1TUCA

Alpha-spectrin src homology 3 domain, circular permutant, cut at s19-p20
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
MGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The order of secondary structure elements does not determine the structure of a protein but does affect its folding kinetics.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
molecule keywords ALPHA-SPECTRIN
total genus 10
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1996-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1tucA00
1UDLA 2ESWA 4HVWA 1SRLA 5IHIA 2F2XA 3C0CA 4KRTA 3EG0A 1TUCA 2D8JA 4J9GA 2LQWA 1WFWA 3PE0A 2JS0A 2D8HA 2DNUA 2XMFA 2L3SA 5ECAA 4GBQA 2DL8A 1UFFA 1SHFA 2L3QA 2MOXA 4ESRA 4LUEA 3RBBB 4WCIA 2JW4A 1JU5C 2CDTA 2PZ1A 2BTTA 5GJWB 1BB9A 4HVVA 4EIKA 2J06A 1T3SA 2I0NA 1W6XA 1N5ZA 3M0RA 3EG3A 4OMLA 4A63B 5I22A 2RPNA 2KGTA 3A98A 4AFQC 3REAB 1RLQC 1YWPA 2K9GA 2GNCA 2K7AA 1RUWA 2KE9A 1G2BA 1RI9A 2KXCA 2BZXA 1MUZA 2KYMA 1GCQC 1GBQA 2CT4A 1WYXA 4F14A 2LQNA 1CSKA 2KBTA 2F2VA 1SPKA 2KROA 2ENMA 1UGVA 4HCKA 2O2OA 1ZUUA 3IQLA 1E7OA 4GLMA 1LCKA 3TSWA 2RNAA 1I07A 1M3AA 4J9IA 2LCSA 2DL4A 2AZVA 2FO0A 1UJYA 4J9CA 5FWBA 2CSQA 2K3BA 2D1XA 4J9BA 2GTJA 2DBKA 3VS4A 2HBWA 1Z9ZA 4HXJA 1KIKA 2DYBA 2FRYA 4IIOA 1PKSA 1BU1A 3FJ5A 1NG2A 1U5SA 2DVJA 1U06A 1KSWA 2JM8A 1W1FA 4OMNA 2YUPA 2LP5A 2E5KA 2JMAA 3H0HA 2DM1A 2HDAA 3H0IA 5IHKA 1GCQA 2K79A 4RTWA 1G83A 2FPFA 2HSPA 4RUGA 1S1NA 2DL5A 3VS0A 2BZ8A 1X6GA 1M3CA 3NGPA 4RTZA 4D8DA 3JV3A 1H92A 4ZNXA 2EVRA 2D0NA 3NPFA 2X3XD 3R6NA 2GGRA 2VVKA 1UG1A 3PVLA 1QLYA 2MIOA 2OAWA 4DEYA 2NWMA 5L23A 2W0ZA 5IXFA 4OMMA 2H8HA 1UECA 1TG0A 1A0NB 2SRCA 2YUOA 1AWXA 1WLPB 2EGAA 2AKLA 2EYYA 4R0KA 3TVTA 1ZLMA 3RNJA 1VYTA 1NEBA 1GFCA 1WI7A 4RTYA 1RLPC 2EGCA 3KFVA 1YNZA 3VS2A 2VKNA 1WXBA 2M0YA 4IIMA 1VA7A 1WX6A 2A08A 3M0PA 3QWYA 3EHRA 4JZ3A 2LNHB 1B3QA 4OMPA 3LH5A 2EW3A 4LNPA 1FMKA 2G6FX 2GBQA 1E6GA 4AFUC 2RQVA 3THKA 2C0OA 4X1VA 1EFNA 3H41A 3UA7A 1X43A 1VYUA 2O88A 1Y57A 1QCFA 4J9FA 3UA6A 2CH4W 3NHNA 5IHNA 2BZYA 3M0QA 1NYFA 1KJWA 4RTUA 1UJ0A 2RQTA 2A37A 2ROLA 2LJ0A 1YWOA 4Z89A 4CC7A 1ABQA 1AOJA 2VWFA 1ABOA 3EGUA 1QKXA 2DF6A 1MV0B 2DBMA 1SEMA 3M0TA 3QWXX 2CUBA 4LN2A 2CUDA 1AD5A 2KYBA 2ED1A 1AZGB 2F2WA 4AFZC 3UF4A 1HD3A 1X27A 4LUDA 2J6FA 2DA9A 2YUNA 5FWCA 2DILA 3I5SA 2EGEA 2JS2A 4F17A 1SSHA 1UE9A 4M4ZA 1PHTA 2DE0X 1K1ZA 2DLPA 2J05A 2FRWA 4HVUA 2PNIA 1AVZC 1WXTA 2M51A 3I9QA 2YT6A 2DL7A 2JT4A 1GBRA 5HCKA 2DX1A 2EQIA 1PWTA 2KRMA 2KXDA 2P4RA 1W70A 3I35A 2FPDA 3VS3A 4J9EA 1GFDA 3VRZA 2DMOA 3CQTA 4Y92A 2KT1A 2CT3A 1UTIA 1YN8A 3M0UA 3VRYA 1QKWA 1HJDA 1E6HA 1ARKA 2DJQA 2EPDA 2OI3A 2DL3A 2LZ6B 1OV3A 2HCKA 4RTVA 2C0TA 3EG1A 2KT8A 2C0IA 2ROTA 2DRKA 1OPLA 1M30A 3SEMA 2KRNA 4RTXA 1MV3A 2FPEA 4JJCA 2EKHA 2RMOA 3TSZA 2CREA 1X69A 1CKAA 1HSQA 4D8KA 3ULRB 1ZUYA 2K6DA 1T0HA 1AZEA 4Z8AA 2MCNA 1M27C 2V1QA 2L0AA 1BBZA 4CC3A 2O31A 1K0SA 1TUDA 1OPKA 1PRMC 3U23A 1QWFA 2OJ2A 1CKBA 1JXOA 1KFZA 1K0XA 2CSIA 2K2MA 2JXBA 2YDLA 2J6KA 4JJDA 1JEGA 4DEXA 1GL5A 1NM7A 1AEYA 2IIMA 2JTEA 1VYVA 1PNJA 1X2QA 1V1CA 4JPBW 2FG0A 3VS1A 2AK5A 2J7IA 2LJ1A 1QWEA 4QT7A 2NUZA 1OOTA 2KRSA 1YP5A 2KNBB 1SHGA 1T0JA 1H8KA 4ORZA 3ZL7C 1WIEA 3GBQA 2EYWA 3VS5A 4E6RA 2SEMA 4JJBA 3I5RA 2O9VA 2RN8A 3UATA 3EHQA 2X3WD 1ZSGA 1I1JA 5GJVB 2A36A 1UHFA 4RTTA 2AKKA 2PTKA 1Z9QA 4K11A 1X6BA 1ZX6A 1IO6A 4LE9A 2EYXA 1NLPC 2LJ3A 2YSQA 1NYGA 4JZ4A 5IH2A 1U3OA 1AWOA 1I0CA 2W10A 1K76A 4AG1C 5EC7A 2ABLA 2GQIA 3VS6A 1JXMA 1FYNA 2RQWA 5IXBA 1GRIA 2B86A 2A28A 2FEIA 2GTOA 2O9SA 2ECZA 4OMQA 1T3LA 1J3TA 3H0FA 4CC4B 3VS7A 1M3BA 1UUEA 3SHWA 1XOVA 2RF0A 1GCPA 1ZUKA 4J9DA 1ZBJA 2L3PA 1AWJA 2CH4A 1WA7A 1NEGA 3O5ZA 4CC2A 1SRMA 2V1RA 2YUQA 1BK2A 2EYZA 3REBB 1K4US 1PKTA 1JQQA 1WDXA 2ED0A 2KEAA 2RQRA 5I11A 1AWWA 1K9AA 4F16A 2J6OA 1PRLC 5FW9A 4AFSC 2LX7A 1M8MA 2LMJA 2JM9A 4AG2C 3PVQA 2DRMA 1UHCA 2QDLA 2EBPA 3EG2A 1WXUA 3M0SA 2L2PA 1Y0MA 1H3HA 2JMCA 1B07A 1JO8A 1NLOC 4OMOA 2HEQA 1X2KA 2KR3A 1OEBA 1YCSB 4Z88A 2AZSA 2RQUA 4FSSA 4J9HA 3NMZC
chains in the Genus database with same CATH superfamily
1MMAA 2LX9A 1SRLA 3D7SB 5KYWB 2ZPBB 2QQAA 3Q1JA 2F2XA 3C0CA 4KRTA 2XG8D 3JRZA 3C95A 1TUCA 4C92C 2L3SA 2I2LA 4PL6A 3OS1A 3EGXA 2DVEA 4BE1A 1C0MA 4IUVA 2CP2A 5CKFA 2EWNA 1W2BA 4EIKA 4OMLA 3EG3A 3MEUA 4A63B 2ZAEA 5LJ5f 1RLQC 4KBMB 1G2BA 5DM7R 2V8JA 2DXCA 2CT4A 1OYXA 5A0LA 3OMGA 5LJ5g 2LQNA 1SPKA 1OU9A 4HCKA 1MMGA 1M1KR 4GLMA 3CPFA 2JN0A 4BY6C 1VQ4Q 1M3AA 5LJ5h 2DL4A 1B34A 2AZVA 2FO0A 3E2UA 3PNWC 3ER0A 5CQYA 1KD1C 3I56Q 3EFOA 4F7UA 4DA4A 4J9BA 3CBPA 3VS4A 4HXJA 3OBWA 1KIKA 1KQSS 2FRYA 3HHTB 1XTDA 1NG2A 3WVDB 2GFUA 2RD1A 3A8GB 1R0BG 4M7AE 5KYXA 2LP5A 3H0HA 4M7DC 5CO7A 4E7HA 5CCAA 1VQPQ 3H0IA 2F69A 1YJWQ 2RK2A 1G83A 2MWPA 1M1GA 2QYZA 4RUGA 3CCJA 3CCLQ 1M2VA 2DXBA 4Z02A 4XTYA 3FC3A 3PT9A 4JDSA 4BACA 4PFZA 3CXCA 2GGRA 5D6WA 2PUKB 1BIBA 4B9WA 4BE2A 3M59A 2OAWA 3V8LA 3MP6A 3CPWP 1RL2A 5L23A 4EMKA 1D1AA 3NFCA 4X9CA 2H8HA 1UECA 2LCLA 1A0NB 2SRCA 2YUOA 2WSFE 1VYTA 3LGFA 3M55A 4C92F 2QTVA 2NYSA 4PJNA 5CQXA 3JCMJ 1YNZA 3VS2A 1RAFB 2V26A 1WXBA 2M0YA 1WX6A 1VQ8T 3QWYA 3CCST 3EHRA 3JCMe 1PD0A 3HL8A 3CMEA 3QDFA 2MK5A 2YLBA 2AIRB 3CXCS 2G6FX 5DLQE 1LVKA 2E6NA 5GANe 4P5NA 5LJ5e 1UGSB 4M7DD 1VQMQ 2PUOB 2RQVA 1M5Q1 1S72T 5KCOA 4BDYA 2C0OA 1EFNA 3QZ5B 1H641 4M7AF 1VYUA 2YLCA 1YJ9T 3UA6A 2BZYA 3M0QA 2DO3A 1UJ0A 3L2UA 3VV0A 1U8RA 2XKOC 3SDZA 3LYIA 3VUBA 3H9NA 4FU6A 2Y4XA 4Z89A 1ABQA 1AHJB 2XICA 2DF6A 1MV0B 3EFSA 4HCCA 1AD5A 3LW5E 1KQSP 3JCMb 5FRMA 2V8IA 2J6FA 5LJ3d 2DILA 2EGEA 3RERA 4C8QC 1PHTA 2E65A 2FRWA 4F04B 5GAMg 4JS4A 3FB9A 4HVUA 3VUZA 1PSEA 1R77A 1WXTA 4KH1B 2DX1A 2DJZA 1ZSZA 2CS7A 2KXDA 2XHCA 5GAOp 2QI2A 3GPLA 1VQ9T 2FPDA 2KQWA 4C92D 4Y92A 1M4ZA 1BIAA 2HQEA 3BDUA 1VQ6Q 2DL3A 1VQ5Q 2CP5A 4X9DA 2C0TA 5KYNA 4JUVA 1Q86C 1BCOA 1QP2A 1VQKQ 3SEMA 3CCLT 2RJCA 1PC0A 2FPEA 2RMOA 4M77E 4M77G 4M7DG 2CREA 3ZFJA 3JCMg 5GMKh 4OP0A 1Q82C 1QVGS 2K6DA 3CCMT 4FW1A 2HL3A 2LT1A 3CC7A 2AT1B 2L0AA 5L8RE 2CYZB 1XJWB 2OJ2A 2R57A 4PLIA 2K2MA 4MDXA 3OYLA 4XTWA 4BI8B 3G7ZA 3RDVA 3CBMA 4QVCA 3M54A 1PCXA 1Q86U 4LDVA 2RA2A 1OOTA 2FZGB 3ZBDA 3CCMA 4JRIA 1SHGA 4A4HA 3CCSQ 2PVDB 4LDXA 5GMKe 3UATA 2K5FA 1K9MU 3EHQA 2P0QA 1QVGA 3G6EA 3SB2A 1VQMA 2AKKA 3MPUB 5HK0A 1D0ZA 1Z9QA 4PJMA 4K11A 3MCAB 1IO6A 3PMTA 2EAYA 2OTJT 4DBHA 1NYGA 3FEOA 4L59A 4DOWA 1VQLA 2JTMA 2W10A 1K76A 4JRPA 2XI9A 2DAQA 4M75F 2RI2A 1JXMA 1K8AR 3QJYA 1M8VA 2O9SA 1VQ9A 2EJFA 5KYWA 1QW1A 2QEXQ 1T3LA 2IG0A 2CP0A 5KYUA 3H0FA 3OYBA 1VQNT 3HPWA 3RMSA 2M02A 1UB4A 3O5ZA 4CC2A 2OTJA 2YUQA 3JB9I 1BK2A 2D0QB 2EYZA 1WDXA 2KEAA 3HFNA 5HK3A 1K9AA 1O75A 2ZPHB 2J6OA 3X24B 5FW9A 1M90R 4A4GA 3OYIA 4AMCA 2LC4A 2LMJA 3OW2A 2CZ1B 2KMTA 4QVDA 3EG2A 5FU6C 3INZA 1WXUA 4OB0B 3M0SA 1Y0MA 1M2VB 4C5GA 2HEQA 2F5TX 4DBFA 4C0FA 3HSBA 4J9HA 4C8QG 2ESWA 3L42A 1IRXA 5IHIA 4MZTA 3RIRA 1YHQA 2JVVA 3EG0A 1VQ8Q 1FX7A 4J9GA 2LQWA 4HCBA 5CKEA 1KC8R 4M77B 4O6JA 5ECAA 1KD1R 4GBQA 2DL8A 1OX9A 4ESRA 4LUEA 2JW4A 1QVFP 2KY9A 1RAEB 2PZ1A 5GJWB 1VQ7T 4ATOA 2DEUA 1W6XA 3C4SA 3M0RA 1VQ8A 5I22A 4LDYA 3JCMW 2KGTA 3QHSA 3V8JA 4AFQC 3L1AA 3UDCA 1EZZB 2KDSA 4PK4A 4XTVA 1PM3A 2FHDA 5A2QE 3VYGA 1MNEA 3CBOA 2M16A 2KXCA 2RJEA 2KYMA 3RUXA 3I55T 3OQ5A 3OSSC 4Y91A 2RM4A 2VUBA 2KBTA 2F2VA 4XU2A 2KROA 4F7UB 1C1AA 4CI0C 1P92A 2O2OA 3IQLA 3TSWA 4XU1A 1LCKA 1ZA1B 3C94A 4WTOB 3JB9D 3JCMV 1N8RC 4J9IA 2LCSA 1HXDA 3QZ9B 1YJNA 4R55A 5GMKm 4PJOD 2HNIA 2MPXC 2CSQA 3SD4A 4XAXB 1IB8A 4M78C 3DLLA 2GTJA 5GAN8 1M1FA 2DYBA 1PKSA 2OTLQ 1U5SA 2DVJA 4PJOA 1QVGP 4OMNA 1QCOA 2YUPA 5LJ3e 1VQ9Q 2HDAA 4OVAA 1GCQA 3M57A 3T9NA 4IURA 2HSPA 5DY9A 4J83A 1TUGB 4FT4A 4BI3A 2BZ8A 2E3HA 5LJ3h 1IZ6A 2B8AA 4N4IA 3NGPA 4C0DC 2YXYA 3JV3A 3OYEA 1H92A 2C06A 4BD3A 2X3XD 3R6NA 1K73R 2HD0A 4EDUA 2LT4A 1QLYA 1TU0B 4JS5A 3META 3RESA 4EMGA 2VB6A 3ME9A 4KULA 1YJNQ 2LTOA 3CCMQ 1WJRA 3QG1A 1TSFA 1TG0A 4HKEA 2DKGA 2AKLA 2EYYA 4R0KA 2RK1A 1ZLMA 2X4JA 2KVQG 1YJ9Q 3EG9A 3RNJA 3FIFA 2DFUA 1NEBA 1VQOA 5GAOl 2YWWA 3HKSA 4NOYA 3QO3A 3SWNB 3CC4T 2M1HA 2A08A 3JB9F 5FU7B 4EPCA 4BB7A 4M75E 1GXIE 1KHCA 4OMPA 4LNPA 3JAME 5LJ5j 1U1TA 1Q82U 4HT9A 4A4FA 2X51A 5I2SA 4IUTA 2DTHA 5KYUB 2BE9B 3I55A 1O9SA 4M77F 1Q7YR 4HT8A 1KK7A 4J9FA 5FU6B 2A3LA 2V8KA 3NHNA 1ZA2B 2HQHA 1YJNT 4RTUA 1MHNA 3LGLA 3X26B 1JB0E 2JUFA 7AT1B 4CC7A 2KSSA 1ABOA 3EGUA 2RHYA 1QKXA 1KQ2A 1OULA 4CRIA 2JNGA 1NJIC 3QSUA 1W4SA 3SWNA 2AHJB 3M0TA 4LN2A 1AZGB 2F2WA 5KYYA 1M90C 1HD3A 1FMVA 3MJXA 4C0DB 3MKDA 4LUDA 3CC2Q 1WHJA 2HAXA 5FWCA 2XD0A 1K8AC 3M9QA 4M7DB 4M75G 1D09B 2CZ7B 4FM4B 1B7TA 1VQ5T 4M4ZA 4KH0B 4DQ2A 4RCCA 2L8DA 2QTXA 4E7KA 3M4YA 4X34A 5KYYB 2JT4A 1GBRA 2HQXA 2PU9B 2RI5A 2P84A 3VS3A 2K5IA 1VQ7Q 2E6ZA 3VRZA 3CQTA 1JRIA 1YN8A 3FRNA 5GAMf 3C12A 4O5VA 1RI0A 1QKWA 1HJDA 3V7CA 2Y4YA 2EPDA 2OI3A 1EIFA 1S72A 1G3WA 4ME7A 2Z0WA 3EG1A 4E7SA 1VOMA 5FU7C 1OPLA 1C6VX 3OA6A 3FLGA 2HKNA 4M77D 4M7AD 4N4GA 3OYHA 3A5ZB 2MF2A 5M9OA 2F1LA 1X69A 4M78A 2P4TA 3M56A 4L5GA 4FYXB 4OB3B 3PIOA 3QJ6A 4C92A 2DETA 1Y96B 4PJJA 2O31A 1WHGA 1OPKA 1G5VA 3GP8A 3A8HB 3CC2A 3X25B 1JXOA 1JJ2A 1K0XA 1RAAB 3HFOA 2FVUA 2YDLA 5CAIA 3M58A 5LJ3f 1KD1U 4NS5A 1NM7A 2LDMA 3A8MB 1BYMA 2ZCFB 4QQ6A 2IIMA 2JTEA 4AT1B 3OYYA 2HSEB 1VQLT 1W2BS 2FG0A 5J26A 2AK5A 2J7IA 4M78B 6AT1B 2KRSA 4IUPA 1H3ZA 2ZPEB 4C92B 3E9FA 1T0JA 3ZL7C 3GNGA 2L3RA 3VS5A 4TVRA 3RR6A 2QEXT 4E47A 3EH2A 1K9MR 2O9VA 2QA4T 3BDLA 4GLKA 3CEYA 1ZSGA 5D6XA 2E64A 1F1BB 3CCRT 2CP3A 8ATCB 3OYGA 2PTKA 4Q5WA 4DBQA 1YHQT 2RHUA 1ZX6A 4LE9A 1K73C 1NLPC 1UEBA 3CCLA 4ZGDB 1AWOA 3WVEB 1I0CA 4AG1C 4M77A 2GQIA 5GAN4 3JB9G 4C8QB 2HZYA 3KXTA 4A4EA 2RQWA 1Q81U 3S3MA 4N0AA 1VQ6A 2B86A 2DK3A 2A28A 4M78E 2GTOA 3M4GA 2ECZA 2E1HA 1J3TA 2QA4A 5J39A 4J7IA 4PLLA 3SHWA 2KI7A 1XOVA 1YI2T 4J9DA 1ZBXA 5C0MA 1KC8C 1YJWT 1NEGA 2QK0A 2K5LA 5GAN5 2ZPGB 1Y7XA 4JJNK 3DB3A 3S6WA 1AWWA 1OZ2A 2XDBA 4C8QF 2LRQA 4EMHA 2JM9A 3SFMA 5J3BA 2QDLA 3R6OA 2R5MA 4XU0A 4C5IA 1OZ3A 3CCVT 2VASA 2L89A 1WPYA 2EQUA 2L2PA 2EJ9A 2OAUA 1H3HA 2R58A 4Y28E 1B07A 3NTHA 2RH2A 2XDPA 4RG2A 1YCSB 4Z88A 4FSSA 3TSZA 1VQLQ 2DYIA 1WGSA 2F5KA 1NPRA 2H3EB 1WFWA 3PE0A 1KC8U 4J6YA 2JS0A 4NL2A 2D8HA 1X01A 2QGFB 4N4HA 1R8OB 2XIDA 2DNUA 1ACMB 5GAOr 1N9SA 1UFFA 1SHFA 2MOXA 4B6MA 2ZZDA 3SWNC 4M7AC 1JU5C 4M77C 1BI0A 5A0GA 2CDTA 3LX7A 1Q81C 1SF9A 2KK4A 4HVVA 2J06A 1T3SA 2I0NA 4M75D 3CPWA 3L2WA 5CKDA 3REAB 1YWPA 3LH0A 1S72Q 2K7AA 5GANj 1K73U 2KE9A 1RI9A 1VQNA 1IHVA 2BZXA 1MUZA 1GCQC 2LQKA 1WYXA 4DBRA 4QW2A 4PNOA 4F7UE 1UGVA 1YI2Q 1ZUUA 1KHIA 2QQ9A 3ASKA 2M9UA 4M7AB 1NBEB 1WQWA 5FWBA 4RG8A 3CD6A 3LWIA 2K3BA 1TTHB 4LXCA 4PKCC 2FB7A 4RCBA 2HBWA 1Z9ZA 4YTLA 4OGCA 4OB2B 1BU1A 3FJ5A 1U06A 1KSWA 2NUPA 1DJ7B 2COWA 1ZSZB 1JJ2P 5GAN2 4KUIA 2JMAA 3FJPA 2DM1A 3CCVQ 3OS5A 2K79A 4RTWA 1R0CB 1VQ5A 4MDWA 1S1NA 4MMLA 2DL5A 3VS0A 1N8RU 3CMAT 2EYQA 2VXFA 3G71Q 1M3CA 4D8DA 1TH7A 1VQOQ 1QVFA 4E7ZA 3CCVA 4F7UG 2EVRA 1I81A 2EQJA 3MP8A 4FT2A 5GAMe 4C0GA 2WSCE 1UG1A 4XTZA 3L2RA 1VQPT 4QKUA 3JB9J 1N9RA 2ATCB 1V29B 4DEYA 3OMCA 2NWMA 3GOXA 3A8LB 3TQ7P 4FW2A 2IVWA 3TREA 2DXUA 2EJGA 2JTFA 4OMMA 3TEEA 4PFOA 3CPWS 5LJ5d 2K3YA 4A54A 2ZPFB 1AWXA 1V76A 2EGAA 3TU4K 3TVTA 1GFCA 4BUGA 4RTYA 3KFVA 4OB1B 1YBYA 5D7UA 1D1CA 2VKNA 4IIMA 4RMOA 1VA7A 4FIBA 2HKQB 4JZ3A 5KH6A 1QVFS 3QDRB 3S3OA 1B3QA 1IREB 3LH5A 2EW3A 1LNXA 1Q95G 1G3YA 3G1JA 4J6WA 2GBQA 1E6GA 2VGNA 3X28B 3CC2T 3H41A 1X43A 4M75A 4FYWB 1Y57A 1KQSA 1TWBA 2A7YA 3JSCA 3MHXA 1NYFA 4PJOG 2A37A 1N8RR 2LJ0A 5GAMd 2RI3A 1AOJA 3OW2S 4NL3A 3OYKA 1LOJA 2K57A 2DBMA 3GIBA 1SEMA 2DEQA 1JJ2S 3JCMc 2ED1A 2KYBA 2KAFA 4KGXB 3CC7T 4ELYC 1OI1A 3CCRA 4M7AG 3OYJA 3WXMB 1Y96A 2YUNA 2R5AA 3EFOB 4D6WA 2JS2A 4EMKB 1SSHA 1UE9A 1WJSA 1MMNA 1RACB 1VQ6T 4PJOF 1RADB 3JCMf 2PNIA 1AVZC 4OMFB 2EQIA 3CCQA 3EGXB 2KRMA 2BUDA 5A0DA 3JB9H 3OYMA 1W70A 2HL5C 3I35A 5GANf 3CMET 2X35A 1SG5A 2E10A 1GFDA 3HP9A 5LJ3j 3AHUA 1UTIA 1D1BA 3M0UA 1YJWA 1YHQQ 3VRYA 2HMAA 4J6XA 3OSVA 1ARKA 4E7LA 2DJQA 2LZ6B 3HRSA 1OV3A 2HCKA 1ZHIA 4RTVA 4M78G 3J80E 4XQ3A 2E4HA 4C92E 2ROTA 2DRKA 4C92G 2KRNA 4ANJA 5HKCA 4RTXA 3GNFB 4JJCA 4MZPA 4QQGA 3J7AF 2O01E 1VIFA 1LPLA 1FMWA 3BW1A 2QASA 3OY9A 3NTKA 3CD6Q 4DOVA 1CKAA 1HSQA 3HRTA 4C8QE 1ZUYA 2LNVA 1T0HA 3G4ST 4Z8AA 1VQ4A 1M27C 2V1QA 3RKXA 5HY6A 1K0SA 1TUDA 1PRMC 4MZMA 3CCEA 1QWFA 1CKBA 1KFZA 1VIEA 2J6KA 1U1SA 4JJDA 1JEGA 1QVPA 3V8KA 3MP1A 1Q86R 2MMPA 3FDRA 1AEYA 2CP6A 3URGA 3RKYA 1NJIU 1QWEA 4QT7A 2NUZA 4QQDA 2EQKA 2KNBB 3G71T 1KQ1A 2YRCA 1TS9A 1WIEA 3GBQA 4E6RA 2XDDA 2SEMA 3MEVA 2RN8A 2MAMA 4FCYA 2A36A 2DD4A 3JCMQ 4LDWA 4IUQA 3BY7A 4JLGA 4FL6A 5IT9E 4LD9K 2COZA 2LJ3A 1WHLA 2YSQA 2RJDA 3CMEQ 1SKUB 2ABLA 3O8VA 3OB9A 5IAYA 3VS6A 2VYTA 5CR2A 1WHMA 1BKBA 3PGGA 3EH1A 2PVGB 1GRIA 3VU3C 1W2BP 1VQ7A 4C8QA 2DERA 4OMQA 1TOVA 2JZ2A 2LQ8A 3M53A 2QAZA 4CC4B 4WF2A 4RKUE 2RF0A 1ZUKA 2CGHA 2VGMA 1WNLA 2L3PA 2RB6A 5GAOn 2QQSA 1WA7A 2FZKB 1ZSZC 5FROA 3VJPA 3AT1B 1SRMA 2V1RA 3EFRA 1M90U 3REBB 1PD1A 1K4US 1JQQA 4ZTFA 5I11A 2BIVA 1WHKA 1N27A 2X9HA 1K9MC 2EIFA 3L2ZA 4JLIA 1IGQA 4AFSC 1M8MA 3CCJT 5AT1B 2DRMA 2EQMA 2A0FB 1Y07A 3P8HA 1QCNA 3DB4A 4F7UF 1BI2A 2OTLT 4PFPA 2RJFA 3OW2P 5CKBA 1JO8A 2JOYA 4OMOA 1X2KA 2KR3A 1OEBA 2RQUA 4LDUA 2PVOB 1UDLA 3MO8A 4HVWA 3QKJA 3ZEHA 2RHXA 3JCMX 3OYNA 1VQMT 5LL6S 4E7JA 2D8JA 3UPUA 2DZCA 4XTXA 3CMAQ 5D6YA 3OYFA 2XMFA 2DIGA 3PFSA 3RKWA 1M9SA 3CXCP 2VXEA 2L3QA 5I2MA 2O4XB 2QQRA 3RBBB 1SSFA 4WCIA 1D0YA 2MYSA 4ZGJB 2BTTA 3I55Q 9ATCB 1BB9A 1PG5B 3KBGA 1N5ZA 3UT1A 1WHHA 3I56A 3CD6T 2RPNA 3A98A 1QP3A 2K9GA 5EG2A 2GNCA 2Y90A 1RUWA 2GCXA 1XNIA 5GMKj 4XK8E 3CCRQ 4L6V5 5GAMj 1GBQA 2YRVA 4F14A 4V2SA 2YRDA 3MEAA 1RAHB 1CSKA 1KG1A 3P8DA 5AYFA 4C5HA 1NE8A 2ENMA 4JRQA 5GAOm 1E7OA 2DPPB 2RNAA 1X75C 1OQKA 3CCQQ 1I07A 1YJ9A 4IKFA 1FXXA 4HCZA 1UJYA 2E5QA 4J9CA 4JRKA 3OS0A 2DTIA 2OTJQ 2FYKA 2D1XA 4M7AA 3GF5A 3V7SA 1VQOT 2NUTA 2DBKA 4M7DF 4C8QD 4IIOA 1QMCA 5GAMh 2OX7A 1MMDA 2M0OA 1D3BA 4OGEA 3QIIA 2JM8A 3JCMd 1RABB 1BI1A 1W1FA 3OS2A 3EGDB 2E5KA 1RAIB 3E19A 2CP7A 2RO0A 2K2VA 4OF1A 3F70A 4HA8A 4M78F 4KGZB 5IHKA 5LJ3g 2QQBA 2FPFA 4B9XA 5KE2A 2CZ6B 3A8OB 5KYXB 3LWHA 2BKDN 3HRUA 1X6GA 3RMQA 1YIJT 1NZ9A 2HBPA 1QQJA 4RTZA 1UGRB 3CCUT 1YITT 2EKOA 4ZNXA 3G6EQ 3QBYA 3EGDA 2D0NA 2LVMA 3NPFA 1PSFA 3G4SA 2OTLA 2VVKA 4LD6A 3PVLA 2MIOA 5IN1A 4GY5A 4J8OA 4N0AC 4E2FB 2E41A 3QYHB 2GQVA 3PIPA 3CC4Q 2GF7A 1TXQA 2W0ZA 4ZN3A 4BE0A 1M1KU 2JJ9A 5IXFA 1AT1B 2EFIA 1B34B 5GANd 1WLPB 1NPPA 2D9TA 4E7IA 3CCUA 1YITA 3PTAA 4R56A 1YFNA 2X4WA 1WI7A 5GAN6 3G71A 1RLPC 2EGCA 2NLUA 1MNDA 4J7FA 3CCEQ 2XU8A 3M0PA 3JCMh 3VYHB 1IXDA 2XK0A 4PJOE 4KGVB 2LNHB 3GLXA 3CC7Q 4M75B 1FMKA 1N6AA 3N5BB 1YCYA 1UGPB 2CZ0B 2K4YA 5GAOq 5CK9A 4AFUC 1WJQA 3THKA 4X1VA 3UA7A 1G3TA 2O88A 1I8FA 1QCFA 3MEWA 2CH4W 5IHNA 3TCJA 1I4K1 2FZCB 1VQKA 1Q7YU 1KJWA 2RQTA 2L5QA 3DKMA 2ROLA 3E9GA 5GANh 5CKHA 1XQHA 1YWOA 1YIJA 2VWFA 3QXEB 4ZTJA 1YI2A 2RHIA 2DTOA 2CUBA 3QWXX 1HK9A 2CUDA 1X6OA 2WSEE 2COYA 2MWOA 3CCUQ 1YITQ 1I5LA 4AFZC 3QPHA 3UF4A 2D6FA 2QG9B 3EAEA 1X27A 1VQ4T 1UGQB 2DA9A 3S3NA 2X4XA 3G6ET 2QXFA 3I5SA 5KE3A 4M75C 4F17A 2GFAA 4FSXA 2DE0X 1K1ZA 2DLPA 4BDZA 4KUDK 2J05A 5FLXE 3CC4A 2CKKA 2M51A 3I9QA 2YT6A 2DL7A 2E70A 3H8ZA 5HCKA 2BE7D 1PWTA 1M1KC 3QUIA 2P4RA 1NJIR 4PJOB 3G4SQ 4A4KA 4J9EA 2DMOA 2KT1A 3VKIA 4ELZC 2CT3A 2LCCA 1VQNQ 3UWNA 1E6HA 4PJLA 3V7RA 5GANg 4A53A 4II1A 1BI3A 3CCET 3H6ZA 1BCMA 2KT8A 2C0IA 3QYGB 1M30A 2MI6A 4FYVB 3M5AA 3OYAA 2P0PA 1MGQA 1OU8A 1MV3A 2DZ9A 2EKHA 4FYYB 2VV5A 3LLRA 2PQWA 1OX8A 4D8KA 2NUPB 3ULRB 3BFMA 1AZEA 3A1PA 2MCNA 5CVIA 4ZGEB 3DLMA 1BBZA 4CC3A 1WZOA 3CCSA 5CIUA 2NUTB 1WQ7A 3OYCA 1G8XA 5I21A 3U23A 1D0XA 1D3BB 2CSIA 1FWZA 2JXBA 2QA4Q 2X4YA 3P8BB 1ZQ1A 2QGGA 4DEXA 4UC4A 1JBMA 4EMKC 1GL5A 4KT0E 1VQKT 2E12A 5GMKl 1VYVA 1PNJA 3I56T 1X2QA 8AT1B 1V1CA 3L2VA 4JPBW 3VS1A 1LJOA 2LJ1A 1IHWA 3E1SA 3L2QA 3CCQT 1YP5A 2O4XA 4IUUA 1YIJQ 1H8KA 4ORZA 3NTIA 1M2OA 4BY6B 4ZN1A 2EYWA 4JJBA 3I5RA 3KUFA 5FRNA 1Q7YC 1Q82R 1G3SA 2P0KA 1Y71A 4XU3A 2IPOB 1I5OB 2X3WD 1I1JA 5GJVB 1VUBA 1UHFA 4RTTA 2YHTA 4M78D 5C6SA 1X6BA 3CMAA 2EYXA 4PJOC 2H3JA 4JZ4A 5IH2A 1U3OA 3CCJQ 5EC7A 5GMKi 1FYNA 2RHZA 5IXBA 1K8AU 1VQPA 2DD5A 2FEIA 5KCHA 4MMKA 3JCMP 3VS7A 4XTUA 1M3BA 1UUEA 4VUBA 2E3IA 2VC8A 1GCPA 1ZBJA 3OBYA 3OYDA 1AWJA 2CH4A 5DLOA 2QDYB 3EG9B 4M7DE 1HYOA 1EX4A 2FL7A 2G3RA 2DIQA 5GAN7 4QVZA 3HTRA 1PKTA 2ED0A 2RQRA 2DXTA 2ZGWA 4BI4A 3PMIA 4F16A 2ZPIB 1PRLC 3J81E 2LX7A 4M7DA 4C5EA 2K3XA 1IGUA 4AG2C 3PVQA 3X20B 1UHCA 2EBPA 1Q81R 3BE3A 2JMCA 4J5YA 2WACA 1NLOC 5GAN3 2AZSA 2QEXA 1RAGB 3NMZC 4C0ZA
chains in the Genus database with same CATH topology
1UDLA 2ESWA 4HVWA 1SRLA 5IHIA 2F2XA 3C0CA 4KRTA 3EG0A 1TUCA 2D8JA 4J9GA 2LQWA 1WFWA 3PE0A 2JS0A 2D8HA 2DNUA 2XMFA 2L3SA 5ECAA 4GBQA 2DL8A 1UFFA 1SHFA 2L3QA 2MOXA 4ESRA 4LUEA 3RBBB 4WCIA 2JW4A 1JU5C 2CDTA 2PZ1A 2BTTA 5GJWB 1BB9A 4HVVA 4EIKA 2J06A 1T3SA 2I0NA 1W6XA 1N5ZA 3M0RA 3EG3A 4OMLA 4A63B 5I22A 2RPNA 2KGTA 3A98A 4AFQC 3REAB 1RLQC 1YWPA 2K9GA 2GNCA 2K7AA 1RUWA 2KE9A 1G2BA 1RI9A 2KXCA 2BZXA 1MUZA 2KYMA 1GCQC 1GBQA 2CT4A 1WYXA 4F14A 2LQNA 1CSKA 2KBTA 2F2VA 1SPKA 2KROA 2ENMA 1UGVA 4HCKA 2O2OA 1ZUUA 3IQLA 1E7OA 4GLMA 1LCKA 3TSWA 2RNAA 1I07A 1M3AA 4J9IA 2LCSA 2DL4A 2AZVA 2FO0A 1UJYA 4J9CA 5FWBA 2CSQA 2K3BA 2D1XA 4J9BA 2GTJA 2DBKA 3VS4A 2HBWA 1Z9ZA 4HXJA 1KIKA 2DYBA 2FRYA 4IIOA 1PKSA 1BU1A 3FJ5A 1NG2A 1U5SA 2DVJA 1U06A 1KSWA 2JM8A 1W1FA 4OMNA 2YUPA 2LP5A 2E5KA 2JMAA 3H0HA 2DM1A 2HDAA 3H0IA 5IHKA 1GCQA 2K79A 4RTWA 1G83A 2FPFA 2HSPA 4RUGA 1S1NA 2DL5A 3VS0A 2BZ8A 1X6GA 1M3CA 3NGPA 4RTZA 4D8DA 3JV3A 1H92A 4ZNXA 2EVRA 2D0NA 3NPFA 2X3XD 3R6NA 2GGRA 2VVKA 1UG1A 3PVLA 1QLYA 2MIOA 2OAWA 4DEYA 2NWMA 5L23A 2W0ZA 5IXFA 4OMMA 2H8HA 1UECA 1TG0A 1A0NB 2SRCA 2YUOA 1AWXA 1WLPB 2EGAA 2AKLA 2EYYA 4R0KA 3TVTA 1ZLMA 3RNJA 1VYTA 1NEBA 1GFCA 1WI7A 4RTYA 1RLPC 2EGCA 3KFVA 1YNZA 3VS2A 2VKNA 1WXBA 2M0YA 4IIMA 1VA7A 1WX6A 2A08A 3M0PA 3QWYA 3EHRA 4JZ3A 2LNHB 1B3QA 4OMPA 3LH5A 2EW3A 4LNPA 1FMKA 2G6FX 2GBQA 1E6GA 4AFUC 2RQVA 3THKA 2C0OA 4X1VA 1EFNA 3H41A 3UA7A 1X43A 1VYUA 2O88A 1Y57A 1QCFA 4J9FA 3UA6A 2CH4W 3NHNA 5IHNA 2BZYA 3M0QA 1NYFA 1KJWA 4RTUA 1UJ0A 2RQTA 2A37A 2ROLA 2LJ0A 1YWOA 4Z89A 4CC7A 1ABQA 1AOJA 2VWFA 1ABOA 3EGUA 1QKXA 2DF6A 1MV0B 2DBMA 1SEMA 3M0TA 3QWXX 2CUBA 4LN2A 2CUDA 1AD5A 2KYBA 2ED1A 1AZGB 2F2WA 4AFZC 3UF4A 1HD3A 1X27A 4LUDA 2J6FA 2DA9A 2YUNA 5FWCA 2DILA 3I5SA 2EGEA 2JS2A 4F17A 1SSHA 1UE9A 4M4ZA 1PHTA 2DE0X 1K1ZA 2DLPA 2J05A 2FRWA 4HVUA 2PNIA 1AVZC 1WXTA 2M51A 3I9QA 2YT6A 2DL7A 2JT4A 1GBRA 5HCKA 2DX1A 2EQIA 1PWTA 2KRMA 2KXDA 2P4RA 1W70A 3I35A 2FPDA 3VS3A 4J9EA 1GFDA 3VRZA 2DMOA 3CQTA 4Y92A 2KT1A 2CT3A 1UTIA 1YN8A 3M0UA 3VRYA 1QKWA 1HJDA 1E6HA 1ARKA 2DJQA 2EPDA 2OI3A 2DL3A 2LZ6B 1OV3A 2HCKA 4RTVA 2C0TA 3EG1A 2KT8A 2C0IA 2ROTA 2DRKA 1OPLA 1M30A 3SEMA 2KRNA 4RTXA 1MV3A 2FPEA 4JJCA 2EKHA 2RMOA 3TSZA 2CREA 1X69A 1CKAA 1HSQA 4D8KA 3ULRB 1ZUYA 2K6DA 1T0HA 1AZEA 4Z8AA 2MCNA 1M27C 2V1QA 2L0AA 1BBZA 4CC3A 2O31A 1K0SA 1TUDA 1OPKA 1PRMC 3U23A 1QWFA 2OJ2A 1CKBA 1JXOA 1KFZA 1K0XA 2CSIA 2K2MA 2JXBA 2YDLA 2J6KA 4JJDA 1JEGA 4DEXA 1GL5A 1NM7A 1AEYA 2IIMA 2JTEA 1VYVA 1PNJA 1X2QA 1V1CA 4JPBW 2FG0A 3VS1A 2AK5A 2J7IA 2LJ1A 1QWEA 4QT7A 2NUZA 1OOTA 2KRSA 1YP5A 2KNBB 1SHGA 1T0JA 1H8KA 4ORZA 3ZL7C 1WIEA 3GBQA 2EYWA 3VS5A 4E6RA 2SEMA 4JJBA 3I5RA 2O9VA 2RN8A 3UATA 3EHQA 2X3WD 1ZSGA 1I1JA 5GJVB 2A36A 1UHFA 4RTTA 2AKKA 2PTKA 1Z9QA 4K11A 1X6BA 1ZX6A 1IO6A 4LE9A 2EYXA 1NLPC 2LJ3A 2YSQA 1NYGA 4JZ4A 5IH2A 1U3OA 1AWOA 1I0CA 2W10A 1K76A 4AG1C 5EC7A 2ABLA 2GQIA 3VS6A 1JXMA 1FYNA 2RQWA 5IXBA 1GRIA 2B86A 2A28A 2FEIA 2GTOA 2O9SA 2ECZA 4OMQA 1T3LA 1J3TA 3H0FA 4CC4B 3VS7A 1M3BA 1UUEA 3SHWA 1XOVA 2RF0A 1GCPA 1ZUKA 4J9DA 1ZBJA 2L3PA 1AWJA 2CH4A 1WA7A 1NEGA 3O5ZA 4CC2A 1SRMA 2V1RA 2YUQA 1BK2A 2EYZA 3REBB 1K4US 1PKTA 1JQQA 1WDXA 2ED0A 2KEAA 2RQRA 5I11A 1AWWA 1K9AA 4F16A 2J6OA 1PRLC 5FW9A 4AFSC 2LX7A 1M8MA 2LMJA 2JM9A 4AG2C 3PVQA 2DRMA 1UHCA 2QDLA 2EBPA 3EG2A 1WXUA 3M0SA 2L2PA 1Y0MA 1H3HA 2JMCA 1B07A 1JO8A 1NLOC 4OMOA 2HEQA 1X2KA 2KR3A 1OEBA 1YCSB 4Z88A 2AZSA 2RQUA 4FSSA 4J9HA 3NMZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UDL A;  2ESW A;  4HVW A;  1SRL A;  5IHI A;  2F2X A;  3C0C A;  4KRT A;  3EG0 A;  1TUC A;  2D8J A;  4J9G A;  2LQW A;  1WFW A;  3PE0 A;  2JS0 A;  2D8H A;  2DNU A;  2XMF A;  2L3S A;  5ECA A;  4GBQ A;  2DL8 A;  1UFF A;  1SHF A;  2L3Q A;  2MOX A;  4ESR A;  4LUE A;  3RBB B;  4WCI A;  2JW4 A;  1JU5 C;  2CDT A;  2PZ1 A;  2BTT A;  5GJW B;  1BB9 A;  4HVV A;  4EIK A;  2J06 A;  1T3S A;  2I0N A;  1W6X A;  1N5Z A;  3M0R A;  3EG3 A;  4OML A;  4A63 B;  5I22 A;  2RPN A;  2KGT A;  3A98 A;  4AFQ C;  3REA B;  1RLQ C;  1YWP A;  2K9G A;  2GNC A;  2K7A A;  1RUW A;  2KE9 A;  1G2B A;  1RI9 A;  2KXC A;  2BZX A;  1MUZ A;  2KYM A;  1GCQ C;  1GBQ A;  2CT4 A;  1WYX A;  4F14 A;  2LQN A;  1CSK A;  2KBT A;  2F2V A;  1SPK A;  2KRO A;  2ENM A;  1UGV A;  4HCK A;  2O2O A;  1ZUU A;  3IQL A;  1E7O A;  4GLM A;  1LCK A;  3TSW A;  2RNA A;  1I07 A;  1M3A A;  4J9I A;  2LCS A;  2DL4 A;  2AZV A;  2FO0 A;  1UJY A;  4J9C A;  5FWB A;  2CSQ A;  2K3B A;  2D1X A;  4J9B A;  2GTJ A;  2DBK A;  3VS4 A;  2HBW A;  1Z9Z A;  4HXJ A;  1KIK A;  2DYB A;  2FRY A;  4IIO A;  1PKS A;  1BU1 A;  3FJ5 A;  1NG2 A;  1U5S A;  2DVJ A;  1U06 A;  1KSW A;  2JM8 A;  1W1F A;  4OMN A;  2YUP A;  2LP5 A;  2E5K A;  2JMA A;  3H0H A;  2DM1 A;  2HDA A;  3H0I A;  5IHK A;  1GCQ A;  2K79 A;  4RTW A;  1G83 A;  2FPF A;  2HSP A;  4RUG A;  1S1N A;  2DL5 A;  3VS0 A;  2BZ8 A;  1X6G A;  1M3C A;  3NGP A;  4RTZ A;  4D8D A;  3JV3 A;  1H92 A;  4ZNX A;  2EVR A;  2D0N A;  3NPF A;  2X3X D;  3R6N A;  2GGR A;  2VVK A;  1UG1 A;  3PVL A;  1QLY A;  2MIO A;  2OAW A;  4DEY A;  2NWM A;  5L23 A;  2W0Z A;  5IXF A;  4OMM A;  2H8H A;  1UEC A;  1TG0 A;  1A0N B;  2SRC A;  2YUO A;  1AWX A;  1WLP B;  2EGA A;  2AKL A;  2EYY A;  4R0K A;  3TVT A;  1ZLM A;  3RNJ A;  1VYT A;  1NEB A;  1GFC A;  1WI7 A;  4RTY A;  1RLP C;  2EGC A;  3KFV A;  1YNZ A;  3VS2 A;  2VKN A;  1WXB A;  2M0Y A;  4IIM A;  1VA7 A;  1WX6 A;  2A08 A;  3M0P A;  3QWY A;  3EHR A;  4JZ3 A;  2LNH B;  1B3Q A;  4OMP A;  3LH5 A;  2EW3 A;  4LNP A;  1FMK A;  2G6F X;  2GBQ A;  1E6G A;  4AFU C;  2RQV A;  3THK A;  2C0O A;  4X1V A;  1EFN A;  3H41 A;  3UA7 A;  1X43 A;  1VYU A;  2O88 A;  1Y57 A;  1QCF A;  4J9F A;  3UA6 A;  2CH4 W;  3NHN A;  5IHN A;  2BZY A;  3M0Q A;  1NYF A;  1KJW A;  4RTU A;  1UJ0 A;  2RQT A;  2A37 A;  2ROL A;  2LJ0 A;  1YWO A;  4Z89 A;  4CC7 A;  1ABQ A;  1AOJ A;  2VWF A;  1ABO A;  3EGU A;  1QKX A;  2DF6 A;  1MV0 B;  2DBM A;  1SEM A;  3M0T A;  3QWX X;  2CUB A;  4LN2 A;  2CUD A;  1AD5 A;  2KYB A;  2ED1 A;  1AZG B;  2F2W A;  4AFZ C;  3UF4 A;  1HD3 A;  1X27 A;  4LUD A;  2J6F A;  2DA9 A;  2YUN A;  5FWC A;  2DIL A;  3I5S A;  2EGE A;  2JS2 A;  4F17 A;  1SSH A;  1UE9 A;  4M4Z A;  1PHT A;  2DE0 X;  1K1Z A;  2DLP A;  2J05 A;  2FRW A;  4HVU A;  2PNI A;  1AVZ C;  1WXT A;  2M51 A;  3I9Q A;  2YT6 A;  2DL7 A;  2JT4 A;  1GBR A;  5HCK A;  2DX1 A;  2EQI A;  1PWT A;  2KRM A;  2KXD A;  2P4R A;  1W70 A;  3I35 A;  2FPD A;  3VS3 A;  4J9E A;  1GFD A;  3VRZ A;  2DMO A;  3CQT A;  4Y92 A;  2KT1 A;  2CT3 A;  1UTI A;  1YN8 A;  3M0U A;  3VRY A;  1QKW A;  1HJD A;  1E6H A;  1ARK A;  2DJQ A;  2EPD A;  2OI3 A;  2DL3 A;  2LZ6 B;  1OV3 A;  2HCK A;  4RTV A;  2C0T A;  3EG1 A;  2KT8 A;  2C0I A;  2ROT A;  2DRK A;  1OPL A;  1M30 A;  3SEM A;  2KRN A;  4RTX A;  1MV3 A;  2FPE A;  4JJC A;  2EKH A;  2RMO A;  3TSZ A;  2CRE A;  1X69 A;  1CKA A;  1HSQ A;  4D8K A;  3ULR B;  1ZUY A;  2K6D A;  1T0H A;  1AZE A;  4Z8A A;  2MCN A;  1M27 C;  2V1Q A;  2L0A A;  1BBZ A;  4CC3 A;  2O31 A;  1K0S A;  1TUD A;  1OPK A;  1PRM C;  3U23 A;  1QWF A;  2OJ2 A;  1CKB A;  1JXO A;  1KFZ A;  1K0X A;  2CSI A;  2K2M A;  2JXB A;  2YDL A;  2J6K A;  4JJD A;  1JEG A;  4DEX A;  1GL5 A;  1NM7 A;  1AEY A;  2IIM A;  2JTE A;  1VYV A;  1PNJ A;  1X2Q A;  1V1C A;  4JPB W;  2FG0 A;  3VS1 A;  2AK5 A;  2J7I A;  2LJ1 A;  1QWE A;  4QT7 A;  2NUZ A;  1OOT A;  2KRS A;  1YP5 A;  2KNB B;  1SHG A;  1T0J A;  1H8K A;  4ORZ A;  3ZL7 C;  1WIE A;  3GBQ A;  2EYW A;  3VS5 A;  4E6R A;  2SEM A;  4JJB A;  3I5R A;  2O9V A;  2RN8 A;  3UAT A;  3EHQ A;  2X3W D;  1ZSG A;  1I1J A;  5GJV B;  2A36 A;  1UHF A;  4RTT A;  2AKK A;  2PTK A;  1Z9Q A;  4K11 A;  1X6B A;  1ZX6 A;  1IO6 A;  4LE9 A;  2EYX A;  1NLP C;  2LJ3 A;  2YSQ A;  1NYG A;  4JZ4 A;  5IH2 A;  1U3O A;  1AWO A;  1I0C A;  2W10 A;  1K76 A;  4AG1 C;  5EC7 A;  2ABL A;  2GQI A;  3VS6 A;  1JXM A;  1FYN A;  2RQW A;  5IXB A;  1GRI A;  2B86 A;  2A28 A;  2FEI A;  2GTO A;  2O9S A;  2ECZ A;  4OMQ A;  1T3L A;  1J3T A;  3H0F A;  4CC4 B;  3VS7 A;  1M3B A;  1UUE A;  3SHW A;  1XOV A;  2RF0 A;  1GCP A;  1ZUK A;  4J9D A;  1ZBJ A;  2L3P A;  1AWJ A;  2CH4 A;  1WA7 A;  1NEG A;  3O5Z A;  4CC2 A;  1SRM A;  2V1R A;  2YUQ A;  1BK2 A;  2EYZ A;  3REB B;  1K4U S;  1PKT A;  1JQQ A;  1WDX A;  2ED0 A;  2KEA A;  2RQR A;  5I11 A;  1AWW A;  1K9A A;  4F16 A;  2J6O A;  1PRL C;  5FW9 A;  4AFS C;  2LX7 A;  1M8M A;  2LMJ A;  2JM9 A;  4AG2 C;  3PVQ A;  2DRM A;  1UHC A;  2QDL A;  2EBP A;  3EG2 A;  1WXU A;  3M0S A;  2L2P A;  1Y0M A;  1H3H A;  2JMC A;  1B07 A;  1JO8 A;  1NLO C;  4OMO A;  2HEQ A;  1X2K A;  2KR3 A;  1OEB A;  1YCS B;  4Z88 A;  2AZS A;  2RQU A;  4FSS A;  4J9H A;  3NMZ C; 
#chains in the Genus database with same CATH topology
 1MMA A;  2LX9 A;  1SRL A;  3D7S B;  5KYW B;  2ZPB B;  2QQA A;  3Q1J A;  2F2X A;  3C0C A;  4KRT A;  2XG8 D;  3JRZ A;  3C95 A;  1TUC A;  4C92 C;  2L3S A;  2I2L A;  4PL6 A;  3OS1 A;  3EGX A;  2DVE A;  4BE1 A;  1C0M A;  4IUV A;  2CP2 A;  5CKF A;  2EWN A;  1W2B A;  4EIK A;  4OML A;  3EG3 A;  3MEU A;  4A63 B;  2ZAE A;  5LJ5 f;  1RLQ C;  4KBM B;  1G2B A;  5DM7 R;  2V8J A;  2DXC A;  2CT4 A;  1OYX A;  5A0L A;  3OMG A;  5LJ5 g;  2LQN A;  1SPK A;  1OU9 A;  4HCK A;  1MMG A;  1M1K R;  4GLM A;  3CPF A;  2JN0 A;  4BY6 C;  1VQ4 Q;  1M3A A;  5LJ5 h;  2DL4 A;  1B34 A;  2AZV A;  2FO0 A;  3E2U A;  3PNW C;  3ER0 A;  5CQY A;  1KD1 C;  3I56 Q;  3EFO A;  4F7U A;  4DA4 A;  4J9B A;  3CBP A;  3VS4 A;  4HXJ A;  3OBW A;  1KIK A;  1KQS S;  2FRY A;  3HHT B;  1XTD A;  1NG2 A;  3WVD B;  2GFU A;  2RD1 A;  3A8G B;  1R0B G;  4M7A E;  5KYX A;  2LP5 A;  3H0H A;  4M7D C;  5CO7 A;  4E7H A;  5CCA A;  1VQP Q;  3H0I A;  2F69 A;  1YJW Q;  2RK2 A;  1G83 A;  2MWP A;  1M1G A;  2QYZ A;  4RUG A;  3CCJ A;  3CCL Q;  1M2V A;  2DXB A;  4Z02 A;  4XTY A;  3FC3 A;  3PT9 A;  4JDS A;  4BAC A;  4PFZ A;  3CXC A;  2GGR A;  5D6W A;  2PUK B;  1BIB A;  4B9W A;  4BE2 A;  3M59 A;  2OAW A;  3V8L A;  3MP6 A;  3CPW P;  1RL2 A;  5L23 A;  4EMK A;  1D1A A;  3NFC A;  4X9C A;  2H8H A;  1UEC A;  2LCL A;  1A0N B;  2SRC A;  2YUO A;  2WSF E;  1VYT A;  3LGF A;  3M55 A;  4C92 F;  2QTV A;  2NYS A;  4PJN A;  5CQX A;  3JCM J;  1YNZ A;  3VS2 A;  1RAF B;  2V26 A;  1WXB A;  2M0Y A;  1WX6 A;  1VQ8 T;  3QWY A;  3CCS T;  3EHR A;  3JCM e;  1PD0 A;  3HL8 A;  3CME A;  3QDF A;  2MK5 A;  2YLB A;  2AIR B;  3CXC S;  2G6F X;  5DLQ E;  1LVK A;  2E6N A;  5GAN e;  4P5N A;  5LJ5 e;  1UGS B;  4M7D D;  1VQM Q;  2PUO B;  2RQV A;  1M5Q 1;  1S72 T;  5KCO A;  4BDY A;  2C0O A;  1EFN A;  3QZ5 B;  1H64 1;  4M7A F;  1VYU A;  2YLC A;  1YJ9 T;  3UA6 A;  2BZY A;  3M0Q A;  2DO3 A;  1UJ0 A;  3L2U A;  3VV0 A;  1U8R A;  2XKO C;  3SDZ A;  3LYI A;  3VUB A;  3H9N A;  4FU6 A;  2Y4X A;  4Z89 A;  1ABQ A;  1AHJ B;  2XIC A;  2DF6 A;  1MV0 B;  3EFS A;  4HCC A;  1AD5 A;  3LW5 E;  1KQS P;  3JCM b;  5FRM A;  2V8I A;  2J6F A;  5LJ3 d;  2DIL A;  2EGE A;  3RER A;  4C8Q C;  1PHT A;  2E65 A;  2FRW A;  4F04 B;  5GAM g;  4JS4 A;  3FB9 A;  4HVU A;  3VUZ A;  1PSE A;  1R77 A;  1WXT A;  4KH1 B;  2DX1 A;  2DJZ A;  1ZSZ A;  2CS7 A;  2KXD A;  2XHC A;  5GAO p;  2QI2 A;  3GPL A;  1VQ9 T;  2FPD A;  2KQW A;  4C92 D;  4Y92 A;  1M4Z A;  1BIA A;  2HQE A;  3BDU A;  1VQ6 Q;  2DL3 A;  1VQ5 Q;  2CP5 A;  4X9D A;  2C0T A;  5KYN A;  4JUV A;  1Q86 C;  1BCO A;  1QP2 A;  1VQK Q;  3SEM A;  3CCL T;  2RJC A;  1PC0 A;  2FPE A;  2RMO A;  4M77 E;  4M77 G;  4M7D G;  2CRE A;  3ZFJ A;  3JCM g;  5GMK h;  4OP0 A;  1Q82 C;  1QVG S;  2K6D A;  3CCM T;  4FW1 A;  2HL3 A;  2LT1 A;  3CC7 A;  2AT1 B;  2L0A A;  5L8R E;  2CYZ B;  1XJW B;  2OJ2 A;  2R57 A;  4PLI A;  2K2M A;  4MDX A;  3OYL A;  4XTW A;  4BI8 B;  3G7Z A;  3RDV A;  3CBM A;  4QVC A;  3M54 A;  1PCX A;  1Q86 U;  4LDV A;  2RA2 A;  1OOT A;  2FZG B;  3ZBD A;  3CCM A;  4JRI A;  1SHG A;  4A4H A;  3CCS Q;  2PVD B;  4LDX A;  5GMK e;  3UAT A;  2K5F A;  1K9M U;  3EHQ A;  2P0Q A;  1QVG A;  3G6E A;  3SB2 A;  1VQM A;  2AKK A;  3MPU B;  5HK0 A;  1D0Z A;  1Z9Q A;  4PJM A;  4K11 A;  3MCA B;  1IO6 A;  3PMT A;  2EAY A;  2OTJ T;  4DBH A;  1NYG A;  3FEO A;  4L59 A;  4DOW A;  1VQL A;  2JTM A;  2W10 A;  1K76 A;  4JRP A;  2XI9 A;  2DAQ A;  4M75 F;  2RI2 A;  1JXM A;  1K8A R;  3QJY A;  1M8V A;  2O9S A;  1VQ9 A;  2EJF A;  5KYW A;  1QW1 A;  2QEX Q;  1T3L A;  2IG0 A;  2CP0 A;  5KYU A;  3H0F A;  3OYB A;  1VQN T;  3HPW A;  3RMS A;  2M02 A;  1UB4 A;  3O5Z A;  4CC2 A;  2OTJ A;  2YUQ A;  3JB9 I;  1BK2 A;  2D0Q B;  2EYZ A;  1WDX A;  2KEA A;  3HFN A;  5HK3 A;  1K9A A;  1O75 A;  2ZPH B;  2J6O A;  3X24 B;  5FW9 A;  1M90 R;  4A4G A;  3OYI A;  4AMC A;  2LC4 A;  2LMJ A;  3OW2 A;  2CZ1 B;  2KMT A;  4QVD A;  3EG2 A;  5FU6 C;  3INZ A;  1WXU A;  4OB0 B;  3M0S A;  1Y0M A;  1M2V B;  4C5G A;  2HEQ A;  2F5T X;  4DBF A;  4C0F A;  3HSB A;  4J9H A;  4C8Q G;  2ESW A;  3L42 A;  1IRX A;  5IHI A;  4MZT A;  3RIR A;  1YHQ A;  2JVV A;  3EG0 A;  1VQ8 Q;  1FX7 A;  4J9G A;  2LQW A;  4HCB A;  5CKE A;  1KC8 R;  4M77 B;  4O6J A;  5ECA A;  1KD1 R;  4GBQ A;  2DL8 A;  1OX9 A;  4ESR A;  4LUE A;  2JW4 A;  1QVF P;  2KY9 A;  1RAE B;  2PZ1 A;  5GJW B;  1VQ7 T;  4ATO A;  2DEU A;  1W6X A;  3C4S A;  3M0R A;  1VQ8 A;  5I22 A;  4LDY A;  3JCM W;  2KGT A;  3QHS A;  3V8J A;  4AFQ C;  3L1A A;  3UDC A;  1EZZ B;  2KDS A;  4PK4 A;  4XTV A;  1PM3 A;  2FHD A;  5A2Q E;  3VYG A;  1MNE A;  3CBO A;  2M16 A;  2KXC A;  2RJE A;  2KYM A;  3RUX A;  3I55 T;  3OQ5 A;  3OSS C;  4Y91 A;  2RM4 A;  2VUB A;  2KBT A;  2F2V A;  4XU2 A;  2KRO A;  4F7U B;  1C1A A;  4CI0 C;  1P92 A;  2O2O A;  3IQL A;  3TSW A;  4XU1 A;  1LCK A;  1ZA1 B;  3C94 A;  4WTO B;  3JB9 D;  3JCM V;  1N8R C;  4J9I A;  2LCS A;  1HXD A;  3QZ9 B;  1YJN A;  4R55 A;  5GMK m;  4PJO D;  2HNI A;  2MPX C;  2CSQ A;  3SD4 A;  4XAX B;  1IB8 A;  4M78 C;  3DLL A;  2GTJ A;  5GAN 8;  1M1F A;  2DYB A;  1PKS A;  2OTL Q;  1U5S A;  2DVJ A;  4PJO A;  1QVG P;  4OMN A;  1QCO A;  2YUP A;  5LJ3 e;  1VQ9 Q;  2HDA A;  4OVA A;  1GCQ A;  3M57 A;  3T9N A;  4IUR A;  2HSP A;  5DY9 A;  4J83 A;  1TUG B;  4FT4 A;  4BI3 A;  2BZ8 A;  2E3H A;  5LJ3 h;  1IZ6 A;  2B8A A;  4N4I A;  3NGP A;  4C0D C;  2YXY A;  3JV3 A;  3OYE A;  1H92 A;  2C06 A;  4BD3 A;  2X3X D;  3R6N A;  1K73 R;  2HD0 A;  4EDU A;  2LT4 A;  1QLY A;  1TU0 B;  4JS5 A;  3MET A;  3RES A;  4EMG A;  2VB6 A;  3ME9 A;  4KUL A;  1YJN Q;  2LTO A;  3CCM Q;  1WJR A;  3QG1 A;  1TSF A;  1TG0 A;  4HKE A;  2DKG A;  2AKL A;  2EYY A;  4R0K A;  2RK1 A;  1ZLM A;  2X4J A;  2KVQ G;  1YJ9 Q;  3EG9 A;  3RNJ A;  3FIF A;  2DFU A;  1NEB A;  1VQO A;  5GAO l;  2YWW A;  3HKS A;  4NOY A;  3QO3 A;  3SWN B;  3CC4 T;  2M1H A;  2A08 A;  3JB9 F;  5FU7 B;  4EPC A;  4BB7 A;  4M75 E;  1GXI E;  1KHC A;  4OMP A;  4LNP A;  3JAM E;  5LJ5 j;  1U1T A;  1Q82 U;  4HT9 A;  4A4F A;  2X51 A;  5I2S A;  4IUT A;  2DTH A;  5KYU B;  2BE9 B;  3I55 A;  1O9S A;  4M77 F;  1Q7Y R;  4HT8 A;  1KK7 A;  4J9F A;  5FU6 B;  2A3L A;  2V8K A;  3NHN A;  1ZA2 B;  2HQH A;  1YJN T;  4RTU A;  1MHN A;  3LGL A;  3X26 B;  1JB0 E;  2JUF A;  7AT1 B;  4CC7 A;  2KSS A;  1ABO A;  3EGU A;  2RHY A;  1QKX A;  1KQ2 A;  1OUL A;  4CRI A;  2JNG A;  1NJI C;  3QSU A;  1W4S A;  3SWN A;  2AHJ B;  3M0T A;  4LN2 A;  1AZG B;  2F2W A;  5KYY A;  1M90 C;  1HD3 A;  1FMV A;  3MJX A;  4C0D B;  3MKD A;  4LUD A;  3CC2 Q;  1WHJ A;  2HAX A;  5FWC A;  2XD0 A;  1K8A C;  3M9Q A;  4M7D B;  4M75 G;  1D09 B;  2CZ7 B;  4FM4 B;  1B7T A;  1VQ5 T;  4M4Z A;  4KH0 B;  4DQ2 A;  4RCC A;  2L8D A;  2QTX A;  4E7K A;  3M4Y A;  4X34 A;  5KYY B;  2JT4 A;  1GBR A;  2HQX A;  2PU9 B;  2RI5 A;  2P84 A;  3VS3 A;  2K5I A;  1VQ7 Q;  2E6Z A;  3VRZ A;  3CQT A;  1JRI A;  1YN8 A;  3FRN A;  5GAM f;  3C12 A;  4O5V A;  1RI0 A;  1QKW A;  1HJD A;  3V7C A;  2Y4Y A;  2EPD A;  2OI3 A;  1EIF A;  1S72 A;  1G3W A;  4ME7 A;  2Z0W A;  3EG1 A;  4E7S A;  1VOM A;  5FU7 C;  1OPL A;  1C6V X;  3OA6 A;  3FLG A;  2HKN A;  4M77 D;  4M7A D;  4N4G A;  3OYH A;  3A5Z B;  2MF2 A;  5M9O A;  2F1L A;  1X69 A;  4M78 A;  2P4T A;  3M56 A;  4L5G A;  4FYX B;  4OB3 B;  3PIO A;  3QJ6 A;  4C92 A;  2DET A;  1Y96 B;  4PJJ A;  2O31 A;  1WHG A;  1OPK A;  1G5V A;  3GP8 A;  3A8H B;  3CC2 A;  3X25 B;  1JXO A;  1JJ2 A;  1K0X A;  1RAA B;  3HFO A;  2FVU A;  2YDL A;  5CAI A;  3M58 A;  5LJ3 f;  1KD1 U;  4NS5 A;  1NM7 A;  2LDM A;  3A8M B;  1BYM A;  2ZCF B;  4QQ6 A;  2IIM A;  2JTE A;  4AT1 B;  3OYY A;  2HSE B;  1VQL T;  1W2B S;  2FG0 A;  5J26 A;  2AK5 A;  2J7I A;  4M78 B;  6AT1 B;  2KRS A;  4IUP A;  1H3Z A;  2ZPE B;  4C92 B;  3E9F A;  1T0J A;  3ZL7 C;  3GNG A;  2L3R A;  3VS5 A;  4TVR A;  3RR6 A;  2QEX T;  4E47 A;  3EH2 A;  1K9M R;  2O9V A;  2QA4 T;  3BDL A;  4GLK A;  3CEY A;  1ZSG A;  5D6X A;  2E64 A;  1F1B B;  3CCR T;  2CP3 A;  8ATC B;  3OYG A;  2PTK A;  4Q5W A;  4DBQ A;  1YHQ T;  2RHU A;  1ZX6 A;  4LE9 A;  1K73 C;  1NLP C;  1UEB A;  3CCL A;  4ZGD B;  1AWO A;  3WVE B;  1I0C A;  4AG1 C;  4M77 A;  2GQI A;  5GAN 4;  3JB9 G;  4C8Q B;  2HZY A;  3KXT A;  4A4E A;  2RQW A;  1Q81 U;  3S3M A;  4N0A A;  1VQ6 A;  2B86 A;  2DK3 A;  2A28 A;  4M78 E;  2GTO A;  3M4G A;  2ECZ A;  2E1H A;  1J3T A;  2QA4 A;  5J39 A;  4J7I A;  4PLL A;  3SHW A;  2KI7 A;  1XOV A;  1YI2 T;  4J9D A;  1ZBX A;  5C0M A;  1KC8 C;  1YJW T;  1NEG A;  2QK0 A;  2K5L A;  5GAN 5;  2ZPG B;  1Y7X A;  4JJN K;  3DB3 A;  3S6W A;  1AWW A;  1OZ2 A;  2XDB A;  4C8Q F;  2LRQ A;  4EMH A;  2JM9 A;  3SFM A;  5J3B A;  2QDL A;  3R6O A;  2R5M A;  4XU0 A;  4C5I A;  1OZ3 A;  3CCV T;  2VAS A;  2L89 A;  1WPY A;  2EQU A;  2L2P A;  2EJ9 A;  2OAU A;  1H3H A;  2R58 A;  4Y28 E;  1B07 A;  3NTH A;  2RH2 A;  2XDP A;  4RG2 A;  1YCS B;  4Z88 A;  4FSS A;  3TSZ A;  1VQL Q;  2DYI A;  1WGS A;  2F5K A;  1NPR A;  2H3E B;  1WFW A;  3PE0 A;  1KC8 U;  4J6Y A;  2JS0 A;  4NL2 A;  2D8H A;  1X01 A;  2QGF B;  4N4H A;  1R8O B;  2XID A;  2DNU A;  1ACM B;  5GAO r;  1N9S A;  1UFF A;  1SHF A;  2MOX A;  4B6M A;  2ZZD A;  3SWN C;  4M7A C;  1JU5 C;  4M77 C;  1BI0 A;  5A0G A;  2CDT A;  3LX7 A;  1Q81 C;  1SF9 A;  2KK4 A;  4HVV A;  2J06 A;  1T3S A;  2I0N A;  4M75 D;  3CPW A;  3L2W A;  5CKD A;  3REA B;  1YWP A;  3LH0 A;  1S72 Q;  2K7A A;  5GAN j;  1K73 U;  2KE9 A;  1RI9 A;  1VQN A;  1IHV A;  2BZX A;  1MUZ A;  1GCQ C;  2LQK A;  1WYX A;  4DBR A;  4QW2 A;  4PNO A;  4F7U E;  1UGV A;  1YI2 Q;  1ZUU A;  1KHI A;  2QQ9 A;  3ASK A;  2M9U A;  4M7A B;  1NBE B;  1WQW A;  5FWB A;  4RG8 A;  3CD6 A;  3LWI A;  2K3B A;  1TTH B;  4LXC A;  4PKC C;  2FB7 A;  4RCB A;  2HBW A;  1Z9Z A;  4YTL A;  4OGC A;  4OB2 B;  1BU1 A;  3FJ5 A;  1U06 A;  1KSW A;  2NUP A;  1DJ7 B;  2COW A;  1ZSZ B;  1JJ2 P;  5GAN 2;  4KUI A;  2JMA A;  3FJP A;  2DM1 A;  3CCV Q;  3OS5 A;  2K79 A;  4RTW A;  1R0C B;  1VQ5 A;  4MDW A;  1S1N A;  4MML A;  2DL5 A;  3VS0 A;  1N8R U;  3CMA T;  2EYQ A;  2VXF A;  3G71 Q;  1M3C A;  4D8D A;  1TH7 A;  1VQO Q;  1QVF A;  4E7Z A;  3CCV A;  4F7U G;  2EVR A;  1I81 A;  2EQJ A;  3MP8 A;  4FT2 A;  5GAM e;  4C0G A;  2WSC E;  1UG1 A;  4XTZ A;  3L2R A;  1VQP T;  4QKU A;  3JB9 J;  1N9R A;  2ATC B;  1V29 B;  4DEY A;  3OMC A;  2NWM A;  3GOX A;  3A8L B;  3TQ7 P;  4FW2 A;  2IVW A;  3TRE A;  2DXU A;  2EJG A;  2JTF A;  4OMM A;  3TEE A;  4PFO A;  3CPW S;  5LJ5 d;  2K3Y A;  4A54 A;  2ZPF B;  1AWX A;  1V76 A;  2EGA A;  3TU4 K;  3TVT A;  1GFC A;  4BUG A;  4RTY A;  3KFV A;  4OB1 B;  1YBY A;  5D7U A;  1D1C A;  2VKN A;  4IIM A;  4RMO A;  1VA7 A;  4FIB A;  2HKQ B;  4JZ3 A;  5KH6 A;  1QVF S;  3QDR B;  3S3O A;  1B3Q A;  1IRE B;  3LH5 A;  2EW3 A;  1LNX A;  1Q95 G;  1G3Y A;  3G1J A;  4J6W A;  2GBQ A;  1E6G A;  2VGN A;  3X28 B;  3CC2 T;  3H41 A;  1X43 A;  4M75 A;  4FYW B;  1Y57 A;  1KQS A;  1TWB A;  2A7Y A;  3JSC A;  3MHX A;  1NYF A;  4PJO G;  2A37 A;  1N8R R;  2LJ0 A;  5GAM d;  2RI3 A;  1AOJ A;  3OW2 S;  4NL3 A;  3OYK A;  1LOJ A;  2K57 A;  2DBM A;  3GIB A;  1SEM A;  2DEQ A;  1JJ2 S;  3JCM c;  2ED1 A;  2KYB A;  2KAF A;  4KGX B;  3CC7 T;  4ELY C;  1OI1 A;  3CCR A;  4M7A G;  3OYJ A;  3WXM B;  1Y96 A;  2YUN A;  2R5A A;  3EFO B;  4D6W A;  2JS2 A;  4EMK B;  1SSH A;  1UE9 A;  1WJS A;  1MMN A;  1RAC B;  1VQ6 T;  4PJO F;  1RAD B;  3JCM f;  2PNI A;  1AVZ C;  4OMF B;  2EQI A;  3CCQ A;  3EGX B;  2KRM A;  2BUD A;  5A0D A;  3JB9 H;  3OYM A;  1W70 A;  2HL5 C;  3I35 A;  5GAN f;  3CME T;  2X35 A;  1SG5 A;  2E10 A;  1GFD A;  3HP9 A;  5LJ3 j;  3AHU A;  1UTI A;  1D1B A;  3M0U A;  1YJW A;  1YHQ Q;  3VRY A;  2HMA A;  4J6X A;  3OSV A;  1ARK A;  4E7L A;  2DJQ A;  2LZ6 B;  3HRS A;  1OV3 A;  2HCK A;  1ZHI A;  4RTV A;  4M78 G;  3J80 E;  4XQ3 A;  2E4H A;  4C92 E;  2ROT A;  2DRK A;  4C92 G;  2KRN A;  4ANJ A;  5HKC A;  4RTX A;  3GNF B;  4JJC A;  4MZP A;  4QQG A;  3J7A F;  2O01 E;  1VIF A;  1LPL A;  1FMW A;  3BW1 A;  2QAS A;  3OY9 A;  3NTK A;  3CD6 Q;  4DOV A;  1CKA A;  1HSQ A;  3HRT A;  4C8Q E;  1ZUY A;  2LNV A;  1T0H A;  3G4S T;  4Z8A A;  1VQ4 A;  1M27 C;  2V1Q A;  3RKX A;  5HY6 A;  1K0S A;  1TUD A;  1PRM C;  4MZM A;  3CCE A;  1QWF A;  1CKB A;  1KFZ A;  1VIE A;  2J6K A;  1U1S A;  4JJD A;  1JEG A;  1QVP A;  3V8K A;  3MP1 A;  1Q86 R;  2MMP A;  3FDR A;  1AEY A;  2CP6 A;  3URG A;  3RKY A;  1NJI U;  1QWE A;  4QT7 A;  2NUZ A;  4QQD A;  2EQK A;  2KNB B;  3G71 T;  1KQ1 A;  2YRC A;  1TS9 A;  1WIE A;  3GBQ A;  4E6R A;  2XDD A;  2SEM A;  3MEV A;  2RN8 A;  2MAM A;  4FCY A;  2A36 A;  2DD4 A;  3JCM Q;  4LDW A;  4IUQ A;  3BY7 A;  4JLG A;  4FL6 A;  5IT9 E;  4LD9 K;  2COZ A;  2LJ3 A;  1WHL A;  2YSQ A;  2RJD A;  3CME Q;  1SKU B;  2ABL A;  3O8V A;  3OB9 A;  5IAY A;  3VS6 A;  2VYT A;  5CR2 A;  1WHM A;  1BKB A;  3PGG A;  3EH1 A;  2PVG B;  1GRI A;  3VU3 C;  1W2B P;  1VQ7 A;  4C8Q A;  2DER A;  4OMQ A;  1TOV A;  2JZ2 A;  2LQ8 A;  3M53 A;  2QAZ A;  4CC4 B;  4WF2 A;  4RKU E;  2RF0 A;  1ZUK A;  2CGH A;  2VGM A;  1WNL A;  2L3P A;  2RB6 A;  5GAO n;  2QQS A;  1WA7 A;  2FZK B;  1ZSZ C;  5FRO A;  3VJP A;  3AT1 B;  1SRM A;  2V1R A;  3EFR A;  1M90 U;  3REB B;  1PD1 A;  1K4U S;  1JQQ A;  4ZTF A;  5I11 A;  2BIV A;  1WHK A;  1N27 A;  2X9H A;  1K9M C;  2EIF A;  3L2Z A;  4JLI A;  1IGQ A;  4AFS C;  1M8M A;  3CCJ T;  5AT1 B;  2DRM A;  2EQM A;  2A0F B;  1Y07 A;  3P8H A;  1QCN A;  3DB4 A;  4F7U F;  1BI2 A;  2OTL T;  4PFP A;  2RJF A;  3OW2 P;  5CKB A;  1JO8 A;  2JOY A;  4OMO A;  1X2K A;  2KR3 A;  1OEB A;  2RQU A;  4LDU A;  2PVO B;  1UDL A;  3MO8 A;  4HVW A;  3QKJ A;  3ZEH A;  2RHX A;  3JCM X;  3OYN A;  1VQM T;  5LL6 S;  4E7J A;  2D8J A;  3UPU A;  2DZC A;  4XTX A;  3CMA Q;  5D6Y A;  3OYF A;  2XMF A;  2DIG A;  3PFS A;  3RKW A;  1M9S A;  3CXC P;  2VXE A;  2L3Q A;  5I2M A;  2O4X B;  2QQR A;  3RBB B;  1SSF A;  4WCI A;  1D0Y A;  2MYS A;  4ZGJ B;  2BTT A;  3I55 Q;  9ATC B;  1BB9 A;  1PG5 B;  3KBG A;  1N5Z A;  3UT1 A;  1WHH A;  3I56 A;  3CD6 T;  2RPN A;  3A98 A;  1QP3 A;  2K9G A;  5EG2 A;  2GNC A;  2Y90 A;  1RUW A;  2GCX A;  1XNI A;  5GMK j;  4XK8 E;  3CCR Q;  4L6V 5;  5GAM j;  1GBQ A;  2YRV A;  4F14 A;  4V2S A;  2YRD A;  3MEA A;  1RAH B;  1CSK A;  1KG1 A;  3P8D A;  5AYF A;  4C5H A;  1NE8 A;  2ENM A;  4JRQ A;  5GAO m;  1E7O A;  2DPP B;  2RNA A;  1X75 C;  1OQK A;  3CCQ Q;  1I07 A;  1YJ9 A;  4IKF A;  1FXX A;  4HCZ A;  1UJY A;  2E5Q A;  4J9C A;  4JRK A;  3OS0 A;  2DTI A;  2OTJ Q;  2FYK A;  2D1X A;  4M7A A;  3GF5 A;  3V7S A;  1VQO T;  2NUT A;  2DBK A;  4M7D F;  4C8Q D;  4IIO A;  1QMC A;  5GAM h;  2OX7 A;  1MMD A;  2M0O A;  1D3B A;  4OGE A;  3QII A;  2JM8 A;  3JCM d;  1RAB B;  1BI1 A;  1W1F A;  3OS2 A;  3EGD B;  2E5K A;  1RAI B;  3E19 A;  2CP7 A;  2RO0 A;  2K2V A;  4OF1 A;  3F70 A;  4HA8 A;  4M78 F;  4KGZ B;  5IHK A;  5LJ3 g;  2QQB A;  2FPF A;  4B9X A;  5KE2 A;  2CZ6 B;  3A8O B;  5KYX B;  3LWH A;  2BKD N;  3HRU A;  1X6G A;  3RMQ A;  1YIJ T;  1NZ9 A;  2HBP A;  1QQJ A;  4RTZ A;  1UGR B;  3CCU T;  1YIT T;  2EKO A;  4ZNX A;  3G6E Q;  3QBY A;  3EGD A;  2D0N A;  2LVM A;  3NPF A;  1PSF A;  3G4S A;  2OTL A;  2VVK A;  4LD6 A;  3PVL A;  2MIO A;  5IN1 A;  4GY5 A;  4J8O A;  4N0A C;  4E2F B;  2E41 A;  3QYH B;  2GQV A;  3PIP A;  3CC4 Q;  2GF7 A;  1TXQ A;  2W0Z A;  4ZN3 A;  4BE0 A;  1M1K U;  2JJ9 A;  5IXF A;  1AT1 B;  2EFI A;  1B34 B;  5GAN d;  1WLP B;  1NPP A;  2D9T A;  4E7I A;  3CCU A;  1YIT A;  3PTA A;  4R56 A;  1YFN A;  2X4W A;  1WI7 A;  5GAN 6;  3G71 A;  1RLP C;  2EGC A;  2NLU A;  1MND A;  4J7F A;  3CCE Q;  2XU8 A;  3M0P A;  3JCM h;  3VYH B;  1IXD A;  2XK0 A;  4PJO E;  4KGV B;  2LNH B;  3GLX A;  3CC7 Q;  4M75 B;  1FMK A;  1N6A A;  3N5B B;  1YCY A;  1UGP B;  2CZ0 B;  2K4Y A;  5GAO q;  5CK9 A;  4AFU C;  1WJQ A;  3THK A;  4X1V A;  3UA7 A;  1G3T A;  2O88 A;  1I8F A;  1QCF A;  3MEW A;  2CH4 W;  5IHN A;  3TCJ A;  1I4K 1;  2FZC B;  1VQK A;  1Q7Y U;  1KJW A;  2RQT A;  2L5Q A;  3DKM A;  2ROL A;  3E9G A;  5GAN h;  5CKH A;  1XQH A;  1YWO A;  1YIJ A;  2VWF A;  3QXE B;  4ZTJ A;  1YI2 A;  2RHI A;  2DTO A;  2CUB A;  3QWX X;  1HK9 A;  2CUD A;  1X6O A;  2WSE E;  2COY A;  2MWO A;  3CCU Q;  1YIT Q;  1I5L A;  4AFZ C;  3QPH A;  3UF4 A;  2D6F A;  2QG9 B;  3EAE A;  1X27 A;  1VQ4 T;  1UGQ B;  2DA9 A;  3S3N A;  2X4X A;  3G6E T;  2QXF A;  3I5S A;  5KE3 A;  4M75 C;  4F17 A;  2GFA A;  4FSX A;  2DE0 X;  1K1Z A;  2DLP A;  4BDZ A;  4KUD K;  2J05 A;  5FLX E;  3CC4 A;  2CKK A;  2M51 A;  3I9Q A;  2YT6 A;  2DL7 A;  2E70 A;  3H8Z A;  5HCK A;  2BE7 D;  1PWT A;  1M1K C;  3QUI A;  2P4R A;  1NJI R;  4PJO B;  3G4S Q;  4A4K A;  4J9E A;  2DMO A;  2KT1 A;  3VKI A;  4ELZ C;  2CT3 A;  2LCC A;  1VQN Q;  3UWN A;  1E6H A;  4PJL A;  3V7R A;  5GAN g;  4A53 A;  4II1 A;  1BI3 A;  3CCE T;  3H6Z A;  1BCM A;  2KT8 A;  2C0I A;  3QYG B;  1M30 A;  2MI6 A;  4FYV B;  3M5A A;  3OYA A;  2P0P A;  1MGQ A;  1OU8 A;  1MV3 A;  2DZ9 A;  2EKH A;  4FYY B;  2VV5 A;  3LLR A;  2PQW A;  1OX8 A;  4D8K A;  2NUP B;  3ULR B;  3BFM A;  1AZE A;  3A1P A;  2MCN A;  5CVI A;  4ZGE B;  3DLM A;  1BBZ A;  4CC3 A;  1WZO A;  3CCS A;  5CIU A;  2NUT B;  1WQ7 A;  3OYC A;  1G8X A;  5I21 A;  3U23 A;  1D0X A;  1D3B B;  2CSI A;  1FWZ A;  2JXB A;  2QA4 Q;  2X4Y A;  3P8B B;  1ZQ1 A;  2QGG A;  4DEX A;  4UC4 A;  1JBM A;  4EMK C;  1GL5 A;  4KT0 E;  1VQK T;  2E12 A;  5GMK l;  1VYV A;  1PNJ A;  3I56 T;  1X2Q A;  8AT1 B;  1V1C A;  3L2V A;  4JPB W;  3VS1 A;  1LJO A;  2LJ1 A;  1IHW A;  3E1S A;  3L2Q A;  3CCQ T;  1YP5 A;  2O4X A;  4IUU A;  1YIJ Q;  1H8K A;  4ORZ A;  3NTI A;  1M2O A;  4BY6 B;  4ZN1 A;  2EYW A;  4JJB A;  3I5R A;  3KUF A;  5FRN A;  1Q7Y C;  1Q82 R;  1G3S A;  2P0K A;  1Y71 A;  4XU3 A;  2IPO B;  1I5O B;  2X3W D;  1I1J A;  5GJV B;  1VUB A;  1UHF A;  4RTT A;  2YHT A;  4M78 D;  5C6S A;  1X6B A;  3CMA A;  2EYX A;  4PJO C;  2H3J A;  4JZ4 A;  5IH2 A;  1U3O A;  3CCJ Q;  5EC7 A;  5GMK i;  1FYN A;  2RHZ A;  5IXB A;  1K8A U;  1VQP A;  2DD5 A;  2FEI A;  5KCH A;  4MMK A;  3JCM P;  3VS7 A;  4XTU A;  1M3B A;  1UUE A;  4VUB A;  2E3I A;  2VC8 A;  1GCP A;  1ZBJ A;  3OBY A;  3OYD A;  1AWJ A;  2CH4 A;  5DLO A;  2QDY B;  3EG9 B;  4M7D E;  1HYO A;  1EX4 A;  2FL7 A;  2G3R A;  2DIQ A;  5GAN 7;  4QVZ A;  3HTR A;  1PKT A;  2ED0 A;  2RQR A;  2DXT A;  2ZGW A;  4BI4 A;  3PMI A;  4F16 A;  2ZPI B;  1PRL C;  3J81 E;  2LX7 A;  4M7D A;  4C5E A;  2K3X A;  1IGU A;  4AG2 C;  3PVQ A;  3X20 B;  1UHC A;  2EBP A;  1Q81 R;  3BE3 A;  2JMC A;  4J5Y A;  2WAC A;  1NLO C;  5GAN 3;  2AZS A;  2QEX A;  1RAG B;  3NMZ C;  4C0Z A; 
#chains in the Genus database with same CATH homology
 1UDL A;  2ESW A;  4HVW A;  1SRL A;  5IHI A;  2F2X A;  3C0C A;  4KRT A;  3EG0 A;  1TUC A;  2D8J A;  4J9G A;  2LQW A;  1WFW A;  3PE0 A;  2JS0 A;  2D8H A;  2DNU A;  2XMF A;  2L3S A;  5ECA A;  4GBQ A;  2DL8 A;  1UFF A;  1SHF A;  2L3Q A;  2MOX A;  4ESR A;  4LUE A;  3RBB B;  4WCI A;  2JW4 A;  1JU5 C;  2CDT A;  2PZ1 A;  2BTT A;  5GJW B;  1BB9 A;  4HVV A;  4EIK A;  2J06 A;  1T3S A;  2I0N A;  1W6X A;  1N5Z A;  3M0R A;  3EG3 A;  4OML A;  4A63 B;  5I22 A;  2RPN A;  2KGT A;  3A98 A;  4AFQ C;  3REA B;  1RLQ C;  1YWP A;  2K9G A;  2GNC A;  2K7A A;  1RUW A;  2KE9 A;  1G2B A;  1RI9 A;  2KXC A;  2BZX A;  1MUZ A;  2KYM A;  1GCQ C;  1GBQ A;  2CT4 A;  1WYX A;  4F14 A;  2LQN A;  1CSK A;  2KBT A;  2F2V A;  1SPK A;  2KRO A;  2ENM A;  1UGV A;  4HCK A;  2O2O A;  1ZUU A;  3IQL A;  1E7O A;  4GLM A;  1LCK A;  3TSW A;  2RNA A;  1I07 A;  1M3A A;  4J9I A;  2LCS A;  2DL4 A;  2AZV A;  2FO0 A;  1UJY A;  4J9C A;  5FWB A;  2CSQ A;  2K3B A;  2D1X A;  4J9B A;  2GTJ A;  2DBK A;  3VS4 A;  2HBW A;  1Z9Z A;  4HXJ A;  1KIK A;  2DYB A;  2FRY A;  4IIO A;  1PKS A;  1BU1 A;  3FJ5 A;  1NG2 A;  1U5S A;  2DVJ A;  1U06 A;  1KSW A;  2JM8 A;  1W1F A;  4OMN A;  2YUP A;  2LP5 A;  2E5K A;  2JMA A;  3H0H A;  2DM1 A;  2HDA A;  3H0I A;  5IHK A;  1GCQ A;  2K79 A;  4RTW A;  1G83 A;  2FPF A;  2HSP A;  4RUG A;  1S1N A;  2DL5 A;  3VS0 A;  2BZ8 A;  1X6G A;  1M3C A;  3NGP A;  4RTZ A;  4D8D A;  3JV3 A;  1H92 A;  4ZNX A;  2EVR A;  2D0N A;  3NPF A;  2X3X D;  3R6N A;  2GGR A;  2VVK A;  1UG1 A;  3PVL A;  1QLY A;  2MIO A;  2OAW A;  4DEY A;  2NWM A;  5L23 A;  2W0Z A;  5IXF A;  4OMM A;  2H8H A;  1UEC A;  1TG0 A;  1A0N B;  2SRC A;  2YUO A;  1AWX A;  1WLP B;  2EGA A;  2AKL A;  2EYY A;  4R0K A;  3TVT A;  1ZLM A;  3RNJ A;  1VYT A;  1NEB A;  1GFC A;  1WI7 A;  4RTY A;  1RLP C;  2EGC A;  3KFV A;  1YNZ A;  3VS2 A;  2VKN A;  1WXB A;  2M0Y A;  4IIM A;  1VA7 A;  1WX6 A;  2A08 A;  3M0P A;  3QWY A;  3EHR A;  4JZ3 A;  2LNH B;  1B3Q A;  4OMP A;  3LH5 A;  2EW3 A;  4LNP A;  1FMK A;  2G6F X;  2GBQ A;  1E6G A;  4AFU C;  2RQV A;  3THK A;  2C0O A;  4X1V A;  1EFN A;  3H41 A;  3UA7 A;  1X43 A;  1VYU A;  2O88 A;  1Y57 A;  1QCF A;  4J9F A;  3UA6 A;  2CH4 W;  3NHN A;  5IHN A;  2BZY A;  3M0Q A;  1NYF A;  1KJW A;  4RTU A;  1UJ0 A;  2RQT A;  2A37 A;  2ROL A;  2LJ0 A;  1YWO A;  4Z89 A;  4CC7 A;  1ABQ A;  1AOJ A;  2VWF A;  1ABO A;  3EGU A;  1QKX A;  2DF6 A;  1MV0 B;  2DBM A;  1SEM A;  3M0T A;  3QWX X;  2CUB A;  4LN2 A;  2CUD A;  1AD5 A;  2KYB A;  2ED1 A;  1AZG B;  2F2W A;  4AFZ C;  3UF4 A;  1HD3 A;  1X27 A;  4LUD A;  2J6F A;  2DA9 A;  2YUN A;  5FWC A;  2DIL A;  3I5S A;  2EGE A;  2JS2 A;  4F17 A;  1SSH A;  1UE9 A;  4M4Z A;  1PHT A;  2DE0 X;  1K1Z A;  2DLP A;  2J05 A;  2FRW A;  4HVU A;  2PNI A;  1AVZ C;  1WXT A;  2M51 A;  3I9Q A;  2YT6 A;  2DL7 A;  2JT4 A;  1GBR A;  5HCK A;  2DX1 A;  2EQI A;  1PWT A;  2KRM A;  2KXD A;  2P4R A;  1W70 A;  3I35 A;  2FPD A;  3VS3 A;  4J9E A;  1GFD A;  3VRZ A;  2DMO A;  3CQT A;  4Y92 A;  2KT1 A;  2CT3 A;  1UTI A;  1YN8 A;  3M0U A;  3VRY A;  1QKW A;  1HJD A;  1E6H A;  1ARK A;  2DJQ A;  2EPD A;  2OI3 A;  2DL3 A;  2LZ6 B;  1OV3 A;  2HCK A;  4RTV A;  2C0T A;  3EG1 A;  2KT8 A;  2C0I A;  2ROT A;  2DRK A;  1OPL A;  1M30 A;  3SEM A;  2KRN A;  4RTX A;  1MV3 A;  2FPE A;  4JJC A;  2EKH A;  2RMO A;  3TSZ A;  2CRE A;  1X69 A;  1CKA A;  1HSQ A;  4D8K A;  3ULR B;  1ZUY A;  2K6D A;  1T0H A;  1AZE A;  4Z8A A;  2MCN A;  1M27 C;  2V1Q A;  2L0A A;  1BBZ A;  4CC3 A;  2O31 A;  1K0S A;  1TUD A;  1OPK A;  1PRM C;  3U23 A;  1QWF A;  2OJ2 A;  1CKB A;  1JXO A;  1KFZ A;  1K0X A;  2CSI A;  2K2M A;  2JXB A;  2YDL A;  2J6K A;  4JJD A;  1JEG A;  4DEX A;  1GL5 A;  1NM7 A;  1AEY A;  2IIM A;  2JTE A;  1VYV A;  1PNJ A;  1X2Q A;  1V1C A;  4JPB W;  2FG0 A;  3VS1 A;  2AK5 A;  2J7I A;  2LJ1 A;  1QWE A;  4QT7 A;  2NUZ A;  1OOT A;  2KRS A;  1YP5 A;  2KNB B;  1SHG A;  1T0J A;  1H8K A;  4ORZ A;  3ZL7 C;  1WIE A;  3GBQ A;  2EYW A;  3VS5 A;  4E6R A;  2SEM A;  4JJB A;  3I5R A;  2O9V A;  2RN8 A;  3UAT A;  3EHQ A;  2X3W D;  1ZSG A;  1I1J A;  5GJV B;  2A36 A;  1UHF A;  4RTT A;  2AKK A;  2PTK A;  1Z9Q A;  4K11 A;  1X6B A;  1ZX6 A;  1IO6 A;  4LE9 A;  2EYX A;  1NLP C;  2LJ3 A;  2YSQ A;  1NYG A;  4JZ4 A;  5IH2 A;  1U3O A;  1AWO A;  1I0C A;  2W10 A;  1K76 A;  4AG1 C;  5EC7 A;  2ABL A;  2GQI A;  3VS6 A;  1JXM A;  1FYN A;  2RQW A;  5IXB A;  1GRI A;  2B86 A;  2A28 A;  2FEI A;  2GTO A;  2O9S A;  2ECZ A;  4OMQ A;  1T3L A;  1J3T A;  3H0F A;  4CC4 B;  3VS7 A;  1M3B A;  1UUE A;  3SHW A;  1XOV A;  2RF0 A;  1GCP A;  1ZUK A;  4J9D A;  1ZBJ A;  2L3P A;  1AWJ A;  2CH4 A;  1WA7 A;  1NEG A;  3O5Z A;  4CC2 A;  1SRM A;  2V1R A;  2YUQ A;  1BK2 A;  2EYZ A;  3REB B;  1K4U S;  1PKT A;  1JQQ A;  1WDX A;  2ED0 A;  2KEA A;  2RQR A;  5I11 A;  1AWW A;  1K9A A;  4F16 A;  2J6O A;  1PRL C;  5FW9 A;  4AFS C;  2LX7 A;  1M8M A;  2LMJ A;  2JM9 A;  4AG2 C;  3PVQ A;  2DRM A;  1UHC A;  2QDL A;  2EBP A;  3EG2 A;  1WXU A;  3M0S A;  2L2P A;  1Y0M A;  1H3H A;  2JMC A;  1B07 A;  1JO8 A;  1NLO C;  4OMO A;  2HEQ A;  1X2K A;  2KR3 A;  1OEB A;  1YCS B;  4Z88 A;  2AZS A;  2RQU A;  4FSS A;  4J9H A;  3NMZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...