1TUDA

Alpha-spectrin src homology 3 domain, circular permutant, cut at n47-d48
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
RQGFVPAAYVKKLDSGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-SPECTRIN
publication title The order of secondary structure elements does not determine the structure of a protein but does affect its folding kinetics.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
total genus 11
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1tudA00
4D8DA 2O9SA 2ABLA 2JMCA 1VA7A 2VVKA 2D1XA 2JM8A 2HDAA 1SHGA 1K9AA 2KNBB 1K1ZA 2YUNA 3I35A 1UHFA 3IQLA 4J9FA 2W10A 2BZ8A 2EGCA 2J6OA 2JM9A 4JZ3A 4AFSC 4WCIA 3KFVA 2D8HA 2FG0A 2DRKA 5IH2A 1AVZC 3SHWA 3VS5A 1M27C 2RQUA 4FSSA 4HVWA 2LQWA 1ZBJA 2A28A 2EYZA 3VRZA 1B07A 1H92A 1M8MA 1T3SA 4F14A 2XMFA 1AWOA 2K7AA 2B86A 5FWBA 2V1RA 3VS7A 2K2MA 1ZUYA 3R6NA 2DLPA 1FMKA 3QWYA 3M0TA 3SEMA 1WLPB 2DBMA 2O31A 1FYNA 1WXTA 4IIOA 1JEGA 1AEYA 4AG1C 1N5ZA 4JZ4A 2RQWA 1WX6A 4GBQA 2DM1A 1WIEA 2LZ6B 1QLYA 2D0NA 1IO6A 1SSHA 2RQTA 2OAWA 1U3OA 1T3LA 1G83A 2JS2A 4RTZA 3A98A 5IHNA 2FRYA 1K76A 2M51A 2MCNA 3ZL7C 2EPDA 1Z9QA 1UECA 1ZX6A 2OI3A 1GBRA 3VS6A 2GGRA 2DJQA 2L3PA 2HBWA 1CKAA 1CSKA 3TSWA 2KT8A 1ABOA 1H3HA 1TUCA 2X3WD 2BZXA 2EKHA 1I07A 1TG0A 3VS1A 2BZYA 3M0RA 1JQQA 1X43A 2SRCA 2X3XD 1TUDA 4J9BA 1AZEA 2ESWA 1K0XA 5EC7A 3EG0A 1ZUKA 2NWMA 3EHQA 2P4RA 2FPDA 4LUDA 5I11A 4OMQA 2O88A 4J9DA 4OMOA 2DMOA 1GCPA 3NMZC 4X1VA 4AG2C 2FRWA 1OV3A 2J06A 1JU5C 2GTOA 2I0NA 4J9CA 2KEAA 4K11A 1Z9ZA 2MOXA 2OJ2A 4CC2A 2NUZA 1E7OA 2KE9A 2L0AA 2GQIA 4RTVA 2KYBA 1JXMA 2F2VA 3O5ZA 1AWXA 2K9GA 2A36A 1WYXA 2C0TA 2LJ3A 1GRIA 4M4ZA 4RTXA 2DNUA 2LJ0A 1X27A 3UA7A 4GLMA 3H0IA 2KGTA 4RUGA 1YWPA 3EHRA 4IIMA 4D8KA 2LCSA 1AZGB 4ESRA 2EGAA 1RLQC 1VYTA 5IXFA 2ED1A 2YSQA 2PZ1A 1H8KA 3H0HA 4OMMA 2J6KA 4KRTA 2RN8A 1LCKA 3H41A 1RI9A 1E6HA 2DILA 2JT4A 1PRMC 4HCKA 2DBKA 2JTEA 2C0IA 2CREA 1ZSGA 2RMOA 4J9EA 2J6FA 2DE0X 3PE0A 4RTYA 1WA7A 2AKKA 2KR3A 3CQTA 4Y92A 1PNJA 2F2XA 3RNJA 2LP5A 2RF0A 2K6DA 1NYGA 1QWFA 1UG1A 3U23A 2EGEA 4J9GA 5FWCA 1CKBA 1V1CA 1E6GA 2E5KA 1RLPC 1GFCA 1KSWA 1UJYA 1YWOA 2AZVA 1NEGA 5IHKA 2V1QA 3REBB 1BBZA 2EW3A 4QT7A 3UF4A 1U06A 1YCSB 2VWFA 2JW4A 4CC3A 1YN8A 2DL5A 1XOVA 4J9HA 1HSQA 1NG2A 2CDTA 2KXDA 2KRSA 4EIKA 1M3CA 2C0OA 4Z89A 2DL4A 4AFUC 2A37A 1HD3A 2W0ZA 1B3QA 1WFWA 1M3AA 4JPBW 2CH4A 5GJWB 3H0FA 1UFFA 4LN2A 1PKTA 2ROLA 3VRYA 2ECZA 2HEQA 4JJDA 4LUEA 2DRMA 2YUPA 2QDLA 4JJBA 2JXBA 2MIOA 3QWXX 1G2BA 4J9IA 4RTWA 3LH5A 2FEIA 1OEBA 1T0HA 3VS0A 4LNPA 2DL3A 2J7IA 2EYWA 3RBBB 4Z88A 1YP5A 3I5SA 1W6XA 2EVRA 1W70A 3TVTA 4JJCA 2DVJA 5L23A 2BTTA 2LX7A 3VS4A 1MV0B 2PTKA 3GBQA 2HSPA 5FW9A 1KIKA 2RQRA 4R0KA 2AKLA 1I0CA 4RTUA 2SEMA 4E6RA 1UJ0A 1WXUA 1W1FA 1WI7A 4HVUA 2KBTA 2A08A 1MUZA 1OPLA 1RUWA 4CC7A 1NLOC 1BB9A 3VS3A 2CUBA 1GCQA 1X69A 5HCKA 1KFZA 1KJWA 2KROA 4HVVA 4OMLA 1GCQC 2GBQA 2GTJA 2F2WA 3PVQA 1GL5A 1PKSA 5I22A 1UHCA 2HCKA 1NEBA 3I9QA 2EYXA 2LQNA 2FO0A 2G6FX 2CT3A 2DYBA 3M0QA 2FPFA 1Y57A 2CUDA 2RNAA 3UATA 4ZNXA 1Y0MA 1M3BA 1QCFA 2YUOA 4OMNA 3M0PA 1OOTA 1NM7A 3NGPA 2KXCA 1T0JA 1SRLA 1JXOA 1WXBA 2YT6A 1PHTA 1MV3A 1UDLA 2AZSA 2RQVA 2J05A 2DA9A 3VS2A 4AFQC 3THKA 2YDLA 1X2KA 1GBQA 2ED0A 2L2PA 3EG1A 3NPFA 1I1JA 4Z8AA 1UTIA 3TSZA 3PVLA 1X6GA 1UGVA 5IHIA 1ZLMA 2ENMA 1AD5A 3M0UA 1UUEA 2L3QA 1PWTA 2DX1A 2RPNA 1X2QA 1SRMA 1M30A 4DEYA 2M0YA 2O9VA 2JS0A 3ULRB 2EBPA 1PRLC 4LE9A 1AWWA 1K4US 4RTTA 4A63B 5ECAA 2DF6A 1BU1A 2IIMA 4DEXA 2CH4W 4F16A 3REAB 2GNCA 4AFZC 3UA6A 1VYUA 2LJ1A 2DL7A 4ORZA 1QKXA 2KRMA 2K3BA 2K79A 3M0SA 1NYFA 2H8HA 2O2OA 1QWEA 2FPEA 2PNIA 3JV3A 2CSQA 1OPKA 2D8JA 2JMAA 3EG3A 2VKNA 1HJDA 1WDXA 5GJVB 1K0SA 3I5RA 5IXBA 4F17A 1SPKA 1UE9A 2CT4A 3C0CA 4OMPA 3EGUA 1AOJA 1J3TA 1VYVA 3FJ5A 1BK2A 1SHFA 1U5SA 2EQIA 1JO8A 1S1NA 2YUQA 1YNZA 1SEMA 2L3SA 4CC4B 1X6BA 4HXJA 2ROTA 2KRNA 1EFNA 2EYYA 3EG2A 1A0NB 2KT1A 1AWJA 2DL8A 1GFDA 1NLPC 2CSIA 2LMJA 1ABQA 2AK5A 2KYMA 3NHNA 1ZUUA 1ARKA 1QKWA 2LNHB
chains in the Genus database with same CATH superfamily
3QYGB 4M7DC 3SFMA 2MMPA 2JTFA 2ABLA 4PFPA 1WJSA 1VA7A 4X9CA 1K9AA 2KNBB 2COYA 2Z0WA 3URGA 1UB4A 2MYSA 5CK9A 1OX8A 2YUNA 2HKNA 4EMGA 1VQ4T 3G4ST 1BI2A 1UHFA 3IQLA 3V7SA 2BZ8A 4Z02A 1W2BA 2L3RA 1IREB 2KVQG 2EQMA 3L2ZA 5IH2A 5HKCA 2OTJA 4A4FA 3JCMJ 2DD5A 4FYXB 4BDZA 2DERA 1S72T 1BI1A 4M75C 1QMCA 2QI2A 3SWNC 3MEUA 1M27C 3E9FA 4OGCA 1H92A 3CBOA 4FIBA 1WGSA 1M8MA 1T3SA 2K7AA 2DXTA 2B86A 2DJZA 3QDFA 4DA4A 5GAN3 3FC3A 3VS7A 1JRIA 3MJXA 3QWYA 3M0TA 1Q86R 1KHCA 4JRIA 2KAFA 2RHZA 1WXTA 1YI2T 3CCMA 4FYWB 4NS5A 3CCEA 3EFSA 4PJNA 1N5ZA 4JZ4A 4LDYA 4A4EA 2L8DA 1PSEA 2RQWA 3CC2Q 3OYKA 5C0MA 3OYFA 2LZ6B 4OB0B 4F7UE 1U3OA 1G83A 1Q81C 1IB8A 3HRSA 6AT1B 2MAMA 4QQ6A 1WHMA 2MCNA 4RKUE 2EPDA 1ZX6A 4OGEA 2M0OA 4NOYA 2DVEA 3X24B 5DLOA 2E3HA 2BZXA 3CCST 4GY5A 1I07A 1TG0A 3JAME 3TQ7P 2VXFA 3MPUB 4B9XA 1VQ7Q 2QGGA 3SDZA 4ATOA 5EC7A 2CZ7B 1BIBA 4HCZA 4IUTA 1ZUKA 2P4RA 1FMVA 4LUDA 2O88A 3M4YA 4KUDK 4J9DA 2EQKA 1GCPA 4F7UB 4X1VA 3CC4T 4AG2C 1OV3A 1X75C 1U1TA 1M1KC 2MOXA 2RI5A 4ELZC 4E7ZA 1TXQA 1KQSA 1M9SA 3D7SB 1AWXA 2QTXA 2A36A 2LJ3A 1GRIA 3MP1A 2NUTB 4M4ZA 3JB9D 2XU8A 3EH2A 3OYHA 2DNUA 1RAGB 2COWA 2LJ0A 2AHJB 2M1HA 3RKXA 2KGTA 4DQ2A 1IGQA 1EIFA 3I55T 4X34A 3EHRA 5GAN6 3S3MA 1RLQC 1VYTA 2YSQA 4LDUA 2KI7A 4OMMA 2J6KA 2LQ8A 4L6V5 4C92F 1N9RA 2E70A 4E47A 2JZ2A 2LVMA 2BKDN 1Y96A 3HP9A 2DBKA 4MZTA 2JTEA 2RMOA 4C8QC 4C92G 1KK7A 4RTYA 1OYXA 1D0YA 3CQTA 1Q82C 4L59A 2F2XA 3RNJA 1BIAA 4M75E 3OYDA 3CCLA 1VQLA 3ME9A 4IKFA 1NE8A 1KC8U 5FWCA 3OYYA 3UPUA 1E6GA 4KT0E 1G5VA 1RAAB 3VYHB 2DIGA 1YWOA 2AZVA 5GMKj 2Y4YA 1VQPQ 4P5NA 1I8FA 2OTJT 5CAIA 2V1QA 2RD1A 4ZTFA 1BBZA 3CCVT 1XOVA 1HSQA 4PNOA 3OYIA 3CPWA 3G6EA 2KXDA 2C0OA 5LL6S 3QHSA 3VUZA 2A37A 3EGDA 2W0ZA 3GP8A 1C6VX 1N9SA 3AT1B 1Q95G 2XDPA 3H0FA 2NLUA 2PQWA 1YIJQ 4LUEA 2XIDA 2YUPA 4JJBA 2MIOA 2CP5A 3QWXX 4JJNK 2DXUA 1C1AA 3N5BB 4N0AA 1W2BP 1OEBA 3VS0A 3CCET 5HK3A 2EYWA 3HRUA 3VV0A 3RBBB 4Z88A 4DBQA 4QVZA 1W70A 4JJCA 2VGMA 5L23A 1WHJA 2BTTA 2LX7A 3VS4A 4PJMA 1VIFA 4JRKA 2EKOA 4R0KA 3MO8A 8ATCB 1I0CA 2DIQA 2E3IA 3H8ZA 4E6RA 1UJ0A 1WI7A 4HVUA 1PD0A 5I2SA 4IUPA 5LJ3g 3QO3A 1M1KR 4M78A 4J83A 3EAEA 1KFZA 1C0MA 2KROA 1KC8R 4QQDA 4ZGDB 2GTJA 1UHCA 2FZGB 5GAMg 1VIEA 1ZSZA 4KGXB 2X4WA 1VQNA 4EMKA 2G6FX 3MP6A 2CT3A 2DYBA 2EJ9A 3M0QA 1Y57A 3UATA 4KGVB 5GMKe 3NTHA 1UEBA 1Y0MA 4OMNA 2YUOA 1BYMA 2FVUA 1YJNT 1QVFA 2MWOA 2M16A 2QEXA 3RMQA 4CRIA 3NGPA 1XJWB 1YJ9Q 2E64A 2VUBA 1SRLA 4PFZA 3EG9A 3HRTA 1PHTA 1MV3A 3E2UA 3CCQA 2AZSA 2YDLA 4FT4A 3ZBDA 1X2KA 4E7KA 2RM4A 2QQSA 1W4SA 3EG1A 2Y4XA 3NPFA 3WVEB 3JB9H 5LJ3j 2CP0A 1UTIA 1ZA1B 3M53A 3TSZA 3G71Q 1X6GA 2P0QA 1UGVA 5IHIA 1AHJB 3M0UA 3QYHB 1OZ3A 2QK0A 4C8QE 1Q7YC 1NPRA 1N8RR 2M0YA 1QP2A 2E41A 2EBPA 3P8DA 2RJDA 3HPWA 1D1BA 1TS9A 4BE1A 4RTTA 3NFCA 2OTLT 2DF6A 2FB7A 2X51A 1QQJA 2YXYA 4DOVA 2CH4W 1B7TA 2GNCA 4AFZC 2COZA 2K5IA 3CMAQ 2KRMA 2HL3A 2K79A 5HY6A 1M5Q1 4B6MA 1KQ2A 1KQSP 1ZA2B 2DZ9A 3JV3A 4C8QD 3RERA 2JMAA 1VQKQ 3CCLT 3ZFJA 1VQLT 3I5RA 1K0SA 2KY9A 1UE9A 3JCMg 1KD1R 3EGUA 4KUIA 4LD9K 2ZPBB 1U5SA 1S1NA 1YNZA 2H3EB 3CCUQ 3JCMb 2QQ9A 1M90U 1Y07A 3A1PA 1EFNA 1JJ2A 5CR2A 1A0NB 1IHWA 1B34A 1AWJA 2DL8A 2CSIA 2LMJA 3J81E 1VQ8A 1TOVA 2DEUA 2AK5A 3LWHA 1JBMA 3G6ET 1ARKA 1G3TA 2F5KA 2LNHB 3X25B 1K73C 2JMCA 3E19A 1DJ7B 3HSBA 1X01A 1M1FA 2LDMA 5J39A 1G8XA 2PUKB 5LJ3e 1FWZA 2W10A 5GAOl 3QG1A 2EGCA 2DTHA 4C5EA 2CS7A 4JZ3A 5GAN2 3CCJA 5CKBA 2AIRB 3QBYA 2PVDB 3C95A 4OB1B 4WCIA 2D8HA 2DRKA 2MI6A 1AVZC 2F5TX 2RJEA 4C92D 3CD6A 1FMWA 2X4YA 1K9MC 3PIOA 2MWPA 2LQWA 4HVWA 2F69A 3UWNA 3CPWP 1TU0B 3S3OA 5KCHA 3OBWA 4C92B 4MDXA 4C5IA 1YITA 2MPXC 2XMFA 3CXCA 1TTHB 4NL2A 2V1RA 3CPWS 2NYSA 3X26B 4A4HA 1RI0A 3GOXA 5KYUB 2K57A 2O4XA 3SB2A 5GMKi 4XU1A 3RESA 3GLXA 4DOWA 4WF2A 3OYEA 1RABB 2DBMA 1VQ4Q 1FYNA 3G4SQ 3EFOB 1JEGA 4HA8A 1VQNT 4PJOA 1O75A 1WX6A 4GBQA 2D0NA 1IO6A 1SSHA 3OW2P 2LCCA 2WSCE 4LDWA 4DBRA 2L89A 3P8BB 2HSEB 2JS2A 3M55A 3OS1A 1S72Q 1K76A 2M51A 3QJYA 3CCQT 1UECA 2OI3A 1GBRA 3VS6A 2GGRA 3OW2S 4M78G 4XQ3A 1CSKA 2RJFA 1Q86U 3BE3A 4M77A 1NJIC 2EKHA 2QAZA 5GAOq 2JOYA 4FU6A 1X43A 4MMLA 2DZCA 2X3XD 3ZEHA 1AZEA 2ESWA 1K8AC 2B8AA 3CBPA 3EHQA 3CC2A 1YI2Q 2P0KA 2VGNA 3JCMP 4OMQA 3NMZC 2RHUA 4FYVB 1RAHB 2JUFA 5KE3A 1IGUA 1JU5C 2J06A 3EGXA 3J80E 5KYXB 2P4TA 3HKSA 2D0QB 2NUZA 2GQIA 4RTVA 2KYBA 2OX7A 2K9GA 2C0TA 2FL7A 3PFSA 1X27A 1PD1A 4GLMA 2DYIA 1G3SA 2HMAA 3CCSQ 4RUGA 2E5QA 5FRNA 2L5QA 4IIMA 4M78C 4XTXA 4D8KA 2LCSA 4M7AA 3CCVA 4OVAA 2M02A 4ESRA 2EGAA 1VQ9A 2YRDA 2ED1A 1H8KA 1OZ2A 5GANj 3INZA 1YJWA 2CZ0B 2CZ6B 3PMIA 1VQ8T 1RI9A 4A4GA 4C0GA 3M54A 1PRMC 4HCKA 3MKDA 3CC4Q 2JVVA 3KUFA 2CREA 4R56A 4OB3B 1G3YA 4MZMA 1XQHA 3PE0A 1QVPA 4C0FA 1WA7A 2RB6A 4QQGA 2KR3A 3DKMA 4BI8B 1PNJA 3NTKA 4HT8A 1VQ5A 4FW2A 2LP5A 1SG5A 3OYAA 2R58A 1UG1A 4J9GA 2FZCB 1RLPC 3CCJT 1V29B 1KSWA 2XI9A 1ZQ1A 1NEGA 5IHKA 1SSFA 4QT7A 5LJ5g 5CKHA 4C0ZA 2VWFA 2JW4A 3OA6A 1JJ2P 3CD6T 3E1SA 4QVCA 2CDTA 4HT9A 2DEQA 4EIKA 4AFUC 1SF9A 1HD3A 5GAN7 1WQWA 2E4HA 1B3QA 3O8VA 1YITT 1M3AA 5GAOr 3PT9A 1D0XA 4LXCA 4LN2A 2ZAEA 2QQAA 1PKTA 4RCCA 2DK3A 2ECZA 5A2QE 3VYGA 2DRMA 2YHTA 3M9QA 1MNDA 2JXBA 1BI0A 2FEIA 1T0HA 1FXXA 1PG5B 2DL3A 3FB9A 4F04B 2XDDA 5CCAA 1YJNA 1YP5A 5IN1A 3CC7A 2D6FA 1VQPA 2XICA 3M5AA 1MMGA 5GANe 5LJ5j 1MV0B 2OTJQ 1Y71A 3X28B 3AHUA 5GAOm 3GBQA 1IHVA 4Q5WA 2M9UA 3UT1A 4KULA 4XAXB 2RQRA 2AKLA 3WVDB 4PJOF 4RTUA 5KYNA 1Y7XA 1TH7A 1W1FA 4N4HA 5A0LA 2Y90A 1RL2A 1QVGA 3MEVA 3QZ5B 3CMEA 1G3WA 1KHIA 1MUZA 3CXCP 1RUWA 4RCBA 4CC7A 4PJOG 2CUBA 1YIJA 1X69A 3QXEB 1GCQC 2GBQA 4AT1B 3JCMW 1GL5A 4E2FB 2EAYA 2OTLA 2K5LA 3CC2T 4JDSA 3CCMQ 1XTDA 2CUDA 4M77F 3CCEQ 1MMAA 4ZNXA 3EGDB 1QCFA 1N6AA 3M56A 3F70A 1WZOA 1RADB 3TEEA 4PL6A 3QSUA 2RHXA 4M77G 2YT6A 2HL5C 2V26A 1MMDA 2JTMA 4XU3A 4M78E 2DA9A 2YRCA 3VS2A 4AFQC 3THKA 1M1KU 1R77A 1GBQA 2BE7D 2ED0A 1WHGA 1I1JA 4Z8AA 3PTAA 2PVOB 1EZZB 1VQ7T 3C4SA 1UUEA 4YTLA 4C0DB 2QA4A 2RPNA 1VQ9T 4Y28E 1M1GA 4LE9A 1AWWA 1LNXA 4M78D 1YJWT 3QKJA 5D6YA 2LCLA 2EJFA 4DEXA 5LJ5e 3FIFA 1Q81R 4M78B 4IUVA 5KH6A 4M7AF 2R5MA 1YBYA 1NYFA 2H8HA 5FRMA 2FPEA 2PNIA 3LH0A 1OPKA 2D8JA 1HJDA 3EG3A 1ZSZB 1VQ5T 5CKFA 4J6WA 4EMKB 4M7AG 1SPKA 1Q82U 3C0CA 3LLRA 4J7IA 4C92C 1VYVA 3FJ5A 1SHFA 4XU0A 1N8RU 4M77C 2RK1A 1JO8A 1SEMA 5CQYA 4CC4B 1EX4A 2KMTA 5I21A 2K3YA 1W2BS 2EYYA 3EG9B 1X6OA 1P92A 4J8OA 4OP0A 1ABQA 4J7FA 1ZUUA 3H6ZA 4M7DA 3TREA 2O9SA 3V8KA 2VVKA 3LGLA 3L2VA 5EG2A 3X20B 1KD1U 2NUPA 1K1ZA 3I35A 3C94A 3L2QA 4J9FA 4JRQA 1WQ7A 3OYLA 1HYOA 2J6OA 3CCLQ 1VQLQ 2JM9A 1MHNA 2LC4A 5CVIA 4ZTJA 2PUOB 4AFSC 2QASA 3GIBA 3KFVA 1BKBA 2ATCB 3QJ6A 1VQPT 3CC7T 4FW1A 4O6JA 3SHWA 4M75A 1QCNA 3SWNA 3L2UA 4FL6A 3BFMA 2YWWA 5CO7A 2A28A 3OSSC 2ZCFB 1D1CA 1UGQB 1B07A 2G3RA 2WSEE 2QQBA 4F14A 2DPPB 1AWOA 4EDUA 3CMET 5FWBA 1YIJT 2DLPA 1FMKA 3FEOA 1Q82R 4IUQA 5GAMj 1H641 3SEMA 3CCRA 1WLPB 5KCOA 2C06A 1B34B 3HHTB 3M59A 5GANd 1YFNA 2CP3A 1U8RA 1M90C 1D0ZA 3H9NA 4BB7A 1WIEA 1QLYA 3MP8A 1YHQA 4XTVA 3FLGA 1PC0A 2DFUA 2QDYB 4E7IA 1OU8A 2DJQA 1ACMB 1CKAA 3TSWA 3VKIA 2KT8A 2DTOA 3OMGA 1H3HA 1TUCA 3VUBA 1QVGP 1KQSS 2BZYA 3M0RA 3LWIA 2FYKA 1JQQA 3I56A 4BE0A 2QA4T 1K0XA 2GCXA 3EG0A 3OYBA 2NWMA 5GANh 2CZ1B 1VQNQ 4OMOA 2DMOA 3JCMQ 4HCCA 5AT1B 4ANJA 2GTOA 1H3ZA 4J9CA 4ZGJB 3V7CA 4BE2A 2KEAA 4C92E 4K11A 2QEXQ 4M77E 4PJOD 2OJ2A 2A3LA 4RG2A 2KE9A 2KSSA 3EH1A 1JXMA 1VQ6A 4MDWA 1V76A 3KBGA 1KQ1A 3O5ZA 1AT1B 3A5ZB 1LVKA 1WYXA 3HL8A 4II1A 2RK2A 9ATCB 4KBMB 4RTXA 4PJOB 3DB4A 5I2MA 3UA7A 2EFIA 2KK4A 3GNFB 1D09B 5GAMe 2H3JA 2KQWA 2RHYA 1VQMA 1FX7A 2EQJA 1PSFA 4J6XA 2BUDA 4M77D 2PZ1A 1ZBXA 2PVGB 2RI3A 4KRTA 2RN8A 1LCKA 3JCMc 4D6WA 1QCOA 2DILA 1VQOQ 5GANf 2JT4A 4M77B 4C8QA 4JUVA 1ZSGA 5DLQE 2FHDA 2J6FA 2DE0X 4X9DA 3BDUA 2AKKA 1K73U 2I2LA 4HCBA 4Y92A 3OYNA 2FZKB 2RJCA 1VQKT 2RF0A 2K6DA 4M7DF 1NYGA 1QWFA 2EGEA 2LQKA 1CKBA 1V1CA 1HXDA 1UJYA 2DD4A 2ZPIB 4M7DG 4N4GA 3QZ9B 3REBB 3WXMB 1Q7YR 5FU7C 5LJ5h 4CC3A 1YN8A 2V8JA 2BE9B 4J9HA 1I5OB 4Z89A 3JB9J 1VQ8Q 2DL4A 4M7AD 1K9MU 2O01E 1WFWA 5AYFA 2CH4A 4M75F 3V8LA 2MK5A 2HAXA 3CBMA 2ROLA 4QKUA 2HEQA 3JCMe 1M4ZA 4M7AB 3JCMX 4BI4A 3FDRA 2QDLA 4BI3A 2V8KA 3CCRT 4M75G 3LGFA 2DKGA 1U1SA 4N0AC 3LX7A 5KYYA 2IVWA 3C12A 3I5SA 1W6XA 3QIIA 3CCJQ 3TVTA 1YHQT 1QVFP 2KDSA 2OAUA 5A0GA 1M2VA 3ASKA 2DETA 3G7ZA 1PCXA 4C0DC 3HFNA 2ZZDA 5FW9A 2HSPA 5CQXA 3RKWA 4WTOB 3MCAB 4ZN3A 5LJ5f 3L1AA 5KYWA 3CD6Q 1QVFS 2CKKA 1WXUA 2P84A 4XK8E 1K73R 5GAN8 1XNIA 2KBTA 2A08A 3SD4A 1BCOA 1VQ7A 1YITQ 2CP2A 1BB9A 2RHIA 1RAFB 3DLLA 2P0PA 4HVVA 4OMLA 1NJIU 2RO0A 5GMKh 3I56T 1M8VA 3Q1JA 5I22A 2HCKA 1OX9A 3RIRA 1NEBA 3I9QA 2EYXA 2LQNA 1ZSZC 2FPFA 3MHXA 4EMKC 4R55A 1K8AU 3VJPA 3MEWA 4J5YA 2CGHA 3M0PA 1OOTA 1NM7A 1I81A 2E6NA 1T0JA 2LT1A 2XHCA 1WXBA 1VOMA 1UDLA 1K9MR 1D3BA 3RDVA 4A53A 2RQVA 2J05A 3RKYA 4BY6C 1VQ6T 2HZYA 5D6XA 5FROA 5DM7R 4FM4B 1NBEB 5KYXA 5FU6C 1ZLMA 2GQVA 1UGPB 4EPCA 2DX1A 3I55Q 1VQMT 4C5GA 1SRMA 1M30A 2DAQA 2LRQA 4DEYA 5GAN4 2QTVA 1I4K1 2ZPFB 1PRLC 4EMHA 1K4US 1IZ6A 4A63B 5ECAA 1BU1A 1MNEA 4F16A 1TSFA 3REAB 4JLIA 5LJ3d 1JJ2S 1WJRA 4RG8A 1VYUA 3KXTA 2LJ1A 2K2VA 4ORZA 1QKXA 2LX9A 4O5VA 3QDRB 3OYMA 4QVDA 1QWEA 5GAMd 2CSQA 5GJVB 5IXBA 2CT4A 2DO3A 5CKEA 1AOJA 1NJIR 1J3TA 1UGRB 4C8QF 5A0DA 1Y96B 2EQIA 3JB9I 1D1AA 2ZPGB 1QW1A 4E7HA 1X6BA 2K4YA 4HXJA 2ROTA 1K8AR 2VV5A 3EG2A 4C8QG 3LYIA 3CCVQ 3S6WA 2X4JA 1VQ9Q 4BDYA 2RI2A 1Q81U 2VXEA 1YJWQ 4FT2A 2IPOB 1QKWA 4NL3A 4D8DA 7AT1B 1WHLA 5LJ3h 3DLMA 2D1XA 2JM8A 2HDAA 3JRZA 1SHGA 1PM3A 3S3NA 4IURA 5FU7B 4A54A 1KC8C 4V2SA 4E7JA 2CYZB 5GAMh 5C6SA 3OQ5A 3CXCS 4IUUA 5J3BA 2VB6A 1VQ5Q 4JS4A 2DXCA 1UGSB 4XTYA 1WNLA 2YLCA 4ZN1A 1QP3A 2LT4A 2FG0A 4M7DE 1OU9A 3VS5A 3P8HA 2YLBA 2RQUA 4FSSA 3TCJA 1IXDA 1ZBJA 3PGGA 5FLXE 2EYQA 2EYZA 3VRZA 4F7UA 3JCMd 4UC4A 2HKQB 4L5GA 3RMSA 2QQRA 3GF5A 2ZPHB 2K2MA 5LJ3f 1ZUYA 3R6NA 3E9GA 4M7DD 1N8RC 2O31A 1M2OA 3JSCA 2GF7A 4IIOA 4PFOA 2NUTA 1AEYA 4AG1C 5GAMf 3OBYA 4M7DB 4PJOC 2DM1A 3V7RA 1BCMA 2RQTA 2OAWA 1YJ9A 1YJNQ 1T3LA 3CC7Q 2V8IA 3BY7A 4RTZA 3A98A 5IHNA 2R57A 5GMKl 2FRYA 1RAEB 2E12A 2NUPB 3ZL7C 2HQXA 2BIVA 1Z9QA 2EJGA 4OF1A 2VYTA 3OMCA 2L3PA 2HBWA 4TVRA 8AT1B 4M75D 5D6WA 1ABOA 3JCMh 3G71A 4BD3A 1KD1C 2X3WD 1BI3A 3VS1A 2D9TA 2VC8A 3CMEQ 2XG8D 3OSVA 4E7LA 4M75B 2K3XA 4LDXA 2SRCA 1TUGB 4JS5A 1TUDA 3SWNB 4J9BA 3G1JA 4BY6B 1R0BG 4FYYB 2FPDA 3CCMT 5I11A 3BW1A 2EIFA 2HQEA 2CP7A 2OTLQ 2FRWA 3OW2A 5FU6B 4DBHA 2I0NA 2QG9B 3CMAA 1JB0E 2IG0A 1Z9ZA 4CC2A 4OMFB 1E7OA 2L0AA 4KH1B 2F2VA 1VQKA 1LOJA 1YCYA 2ZPEB 2AT1B 3CCUA 2RA2A 3H0IA 3JCMf 5HK0A 1YWPA 2E6ZA 4HKEA 1WHHA 4XU2A 1AZGB 3A8LB 4PLIA 4MMKA 4PKCC 5IXFA 2QA4Q 4M7AC 3H0HA 5KE2A 5GAOp 3OY9A 3QUIA 5J26A 1I5LA 1ZHIA 3H41A 3M4GA 1E6HA 2XK0A 4AMCA 3CPFA 3G6EQ 1OULA 4GLKA 1WHKA 2C0IA 4C5HA 3HFOA 2QYZA 4J9EA 3A8MB 2HQHA 4LD6A 3VU3C 2E65A 4J6YA 2LNVA 3OS5A 2F1LA 2DXBA 2QXFA 4BACA 2R5AA 3U23A 4XTUA 3M57A 4KH0B 1TWBA 3V8JA 3UDCA 2E5KA 4PLLA 2JNGA 2WACA 1GFCA 3L42A 4XTZA 1KG1A 5IAYA 2EW3A 4A4KA 3META 3UF4A 2LTOA 1U06A 1YCSB 4Y91A 2DL5A 3GPLA 1VQOA 1NG2A 3PIPA 2KRSA 1M3CA 1IRXA 4FCYA 4PJJA 3MEAA 3JCMV 1LPLA 4JPBW 4JRPA 4PJOE 1R8OB 3L2WA 5GJWB 2X4XA 1UFFA 3M58A 4VUBA 2MF2A 1O9SA 4ZGEB 3VRYA 2XKOC 1HK9A 4JJDA 3FJPA 3GNGA 4E7SA 3TU4K 4LDVA 1VQ4A 3G4SA 1QVGS 4DBFA 1G2BA 2HD0A 4J9IA 1RACB 4RTWA 4F7UF 3LH5A 3DB3A 5GAN5 4LNPA 2A7YA 1Q7YU 2J7IA 2WSFE 2RH2A 2EVRA 4C8QB 2DVJA 1YJ9T 4F7UG 1S72A 3QPHA 4FSXA 4KGZB 3A8OB 2PTKA 1KIKA 2O4XB 3CCQQ 2X9HA 1LJOA 2SEMA 1OQKA 3FRNA 5L8RE 4QW2A 4XTWA 3LW5E 3G71T 1OPLA 1NLOC 3VS3A 3JB9F 1NZ9A 1GCQA 5HCKA 1MGQA 1KJWA 2F2WA 5LJ5d 3A8GB 3PVQA 1R0CB 1PKSA 1VUBA 1YI2A 3JB9G 3CCRQ 2GFAA 2FO0A 4RMOA 3RR6A 1MMNA 4CI0C 2RNAA 3CEYA 5CKDA 1M3BA 3R6OA 2E1HA 3EFRA 1YHQQ 1NPPA 2KXCA 3CMAT 3OYJA 3ER0A 4PK4A 2XD0A 1JXOA 1WJQA 1OI1A 1F1BB 5D7UA 1Q86C 2PU9B 3OYCA 1WPYA 2EQUA 4M7AE 2DTIA 2L2PA 2VASA 2JN0A 4ELYC 3A8HB 3CCSA 5KYYB 3PVLA 3CCUT 2EWNA 2JJ9A 2ENMA 3EGXB 1AD5A 5DY9A 2L3QA 1PWTA 5GMKm 1M2VB 2K5FA 3NTIA 3OS0A 4PJLA 1N27A 5M9OA 5GAOn 3OS2A 1X2QA 3I56Q 1GXIE 2O9VA 2JS0A 3ULRB 4JLGA 3T9NA 5KYWB 2ZGWA 2QGFB 1M90R 2X35A 3CC4A 3PNWC 3HTRA 2IIMA 4OB2B 4M78F 3UA6A 2QEXT 2E10A 2DL7A 5CIUA 2K3BA 3BDLA 3M0SA 1RAIB 2O2OA 2HBPA 2XDBA 2HNIA 1VQ6Q 2VKNA 1WDXA 2A0FB 4C92A 4F17A 4MZPA 4OMPA 3RUXA 3OB9A 1BK2A 3OYGA 4N4IA 2YUQA 3L2RA 3I55A 4B9WA 2L3SA 5IT9E 4ME7A 3J7AF 5KYUA 1VQMQ 2KRNA 1D3BB 2GFUA 2KT1A 2YRVA 3EFOA 1GFDA 1NLPC 3PMTA 1SKUB 5GANg 2KYMA 3NHNA 4BUGA 1VQOT 2CP6A
chains in the Genus database with same CATH topology
4D8DA 2O9SA 2ABLA 2JMCA 1VA7A 2VVKA 2D1XA 2JM8A 2HDAA 1SHGA 1K9AA 2KNBB 1K1ZA 2YUNA 3I35A 1UHFA 3IQLA 4J9FA 2W10A 2BZ8A 2EGCA 2J6OA 2JM9A 4JZ3A 4AFSC 4WCIA 3KFVA 2D8HA 2FG0A 2DRKA 5IH2A 1AVZC 3SHWA 3VS5A 1M27C 2RQUA 4FSSA 4HVWA 2LQWA 1ZBJA 2A28A 2EYZA 3VRZA 1B07A 1H92A 1M8MA 1T3SA 4F14A 2XMFA 1AWOA 2K7AA 2B86A 5FWBA 2V1RA 3VS7A 2K2MA 1ZUYA 3R6NA 2DLPA 1FMKA 3QWYA 3M0TA 3SEMA 1WLPB 2DBMA 2O31A 1FYNA 1WXTA 4IIOA 1JEGA 1AEYA 4AG1C 1N5ZA 4JZ4A 2RQWA 1WX6A 4GBQA 2DM1A 1WIEA 2LZ6B 1QLYA 2D0NA 1IO6A 1SSHA 2RQTA 2OAWA 1U3OA 1T3LA 1G83A 2JS2A 4RTZA 3A98A 5IHNA 2FRYA 1K76A 2M51A 2MCNA 3ZL7C 2EPDA 1Z9QA 1UECA 1ZX6A 2OI3A 1GBRA 3VS6A 2GGRA 2DJQA 2L3PA 2HBWA 1CKAA 1CSKA 3TSWA 2KT8A 1ABOA 1H3HA 1TUCA 2X3WD 2BZXA 2EKHA 1I07A 1TG0A 3VS1A 2BZYA 3M0RA 1JQQA 1X43A 2SRCA 2X3XD 1TUDA 4J9BA 1AZEA 2ESWA 1K0XA 5EC7A 3EG0A 1ZUKA 2NWMA 3EHQA 2P4RA 2FPDA 4LUDA 5I11A 4OMQA 2O88A 4J9DA 4OMOA 2DMOA 1GCPA 3NMZC 4X1VA 4AG2C 2FRWA 1OV3A 2J06A 1JU5C 2GTOA 2I0NA 4J9CA 2KEAA 4K11A 1Z9ZA 2MOXA 2OJ2A 4CC2A 2NUZA 1E7OA 2KE9A 2L0AA 2GQIA 4RTVA 2KYBA 1JXMA 2F2VA 3O5ZA 1AWXA 2K9GA 2A36A 1WYXA 2C0TA 2LJ3A 1GRIA 4M4ZA 4RTXA 2DNUA 2LJ0A 1X27A 3UA7A 4GLMA 3H0IA 2KGTA 4RUGA 1YWPA 3EHRA 4IIMA 4D8KA 2LCSA 1AZGB 4ESRA 2EGAA 1RLQC 1VYTA 5IXFA 2ED1A 2YSQA 2PZ1A 1H8KA 3H0HA 4OMMA 2J6KA 4KRTA 2RN8A 1LCKA 3H41A 1RI9A 1E6HA 2DILA 2JT4A 1PRMC 4HCKA 2DBKA 2JTEA 2C0IA 2CREA 1ZSGA 2RMOA 4J9EA 2J6FA 2DE0X 3PE0A 4RTYA 1WA7A 2AKKA 2KR3A 3CQTA 4Y92A 1PNJA 2F2XA 3RNJA 2LP5A 2RF0A 2K6DA 1NYGA 1QWFA 1UG1A 3U23A 2EGEA 4J9GA 5FWCA 1CKBA 1V1CA 1E6GA 2E5KA 1RLPC 1GFCA 1KSWA 1UJYA 1YWOA 2AZVA 1NEGA 5IHKA 2V1QA 3REBB 1BBZA 2EW3A 4QT7A 3UF4A 1U06A 1YCSB 2VWFA 2JW4A 4CC3A 1YN8A 2DL5A 1XOVA 4J9HA 1HSQA 1NG2A 2CDTA 2KXDA 2KRSA 4EIKA 1M3CA 2C0OA 4Z89A 2DL4A 4AFUC 2A37A 1HD3A 2W0ZA 1B3QA 1WFWA 1M3AA 4JPBW 2CH4A 5GJWB 3H0FA 1UFFA 4LN2A 1PKTA 2ROLA 3VRYA 2ECZA 2HEQA 4JJDA 4LUEA 2DRMA 2YUPA 2QDLA 4JJBA 2JXBA 2MIOA 3QWXX 1G2BA 4J9IA 4RTWA 3LH5A 2FEIA 1OEBA 1T0HA 3VS0A 4LNPA 2DL3A 2J7IA 2EYWA 3RBBB 4Z88A 1YP5A 3I5SA 1W6XA 2EVRA 1W70A 3TVTA 4JJCA 2DVJA 5L23A 2BTTA 2LX7A 3VS4A 1MV0B 2PTKA 3GBQA 2HSPA 5FW9A 1KIKA 2RQRA 4R0KA 2AKLA 1I0CA 4RTUA 2SEMA 4E6RA 1UJ0A 1WXUA 1W1FA 1WI7A 4HVUA 2KBTA 2A08A 1MUZA 1OPLA 1RUWA 4CC7A 1NLOC 1BB9A 3VS3A 2CUBA 1GCQA 1X69A 5HCKA 1KFZA 1KJWA 2KROA 4HVVA 4OMLA 1GCQC 2GBQA 2GTJA 2F2WA 3PVQA 1GL5A 1PKSA 5I22A 1UHCA 2HCKA 1NEBA 3I9QA 2EYXA 2LQNA 2FO0A 2G6FX 2CT3A 2DYBA 3M0QA 2FPFA 1Y57A 2CUDA 2RNAA 3UATA 4ZNXA 1Y0MA 1M3BA 1QCFA 2YUOA 4OMNA 3M0PA 1OOTA 1NM7A 3NGPA 2KXCA 1T0JA 1SRLA 1JXOA 1WXBA 2YT6A 1PHTA 1MV3A 1UDLA 2AZSA 2RQVA 2J05A 2DA9A 3VS2A 4AFQC 3THKA 2YDLA 1X2KA 1GBQA 2ED0A 2L2PA 3EG1A 3NPFA 1I1JA 4Z8AA 1UTIA 3TSZA 3PVLA 1X6GA 1UGVA 5IHIA 1ZLMA 2ENMA 1AD5A 3M0UA 1UUEA 2L3QA 1PWTA 2DX1A 2RPNA 1X2QA 1SRMA 1M30A 4DEYA 2M0YA 2O9VA 2JS0A 3ULRB 2EBPA 1PRLC 4LE9A 1AWWA 1K4US 4RTTA 4A63B 5ECAA 2DF6A 1BU1A 2IIMA 4DEXA 2CH4W 4F16A 3REAB 2GNCA 4AFZC 3UA6A 1VYUA 2LJ1A 2DL7A 4ORZA 1QKXA 2KRMA 2K3BA 2K79A 3M0SA 1NYFA 2H8HA 2O2OA 1QWEA 2FPEA 2PNIA 3JV3A 2CSQA 1OPKA 2D8JA 2JMAA 3EG3A 2VKNA 1HJDA 1WDXA 5GJVB 1K0SA 3I5RA 5IXBA 4F17A 1SPKA 1UE9A 2CT4A 3C0CA 4OMPA 3EGUA 1AOJA 1J3TA 1VYVA 3FJ5A 1BK2A 1SHFA 1U5SA 2EQIA 1JO8A 1S1NA 2YUQA 1YNZA 1SEMA 2L3SA 4CC4B 1X6BA 4HXJA 2ROTA 2KRNA 1EFNA 2EYYA 3EG2A 1A0NB 2KT1A 1AWJA 2DL8A 1GFDA 1NLPC 2CSIA 2LMJA 1ABQA 2AK5A 2KYMA 3NHNA 1ZUUA 1ARKA 1QKWA 2LNHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8D A;  2O9S A;  2ABL A;  2JMC A;  1VA7 A;  2VVK A;  2D1X A;  2JM8 A;  2HDA A;  1SHG A;  1K9A A;  2KNB B;  1K1Z A;  2YUN A;  3I35 A;  1UHF A;  3IQL A;  4J9F A;  2W10 A;  2BZ8 A;  2EGC A;  2J6O A;  2JM9 A;  4JZ3 A;  4AFS C;  4WCI A;  3KFV A;  2D8H A;  2FG0 A;  2DRK A;  5IH2 A;  1AVZ C;  3SHW A;  3VS5 A;  1M27 C;  2RQU A;  4FSS A;  4HVW A;  2LQW A;  1ZBJ A;  2A28 A;  2EYZ A;  3VRZ A;  1B07 A;  1H92 A;  1M8M A;  1T3S A;  4F14 A;  2XMF A;  1AWO A;  2K7A A;  2B86 A;  5FWB A;  2V1R A;  3VS7 A;  2K2M A;  1ZUY A;  3R6N A;  2DLP A;  1FMK A;  3QWY A;  3M0T A;  3SEM A;  1WLP B;  2DBM A;  2O31 A;  1FYN A;  1WXT A;  4IIO A;  1JEG A;  1AEY A;  4AG1 C;  1N5Z A;  4JZ4 A;  2RQW A;  1WX6 A;  4GBQ A;  2DM1 A;  1WIE A;  2LZ6 B;  1QLY A;  2D0N A;  1IO6 A;  1SSH A;  2RQT A;  2OAW A;  1U3O A;  1T3L A;  1G83 A;  2JS2 A;  4RTZ A;  3A98 A;  5IHN A;  2FRY A;  1K76 A;  2M51 A;  2MCN A;  3ZL7 C;  2EPD A;  1Z9Q A;  1UEC A;  1ZX6 A;  2OI3 A;  1GBR A;  3VS6 A;  2GGR A;  2DJQ A;  2L3P A;  2HBW A;  1CKA A;  1CSK A;  3TSW A;  2KT8 A;  1ABO A;  1H3H A;  1TUC A;  2X3W D;  2BZX A;  2EKH A;  1I07 A;  1TG0 A;  3VS1 A;  2BZY A;  3M0R A;  1JQQ A;  1X43 A;  2SRC A;  2X3X D;  1TUD A;  4J9B A;  1AZE A;  2ESW A;  1K0X A;  5EC7 A;  3EG0 A;  1ZUK A;  2NWM A;  3EHQ A;  2P4R A;  2FPD A;  4LUD A;  5I11 A;  4OMQ A;  2O88 A;  4J9D A;  4OMO A;  2DMO A;  1GCP A;  3NMZ C;  4X1V A;  4AG2 C;  2FRW A;  1OV3 A;  2J06 A;  1JU5 C;  2GTO A;  2I0N A;  4J9C A;  2KEA A;  4K11 A;  1Z9Z A;  2MOX A;  2OJ2 A;  4CC2 A;  2NUZ A;  1E7O A;  2KE9 A;  2L0A A;  2GQI A;  4RTV A;  2KYB A;  1JXM A;  2F2V A;  3O5Z A;  1AWX A;  2K9G A;  2A36 A;  1WYX A;  2C0T A;  2LJ3 A;  1GRI A;  4M4Z A;  4RTX A;  2DNU A;  2LJ0 A;  1X27 A;  3UA7 A;  4GLM A;  3H0I A;  2KGT A;  4RUG A;  1YWP A;  3EHR A;  4IIM A;  4D8K A;  2LCS A;  1AZG B;  4ESR A;  2EGA A;  1RLQ C;  1VYT A;  5IXF A;  2ED1 A;  2YSQ A;  2PZ1 A;  1H8K A;  3H0H A;  4OMM A;  2J6K A;  4KRT A;  2RN8 A;  1LCK A;  3H41 A;  1RI9 A;  1E6H A;  2DIL A;  2JT4 A;  1PRM C;  4HCK A;  2DBK A;  2JTE A;  2C0I A;  2CRE A;  1ZSG A;  2RMO A;  4J9E A;  2J6F A;  2DE0 X;  3PE0 A;  4RTY A;  1WA7 A;  2AKK A;  2KR3 A;  3CQT A;  4Y92 A;  1PNJ A;  2F2X A;  3RNJ A;  2LP5 A;  2RF0 A;  2K6D A;  1NYG A;  1QWF A;  1UG1 A;  3U23 A;  2EGE A;  4J9G A;  5FWC A;  1CKB A;  1V1C A;  1E6G A;  2E5K A;  1RLP C;  1GFC A;  1KSW A;  1UJY A;  1YWO A;  2AZV A;  1NEG A;  5IHK A;  2V1Q A;  3REB B;  1BBZ A;  2EW3 A;  4QT7 A;  3UF4 A;  1U06 A;  1YCS B;  2VWF A;  2JW4 A;  4CC3 A;  1YN8 A;  2DL5 A;  1XOV A;  4J9H A;  1HSQ A;  1NG2 A;  2CDT A;  2KXD A;  2KRS A;  4EIK A;  1M3C A;  2C0O A;  4Z89 A;  2DL4 A;  4AFU C;  2A37 A;  1HD3 A;  2W0Z A;  1B3Q A;  1WFW A;  1M3A A;  4JPB W;  2CH4 A;  5GJW B;  3H0F A;  1UFF A;  4LN2 A;  1PKT A;  2ROL A;  3VRY A;  2ECZ A;  2HEQ A;  4JJD A;  4LUE A;  2DRM A;  2YUP A;  2QDL A;  4JJB A;  2JXB A;  2MIO A;  3QWX X;  1G2B A;  4J9I A;  4RTW A;  3LH5 A;  2FEI A;  1OEB A;  1T0H A;  3VS0 A;  4LNP A;  2DL3 A;  2J7I A;  2EYW A;  3RBB B;  4Z88 A;  1YP5 A;  3I5S A;  1W6X A;  2EVR A;  1W70 A;  3TVT A;  4JJC A;  2DVJ A;  5L23 A;  2BTT A;  2LX7 A;  3VS4 A;  1MV0 B;  2PTK A;  3GBQ A;  2HSP A;  5FW9 A;  1KIK A;  2RQR A;  4R0K A;  2AKL A;  1I0C A;  4RTU A;  2SEM A;  4E6R A;  1UJ0 A;  1WXU A;  1W1F A;  1WI7 A;  4HVU A;  2KBT A;  2A08 A;  1MUZ A;  1OPL A;  1RUW A;  4CC7 A;  1NLO C;  1BB9 A;  3VS3 A;  2CUB A;  1GCQ A;  1X69 A;  5HCK A;  1KFZ A;  1KJW A;  2KRO A;  4HVV A;  4OML A;  1GCQ C;  2GBQ A;  2GTJ A;  2F2W A;  3PVQ A;  1GL5 A;  1PKS A;  5I22 A;  1UHC A;  2HCK A;  1NEB A;  3I9Q A;  2EYX A;  2LQN A;  2FO0 A;  2G6F X;  2CT3 A;  2DYB A;  3M0Q A;  2FPF A;  1Y57 A;  2CUD A;  2RNA A;  3UAT A;  4ZNX A;  1Y0M A;  1M3B A;  1QCF A;  2YUO A;  4OMN A;  3M0P A;  1OOT A;  1NM7 A;  3NGP A;  2KXC A;  1T0J A;  1SRL A;  1JXO A;  1WXB A;  2YT6 A;  1PHT A;  1MV3 A;  1UDL A;  2AZS A;  2RQV A;  2J05 A;  2DA9 A;  3VS2 A;  4AFQ C;  3THK A;  2YDL A;  1X2K A;  1GBQ A;  2ED0 A;  2L2P A;  3EG1 A;  3NPF A;  1I1J A;  4Z8A A;  1UTI A;  3TSZ A;  3PVL A;  1X6G A;  1UGV A;  5IHI A;  1ZLM A;  2ENM A;  1AD5 A;  3M0U A;  1UUE A;  2L3Q A;  1PWT A;  2DX1 A;  2RPN A;  1X2Q A;  1SRM A;  1M30 A;  4DEY A;  2M0Y A;  2O9V A;  2JS0 A;  3ULR B;  2EBP A;  1PRL C;  4LE9 A;  1AWW A;  1K4U S;  4RTT A;  4A63 B;  5ECA A;  2DF6 A;  1BU1 A;  2IIM A;  4DEX A;  2CH4 W;  4F16 A;  3REA B;  2GNC A;  4AFZ C;  3UA6 A;  1VYU A;  2LJ1 A;  2DL7 A;  4ORZ A;  1QKX A;  2KRM A;  2K3B A;  2K79 A;  3M0S A;  1NYF A;  2H8H A;  2O2O A;  1QWE A;  2FPE A;  2PNI A;  3JV3 A;  2CSQ A;  1OPK A;  2D8J A;  2JMA A;  3EG3 A;  2VKN A;  1HJD A;  1WDX A;  5GJV B;  1K0S A;  3I5R A;  5IXB A;  4F17 A;  1SPK A;  1UE9 A;  2CT4 A;  3C0C A;  4OMP A;  3EGU A;  1AOJ A;  1J3T A;  1VYV A;  3FJ5 A;  1BK2 A;  1SHF A;  1U5S A;  2EQI A;  1JO8 A;  1S1N A;  2YUQ A;  1YNZ A;  1SEM A;  2L3S A;  4CC4 B;  1X6B A;  4HXJ A;  2ROT A;  2KRN A;  1EFN A;  2EYY A;  3EG2 A;  1A0N B;  2KT1 A;  1AWJ A;  2DL8 A;  1GFD A;  1NLP C;  2CSI A;  2LMJ A;  1ABQ A;  2AK5 A;  2KYM A;  3NHN A;  1ZUU A;  1ARK A;  1QKW A;  2LNH B; 
#chains in the Genus database with same CATH topology
 3QYG B;  4M7D C;  3SFM A;  2MMP A;  2JTF A;  2ABL A;  4PFP A;  1WJS A;  1VA7 A;  4X9C A;  1K9A A;  2KNB B;  2COY A;  2Z0W A;  3URG A;  1UB4 A;  2MYS A;  5CK9 A;  1OX8 A;  2YUN A;  2HKN A;  4EMG A;  1VQ4 T;  3G4S T;  1BI2 A;  1UHF A;  3IQL A;  3V7S A;  2BZ8 A;  4Z02 A;  1W2B A;  2L3R A;  1IRE B;  2KVQ G;  2EQM A;  3L2Z A;  5IH2 A;  5HKC A;  2OTJ A;  4A4F A;  3JCM J;  2DD5 A;  4FYX B;  4BDZ A;  2DER A;  1S72 T;  1BI1 A;  4M75 C;  1QMC A;  2QI2 A;  3SWN C;  3MEU A;  1M27 C;  3E9F A;  4OGC A;  1H92 A;  3CBO A;  4FIB A;  1WGS A;  1M8M A;  1T3S A;  2K7A A;  2DXT A;  2B86 A;  2DJZ A;  3QDF A;  4DA4 A;  5GAN 3;  3FC3 A;  3VS7 A;  1JRI A;  3MJX A;  3QWY A;  3M0T A;  1Q86 R;  1KHC A;  4JRI A;  2KAF A;  2RHZ A;  1WXT A;  1YI2 T;  3CCM A;  4FYW B;  4NS5 A;  3CCE A;  3EFS A;  4PJN A;  1N5Z A;  4JZ4 A;  4LDY A;  4A4E A;  2L8D A;  1PSE A;  2RQW A;  3CC2 Q;  3OYK A;  5C0M A;  3OYF A;  2LZ6 B;  4OB0 B;  4F7U E;  1U3O A;  1G83 A;  1Q81 C;  1IB8 A;  3HRS A;  6AT1 B;  2MAM A;  4QQ6 A;  1WHM A;  2MCN A;  4RKU E;  2EPD A;  1ZX6 A;  4OGE A;  2M0O A;  4NOY A;  2DVE A;  3X24 B;  5DLO A;  2E3H A;  2BZX A;  3CCS T;  4GY5 A;  1I07 A;  1TG0 A;  3JAM E;  3TQ7 P;  2VXF A;  3MPU B;  4B9X A;  1VQ7 Q;  2QGG A;  3SDZ A;  4ATO A;  5EC7 A;  2CZ7 B;  1BIB A;  4HCZ A;  4IUT A;  1ZUK A;  2P4R A;  1FMV A;  4LUD A;  2O88 A;  3M4Y A;  4KUD K;  4J9D A;  2EQK A;  1GCP A;  4F7U B;  4X1V A;  3CC4 T;  4AG2 C;  1OV3 A;  1X75 C;  1U1T A;  1M1K C;  2MOX A;  2RI5 A;  4ELZ C;  4E7Z A;  1TXQ A;  1KQS A;  1M9S A;  3D7S B;  1AWX A;  2QTX A;  2A36 A;  2LJ3 A;  1GRI A;  3MP1 A;  2NUT B;  4M4Z A;  3JB9 D;  2XU8 A;  3EH2 A;  3OYH A;  2DNU A;  1RAG B;  2COW A;  2LJ0 A;  2AHJ B;  2M1H A;  3RKX A;  2KGT A;  4DQ2 A;  1IGQ A;  1EIF A;  3I55 T;  4X34 A;  3EHR A;  5GAN 6;  3S3M A;  1RLQ C;  1VYT A;  2YSQ A;  4LDU A;  2KI7 A;  4OMM A;  2J6K A;  2LQ8 A;  4L6V 5;  4C92 F;  1N9R A;  2E70 A;  4E47 A;  2JZ2 A;  2LVM A;  2BKD N;  1Y96 A;  3HP9 A;  2DBK A;  4MZT A;  2JTE A;  2RMO A;  4C8Q C;  4C92 G;  1KK7 A;  4RTY A;  1OYX A;  1D0Y A;  3CQT A;  1Q82 C;  4L59 A;  2F2X A;  3RNJ A;  1BIA A;  4M75 E;  3OYD A;  3CCL A;  1VQL A;  3ME9 A;  4IKF A;  1NE8 A;  1KC8 U;  5FWC A;  3OYY A;  3UPU A;  1E6G A;  4KT0 E;  1G5V A;  1RAA B;  3VYH B;  2DIG A;  1YWO A;  2AZV A;  5GMK j;  2Y4Y A;  1VQP Q;  4P5N A;  1I8F A;  2OTJ T;  5CAI A;  2V1Q A;  2RD1 A;  4ZTF A;  1BBZ A;  3CCV T;  1XOV A;  1HSQ A;  4PNO A;  3OYI A;  3CPW A;  3G6E A;  2KXD A;  2C0O A;  5LL6 S;  3QHS A;  3VUZ A;  2A37 A;  3EGD A;  2W0Z A;  3GP8 A;  1C6V X;  1N9S A;  3AT1 B;  1Q95 G;  2XDP A;  3H0F A;  2NLU A;  2PQW A;  1YIJ Q;  4LUE A;  2XID A;  2YUP A;  4JJB A;  2MIO A;  2CP5 A;  3QWX X;  4JJN K;  2DXU A;  1C1A A;  3N5B B;  4N0A A;  1W2B P;  1OEB A;  3VS0 A;  3CCE T;  5HK3 A;  2EYW A;  3HRU A;  3VV0 A;  3RBB B;  4Z88 A;  4DBQ A;  4QVZ A;  1W70 A;  4JJC A;  2VGM A;  5L23 A;  1WHJ A;  2BTT A;  2LX7 A;  3VS4 A;  4PJM A;  1VIF A;  4JRK A;  2EKO A;  4R0K A;  3MO8 A;  8ATC B;  1I0C A;  2DIQ A;  2E3I A;  3H8Z A;  4E6R A;  1UJ0 A;  1WI7 A;  4HVU A;  1PD0 A;  5I2S A;  4IUP A;  5LJ3 g;  3QO3 A;  1M1K R;  4M78 A;  4J83 A;  3EAE A;  1KFZ A;  1C0M A;  2KRO A;  1KC8 R;  4QQD A;  4ZGD B;  2GTJ A;  1UHC A;  2FZG B;  5GAM g;  1VIE A;  1ZSZ A;  4KGX B;  2X4W A;  1VQN A;  4EMK A;  2G6F X;  3MP6 A;  2CT3 A;  2DYB A;  2EJ9 A;  3M0Q A;  1Y57 A;  3UAT A;  4KGV B;  5GMK e;  3NTH A;  1UEB A;  1Y0M A;  4OMN A;  2YUO A;  1BYM A;  2FVU A;  1YJN T;  1QVF A;  2MWO A;  2M16 A;  2QEX A;  3RMQ A;  4CRI A;  3NGP A;  1XJW B;  1YJ9 Q;  2E64 A;  2VUB A;  1SRL A;  4PFZ A;  3EG9 A;  3HRT A;  1PHT A;  1MV3 A;  3E2U A;  3CCQ A;  2AZS A;  2YDL A;  4FT4 A;  3ZBD A;  1X2K A;  4E7K A;  2RM4 A;  2QQS A;  1W4S A;  3EG1 A;  2Y4X A;  3NPF A;  3WVE B;  3JB9 H;  5LJ3 j;  2CP0 A;  1UTI A;  1ZA1 B;  3M53 A;  3TSZ A;  3G71 Q;  1X6G A;  2P0Q A;  1UGV A;  5IHI A;  1AHJ B;  3M0U A;  3QYH B;  1OZ3 A;  2QK0 A;  4C8Q E;  1Q7Y C;  1NPR A;  1N8R R;  2M0Y A;  1QP2 A;  2E41 A;  2EBP A;  3P8D A;  2RJD A;  3HPW A;  1D1B A;  1TS9 A;  4BE1 A;  4RTT A;  3NFC A;  2OTL T;  2DF6 A;  2FB7 A;  2X51 A;  1QQJ A;  2YXY A;  4DOV A;  2CH4 W;  1B7T A;  2GNC A;  4AFZ C;  2COZ A;  2K5I A;  3CMA Q;  2KRM A;  2HL3 A;  2K79 A;  5HY6 A;  1M5Q 1;  4B6M A;  1KQ2 A;  1KQS P;  1ZA2 B;  2DZ9 A;  3JV3 A;  4C8Q D;  3RER A;  2JMA A;  1VQK Q;  3CCL T;  3ZFJ A;  1VQL T;  3I5R A;  1K0S A;  2KY9 A;  1UE9 A;  3JCM g;  1KD1 R;  3EGU A;  4KUI A;  4LD9 K;  2ZPB B;  1U5S A;  1S1N A;  1YNZ A;  2H3E B;  3CCU Q;  3JCM b;  2QQ9 A;  1M90 U;  1Y07 A;  3A1P A;  1EFN A;  1JJ2 A;  5CR2 A;  1A0N B;  1IHW A;  1B34 A;  1AWJ A;  2DL8 A;  2CSI A;  2LMJ A;  3J81 E;  1VQ8 A;  1TOV A;  2DEU A;  2AK5 A;  3LWH A;  1JBM A;  3G6E T;  1ARK A;  1G3T A;  2F5K A;  2LNH B;  3X25 B;  1K73 C;  2JMC A;  3E19 A;  1DJ7 B;  3HSB A;  1X01 A;  1M1F A;  2LDM A;  5J39 A;  1G8X A;  2PUK B;  5LJ3 e;  1FWZ A;  2W10 A;  5GAO l;  3QG1 A;  2EGC A;  2DTH A;  4C5E A;  2CS7 A;  4JZ3 A;  5GAN 2;  3CCJ A;  5CKB A;  2AIR B;  3QBY A;  2PVD B;  3C95 A;  4OB1 B;  4WCI A;  2D8H A;  2DRK A;  2MI6 A;  1AVZ C;  2F5T X;  2RJE A;  4C92 D;  3CD6 A;  1FMW A;  2X4Y A;  1K9M C;  3PIO A;  2MWP A;  2LQW A;  4HVW A;  2F69 A;  3UWN A;  3CPW P;  1TU0 B;  3S3O A;  5KCH A;  3OBW A;  4C92 B;  4MDX A;  4C5I A;  1YIT A;  2MPX C;  2XMF A;  3CXC A;  1TTH B;  4NL2 A;  2V1R A;  3CPW S;  2NYS A;  3X26 B;  4A4H A;  1RI0 A;  3GOX A;  5KYU B;  2K57 A;  2O4X A;  3SB2 A;  5GMK i;  4XU1 A;  3RES A;  3GLX A;  4DOW A;  4WF2 A;  3OYE A;  1RAB B;  2DBM A;  1VQ4 Q;  1FYN A;  3G4S Q;  3EFO B;  1JEG A;  4HA8 A;  1VQN T;  4PJO A;  1O75 A;  1WX6 A;  4GBQ A;  2D0N A;  1IO6 A;  1SSH A;  3OW2 P;  2LCC A;  2WSC E;  4LDW A;  4DBR A;  2L89 A;  3P8B B;  2HSE B;  2JS2 A;  3M55 A;  3OS1 A;  1S72 Q;  1K76 A;  2M51 A;  3QJY A;  3CCQ T;  1UEC A;  2OI3 A;  1GBR A;  3VS6 A;  2GGR A;  3OW2 S;  4M78 G;  4XQ3 A;  1CSK A;  2RJF A;  1Q86 U;  3BE3 A;  4M77 A;  1NJI C;  2EKH A;  2QAZ A;  5GAO q;  2JOY A;  4FU6 A;  1X43 A;  4MML A;  2DZC A;  2X3X D;  3ZEH A;  1AZE A;  2ESW A;  1K8A C;  2B8A A;  3CBP A;  3EHQ A;  3CC2 A;  1YI2 Q;  2P0K A;  2VGN A;  3JCM P;  4OMQ A;  3NMZ C;  2RHU A;  4FYV B;  1RAH B;  2JUF A;  5KE3 A;  1IGU A;  1JU5 C;  2J06 A;  3EGX A;  3J80 E;  5KYX B;  2P4T A;  3HKS A;  2D0Q B;  2NUZ A;  2GQI A;  4RTV A;  2KYB A;  2OX7 A;  2K9G A;  2C0T A;  2FL7 A;  3PFS A;  1X27 A;  1PD1 A;  4GLM A;  2DYI A;  1G3S A;  2HMA A;  3CCS Q;  4RUG A;  2E5Q A;  5FRN A;  2L5Q A;  4IIM A;  4M78 C;  4XTX A;  4D8K A;  2LCS A;  4M7A A;  3CCV A;  4OVA A;  2M02 A;  4ESR A;  2EGA A;  1VQ9 A;  2YRD A;  2ED1 A;  1H8K A;  1OZ2 A;  5GAN j;  3INZ A;  1YJW A;  2CZ0 B;  2CZ6 B;  3PMI A;  1VQ8 T;  1RI9 A;  4A4G A;  4C0G A;  3M54 A;  1PRM C;  4HCK A;  3MKD A;  3CC4 Q;  2JVV A;  3KUF A;  2CRE A;  4R56 A;  4OB3 B;  1G3Y A;  4MZM A;  1XQH A;  3PE0 A;  1QVP A;  4C0F A;  1WA7 A;  2RB6 A;  4QQG A;  2KR3 A;  3DKM A;  4BI8 B;  1PNJ A;  3NTK A;  4HT8 A;  1VQ5 A;  4FW2 A;  2LP5 A;  1SG5 A;  3OYA A;  2R58 A;  1UG1 A;  4J9G A;  2FZC B;  1RLP C;  3CCJ T;  1V29 B;  1KSW A;  2XI9 A;  1ZQ1 A;  1NEG A;  5IHK A;  1SSF A;  4QT7 A;  5LJ5 g;  5CKH A;  4C0Z A;  2VWF A;  2JW4 A;  3OA6 A;  1JJ2 P;  3CD6 T;  3E1S A;  4QVC A;  2CDT A;  4HT9 A;  2DEQ A;  4EIK A;  4AFU C;  1SF9 A;  1HD3 A;  5GAN 7;  1WQW A;  2E4H A;  1B3Q A;  3O8V A;  1YIT T;  1M3A A;  5GAO r;  3PT9 A;  1D0X A;  4LXC A;  4LN2 A;  2ZAE A;  2QQA A;  1PKT A;  4RCC A;  2DK3 A;  2ECZ A;  5A2Q E;  3VYG A;  2DRM A;  2YHT A;  3M9Q A;  1MND A;  2JXB A;  1BI0 A;  2FEI A;  1T0H A;  1FXX A;  1PG5 B;  2DL3 A;  3FB9 A;  4F04 B;  2XDD A;  5CCA A;  1YJN A;  1YP5 A;  5IN1 A;  3CC7 A;  2D6F A;  1VQP A;  2XIC A;  3M5A A;  1MMG A;  5GAN e;  5LJ5 j;  1MV0 B;  2OTJ Q;  1Y71 A;  3X28 B;  3AHU A;  5GAO m;  3GBQ A;  1IHV A;  4Q5W A;  2M9U A;  3UT1 A;  4KUL A;  4XAX B;  2RQR A;  2AKL A;  3WVD B;  4PJO F;  4RTU A;  5KYN A;  1Y7X A;  1TH7 A;  1W1F A;  4N4H A;  5A0L A;  2Y90 A;  1RL2 A;  1QVG A;  3MEV A;  3QZ5 B;  3CME A;  1G3W A;  1KHI A;  1MUZ A;  3CXC P;  1RUW A;  4RCB A;  4CC7 A;  4PJO G;  2CUB A;  1YIJ A;  1X69 A;  3QXE B;  1GCQ C;  2GBQ A;  4AT1 B;  3JCM W;  1GL5 A;  4E2F B;  2EAY A;  2OTL A;  2K5L A;  3CC2 T;  4JDS A;  3CCM Q;  1XTD A;  2CUD A;  4M77 F;  3CCE Q;  1MMA A;  4ZNX A;  3EGD B;  1QCF A;  1N6A A;  3M56 A;  3F70 A;  1WZO A;  1RAD B;  3TEE A;  4PL6 A;  3QSU A;  2RHX A;  4M77 G;  2YT6 A;  2HL5 C;  2V26 A;  1MMD A;  2JTM A;  4XU3 A;  4M78 E;  2DA9 A;  2YRC A;  3VS2 A;  4AFQ C;  3THK A;  1M1K U;  1R77 A;  1GBQ A;  2BE7 D;  2ED0 A;  1WHG A;  1I1J A;  4Z8A A;  3PTA A;  2PVO B;  1EZZ B;  1VQ7 T;  3C4S A;  1UUE A;  4YTL A;  4C0D B;  2QA4 A;  2RPN A;  1VQ9 T;  4Y28 E;  1M1G A;  4LE9 A;  1AWW A;  1LNX A;  4M78 D;  1YJW T;  3QKJ A;  5D6Y A;  2LCL A;  2EJF A;  4DEX A;  5LJ5 e;  3FIF A;  1Q81 R;  4M78 B;  4IUV A;  5KH6 A;  4M7A F;  2R5M A;  1YBY A;  1NYF A;  2H8H A;  5FRM A;  2FPE A;  2PNI A;  3LH0 A;  1OPK A;  2D8J A;  1HJD A;  3EG3 A;  1ZSZ B;  1VQ5 T;  5CKF A;  4J6W A;  4EMK B;  4M7A G;  1SPK A;  1Q82 U;  3C0C A;  3LLR A;  4J7I A;  4C92 C;  1VYV A;  3FJ5 A;  1SHF A;  4XU0 A;  1N8R U;  4M77 C;  2RK1 A;  1JO8 A;  1SEM A;  5CQY A;  4CC4 B;  1EX4 A;  2KMT A;  5I21 A;  2K3Y A;  1W2B S;  2EYY A;  3EG9 B;  1X6O A;  1P92 A;  4J8O A;  4OP0 A;  1ABQ A;  4J7F A;  1ZUU A;  3H6Z A;  4M7D A;  3TRE A;  2O9S A;  3V8K A;  2VVK A;  3LGL A;  3L2V A;  5EG2 A;  3X20 B;  1KD1 U;  2NUP A;  1K1Z A;  3I35 A;  3C94 A;  3L2Q A;  4J9F A;  4JRQ A;  1WQ7 A;  3OYL A;  1HYO A;  2J6O A;  3CCL Q;  1VQL Q;  2JM9 A;  1MHN A;  2LC4 A;  5CVI A;  4ZTJ A;  2PUO B;  4AFS C;  2QAS A;  3GIB A;  3KFV A;  1BKB A;  2ATC B;  3QJ6 A;  1VQP T;  3CC7 T;  4FW1 A;  4O6J A;  3SHW A;  4M75 A;  1QCN A;  3SWN A;  3L2U A;  4FL6 A;  3BFM A;  2YWW A;  5CO7 A;  2A28 A;  3OSS C;  2ZCF B;  1D1C A;  1UGQ B;  1B07 A;  2G3R A;  2WSE E;  2QQB A;  4F14 A;  2DPP B;  1AWO A;  4EDU A;  3CME T;  5FWB A;  1YIJ T;  2DLP A;  1FMK A;  3FEO A;  1Q82 R;  4IUQ A;  5GAM j;  1H64 1;  3SEM A;  3CCR A;  1WLP B;  5KCO A;  2C06 A;  1B34 B;  3HHT B;  3M59 A;  5GAN d;  1YFN A;  2CP3 A;  1U8R A;  1M90 C;  1D0Z A;  3H9N A;  4BB7 A;  1WIE A;  1QLY A;  3MP8 A;  1YHQ A;  4XTV A;  3FLG A;  1PC0 A;  2DFU A;  2QDY B;  4E7I A;  1OU8 A;  2DJQ A;  1ACM B;  1CKA A;  3TSW A;  3VKI A;  2KT8 A;  2DTO A;  3OMG A;  1H3H A;  1TUC A;  3VUB A;  1QVG P;  1KQS S;  2BZY A;  3M0R A;  3LWI A;  2FYK A;  1JQQ A;  3I56 A;  4BE0 A;  2QA4 T;  1K0X A;  2GCX A;  3EG0 A;  3OYB A;  2NWM A;  5GAN h;  2CZ1 B;  1VQN Q;  4OMO A;  2DMO A;  3JCM Q;  4HCC A;  5AT1 B;  4ANJ A;  2GTO A;  1H3Z A;  4J9C A;  4ZGJ B;  3V7C A;  4BE2 A;  2KEA A;  4C92 E;  4K11 A;  2QEX Q;  4M77 E;  4PJO D;  2OJ2 A;  2A3L A;  4RG2 A;  2KE9 A;  2KSS A;  3EH1 A;  1JXM A;  1VQ6 A;  4MDW A;  1V76 A;  3KBG A;  1KQ1 A;  3O5Z A;  1AT1 B;  3A5Z B;  1LVK A;  1WYX A;  3HL8 A;  4II1 A;  2RK2 A;  9ATC B;  4KBM B;  4RTX A;  4PJO B;  3DB4 A;  5I2M A;  3UA7 A;  2EFI A;  2KK4 A;  3GNF B;  1D09 B;  5GAM e;  2H3J A;  2KQW A;  2RHY A;  1VQM A;  1FX7 A;  2EQJ A;  1PSF A;  4J6X A;  2BUD A;  4M77 D;  2PZ1 A;  1ZBX A;  2PVG B;  2RI3 A;  4KRT A;  2RN8 A;  1LCK A;  3JCM c;  4D6W A;  1QCO A;  2DIL A;  1VQO Q;  5GAN f;  2JT4 A;  4M77 B;  4C8Q A;  4JUV A;  1ZSG A;  5DLQ E;  2FHD A;  2J6F A;  2DE0 X;  4X9D A;  3BDU A;  2AKK A;  1K73 U;  2I2L A;  4HCB A;  4Y92 A;  3OYN A;  2FZK B;  2RJC A;  1VQK T;  2RF0 A;  2K6D A;  4M7D F;  1NYG A;  1QWF A;  2EGE A;  2LQK A;  1CKB A;  1V1C A;  1HXD A;  1UJY A;  2DD4 A;  2ZPI B;  4M7D G;  4N4G A;  3QZ9 B;  3REB B;  3WXM B;  1Q7Y R;  5FU7 C;  5LJ5 h;  4CC3 A;  1YN8 A;  2V8J A;  2BE9 B;  4J9H A;  1I5O B;  4Z89 A;  3JB9 J;  1VQ8 Q;  2DL4 A;  4M7A D;  1K9M U;  2O01 E;  1WFW A;  5AYF A;  2CH4 A;  4M75 F;  3V8L A;  2MK5 A;  2HAX A;  3CBM A;  2ROL A;  4QKU A;  2HEQ A;  3JCM e;  1M4Z A;  4M7A B;  3JCM X;  4BI4 A;  3FDR A;  2QDL A;  4BI3 A;  2V8K A;  3CCR T;  4M75 G;  3LGF A;  2DKG A;  1U1S A;  4N0A C;  3LX7 A;  5KYY A;  2IVW A;  3C12 A;  3I5S A;  1W6X A;  3QII A;  3CCJ Q;  3TVT A;  1YHQ T;  1QVF P;  2KDS A;  2OAU A;  5A0G A;  1M2V A;  3ASK A;  2DET A;  3G7Z A;  1PCX A;  4C0D C;  3HFN A;  2ZZD A;  5FW9 A;  2HSP A;  5CQX A;  3RKW A;  4WTO B;  3MCA B;  4ZN3 A;  5LJ5 f;  3L1A A;  5KYW A;  3CD6 Q;  1QVF S;  2CKK A;  1WXU A;  2P84 A;  4XK8 E;  1K73 R;  5GAN 8;  1XNI A;  2KBT A;  2A08 A;  3SD4 A;  1BCO A;  1VQ7 A;  1YIT Q;  2CP2 A;  1BB9 A;  2RHI A;  1RAF B;  3DLL A;  2P0P A;  4HVV A;  4OML A;  1NJI U;  2RO0 A;  5GMK h;  3I56 T;  1M8V A;  3Q1J A;  5I22 A;  2HCK A;  1OX9 A;  3RIR A;  1NEB A;  3I9Q A;  2EYX A;  2LQN A;  1ZSZ C;  2FPF A;  3MHX A;  4EMK C;  4R55 A;  1K8A U;  3VJP A;  3MEW A;  4J5Y A;  2CGH A;  3M0P A;  1OOT A;  1NM7 A;  1I81 A;  2E6N A;  1T0J A;  2LT1 A;  2XHC A;  1WXB A;  1VOM A;  1UDL A;  1K9M R;  1D3B A;  3RDV A;  4A53 A;  2RQV A;  2J05 A;  3RKY A;  4BY6 C;  1VQ6 T;  2HZY A;  5D6X A;  5FRO A;  5DM7 R;  4FM4 B;  1NBE B;  5KYX A;  5FU6 C;  1ZLM A;  2GQV A;  1UGP B;  4EPC A;  2DX1 A;  3I55 Q;  1VQM T;  4C5G A;  1SRM A;  1M30 A;  2DAQ A;  2LRQ A;  4DEY A;  5GAN 4;  2QTV A;  1I4K 1;  2ZPF B;  1PRL C;  4EMH A;  1K4U S;  1IZ6 A;  4A63 B;  5ECA A;  1BU1 A;  1MNE A;  4F16 A;  1TSF A;  3REA B;  4JLI A;  5LJ3 d;  1JJ2 S;  1WJR A;  4RG8 A;  1VYU A;  3KXT A;  2LJ1 A;  2K2V A;  4ORZ A;  1QKX A;  2LX9 A;  4O5V A;  3QDR B;  3OYM A;  4QVD A;  1QWE A;  5GAM d;  2CSQ A;  5GJV B;  5IXB A;  2CT4 A;  2DO3 A;  5CKE A;  1AOJ A;  1NJI R;  1J3T A;  1UGR B;  4C8Q F;  5A0D A;  1Y96 B;  2EQI A;  3JB9 I;  1D1A A;  2ZPG B;  1QW1 A;  4E7H A;  1X6B A;  2K4Y A;  4HXJ A;  2ROT A;  1K8A R;  2VV5 A;  3EG2 A;  4C8Q G;  3LYI A;  3CCV Q;  3S6W A;  2X4J A;  1VQ9 Q;  4BDY A;  2RI2 A;  1Q81 U;  2VXE A;  1YJW Q;  4FT2 A;  2IPO B;  1QKW A;  4NL3 A;  4D8D A;  7AT1 B;  1WHL A;  5LJ3 h;  3DLM A;  2D1X A;  2JM8 A;  2HDA A;  3JRZ A;  1SHG A;  1PM3 A;  3S3N A;  4IUR A;  5FU7 B;  4A54 A;  1KC8 C;  4V2S A;  4E7J A;  2CYZ B;  5GAM h;  5C6S A;  3OQ5 A;  3CXC S;  4IUU A;  5J3B A;  2VB6 A;  1VQ5 Q;  4JS4 A;  2DXC A;  1UGS B;  4XTY A;  1WNL A;  2YLC A;  4ZN1 A;  1QP3 A;  2LT4 A;  2FG0 A;  4M7D E;  1OU9 A;  3VS5 A;  3P8H A;  2YLB A;  2RQU A;  4FSS A;  3TCJ A;  1IXD A;  1ZBJ A;  3PGG A;  5FLX E;  2EYQ A;  2EYZ A;  3VRZ A;  4F7U A;  3JCM d;  4UC4 A;  2HKQ B;  4L5G A;  3RMS A;  2QQR A;  3GF5 A;  2ZPH B;  2K2M A;  5LJ3 f;  1ZUY A;  3R6N A;  3E9G A;  4M7D D;  1N8R C;  2O31 A;  1M2O A;  3JSC A;  2GF7 A;  4IIO A;  4PFO A;  2NUT A;  1AEY A;  4AG1 C;  5GAM f;  3OBY A;  4M7D B;  4PJO C;  2DM1 A;  3V7R A;  1BCM A;  2RQT A;  2OAW A;  1YJ9 A;  1YJN Q;  1T3L A;  3CC7 Q;  2V8I A;  3BY7 A;  4RTZ A;  3A98 A;  5IHN A;  2R57 A;  5GMK l;  2FRY A;  1RAE B;  2E12 A;  2NUP B;  3ZL7 C;  2HQX A;  2BIV A;  1Z9Q A;  2EJG A;  4OF1 A;  2VYT A;  3OMC A;  2L3P A;  2HBW A;  4TVR A;  8AT1 B;  4M75 D;  5D6W A;  1ABO A;  3JCM h;  3G71 A;  4BD3 A;  1KD1 C;  2X3W D;  1BI3 A;  3VS1 A;  2D9T A;  2VC8 A;  3CME Q;  2XG8 D;  3OSV A;  4E7L A;  4M75 B;  2K3X A;  4LDX A;  2SRC A;  1TUG B;  4JS5 A;  1TUD A;  3SWN B;  4J9B A;  3G1J A;  4BY6 B;  1R0B G;  4FYY B;  2FPD A;  3CCM T;  5I11 A;  3BW1 A;  2EIF A;  2HQE A;  2CP7 A;  2OTL Q;  2FRW A;  3OW2 A;  5FU6 B;  4DBH A;  2I0N A;  2QG9 B;  3CMA A;  1JB0 E;  2IG0 A;  1Z9Z A;  4CC2 A;  4OMF B;  1E7O A;  2L0A A;  4KH1 B;  2F2V A;  1VQK A;  1LOJ A;  1YCY A;  2ZPE B;  2AT1 B;  3CCU A;  2RA2 A;  3H0I A;  3JCM f;  5HK0 A;  1YWP A;  2E6Z A;  4HKE A;  1WHH A;  4XU2 A;  1AZG B;  3A8L B;  4PLI A;  4MMK A;  4PKC C;  5IXF A;  2QA4 Q;  4M7A C;  3H0H A;  5KE2 A;  5GAO p;  3OY9 A;  3QUI A;  5J26 A;  1I5L A;  1ZHI A;  3H41 A;  3M4G A;  1E6H A;  2XK0 A;  4AMC A;  3CPF A;  3G6E Q;  1OUL A;  4GLK A;  1WHK A;  2C0I A;  4C5H A;  3HFO A;  2QYZ A;  4J9E A;  3A8M B;  2HQH A;  4LD6 A;  3VU3 C;  2E65 A;  4J6Y A;  2LNV A;  3OS5 A;  2F1L A;  2DXB A;  2QXF A;  4BAC A;  2R5A A;  3U23 A;  4XTU A;  3M57 A;  4KH0 B;  1TWB A;  3V8J A;  3UDC A;  2E5K A;  4PLL A;  2JNG A;  2WAC A;  1GFC A;  3L42 A;  4XTZ A;  1KG1 A;  5IAY A;  2EW3 A;  4A4K A;  3MET A;  3UF4 A;  2LTO A;  1U06 A;  1YCS B;  4Y91 A;  2DL5 A;  3GPL A;  1VQO A;  1NG2 A;  3PIP A;  2KRS A;  1M3C A;  1IRX A;  4FCY A;  4PJJ A;  3MEA A;  3JCM V;  1LPL A;  4JPB W;  4JRP A;  4PJO E;  1R8O B;  3L2W A;  5GJW B;  2X4X A;  1UFF A;  3M58 A;  4VUB A;  2MF2 A;  1O9S A;  4ZGE B;  3VRY A;  2XKO C;  1HK9 A;  4JJD A;  3FJP A;  3GNG A;  4E7S A;  3TU4 K;  4LDV A;  1VQ4 A;  3G4S A;  1QVG S;  4DBF A;  1G2B A;  2HD0 A;  4J9I A;  1RAC B;  4RTW A;  4F7U F;  3LH5 A;  3DB3 A;  5GAN 5;  4LNP A;  2A7Y A;  1Q7Y U;  2J7I A;  2WSF E;  2RH2 A;  2EVR A;  4C8Q B;  2DVJ A;  1YJ9 T;  4F7U G;  1S72 A;  3QPH A;  4FSX A;  4KGZ B;  3A8O B;  2PTK A;  1KIK A;  2O4X B;  3CCQ Q;  2X9H A;  1LJO A;  2SEM A;  1OQK A;  3FRN A;  5L8R E;  4QW2 A;  4XTW A;  3LW5 E;  3G71 T;  1OPL A;  1NLO C;  3VS3 A;  3JB9 F;  1NZ9 A;  1GCQ A;  5HCK A;  1MGQ A;  1KJW A;  2F2W A;  5LJ5 d;  3A8G B;  3PVQ A;  1R0C B;  1PKS A;  1VUB A;  1YI2 A;  3JB9 G;  3CCR Q;  2GFA A;  2FO0 A;  4RMO A;  3RR6 A;  1MMN A;  4CI0 C;  2RNA A;  3CEY A;  5CKD A;  1M3B A;  3R6O A;  2E1H A;  3EFR A;  1YHQ Q;  1NPP A;  2KXC A;  3CMA T;  3OYJ A;  3ER0 A;  4PK4 A;  2XD0 A;  1JXO A;  1WJQ A;  1OI1 A;  1F1B B;  5D7U A;  1Q86 C;  2PU9 B;  3OYC A;  1WPY A;  2EQU A;  4M7A E;  2DTI A;  2L2P A;  2VAS A;  2JN0 A;  4ELY C;  3A8H B;  3CCS A;  5KYY B;  3PVL A;  3CCU T;  2EWN A;  2JJ9 A;  2ENM A;  3EGX B;  1AD5 A;  5DY9 A;  2L3Q A;  1PWT A;  5GMK m;  1M2V B;  2K5F A;  3NTI A;  3OS0 A;  4PJL A;  1N27 A;  5M9O A;  5GAO n;  3OS2 A;  1X2Q A;  3I56 Q;  1GXI E;  2O9V A;  2JS0 A;  3ULR B;  4JLG A;  3T9N A;  5KYW B;  2ZGW A;  2QGF B;  1M90 R;  2X35 A;  3CC4 A;  3PNW C;  3HTR A;  2IIM A;  4OB2 B;  4M78 F;  3UA6 A;  2QEX T;  2E10 A;  2DL7 A;  5CIU A;  2K3B A;  3BDL A;  3M0S A;  1RAI B;  2O2O A;  2HBP A;  2XDB A;  2HNI A;  1VQ6 Q;  2VKN A;  1WDX A;  2A0F B;  4C92 A;  4F17 A;  4MZP A;  4OMP A;  3RUX A;  3OB9 A;  1BK2 A;  3OYG A;  4N4I A;  2YUQ A;  3L2R A;  3I55 A;  4B9W A;  2L3S A;  5IT9 E;  4ME7 A;  3J7A F;  5KYU A;  1VQM Q;  2KRN A;  1D3B B;  2GFU A;  2KT1 A;  2YRV A;  3EFO A;  1GFD A;  1NLP C;  3PMT A;  1SKU B;  5GAN g;  2KYM A;  3NHN A;  4BUG A;  1VQO T;  2CP6 A; 
#chains in the Genus database with same CATH homology
 4D8D A;  2O9S A;  2ABL A;  2JMC A;  1VA7 A;  2VVK A;  2D1X A;  2JM8 A;  2HDA A;  1SHG A;  1K9A A;  2KNB B;  1K1Z A;  2YUN A;  3I35 A;  1UHF A;  3IQL A;  4J9F A;  2W10 A;  2BZ8 A;  2EGC A;  2J6O A;  2JM9 A;  4JZ3 A;  4AFS C;  4WCI A;  3KFV A;  2D8H A;  2FG0 A;  2DRK A;  5IH2 A;  1AVZ C;  3SHW A;  3VS5 A;  1M27 C;  2RQU A;  4FSS A;  4HVW A;  2LQW A;  1ZBJ A;  2A28 A;  2EYZ A;  3VRZ A;  1B07 A;  1H92 A;  1M8M A;  1T3S A;  4F14 A;  2XMF A;  1AWO A;  2K7A A;  2B86 A;  5FWB A;  2V1R A;  3VS7 A;  2K2M A;  1ZUY A;  3R6N A;  2DLP A;  1FMK A;  3QWY A;  3M0T A;  3SEM A;  1WLP B;  2DBM A;  2O31 A;  1FYN A;  1WXT A;  4IIO A;  1JEG A;  1AEY A;  4AG1 C;  1N5Z A;  4JZ4 A;  2RQW A;  1WX6 A;  4GBQ A;  2DM1 A;  1WIE A;  2LZ6 B;  1QLY A;  2D0N A;  1IO6 A;  1SSH A;  2RQT A;  2OAW A;  1U3O A;  1T3L A;  1G83 A;  2JS2 A;  4RTZ A;  3A98 A;  5IHN A;  2FRY A;  1K76 A;  2M51 A;  2MCN A;  3ZL7 C;  2EPD A;  1Z9Q A;  1UEC A;  1ZX6 A;  2OI3 A;  1GBR A;  3VS6 A;  2GGR A;  2DJQ A;  2L3P A;  2HBW A;  1CKA A;  1CSK A;  3TSW A;  2KT8 A;  1ABO A;  1H3H A;  1TUC A;  2X3W D;  2BZX A;  2EKH A;  1I07 A;  1TG0 A;  3VS1 A;  2BZY A;  3M0R A;  1JQQ A;  1X43 A;  2SRC A;  2X3X D;  1TUD A;  4J9B A;  1AZE A;  2ESW A;  1K0X A;  5EC7 A;  3EG0 A;  1ZUK A;  2NWM A;  3EHQ A;  2P4R A;  2FPD A;  4LUD A;  5I11 A;  4OMQ A;  2O88 A;  4J9D A;  4OMO A;  2DMO A;  1GCP A;  3NMZ C;  4X1V A;  4AG2 C;  2FRW A;  1OV3 A;  2J06 A;  1JU5 C;  2GTO A;  2I0N A;  4J9C A;  2KEA A;  4K11 A;  1Z9Z A;  2MOX A;  2OJ2 A;  4CC2 A;  2NUZ A;  1E7O A;  2KE9 A;  2L0A A;  2GQI A;  4RTV A;  2KYB A;  1JXM A;  2F2V A;  3O5Z A;  1AWX A;  2K9G A;  2A36 A;  1WYX A;  2C0T A;  2LJ3 A;  1GRI A;  4M4Z A;  4RTX A;  2DNU A;  2LJ0 A;  1X27 A;  3UA7 A;  4GLM A;  3H0I A;  2KGT A;  4RUG A;  1YWP A;  3EHR A;  4IIM A;  4D8K A;  2LCS A;  1AZG B;  4ESR A;  2EGA A;  1RLQ C;  1VYT A;  5IXF A;  2ED1 A;  2YSQ A;  2PZ1 A;  1H8K A;  3H0H A;  4OMM A;  2J6K A;  4KRT A;  2RN8 A;  1LCK A;  3H41 A;  1RI9 A;  1E6H A;  2DIL A;  2JT4 A;  1PRM C;  4HCK A;  2DBK A;  2JTE A;  2C0I A;  2CRE A;  1ZSG A;  2RMO A;  4J9E A;  2J6F A;  2DE0 X;  3PE0 A;  4RTY A;  1WA7 A;  2AKK A;  2KR3 A;  3CQT A;  4Y92 A;  1PNJ A;  2F2X A;  3RNJ A;  2LP5 A;  2RF0 A;  2K6D A;  1NYG A;  1QWF A;  1UG1 A;  3U23 A;  2EGE A;  4J9G A;  5FWC A;  1CKB A;  1V1C A;  1E6G A;  2E5K A;  1RLP C;  1GFC A;  1KSW A;  1UJY A;  1YWO A;  2AZV A;  1NEG A;  5IHK A;  2V1Q A;  3REB B;  1BBZ A;  2EW3 A;  4QT7 A;  3UF4 A;  1U06 A;  1YCS B;  2VWF A;  2JW4 A;  4CC3 A;  1YN8 A;  2DL5 A;  1XOV A;  4J9H A;  1HSQ A;  1NG2 A;  2CDT A;  2KXD A;  2KRS A;  4EIK A;  1M3C A;  2C0O A;  4Z89 A;  2DL4 A;  4AFU C;  2A37 A;  1HD3 A;  2W0Z A;  1B3Q A;  1WFW A;  1M3A A;  4JPB W;  2CH4 A;  5GJW B;  3H0F A;  1UFF A;  4LN2 A;  1PKT A;  2ROL A;  3VRY A;  2ECZ A;  2HEQ A;  4JJD A;  4LUE A;  2DRM A;  2YUP A;  2QDL A;  4JJB A;  2JXB A;  2MIO A;  3QWX X;  1G2B A;  4J9I A;  4RTW A;  3LH5 A;  2FEI A;  1OEB A;  1T0H A;  3VS0 A;  4LNP A;  2DL3 A;  2J7I A;  2EYW A;  3RBB B;  4Z88 A;  1YP5 A;  3I5S A;  1W6X A;  2EVR A;  1W70 A;  3TVT A;  4JJC A;  2DVJ A;  5L23 A;  2BTT A;  2LX7 A;  3VS4 A;  1MV0 B;  2PTK A;  3GBQ A;  2HSP A;  5FW9 A;  1KIK A;  2RQR A;  4R0K A;  2AKL A;  1I0C A;  4RTU A;  2SEM A;  4E6R A;  1UJ0 A;  1WXU A;  1W1F A;  1WI7 A;  4HVU A;  2KBT A;  2A08 A;  1MUZ A;  1OPL A;  1RUW A;  4CC7 A;  1NLO C;  1BB9 A;  3VS3 A;  2CUB A;  1GCQ A;  1X69 A;  5HCK A;  1KFZ A;  1KJW A;  2KRO A;  4HVV A;  4OML A;  1GCQ C;  2GBQ A;  2GTJ A;  2F2W A;  3PVQ A;  1GL5 A;  1PKS A;  5I22 A;  1UHC A;  2HCK A;  1NEB A;  3I9Q A;  2EYX A;  2LQN A;  2FO0 A;  2G6F X;  2CT3 A;  2DYB A;  3M0Q A;  2FPF A;  1Y57 A;  2CUD A;  2RNA A;  3UAT A;  4ZNX A;  1Y0M A;  1M3B A;  1QCF A;  2YUO A;  4OMN A;  3M0P A;  1OOT A;  1NM7 A;  3NGP A;  2KXC A;  1T0J A;  1SRL A;  1JXO A;  1WXB A;  2YT6 A;  1PHT A;  1MV3 A;  1UDL A;  2AZS A;  2RQV A;  2J05 A;  2DA9 A;  3VS2 A;  4AFQ C;  3THK A;  2YDL A;  1X2K A;  1GBQ A;  2ED0 A;  2L2P A;  3EG1 A;  3NPF A;  1I1J A;  4Z8A A;  1UTI A;  3TSZ A;  3PVL A;  1X6G A;  1UGV A;  5IHI A;  1ZLM A;  2ENM A;  1AD5 A;  3M0U A;  1UUE A;  2L3Q A;  1PWT A;  2DX1 A;  2RPN A;  1X2Q A;  1SRM A;  1M30 A;  4DEY A;  2M0Y A;  2O9V A;  2JS0 A;  3ULR B;  2EBP A;  1PRL C;  4LE9 A;  1AWW A;  1K4U S;  4RTT A;  4A63 B;  5ECA A;  2DF6 A;  1BU1 A;  2IIM A;  4DEX A;  2CH4 W;  4F16 A;  3REA B;  2GNC A;  4AFZ C;  3UA6 A;  1VYU A;  2LJ1 A;  2DL7 A;  4ORZ A;  1QKX A;  2KRM A;  2K3B A;  2K79 A;  3M0S A;  1NYF A;  2H8H A;  2O2O A;  1QWE A;  2FPE A;  2PNI A;  3JV3 A;  2CSQ A;  1OPK A;  2D8J A;  2JMA A;  3EG3 A;  2VKN A;  1HJD A;  1WDX A;  5GJV B;  1K0S A;  3I5R A;  5IXB A;  4F17 A;  1SPK A;  1UE9 A;  2CT4 A;  3C0C A;  4OMP A;  3EGU A;  1AOJ A;  1J3T A;  1VYV A;  3FJ5 A;  1BK2 A;  1SHF A;  1U5S A;  2EQI A;  1JO8 A;  1S1N A;  2YUQ A;  1YNZ A;  1SEM A;  2L3S A;  4CC4 B;  1X6B A;  4HXJ A;  2ROT A;  2KRN A;  1EFN A;  2EYY A;  3EG2 A;  1A0N B;  2KT1 A;  1AWJ A;  2DL8 A;  1GFD A;  1NLP C;  2CSI A;  2LMJ A;  1ABQ A;  2AK5 A;  2KYM A;  3NHN A;  1ZUU A;  1ARK A;  1QKW A;  2LNH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...