1TUCA

Alpha-spectrin src homology 3 domain, circular permutant, cut at s19-p20
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
MGPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDSGTGKELVLALYDYQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The order of secondary structure elements does not determine the structure of a protein but does affect its folding kinetics.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
molecule keywords ALPHA-SPECTRIN
total genus 10
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1996-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1tucA00
2ABLA 4J9EA 3QWXX 4FSSA 1RUWA 4LN2A 1VYVA 4M4ZA 3PVLA 4HVWA 2ROLA 1IO6A 2RMOA 4JJCA 2KEAA 1UTIA 1AVZC 2DE0X 3M0TA 4F14A 2MCNA 2K9GA 2FEIA 2KXDA 1ZSGA 3H0IA 2X3XD 2KYMA 3UF4A 2J6KA 1ZUKA 1TUCA 1UJYA 1K0SA 2KE9A 3IQLA 2C0OA 1RI9A 3SHWA 1OPKA 3EG3A 3O5ZA 2ED1A 2VKNA 1UE9A 2CSIA 2DM1A 2ECZA 5L23A 4JZ4A 1G83A 1LCKA 2YUOA 2KRSA 3GBQA 1M3AA 4CC2A 2D0NA 1I1JA 1NYGA 1X2QA 4GBQA 5I22A 3JV3A 4RUGA 2LQWA 3M0PA 1E6GA 1UHFA 1WXBA 3QWYA 2HDAA 4J9BA 4RTVA 3REBB 1ZLMA 1QKXA 1UUEA 2LJ0A 4JJDA 5GJWB 4J9FA 1VA7A 3H0HA 4JPBW 3VS6A 1XOVA 2CT4A 1MUZA 4ESRA 2V1QA 2M0YA 1WXUA 2DBKA 1HD3A 1M3BA 2DILA 4RTUA 1K9AA 2CH4A 3U23A 2YUPA 1AWJA 1M3CA 1WIEA 3THKA 1FMKA 1MV3A 2FG0A 1K1ZA 4KRTA 4LUEA 2L3SA 1QWEA 2CDTA 2FPEA 4RTXA 2F2XA 1JU5C 3VS0A 4AFQC 1U06A 2L3QA 2K2MA 3LH5A 2JM9A 1PHTA 1WLPB 3KFVA 2AKLA 3VS2A 2D8JA 2LCSA 4J9HA 3NHNA 2YT6A 2QDLA 1ABQA 2EYYA 2J05A 1UG1A 4OMOA 3ZL7C 1YCSB 1X69A 2DMOA 2I0NA 3TSWA 1W70A 2BZ8A 4RTYA 4J9CA 1GL5A 2C0TA 1X27A 2DYBA 2BTTA 2OJ2A 2LZ6B 2DA9A 2GQIA 1NLPC 2L3PA 2GGRA 1YWOA 1W6XA 1X43A 4F17A 1WXTA 2OAWA 1H8KA 3EG0A 1SRLA 4Z88A 2OI3A 1GBRA 3EHQA 2DBMA 3EG1A 4D8KA 1SEMA 1JEGA 5ECAA 1UDLA 2YSQA 3PVQA 1WX6A 5HCKA 1Z9ZA 2KYBA 2JW4A 2YUNA 1SRMA 4CC7A 2EGCA 4AFSC 2EGAA 1PKSA 1GCQA 1PNJA 2GBQA 1G2BA 4OMNA 3UATA 4HVUA 4OMMA 2FRYA 2JXBA 4GLMA 4RTZA 1GCPA 2FPDA 1HJDA 2B86A 1Z9QA 2HBWA 4DEXA 3I5SA 1TG0A 2DF6A 5IXFA 1NEGA 4J9IA 4HVVA 3NMZC 1VYTA 1M27C 1NG2A 5FW9A 1SHFA 3UA6A 1WA7A 1K0XA 1ZX6A 2DNUA 1GCQC 2LNHB 2A36A 4J9DA 1ZBJA 2EYWA 4A63B 1AEYA 2EW3A 2KT8A 3EHRA 2J06A 3H41A 1GFDA 2F2VA 2LQNA 1SSHA 1MV0B 1HSQA 1UGVA 2KT1A 2RN8A 1AZEA 2RQWA 2F2WA 3VS1A 2C0IA 3SEMA 2HEQA 1E7OA 2CREA 2X3WD 2DL8A 2DL7A 5EC7A 1WFWA 2LJ1A 2RQUA 4IIMA 2A08A 4E6RA 2MOXA 2VVKA 2L0AA 1T3SA 1UJ0A 1QLYA 2CH4W 3I35A 3R6NA 2CT3A 2JS0A 5IHKA 1M8MA 1FYNA 2FPFA 2JM8A 2K6DA 3PE0A 3I9QA 4F16A 2EKHA 4R0KA 4LE9A 4JZ3A 1H3HA 2RNAA 3VRYA 4J9GA 2DX1A 2K79A 4D8DA 1Y0MA 3I5RA 2J6OA 4LNPA 4QT7A 2AZSA 2JTEA 2SEMA 1KJWA 2J7IA 2FRWA 1WI7A 5I11A 1VYUA 1YWPA 2CUBA 2JT4A 4Z8AA 2RQTA 4AFUC 5IXBA 3UA7A 2EBPA 1U5SA 2ROTA 1OEBA 2DRMA 1PKTA 2HCKA 1K76A 1AWXA 1AWWA 2J6FA 1TUDA 4K11A 2KNBB 4OMPA 1PRLC 2AKKA 2D8HA 1AD5A 1PRMC 1H92A 1YN8A 4DEYA 1AOJA 2VWFA 2DVJA 3EG2A 2GTJA 1N5ZA 2DRKA 1BB9A 4JJBA 1KIKA 1M30A 2BZYA 3M0UA 2XMFA 2RF0A 2W10A 5FWBA 1ABOA 1QWFA 1JXOA 4OMLA 1V1CA 2P4RA 1JQQA 2A37A 3A98A 2LX7A 2DL5A 5IH2A 3CQTA 1OPLA 2DLPA 4HCKA 1WYXA 1NEBA 2SRCA 1GRIA 3VS7A 2M51A 1I07A 1T3LA 1GBQA 1W1FA 1ARKA 2O9VA 2KROA 2D1XA 1J3TA 2ENMA 3EGUA 2GNCA 4ZNXA 2LP5A 2KXCA 2RQVA 2EVRA 1T0HA 1YNZA 2EYZA 3M0QA 1A0NB 2YDLA 2KGTA 1JO8A 2O31A 1KFZA 1OV3A 2KRMA 2V1RA 2LJ3A 2EYXA 1E6HA 1SHGA 2JS2A 2GTOA 4X1VA 1CKAA 1YP5A 1PWTA 2JMAA 2RQRA 1NYFA 4AFZC 2FO0A 2K3BA 3FJ5A 2AZVA 1NLOC 2NWMA 3NPFA 1WDXA 2CSQA 1ZUUA 1ZUYA 3ULRB 2HSPA 2CUDA 2K7AA 4EIKA 4CC4B 3VRZA 2YUQA 1UHCA 4ORZA 1CSKA 4CC3A 2EGEA 2DL3A 2O88A 5GJVB 4Y92A 2A28A 1SPKA 3RNJA 3H0FA 1T0JA 1QCFA 3VS5A 2EQIA 1X6BA 2EPDA 1EFNA 1Y57A 2DJQA 1JXMA 2ED0A 2PZ1A 5IHNA 2L2PA 1X6GA 5FWCA 2NUZA 2G6FX 1I0CA 4AG2C 1OOTA 1BU1A 1RLQC 1UECA 4LUDA 1RLPC 1CKBA 3M0RA 1K4US 3VS3A 2DL4A 4RTWA 1BBZA 2O9SA 2KRNA 2LMJA 4HXJA 3RBBB 5IHIA 1B07A 2PTKA 1B3QA 2JMCA 1AZGB 3C0CA 1X2KA 3REAB 2H8HA 2IIMA 2PNIA 1KSWA 4RTTA 3TVTA 1UFFA 2KBTA 4IIOA 1NM7A 3NGPA 1AWOA 2BZXA 2ESWA 2O2OA 1BK2A 3TSZA 1GFCA 3M0SA 4AG1C 4Z89A 2KR3A 2E5KA 2W0ZA 4OMQA 3VS4A 2RPNA 4WCIA 1QKWA 2AK5A 2MIOA 1S1NA 1U3OA
chains in the Genus database with same CATH superfamily
2ABLA 3OBWA 5IT9E 1RUWA 2M02A 2QGGA 2LCCA 4JJCA 2RO0A 1VQMA 4KBMB 3R6OA 5FLXE 4F14A 3M0TA 2L5QA 3M53A 1VQKT 2FEIA 1Y7XA 2KYMA 4D6WA 5GANj 1D0XA 4C92A 3QHSA 4QQGA 2C0OA 4M75A 1RI9A 1YJWQ 2DD5A 2CSIA 5CVIA 4IUQA 4IKFA 2RJCA 5CKFA 2K5FA 1M3AA 1VQPA 1G8XA 4RG8A 1Q81U 1LOJA 1NYGA 1LVKA 3CCET 4M77F 5GAOr 1U1SA 4JRPA 1S72Q 4M78F 3M0PA 4B6MA 3QWYA 3CCJA 1Q7YU 4DBRA 1KD1C 1BYMA 4BE2A 2QYZA 1N9SA 4YTLA 4J9FA 3M9QA 1BIBA 1NZ9A 2P84A 3H0HA 4F7UB 4IUPA 1WHJA 4M77G 4FYWB 3CBOA 4RTUA 1M3BA 5D6WA 1TWBA 2CH4A 3U23A 1B34B 1FMKA 3SWNB 3MEAA 3QKJA 3URGA 2CP7A 3G1JA 4F7UE 2K3XA 4L5GA 2CDTA 4OB2B 2OAUA 2O4XB 3CCMA 1Q82C 4FCYA 1WPYA 2F2XA 2MWOA 1ZA2B 2O01E 3FDRA 4PJOA 3QG1A 4LDWA 1YITA 3HHTB 3HP9A 2COWA 3PNWC 1ACMB 1KC8U 4KH1B 2DXTA 3MJXA 2JOYA 1PHTA 1VQ8T 3CCUT 1WLPB 3KFVA 2E6ZA 4JS5A 2LCSA 3V8JA 4J7IA 2YT6A 3GLXA 2Z0WA 2EYYA 2J05A 4HCBA 1VQ4A 3ZL7C 1YCSB 2QK0A 2COYA 2DMOA 2X51A 3TSWA 1IREB 4EDUA 5GAN2 1IB8A 3OYCA 2CZ7B 1GL5A 2A7YA 1VQLQ 1NLPC 4FM4B 3WVEB 3L42A 3G4SA 1W6XA 3G4ST 1WXTA 4B9XA 3CD6Q 3EG0A 1VQ4Q 2OI3A 1GBRA 3OYDA 3JCMe 2KI7A 2FZGB 5GAMd 4N4HA 3UWNA 2IPOB 1Z9ZA 4ZTFA 3WXMB 2JW4A 3OYGA 3CC7Q 4AFSC 3QIIA 1SKUB 3RKWA 4OMMA 2JXBA 1BCOA 2FPDA 4C8QF 1ZSZC 2DXCA 1RAFB 4PJOG 1BI0A 1YITQ 4MMLA 2DF6A 1SSFA 5GAN5 5GANh 1VYTA 5GAN3 1NG2A 2L8DA 3OYYA 4BUGA 5KYXB 1GCQC 5DLQE 1KK7A 2A36A 5FU7C 3CCUQ 3RIRA 2EYWA 3T9NA 5LJ5g 1M90C 2MK5A 2PUOB 2CGHA 4ZGEB 1YJ9Q 5IN1A 1OQKA 3BDUA 3JB9G 2Y4XA 4M7AA 4KGVB 3OS5A 3J81E 2CREA 1QCNA 3P8DA 2CP6A 2DL7A 4CRIA 2NLUA 4E6RA 2FL7A 2X4YA 3RUXA 2L0AA 1QLYA 3DB3A 5LJ5e 1I81A 1Q82U 3OYBA 5GAOq 2JS0A 2DTIA 3OA6A 4JJNK 4E7ZA 4OMFB 4F16A 2JM8A 4QQ6A 2JTFA 3I9QA 2OTJT 3MP8A 3VUZA 2OTJA 1RAEB 4C8QA 2R5MA 2WSEE 4PJOB 4M78B 4J9GA 2QQSA 3KUFA 4JUVA 3RKYA 1BI3A 1UGSB 2R5AA 3MHXA 2J6OA 4LNPA 1XJWB 1D0ZA 2JTEA 4XTZA 2J7IA 5GAMj 2RI2A 4M78C 3D7SB 2AHJB 5KYUA 4MDWA 3V7SA 1KD1R 3CCUA 3BW1A 3UA7A 1WQWA 1UB4A 1W2BP 2JTMA 4FW1A 4M75D 4M78A 1VQ5Q 2E4HA 2AIRB 3JRZA 1PRMC 1YN8A 2FYKA 3JB9H 3NTHA 3FLGA 2DRKA 4KUIA 1QVFP 1BB9A 1KIKA 1YIJA 3JB9F 2GFAA 2RF0A 2X4XA 2K3YA 3HRSA 1ABOA 2HQHA 5IAYA 1V1CA 2EQKA 3VKIA 3OYHA 1JQQA 3A98A 3L2RA 1IGUA 2RK2A 3QXEB 2QQ9A 3E9GA 1YITT 2HKNA 2SRCA 4BACA 1I07A 1YJWT 4OB0B 3CC4A 4PJJA 1VQ7Q 1ARKA 1YIJQ 4M75C 3VYHB 4CI0C 2MWPA 4NL2A 2GNCA 4ZNXA 2E65A 2KXCA 2MYSA 2EYZA 1A0NB 4OB3B 2O31A 3OYAA 3OYKA 2MPXC 1OV3A 1SF9A 2LJ3A 2EYXA 2JS2A 2XHCA 5M9OA 1YP5A 3MPUB 2HNIA 1PWTA 1N6AA 2JMAA 1PD0A 2LRQA 4R56A 2FO0A 3I56Q 2P0PA 5CCAA 2AZVA 4MDXA 2NWMA 2EWNA 3LGLA 4C0DB 1QW1A 5EG2A 2LNVA 4LD9K 2QDYB 3L1AA 1ZUUA 1ZUYA 4M77A 1ZSZA 3E1SA 4C8QE 3JB9I 1CSKA 5I2SA 5GJVB 3AT1B 1QCFA 5A2QE 3VS5A 4OVAA 2COZA 2DJZA 4M7AG 4M75B 4E7JA 2DJQA 4E7SA 4JRKA 2BIVA 1KQ2A 3SDZA 1XTDA 2JZ2A 1YJNQ 3FEOA 4E7KA 1YI2Q 2QEXT 2MAMA 1CKBA 5A0GA 3MP1A 2O9SA 2KRNA 1WHGA 2LMJA 3QZ9B 2RHUA 1B3QA 2K2VA 4RCBA 2JJ9A 3JCMc 4KGZB 1PG5B 1LPLA 4OF1A 4XAXB 4ATOA 1DJ7B 2DXUA 1UFFA 3RDVA 4XU0A 4HCZA 3CCEA 2ZPFB 2NYSA 3RESA 2ESWA 2FZKB 3TSZA 4C8QB 4IURA 2KR3A 4OMQA 1H641 3VS4A 1I5LA 4VUBA 2JNGA 4WCIA 2AK5A 2DIGA 1PSEA 1WHLA 1S1NA 1U3OA 3CXCP 5LJ3e 3QWXX 4KH0B 3GP8A 4LN2A 1VYVA 3PIPA 4HVWA 2MI6A 2D9TA 2ROLA 3OQ5A 2RMOA 3CMEA 1WHMA 3GF5A 3A8HB 1WJRA 2MCNA 5GANe 8ATCB 1ZSGA 2NUTA 2KE9A 3SHWA 1OPKA 1M8VA 3EG3A 3O5ZA 2ED1A 3OYNA 2VKNA 1UE9A 2M16A 4II1A 5L23A 4LDUA 3CCJQ 1KC8R 1IGQA 2D0NA 1KHCA 5I22A 3JV3A 4M7DB 3G71A 1E6GA 2HDAA 4RTVA 4M78E 1UUEA 2L89A 3OS1A 1VQMQ 2LJ0A 5GJWB 2LC4A 4R55A 1VA7A 4N4IA 3GIBA 4DA4A 4JPBW 1QVPA 5GAOp 2E70A 2RM4A 5KCHA 4ESRA 2V1QA 4M7AD 2PVDB 4PLLA 1K9AA 2PU9B 1QVFA 4V2SA 3META 1WHKA 2YUPA 1MV3A 1VQKA 4HT9A 3TQ7P 2H3EB 2WSFE 3X26B 5CKBA 2L3SA 2QASA 4A54A 4J83A 4QVDA 1JU5C 1WHHA 3VS0A 4F7UG 1WQ7A 5KYWB 1VQ5T 4E47A 3C95A 1W2BS 1VQOA 2L3QA 4M7AE 1RL2A 2E12A 2JM9A 1K8AC 3PGGA 2AKLA 2RD1A 4TVRA 3PMIA 2DZ9A 3NHNA 2QDLA 4XQ3A 4NL3A 1NPPA 4LDVA 1EZZB 1G3SA 5CK9A 1X69A 2I0NA 4OB1B 1VQLA 4A4GA 5FRMA 1G3TA 3CCMQ 1FMWA 3G4SQ 3CC4T 3CD6A 1I8FA 3L2UA 2DYBA 2BTTA 2LZ6B 3V8KA 2RHYA 4F17A 3CPWP 4C0ZA 1PSFA 3EHQA 4BI4A 2DBMA 4PFZA 1WZOA 2YSQA 5HCKA 4FW2A 3OS2A 1YFNA 2HBPA 2KYBA 1VQKQ 5GANf 2YUNA 1SRMA 4CC7A 2EGCA 2C06A 1OI1A 2GBQA 4C92E 4RTZA 5DY9A 1Y96B 2EQJA 4QVZA 2B86A 5GAMf 1F1BB 4DEXA 3I5SA 4B9WA 5IXFA 4J9IA 1OX8A 3CCLT 2PQWA 1K0XA 4J9DA 1ZBJA 2K4YA 2KT8A 2VUBA 2QA4T 4Y91A 2ATCB 2J06A 2E64A 1SSHA 1RI0A 1AZEA 1UGVA 1VIFA 4KGXB 1JRIA 2RQWA 1XQHA 3C94A 1UEBA 2QEXA 1M1KC 2WSCE 2DEUA 2DL8A 1O75A 3I56T 2LX9A 4IIMA 3M5AA 1R8OB 2HKQB 2MOXA 2VGNA 3FRNA 1YHQA 1N8RR 2E1HA 2CT3A 2DKGA 4PJOC 3M54A 1M8MA 3AHUA 3A8MB 4R0KA 1HXDA 3CC2Q 1FMVA 1ZA1B 5LJ5h 3JCMf 1H3HA 1K9MR 2RNAA 4ME7A 2DX1A 1PCXA 3PMTA 4MMKA 3I5RA 4M75G 2CZ0B 4QT7A 1KG1A 5CIUA 1JBMA 2AZSA 5GMKl 4BDZA 3LWIA 2OTLT 1WI7A 5D6YA 3CCQT 1VYUA 1MNEA 2DZCA 3CMET 1Q7YC 3MEUA 1OYXA 3A8LB 4RCCA 1G3YA 1U5SA 4C5HA 4DBQA 3A8OB 1PKTA 4C92D 1IZ6A 4ANJA 1QVGA 1AWWA 4K11A 4PKCC 1B34A 2KDSA 2F69A 1PRLC 1VQLT 2D8HA 1RAAB 3TEEA 2MF2A 4KUDK 2X9HA 4DEYA 1KQSS 2CZ6B 3E2UA 3EG2A 2GTJA 4J5YA 4A4HA 4JJBA 3SB2A 3QBYA 3L2QA 1M2VA 2BZYA 3M0UA 2XMFA 4QQDA 3NFCA 5FWBA 2QQAA 2YXYA 2RHXA 4OMLA 3H6ZA 2LX7A 2F1LA 1D1CA 5FU6B 3INZA 2YLCA 2R58A 3ZFJA 5GAN6 4J6YA 2LVMA 2HQEA 2M51A 3QYGB 3VS7A 3FC3A 1V29B 3OW2A 4M7DG 3FIFA 2O9VA 2KROA 3BE3A 4FYVB 4C92G 3CCJT 1J3TA 1MHNA 3HPWA 4M75E 1RAIB 1QMCA 1D09B 2LP5A 2EVRA 5FU6C 5CR2A 1TH7A 1YNZA 1VQNQ 2KGTA 2B8AA 2KRMA 1VQ9T 3VV0A 3VJPA 2VGMA 2XKOC 2IG0A 3X25B 3HFOA 1VQOT 4HKEA 1CKAA 4X1VA 2ZAEA 2DYIA 4BDYA 3GOXA 2RQRA 2PUKB 1NYFA 4AFZC 1FX7A 3NPFA 4JDSA 4EMKC 1VQ7A 3CCVA 1VQNA 4XTXA 3OSSC 4C5GA 2CUDA 2K7AA 4CC4B 2YUQA 1UHCA 5I2MA 2E5QA 1Y71A 5GMKi 4JLIA 3P8BB 5C0MA 2DL3A 9ATCB 3C4SA 3WVDB 3EGDB 4F04B 3CCSA 2VASA 4Y92A 5LJ3f 1SPKA 1QVFS 1T0JA 5HKCA 1W4SA 3OYLA 2DK3A 1HYOA 1X6BA 1YJNA 4C0FA 3ER0A 4M78D 4HCCA 1JXMA 2PZ1A 2E41A 3UT1A 1VQ4T 4F7UA 1X6GA 3EFSA 3M55A 4MZPA 3CPWS 4UC4A 2FVUA 2EIFA 2QTVA 1BU1A 1W2BA 4GLKA 4LUDA 3JB9J 3CCRA 1QVGP 3VS3A 4E7LA 1ZSZB 3CBMA 3QDFA 3JCMd 2XK0A 2V8JA 2ZPEB 1B07A 4XU1A 1X2KA 5AYFA 1NJIR 4L59A 2PNIA 3QPHA 1D3BB 4EMGA 1QCOA 4IIOA 1SG5A 3NGPA 4A53A 1X75C 4Q5WA 1BK2A 4DQ2A 2E5KA 3HRTA 5GAMh 4N0AC 1M9SA 2MIOA 2CZ1B 3RERA 4J6XA 3OW2P 4J9EA 1TXQA 1M2VB 2DAQA 4M4ZA 3OYMA 1IO6A 5KYYA 2XDDA 2KEAA 1UTIA 3PT9A 4BE1A 2DE0X 2GQVA 3EFOA 5GAN8 2KXDA 3LGFA 3CC7T 4C8QG 1K73U 1ZUKA 1JJ2A 1UJYA 1UGRB 1MMAA 1YBYA 2R57A 4N4GA 1YJ9A 4JZ4A 1G83A 1LCKA 3GBQA 2RI3A 4BD3A 2EQMA 4CC2A 2RHIA 2FZCB 1QQJA 1OULA 4A4KA 4GBQA 4C8QC 1ZLMA 1QKXA 2HAXA 2LQKA 3V7CA 4JJDA 1M5Q1 4FT2A 3SWNC 1IXDA 3OYFA 3HRUA 3VS6A 1JB0E 2NUTB 1XOVA 3L2WA 1MUZA 2M0YA 3QYHB 4C8QD 2E3HA 2DILA 1HD3A 2DFUA 2BUDA 1AT1B 3DLMA 2KQWA 1M3CA 2EAYA 3THKA 4OP0A 4BB7A 2XICA 1Q86U 4J6WA 1VQ6T 4KRTA 2EQUA 2FPEA 4RTXA 3GNGA 1HK9A 3EG9A 3ZBDA 2BKDN 4AFQC 1VQPQ 4LDYA 4ELYC 1Q86R 1RAHB 2K2MA 3CMAT 3CPWA 3TREA 5GAMe 1VQ8A 2QI2A 1OU8A 2F5KA 2PVOB 2WACA 4J7FA 5HK0A 3FB9A 3VS2A 1VOMA 2BE7D 2D8JA 4XTVA 2GFUA 1UG1A 2XG8D 3QSUA 4IUUA 3OYIA 2E6NA 4PLIA 2DO3A 1NJIU 3CMAQ 2C0TA 1X27A 2OJ2A 4E2FB 2DA9A 4QW2A 5LJ3h 1WGSA 3SFMA 2CYZB 2GGRA 4PJLA 5KYUB 1X43A 2OAWA 4M78G 3G71Q 4D8KA 1SEMA 3NTIA 5GAOm 2OTLA 5D7UA 2ZZDA 1BIAA 5GMKh 3CC4Q 1RADB 3X20B 5KYNA 4FU6A 2NUPA 4BI8B 2EGAA 1PKSA 1GCQA 3UATA 1Q7YR 4GLMA 2LCLA 1YI2T 2CP3A 4HT8A 2D6FA 2Y90A 2HQXA 4HVVA 3RR6A 4M75F 1FWZA 1SHFA 5FW9A 1WA7A 1ZX6A 5LJ3g 1QP3A 4A63B 3I56A 5A0LA 3VYGA 3I55T 4C92B 3QDRB 2O4XA 4M7DA 1C0MA 3M4YA 1MMNA 2LQNA 4WF2A 5LL6S 1MV0B 3EH1A 2KT1A 2RN8A 4PL6A 1KQ1A 1H3ZA 2L3RA 3VS1A 2C0IA 1N9RA 1S72A 2HEQA 2VYTA 2X3WD 2DEQA 4X9CA 1WFWA 2RI5A 3JCMW 5HY6A 4O5VA 4JLGA 1Q86C 2VVKA 3CC2T 1T3SA 2PVGB 1UJ0A 3I35A 2OTLQ 3LW5E 3OY9A 2KSSA 5IHKA 2YLBA 1VQ9A 2FPFA 3PE0A 3G6ET 2EKHA 1M1FA 3EFRA 2AT1B 5CKEA 4JZ3A 3CPFA 4RG2A 4Y28E 3VRYA 2K79A 3BDLA 5LJ3d 4D8DA 1Y0MA 2M1HA 4OGEA 2ZPIB 4EMHA 2X35A 5DM7R 1B7TA 2E3IA 2SEMA 3F70A 3HL8A 1KJWA 2EJ9A 5I11A 1YWPA 5KYYB 2RJEA 2CUBA 2JT4A 5FRNA 1VIEA 4Z8AA 3X24B 1PC0A 3LX7A 5LJ5d 3JCMg 1Q81C 1RACB 3CCRT 2RQTA 5GAN4 4AFUC 5IXBA 2EBPA 2ROTA 1OEBA 2CP2A 2HCKA 1K76A 1O9SA 3OMGA 3CC2A 2XD0A 2J6FA 1KD1U 4AT1B 4OMPA 1IRXA 3RKXA 4PFPA 1H92A 1N8RC 2DVJA 4M7AC 2GCXA 1N5ZA 4GY5A 2RH2A 1VQ6A 1M30A 1G5VA 1JXOA 4PFOA 2P4RA 4QVCA 1P92A 3CCLQ 2DL5A 2BE9B 2DIQA 3CQTA 3VUBA 2QTXA 1NEBA 4E7HA 2A3LA 5I21A 3VU3C 1GBQA 4A4FA 2LDMA 2QA4Q 2RA2A 1W1FA 3CC7A 2Y4YA 2D1XA 2DXBA 2ENMA 3EGUA 1T0HA 1JJ2S 3JCMQ 3QUIA 2YDLA 1JO8A 1IHVA 4JS4A 1KFZA 3HTRA 1MNDA 1JJ2P 1E6HA 3JAME 3HSBA 4N0AA 2K3BA 3QO3A 3FJ5A 2E10A 3EH2A 1OZ2A 1NLOC 4DBHA 3I55A 1WDXA 3ZEHA 5CAIA 2CSQA 2XDBA 5J26A 3JCMX 2HSPA 1YCYA 2ZPHB 2NUPB 2VC8A 3LLRA 3A8GB 4EIKA 3OW2S 3VRZA 4ORZA 4CC3A 2O88A 2ZPBB 1VQOQ 3A5ZB 4BY6C 2A28A 3UDCA 5GMKj 1RABB 4ZTJA 2EYQA 2ZPGB 3DB4A 1KQSP 2ZCFB 5CQYA 2EPDA 2QGFB 1NBEB 2RJDA 2YWWA 1EFNA 2YRVA 1G3WA 2MMPA 5IHNA 3J7AF 1LJOA 4M7DC 3M57A 4QKUA 2M9UA 5FWCA 3JB9D 3V7RA 3M58A 4AG2C 1OOTA 3HFNA 3M56A 1RLQC 1UECA 1OX9A 3M0RA 5L8RE 1K4US 2DL4A 7AT1B 1YIJT 1WNLA 1XNIA 5IHIA 2PTKA 2JMCA 5KYXA 3C0CA 5DLOA 1M90U 4O6JA 4FYXB 1M1KU 4RTTA 3TVTA 4ZGJB 3KBGA 1YJWA 1I4K1 4FL6A 2X4WA 2G3RA 1AWOA 2BZXA 2O2OA 4Z89A 5CKDA 3JCMh 1N8RU 2RPNA 4DOWA 5CQXA 3V8LA 3EAEA 1C1AA 4FSSA 2EKOA 2LT1A 1VQ5A 3PVLA 3S6WA 1NPRA 2KK4A 1WJQA 3EGXA 3BFMA 1AVZC 3G7ZA 3CCVQ 4F7UF 5KCOA 2K9GA 3H0IA 4KULA 2X3XD 3UF4A 2J6KA 1TUCA 2YRDA 1K0SA 3IQLA 5D6XA 1ZHIA 2CS7A 3HKSA 1BI1A 2DM1A 2ECZA 4IUVA 2DETA 2YUOA 2KRSA 3LH0A 5CKHA 3RMSA 4M7AB 1I1JA 1X2QA 1K9MU 1M2OA 5GMKe 5GAMg 2QEXQ 4RUGA 2LQWA 2RHZA 1WXBA 1QP2A 1UHFA 3OB9A 4J9BA 4BE0A 3REBB 3GPLA 2JUFA 4M77E 1OU9A 3EGXB 4EMKA 1YJ9T 3X28B 3CCRQ 2HL3A 3BY7A 1ZQ1A 5GAN7 1YHQQ 3LWHA 2CT4A 1VQPT 2QAZA 3MEVA 3P8HA 4ZGDB 3CMEQ 1WXUA 2DBKA 2A0FB 3TCJA 1AWJA 1WIEA 2EFIA 1U1TA 2FG0A 1K1ZA 4NS5A 1WJSA 4LUEA 1V76A 1QWEA 1MGQA 3OSVA 5FU7B 3S3MA 1VQ8Q 2QQRA 2P4TA 1U06A 2RJFA 1M90R 2YRCA 3G6EA 2M0OA 4LXCA 3EGDA 3Q1JA 3PFSA 3LH5A 1QVGS 1Y07A 4J9HA 2RK1A 3CCVT 3OBYA 1ABQA 4OMOA 5LJ5j 1MMDA 3DKMA 1TS9A 5LJ3j 3M4GA 1W70A 3KXTA 2BZ8A 3L2VA 1VQMT 4RTYA 4RMOA 4J9CA 3MO8A 3CCST 1GXIE 5LJ5f 2GQIA 2K5IA 2L3PA 5C6SA 1YWOA 1TU0B 1VQ7T 1H8KA 1SRLA 3E9FA 4Z88A 3EG1A 1YHQT 4C0GA 1JEGA 3CCQA 5ECAA 1NE8A 1UDLA 3PVQA 1WX6A 2V8IA 2CKKA 3E19A 4M7DE 3CBPA 4PJOE 1PNJA 4L6V5 1G2BA 4AMCA 4OMNA 3H8ZA 4HVUA 2FRYA 4M7AF 1GCPA 1HJDA 1D1AA 4PNOA 1Z9QA 2HBWA 1PM3A 4C92F 5KE2A 3CCQQ 1TG0A 4XTUA 1NEGA 2LT4A 1BI2A 3NMZC 4M7DF 1M27C 3A1PA 3UA6A 2XU8A 1K73R 2DNUA 3G71T 2LNHB 1K9MC 2KAFA 3DLLA 1MMGA 1AEYA 2EW3A 2HMAA 3EHRA 4PK4A 2H3JA 3CCMT 2OX7A 3H41A 4M77B 1GFDA 2F2VA 3QZ5B 2V26A 1HSQA 3PTAA 1TSFA 3O8VA 4BY6B 3J80E 1OZ3A 1Q82R 1BCMA 2DERA 2F2WA 3SEMA 2FB7A 1UGQB 1E7OA 4JRIA 4ZN1A 2QG9B 2KMTA 5EC7A 2HL5C 1K8AR 2LJ1A 1U8RA 2RQUA 1YJNT 2ZGWA 2A08A 2XI9A 3MEWA 4XTYA 1TUGB 3EFOB 2CH4W 3R6NA 2DD4A 2QQBA 1PD1A 2GF7A 1EX4A 1BKBA 1FYNA 2K6DA 4DBFA 5J39A 2HSEB 1K73C 4HA8A 1FXXA 4LE9A 4FIBA 4XU3A 4WTOB 2CP5A 2DPPB 1X6OA 2FHDA 3GNFB 2OTJQ 1VQNT 2VV5A 3MP6A 3UPUA 2FRWA 1D3BA 2X4JA 4PJNA 1I5OB 4C5IA 4LD6A 3FJPA 2XDPA 3NTKA 1VQ9Q 2DTOA 2DRMA 4FSXA 5KH6A 4PJOD 2EJGA 5GMKm 1AWXA 3CXCA 1TUDA 2V8KA 4RKUE 8AT1B 1M1GA 2KNBB 4X34A 4M7DD 5GANg 2JN0A 4JRQA 4DOVA 2AKKA 3OYJA 1VQ6Q 2IVWA 1N27A 1R0CB 1AD5A 2VXEA 4FYYB 1AOJA 3CCLA 2I2LA 2VWFA 1Y96A 5A0DA 3EG9B 2K5LA 2W10A 3JCMJ 1KQSA 1TOVA 3PIOA 1QWFA 1KHIA 5FROA 4P5NA 2A37A 1YI2A 3N5BB 2QA4A 4Z02A 5IH2A 3SWNA 3JCMP 2K57A 5CO7A 3ASKA 4A4EA 1OPLA 2DLPA 4HCKA 4MZMA 2KY9A 1WYXA 2HZYA 1GRIA 3H9NA 1T3LA 4KT0E 1M1KR 5HK3A 3CCSQ 3MKDA 1R77A 1AHJB 1D0YA 3MCAB 2EJFA 2RQVA 1D1BA 1K8AU 3LYIA 3M0QA 1C6VX 3L2ZA 1M4ZA 1IHWA 5GANd 3S3OA 2QXFA 1NJIC 3TU4K 2V1RA 4IUTA 5GAOl 4NOYA 1SHGA 2GTOA 3CD6T 3S3NA 3OS0A 5AT1B 5GAOn 5KE3A 4C0DC 1TTHB 4ELZC 4XU2A 4FT4A 2LTOA 1Q81R 3ULRB 3ME9A 3CEYA 4ZN3A 3QJ6A 2XIDA 3JCMV 3CXCS 2DTHA 1VUBA 2EGEA 2KVQG 2YHTA 1ZBXA 2D0QB 3QJYA 4PJOF 2LQ8A 3RNJA 3H0FA 3JCMb 1EIFA 2EQIA 5KYWA 2DVEA 4J8OA 4M77D 4EPCA 1Y57A 4C92C 3CCEQ 2ED0A 2L2PA 1KC8C 1X01A 3I55Q 4E7IA 2NUZA 2G6FX 1LNXA 2CP0A 1I0CA 3OMCA 1R0BG 1S72T 3CMAA 5J3BA 4BI3A 1RLPC 2P0QA 3M59A 4RTWA 2VB6A 2VXFA 1BBZA 3C12A 4HXJA 4PJMA 3RBBB 4X9DA 3G6EQ 1RAGB 4EMKB 1AZGB 4MZTA 4LDXA 2RB6A 3REAB 2H8HA 2IIMA 1KSWA 3SD4A 2JVVA 2P0KA 1Q95G 2KBTA 4OGCA 1NM7A 2F5TX 4XK8E 1GFCA 3M0SA 4AG1C 3RMQA 2W0ZA 6AT1B 2HD0A 3JSCA 3OYEA 1QKWA 4M77C 4XTWA 1UGPB 4C5EA
chains in the Genus database with same CATH topology
2ABLA 4J9EA 3QWXX 4FSSA 1RUWA 4LN2A 1VYVA 4M4ZA 3PVLA 4HVWA 2ROLA 1IO6A 2RMOA 4JJCA 2KEAA 1UTIA 1AVZC 2DE0X 3M0TA 4F14A 2MCNA 2K9GA 2FEIA 2KXDA 1ZSGA 3H0IA 2X3XD 2KYMA 3UF4A 2J6KA 1ZUKA 1TUCA 1UJYA 1K0SA 2KE9A 3IQLA 2C0OA 1RI9A 3SHWA 1OPKA 3EG3A 3O5ZA 2ED1A 2VKNA 1UE9A 2CSIA 2DM1A 2ECZA 5L23A 4JZ4A 1G83A 1LCKA 2YUOA 2KRSA 3GBQA 1M3AA 4CC2A 2D0NA 1I1JA 1NYGA 1X2QA 4GBQA 5I22A 3JV3A 4RUGA 2LQWA 3M0PA 1E6GA 1UHFA 1WXBA 3QWYA 2HDAA 4J9BA 4RTVA 3REBB 1ZLMA 1QKXA 1UUEA 2LJ0A 4JJDA 5GJWB 4J9FA 1VA7A 3H0HA 4JPBW 3VS6A 1XOVA 2CT4A 1MUZA 4ESRA 2V1QA 2M0YA 1WXUA 2DBKA 1HD3A 1M3BA 2DILA 4RTUA 1K9AA 2CH4A 3U23A 2YUPA 1AWJA 1M3CA 1WIEA 3THKA 1FMKA 1MV3A 2FG0A 1K1ZA 4KRTA 4LUEA 2L3SA 1QWEA 2CDTA 2FPEA 4RTXA 2F2XA 1JU5C 3VS0A 4AFQC 1U06A 2L3QA 2K2MA 3LH5A 2JM9A 1PHTA 1WLPB 3KFVA 2AKLA 3VS2A 2D8JA 2LCSA 4J9HA 3NHNA 2YT6A 2QDLA 1ABQA 2EYYA 2J05A 1UG1A 4OMOA 3ZL7C 1YCSB 1X69A 2DMOA 2I0NA 3TSWA 1W70A 2BZ8A 4RTYA 4J9CA 1GL5A 2C0TA 1X27A 2DYBA 2BTTA 2OJ2A 2LZ6B 2DA9A 2GQIA 1NLPC 2L3PA 2GGRA 1YWOA 1W6XA 1X43A 4F17A 1WXTA 2OAWA 1H8KA 3EG0A 1SRLA 4Z88A 2OI3A 1GBRA 3EHQA 2DBMA 3EG1A 4D8KA 1SEMA 1JEGA 5ECAA 1UDLA 2YSQA 3PVQA 1WX6A 5HCKA 1Z9ZA 2KYBA 2JW4A 2YUNA 1SRMA 4CC7A 2EGCA 4AFSC 2EGAA 1PKSA 1GCQA 1PNJA 2GBQA 1G2BA 4OMNA 3UATA 4HVUA 4OMMA 2FRYA 2JXBA 4GLMA 4RTZA 1GCPA 2FPDA 1HJDA 2B86A 1Z9QA 2HBWA 4DEXA 3I5SA 1TG0A 2DF6A 5IXFA 1NEGA 4J9IA 4HVVA 3NMZC 1VYTA 1M27C 1NG2A 5FW9A 1SHFA 3UA6A 1WA7A 1K0XA 1ZX6A 2DNUA 1GCQC 2LNHB 2A36A 4J9DA 1ZBJA 2EYWA 4A63B 1AEYA 2EW3A 2KT8A 3EHRA 2J06A 3H41A 1GFDA 2F2VA 2LQNA 1SSHA 1MV0B 1HSQA 1UGVA 2KT1A 2RN8A 1AZEA 2RQWA 2F2WA 3VS1A 2C0IA 3SEMA 2HEQA 1E7OA 2CREA 2X3WD 2DL8A 2DL7A 5EC7A 1WFWA 2LJ1A 2RQUA 4IIMA 2A08A 4E6RA 2MOXA 2VVKA 2L0AA 1T3SA 1UJ0A 1QLYA 2CH4W 3I35A 3R6NA 2CT3A 2JS0A 5IHKA 1M8MA 1FYNA 2FPFA 2JM8A 2K6DA 3PE0A 3I9QA 4F16A 2EKHA 4R0KA 4LE9A 4JZ3A 1H3HA 2RNAA 3VRYA 4J9GA 2DX1A 2K79A 4D8DA 1Y0MA 3I5RA 2J6OA 4LNPA 4QT7A 2AZSA 2JTEA 2SEMA 1KJWA 2J7IA 2FRWA 1WI7A 5I11A 1VYUA 1YWPA 2CUBA 2JT4A 4Z8AA 2RQTA 4AFUC 5IXBA 3UA7A 2EBPA 1U5SA 2ROTA 1OEBA 2DRMA 1PKTA 2HCKA 1K76A 1AWXA 1AWWA 2J6FA 1TUDA 4K11A 2KNBB 4OMPA 1PRLC 2AKKA 2D8HA 1AD5A 1PRMC 1H92A 1YN8A 4DEYA 1AOJA 2VWFA 2DVJA 3EG2A 2GTJA 1N5ZA 2DRKA 1BB9A 4JJBA 1KIKA 1M30A 2BZYA 3M0UA 2XMFA 2RF0A 2W10A 5FWBA 1ABOA 1QWFA 1JXOA 4OMLA 1V1CA 2P4RA 1JQQA 2A37A 3A98A 2LX7A 2DL5A 5IH2A 3CQTA 1OPLA 2DLPA 4HCKA 1WYXA 1NEBA 2SRCA 1GRIA 3VS7A 2M51A 1I07A 1T3LA 1GBQA 1W1FA 1ARKA 2O9VA 2KROA 2D1XA 1J3TA 2ENMA 3EGUA 2GNCA 4ZNXA 2LP5A 2KXCA 2RQVA 2EVRA 1T0HA 1YNZA 2EYZA 3M0QA 1A0NB 2YDLA 2KGTA 1JO8A 2O31A 1KFZA 1OV3A 2KRMA 2V1RA 2LJ3A 2EYXA 1E6HA 1SHGA 2JS2A 2GTOA 4X1VA 1CKAA 1YP5A 1PWTA 2JMAA 2RQRA 1NYFA 4AFZC 2FO0A 2K3BA 3FJ5A 2AZVA 1NLOC 2NWMA 3NPFA 1WDXA 2CSQA 1ZUUA 1ZUYA 3ULRB 2HSPA 2CUDA 2K7AA 4EIKA 4CC4B 3VRZA 2YUQA 1UHCA 4ORZA 1CSKA 4CC3A 2EGEA 2DL3A 2O88A 5GJVB 4Y92A 2A28A 1SPKA 3RNJA 3H0FA 1T0JA 1QCFA 3VS5A 2EQIA 1X6BA 2EPDA 1EFNA 1Y57A 2DJQA 1JXMA 2ED0A 2PZ1A 5IHNA 2L2PA 1X6GA 5FWCA 2NUZA 2G6FX 1I0CA 4AG2C 1OOTA 1BU1A 1RLQC 1UECA 4LUDA 1RLPC 1CKBA 3M0RA 1K4US 3VS3A 2DL4A 4RTWA 1BBZA 2O9SA 2KRNA 2LMJA 4HXJA 3RBBB 5IHIA 1B07A 2PTKA 1B3QA 2JMCA 1AZGB 3C0CA 1X2KA 3REAB 2H8HA 2IIMA 2PNIA 1KSWA 4RTTA 3TVTA 1UFFA 2KBTA 4IIOA 1NM7A 3NGPA 1AWOA 2BZXA 2ESWA 2O2OA 1BK2A 3TSZA 1GFCA 3M0SA 4AG1C 4Z89A 2KR3A 2E5KA 2W0ZA 4OMQA 3VS4A 2RPNA 4WCIA 1QKWA 2AK5A 2MIOA 1S1NA 1U3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ABL A;  4J9E A;  3QWX X;  4FSS A;  1RUW A;  4LN2 A;  1VYV A;  4M4Z A;  3PVL A;  4HVW A;  2ROL A;  1IO6 A;  2RMO A;  4JJC A;  2KEA A;  1UTI A;  1AVZ C;  2DE0 X;  3M0T A;  4F14 A;  2MCN A;  2K9G A;  2FEI A;  2KXD A;  1ZSG A;  3H0I A;  2X3X D;  2KYM A;  3UF4 A;  2J6K A;  1ZUK A;  1TUC A;  1UJY A;  1K0S A;  2KE9 A;  3IQL A;  2C0O A;  1RI9 A;  3SHW A;  1OPK A;  3EG3 A;  3O5Z A;  2ED1 A;  2VKN A;  1UE9 A;  2CSI A;  2DM1 A;  2ECZ A;  5L23 A;  4JZ4 A;  1G83 A;  1LCK A;  2YUO A;  2KRS A;  3GBQ A;  1M3A A;  4CC2 A;  2D0N A;  1I1J A;  1NYG A;  1X2Q A;  4GBQ A;  5I22 A;  3JV3 A;  4RUG A;  2LQW A;  3M0P A;  1E6G A;  1UHF A;  1WXB A;  3QWY A;  2HDA A;  4J9B A;  4RTV A;  3REB B;  1ZLM A;  1QKX A;  1UUE A;  2LJ0 A;  4JJD A;  5GJW B;  4J9F A;  1VA7 A;  3H0H A;  4JPB W;  3VS6 A;  1XOV A;  2CT4 A;  1MUZ A;  4ESR A;  2V1Q A;  2M0Y A;  1WXU A;  2DBK A;  1HD3 A;  1M3B A;  2DIL A;  4RTU A;  1K9A A;  2CH4 A;  3U23 A;  2YUP A;  1AWJ A;  1M3C A;  1WIE A;  3THK A;  1FMK A;  1MV3 A;  2FG0 A;  1K1Z A;  4KRT A;  4LUE A;  2L3S A;  1QWE A;  2CDT A;  2FPE A;  4RTX A;  2F2X A;  1JU5 C;  3VS0 A;  4AFQ C;  1U06 A;  2L3Q A;  2K2M A;  3LH5 A;  2JM9 A;  1PHT A;  1WLP B;  3KFV A;  2AKL A;  3VS2 A;  2D8J A;  2LCS A;  4J9H A;  3NHN A;  2YT6 A;  2QDL A;  1ABQ A;  2EYY A;  2J05 A;  1UG1 A;  4OMO A;  3ZL7 C;  1YCS B;  1X69 A;  2DMO A;  2I0N A;  3TSW A;  1W70 A;  2BZ8 A;  4RTY A;  4J9C A;  1GL5 A;  2C0T A;  1X27 A;  2DYB A;  2BTT A;  2OJ2 A;  2LZ6 B;  2DA9 A;  2GQI A;  1NLP C;  2L3P A;  2GGR A;  1YWO A;  1W6X A;  1X43 A;  4F17 A;  1WXT A;  2OAW A;  1H8K A;  3EG0 A;  1SRL A;  4Z88 A;  2OI3 A;  1GBR A;  3EHQ A;  2DBM A;  3EG1 A;  4D8K A;  1SEM A;  1JEG A;  5ECA A;  1UDL A;  2YSQ A;  3PVQ A;  1WX6 A;  5HCK A;  1Z9Z A;  2KYB A;  2JW4 A;  2YUN A;  1SRM A;  4CC7 A;  2EGC A;  4AFS C;  2EGA A;  1PKS A;  1GCQ A;  1PNJ A;  2GBQ A;  1G2B A;  4OMN A;  3UAT A;  4HVU A;  4OMM A;  2FRY A;  2JXB A;  4GLM A;  4RTZ A;  1GCP A;  2FPD A;  1HJD A;  2B86 A;  1Z9Q A;  2HBW A;  4DEX A;  3I5S A;  1TG0 A;  2DF6 A;  5IXF A;  1NEG A;  4J9I A;  4HVV A;  3NMZ C;  1VYT A;  1M27 C;  1NG2 A;  5FW9 A;  1SHF A;  3UA6 A;  1WA7 A;  1K0X A;  1ZX6 A;  2DNU A;  1GCQ C;  2LNH B;  2A36 A;  4J9D A;  1ZBJ A;  2EYW A;  4A63 B;  1AEY A;  2EW3 A;  2KT8 A;  3EHR A;  2J06 A;  3H41 A;  1GFD A;  2F2V A;  2LQN A;  1SSH A;  1MV0 B;  1HSQ A;  1UGV A;  2KT1 A;  2RN8 A;  1AZE A;  2RQW A;  2F2W A;  3VS1 A;  2C0I A;  3SEM A;  2HEQ A;  1E7O A;  2CRE A;  2X3W D;  2DL8 A;  2DL7 A;  5EC7 A;  1WFW A;  2LJ1 A;  2RQU A;  4IIM A;  2A08 A;  4E6R A;  2MOX A;  2VVK A;  2L0A A;  1T3S A;  1UJ0 A;  1QLY A;  2CH4 W;  3I35 A;  3R6N A;  2CT3 A;  2JS0 A;  5IHK A;  1M8M A;  1FYN A;  2FPF A;  2JM8 A;  2K6D A;  3PE0 A;  3I9Q A;  4F16 A;  2EKH A;  4R0K A;  4LE9 A;  4JZ3 A;  1H3H A;  2RNA A;  3VRY A;  4J9G A;  2DX1 A;  2K79 A;  4D8D A;  1Y0M A;  3I5R A;  2J6O A;  4LNP A;  4QT7 A;  2AZS A;  2JTE A;  2SEM A;  1KJW A;  2J7I A;  2FRW A;  1WI7 A;  5I11 A;  1VYU A;  1YWP A;  2CUB A;  2JT4 A;  4Z8A A;  2RQT A;  4AFU C;  5IXB A;  3UA7 A;  2EBP A;  1U5S A;  2ROT A;  1OEB A;  2DRM A;  1PKT A;  2HCK A;  1K76 A;  1AWX A;  1AWW A;  2J6F A;  1TUD A;  4K11 A;  2KNB B;  4OMP A;  1PRL C;  2AKK A;  2D8H A;  1AD5 A;  1PRM C;  1H92 A;  1YN8 A;  4DEY A;  1AOJ A;  2VWF A;  2DVJ A;  3EG2 A;  2GTJ A;  1N5Z A;  2DRK A;  1BB9 A;  4JJB A;  1KIK A;  1M30 A;  2BZY A;  3M0U A;  2XMF A;  2RF0 A;  2W10 A;  5FWB A;  1ABO A;  1QWF A;  1JXO A;  4OML A;  1V1C A;  2P4R A;  1JQQ A;  2A37 A;  3A98 A;  2LX7 A;  2DL5 A;  5IH2 A;  3CQT A;  1OPL A;  2DLP A;  4HCK A;  1WYX A;  1NEB A;  2SRC A;  1GRI A;  3VS7 A;  2M51 A;  1I07 A;  1T3L A;  1GBQ A;  1W1F A;  1ARK A;  2O9V A;  2KRO A;  2D1X A;  1J3T A;  2ENM A;  3EGU A;  2GNC A;  4ZNX A;  2LP5 A;  2KXC A;  2RQV A;  2EVR A;  1T0H A;  1YNZ A;  2EYZ A;  3M0Q A;  1A0N B;  2YDL A;  2KGT A;  1JO8 A;  2O31 A;  1KFZ A;  1OV3 A;  2KRM A;  2V1R A;  2LJ3 A;  2EYX A;  1E6H A;  1SHG A;  2JS2 A;  2GTO A;  4X1V A;  1CKA A;  1YP5 A;  1PWT A;  2JMA A;  2RQR A;  1NYF A;  4AFZ C;  2FO0 A;  2K3B A;  3FJ5 A;  2AZV A;  1NLO C;  2NWM A;  3NPF A;  1WDX A;  2CSQ A;  1ZUU A;  1ZUY A;  3ULR B;  2HSP A;  2CUD A;  2K7A A;  4EIK A;  4CC4 B;  3VRZ A;  2YUQ A;  1UHC A;  4ORZ A;  1CSK A;  4CC3 A;  2EGE A;  2DL3 A;  2O88 A;  5GJV B;  4Y92 A;  2A28 A;  1SPK A;  3RNJ A;  3H0F A;  1T0J A;  1QCF A;  3VS5 A;  2EQI A;  1X6B A;  2EPD A;  1EFN A;  1Y57 A;  2DJQ A;  1JXM A;  2ED0 A;  2PZ1 A;  5IHN A;  2L2P A;  1X6G A;  5FWC A;  2NUZ A;  2G6F X;  1I0C A;  4AG2 C;  1OOT A;  1BU1 A;  1RLQ C;  1UEC A;  4LUD A;  1RLP C;  1CKB A;  3M0R A;  1K4U S;  3VS3 A;  2DL4 A;  4RTW A;  1BBZ A;  2O9S A;  2KRN A;  2LMJ A;  4HXJ A;  3RBB B;  5IHI A;  1B07 A;  2PTK A;  1B3Q A;  2JMC A;  1AZG B;  3C0C A;  1X2K A;  3REA B;  2H8H A;  2IIM A;  2PNI A;  1KSW A;  4RTT A;  3TVT A;  1UFF A;  2KBT A;  4IIO A;  1NM7 A;  3NGP A;  1AWO A;  2BZX A;  2ESW A;  2O2O A;  1BK2 A;  3TSZ A;  1GFC A;  3M0S A;  4AG1 C;  4Z89 A;  2KR3 A;  2E5K A;  2W0Z A;  4OMQ A;  3VS4 A;  2RPN A;  4WCI A;  1QKW A;  2AK5 A;  2MIO A;  1S1N A;  1U3O A; 
#chains in the Genus database with same CATH topology
 2ABL A;  3OBW A;  5IT9 E;  1RUW A;  2M02 A;  2QGG A;  2LCC A;  4JJC A;  2RO0 A;  1VQM A;  4KBM B;  3R6O A;  5FLX E;  4F14 A;  3M0T A;  2L5Q A;  3M53 A;  1VQK T;  2FEI A;  1Y7X A;  2KYM A;  4D6W A;  5GAN j;  1D0X A;  4C92 A;  3QHS A;  4QQG A;  2C0O A;  4M75 A;  1RI9 A;  1YJW Q;  2DD5 A;  2CSI A;  5CVI A;  4IUQ A;  4IKF A;  2RJC A;  5CKF A;  2K5F A;  1M3A A;  1VQP A;  1G8X A;  4RG8 A;  1Q81 U;  1LOJ A;  1NYG A;  1LVK A;  3CCE T;  4M77 F;  5GAO r;  1U1S A;  4JRP A;  1S72 Q;  4M78 F;  3M0P A;  4B6M A;  3QWY A;  3CCJ A;  1Q7Y U;  4DBR A;  1KD1 C;  1BYM A;  4BE2 A;  2QYZ A;  1N9S A;  4YTL A;  4J9F A;  3M9Q A;  1BIB A;  1NZ9 A;  2P84 A;  3H0H A;  4F7U B;  4IUP A;  1WHJ A;  4M77 G;  4FYW B;  3CBO A;  4RTU A;  1M3B A;  5D6W A;  1TWB A;  2CH4 A;  3U23 A;  1B34 B;  1FMK A;  3SWN B;  3MEA A;  3QKJ A;  3URG A;  2CP7 A;  3G1J A;  4F7U E;  2K3X A;  4L5G A;  2CDT A;  4OB2 B;  2OAU A;  2O4X B;  3CCM A;  1Q82 C;  4FCY A;  1WPY A;  2F2X A;  2MWO A;  1ZA2 B;  2O01 E;  3FDR A;  4PJO A;  3QG1 A;  4LDW A;  1YIT A;  3HHT B;  3HP9 A;  2COW A;  3PNW C;  1ACM B;  1KC8 U;  4KH1 B;  2DXT A;  3MJX A;  2JOY A;  1PHT A;  1VQ8 T;  3CCU T;  1WLP B;  3KFV A;  2E6Z A;  4JS5 A;  2LCS A;  3V8J A;  4J7I A;  2YT6 A;  3GLX A;  2Z0W A;  2EYY A;  2J05 A;  4HCB A;  1VQ4 A;  3ZL7 C;  1YCS B;  2QK0 A;  2COY A;  2DMO A;  2X51 A;  3TSW A;  1IRE B;  4EDU A;  5GAN 2;  1IB8 A;  3OYC A;  2CZ7 B;  1GL5 A;  2A7Y A;  1VQL Q;  1NLP C;  4FM4 B;  3WVE B;  3L42 A;  3G4S A;  1W6X A;  3G4S T;  1WXT A;  4B9X A;  3CD6 Q;  3EG0 A;  1VQ4 Q;  2OI3 A;  1GBR A;  3OYD A;  3JCM e;  2KI7 A;  2FZG B;  5GAM d;  4N4H A;  3UWN A;  2IPO B;  1Z9Z A;  4ZTF A;  3WXM B;  2JW4 A;  3OYG A;  3CC7 Q;  4AFS C;  3QII A;  1SKU B;  3RKW A;  4OMM A;  2JXB A;  1BCO A;  2FPD A;  4C8Q F;  1ZSZ C;  2DXC A;  1RAF B;  4PJO G;  1BI0 A;  1YIT Q;  4MML A;  2DF6 A;  1SSF A;  5GAN 5;  5GAN h;  1VYT A;  5GAN 3;  1NG2 A;  2L8D A;  3OYY A;  4BUG A;  5KYX B;  1GCQ C;  5DLQ E;  1KK7 A;  2A36 A;  5FU7 C;  3CCU Q;  3RIR A;  2EYW A;  3T9N A;  5LJ5 g;  1M90 C;  2MK5 A;  2PUO B;  2CGH A;  4ZGE B;  1YJ9 Q;  5IN1 A;  1OQK A;  3BDU A;  3JB9 G;  2Y4X A;  4M7A A;  4KGV B;  3OS5 A;  3J81 E;  2CRE A;  1QCN A;  3P8D A;  2CP6 A;  2DL7 A;  4CRI A;  2NLU A;  4E6R A;  2FL7 A;  2X4Y A;  3RUX A;  2L0A A;  1QLY A;  3DB3 A;  5LJ5 e;  1I81 A;  1Q82 U;  3OYB A;  5GAO q;  2JS0 A;  2DTI A;  3OA6 A;  4JJN K;  4E7Z A;  4OMF B;  4F16 A;  2JM8 A;  4QQ6 A;  2JTF A;  3I9Q A;  2OTJ T;  3MP8 A;  3VUZ A;  2OTJ A;  1RAE B;  4C8Q A;  2R5M A;  2WSE E;  4PJO B;  4M78 B;  4J9G A;  2QQS A;  3KUF A;  4JUV A;  3RKY A;  1BI3 A;  1UGS B;  2R5A A;  3MHX A;  2J6O A;  4LNP A;  1XJW B;  1D0Z A;  2JTE A;  4XTZ A;  2J7I A;  5GAM j;  2RI2 A;  4M78 C;  3D7S B;  2AHJ B;  5KYU A;  4MDW A;  3V7S A;  1KD1 R;  3CCU A;  3BW1 A;  3UA7 A;  1WQW A;  1UB4 A;  1W2B P;  2JTM A;  4FW1 A;  4M75 D;  4M78 A;  1VQ5 Q;  2E4H A;  2AIR B;  3JRZ A;  1PRM C;  1YN8 A;  2FYK A;  3JB9 H;  3NTH A;  3FLG A;  2DRK A;  4KUI A;  1QVF P;  1BB9 A;  1KIK A;  1YIJ A;  3JB9 F;  2GFA A;  2RF0 A;  2X4X A;  2K3Y A;  3HRS A;  1ABO A;  2HQH A;  5IAY A;  1V1C A;  2EQK A;  3VKI A;  3OYH A;  1JQQ A;  3A98 A;  3L2R A;  1IGU A;  2RK2 A;  3QXE B;  2QQ9 A;  3E9G A;  1YIT T;  2HKN A;  2SRC A;  4BAC A;  1I07 A;  1YJW T;  4OB0 B;  3CC4 A;  4PJJ A;  1VQ7 Q;  1ARK A;  1YIJ Q;  4M75 C;  3VYH B;  4CI0 C;  2MWP A;  4NL2 A;  2GNC A;  4ZNX A;  2E65 A;  2KXC A;  2MYS A;  2EYZ A;  1A0N B;  4OB3 B;  2O31 A;  3OYA A;  3OYK A;  2MPX C;  1OV3 A;  1SF9 A;  2LJ3 A;  2EYX A;  2JS2 A;  2XHC A;  5M9O A;  1YP5 A;  3MPU B;  2HNI A;  1PWT A;  1N6A A;  2JMA A;  1PD0 A;  2LRQ A;  4R56 A;  2FO0 A;  3I56 Q;  2P0P A;  5CCA A;  2AZV A;  4MDX A;  2NWM A;  2EWN A;  3LGL A;  4C0D B;  1QW1 A;  5EG2 A;  2LNV A;  4LD9 K;  2QDY B;  3L1A A;  1ZUU A;  1ZUY A;  4M77 A;  1ZSZ A;  3E1S A;  4C8Q E;  3JB9 I;  1CSK A;  5I2S A;  5GJV B;  3AT1 B;  1QCF A;  5A2Q E;  3VS5 A;  4OVA A;  2COZ A;  2DJZ A;  4M7A G;  4M75 B;  4E7J A;  2DJQ A;  4E7S A;  4JRK A;  2BIV A;  1KQ2 A;  3SDZ A;  1XTD A;  2JZ2 A;  1YJN Q;  3FEO A;  4E7K A;  1YI2 Q;  2QEX T;  2MAM A;  1CKB A;  5A0G A;  3MP1 A;  2O9S A;  2KRN A;  1WHG A;  2LMJ A;  3QZ9 B;  2RHU A;  1B3Q A;  2K2V A;  4RCB A;  2JJ9 A;  3JCM c;  4KGZ B;  1PG5 B;  1LPL A;  4OF1 A;  4XAX B;  4ATO A;  1DJ7 B;  2DXU A;  1UFF A;  3RDV A;  4XU0 A;  4HCZ A;  3CCE A;  2ZPF B;  2NYS A;  3RES A;  2ESW A;  2FZK B;  3TSZ A;  4C8Q B;  4IUR A;  2KR3 A;  4OMQ A;  1H64 1;  3VS4 A;  1I5L A;  4VUB A;  2JNG A;  4WCI A;  2AK5 A;  2DIG A;  1PSE A;  1WHL A;  1S1N A;  1U3O A;  3CXC P;  5LJ3 e;  3QWX X;  4KH0 B;  3GP8 A;  4LN2 A;  1VYV A;  3PIP A;  4HVW A;  2MI6 A;  2D9T A;  2ROL A;  3OQ5 A;  2RMO A;  3CME A;  1WHM A;  3GF5 A;  3A8H B;  1WJR A;  2MCN A;  5GAN e;  8ATC B;  1ZSG A;  2NUT A;  2KE9 A;  3SHW A;  1OPK A;  1M8V A;  3EG3 A;  3O5Z A;  2ED1 A;  3OYN A;  2VKN A;  1UE9 A;  2M16 A;  4II1 A;  5L23 A;  4LDU A;  3CCJ Q;  1KC8 R;  1IGQ A;  2D0N A;  1KHC A;  5I22 A;  3JV3 A;  4M7D B;  3G71 A;  1E6G A;  2HDA A;  4RTV A;  4M78 E;  1UUE A;  2L89 A;  3OS1 A;  1VQM Q;  2LJ0 A;  5GJW B;  2LC4 A;  4R55 A;  1VA7 A;  4N4I A;  3GIB A;  4DA4 A;  4JPB W;  1QVP A;  5GAO p;  2E70 A;  2RM4 A;  5KCH A;  4ESR A;  2V1Q A;  4M7A D;  2PVD B;  4PLL A;  1K9A A;  2PU9 B;  1QVF A;  4V2S A;  3MET A;  1WHK A;  2YUP A;  1MV3 A;  1VQK A;  4HT9 A;  3TQ7 P;  2H3E B;  2WSF E;  3X26 B;  5CKB A;  2L3S A;  2QAS A;  4A54 A;  4J83 A;  4QVD A;  1JU5 C;  1WHH A;  3VS0 A;  4F7U G;  1WQ7 A;  5KYW B;  1VQ5 T;  4E47 A;  3C95 A;  1W2B S;  1VQO A;  2L3Q A;  4M7A E;  1RL2 A;  2E12 A;  2JM9 A;  1K8A C;  3PGG A;  2AKL A;  2RD1 A;  4TVR A;  3PMI A;  2DZ9 A;  3NHN A;  2QDL A;  4XQ3 A;  4NL3 A;  1NPP A;  4LDV A;  1EZZ B;  1G3S A;  5CK9 A;  1X69 A;  2I0N A;  4OB1 B;  1VQL A;  4A4G A;  5FRM A;  1G3T A;  3CCM Q;  1FMW A;  3G4S Q;  3CC4 T;  3CD6 A;  1I8F A;  3L2U A;  2DYB A;  2BTT A;  2LZ6 B;  3V8K A;  2RHY A;  4F17 A;  3CPW P;  4C0Z A;  1PSF A;  3EHQ A;  4BI4 A;  2DBM A;  4PFZ A;  1WZO A;  2YSQ A;  5HCK A;  4FW2 A;  3OS2 A;  1YFN A;  2HBP A;  2KYB A;  1VQK Q;  5GAN f;  2YUN A;  1SRM A;  4CC7 A;  2EGC A;  2C06 A;  1OI1 A;  2GBQ A;  4C92 E;  4RTZ A;  5DY9 A;  1Y96 B;  2EQJ A;  4QVZ A;  2B86 A;  5GAM f;  1F1B B;  4DEX A;  3I5S A;  4B9W A;  5IXF A;  4J9I A;  1OX8 A;  3CCL T;  2PQW A;  1K0X A;  4J9D A;  1ZBJ A;  2K4Y A;  2KT8 A;  2VUB A;  2QA4 T;  4Y91 A;  2ATC B;  2J06 A;  2E64 A;  1SSH A;  1RI0 A;  1AZE A;  1UGV A;  1VIF A;  4KGX B;  1JRI A;  2RQW A;  1XQH A;  3C94 A;  1UEB A;  2QEX A;  1M1K C;  2WSC E;  2DEU A;  2DL8 A;  1O75 A;  3I56 T;  2LX9 A;  4IIM A;  3M5A A;  1R8O B;  2HKQ B;  2MOX A;  2VGN A;  3FRN A;  1YHQ A;  1N8R R;  2E1H A;  2CT3 A;  2DKG A;  4PJO C;  3M54 A;  1M8M A;  3AHU A;  3A8M B;  4R0K A;  1HXD A;  3CC2 Q;  1FMV A;  1ZA1 B;  5LJ5 h;  3JCM f;  1H3H A;  1K9M R;  2RNA A;  4ME7 A;  2DX1 A;  1PCX A;  3PMT A;  4MMK A;  3I5R A;  4M75 G;  2CZ0 B;  4QT7 A;  1KG1 A;  5CIU A;  1JBM A;  2AZS A;  5GMK l;  4BDZ A;  3LWI A;  2OTL T;  1WI7 A;  5D6Y A;  3CCQ T;  1VYU A;  1MNE A;  2DZC A;  3CME T;  1Q7Y C;  3MEU A;  1OYX A;  3A8L B;  4RCC A;  1G3Y A;  1U5S A;  4C5H A;  4DBQ A;  3A8O B;  1PKT A;  4C92 D;  1IZ6 A;  4ANJ A;  1QVG A;  1AWW A;  4K11 A;  4PKC C;  1B34 A;  2KDS A;  2F69 A;  1PRL C;  1VQL T;  2D8H A;  1RAA B;  3TEE A;  2MF2 A;  4KUD K;  2X9H A;  4DEY A;  1KQS S;  2CZ6 B;  3E2U A;  3EG2 A;  2GTJ A;  4J5Y A;  4A4H A;  4JJB A;  3SB2 A;  3QBY A;  3L2Q A;  1M2V A;  2BZY A;  3M0U A;  2XMF A;  4QQD A;  3NFC A;  5FWB A;  2QQA A;  2YXY A;  2RHX A;  4OML A;  3H6Z A;  2LX7 A;  2F1L A;  1D1C A;  5FU6 B;  3INZ A;  2YLC A;  2R58 A;  3ZFJ A;  5GAN 6;  4J6Y A;  2LVM A;  2HQE A;  2M51 A;  3QYG B;  3VS7 A;  3FC3 A;  1V29 B;  3OW2 A;  4M7D G;  3FIF A;  2O9V A;  2KRO A;  3BE3 A;  4FYV B;  4C92 G;  3CCJ T;  1J3T A;  1MHN A;  3HPW A;  4M75 E;  1RAI B;  1QMC A;  1D09 B;  2LP5 A;  2EVR A;  5FU6 C;  5CR2 A;  1TH7 A;  1YNZ A;  1VQN Q;  2KGT A;  2B8A A;  2KRM A;  1VQ9 T;  3VV0 A;  3VJP A;  2VGM A;  2XKO C;  2IG0 A;  3X25 B;  3HFO A;  1VQO T;  4HKE A;  1CKA A;  4X1V A;  2ZAE A;  2DYI A;  4BDY A;  3GOX A;  2RQR A;  2PUK B;  1NYF A;  4AFZ C;  1FX7 A;  3NPF A;  4JDS A;  4EMK C;  1VQ7 A;  3CCV A;  1VQN A;  4XTX A;  3OSS C;  4C5G A;  2CUD A;  2K7A A;  4CC4 B;  2YUQ A;  1UHC A;  5I2M A;  2E5Q A;  1Y71 A;  5GMK i;  4JLI A;  3P8B B;  5C0M A;  2DL3 A;  9ATC B;  3C4S A;  3WVD B;  3EGD B;  4F04 B;  3CCS A;  2VAS A;  4Y92 A;  5LJ3 f;  1SPK A;  1QVF S;  1T0J A;  5HKC A;  1W4S A;  3OYL A;  2DK3 A;  1HYO A;  1X6B A;  1YJN A;  4C0F A;  3ER0 A;  4M78 D;  4HCC A;  1JXM A;  2PZ1 A;  2E41 A;  3UT1 A;  1VQ4 T;  4F7U A;  1X6G A;  3EFS A;  3M55 A;  4MZP A;  3CPW S;  4UC4 A;  2FVU A;  2EIF A;  2QTV A;  1BU1 A;  1W2B A;  4GLK A;  4LUD A;  3JB9 J;  3CCR A;  1QVG P;  3VS3 A;  4E7L A;  1ZSZ B;  3CBM A;  3QDF A;  3JCM d;  2XK0 A;  2V8J A;  2ZPE B;  1B07 A;  4XU1 A;  1X2K A;  5AYF A;  1NJI R;  4L59 A;  2PNI A;  3QPH A;  1D3B B;  4EMG A;  1QCO A;  4IIO A;  1SG5 A;  3NGP A;  4A53 A;  1X75 C;  4Q5W A;  1BK2 A;  4DQ2 A;  2E5K A;  3HRT A;  5GAM h;  4N0A C;  1M9S A;  2MIO A;  2CZ1 B;  3RER A;  4J6X A;  3OW2 P;  4J9E A;  1TXQ A;  1M2V B;  2DAQ A;  4M4Z A;  3OYM A;  1IO6 A;  5KYY A;  2XDD A;  2KEA A;  1UTI A;  3PT9 A;  4BE1 A;  2DE0 X;  2GQV A;  3EFO A;  5GAN 8;  2KXD A;  3LGF A;  3CC7 T;  4C8Q G;  1K73 U;  1ZUK A;  1JJ2 A;  1UJY A;  1UGR B;  1MMA A;  1YBY A;  2R57 A;  4N4G A;  1YJ9 A;  4JZ4 A;  1G83 A;  1LCK A;  3GBQ A;  2RI3 A;  4BD3 A;  2EQM A;  4CC2 A;  2RHI A;  2FZC B;  1QQJ A;  1OUL A;  4A4K A;  4GBQ A;  4C8Q C;  1ZLM A;  1QKX A;  2HAX A;  2LQK A;  3V7C A;  4JJD A;  1M5Q 1;  4FT2 A;  3SWN C;  1IXD A;  3OYF A;  3HRU A;  3VS6 A;  1JB0 E;  2NUT B;  1XOV A;  3L2W A;  1MUZ A;  2M0Y A;  3QYH B;  4C8Q D;  2E3H A;  2DIL A;  1HD3 A;  2DFU A;  2BUD A;  1AT1 B;  3DLM A;  2KQW A;  1M3C A;  2EAY A;  3THK A;  4OP0 A;  4BB7 A;  2XIC A;  1Q86 U;  4J6W A;  1VQ6 T;  4KRT A;  2EQU A;  2FPE A;  4RTX A;  3GNG A;  1HK9 A;  3EG9 A;  3ZBD A;  2BKD N;  4AFQ C;  1VQP Q;  4LDY A;  4ELY C;  1Q86 R;  1RAH B;  2K2M A;  3CMA T;  3CPW A;  3TRE A;  5GAM e;  1VQ8 A;  2QI2 A;  1OU8 A;  2F5K A;  2PVO B;  2WAC A;  4J7F A;  5HK0 A;  3FB9 A;  3VS2 A;  1VOM A;  2BE7 D;  2D8J A;  4XTV A;  2GFU A;  1UG1 A;  2XG8 D;  3QSU A;  4IUU A;  3OYI A;  2E6N A;  4PLI A;  2DO3 A;  1NJI U;  3CMA Q;  2C0T A;  1X27 A;  2OJ2 A;  4E2F B;  2DA9 A;  4QW2 A;  5LJ3 h;  1WGS A;  3SFM A;  2CYZ B;  2GGR A;  4PJL A;  5KYU B;  1X43 A;  2OAW A;  4M78 G;  3G71 Q;  4D8K A;  1SEM A;  3NTI A;  5GAO m;  2OTL A;  5D7U A;  2ZZD A;  1BIA A;  5GMK h;  3CC4 Q;  1RAD B;  3X20 B;  5KYN A;  4FU6 A;  2NUP A;  4BI8 B;  2EGA A;  1PKS A;  1GCQ A;  3UAT A;  1Q7Y R;  4GLM A;  2LCL A;  1YI2 T;  2CP3 A;  4HT8 A;  2D6F A;  2Y90 A;  2HQX A;  4HVV A;  3RR6 A;  4M75 F;  1FWZ A;  1SHF A;  5FW9 A;  1WA7 A;  1ZX6 A;  5LJ3 g;  1QP3 A;  4A63 B;  3I56 A;  5A0L A;  3VYG A;  3I55 T;  4C92 B;  3QDR B;  2O4X A;  4M7D A;  1C0M A;  3M4Y A;  1MMN A;  2LQN A;  4WF2 A;  5LL6 S;  1MV0 B;  3EH1 A;  2KT1 A;  2RN8 A;  4PL6 A;  1KQ1 A;  1H3Z A;  2L3R A;  3VS1 A;  2C0I A;  1N9R A;  1S72 A;  2HEQ A;  2VYT A;  2X3W D;  2DEQ A;  4X9C A;  1WFW A;  2RI5 A;  3JCM W;  5HY6 A;  4O5V A;  4JLG A;  1Q86 C;  2VVK A;  3CC2 T;  1T3S A;  2PVG B;  1UJ0 A;  3I35 A;  2OTL Q;  3LW5 E;  3OY9 A;  2KSS A;  5IHK A;  2YLB A;  1VQ9 A;  2FPF A;  3PE0 A;  3G6E T;  2EKH A;  1M1F A;  3EFR A;  2AT1 B;  5CKE A;  4JZ3 A;  3CPF A;  4RG2 A;  4Y28 E;  3VRY A;  2K79 A;  3BDL A;  5LJ3 d;  4D8D A;  1Y0M A;  2M1H A;  4OGE A;  2ZPI B;  4EMH A;  2X35 A;  5DM7 R;  1B7T A;  2E3I A;  2SEM A;  3F70 A;  3HL8 A;  1KJW A;  2EJ9 A;  5I11 A;  1YWP A;  5KYY B;  2RJE A;  2CUB A;  2JT4 A;  5FRN A;  1VIE A;  4Z8A A;  3X24 B;  1PC0 A;  3LX7 A;  5LJ5 d;  3JCM g;  1Q81 C;  1RAC B;  3CCR T;  2RQT A;  5GAN 4;  4AFU C;  5IXB A;  2EBP A;  2ROT A;  1OEB A;  2CP2 A;  2HCK A;  1K76 A;  1O9S A;  3OMG A;  3CC2 A;  2XD0 A;  2J6F A;  1KD1 U;  4AT1 B;  4OMP A;  1IRX A;  3RKX A;  4PFP A;  1H92 A;  1N8R C;  2DVJ A;  4M7A C;  2GCX A;  1N5Z A;  4GY5 A;  2RH2 A;  1VQ6 A;  1M30 A;  1G5V A;  1JXO A;  4PFO A;  2P4R A;  4QVC A;  1P92 A;  3CCL Q;  2DL5 A;  2BE9 B;  2DIQ A;  3CQT A;  3VUB A;  2QTX A;  1NEB A;  4E7H A;  2A3L A;  5I21 A;  3VU3 C;  1GBQ A;  4A4F A;  2LDM A;  2QA4 Q;  2RA2 A;  1W1F A;  3CC7 A;  2Y4Y A;  2D1X A;  2DXB A;  2ENM A;  3EGU A;  1T0H A;  1JJ2 S;  3JCM Q;  3QUI A;  2YDL A;  1JO8 A;  1IHV A;  4JS4 A;  1KFZ A;  3HTR A;  1MND A;  1JJ2 P;  1E6H A;  3JAM E;  3HSB A;  4N0A A;  2K3B A;  3QO3 A;  3FJ5 A;  2E10 A;  3EH2 A;  1OZ2 A;  1NLO C;  4DBH A;  3I55 A;  1WDX A;  3ZEH A;  5CAI A;  2CSQ A;  2XDB A;  5J26 A;  3JCM X;  2HSP A;  1YCY A;  2ZPH B;  2NUP B;  2VC8 A;  3LLR A;  3A8G B;  4EIK A;  3OW2 S;  3VRZ A;  4ORZ A;  4CC3 A;  2O88 A;  2ZPB B;  1VQO Q;  3A5Z B;  4BY6 C;  2A28 A;  3UDC A;  5GMK j;  1RAB B;  4ZTJ A;  2EYQ A;  2ZPG B;  3DB4 A;  1KQS P;  2ZCF B;  5CQY A;  2EPD A;  2QGF B;  1NBE B;  2RJD A;  2YWW A;  1EFN A;  2YRV A;  1G3W A;  2MMP A;  5IHN A;  3J7A F;  1LJO A;  4M7D C;  3M57 A;  4QKU A;  2M9U A;  5FWC A;  3JB9 D;  3V7R A;  3M58 A;  4AG2 C;  1OOT A;  3HFN A;  3M56 A;  1RLQ C;  1UEC A;  1OX9 A;  3M0R A;  5L8R E;  1K4U S;  2DL4 A;  7AT1 B;  1YIJ T;  1WNL A;  1XNI A;  5IHI A;  2PTK A;  2JMC A;  5KYX A;  3C0C A;  5DLO A;  1M90 U;  4O6J A;  4FYX B;  1M1K U;  4RTT A;  3TVT A;  4ZGJ B;  3KBG A;  1YJW A;  1I4K 1;  4FL6 A;  2X4W A;  2G3R A;  1AWO A;  2BZX A;  2O2O A;  4Z89 A;  5CKD A;  3JCM h;  1N8R U;  2RPN A;  4DOW A;  5CQX A;  3V8L A;  3EAE A;  1C1A A;  4FSS A;  2EKO A;  2LT1 A;  1VQ5 A;  3PVL A;  3S6W A;  1NPR A;  2KK4 A;  1WJQ A;  3EGX A;  3BFM A;  1AVZ C;  3G7Z A;  3CCV Q;  4F7U F;  5KCO A;  2K9G A;  3H0I A;  4KUL A;  2X3X D;  3UF4 A;  2J6K A;  1TUC A;  2YRD A;  1K0S A;  3IQL A;  5D6X A;  1ZHI A;  2CS7 A;  3HKS A;  1BI1 A;  2DM1 A;  2ECZ A;  4IUV A;  2DET A;  2YUO A;  2KRS A;  3LH0 A;  5CKH A;  3RMS A;  4M7A B;  1I1J A;  1X2Q A;  1K9M U;  1M2O A;  5GMK e;  5GAM g;  2QEX Q;  4RUG A;  2LQW A;  2RHZ A;  1WXB A;  1QP2 A;  1UHF A;  3OB9 A;  4J9B A;  4BE0 A;  3REB B;  3GPL A;  2JUF A;  4M77 E;  1OU9 A;  3EGX B;  4EMK A;  1YJ9 T;  3X28 B;  3CCR Q;  2HL3 A;  3BY7 A;  1ZQ1 A;  5GAN 7;  1YHQ Q;  3LWH A;  2CT4 A;  1VQP T;  2QAZ A;  3MEV A;  3P8H A;  4ZGD B;  3CME Q;  1WXU A;  2DBK A;  2A0F B;  3TCJ A;  1AWJ A;  1WIE A;  2EFI A;  1U1T A;  2FG0 A;  1K1Z A;  4NS5 A;  1WJS A;  4LUE A;  1V76 A;  1QWE A;  1MGQ A;  3OSV A;  5FU7 B;  3S3M A;  1VQ8 Q;  2QQR A;  2P4T A;  1U06 A;  2RJF A;  1M90 R;  2YRC A;  3G6E A;  2M0O A;  4LXC A;  3EGD A;  3Q1J A;  3PFS A;  3LH5 A;  1QVG S;  1Y07 A;  4J9H A;  2RK1 A;  3CCV T;  3OBY A;  1ABQ A;  4OMO A;  5LJ5 j;  1MMD A;  3DKM A;  1TS9 A;  5LJ3 j;  3M4G A;  1W70 A;  3KXT A;  2BZ8 A;  3L2V A;  1VQM T;  4RTY A;  4RMO A;  4J9C A;  3MO8 A;  3CCS T;  1GXI E;  5LJ5 f;  2GQI A;  2K5I A;  2L3P A;  5C6S A;  1YWO A;  1TU0 B;  1VQ7 T;  1H8K A;  1SRL A;  3E9F A;  4Z88 A;  3EG1 A;  1YHQ T;  4C0G A;  1JEG A;  3CCQ A;  5ECA A;  1NE8 A;  1UDL A;  3PVQ A;  1WX6 A;  2V8I A;  2CKK A;  3E19 A;  4M7D E;  3CBP A;  4PJO E;  1PNJ A;  4L6V 5;  1G2B A;  4AMC A;  4OMN A;  3H8Z A;  4HVU A;  2FRY A;  4M7A F;  1GCP A;  1HJD A;  1D1A A;  4PNO A;  1Z9Q A;  2HBW A;  1PM3 A;  4C92 F;  5KE2 A;  3CCQ Q;  1TG0 A;  4XTU A;  1NEG A;  2LT4 A;  1BI2 A;  3NMZ C;  4M7D F;  1M27 C;  3A1P A;  3UA6 A;  2XU8 A;  1K73 R;  2DNU A;  3G71 T;  2LNH B;  1K9M C;  2KAF A;  3DLL A;  1MMG A;  1AEY A;  2EW3 A;  2HMA A;  3EHR A;  4PK4 A;  2H3J A;  3CCM T;  2OX7 A;  3H41 A;  4M77 B;  1GFD A;  2F2V A;  3QZ5 B;  2V26 A;  1HSQ A;  3PTA A;  1TSF A;  3O8V A;  4BY6 B;  3J80 E;  1OZ3 A;  1Q82 R;  1BCM A;  2DER A;  2F2W A;  3SEM A;  2FB7 A;  1UGQ B;  1E7O A;  4JRI A;  4ZN1 A;  2QG9 B;  2KMT A;  5EC7 A;  2HL5 C;  1K8A R;  2LJ1 A;  1U8R A;  2RQU A;  1YJN T;  2ZGW A;  2A08 A;  2XI9 A;  3MEW A;  4XTY A;  1TUG B;  3EFO B;  2CH4 W;  3R6N A;  2DD4 A;  2QQB A;  1PD1 A;  2GF7 A;  1EX4 A;  1BKB A;  1FYN A;  2K6D A;  4DBF A;  5J39 A;  2HSE B;  1K73 C;  4HA8 A;  1FXX A;  4LE9 A;  4FIB A;  4XU3 A;  4WTO B;  2CP5 A;  2DPP B;  1X6O A;  2FHD A;  3GNF B;  2OTJ Q;  1VQN T;  2VV5 A;  3MP6 A;  3UPU A;  2FRW A;  1D3B A;  2X4J A;  4PJN A;  1I5O B;  4C5I A;  4LD6 A;  3FJP A;  2XDP A;  3NTK A;  1VQ9 Q;  2DTO A;  2DRM A;  4FSX A;  5KH6 A;  4PJO D;  2EJG A;  5GMK m;  1AWX A;  3CXC A;  1TUD A;  2V8K A;  4RKU E;  8AT1 B;  1M1G A;  2KNB B;  4X34 A;  4M7D D;  5GAN g;  2JN0 A;  4JRQ A;  4DOV A;  2AKK A;  3OYJ A;  1VQ6 Q;  2IVW A;  1N27 A;  1R0C B;  1AD5 A;  2VXE A;  4FYY B;  1AOJ A;  3CCL A;  2I2L A;  2VWF A;  1Y96 A;  5A0D A;  3EG9 B;  2K5L A;  2W10 A;  3JCM J;  1KQS A;  1TOV A;  3PIO A;  1QWF A;  1KHI A;  5FRO A;  4P5N A;  2A37 A;  1YI2 A;  3N5B B;  2QA4 A;  4Z02 A;  5IH2 A;  3SWN A;  3JCM P;  2K57 A;  5CO7 A;  3ASK A;  4A4E A;  1OPL A;  2DLP A;  4HCK A;  4MZM A;  2KY9 A;  1WYX A;  2HZY A;  1GRI A;  3H9N A;  1T3L A;  4KT0 E;  1M1K R;  5HK3 A;  3CCS Q;  3MKD A;  1R77 A;  1AHJ B;  1D0Y A;  3MCA B;  2EJF A;  2RQV A;  1D1B A;  1K8A U;  3LYI A;  3M0Q A;  1C6V X;  3L2Z A;  1M4Z A;  1IHW A;  5GAN d;  3S3O A;  2QXF A;  1NJI C;  3TU4 K;  2V1R A;  4IUT A;  5GAO l;  4NOY A;  1SHG A;  2GTO A;  3CD6 T;  3S3N A;  3OS0 A;  5AT1 B;  5GAO n;  5KE3 A;  4C0D C;  1TTH B;  4ELZ C;  4XU2 A;  4FT4 A;  2LTO A;  1Q81 R;  3ULR B;  3ME9 A;  3CEY A;  4ZN3 A;  3QJ6 A;  2XID A;  3JCM V;  3CXC S;  2DTH A;  1VUB A;  2EGE A;  2KVQ G;  2YHT A;  1ZBX A;  2D0Q B;  3QJY A;  4PJO F;  2LQ8 A;  3RNJ A;  3H0F A;  3JCM b;  1EIF A;  2EQI A;  5KYW A;  2DVE A;  4J8O A;  4M77 D;  4EPC A;  1Y57 A;  4C92 C;  3CCE Q;  2ED0 A;  2L2P A;  1KC8 C;  1X01 A;  3I55 Q;  4E7I A;  2NUZ A;  2G6F X;  1LNX A;  2CP0 A;  1I0C A;  3OMC A;  1R0B G;  1S72 T;  3CMA A;  5J3B A;  4BI3 A;  1RLP C;  2P0Q A;  3M59 A;  4RTW A;  2VB6 A;  2VXF A;  1BBZ A;  3C12 A;  4HXJ A;  4PJM A;  3RBB B;  4X9D A;  3G6E Q;  1RAG B;  4EMK B;  1AZG B;  4MZT A;  4LDX A;  2RB6 A;  3REA B;  2H8H A;  2IIM A;  1KSW A;  3SD4 A;  2JVV A;  2P0K A;  1Q95 G;  2KBT A;  4OGC A;  1NM7 A;  2F5T X;  4XK8 E;  1GFC A;  3M0S A;  4AG1 C;  3RMQ A;  2W0Z A;  6AT1 B;  2HD0 A;  3JSC A;  3OYE A;  1QKW A;  4M77 C;  4XTW A;  1UGP B;  4C5E A; 
#chains in the Genus database with same CATH homology
 2ABL A;  4J9E A;  3QWX X;  4FSS A;  1RUW A;  4LN2 A;  1VYV A;  4M4Z A;  3PVL A;  4HVW A;  2ROL A;  1IO6 A;  2RMO A;  4JJC A;  2KEA A;  1UTI A;  1AVZ C;  2DE0 X;  3M0T A;  4F14 A;  2MCN A;  2K9G A;  2FEI A;  2KXD A;  1ZSG A;  3H0I A;  2X3X D;  2KYM A;  3UF4 A;  2J6K A;  1ZUK A;  1TUC A;  1UJY A;  1K0S A;  2KE9 A;  3IQL A;  2C0O A;  1RI9 A;  3SHW A;  1OPK A;  3EG3 A;  3O5Z A;  2ED1 A;  2VKN A;  1UE9 A;  2CSI A;  2DM1 A;  2ECZ A;  5L23 A;  4JZ4 A;  1G83 A;  1LCK A;  2YUO A;  2KRS A;  3GBQ A;  1M3A A;  4CC2 A;  2D0N A;  1I1J A;  1NYG A;  1X2Q A;  4GBQ A;  5I22 A;  3JV3 A;  4RUG A;  2LQW A;  3M0P A;  1E6G A;  1UHF A;  1WXB A;  3QWY A;  2HDA A;  4J9B A;  4RTV A;  3REB B;  1ZLM A;  1QKX A;  1UUE A;  2LJ0 A;  4JJD A;  5GJW B;  4J9F A;  1VA7 A;  3H0H A;  4JPB W;  3VS6 A;  1XOV A;  2CT4 A;  1MUZ A;  4ESR A;  2V1Q A;  2M0Y A;  1WXU A;  2DBK A;  1HD3 A;  1M3B A;  2DIL A;  4RTU A;  1K9A A;  2CH4 A;  3U23 A;  2YUP A;  1AWJ A;  1M3C A;  1WIE A;  3THK A;  1FMK A;  1MV3 A;  2FG0 A;  1K1Z A;  4KRT A;  4LUE A;  2L3S A;  1QWE A;  2CDT A;  2FPE A;  4RTX A;  2F2X A;  1JU5 C;  3VS0 A;  4AFQ C;  1U06 A;  2L3Q A;  2K2M A;  3LH5 A;  2JM9 A;  1PHT A;  1WLP B;  3KFV A;  2AKL A;  3VS2 A;  2D8J A;  2LCS A;  4J9H A;  3NHN A;  2YT6 A;  2QDL A;  1ABQ A;  2EYY A;  2J05 A;  1UG1 A;  4OMO A;  3ZL7 C;  1YCS B;  1X69 A;  2DMO A;  2I0N A;  3TSW A;  1W70 A;  2BZ8 A;  4RTY A;  4J9C A;  1GL5 A;  2C0T A;  1X27 A;  2DYB A;  2BTT A;  2OJ2 A;  2LZ6 B;  2DA9 A;  2GQI A;  1NLP C;  2L3P A;  2GGR A;  1YWO A;  1W6X A;  1X43 A;  4F17 A;  1WXT A;  2OAW A;  1H8K A;  3EG0 A;  1SRL A;  4Z88 A;  2OI3 A;  1GBR A;  3EHQ A;  2DBM A;  3EG1 A;  4D8K A;  1SEM A;  1JEG A;  5ECA A;  1UDL A;  2YSQ A;  3PVQ A;  1WX6 A;  5HCK A;  1Z9Z A;  2KYB A;  2JW4 A;  2YUN A;  1SRM A;  4CC7 A;  2EGC A;  4AFS C;  2EGA A;  1PKS A;  1GCQ A;  1PNJ A;  2GBQ A;  1G2B A;  4OMN A;  3UAT A;  4HVU A;  4OMM A;  2FRY A;  2JXB A;  4GLM A;  4RTZ A;  1GCP A;  2FPD A;  1HJD A;  2B86 A;  1Z9Q A;  2HBW A;  4DEX A;  3I5S A;  1TG0 A;  2DF6 A;  5IXF A;  1NEG A;  4J9I A;  4HVV A;  3NMZ C;  1VYT A;  1M27 C;  1NG2 A;  5FW9 A;  1SHF A;  3UA6 A;  1WA7 A;  1K0X A;  1ZX6 A;  2DNU A;  1GCQ C;  2LNH B;  2A36 A;  4J9D A;  1ZBJ A;  2EYW A;  4A63 B;  1AEY A;  2EW3 A;  2KT8 A;  3EHR A;  2J06 A;  3H41 A;  1GFD A;  2F2V A;  2LQN A;  1SSH A;  1MV0 B;  1HSQ A;  1UGV A;  2KT1 A;  2RN8 A;  1AZE A;  2RQW A;  2F2W A;  3VS1 A;  2C0I A;  3SEM A;  2HEQ A;  1E7O A;  2CRE A;  2X3W D;  2DL8 A;  2DL7 A;  5EC7 A;  1WFW A;  2LJ1 A;  2RQU A;  4IIM A;  2A08 A;  4E6R A;  2MOX A;  2VVK A;  2L0A A;  1T3S A;  1UJ0 A;  1QLY A;  2CH4 W;  3I35 A;  3R6N A;  2CT3 A;  2JS0 A;  5IHK A;  1M8M A;  1FYN A;  2FPF A;  2JM8 A;  2K6D A;  3PE0 A;  3I9Q A;  4F16 A;  2EKH A;  4R0K A;  4LE9 A;  4JZ3 A;  1H3H A;  2RNA A;  3VRY A;  4J9G A;  2DX1 A;  2K79 A;  4D8D A;  1Y0M A;  3I5R A;  2J6O A;  4LNP A;  4QT7 A;  2AZS A;  2JTE A;  2SEM A;  1KJW A;  2J7I A;  2FRW A;  1WI7 A;  5I11 A;  1VYU A;  1YWP A;  2CUB A;  2JT4 A;  4Z8A A;  2RQT A;  4AFU C;  5IXB A;  3UA7 A;  2EBP A;  1U5S A;  2ROT A;  1OEB A;  2DRM A;  1PKT A;  2HCK A;  1K76 A;  1AWX A;  1AWW A;  2J6F A;  1TUD A;  4K11 A;  2KNB B;  4OMP A;  1PRL C;  2AKK A;  2D8H A;  1AD5 A;  1PRM C;  1H92 A;  1YN8 A;  4DEY A;  1AOJ A;  2VWF A;  2DVJ A;  3EG2 A;  2GTJ A;  1N5Z A;  2DRK A;  1BB9 A;  4JJB A;  1KIK A;  1M30 A;  2BZY A;  3M0U A;  2XMF A;  2RF0 A;  2W10 A;  5FWB A;  1ABO A;  1QWF A;  1JXO A;  4OML A;  1V1C A;  2P4R A;  1JQQ A;  2A37 A;  3A98 A;  2LX7 A;  2DL5 A;  5IH2 A;  3CQT A;  1OPL A;  2DLP A;  4HCK A;  1WYX A;  1NEB A;  2SRC A;  1GRI A;  3VS7 A;  2M51 A;  1I07 A;  1T3L A;  1GBQ A;  1W1F A;  1ARK A;  2O9V A;  2KRO A;  2D1X A;  1J3T A;  2ENM A;  3EGU A;  2GNC A;  4ZNX A;  2LP5 A;  2KXC A;  2RQV A;  2EVR A;  1T0H A;  1YNZ A;  2EYZ A;  3M0Q A;  1A0N B;  2YDL A;  2KGT A;  1JO8 A;  2O31 A;  1KFZ A;  1OV3 A;  2KRM A;  2V1R A;  2LJ3 A;  2EYX A;  1E6H A;  1SHG A;  2JS2 A;  2GTO A;  4X1V A;  1CKA A;  1YP5 A;  1PWT A;  2JMA A;  2RQR A;  1NYF A;  4AFZ C;  2FO0 A;  2K3B A;  3FJ5 A;  2AZV A;  1NLO C;  2NWM A;  3NPF A;  1WDX A;  2CSQ A;  1ZUU A;  1ZUY A;  3ULR B;  2HSP A;  2CUD A;  2K7A A;  4EIK A;  4CC4 B;  3VRZ A;  2YUQ A;  1UHC A;  4ORZ A;  1CSK A;  4CC3 A;  2EGE A;  2DL3 A;  2O88 A;  5GJV B;  4Y92 A;  2A28 A;  1SPK A;  3RNJ A;  3H0F A;  1T0J A;  1QCF A;  3VS5 A;  2EQI A;  1X6B A;  2EPD A;  1EFN A;  1Y57 A;  2DJQ A;  1JXM A;  2ED0 A;  2PZ1 A;  5IHN A;  2L2P A;  1X6G A;  5FWC A;  2NUZ A;  2G6F X;  1I0C A;  4AG2 C;  1OOT A;  1BU1 A;  1RLQ C;  1UEC A;  4LUD A;  1RLP C;  1CKB A;  3M0R A;  1K4U S;  3VS3 A;  2DL4 A;  4RTW A;  1BBZ A;  2O9S A;  2KRN A;  2LMJ A;  4HXJ A;  3RBB B;  5IHI A;  1B07 A;  2PTK A;  1B3Q A;  2JMC A;  1AZG B;  3C0C A;  1X2K A;  3REA B;  2H8H A;  2IIM A;  2PNI A;  1KSW A;  4RTT A;  3TVT A;  1UFF A;  2KBT A;  4IIO A;  1NM7 A;  3NGP A;  1AWO A;  2BZX A;  2ESW A;  2O2O A;  1BK2 A;  3TSZ A;  1GFC A;  3M0S A;  4AG1 C;  4Z89 A;  2KR3 A;  2E5K A;  2W0Z A;  4OMQ A;  3VS4 A;  2RPN A;  4WCI A;  1QKW A;  2AK5 A;  2MIO A;  1S1N A;  1U3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...