5 A;  5D6X A;  2KXC A;  2O2O A;  4J7I A;  3QWX X;  1MUZ A;  2EAY A;  4M7D A;  3V8L A;  1VQ8 T;  1RUW A;  2PNI A;  3LGF A;  1AWJ A;  1QW1 A;  2DKG A;  2HSP A;  1RLQ C;  1W6X A;  3CC2 Q;  5GAO q;  1JJ2 P;  1AOJ A;  2DL8 A;  2K3B A;  4TVR A;  2BE9 B;  3LLR A;  1U5S A;  3P8D A;  2RD1 A;  4CRI A;  1BYM A;  1UEC A;  4DEY A;  3X26 B;  3BDL A;  3QXE B;  3JCM V;  4M75 D;  2QQ9 A;  2LCC A;  1Q81 R;  1VQN Q;  4ZGE B;  4LXC A;  3VKI A;  1D3B A;  4A4K A;  3GF5 A;  4R56 A;  3EGU A;  4M78 F;  3J7A F;  1X01 A;  5GAM g;  2ED1 A;  4HCK A;  2QK0 A;  4J9E A;  2XI9 A;  2KRM A;  4F7U B;  4NOY A;  2JW4 A;  3JAM E;  2VXF A;  3NFC A;  3DLL A;  3OYH A;  1SKU B;  3C12 A;  4X34 A;  1G3S A;  2MWP A;  4RTU A;  3I55 Q;  3M0U A;  2ZPG B;  1OPL A;  3P8H A;  2XK0 A;  2NUT B;  2W10 A;  1OPK A;  3Q1J A;  4BB7 A;  4QQG A;  1M90 U;  2CP6 A;  3QO3 A;  1UB4 A;  3L2W A;  4PLL A;  1RAB B;  1WHM A;  2LC4 A;  3JCM J;  1WFW A;  2SRC A;  5D7U A;  2DYB A;  3CCE T;  1NG2 A;  2D8H A;  1M90 R;  3NPF A;  4OGE A;  4DBF A;  1ZQ1 A;  1GFC A;  2H3E B;  2K7A A;  2HL3 A;  2EGE A;  2CDT A;  2E65 A;  2LNV A;  2DET A;  3QII A;  1QVP A;  3VS3 A;  3JCM W;  3OYF A;  2V8K A;  3SD4 A;  4LUD A;  1PRM C;  2E41 A;  4IIM A;  2DTH A;  4AFQ C;  3CD6 A;  2E12 A;  4HCC A;  3QYH B;  3L2R A;  2IVW A;  3A5Z B;  4PJN A;  1M1F A;  5CR2 A;  1V1C A;  1IRX A;  2CZ6 B;  2COZ A;  3DB4 A;  5FU6 B;  3CPF A;  1W70 A;  2J6K A;  1KC8 U;  4M78 C;  4QKU A;  1NPP A;  1I4K 1;  5GAO l;  1IO6 A;  2DD4 A;  3I55 A;  1VQ9 A;  2DL7 A;  1ZX6 A;  1JXO A;  3EHR A;  3KFV A;  1YIJ T;  3QWY A;  2A08 A;  4IIO A;  1OV3 A;  3CME T;  3TSZ A;  3EG9 B;  2MAM A;  1ABQ A;  3SWN C;  2V1Q A;  2RMO A;  5AT1 B;  2YUN A;  3CXC S;  3M0S A;  2FPD A;  1G5V A;  3I55 T;  1RAG B;  2LDM A;  2YLC A;  1I07 A;  2J6F A;  3RER A;  4IUV A;  5GAM d;  1U1S A;  4XTX A;  5FW9 A;  4A63 B;  3L2Z A;  4V2S A;  2KNB B;  2YT6 A;  5IHI A;  5GAO m;  1X2Q A;  1I81 A;  1HK9 A;  5GMK j;  3VUB A;  2JZ2 A;  2QG9 B;  3OS0 A;  1I5O B;  1IZ6 A;  2F2W A;  1VQK A;  2K3Y A;  4CC4 B;  1WI7 A;  3CCS A;  3M59 A;  1NJI C;  3OW2 A;  1QWF A;  4L5G A;  2AIR B;  5ECA A;  2FZG B;  1YN8 A;  4C92 B;  1D0Y A;  4M75 G;  1FYN A;  2GNC A;  1X43 A;  2P0K A;  2G6F X;  2DER A;  3UT1 A;  1OX8 A;  2GGR A;  4DBH A;  1VYU A;  3QDR B;  2J05 A;  3PIO A;  3AT1 B;  3OYN A;  1AWX A;  3WVD B;  1UE9 A;  2HAX A;  2CKK A;  2JOY A;  1AD5 A;  4C0F A;  1KIK A;  3SWN B;  5GAM f;  4OMO A;  1D1A A;  1V76 A;  2JT4 A;  5CIU A;  1WIE A;  2DJQ A;  3TCJ A;  1QCO A;  4FIB A;  4FT2 A;  4FCY A;  1Y7X A;  4XTW A;  4II1 A;  5GAN 6;  1H3Z A;  1TS9 A;  1IGU A;  3OS1 A;  2YRD A;  3JCM g;  2V8I A;  4C8Q F;  2A37 A;  4X1V A;  1ZUU A;  1YJN Q;  1G2B A;  4J83 A;  3SWN A;  3CCL Q;  1GXI E;  2OTL A;  3M55 A;  3MCA B;  2EW3 A;  2KBT A;  5HK3 A;  4M7A A;  2O31 A;  2LQW A;  1QVG A;  2EYX A;  4F7U E;  5GAN 7;  4LDV A;  2CSI A;  3MJX A;  5LJ5 h;  1N27 A;  5KYW B;  4C5H A;  3A8M B;  2KY9 A;  3JCM X;  3OW2 P;  2M0Y A;  1YI2 A;  3CCQ Q;  1HJD A;  2EYZ A;  5GMK i;  2ED0 A;  4RCB A;  3JRZ A;  1TUC A;  1K73 C;  4PJO G;  3UF4 A;  4DEX A;  1B07 A;  2E4H A;  2ZPB B;  3OYY A;  4RMO A;  2C0I A;  2LP5 A;  5D6Y A;  1VQM Q;  2KRN A;  2LCL A;  2R58 A;  4J5Y A;  1K4U S;  1U1T A;  1PD1 A;  3OSV A;  5GAN f;  2D8J A;  2JS2 A;  5GAN 5;  2RI3 A;  1UUE A;  4C0D C;  4HKE A;  5L23 A;  4CC7 A;  2BE7 D;  2CH4 W;  3EG9 A;  1KQS A;  5I11 A;  4KUI A;  3GP8 A;  1S72 Q;  5J26 A;  5FRM A;  4KT0 E;  2JVV A;  3V7C A;  2QGF B;  1VQN T;  1FX7 A;  4M7A B;  4F16 A;  2ECZ A;  3X25 B;  1T0H A;  3TU4 K;  3OYL A;  4JRQ A;  3M9Q A;  2XDP A;  4PJO E;  1YI2 Q;  4GBQ A;  5CKH A;  2ZPE B;  4ESR A;  1H92 A;  4KUL A;  3UWN A;  1UFF A;  2JXB A;  3M0Q A;  4J6Y A;  1Q7Y C;  1RLP C;  4Z8A A;  3S3N A;  4ELZ C;  1KG1 A;  1FWZ A;  2OAU A;  3G1J A;  3HFO A;  4C8Q D;  2QQA A;  4RTX A;  1UEB A;  5C0M A;  7AT1 B;  4M77 A;  1YJN A;  2RA2 A;  2X51 A;  2PU9 B;  1G83 A;  3VYH B;  1M2V B;  1BCM A;  4QQ6 A;  1JU5 C;  2DXU A;  3TQ7 P;  3EGX B;  4QVD A;  5KYX B;  4EMK C;  1X69 A;  2E70 A;  2E5Q A;  4PJO A;  3PT9 A;  1YIJ A;  1I5L A;  4ME7 A;  1GCQ A;  4N4I A;  4OP0 A;  1QQJ A;  3QSU A;  3FB9 A;  2VGN A;  1KHI A;  1QKW A;  2IIM A;  2OJ2 A;  5I21 A;  2GTO A;  4Y28 E;  1M9S A;  1K9M U;  2X4J A;  3TVT A;  4C8Q G;  4P5N A;  5KCO A;  3OYC A;  3NTI A;  2RJE A;  3OQ5 A;  2WAC A;  3QJ6 A;  1GBR A;  2JNG A;  3RKY A;  2L89 A;  4KUD K;  3DB3 A;  4M77 C;  1PC0 A;  4KH0 B;  4XAX B;  2DRM A;  3CD6 Q;  1M1K U;  2Y90 A;  4FYX B;  1VQK Q;  4JPB W;  1Q86 U;  2RM4 A;  3OYK A;  3H0F A;  4WCI A;  1JJ2 A;  3OSS C;  3OYJ A;  5DY9 A;  2EJG A;  1XNI A;  1TWB A;  4JS4 A;  2ZAE A;  4XTZ A;  4A53 A;  3VYG A;  2OTJ A;  4RCC A;  3CME A;  2GBQ A;  3LGL A;  3NTH A;  3C0C A;  2HKQ B;  3GNF B;  5CKF A;  1WHK A;  4HCZ A;  1RAI B;  2FVU A;  1N8R C;  4C92 G;  4J9I A;  4KGX B;  2K5I A;  2BIV A;  3E9G A;  3M0P A;  4FYV B;  1ZA2 B;  3PGG A;  4BD3 A;  1VQP Q;  3RNJ A;  3PIP A;  1VQ5 A;  5FWC A;  5GAN 8;  4PJO D;  5GAN j;  4AFZ C;  1Y57 A;  4WTO B;  2DBM A;  2RQU A;  3V8K A;  1AT1 B;  2JS0 A;  2MPX C;  2CRE A;  4LNP A;  5LJ3 d;  1G8X A;  4KGZ B;  4BI3 A;  2JN0 A;  1WHJ A;  2M9U A;  3CPW S;  4A4H A;  1W2B S;  5GAM h;  5IH2 A;  1PSF A;  2R57 A;  3CCV A;  5C6S A;  2DF6 A;  1GBQ A;  2MCN A;  2LJ3 A;  3CMA Q;  3BFM A;  2C0O A;  3BE3 A;  1QP3 A;  3X20 B;  3TSW A;  3FIF A;  2MOX A;  3A8L B;  1X6O A;  3QUI A;  4NS5 A;  4RKU E;  3VS6 A;  4ANJ A;  1YNZ A;  1WXT A;  1RL2 A;  1K9A A;  3M0R A;  4BY6 B;  4F7U F;  2KRO A;  1VQ6 A;  1WYX A;  3V7S A;  5I2S A;  4M7A C;  2K2V A;  1LVK A;  3I56 A;  2M0O A;  2RH2 A;  1M2V A;  4PJM A;  3JCM P;  3LWI A;  2CZ7 B;  4C5E A;  2XKO C;  3EFR A;  1ZHI A;  1JXM A;  4OF1 A;  4JJB A;  2CUD A;  1KQ2 A;  3H9N A;  2ESW A;  1M4Z A;  4OMF B;  3V8J A;  1N5Z A;  1UGQ B;  1Q95 G;  4C92 E;  3EG2 A;  3SHW A;  2HZY A;  2QDL A;  1YJW T;  1R0B G;  3NMZ C;  4PJO B;  3CBO A;  3MET A;  2G3R A;  2XID A;  3EG1 A;  4OGC A;  2XD0 A;  4E7K A;  4E6R A;  3NGP A;  4IUR A;  1YJ9 T;  1IGQ A;  5DLQ E;  2MWO A;  3FRN A;  3GLX A;  3TEE A;  4Q5W A;  3CC2 T;  3CXC A;  1KD1 C;  3CCU Q;  1WHH A;  4C0Z A;  2OAW A;  2WSE E;  2E6N A;  5CAI A;  2WSC E;  1K76 A;  4N0A C;  1XTD A;  4AG1 C;  4C92 D;  1OOT A;  2QA4 T;  2D9T A;  2PUK B;  4F17 A;  4XK8 E;  1VQ8 A;  1VQO A;  1BIA A;  3ASK A;  4EPC A;  1AHJ B;  2P4T A;  1XQH A;  3MP1 A;  3OYA A;  1NZ9 A;  3CBM A;  4N4G A;  1SSH A;  3SB2 A;  2GFA A;  2O01 E;  1VQ7 Q;  3UAT A;  4M75 F;  3EH1 A;  1HYO A;  2CP0 A;  1YIT A;  3CXC P;  1Q86 R;  1ACM B;  5LJ5 f;  4M7D E;  1M8M A;  5GAN h;  5CQY A;  5LJ3 f;  4J9G A;  2VYT A;  3J81 E;  2M02 A;  4QT7 A;  1WX6 A;  1VQP T;  1LJO A;  1W1F A;  1NEG A;  1NEB A;  1X2K A;  4LE9 A;  3UPU A;  1WA7 A;  4IKF A;  2CUB A;  2RHU A;  5CVI A;  1NYG A;  4L59 A;  4Y92 A;  3KBG A;  3JCM e;  1UJ0 A;  1OU8 A;  1H8K A;  2M1H A;  5GMK m;  2E64 A;  2GF7 A;  5D6W A;  1RAF B;  1TTH B;  1O75 A;  5CQX A;  1N6A A;  3CME Q;  2I2L A;  1UTI A;  1PNJ A;  2BZX A;  3E9F A;  1TUG B;  3OY9 A;  2LQN A;  4E7H A;  3WVE B;  4ZGJ B;  4C8Q E;  2DK3 A;  4KRT A;  1DJ7 B;  2RNA A;  2Y4Y A;  1YJ9 Q;  1M1K C;  4BY6 C;  3L1A A;  2HD0 A;  1B34 B;  4PJO C;  5A0L A;  3CMA A;  2HBW A;  4JRI A;  2CZ1 B;  5FU7 B;  2KT1 A;  2LJ1 A;  2JJ9 A;  3CCV Q;  2EPD A;  5IHK A;  3HTR A;  1JBM A;  2HKN A;  2DPP B;  3CCR T;  4KH1 B;  3CCR A;  5IXB A;  1RAE B;  4M78 A;  1UDL A;  2AKL A;  3LYI A;  4O6J A;  2CP7 A;  1X27 A;  2R5A A;  2NUP A;  4JDS A;  3V7R A;  4ZN3 A;  1HD3 A;  4AFU C;  2RO0 A;  1KFZ A;  1YIJ Q;  2KI7 A;  4ZNX A;  2YRV A;  2XMF A;  3N5B B;  4L6V 5;  3JCM f;  4DQ2 A;  2EKH A;  4VUB A;  1K73 R;  5GMK e;  2L8D A;  4JLI A;  3JB9 H;  1BIB A;  4JZ3 A;  3CCQ T;  2V8J A;  1M3A A;  4X9C A;  5CCA A;  4MZP A;  1TSF A;  4OMN A;  2D0Q B;  2QEX A;  4M78 E;  4FM4 B;  3QZ9 B;  2X3X D;  4JJC A;  3J80 E;  1MMA A;  1VQ5 T;  4XU3 A;  1BK2 A;  1J3T A;  1GCP A;  2DL3 A;  1M3C A;  2O4X B;  1SHF A;  2DX1 A;  4M77 E;  2L3Q A;  4PLI A;  1FMK A;  2ZZD A;  2MI6 A;  4PFO A;  4Z88 A;  2JTF A;  5LJ3 j;  2QQR A;  4ZTJ A;  5GAN g;  3QKJ A;  2DIL A;  4HT8 A;  3JCM d;  2QQB A;  1RAD B;  2D1X A;  2B86 A;  2KAF A;  2F1L A;  5L8R E;  5GAN 3;  4RTT A;  2KMT A;  1C0M A;  5GAN d;  3A98 A;  5CO7 A;  4XTV A;  1YCY A;  3HKS A;  1EZZ B;  5DM7 R;  2GTJ A;  4OML A;  3P8B B;  2QAZ A;  2XIC A;  2DNU A;  1OI1 A;  2ENM A;  2VGM A;  1MMG A;  3SFM A;  5IAY A;  3E2U A;  2DTI A;  4PJO F;  2DTO A;  3MP6 A;  1HSQ A;  3CCQ A;  2XG8 D;  1SG5 A;  2DRK A;  3CD6 T;  2EGA A;  1VQ4 T;  4M75 A;  3GIB A;  4AG2 C;  1UGV A;  3HP9 A;  2DL5 A;  3ER0 A;  1WXU A;  2RQV A;  3M56 A;  3FC3 A;  3LX7 A;  1QP2 A;  4M75 C;  3LWH A;  4GLK A;  1MV3 A;  1S72 T;  1K8A R;  1W4S A;  3M5A A;  5AYF A;  3CCM A;  3AHU A;  4BAC A;  2EJ9 A;  1IHW A;  4RTY A;  5IN1 A;  2EYY A;  4NL3 A;  2DEU A;  1K8A U;  1M8V A;  2A3L A;  2H3J A;  3HRU A;  2K9G A;  2RHI A;  3SDZ A;  4F04 B;  2X3W D;  2YXY A;  1YJW A;  5HY6 A;  1KHC A;  2RHY A;  4FT4 A;  4M77 D;  1RAH B;  2ROL A;  1VA7 A;  1R0C B;  1S72 A;  2F5T X;  4AT1 B;  1VIF A;  4M75 E;  1G3Y A;  1V29 B;  3PTA A;  3RES A;  1K9M R;  1MHN A;  1OQK A;  4PL6 A;  4LD9 K;  2XU8 A;  2EQU A;  1PM3 A;  3PE0 A;  2BUD A;  1JB0 E;  2PUO B;  1TG0 A;  4C0D B;  4FW1 A;  2E1H A;  5IHN A;  4YTL A;  3C95 A;  4EMG A;  1N9R A;  3C4S A;  4XQ3 A;  1SRL A;  2MF2 A;  2VB6 A;  3L2Q A;  1QLY A;  3VS2 A;  4CC3 A;  1M2O A;  2EYQ A;  4RUG A;  2FZK B;  2KEA A;  4ZN1 A;  4M7A E;  4FL6 A;  4C8Q B;  2E5K A;  4J9F A;  3VS7 A;  4C5G A;  1I8F A;  4MMK A;  2AHJ B;  1QVF S;  3EFO B;  1Q81 U;  3CC7 Q;  4M7A F;  1JO8 A;  2E3I A;  2DZC A;  4PKC C;  2OTL Q;  2COW A;  1KQ1 A;  2FB7 A;  2L5Q A;  3X28 B;  1PD0 A;  2QTV A;  2QDY B;  5FRN A;  3G4S T;  4RTV A;  1VYV A;  4B9W A;  2EYW A;  3BDU A;  4OB2 B;  1VQK T;  3VS1 A;  4A54 A;  2BTT A;  1K8A C;  1VQM T;  5CK9 A;  5IT9 E;  2CP2 A;  4B6M A;  2F2X A;  1D09 B;  1YP5 A;  2JTM A;  4E7S A;  2NLU A;  1IRE B;  1E6H A;  1E7O A;  2VXE A;  1PCX A;  5A2Q E;  3CCJ T;  4E7L A;  3ZL7 C;  3OMC A;  5DLO A;  2DVE A;  2WSF E;  4RG2 A;  2PQW A;  1T3L A;  4HXJ A;  1NYF A;  2K2M A;  1WJQ A;  5KYW A;  3CCS Q;  4F14 A;  1OZ2 A;  3QYG B;  2DEQ A;  1TOV A;  3I56 Q;  1C6V X;  1Q7Y U;  1ZSZ B;  3CCM T;  4E2F B;  2FRW A;  1WNL A;  1JEG A;  1RI9 A;  4XU0 A;  1M1G A;  3CCJ A;  2GQV A;  1IXD A;  2V26 A;  2YLB A;  4OMP A;  2LRQ A;  4OVA A;  1Q7Y R;  2C0T A;  1N8R R;  2A36 A;  4XTU A;  4BE0 A;  2JM9 A;  2D0N A;  1Y0M A;  3FJP A;  2HNI A;  2HMA A;  4FYY B;  9ATC B;  3H0I A;  1AEY A;  2HBP A;  3MEA A;  1IHV A;  1NM7 A;  1AWO A;  2NUT A;  1SEM A;  2DMO A;  5LL6 S;  2P0P A;  1WHL A;  4J6W A;  5GAN 4;  5KCH A;  2KDS A;  2CGH A;  2J6O A;  1U8R A;  1PG5 B;  2EVR A;  1D1B A;  3VRZ A;  3OBY A;  2QA4 A;  1SRM A;  3M57 A;  1Z9Z A;  1ZUK A;  3CC4 T;  2L0A A;  3G71 T;  3FDR A;  3BY7 A;  3CPW P;  1VQ9 Q;  2DFU A;  2QA4 Q;  4M7A G;  1PHT A;  4ZGD B;  1WQW A;  3HHT B;  2LVM A;  1WZO A;  2DM1 A;  5GAO p;  1RAC B;  1RI0 A;  3ZFJ A;  2HDA A;  1ZLM A;  1H64 1;  1BB9 A;  4FW2 A;  1VQP A;  1M1K R;  4OB1 B;  2RHZ A;  1YHQ A;  3MEU A;  3M4Y A;  3OYD A;  3L42 A;  2JUF A;  4Z89 A;  3EFO A;  2RQR A;  3REB B;  3A8H B;  3EG0 A;  1M5Q 1;  2K3X A;  5M9O A;  2KVQ G;  3UDC A;  5GJV B;  2FO0 A;  1WHG A;  3OYB A;  2DLP A;  4D6W A;  2PVG B;  5KYU A;  3CC7 A;  1UG1 A;  2EQK A;  4A4F A;  3RDV A;  3G6E A;  3DLM A;  1VQO T;  3VU3 C;  2DIG A;  1ZUY A;  2X9H A;  2K57 A;  5LJ3 g;  4JS5 A;  2RQT A;  3JB9 F;  1ZSZ C;  3JCM b;  1QVF A;  3M58 A;  2DAQ A;  5KYY B;  2AZS A;  3FEO A;  2QGG A;  2H8H A;  2B8A A;  3M54 A;  4HCB A;  2FPE A;  1VQL Q;  4D8K A;  4O5V A;  3JCM Q;  1U06 A;  1BI1 A;  1T0J A;  1U3O A;  1UGR B;  3RIR A;  1QVG P;  4PNO A;  4JLG A;  3EAE A;  2C06 A;  2KQW A;  2RK1 A;  1QVG S;  3JB9 I;  1YJW Q;  4C5I A;  2CT3 A;  1KJW A;  5LJ5 e;  2VAS A;  1E6G A;  1W2B A;  3U23 A;  5LJ5 d;  3RR6 A;  2FYK A;  3GPL A;  1ABO A;  1KK7 A;  1VQN A;  3GBQ A;  3CCM Q;  1HXD A;  1ZSZ A;  3HL8 A;  1UHC A;  3I9Q A;  3RMS A;  1NJI R;  4PJL A;  2F2V A;  1JQQ A;  1OYX A;  4IUT A;  4ATO A;  3L2U A;  1PSE A;  2O88 A;  1YJN T;  3X24 B;  2LMJ A;  3M0T A;  2DXC A;  3A1P A;  4M4Z A;  4C92 C;  3CC2 A;  4Z02 A;  4CI0 C;  1QWE A;  4KGV B;  1M30 A;  4C92 A;  3L2V A;  4ZTF A;  4C8Q C;  1KQS P;  3O8V A;  4FSX A;  3JSC A;  1Q81 C;  2DJZ A;  4J9H A;  2ZGW A;  4MML A;  2NUP B;  3VS5 A;  1VQ7 T;  3OS2 A;  3OB9 A;  1ZA1 B;  4OB3 B;  1VQL A;  2FG0 A;  2RHX A;  4XTY A;  1FMW A;  1KC8 R;  2ZCF B;  2RF0 A;  2F69 A;  3E19 A;  3G6E T;  2VV5 A;  2XDB A;  2DIQ A;  1AZG B;  2V1R A;  4PJJ A;  1WJR A;  1VQM A;  2DYI A;  1SSF A;  3OMG A;  4J9C A;  2AZV A;  4LDW A;  4A4G A;  2HL5 C;  3H41 A;  3PVQ A;  1F1B B;  1YHQ T;  2XDD A;  4HVW A;  5HCK A;  2YDL A;  2D6F A;  1PWT A;  1VQL T;  4M7D C;  3M53 A;  1K0X A;  5GMK l;  4DBQ A;  3PMI A;  1K9M C;  4N0A A;  2X4X A;  1AZE A;  3G7Z A;  3CCL A;  3MKD A;  1BI2 A;  3ME9 A;  2PTK A;  2L3P A;  3CCL T;  1M90 C;  3S6W A;  5GAO r;  5LJ5 g;  4MDX A;  5CKE A;  4F7U G;  4R55 A;  2ABL A;  2RK2 A;  2K4Y A;  3MP8 A;  1UHF A;  3EGD A;  2DD5 A;  4M77 F;  4JRK A;  2GFU A;  1G3W A;  4UC4 A;  2DBK A;  1Y71 A;  4IUQ A;  2HSE B;  5FWB A;  1Q82 C;  3S3O A;  2CZ0 B;  5KE2 A;  2O9S A;  1MND A;  2RPN A;  1YFN A;  3RKW A;  1AVZ C;  3T9N A;  2IPO B;  2JMC A;  3I35 A;  1PKS A;  3I5S A;  5FU7 C;  1SPK A;  1PKT A;  1H3H A;  5CKB A;  3VV0 A;  1VUB A;  4XU2 A;  4LD6 A;  3URG A;  1ZBJ A;  2FEI A;  4PK4 A;  3OS5 A;  1BU1 A;  4DOV A;  3H8Z A;  2J7I A;  5GJW B;  3M4G A;  3VUZ A;  4M78 G;  1QMC A;  1MMD A;  1EFN A;  3QG1 A;  4HT9 A;  1WXB A;  1B7T A;  3R6N A;  5GAM j;  2FL7 A;  2DVJ A;  2GQI A;  4BI8 B;  2MIO A;  4HVU A;  3BW1 A;  3QZ5 B;  3G6E Q;  1G3T A;  4E7J A;  1XJW B;  4DBR A;  3SEM A;  3I5R A;  2L3R A;  4M7D F;  2EBP A;  3EGD B;  1EX4 A;  2E3H A;  4DA4 A;  3QBY A;  4C92 F;  4JUV A;  1ZBX A;  4EIK A;  1FMV A;  3VRY A;  2RI5 A;  4EMK B;  4DOW A;  2K79 A;  4F7U A;  1YHQ Q;  1NJI U;  1QCN A;  1PRL C;  1EIF A;  3JB9 J;  1I1J A;  1YIT T;  4ELY C;  1N9S A;  3H0H A;  1SHG A;  3ULR B;  1CKB A;  2PVO B;  4EDU A;  2ZPH B;  3A8G B;  4MDW A;  3CC7 T;  4FSS A;  2QAS A;  1BI0 A;  2X4Y A;  1S1N A;  2ATC B;  2NWM A;  3DKM A;  3PVL A;  2Z0W A;  1LCK A;  1LOJ A;  2RQW A;  4BUG A;  3LH5 A;  4HA8 A;  2E10 A;  3PFS A;  4EMH A;  1YBY A;  4AMC A;  2YWW A;  1OEB A;  1NPR A;  4J8O A;  4R0K A;  1MGQ A;  4JJD A;  4C8Q A;  5HK0 A;  2LZ6 B;  5I2M A;  2EQJ A;  1OU9 A;  1Q82 R;  4JRP A;  2QYZ A;  4X9D A;  4RTZ A;  2EJF A;  2HQX A;  2LNH B;  1D1C A;  1KSW A;  1VQO Q;  2FRY A; 
#chains in the Genus database with same CATH homology
 3TSW A;  2MOX A;  2RN8 A;  1E6H A;  4RTU A;  3M0U A;  2YUO A;  1E7O A;  3VS6 A;  1K1Z A;  1OPL A;  1YNZ A;  1NLO C;  1WXT A;  2KYB A;  3ZL7 C;  4J9D A;  2W10 A;  1K9A A;  3EG3 A;  3M0R A;  1OPK A;  1T3L A;  1CSK A;  2KRO A;  1WYX A;  4HXJ A;  2VVK A;  1NYF A;  2K2M A;  2M51 A;  2HCK A;  4F14 A;  1WFW A;  2SRC A;  2DYB A;  1NG2 A;  2D8H A;  2KE9 A;  3NPF A;  2EGC A;  2FRW A;  1GFC A;  1JEG A;  1RI9 A;  2K7A A;  1JXM A;  4JJB A;  2DA9 A;  2EGE A;  2CDT A;  2CUD A;  4OMP A;  3VS3 A;  2ESW A;  3O5Z A;  2C0T A;  2A36 A;  1N5Z A;  3REA B;  2JM9 A;  4LUD A;  1PRM C;  2D0N A;  3EG2 A;  1Y0M A;  3SHW A;  2QDL A;  4IIM A;  4AFQ C;  3NMZ C;  3H0I A;  1GRI A;  1AEY A;  3EG1 A;  2AKK A;  1NM7 A;  1V1C A;  1UJY A;  2FPF A;  1AWO A;  1SEM A;  4E6R A;  3NGP A;  1CKA A;  2DMO A;  1W70 A;  1YWO A;  2J6K A;  4LN2 A;  2J6O A;  2OAW A;  2EVR A;  3VRZ A;  1K76 A;  4AG1 C;  1IO6 A;  1SRM A;  2DL7 A;  1ZX6 A;  1OOT A;  4JZ4 A;  1JXO A;  3EHR A;  1Z9Z A;  1ZUK A;  3KFV A;  2L0A A;  3QWY A;  2A08 A;  4IIO A;  4F17 A;  1OV3 A;  4ORZ A;  2LCS A;  3TSZ A;  2JMA A;  1PHT A;  2W0Z A;  1ABQ A;  1M27 C;  2DM1 A;  2V1Q A;  1X6G A;  5I22 A;  1SSH A;  2HDA A;  1NLP C;  2OI3 A;  2RMO A;  1ZLM A;  2YUN A;  1BB9 A;  3M0S A;  2FPD A;  3UAT A;  1I07 A;  2J6F A;  1M8M A;  2YSQ A;  4Z89 A;  4J9G A;  5FW9 A;  4A63 B;  2RQR A;  3FJ5 A;  4QT7 A;  3REB B;  1BBZ A;  1WX6 A;  3EG0 A;  2KNB B;  1W1F A;  1NEG A;  1NEB A;  1X2K A;  2FO0 A;  5GJV B;  4LE9 A;  2YT6 A;  4RTW A;  1WA7 A;  5IHI A;  1X2Q A;  4OMM A;  2CUB A;  2DLP A;  3VS4 A;  4HVV A;  2DE0 X;  1NYG A;  1UG1 A;  4Y92 A;  2AK5 A;  2LX7 A;  2F2W A;  1UJ0 A;  1B3Q A;  1H8K A;  4CC4 B;  1WI7 A;  1ZUY A;  1QWF A;  5ECA A;  1QCF A;  2RQT A;  1XOV A;  1YN8 A;  5IXF A;  1FYN A;  1UTI A;  1PNJ A;  2GNC A;  2BZX A;  1X43 A;  1ARK A;  2G6F X;  2AZS A;  1GFD A;  2LQN A;  2GGR A;  2H8H A;  4KRT A;  1VYU A;  2JM8 A;  2P4R A;  2FPE A;  2J05 A;  4D8K A;  1U06 A;  2RNA A;  1AWX A;  3JV3 A;  1UE9 A;  1KIK A;  1AD5 A;  1T0J A;  1ZSG A;  1U3O A;  4OMO A;  2JT4 A;  1WIE A;  2DJQ A;  2HBW A;  2KT1 A;  2LJ1 A;  2EPD A;  5IHK A;  2CT3 A;  2I0N A;  1KJW A;  3RBB B;  4D8D A;  2L2P A;  1E6G A;  3U23 A;  2A37 A;  4X1V A;  1ZUU A;  5IXB A;  1ABO A;  1G2B A;  3NHN A;  4AFS C;  1UDL A;  2L3S A;  2AKL A;  3GBQ A;  1X27 A;  2ROT A;  2A28 A;  3I9Q A;  1UHC A;  1HD3 A;  4AFU C;  2KT8 A;  1KFZ A;  2EW3 A;  2KBT A;  2F2V A;  1JQQ A;  4ZNX A;  2O31 A;  1WLP B;  1YWP A;  2LQW A;  2EYX A;  2CSI A;  2XMF A;  2O88 A;  2LJ0 A;  2LMJ A;  3M0T A;  2M0Y A;  1WDX A;  4M4Z A;  2EKH A;  2K6D A;  1HJD A;  1MV0 B;  2EYZ A;  1QWE A;  2ED0 A;  1M30 A;  1TUC A;  2SEM A;  2CSQ A;  3UF4 A;  4JZ3 A;  1VYT A;  4DEX A;  1B07 A;  1M3A A;  2C0I A;  2LP5 A;  2KRN A;  4J9H A;  4OMN A;  3VS5 A;  3UA6 A;  2X3X D;  1K4U S;  4JJC A;  2JTE A;  2D8J A;  2JS2 A;  1YCS B;  1UUE A;  3UA7 A;  2KGT A;  1BK2 A;  4K11 A;  5L23 A;  4CC7 A;  2CH4 A;  2FG0 A;  1J3T A;  1GCP A;  2DL3 A;  2CH4 W;  1M3C A;  5I11 A;  1SHF A;  2RF0 A;  2DX1 A;  2L3Q A;  1AZG B;  1Z9Q A;  2V1R A;  1FMK A;  2YUP A;  4J9C A;  2KR3 A;  4Z88 A;  2AZV A;  4F16 A;  3THK A;  2BZ8 A;  2ECZ A;  3H41 A;  1T0H A;  3PVQ A;  4OMQ A;  2DIL A;  4GBQ A;  4HVW A;  5EC7 A;  5HCK A;  4ESR A;  2YDL A;  1H92 A;  2D1X A;  1GL5 A;  2B86 A;  1UFF A;  1PWT A;  2JXB A;  3M0Q A;  2YUQ A;  1K0X A;  1RLP C;  4RTT A;  4Z8A A;  3A98 A;  1AWW A;  2VWF A;  2HEQ A;  2GTJ A;  4OML A;  2DNU A;  2ENM A;  1A0N B;  1AZE A;  4RTX A;  1K0S A;  2PTK A;  2NUZ A;  2L3P A;  4J9B A;  1HSQ A;  1I0C A;  3VS0 A;  3CQT A;  2DRK A;  2EGA A;  1G83 A;  4GLM A;  2PZ1 A;  2ABL A;  1JU5 C;  4AG2 C;  1UGV A;  2DL5 A;  1WXU A;  2RQV A;  1X69 A;  1UHF A;  2CT4 A;  2KYM A;  1MV3 A;  1GCQ A;  2DBK A;  2VKN A;  3IQL A;  4CC2 A;  1TUD A;  5FWB A;  1QKX A;  1QKW A;  2EQI A;  2O9S A;  2RPN A;  2IIM A;  1AVZ C;  1T3S A;  2KXD A;  2OJ2 A;  2JMC A;  4RTY A;  3I35 A;  1PKS A;  2EYY A;  3I5S A;  1SPK A;  1PKT A;  2GTO A;  1H3H A;  2K9G A;  1ZBJ A;  2FEI A;  1M3B A;  3TVT A;  2KRS A;  2X3W D;  1BU1 A;  4LUE A;  2J7I A;  5GJW B;  2DL4 A;  1VA7 A;  2ROL A;  2J06 A;  2O9V A;  1EFN A;  1GBR A;  1WXB A;  3R6N A;  1GCQ C;  1X6B A;  3EHQ A;  2DVJ A;  2GQI A;  2MIO A;  4HVU A;  2DRM A;  3PE0 A;  2BZY A;  1TG0 A;  4JPB W;  5IHN A;  2KXC A;  2O2O A;  3H0F A;  4WCI A;  3SEM A;  1SRL A;  3I5R A;  2EBP A;  3QWX X;  1MUZ A;  1QLY A;  2GBQ A;  1RUW A;  2PNI A;  3C0C A;  3VS2 A;  4CC3 A;  4EIK A;  1AWJ A;  4RUG A;  2KEA A;  3VRY A;  2HSP A;  1RLQ C;  1W6X A;  4J9I A;  2E5K A;  2K79 A;  1AOJ A;  4J9F A;  3VS7 A;  2DL8 A;  2K3B A;  3M0P A;  1U5S A;  3RNJ A;  1PRL C;  1I1J A;  5FWC A;  1JO8 A;  1UEC A;  3H0H A;  1SHG A;  4DEY A;  3ULR B;  1CKB A;  4AFZ C;  1Y57 A;  2DBM A;  2RQU A;  4FSS A;  1S1N A;  2NWM A;  2JS0 A;  2CRE A;  3PVL A;  4LNP A;  1LCK A;  2RQW A;  3LH5 A;  4RTV A;  1OEB A;  1VYV A;  3EGU A;  2EYW A;  2ED1 A;  4HCK A;  4J9E A;  4R0K A;  3VS1 A;  4JJD A;  2KRM A;  5IH2 A;  2LZ6 B;  2BTT A;  2DF6 A;  1GBQ A;  4RTZ A;  2MCN A;  2JW4 A;  2LJ3 A;  2C0O A;  2LNH B;  2F2X A;  1KSW A;  2FRY A;  1YP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...