1TUDA

Alpha-spectrin src homology 3 domain, circular permutant, cut at n47-d48
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
RQGFVPAAYVKKLDSGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The order of secondary structure elements does not determine the structure of a protein but does affect its folding kinetics.
pubmed doi rcsb
molecule keywords ALPHA-SPECTRIN
molecule tags Cytoskeleton
source organism Gallus gallus
total genus 11
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1tudA00
4JJBA 2SRCA 4AG1C 4D8DA 2ECZA 2I0NA 1NG2A 2RNAA 4RTXA 4AFUC 2L3SA 2ESWA 1SHFA 2EYZA 2A08A 2KT8A 3M0RA 4IIOA 1KJWA 2ED1A 2EYYA 1QKXA 2CSQA 2D0NA 2GTJA 4RTTA 3O5ZA 2EYWA 1NEBA 2VWFA 1GRIA 1I0CA 1K1ZA 2MOXA 2X3XD 3UF4A 2J6OA 2CH4W 1SRLA 2EGCA 2YUOA 1WDXA 2EW3A 3M0TA 1MUZA 1V1CA 1CKAA 1AVZC 4K11A 2DE0X 1WXBA 1YWPA 2EPDA 2LCSA 2X3WD 2O2OA 2A37A 2EKHA 4DEYA 4LN2A 2FRWA 4JZ4A 5EC7A 3I5RA 3TSWA 2J05A 4IIMA 1JQQA 2DL8A 2DRMA 5IH2A 1BU1A 4F16A 3VS0A 1UGVA 1A0NB 4J9HA 4RTYA 1WXUA 2CDTA 1ABOA 2K79A 2KYBA 1SRMA 2IIMA 3REBB 1S1NA 1AWXA 1UE9A 4HXJA 3I5SA 4LUDA 2FPFA 1X6BA 2DILA 1NLOC 1MV3A 2KYMA 1K0XA 2LMJA 3UATA 1PKSA 1OOTA 2DL3A 2JTEA 1GCQA 2BZYA 1WI7A 3H0FA 2JM9A 2V1RA 2RQWA 1IO6A 2W10A 1AD5A 2GQIA 2EYXA 4GBQA 1X6GA 5GJVB 3R6NA 1FYNA 2DL5A 2EBPA 2YUQA 2KRMA 4RTZA 2K6DA 2OAWA 4RTVA 4Z88A 5GJWB 5L23A 1SSHA 1UJYA 5ECAA 1H3HA 1M27C 2DYBA 1G2BA 2JXBA 1Y0MA 1JXMA 1M3BA 1OV3A 2G6FX 1NYGA 2LJ3A 4R0KA 1SHGA 1AOJA 1T0JA 4FSSA 1M30A 1RUWA 1LCKA 1BB9A 1G83A 2LP5A 2CREA 4OMPA 2KR3A 2HEQA 3ZL7C 1MV0B 4J9DA 1ZX6A 4WCIA 3TVTA 2HSPA 1QKWA 4JJDA 3VS3A 2W0ZA 1WFWA 2B86A 1EFNA 3TSZA 2RQTA 1XOVA 2P4RA 3VS2A 4AFSC 1K4US 3REAB 2JMAA 2JS2A 2KRSA 1I07A 1UJ0A 1KFZA 1W70A 3EG0A 1JXOA 1VYVA 1UG1A 2L0AA 3VS5A 2JM8A 2KEAA 2C0TA 2KRNA 2LJ1A 2DA9A 1SEMA 1GFCA 2FO0A 2PTKA 3UA7A 3EG2A 2DF6A 1AWWA 1X43A 1Z9ZA 1M3AA 3VS1A 1X2QA 2DJQA 4KRTA 3GBQA 3UA6A 1X27A 3PVLA 2LZ6B 3RNJA 1E7OA 1HD3A 1UFFA 2YT6A 1GFDA 1Z9QA 2ROTA 4F14A 1AWOA 1ABQA 1X69A 5FWBA 1RLPC 5HCKA 2DNUA 2JT4A 2DL4A 2FG0A 3NHNA 1E6HA 4JZ3A 4HVVA 4AFZC 3I9QA 1WYXA 3I35A 1VYTA 1HJDA 3M0UA 2A28A 2J06A 2FEIA 1K0SA 4CC3A 2LQWA 2D8HA 1W6XA 1PWTA 2EGAA 2CT4A 1I1JA 2KGTA 3LH5A 2XMFA 2O88A 3M0SA 1UTIA 4HCKA 4RTWA 2C0IA 1AZGB 2KNBB 2DM1A 1U06A 1WIEA 2PNIA 3VS4A 5FWCA 1BK2A 2AK5A 2GGRA 2DBMA 3FJ5A 2F2VA 1T3LA 2CSIA 3M0QA 3THKA 1YN8A 2AKLA 1E6GA 2M51A 4J9IA 4QT7A 2LNHB 1ZBJA 1BBZA 4DEXA 1GBRA 2DLPA 2BTTA 1OPLA 2K7AA 3H0HA 2KXCA 2MIOA 1KSWA 1B3QA 1ZUUA 2GNCA 2RPNA 2J7IA 2HBWA 2ABLA 4OMLA 1ZUYA 4AG2C 5IXFA 5IHKA 1W1FA 4JPBW 1B07A 1VA7A 2NWMA 3CQTA 4J9CA 1TUDA 3VS6A 1GL5A 1U5SA 1GBQA 2K2MA 1VYUA 2FPEA 2JW4A 2EQIA 3NGPA 2A36A 2D1XA 4RTUA 4ORZA 2CUDA 3PE0A 2LX7A 4OMOA 4EIKA 4RUGA 3EHRA 2KE9A 3H0IA 4ZNXA 5I22A 1K9AA 2OJ2A 2RMOA 1CSKA 2KBTA 1CKBA 2RQRA 4HVWA 3KFVA 1NM7A 1WXTA 2YSQA 2VKNA 2RQVA 1PKTA 1WLPB 2O9SA 4Z89A 2BZXA 1JU5C 1RLQC 2PZ1A 2L3QA 5IXBA 1UUEA 4CC4B 3RBBB 2D8JA 2YUNA 1U3OA 4F17A 3PVQA 4M4ZA 2YUPA 4J9EA 4OMNA 1OPKA 2BZ8A 2F2XA 2KXDA 3EG3A 1PHTA 2OI3A 5IHNA 2MCNA 1TG0A 1M3CA 1GCQC 1AZEA 2K9GA 1PNJA 1RI9A 2O31A 3SHWA 2AKKA 1QCFA 1FMKA 2GTOA 3NMZC 3NPFA 1WA7A 2V1QA 2HCKA 4X1VA 3SEMA 1KIKA 2ENMA 2VVKA 2DMOA 1J3TA 1UDLA 1AWJA 1JO8A 1T0HA 1ZUKA 2CUBA 2JMCA 2F2WA 4OMQA 2EVRA 2LJ0A 4E6RA 1UHCA 1YP5A 2RQUA 2LQNA 2ROLA 2SEMA 4OMMA 4CC2A 1X2KA 1JEGA 3QWXX 2K3BA 4LUEA 1GCPA 1WX6A 2JS0A 1NLPC 4ESRA 2M0YA 1M8MA 2HDAA 4Z8AA 5FW9A 1OEBA 5IHIA 1ZSGA 2CH4A 4HVUA 1YWOA 3EHQA 3H41A 2ED0A 5I11A 2QDLA 4J9BA 2RN8A 3M0PA 1QLYA 4CC7A 2CT3A 2AZVA 2DL7A 1SPKA 1QWFA 1PRMC 2O9VA 2EGEA 3ULRB 3VRZA 1NEGA 1TUCA 4A63B 4GLMA 2NUZA 1PRLC 1ZLMA 1K76A 1UECA 2FPDA 1HSQA 2H8HA 2KT1A 1QWEA 3A98A 1YNZA 3C0CA 4JJCA 2C0OA 4J9GA 4Y92A 1N5ZA 2RF0A 1H92A 3VS7A 4D8KA 1H8KA 2AZSA 4LNPA 3JV3A 2L3PA 2FRYA 2E5KA 2YDLA 3EGUA 2DRKA 1Y57A 1UHFA 1AEYA 4LE9A 1NYFA 1T3SA 2DBKA 2DVJA 3U23A 2DX1A 3IQLA 2KROA 2L2PA 2J6FA 1YCSB 3VRYA 1ARKA 3QWYA 2J6KA 4J9FA 3EG1A 4AFQC 2GBQA
chains in the Genus database with same CATH superfamily
2RHUA 3OYCA 3OB9A 4JJBA 2SRCA 3HPWA 2ECZA 4RTXA 2ESWA 3G71Q 2A08A 3CCMA 4FW1A 2EYYA 3CBMA 2VWFA 1NEBA 1GRIA 1I0CA 4V2SA 1K1ZA 2XDPA 2DIQA 4PJMA 4F7UE 4JRKA 1RADB 1BYMA 1IZ6A 4IUUA 2J6OA 3PMTA 3MEVA 3JCMQ 3VUBA 2EGCA 2JZ2A 4KGXB 5GAN3 4OB3B 4QQDA 1WDXA 3FRNA 3CBPA 3QIIA 3M0TA 5KYYA 3A8OB 1ZA2B 1CKAA 1AVZC 3OYEA 1RI0A 2LCSA 2X3WD 2EIFA 2MPXC 3QJ6A 2X9HA 1NJIU 3HSBA 5KYXB 4JZ4A 5EC7A 1TWBA 3TSWA 5GAN4 4IIMA 1Q95G 2F69A 1JQQA 3FDRA 3QZ5B 4F16A 4F7UA 2KVQG 4RTYA 3HHTB 2HL5C 3L2WA 1S1NA 1AWXA 4PJOE 3I5SA 3CMET 2VXFA 1OQKA 4L6V5 3SFMA 3JRZA 4J6YA 1VUBA 3J80E 1D1BA 5CKFA 2QEXT 2LMJA 3UATA 1AT1B 1EIFA 2HQHA 1OOTA 5GAN2 1VQ9A 1JJ2S 2PUOB 4DOVA 1VQ6T 2CYZB 3EFRA 2ZPFB 3V7SA 5FLXE 3DB4A 3M55A 2EBPA 1MNDA 2LQ8A 3CMEQ 4HCZA 4PJOA 4M78B 2QEXQ 2G3RA 1BCOA 2R5MA 2DAQA 2CZ1B 1UJYA 4PFPA 1YCYA 3OQ5A 3QKJA 2DYBA 4M7AF 1G2BA 5C6SA 1IHVA 3CCVQ 2G6FX 3CCJA 2XI9A 1M30A 1RL2A 1YITQ 4C92E 2MK5A 5DLQE 1VQ6Q 2E3HA 4PJJA 1Y96A 4OMPA 2KR3A 2HEQA 1VQOA 2P4TA 1LJOA 3TVTA 5KYUA 5LJ3j 2JVVA 4EMKB 2D0QB 1W70A 3EG0A 2QA4T 1JXOA 1R0CB 4M77C 3TQ7P 2KEAA 3RDVA 2XG8D 4J6WA 2DA9A 4LD6A 2H3EB 2VXEA 2E1HA 4C8QF 3A5ZB 1X01A 2LT1A 3A8GB 4OMFB 4C92A 3DKMA 2DF6A 1X43A 1X2QA 1U1TA 1RABB 1PSFA 5GMKm 2LZ6B 1WQWA 4JJNK 2QA4Q 2RJEA 4XU0A 4C92D 3Q1JA 5GANe 3CC7Q 3JCMX 1AWOA 3VU3C 2DYIA 3P8DA 3QBYA 2IVWA 3OY9A 1IGUA 2AT1B 1JRIA 1WPYA 1E6HA 3H6ZA 4HVVA 4AFZC 4LD9K 3E9FA 5CQXA 2VYTA 3M0UA 5GAOr 4M7DC 5CKEA 4O6JA 3LH0A 4HA8A 4CC3A 2LQWA 4JUVA 3EFSA 4ANJA 1PWTA 1Y7XA 4VUBA 2XMFA 5A0LA 3V8KA 5KCOA 3MP6A 9ATCB 1UTIA 8ATCB 1M8VA 3VV0A 1AZGB 1Y71A 3M53A 2LVMA 3VJPA 1QCNA 1WJQA 3VS4A 3BE3A 1R77A 5HKCA 4KGVB 1VIEA 2CSIA 4HT9A 4JDSA 2CZ6B 2Y4YA 3X25B 4M75B 4J9IA 1SKUB 1ZBJA 3L2ZA 1HXDA 4PJNA 3JCMh 1YI2T 3H0HA 1FMWA 1KSWA 5KE3A 2EQKA 1ZUUA 3MPUB 2GNCA 2J7IA 4TVRA 1YJ9T 4AG2C 1N8RU 4JPBW 1B07A 3G7ZA 3CC2T 2LT4A 2E3IA 4C8QE 4PKCC 1GL5A 1U5SA 4CI0C 3JCMb 2QI2A 2EQIA 3EG9A 4M75G 2CUDA 5LJ5e 2BUDA 2LX7A 1FWZA 4EIKA 3G6EA 2QAZA 1WJSA 1YI2Q 4M7DD 3EHRA 2KE9A 4M78F 3H0IA 3AHUA 4ZNXA 2E10A 5I22A 4JRQA 3DB3A 2DXUA 1WHGA 2KBTA 3CCRA 4RCCA 3PFSA 1RAIB 2EQUA 2RQRA 3OS2A 2RH2A 3KFVA 5HK0A 1NM7A 2YSQA 1M2OA 2PU9B 2O9SA 3JCMf 1YHQA 3GP8A 2PZ1A 5IXBA 1UUEA 2DO3A 1VQ5A 2M9UA 1M1KU 3JCMP 4C5IA 1Q86R 3OW2P 1MHNA 4FM4B 2F2XA 1NPRA 1PHTA 3CCSA 3S3NA 3GOXA 2RHYA 1GCQC 2E12A 3I55A 1AZEA 1Y07A 2O31A 4N4IA 1UGSB 4KH0B 2FB7A 2V1QA 2DD5A 2DMOA 2V26A 1YJWA 2YXYA 1AWJA 1JO8A 1KHIA 1QW1A 2CUBA 4QVZA 2GF7A 2HBPA 2WSEE 4E7IA 4OMQA 1NE8A 2YLBA 2YRVA 2FL7A 1K9MC 2OTJA 4E2FB 2BE7D 1PD1A 2LQNA 2ROLA 4FYXB 3KBGA 4PJLA 1JEGA 2K3BA 1GCPA 2JS0A 2ZPIB 3F70A 1X75C 3RERA 2HDAA 5FW9A 2LCLA 2JUFA 5A0GA 3RKWA 5GAOn 2QDYB 4IUPA 4LDXA 4KULA 3QXEB 4UC4A 3QZ9B 2AHJB 4N4HA 5KYXA 3CD6Q 1QLYA 4CC7A 3RIRA 3ER0A 3URGA 1PRMC 3ULRB 1IB8A 2L8DA 1TUCA 2DK3A 3JCMJ 2GQVA 4M78E 1K76A 2FPDA 2H8HA 2XICA 3X26B 2C0OA 5CKHA 3VS7A 4N0AC 1Q81U 4LNPA 3JAME 2L3PA 3E19A 4B9XA 2DJZA 5GAOq 2F5KA 3ZFJA 4Y28E 2VASA 1BCMA 2DIGA 1NYFA 2DBKA 4KUDK 3KXTA 3BFMA 3IQLA 4ZGEB 2X4XA 1BIAA 2AIRB 1K8AC 5FU6C 1ARKA 3QWYA 1W2BS 4M78A 1VQ8A 2QQRA 5LJ3g 4AG1C 3P8HA 2YWWA 3OSSC 1KC8U 1MMAA 3X28B 2L3SA 1SHFA 5A2QE 3CPWP 4OB1B 2X35A 3FIFA 2D0NA 4M77B 2RHIA 2NUPB 3QYGB 2MOXA 3UF4A 4ZGDB 4PL6A 4FU6A 5GANj 3QYHB 4A4FA 5FROA 4EMKA 2YUOA 1QVFS 3FEOA 4A4GA 2CKKA 4FT2A 3WXMB 1WXBA 2EPDA 5M9OA 4M77G 3CC4A 2A37A 2RK1A 8AT1B 1Q81R 1IREB 2DKGA 1VQ4T 3I5RA 5GAN8 4B9WA 3VS0A 1RAAB 1UGVA 1LOJA 2KYBA 2IIMA 3REBB 4HXJA 4DQ2A 2ZPBB 1WHLA 4LUDA 5GAMj 5AT1B 5GMKl 4BE1A 3J81E 1PD0A 1JBMA 3CMAT 3CCET 5GMKe 3X24B 2QQSA 3A8LB 3TU4K 2QQ9A 3L42A 4BDYA 2DL3A 1WI7A 3H0FA 1VQ4Q 3E2UA 1TUGB 2QQBA 2W10A 1AD5A 1M90U 3S3OA 2GFUA 4GBQA 2XDDA 1BIBA 1FYNA 2DL5A 4M75E 2H3JA 2DTHA 3T9NA 2K6DA 3CMAQ 2CZ7B 4RTVA 3OYHA 4LXCA 4Z88A 3MJXA 3FLGA 4FT4A 1SSHA 3G4ST 1H3HA 2KSSA 1HYOA 4BDZA 2XHCA 1VQMA 3CCLT 2ZPEB 1Q82C 1NYGA 3ZEHA 3GPLA 1SHGA 1T0JA 4FSSA 2JOYA 5KYWB 1G83A 2D6FA 3QSUA 4BUGA 2CREA 3OYLA 1FX7A 1N9RA 4M7AG 1MV0B 4XU2A 1ZX6A 2HSPA 1QKWA 1WFWA 2DPPB 4M75A 1JJ2A 3TSZA 1XOVA 2Y4XA 5KCHA 3G4SQ 2JMAA 2JS2A 2KRSA 2QEXA 1UJ0A 3CCLQ 1C1AA 3GNGA 2OTLT 1VYVA 4PLLA 1YJNT 2L0AA 1RACB 2KQWA 4C92F 2JM8A 2C0TA 3PIPA 2LJ1A 3OW2S 4M75D 3CCVA 2P84A 3CCUT 3C4SA 2COYA 2RJFA 4JLGA 1YITA 3CPFA 1VQPT 1B34B 2JJ9A 2RD1A 1EX4A 3EG2A 1WJRA 1Z9ZA 4J83A 2K5FA 4KRTA 1D0YA 1M90R 4KH1B 1X27A 4XTYA 1UFFA 4EPCA 2OTLQ 1YJNQ 5CR2A 1OZ2A 2V8KA 2ZCFB 1SG5A 4F14A 4XU1A 1X69A 3CCQT 2YRCA 5HCKA 3CCUQ 3JB9D 5DM7R 4BI4A 1VQPQ 2JT4A 5FRNA 2QGFB 2FG0A 2LC4A 2P0KA 3CPWA 3A1PA 1QP2A 2BKDN 2JN0A 3S6WA 1MMDA 3OMCA 1VYTA 3JB9H 4IUVA 3OBYA 2J06A 5D7UA 4BD3A 1K0SA 2QA4A 3HRSA 2EGAA 1I1JA 3E9GA 5GANh 3CCQQ 2RHXA 2Y90A 2I2LA 3CC7A 4QVCA 2EJ9A 5EG2A 1KK7A 3PMIA 4OF1A 1WIEA 3X20B 1M4ZA 1G3YA 4BI3A 2PNIA 5KH6A 1BK2A 3GLXA 4RG8A 1XTDA 2EFIA 3OS5A 3THKA 4C5GA 1Q7YC 2AKLA 3MEUA 3CCMT 4QT7A 4M7DF 2VV5A 1GBRA 2C06A 2KY9A 2K7AA 2KXCA 2A3LA 5GAMh 3M4YA 1ZUYA 5IHKA 1W1FA 3RKXA 4DBHA 3J7AF 2EYQA 2CP3A 3E1SA 4J9CA 4JS4A 3VS6A 1GBQA 2K2MA 1VYUA 1NJIR 4HCCA 5GANf 3CCMQ 2A36A 3MCAB 2BE9B 2D1XA 4RTUA 3PE0A 1G3TA 4PK4A 3CPWS 3M54A 4J5YA 2PVDB 2RMOA 1CKBA 1KQ2A 1V29B 4KGZB 5FU6B 4HVWA 1W2BP 1WXTA 2VKNA 2JNGA 1K73C 2WACA 2MF2A 5J39A 1PKTA 3M57A 1RLQC 3L2VA 1PM3A 3CXCP 3RBBB 2D8JA 1N27A 4ME7A 3MP1A 2QTVA 2KI7A 5LJ5h 4RMOA 3JSCA 5CKBA 4C5EA 2DTOA 3PVQA 1D1CA 5GAMf 1YI2A 4J9EA 1VQ9T 4OMNA 2HMAA 1ZSZC 3MO8A 2BZ8A 3FJPA 3OYYA 2HSEB 5IHNA 3BDUA 1WZOA 1M2VB 1PNJA 1RI9A 1KD1U 2AKKA 1BI2A 1FMKA 3NMZC 3NPFA 1BI0A 1QVFP 3SEMA 1LNXA 4FYVB 4L59A 3TCJA 2MYSA 2E4HA 2YHTA 2LX9A 1T0HA 1ZUKA 2VB6A 4M77A 2JMCA 2NUPA 2EVRA 4GY5A 4RCBA 1N6AA 1WHKA 1VQLA 3OMGA 3CCJT 4CC2A 2M16A 5D6WA 3GNFB 4M77D 1D09B 5IN1A 3C95A 4M7DE 4ELYC 2PUKB 3M56A 1VQOT 2R58A 3SDZA 1M8MA 4Z8AA 4J7FA 5L8RE 1Q86C 1ZSGA 5LJ5f 1M1FA 4M7AC 3RESA 4IURA 1YWOA 4PFOA 2QDLA 2K3XA 3LLRA 4J9BA 3M0PA 1KHCA 2AZVA 1SPKA 5CQYA 3CCJQ 2DZCA 1PSEA 2EGEA 3VRZA 1NEGA 2DEUA 4A63B 1U1SA 1UECA 1WHJA 2KT1A 3G1JA 1YNZA 4M7DA 3NTHA 2RF0A 1H92A 2AZSA 4B6MA 4MZTA 3OYAA 4GLKA 2ZGWA 1BKBA 4C8QC 2E5KA 1KD1R 3UT1A 3EGUA 3CD6A 2DRKA 3CEYA 1UHFA 3M9QA 2DVJA 3V7CA 2HAXA 2KROA 2F1LA 1MMNA 4A4HA 1YJ9Q 3VRYA 4J9FA 1YIJA 4AFQC 3CC2Q 2KDSA 2GBQA 2O4XB 4XTZA 5I21A 3QJYA 2I0NA 1NG2A 2RNAA 1OYXA 2EYZA 2KT8A 2EJFA 4A4KA 4FIBA 5J26A 5KYWA 1QKXA 2CSQA 3V8LA 4C0DC 5C0MA 1NBEB 2X3XD 3EAEA 3VUZA 2CH4W 2E70A 2QXFA 1SRLA 2FHDA 4F7UB 2EW3A 2RM4A 4BI8B 4K11A 1VQNA 2DE0X 3FC3A 1QVPA 4WTOB 4CRIA 1N8RR 1W2BA 2O2OA 4XTUA 1B34A 4R55A 5I2SA 4LN2A 3V7RA 2K4YA 3BW1A 1W4SA 2J05A 4FW2A 3CXCA 4FSXA 2DRMA 3LGLA 1UEBA 1OU8A 4Q5WA 1A0NB 3JCMg 4J9HA 2K79A 4F7UG 1ABOA 2Z0WA 1SRMA 3M4GA 5GMKi 1S72A 4BACA 4OB0B 2DILA 4JS5A 3JB9I 1MV3A 3RMQA 2CP2A 2KYMA 3G6ET 3JCMe 3NTIA 1K9MU 5CK9A 2O01E 1PKSA 1O75A 4QW2A 1QVFA 2DTIA 2JTEA 1GCQA 2BZYA 4KBMB 2K3YA 3CCRT 1M1GA 2GQIA 1TU0B 4NOYA 4PNOA 2EYXA 4FCYA 2XKOC 4BE0A 1X6GA 3R6NA 1QVGP 2K5IA 1M1KR 5KYNA 3OA6A 1PCXA 2KRMA 4OGCA 3OS0A 3LWHA 1N9SA 2GCXA 4RTZA 2OAWA 3G6EQ 4QKUA 4PJOG 5L23A 2HNIA 1VQ7A 2K57A 4ELZC 3H8ZA 4EMGA 4JRPA 1Y0MA 3CCRQ 1M3BA 2LJ3A 3M58A 3CCST 3OYGA 1AOJA 3I55T 1EZZB 1BB9A 1LCKA 4M75F 1MGQA 4X34A 2ATCB 2CP5A 4ZGJB 2QTXA 4FYWB 1I8FA 3EGDB 4J9DA 2WSCE 1YJWT 2FYKA 3VS3A 2W0ZA 2B86A 1EFNA 1ZBXA 4MDXA 2RQTA 2P4RA 3CMAA 3REAB 1R0BG 3CXCS 1I5LA 3SWNC 3EFOB 2PVGB 1UG1A 3VS5A 3CCSQ 3META 3TEEA 5LJ3e 2KRNA 1R8OB 3JB9F 3DLLA 1GFCA 2FO0A 1PG5B 2PTKA 1RAGB 4N0AA 1AWWA 3HRUA 1YJWQ 2QG9B 3A8MB 1M3AA 3VS1A 1UB4A 4D6WA 2DJQA 1BI1A 5CO7A 3UA6A 3LWIA 2HQXA 3PVLA 1E7OA 1YFNA 2YT6A 1GFDA 2B8AA 1ZHIA 2GFAA 1Z9QA 4EMHA 3G71A 1ABQA 3JCMd 5GAN7 5FWBA 1ZSZB 3OYDA 2DNUA 4OVAA 2OX7A 3LYIA 1WNLA 5GAOp 3NHNA 1H641 4JZ3A 5IT9E 3I9QA 3QPHA 3NFCA 3OW2A 4DBQA 2A28A 2E6ZA 2MMPA 3FB9A 3MHXA 1YJNA 3I56T 1M2VA 2KGTA 4ZN3A 3LH5A 3M0SA 1VQKT 4XTXA 1M90C 2IPOB 1KQ1A 3CCUA 4RTWA 2C0IA 5CIUA 2XIDA 3OYMA 2M0OA 1PC0A 3MP8A 1KC8R 1U06A 3RUXA 1VQ8T 1RAEB 3M59A 3OYNA 1KG1A 1TOVA 4E7JA 4M7AB 2AK5A 4Y91A 4ZTJA 2DBMA 2F2VA 1BI3A 1T3LA 5A0DA 3R6OA 3M0QA 3CCEQ 3I56Q 5D6XA 1HK9A 1E6GA 2M51A 3MEAA 2LNHB 1BBZA 2QYZA 1VQKQ 2YLCA 2DLPA 2BTTA 3INZA 1OPLA 3D7SB 2K2VA 3WVDB 2MIOA 2RI2A 3PTAA 1B3QA 1FMVA 1LVKA 3EH1A 5GAN6 2HBWA 4OGEA 5LJ3d 1VQ8Q 7AT1B 3GIBA 4OMLA 5IXFA 5LJ5j 3EGXB 1VA7A 2NWMA 3SD4A 3S3MA 4IUTA 3OYFA 2COWA 1SSFA 1D0ZA 4ZN1A 5FRMA 4F04B 3CMEA 4C8QB 4OMOA 2CGHA 3CC4T 4IUQA 4RUGA 2CS7A 2NYSA 1Q82U 4DA4A 3DLMA 2ZPGB 1CSKA 3OYJA 2RK2A 2X4JA 1SF9A 1VQ6A 3VYHB 2F5TX 4JLIA 4Z89A 4E7LA 1JU5C 4C8QG 3CC4Q 2YUNA 1OZ3A 4F17A 2DFUA 4ZTFA 2M1HA 2VGMA 1AHJB 4MMLA 4C0DB 2E5QA 1M5Q1 2RA2A 1MNEA 2XDBA 2KXDA 1NJIC 4XTVA 2MCNA 5DLOA 2O4XA 1TG0A 1M3CA 3P8BB 2K9GA 3PGGA 1QCOA 4M77F 2GTOA 1WA7A 2HCKA 1KIKA 4E7SA 1J3TA 3PNWC 4HKEA 4KT0E 2F2WA 1VQMT 1YP5A 3HKSA 4PJOC 3N5BB 2RQUA 2QK0A 2SEMA 4OMMA 2A7YA 1X2KA 3QWXX 1WX6A 1D3BB 1NLPC 2E65A 2M0YA 1Q82R 1QVGS 4ATOA 5CCAA 1OEBA 2E6NA 4O5VA 1TS9A 1VQMQ 4J8OA 4BB7A 1IHWA 5GAOm 3CCVT 1YITT 2KMTA 3BY7A 3UWNA 4HCBA 1QWEA 3A98A 1X6OA 3M5AA 3C0CA 4JJCA 2M02A 4C92C 1ZA1B 1C0MA 3QO3A 4LDVA 4D8KA 1G3WA 3V8JA 3JV3A 1Q7YU 4MDWA 2FRYA 3HTRA 5CKDA 3JCMV 1Y57A 3VKIA 4PJOD 1T3SA 3U23A 4NL2A 2J6FA 3QG1A 1YCSB 3PIOA 2YRDA 4C0FA 2J6KA 2V8JA 2BIVA 2D9TA 4DBRA 4M78G 2V8IA 3OBWA 4D8DA 5KE2A 1NPPA 4M77E 4AFUC 4E47A 3M0RA 4IIOA 1G8XA 4OB2B 1KJWA 3SWNB 2ED1A 4QQ6A 3CC7T 1IGQA 2GTJA 4RTTA 4BE2A 3O5ZA 2EYWA 3EGDA 2HKNA 2QGGA 4PLIA 1OU9A 5DY9A 1YJ9A 2RHZA 4NL3A 1KD1C 4HT8A 4P5NA 4FYYB 5GANg 3L2QA 1K73U 3CC2A 1MUZA 1V1CA 2DVEA 4AMCA 2LTOA 3EFOA 1M9SA 1I5OB 2FZCB 1YWPA 3QHSA 2EAYA 3AT1B 1OX8A 2QQAA 1VQ9Q 2EKHA 4DEYA 2FRWA 1LPLA 2NLUA 1Q7YR 3L1AA 4E7ZA 4C0GA 2WSFE 2DL8A 5IH2A 1BU1A 5GMKj 2HQEA 2EKOA 1WXUA 2CDTA 2X4YA 4BY6C 4XK8E 1UE9A 1XNIA 4MMKA 3L2RA 2FPFA 1X6BA 3TREA 5GAMg 4AT1B 4OP0A 1NLOC 2LDMA 1ZSZA 4XU3A 1VIFA 3LW5E 2VGNA 1K0XA 5FU7C 1OULA 5J3BA 3MKDA 2HKQB 2JM9A 2V1RA 2RQWA 5GAMe 1IO6A 1QMCA 1TXQA 2XU8A 4M7AE 1KQSP 2MWOA 1WQ7A 5GJVB 1VQOQ 2DERA 1GXIE 1WGSA 1N8RC 1Q86U 2YUQA 2NUTB 4A53A 1YBYA 1B7TA 5GJWB 1ACMB 4LDYA 4KUIA 5ECAA 5AYFA 1M27C 1K73R 2JXBA 1JXMA 4XQ3A 1OV3A 4R0KA 1RUWA 3UPUA 2LP5A 2XK0A 4M7AA 5LJ5g 2L3RA 2LCCA 2P0QA 3ZL7C 1NZ9A 1C6VX 4WCIA 1H3ZA 1IRXA 2HZYA 2P0PA 4JJDA 4RKUE 3VS2A 2PQWA 4AFSC 1K4US 3GF5A 3LGFA 1I07A 1KFZA 1G5VA 4M7AD 5KYYB 1M1KC 5GANd 3L2UA 1VQLT 3EGXA 4X9DA 3JCMW 1SEMA 2DETA 3QDRB 4II1A 5HY6A 3UA7A 5CAIA 3O8VA 1WHMA 4DOWA 4C8QA 3GBQA 3RR6A 3VYGA 3RNJA 3OYIA 2L89A 2MI6A 3JB9G 2LQKA 1HD3A 1QP3A 3HFNA 1VQLQ 2ROTA 1QQJA 2CZ0B 1RLPC 5D6YA 4C8QD 5LJ3h 1OI1A 2LNVA 2DL4A 5GAMd 1D1AA 2JTFA 3HRTA 2JTMA 4RG2A 4EDUA 1WYXA 3I35A 1HJDA 1D0XA 3PT9A 2FEIA 1XQHA 1DJ7B 3CD6T 2D8HA 1W6XA 3C94A 1XJWB 4PJOB 1RAFB 1RAHB 2CT4A 3RKYA 2O88A 2R5AA 4C5HA 4HCKA 2HD0A 2K5LA 3HL8A 4XTWA 1YIJT 2KNBB 2DM1A 4LDWA 1TH7A 3HP9A 3BDLA 5FWCA 5LL6S 2R57A 2ZZDA 2GGRA 1Y96B 3FJ5A 4M78C 1Q81C 1YHQT 1YN8A 2MAMA 5LJ3f 5KYUB 4PFZA 1VQ5T 5LJ5d 5GMKh 3LX7A 4DEXA 1JJ2P 2EWNA 4C0ZA 1D3BA 2RPNA 1YIJQ 1VQ4A 4MZMA 2ABLA 5GAN5 2KK4A 2FVUA 1TSFA 1WHHA 3WVEB 3CQTA 1I4K1 1TUDA 2L5QA 1YHQQ 2ZPHB 4C92B 2DD4A 2FPEA 2JW4A 2RI3A 1VQNT 2FZKB 3NGPA 4EMKC 2DXBA 1VQ5Q 4LDUA 1KQSA 4ORZA 1KC8C 2OAUA 2CP7A 3CCEA 3I56A 2LRQA 2OTJT 3HFOA 1VQKA 4QVDA 4J6XA 5GAOl 4L5GA 4R56A 1K9AA 1F1BB 2OJ2A 1ZQ1A 2QASA 3I55Q 3QUIA 4WF2A 1MMGA 1K8AU 1UGPB 6AT1B 3OS1A 1K9MR 5IAYA 2X4WA 2RQVA 4C92G 1S72T 1VQNQ 3OYKA 1WLPB 2BZXA 2COZA 3ASKA 1FXXA 2L3QA 4CC4B 1U3OA 2OTJQ 4M78D 4N4GA 3G4SA 4J7IA 1G3SA 2DZ9A 2VUBA 1I81A 4M4ZA 4QQGA 2YUPA 3OSVA 3MEWA 3CCLA 2XD0A 1OPKA 5HK3A 3EG3A 2OI3A 2RB6A 1TTHB 2EQMA 1P92A 3SHWA 1QCFA 3UDCA 1S72Q 4JRIA 4X1VA 2ENMA 2DXCA 2VVKA 3SWNA 1UDLA 4NS5A 1VQ7T 3C12A 1V76A 2LJ0A 4E6RA 1UHCA 4F7UF 4YTLA 1IXDA 2A0FB 1UGRB 2OTLA 2VC8A 4XAXB 2HL3A 2DXTA 1OX9A 4LUEA 2E41A 2RI5A 3JB9J 1VQPA 4MZPA 1KQSS 4ESRA 1JB0E 4BY6B 2RJDA 4Z02A 5IHIA 2CH4A 3H9NA 4HVUA 4M7DB 3EHQA 3EH2A 3H41A 2ED0A 5I11A 1VQ7Q 4E7HA 2IG0A 2RN8A 2MWPA 1K8AR 2EJGA 4M75C 2CT3A 2ZAEA 1O9SA 2DL7A 3CBOA 3ZBDA 1QWFA 5FU7B 2O9VA 2EQJA 3JCMc 3QDFA 3EG9B 3CCQA 4GLMA 4PJOF 4E7KA 2NUZA 1UGQB 1PRLC 4IKFA 1ZLMA 1HSQA 3NTKA 4J9GA 2CP0A 4Y92A 4M7DG 1N5ZA 4X9CA 3OYBA 5I2MA 4A54A 1H8KA 2PVOB 2CP6A 3KUFA 1U8RA 4DBFA 2YDLA 3G71T 2RJCA 1QVGA 4A4EA 1AEYA 2X51A 2RO0A 4LE9A 2FZGB 2DX1A 2NUTA 2L2PA 5CVIA 3RMSA 2KAFA 3ME9A 2E64A 3EG1A 1VOMA 2DEQA 3A8HB 4FL6A 3SB2A
chains in the Genus database with same CATH topology
4JJBA 2SRCA 4AG1C 4D8DA 2ECZA 2I0NA 1NG2A 2RNAA 4RTXA 4AFUC 2L3SA 2ESWA 1SHFA 2EYZA 2A08A 2KT8A 3M0RA 4IIOA 1KJWA 2ED1A 2EYYA 1QKXA 2CSQA 2D0NA 2GTJA 4RTTA 3O5ZA 2EYWA 1NEBA 2VWFA 1GRIA 1I0CA 1K1ZA 2MOXA 2X3XD 3UF4A 2J6OA 2CH4W 1SRLA 2EGCA 2YUOA 1WDXA 2EW3A 3M0TA 1MUZA 1V1CA 1CKAA 1AVZC 4K11A 2DE0X 1WXBA 1YWPA 2EPDA 2LCSA 2X3WD 2O2OA 2A37A 2EKHA 4DEYA 4LN2A 2FRWA 4JZ4A 5EC7A 3I5RA 3TSWA 2J05A 4IIMA 1JQQA 2DL8A 2DRMA 5IH2A 1BU1A 4F16A 3VS0A 1UGVA 1A0NB 4J9HA 4RTYA 1WXUA 2CDTA 1ABOA 2K79A 2KYBA 1SRMA 2IIMA 3REBB 1S1NA 1AWXA 1UE9A 4HXJA 3I5SA 4LUDA 2FPFA 1X6BA 2DILA 1NLOC 1MV3A 2KYMA 1K0XA 2LMJA 3UATA 1PKSA 1OOTA 2DL3A 2JTEA 1GCQA 2BZYA 1WI7A 3H0FA 2JM9A 2V1RA 2RQWA 1IO6A 2W10A 1AD5A 2GQIA 2EYXA 4GBQA 1X6GA 5GJVB 3R6NA 1FYNA 2DL5A 2EBPA 2YUQA 2KRMA 4RTZA 2K6DA 2OAWA 4RTVA 4Z88A 5GJWB 5L23A 1SSHA 1UJYA 5ECAA 1H3HA 1M27C 2DYBA 1G2BA 2JXBA 1Y0MA 1JXMA 1M3BA 1OV3A 2G6FX 1NYGA 2LJ3A 4R0KA 1SHGA 1AOJA 1T0JA 4FSSA 1M30A 1RUWA 1LCKA 1BB9A 1G83A 2LP5A 2CREA 4OMPA 2KR3A 2HEQA 3ZL7C 1MV0B 4J9DA 1ZX6A 4WCIA 3TVTA 2HSPA 1QKWA 4JJDA 3VS3A 2W0ZA 1WFWA 2B86A 1EFNA 3TSZA 2RQTA 1XOVA 2P4RA 3VS2A 4AFSC 1K4US 3REAB 2JMAA 2JS2A 2KRSA 1I07A 1UJ0A 1KFZA 1W70A 3EG0A 1JXOA 1VYVA 1UG1A 2L0AA 3VS5A 2JM8A 2KEAA 2C0TA 2KRNA 2LJ1A 2DA9A 1SEMA 1GFCA 2FO0A 2PTKA 3UA7A 3EG2A 2DF6A 1AWWA 1X43A 1Z9ZA 1M3AA 3VS1A 1X2QA 2DJQA 4KRTA 3GBQA 3UA6A 1X27A 3PVLA 2LZ6B 3RNJA 1E7OA 1HD3A 1UFFA 2YT6A 1GFDA 1Z9QA 2ROTA 4F14A 1AWOA 1ABQA 1X69A 5FWBA 1RLPC 5HCKA 2DNUA 2JT4A 2DL4A 2FG0A 3NHNA 1E6HA 4JZ3A 4HVVA 4AFZC 3I9QA 1WYXA 3I35A 1VYTA 1HJDA 3M0UA 2A28A 2J06A 2FEIA 1K0SA 4CC3A 2LQWA 2D8HA 1W6XA 1PWTA 2EGAA 2CT4A 1I1JA 2KGTA 3LH5A 2XMFA 2O88A 3M0SA 1UTIA 4HCKA 4RTWA 2C0IA 1AZGB 2KNBB 2DM1A 1U06A 1WIEA 2PNIA 3VS4A 5FWCA 1BK2A 2AK5A 2GGRA 2DBMA 3FJ5A 2F2VA 1T3LA 2CSIA 3M0QA 3THKA 1YN8A 2AKLA 1E6GA 2M51A 4J9IA 4QT7A 2LNHB 1ZBJA 1BBZA 4DEXA 1GBRA 2DLPA 2BTTA 1OPLA 2K7AA 3H0HA 2KXCA 2MIOA 1KSWA 1B3QA 1ZUUA 2GNCA 2RPNA 2J7IA 2HBWA 2ABLA 4OMLA 1ZUYA 4AG2C 5IXFA 5IHKA 1W1FA 4JPBW 1B07A 1VA7A 2NWMA 3CQTA 4J9CA 1TUDA 3VS6A 1GL5A 1U5SA 1GBQA 2K2MA 1VYUA 2FPEA 2JW4A 2EQIA 3NGPA 2A36A 2D1XA 4RTUA 4ORZA 2CUDA 3PE0A 2LX7A 4OMOA 4EIKA 4RUGA 3EHRA 2KE9A 3H0IA 4ZNXA 5I22A 1K9AA 2OJ2A 2RMOA 1CSKA 2KBTA 1CKBA 2RQRA 4HVWA 3KFVA 1NM7A 1WXTA 2YSQA 2VKNA 2RQVA 1PKTA 1WLPB 2O9SA 4Z89A 2BZXA 1JU5C 1RLQC 2PZ1A 2L3QA 5IXBA 1UUEA 4CC4B 3RBBB 2D8JA 2YUNA 1U3OA 4F17A 3PVQA 4M4ZA 2YUPA 4J9EA 4OMNA 1OPKA 2BZ8A 2F2XA 2KXDA 3EG3A 1PHTA 2OI3A 5IHNA 2MCNA 1TG0A 1M3CA 1GCQC 1AZEA 2K9GA 1PNJA 1RI9A 2O31A 3SHWA 2AKKA 1QCFA 1FMKA 2GTOA 3NMZC 3NPFA 1WA7A 2V1QA 2HCKA 4X1VA 3SEMA 1KIKA 2ENMA 2VVKA 2DMOA 1J3TA 1UDLA 1AWJA 1JO8A 1T0HA 1ZUKA 2CUBA 2JMCA 2F2WA 4OMQA 2EVRA 2LJ0A 4E6RA 1UHCA 1YP5A 2RQUA 2LQNA 2ROLA 2SEMA 4OMMA 4CC2A 1X2KA 1JEGA 3QWXX 2K3BA 4LUEA 1GCPA 1WX6A 2JS0A 1NLPC 4ESRA 2M0YA 1M8MA 2HDAA 4Z8AA 5FW9A 1OEBA 5IHIA 1ZSGA 2CH4A 4HVUA 1YWOA 3EHQA 3H41A 2ED0A 5I11A 2QDLA 4J9BA 2RN8A 3M0PA 1QLYA 4CC7A 2CT3A 2AZVA 2DL7A 1SPKA 1QWFA 1PRMC 2O9VA 2EGEA 3ULRB 3VRZA 1NEGA 1TUCA 4A63B 4GLMA 2NUZA 1PRLC 1ZLMA 1K76A 1UECA 2FPDA 1HSQA 2H8HA 2KT1A 1QWEA 3A98A 1YNZA 3C0CA 4JJCA 2C0OA 4J9GA 4Y92A 1N5ZA 2RF0A 1H92A 3VS7A 4D8KA 1H8KA 2AZSA 4LNPA 3JV3A 2L3PA 2FRYA 2E5KA 2YDLA 3EGUA 2DRKA 1Y57A 1UHFA 1AEYA 4LE9A 1NYFA 1T3SA 2DBKA 2DVJA 3U23A 2DX1A 3IQLA 2KROA 2L2PA 2J6FA 1YCSB 3VRYA 1ARKA 3QWYA 2J6KA 4J9FA 3EG1A 4AFQC 2GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJB A;  2SRC A;  4AG1 C;  4D8D A;  2ECZ A;  2I0N A;  1NG2 A;  2RNA A;  4RTX A;  4AFU C;  2L3S A;  2ESW A;  1SHF A;  2EYZ A;  2A08 A;  2KT8 A;  3M0R A;  4IIO A;  1KJW A;  2ED1 A;  2EYY A;  1QKX A;  2CSQ A;  2D0N A;  2GTJ A;  4RTT A;  3O5Z A;  2EYW A;  1NEB A;  2VWF A;  1GRI A;  1I0C A;  1K1Z A;  2MOX A;  2X3X D;  3UF4 A;  2J6O A;  2CH4 W;  1SRL A;  2EGC A;  2YUO A;  1WDX A;  2EW3 A;  3M0T A;  1MUZ A;  1V1C A;  1CKA A;  1AVZ C;  4K11 A;  2DE0 X;  1WXB A;  1YWP A;  2EPD A;  2LCS A;  2X3W D;  2O2O A;  2A37 A;  2EKH A;  4DEY A;  4LN2 A;  2FRW A;  4JZ4 A;  5EC7 A;  3I5R A;  3TSW A;  2J05 A;  4IIM A;  1JQQ A;  2DL8 A;  2DRM A;  5IH2 A;  1BU1 A;  4F16 A;  3VS0 A;  1UGV A;  1A0N B;  4J9H A;  4RTY A;  1WXU A;  2CDT A;  1ABO A;  2K79 A;  2KYB A;  1SRM A;  2IIM A;  3REB B;  1S1N A;  1AWX A;  1UE9 A;  4HXJ A;  3I5S A;  4LUD A;  2FPF A;  1X6B A;  2DIL A;  1NLO C;  1MV3 A;  2KYM A;  1K0X A;  2LMJ A;  3UAT A;  1PKS A;  1OOT A;  2DL3 A;  2JTE A;  1GCQ A;  2BZY A;  1WI7 A;  3H0F A;  2JM9 A;  2V1R A;  2RQW A;  1IO6 A;  2W10 A;  1AD5 A;  2GQI A;  2EYX A;  4GBQ A;  1X6G A;  5GJV B;  3R6N A;  1FYN A;  2DL5 A;  2EBP A;  2YUQ A;  2KRM A;  4RTZ A;  2K6D A;  2OAW A;  4RTV A;  4Z88 A;  5GJW B;  5L23 A;  1SSH A;  1UJY A;  5ECA A;  1H3H A;  1M27 C;  2DYB A;  1G2B A;  2JXB A;  1Y0M A;  1JXM A;  1M3B A;  1OV3 A;  2G6F X;  1NYG A;  2LJ3 A;  4R0K A;  1SHG A;  1AOJ A;  1T0J A;  4FSS A;  1M30 A;  1RUW A;  1LCK A;  1BB9 A;  1G83 A;  2LP5 A;  2CRE A;  4OMP A;  2KR3 A;  2HEQ A;  3ZL7 C;  1MV0 B;  4J9D A;  1ZX6 A;  4WCI A;  3TVT A;  2HSP A;  1QKW A;  4JJD A;  3VS3 A;  2W0Z A;  1WFW A;  2B86 A;  1EFN A;  3TSZ A;  2RQT A;  1XOV A;  2P4R A;  3VS2 A;  4AFS C;  1K4U S;  3REA B;  2JMA A;  2JS2 A;  2KRS A;  1I07 A;  1UJ0 A;  1KFZ A;  1W70 A;  3EG0 A;  1JXO A;  1VYV A;  1UG1 A;  2L0A A;  3VS5 A;  2JM8 A;  2KEA A;  2C0T A;  2KRN A;  2LJ1 A;  2DA9 A;  1SEM A;  1GFC A;  2FO0 A;  2PTK A;  3UA7 A;  3EG2 A;  2DF6 A;  1AWW A;  1X43 A;  1Z9Z A;  1M3A A;  3VS1 A;  1X2Q A;  2DJQ A;  4KRT A;  3GBQ A;  3UA6 A;  1X27 A;  3PVL A;  2LZ6 B;  3RNJ A;  1E7O A;  1HD3 A;  1UFF A;  2YT6 A;  1GFD A;  1Z9Q A;  2ROT A;  4F14 A;  1AWO A;  1ABQ A;  1X69 A;  5FWB A;  1RLP C;  5HCK A;  2DNU A;  2JT4 A;  2DL4 A;  2FG0 A;  3NHN A;  1E6H A;  4JZ3 A;  4HVV A;  4AFZ C;  3I9Q A;  1WYX A;  3I35 A;  1VYT A;  1HJD A;  3M0U A;  2A28 A;  2J06 A;  2FEI A;  1K0S A;  4CC3 A;  2LQW A;  2D8H A;  1W6X A;  1PWT A;  2EGA A;  2CT4 A;  1I1J A;  2KGT A;  3LH5 A;  2XMF A;  2O88 A;  3M0S A;  1UTI A;  4HCK A;  4RTW A;  2C0I A;  1AZG B;  2KNB B;  2DM1 A;  1U06 A;  1WIE A;  2PNI A;  3VS4 A;  5FWC A;  1BK2 A;  2AK5 A;  2GGR A;  2DBM A;  3FJ5 A;  2F2V A;  1T3L A;  2CSI A;  3M0Q A;  3THK A;  1YN8 A;  2AKL A;  1E6G A;  2M51 A;  4J9I A;  4QT7 A;  2LNH B;  1ZBJ A;  1BBZ A;  4DEX A;  1GBR A;  2DLP A;  2BTT A;  1OPL A;  2K7A A;  3H0H A;  2KXC A;  2MIO A;  1KSW A;  1B3Q A;  1ZUU A;  2GNC A;  2RPN A;  2J7I A;  2HBW A;  2ABL A;  4OML A;  1ZUY A;  4AG2 C;  5IXF A;  5IHK A;  1W1F A;  4JPB W;  1B07 A;  1VA7 A;  2NWM A;  3CQT A;  4J9C A;  1TUD A;  3VS6 A;  1GL5 A;  1U5S A;  1GBQ A;  2K2M A;  1VYU A;  2FPE A;  2JW4 A;  2EQI A;  3NGP A;  2A36 A;  2D1X A;  4RTU A;  4ORZ A;  2CUD A;  3PE0 A;  2LX7 A;  4OMO A;  4EIK A;  4RUG A;  3EHR A;  2KE9 A;  3H0I A;  4ZNX A;  5I22 A;  1K9A A;  2OJ2 A;  2RMO A;  1CSK A;  2KBT A;  1CKB A;  2RQR A;  4HVW A;  3KFV A;  1NM7 A;  1WXT A;  2YSQ A;  2VKN A;  2RQV A;  1PKT A;  1WLP B;  2O9S A;  4Z89 A;  2BZX A;  1JU5 C;  1RLQ C;  2PZ1 A;  2L3Q A;  5IXB A;  1UUE A;  4CC4 B;  3RBB B;  2D8J A;  2YUN A;  1U3O A;  4F17 A;  3PVQ A;  4M4Z A;  2YUP A;  4J9E A;  4OMN A;  1OPK A;  2BZ8 A;  2F2X A;  2KXD A;  3EG3 A;  1PHT A;  2OI3 A;  5IHN A;  2MCN A;  1TG0 A;  1M3C A;  1GCQ C;  1AZE A;  2K9G A;  1PNJ A;  1RI9 A;  2O31 A;  3SHW A;  2AKK A;  1QCF A;  1FMK A;  2GTO A;  3NMZ C;  3NPF A;  1WA7 A;  2V1Q A;  2HCK A;  4X1V A;  3SEM A;  1KIK A;  2ENM A;  2VVK A;  2DMO A;  1J3T A;  1UDL A;  1AWJ A;  1JO8 A;  1T0H A;  1ZUK A;  2CUB A;  2JMC A;  2F2W A;  4OMQ A;  2EVR A;  2LJ0 A;  4E6R A;  1UHC A;  1YP5 A;  2RQU A;  2LQN A;  2ROL A;  2SEM A;  4OMM A;  4CC2 A;  1X2K A;  1JEG A;  3QWX X;  2K3B A;  4LUE A;  1GCP A;  1WX6 A;  2JS0 A;  1NLP C;  4ESR A;  2M0Y A;  1M8M A;  2HDA A;  4Z8A A;  5FW9 A;  1OEB A;  5IHI A;  1ZSG A;  2CH4 A;  4HVU A;  1YWO A;  3EHQ A;  3H41 A;  2ED0 A;  5I11 A;  2QDL A;  4J9B A;  2RN8 A;  3M0P A;  1QLY A;  4CC7 A;  2CT3 A;  2AZV A;  2DL7 A;  1SPK A;  1QWF A;  1PRM C;  2O9V A;  2EGE A;  3ULR B;  3VRZ A;  1NEG A;  1TUC A;  4A63 B;  4GLM A;  2NUZ A;  1PRL C;  1ZLM A;  1K76 A;  1UEC A;  2FPD A;  1HSQ A;  2H8H A;  2KT1 A;  1QWE A;  3A98 A;  1YNZ A;  3C0C A;  4JJC A;  2C0O A;  4J9G A;  4Y92 A;  1N5Z A;  2RF0 A;  1H92 A;  3VS7 A;  4D8K A;  1H8K A;  2AZS A;  4LNP A;  3JV3 A;  2L3P A;  2FRY A;  2E5K A;  2YDL A;  3EGU A;  2DRK A;  1Y57 A;  1UHF A;  1AEY A;  4LE9 A;  1NYF A;  1T3S A;  2DBK A;  2DVJ A;  3U23 A;  2DX1 A;  3IQL A;  2KRO A;  2L2P A;  2J6F A;  1YCS B;  3VRY A;  1ARK A;  3QWY A;  2J6K A;  4J9F A;  3EG1 A;  4AFQ C;  2GBQ A; 
#chains in the Genus database with same CATH topology
 2RHU A;  3OYC A;  3OB9 A;  4JJB A;  2SRC A;  3HPW A;  2ECZ A;  4RTX A;  2ESW A;  3G71 Q;  2A08 A;  3CCM A;  4FW1 A;  2EYY A;  3CBM A;  2VWF A;  1NEB A;  1GRI A;  1I0C A;  4V2S A;  1K1Z A;  2XDP A;  2DIQ A;  4PJM A;  4F7U E;  4JRK A;  1RAD B;  1BYM A;  1IZ6 A;  4IUU A;  2J6O A;  3PMT A;  3MEV A;  3JCM Q;  3VUB A;  2EGC A;  2JZ2 A;  4KGX B;  5GAN 3;  4OB3 B;  4QQD A;  1WDX A;  3FRN A;  3CBP A;  3QII A;  3M0T A;  5KYY A;  3A8O B;  1ZA2 B;  1CKA A;  1AVZ C;  3OYE A;  1RI0 A;  2LCS A;  2X3W D;  2EIF A;  2MPX C;  3QJ6 A;  2X9H A;  1NJI U;  3HSB A;  5KYX B;  4JZ4 A;  5EC7 A;  1TWB A;  3TSW A;  5GAN 4;  4IIM A;  1Q95 G;  2F69 A;  1JQQ A;  3FDR A;  3QZ5 B;  4F16 A;  4F7U A;  2KVQ G;  4RTY A;  3HHT B;  2HL5 C;  3L2W A;  1S1N A;  1AWX A;  4PJO E;  3I5S A;  3CME T;  2VXF A;  1OQK A;  4L6V 5;  3SFM A;  3JRZ A;  4J6Y A;  1VUB A;  3J80 E;  1D1B A;  5CKF A;  2QEX T;  2LMJ A;  3UAT A;  1AT1 B;  1EIF A;  2HQH A;  1OOT A;  5GAN 2;  1VQ9 A;  1JJ2 S;  2PUO B;  4DOV A;  1VQ6 T;  2CYZ B;  3EFR A;  2ZPF B;  3V7S A;  5FLX E;  3DB4 A;  3M55 A;  2EBP A;  1MND A;  2LQ8 A;  3CME Q;  4HCZ A;  4PJO A;  4M78 B;  2QEX Q;  2G3R A;  1BCO A;  2R5M A;  2DAQ A;  2CZ1 B;  1UJY A;  4PFP A;  1YCY A;  3OQ5 A;  3QKJ A;  2DYB A;  4M7A F;  1G2B A;  5C6S A;  1IHV A;  3CCV Q;  2G6F X;  3CCJ A;  2XI9 A;  1M30 A;  1RL2 A;  1YIT Q;  4C92 E;  2MK5 A;  5DLQ E;  1VQ6 Q;  2E3H A;  4PJJ A;  1Y96 A;  4OMP A;  2KR3 A;  2HEQ A;  1VQO A;  2P4T A;  1LJO A;  3TVT A;  5KYU A;  5LJ3 j;  2JVV A;  4EMK B;  2D0Q B;  1W70 A;  3EG0 A;  2QA4 T;  1JXO A;  1R0C B;  4M77 C;  3TQ7 P;  2KEA A;  3RDV A;  2XG8 D;  4J6W A;  2DA9 A;  4LD6 A;  2H3E B;  2VXE A;  2E1H A;  4C8Q F;  3A5Z B;  1X01 A;  2LT1 A;  3A8G B;  4OMF B;  4C92 A;  3DKM A;  2DF6 A;  1X43 A;  1X2Q A;  1U1T A;  1RAB B;  1PSF A;  5GMK m;  2LZ6 B;  1WQW A;  4JJN K;  2QA4 Q;  2RJE A;  4XU0 A;  4C92 D;  3Q1J A;  5GAN e;  3CC7 Q;  3JCM X;  1AWO A;  3VU3 C;  2DYI A;  3P8D A;  3QBY A;  2IVW A;  3OY9 A;  1IGU A;  2AT1 B;  1JRI A;  1WPY A;  1E6H A;  3H6Z A;  4HVV A;  4AFZ C;  4LD9 K;  3E9F A;  5CQX A;  2VYT A;  3M0U A;  5GAO r;  4M7D C;  5CKE A;  4O6J A;  3LH0 A;  4HA8 A;  4CC3 A;  2LQW A;  4JUV A;  3EFS A;  4ANJ A;  1PWT A;  1Y7X A;  4VUB A;  2XMF A;  5A0L A;  3V8K A;  5KCO A;  3MP6 A;  9ATC B;  1UTI A;  8ATC B;  1M8V A;  3VV0 A;  1AZG B;  1Y71 A;  3M53 A;  2LVM A;  3VJP A;  1QCN A;  1WJQ A;  3VS4 A;  3BE3 A;  1R77 A;  5HKC A;  4KGV B;  1VIE A;  2CSI A;  4HT9 A;  4JDS A;  2CZ6 B;  2Y4Y A;  3X25 B;  4M75 B;  4J9I A;  1SKU B;  1ZBJ A;  3L2Z A;  1HXD A;  4PJN A;  3JCM h;  1YI2 T;  3H0H A;  1FMW A;  1KSW A;  5KE3 A;  2EQK A;  1ZUU A;  3MPU B;  2GNC A;  2J7I A;  4TVR A;  1YJ9 T;  4AG2 C;  1N8R U;  4JPB W;  1B07 A;  3G7Z A;  3CC2 T;  2LT4 A;  2E3I A;  4C8Q E;  4PKC C;  1GL5 A;  1U5S A;  4CI0 C;  3JCM b;  2QI2 A;  2EQI A;  3EG9 A;  4M75 G;  2CUD A;  5LJ5 e;  2BUD A;  2LX7 A;  1FWZ A;  4EIK A;  3G6E A;  2QAZ A;  1WJS A;  1YI2 Q;  4M7D D;  3EHR A;  2KE9 A;  4M78 F;  3H0I A;  3AHU A;  4ZNX A;  2E10 A;  5I22 A;  4JRQ A;  3DB3 A;  2DXU A;  1WHG A;  2KBT A;  3CCR A;  4RCC A;  3PFS A;  1RAI B;  2EQU A;  2RQR A;  3OS2 A;  2RH2 A;  3KFV A;  5HK0 A;  1NM7 A;  2YSQ A;  1M2O A;  2PU9 B;  2O9S A;  3JCM f;  1YHQ A;  3GP8 A;  2PZ1 A;  5IXB A;  1UUE A;  2DO3 A;  1VQ5 A;  2M9U A;  1M1K U;  3JCM P;  4C5I A;  1Q86 R;  3OW2 P;  1MHN A;  4FM4 B;  2F2X A;  1NPR A;  1PHT A;  3CCS A;  3S3N A;  3GOX A;  2RHY A;  1GCQ C;  2E12 A;  3I55 A;  1AZE A;  1Y07 A;  2O31 A;  4N4I A;  1UGS B;  4KH0 B;  2FB7 A;  2V1Q A;  2DD5 A;  2DMO A;  2V26 A;  1YJW A;  2YXY A;  1AWJ A;  1JO8 A;  1KHI A;  1QW1 A;  2CUB A;  4QVZ A;  2GF7 A;  2HBP A;  2WSE E;  4E7I A;  4OMQ A;  1NE8 A;  2YLB A;  2YRV A;  2FL7 A;  1K9M C;  2OTJ A;  4E2F B;  2BE7 D;  1PD1 A;  2LQN A;  2ROL A;  4FYX B;  3KBG A;  4PJL A;  1JEG A;  2K3B A;  1GCP A;  2JS0 A;  2ZPI B;  3F70 A;  1X75 C;  3RER A;  2HDA A;  5FW9 A;  2LCL A;  2JUF A;  5A0G A;  3RKW A;  5GAO n;  2QDY B;  4IUP A;  4LDX A;  4KUL A;  3QXE B;  4UC4 A;  3QZ9 B;  2AHJ B;  4N4H A;  5KYX A;  3CD6 Q;  1QLY A;  4CC7 A;  3RIR A;  3ER0 A;  3URG A;  1PRM C;  3ULR B;  1IB8 A;  2L8D A;  1TUC A;  2DK3 A;  3JCM J;  2GQV A;  4M78 E;  1K76 A;  2FPD A;  2H8H A;  2XIC A;  3X26 B;  2C0O A;  5CKH A;  3VS7 A;  4N0A C;  1Q81 U;  4LNP A;  3JAM E;  2L3P A;  3E19 A;  4B9X A;  2DJZ A;  5GAO q;  2F5K A;  3ZFJ A;  4Y28 E;  2VAS A;  1BCM A;  2DIG A;  1NYF A;  2DBK A;  4KUD K;  3KXT A;  3BFM A;  3IQL A;  4ZGE B;  2X4X A;  1BIA A;  2AIR B;  1K8A C;  5FU6 C;  1ARK A;  3QWY A;  1W2B S;  4M78 A;  1VQ8 A;  2QQR A;  5LJ3 g;  4AG1 C;  3P8H A;  2YWW A;  3OSS C;  1KC8 U;  1MMA A;  3X28 B;  2L3S A;  1SHF A;  5A2Q E;  3CPW P;  4OB1 B;  2X35 A;  3FIF A;  2D0N A;  4M77 B;  2RHI A;  2NUP B;  3QYG B;  2MOX A;  3UF4 A;  4ZGD B;  4PL6 A;  4FU6 A;  5GAN j;  3QYH B;  4A4F A;  5FRO A;  4EMK A;  2YUO A;  1QVF S;  3FEO A;  4A4G A;  2CKK A;  4FT2 A;  3WXM B;  1WXB A;  2EPD A;  5M9O A;  4M77 G;  3CC4 A;  2A37 A;  2RK1 A;  8AT1 B;  1Q81 R;  1IRE B;  2DKG A;  1VQ4 T;  3I5R A;  5GAN 8;  4B9W A;  3VS0 A;  1RAA B;  1UGV A;  1LOJ A;  2KYB A;  2IIM A;  3REB B;  4HXJ A;  4DQ2 A;  2ZPB B;  1WHL A;  4LUD A;  5GAM j;  5AT1 B;  5GMK l;  4BE1 A;  3J81 E;  1PD0 A;  1JBM A;  3CMA T;  3CCE T;  5GMK e;  3X24 B;  2QQS A;  3A8L B;  3TU4 K;  2QQ9 A;  3L42 A;  4BDY A;  2DL3 A;  1WI7 A;  3H0F A;  1VQ4 Q;  3E2U A;  1TUG B;  2QQB A;  2W10 A;  1AD5 A;  1M90 U;  3S3O A;  2GFU A;  4GBQ A;  2XDD A;  1BIB A;  1FYN A;  2DL5 A;  4M75 E;  2H3J A;  2DTH A;  3T9N A;  2K6D A;  3CMA Q;  2CZ7 B;  4RTV A;  3OYH A;  4LXC A;  4Z88 A;  3MJX A;  3FLG A;  4FT4 A;  1SSH A;  3G4S T;  1H3H A;  2KSS A;  1HYO A;  4BDZ A;  2XHC A;  1VQM A;  3CCL T;  2ZPE B;  1Q82 C;  1NYG A;  3ZEH A;  3GPL A;  1SHG A;  1T0J A;  4FSS A;  2JOY A;  5KYW B;  1G83 A;  2D6F A;  3QSU A;  4BUG A;  2CRE A;  3OYL A;  1FX7 A;  1N9R A;  4M7A G;  1MV0 B;  4XU2 A;  1ZX6 A;  2HSP A;  1QKW A;  1WFW A;  2DPP B;  4M75 A;  1JJ2 A;  3TSZ A;  1XOV A;  2Y4X A;  5KCH A;  3G4S Q;  2JMA A;  2JS2 A;  2KRS A;  2QEX A;  1UJ0 A;  3CCL Q;  1C1A A;  3GNG A;  2OTL T;  1VYV A;  4PLL A;  1YJN T;  2L0A A;  1RAC B;  2KQW A;  4C92 F;  2JM8 A;  2C0T A;  3PIP A;  2LJ1 A;  3OW2 S;  4M75 D;  3CCV A;  2P84 A;  3CCU T;  3C4S A;  2COY A;  2RJF A;  4JLG A;  1YIT A;  3CPF A;  1VQP T;  1B34 B;  2JJ9 A;  2RD1 A;  1EX4 A;  3EG2 A;  1WJR A;  1Z9Z A;  4J83 A;  2K5F A;  4KRT A;  1D0Y A;  1M90 R;  4KH1 B;  1X27 A;  4XTY A;  1UFF A;  4EPC A;  2OTL Q;  1YJN Q;  5CR2 A;  1OZ2 A;  2V8K A;  2ZCF B;  1SG5 A;  4F14 A;  4XU1 A;  1X69 A;  3CCQ T;  2YRC A;  5HCK A;  3CCU Q;  3JB9 D;  5DM7 R;  4BI4 A;  1VQP Q;  2JT4 A;  5FRN A;  2QGF B;  2FG0 A;  2LC4 A;  2P0K A;  3CPW A;  3A1P A;  1QP2 A;  2BKD N;  2JN0 A;  3S6W A;  1MMD A;  3OMC A;  1VYT A;  3JB9 H;  4IUV A;  3OBY A;  2J06 A;  5D7U A;  4BD3 A;  1K0S A;  2QA4 A;  3HRS A;  2EGA A;  1I1J A;  3E9G A;  5GAN h;  3CCQ Q;  2RHX A;  2Y90 A;  2I2L A;  3CC7 A;  4QVC A;  2EJ9 A;  5EG2 A;  1KK7 A;  3PMI A;  4OF1 A;  1WIE A;  3X20 B;  1M4Z A;  1G3Y A;  4BI3 A;  2PNI A;  5KH6 A;  1BK2 A;  3GLX A;  4RG8 A;  1XTD A;  2EFI A;  3OS5 A;  3THK A;  4C5G A;  1Q7Y C;  2AKL A;  3MEU A;  3CCM T;  4QT7 A;  4M7D F;  2VV5 A;  1GBR A;  2C06 A;  2KY9 A;  2K7A A;  2KXC A;  2A3L A;  5GAM h;  3M4Y A;  1ZUY A;  5IHK A;  1W1F A;  3RKX A;  4DBH A;  3J7A F;  2EYQ A;  2CP3 A;  3E1S A;  4J9C A;  4JS4 A;  3VS6 A;  1GBQ A;  2K2M A;  1VYU A;  1NJI R;  4HCC A;  5GAN f;  3CCM Q;  2A36 A;  3MCA B;  2BE9 B;  2D1X A;  4RTU A;  3PE0 A;  1G3T A;  4PK4 A;  3CPW S;  3M54 A;  4J5Y A;  2PVD B;  2RMO A;  1CKB A;  1KQ2 A;  1V29 B;  4KGZ B;  5FU6 B;  4HVW A;  1W2B P;  1WXT A;  2VKN A;  2JNG A;  1K73 C;  2WAC A;  2MF2 A;  5J39 A;  1PKT A;  3M57 A;  1RLQ C;  3L2V A;  1PM3 A;  3CXC P;  3RBB B;  2D8J A;  1N27 A;  4ME7 A;  3MP1 A;  2QTV A;  2KI7 A;  5LJ5 h;  4RMO A;  3JSC A;  5CKB A;  4C5E A;  2DTO A;  3PVQ A;  1D1C A;  5GAM f;  1YI2 A;  4J9E A;  1VQ9 T;  4OMN A;  2HMA A;  1ZSZ C;  3MO8 A;  2BZ8 A;  3FJP A;  3OYY A;  2HSE B;  5IHN A;  3BDU A;  1WZO A;  1M2V B;  1PNJ A;  1RI9 A;  1KD1 U;  2AKK A;  1BI2 A;  1FMK A;  3NMZ C;  3NPF A;  1BI0 A;  1QVF P;  3SEM A;  1LNX A;  4FYV B;  4L59 A;  3TCJ A;  2MYS A;  2E4H A;  2YHT A;  2LX9 A;  1T0H A;  1ZUK A;  2VB6 A;  4M77 A;  2JMC A;  2NUP A;  2EVR A;  4GY5 A;  4RCB A;  1N6A A;  1WHK A;  1VQL A;  3OMG A;  3CCJ T;  4CC2 A;  2M16 A;  5D6W A;  3GNF B;  4M77 D;  1D09 B;  5IN1 A;  3C95 A;  4M7D E;  4ELY C;  2PUK B;  3M56 A;  1VQO T;  2R58 A;  3SDZ A;  1M8M A;  4Z8A A;  4J7F A;  5L8R E;  1Q86 C;  1ZSG A;  5LJ5 f;  1M1F A;  4M7A C;  3RES A;  4IUR A;  1YWO A;  4PFO A;  2QDL A;  2K3X A;  3LLR A;  4J9B A;  3M0P A;  1KHC A;  2AZV A;  1SPK A;  5CQY A;  3CCJ Q;  2DZC A;  1PSE A;  2EGE A;  3VRZ A;  1NEG A;  2DEU A;  4A63 B;  1U1S A;  1UEC A;  1WHJ A;  2KT1 A;  3G1J A;  1YNZ A;  4M7D A;  3NTH A;  2RF0 A;  1H92 A;  2AZS A;  4B6M A;  4MZT A;  3OYA A;  4GLK A;  2ZGW A;  1BKB A;  4C8Q C;  2E5K A;  1KD1 R;  3UT1 A;  3EGU A;  3CD6 A;  2DRK A;  3CEY A;  1UHF A;  3M9Q A;  2DVJ A;  3V7C A;  2HAX A;  2KRO A;  2F1L A;  1MMN A;  4A4H A;  1YJ9 Q;  3VRY A;  4J9F A;  1YIJ A;  4AFQ C;  3CC2 Q;  2KDS A;  2GBQ A;  2O4X B;  4XTZ A;  5I21 A;  3QJY A;  2I0N A;  1NG2 A;  2RNA A;  1OYX A;  2EYZ A;  2KT8 A;  2EJF A;  4A4K A;  4FIB A;  5J26 A;  5KYW A;  1QKX A;  2CSQ A;  3V8L A;  4C0D C;  5C0M A;  1NBE B;  2X3X D;  3EAE A;  3VUZ A;  2CH4 W;  2E70 A;  2QXF A;  1SRL A;  2FHD A;  4F7U B;  2EW3 A;  2RM4 A;  4BI8 B;  4K11 A;  1VQN A;  2DE0 X;  3FC3 A;  1QVP A;  4WTO B;  4CRI A;  1N8R R;  1W2B A;  2O2O A;  4XTU A;  1B34 A;  4R55 A;  5I2S A;  4LN2 A;  3V7R A;  2K4Y A;  3BW1 A;  1W4S A;  2J05 A;  4FW2 A;  3CXC A;  4FSX A;  2DRM A;  3LGL A;  1UEB A;  1OU8 A;  4Q5W A;  1A0N B;  3JCM g;  4J9H A;  2K79 A;  4F7U G;  1ABO A;  2Z0W A;  1SRM A;  3M4G A;  5GMK i;  1S72 A;  4BAC A;  4OB0 B;  2DIL A;  4JS5 A;  3JB9 I;  1MV3 A;  3RMQ A;  2CP2 A;  2KYM A;  3G6E T;  3JCM e;  3NTI A;  1K9M U;  5CK9 A;  2O01 E;  1PKS A;  1O75 A;  4QW2 A;  1QVF A;  2DTI A;  2JTE A;  1GCQ A;  2BZY A;  4KBM B;  2K3Y A;  3CCR T;  1M1G A;  2GQI A;  1TU0 B;  4NOY A;  4PNO A;  2EYX A;  4FCY A;  2XKO C;  4BE0 A;  1X6G A;  3R6N A;  1QVG P;  2K5I A;  1M1K R;  5KYN A;  3OA6 A;  1PCX A;  2KRM A;  4OGC A;  3OS0 A;  3LWH A;  1N9S A;  2GCX A;  4RTZ A;  2OAW A;  3G6E Q;  4QKU A;  4PJO G;  5L23 A;  2HNI A;  1VQ7 A;  2K57 A;  4ELZ C;  3H8Z A;  4EMG A;  4JRP A;  1Y0M A;  3CCR Q;  1M3B A;  2LJ3 A;  3M58 A;  3CCS T;  3OYG A;  1AOJ A;  3I55 T;  1EZZ B;  1BB9 A;  1LCK A;  4M75 F;  1MGQ A;  4X34 A;  2ATC B;  2CP5 A;  4ZGJ B;  2QTX A;  4FYW B;  1I8F A;  3EGD B;  4J9D A;  2WSC E;  1YJW T;  2FYK A;  3VS3 A;  2W0Z A;  2B86 A;  1EFN A;  1ZBX A;  4MDX A;  2RQT A;  2P4R A;  3CMA A;  3REA B;  1R0B G;  3CXC S;  1I5L A;  3SWN C;  3EFO B;  2PVG B;  1UG1 A;  3VS5 A;  3CCS Q;  3MET A;  3TEE A;  5LJ3 e;  2KRN A;  1R8O B;  3JB9 F;  3DLL A;  1GFC A;  2FO0 A;  1PG5 B;  2PTK A;  1RAG B;  4N0A A;  1AWW A;  3HRU A;  1YJW Q;  2QG9 B;  3A8M B;  1M3A A;  3VS1 A;  1UB4 A;  4D6W A;  2DJQ A;  1BI1 A;  5CO7 A;  3UA6 A;  3LWI A;  2HQX A;  3PVL A;  1E7O A;  1YFN A;  2YT6 A;  1GFD A;  2B8A A;  1ZHI A;  2GFA A;  1Z9Q A;  4EMH A;  3G71 A;  1ABQ A;  3JCM d;  5GAN 7;  5FWB A;  1ZSZ B;  3OYD A;  2DNU A;  4OVA A;  2OX7 A;  3LYI A;  1WNL A;  5GAO p;  3NHN A;  1H64 1;  4JZ3 A;  5IT9 E;  3I9Q A;  3QPH A;  3NFC A;  3OW2 A;  4DBQ A;  2A28 A;  2E6Z A;  2MMP A;  3FB9 A;  3MHX A;  1YJN A;  3I56 T;  1M2V A;  2KGT A;  4ZN3 A;  3LH5 A;  3M0S A;  1VQK T;  4XTX A;  1M90 C;  2IPO B;  1KQ1 A;  3CCU A;  4RTW A;  2C0I A;  5CIU A;  2XID A;  3OYM A;  2M0O A;  1PC0 A;  3MP8 A;  1KC8 R;  1U06 A;  3RUX A;  1VQ8 T;  1RAE B;  3M59 A;  3OYN A;  1KG1 A;  1TOV A;  4E7J A;  4M7A B;  2AK5 A;  4Y91 A;  4ZTJ A;  2DBM A;  2F2V A;  1BI3 A;  1T3L A;  5A0D A;  3R6O A;  3M0Q A;  3CCE Q;  3I56 Q;  5D6X A;  1HK9 A;  1E6G A;  2M51 A;  3MEA A;  2LNH B;  1BBZ A;  2QYZ A;  1VQK Q;  2YLC A;  2DLP A;  2BTT A;  3INZ A;  1OPL A;  3D7S B;  2K2V A;  3WVD B;  2MIO A;  2RI2 A;  3PTA A;  1B3Q A;  1FMV A;  1LVK A;  3EH1 A;  5GAN 6;  2HBW A;  4OGE A;  5LJ3 d;  1VQ8 Q;  7AT1 B;  3GIB A;  4OML A;  5IXF A;  5LJ5 j;  3EGX B;  1VA7 A;  2NWM A;  3SD4 A;  3S3M A;  4IUT A;  3OYF A;  2COW A;  1SSF A;  1D0Z A;  4ZN1 A;  5FRM A;  4F04 B;  3CME A;  4C8Q B;  4OMO A;  2CGH A;  3CC4 T;  4IUQ A;  4RUG A;  2CS7 A;  2NYS A;  1Q82 U;  4DA4 A;  3DLM A;  2ZPG B;  1CSK A;  3OYJ A;  2RK2 A;  2X4J A;  1SF9 A;  1VQ6 A;  3VYH B;  2F5T X;  4JLI A;  4Z89 A;  4E7L A;  1JU5 C;  4C8Q G;  3CC4 Q;  2YUN A;  1OZ3 A;  4F17 A;  2DFU A;  4ZTF A;  2M1H A;  2VGM A;  1AHJ B;  4MML A;  4C0D B;  2E5Q A;  1M5Q 1;  2RA2 A;  1MNE A;  2XDB A;  2KXD A;  1NJI C;  4XTV A;  2MCN A;  5DLO A;  2O4X A;  1TG0 A;  1M3C A;  3P8B B;  2K9G A;  3PGG A;  1QCO A;  4M77 F;  2GTO A;  1WA7 A;  2HCK A;  1KIK A;  4E7S A;  1J3T A;  3PNW C;  4HKE A;  4KT0 E;  2F2W A;  1VQM T;  1YP5 A;  3HKS A;  4PJO C;  3N5B B;  2RQU A;  2QK0 A;  2SEM A;  4OMM A;  2A7Y A;  1X2K A;  3QWX X;  1WX6 A;  1D3B B;  1NLP C;  2E65 A;  2M0Y A;  1Q82 R;  1QVG S;  4ATO A;  5CCA A;  1OEB A;  2E6N A;  4O5V A;  1TS9 A;  1VQM Q;  4J8O A;  4BB7 A;  1IHW A;  5GAO m;  3CCV T;  1YIT T;  2KMT A;  3BY7 A;  3UWN A;  4HCB A;  1QWE A;  3A98 A;  1X6O A;  3M5A A;  3C0C A;  4JJC A;  2M02 A;  4C92 C;  1ZA1 B;  1C0M A;  3QO3 A;  4LDV A;  4D8K A;  1G3W A;  3V8J A;  3JV3 A;  1Q7Y U;  4MDW A;  2FRY A;  3HTR A;  5CKD A;  3JCM V;  1Y57 A;  3VKI A;  4PJO D;  1T3S A;  3U23 A;  4NL2 A;  2J6F A;  3QG1 A;  1YCS B;  3PIO A;  2YRD A;  4C0F A;  2J6K A;  2V8J A;  2BIV A;  2D9T A;  4DBR A;  4M78 G;  2V8I A;  3OBW A;  4D8D A;  5KE2 A;  1NPP A;  4M77 E;  4AFU C;  4E47 A;  3M0R A;  4IIO A;  1G8X A;  4OB2 B;  1KJW A;  3SWN B;  2ED1 A;  4QQ6 A;  3CC7 T;  1IGQ A;  2GTJ A;  4RTT A;  4BE2 A;  3O5Z A;  2EYW A;  3EGD A;  2HKN A;  2QGG A;  4PLI A;  1OU9 A;  5DY9 A;  1YJ9 A;  2RHZ A;  4NL3 A;  1KD1 C;  4HT8 A;  4P5N A;  4FYY B;  5GAN g;  3L2Q A;  1K73 U;  3CC2 A;  1MUZ A;  1V1C A;  2DVE A;  4AMC A;  2LTO A;  3EFO A;  1M9S A;  1I5O B;  2FZC B;  1YWP A;  3QHS A;  2EAY A;  3AT1 B;  1OX8 A;  2QQA A;  1VQ9 Q;  2EKH A;  4DEY A;  2FRW A;  1LPL A;  2NLU A;  1Q7Y R;  3L1A A;  4E7Z A;  4C0G A;  2WSF E;  2DL8 A;  5IH2 A;  1BU1 A;  5GMK j;  2HQE A;  2EKO A;  1WXU A;  2CDT A;  2X4Y A;  4BY6 C;  4XK8 E;  1UE9 A;  1XNI A;  4MMK A;  3L2R A;  2FPF A;  1X6B A;  3TRE A;  5GAM g;  4AT1 B;  4OP0 A;  1NLO C;  2LDM A;  1ZSZ A;  4XU3 A;  1VIF A;  3LW5 E;  2VGN A;  1K0X A;  5FU7 C;  1OUL A;  5J3B A;  3MKD A;  2HKQ B;  2JM9 A;  2V1R A;  2RQW A;  5GAM e;  1IO6 A;  1QMC A;  1TXQ A;  2XU8 A;  4M7A E;  1KQS P;  2MWO A;  1WQ7 A;  5GJV B;  1VQO Q;  2DER A;  1GXI E;  1WGS A;  1N8R C;  1Q86 U;  2YUQ A;  2NUT B;  4A53 A;  1YBY A;  1B7T A;  5GJW B;  1ACM B;  4LDY A;  4KUI A;  5ECA A;  5AYF A;  1M27 C;  1K73 R;  2JXB A;  1JXM A;  4XQ3 A;  1OV3 A;  4R0K A;  1RUW A;  3UPU A;  2LP5 A;  2XK0 A;  4M7A A;  5LJ5 g;  2L3R A;  2LCC A;  2P0Q A;  3ZL7 C;  1NZ9 A;  1C6V X;  4WCI A;  1H3Z A;  1IRX A;  2HZY A;  2P0P A;  4JJD A;  4RKU E;  3VS2 A;  2PQW A;  4AFS C;  1K4U S;  3GF5 A;  3LGF A;  1I07 A;  1KFZ A;  1G5V A;  4M7A D;  5KYY B;  1M1K C;  5GAN d;  3L2U A;  1VQL T;  3EGX A;  4X9D A;  3JCM W;  1SEM A;  2DET A;  3QDR B;  4II1 A;  5HY6 A;  3UA7 A;  5CAI A;  3O8V A;  1WHM A;  4DOW A;  4C8Q A;  3GBQ A;  3RR6 A;  3VYG A;  3RNJ A;  3OYI A;  2L89 A;  2MI6 A;  3JB9 G;  2LQK A;  1HD3 A;  1QP3 A;  3HFN A;  1VQL Q;  2ROT A;  1QQJ A;  2CZ0 B;  1RLP C;  5D6Y A;  4C8Q D;  5LJ3 h;  1OI1 A;  2LNV A;  2DL4 A;  5GAM d;  1D1A A;  2JTF A;  3HRT A;  2JTM A;  4RG2 A;  4EDU A;  1WYX A;  3I35 A;  1HJD A;  1D0X A;  3PT9 A;  2FEI A;  1XQH A;  1DJ7 B;  3CD6 T;  2D8H A;  1W6X A;  3C94 A;  1XJW B;  4PJO B;  1RAF B;  1RAH B;  2CT4 A;  3RKY A;  2O88 A;  2R5A A;  4C5H A;  4HCK A;  2HD0 A;  2K5L A;  3HL8 A;  4XTW A;  1YIJ T;  2KNB B;  2DM1 A;  4LDW A;  1TH7 A;  3HP9 A;  3BDL A;  5FWC A;  5LL6 S;  2R57 A;  2ZZD A;  2GGR A;  1Y96 B;  3FJ5 A;  4M78 C;  1Q81 C;  1YHQ T;  1YN8 A;  2MAM A;  5LJ3 f;  5KYU B;  4PFZ A;  1VQ5 T;  5LJ5 d;  5GMK h;  3LX7 A;  4DEX A;  1JJ2 P;  2EWN A;  4C0Z A;  1D3B A;  2RPN A;  1YIJ Q;  1VQ4 A;  4MZM A;  2ABL A;  5GAN 5;  2KK4 A;  2FVU A;  1TSF A;  1WHH A;  3WVE B;  3CQT A;  1I4K 1;  1TUD A;  2L5Q A;  1YHQ Q;  2ZPH B;  4C92 B;  2DD4 A;  2FPE A;  2JW4 A;  2RI3 A;  1VQN T;  2FZK B;  3NGP A;  4EMK C;  2DXB A;  1VQ5 Q;  4LDU A;  1KQS A;  4ORZ A;  1KC8 C;  2OAU A;  2CP7 A;  3CCE A;  3I56 A;  2LRQ A;  2OTJ T;  3HFO A;  1VQK A;  4QVD A;  4J6X A;  5GAO l;  4L5G A;  4R56 A;  1K9A A;  1F1B B;  2OJ2 A;  1ZQ1 A;  2QAS A;  3I55 Q;  3QUI A;  4WF2 A;  1MMG A;  1K8A U;  1UGP B;  6AT1 B;  3OS1 A;  1K9M R;  5IAY A;  2X4W A;  2RQV A;  4C92 G;  1S72 T;  1VQN Q;  3OYK A;  1WLP B;  2BZX A;  2COZ A;  3ASK A;  1FXX A;  2L3Q A;  4CC4 B;  1U3O A;  2OTJ Q;  4M78 D;  4N4G A;  3G4S A;  4J7I A;  1G3S A;  2DZ9 A;  2VUB A;  1I81 A;  4M4Z A;  4QQG A;  2YUP A;  3OSV A;  3MEW A;  3CCL A;  2XD0 A;  1OPK A;  5HK3 A;  3EG3 A;  2OI3 A;  2RB6 A;  1TTH B;  2EQM A;  1P92 A;  3SHW A;  1QCF A;  3UDC A;  1S72 Q;  4JRI A;  4X1V A;  2ENM A;  2DXC A;  2VVK A;  3SWN A;  1UDL A;  4NS5 A;  1VQ7 T;  3C12 A;  1V76 A;  2LJ0 A;  4E6R A;  1UHC A;  4F7U F;  4YTL A;  1IXD A;  2A0F B;  1UGR B;  2OTL A;  2VC8 A;  4XAX B;  2HL3 A;  2DXT A;  1OX9 A;  4LUE A;  2E41 A;  2RI5 A;  3JB9 J;  1VQP A;  4MZP A;  1KQS S;  4ESR A;  1JB0 E;  4BY6 B;  2RJD A;  4Z02 A;  5IHI A;  2CH4 A;  3H9N A;  4HVU A;  4M7D B;  3EHQ A;  3EH2 A;  3H41 A;  2ED0 A;  5I11 A;  1VQ7 Q;  4E7H A;  2IG0 A;  2RN8 A;  2MWP A;  1K8A R;  2EJG A;  4M75 C;  2CT3 A;  2ZAE A;  1O9S A;  2DL7 A;  3CBO A;  3ZBD A;  1QWF A;  5FU7 B;  2O9V A;  2EQJ A;  3JCM c;  3QDF A;  3EG9 B;  3CCQ A;  4GLM A;  4PJO F;  4E7K A;  2NUZ A;  1UGQ B;  1PRL C;  4IKF A;  1ZLM A;  1HSQ A;  3NTK A;  4J9G A;  2CP0 A;  4Y92 A;  4M7D G;  1N5Z A;  4X9C A;  3OYB A;  5I2M A;  4A54 A;  1H8K A;  2PVO B;  2CP6 A;  3KUF A;  1U8R A;  4DBF A;  2YDL A;  3G71 T;  2RJC A;  1QVG A;  4A4E A;  1AEY A;  2X51 A;  2RO0 A;  4LE9 A;  2FZG B;  2DX1 A;  2NUT A;  2L2P A;  5CVI A;  3RMS A;  2KAF A;  3ME9 A;  2E64 A;  3EG1 A;  1VOM A;  2DEQ A;  3A8H B;  4FL6 A;  3SB2 A; 
#chains in the Genus database with same CATH homology
 4JJB A;  2SRC A;  4AG1 C;  4D8D A;  2ECZ A;  2I0N A;  1NG2 A;  2RNA A;  4RTX A;  4AFU C;  2L3S A;  2ESW A;  1SHF A;  2EYZ A;  2A08 A;  2KT8 A;  3M0R A;  4IIO A;  1KJW A;  2ED1 A;  2EYY A;  1QKX A;  2CSQ A;  2D0N A;  2GTJ A;  4RTT A;  3O5Z A;  2EYW A;  1NEB A;  2VWF A;  1GRI A;  1I0C A;  1K1Z A;  2MOX A;  2X3X D;  3UF4 A;  2J6O A;  2CH4 W;  1SRL A;  2EGC A;  2YUO A;  1WDX A;  2EW3 A;  3M0T A;  1MUZ A;  1V1C A;  1CKA A;  1AVZ C;  4K11 A;  2DE0 X;  1WXB A;  1YWP A;  2EPD A;  2LCS A;  2X3W D;  2O2O A;  2A37 A;  2EKH A;  4DEY A;  4LN2 A;  2FRW A;  4JZ4 A;  5EC7 A;  3I5R A;  3TSW A;  2J05 A;  4IIM A;  1JQQ A;  2DL8 A;  2DRM A;  5IH2 A;  1BU1 A;  4F16 A;  3VS0 A;  1UGV A;  1A0N B;  4J9H A;  4RTY A;  1WXU A;  2CDT A;  1ABO A;  2K79 A;  2KYB A;  1SRM A;  2IIM A;  3REB B;  1S1N A;  1AWX A;  1UE9 A;  4HXJ A;  3I5S A;  4LUD A;  2FPF A;  1X6B A;  2DIL A;  1NLO C;  1MV3 A;  2KYM A;  1K0X A;  2LMJ A;  3UAT A;  1PKS A;  1OOT A;  2DL3 A;  2JTE A;  1GCQ A;  2BZY A;  1WI7 A;  3H0F A;  2JM9 A;  2V1R A;  2RQW A;  1IO6 A;  2W10 A;  1AD5 A;  2GQI A;  2EYX A;  4GBQ A;  1X6G A;  5GJV B;  3R6N A;  1FYN A;  2DL5 A;  2EBP A;  2YUQ A;  2KRM A;  4RTZ A;  2K6D A;  2OAW A;  4RTV A;  4Z88 A;  5GJW B;  5L23 A;  1SSH A;  1UJY A;  5ECA A;  1H3H A;  1M27 C;  2DYB A;  1G2B A;  2JXB A;  1Y0M A;  1JXM A;  1M3B A;  1OV3 A;  2G6F X;  1NYG A;  2LJ3 A;  4R0K A;  1SHG A;  1AOJ A;  1T0J A;  4FSS A;  1M30 A;  1RUW A;  1LCK A;  1BB9 A;  1G83 A;  2LP5 A;  2CRE A;  4OMP A;  2KR3 A;  2HEQ A;  3ZL7 C;  1MV0 B;  4J9D A;  1ZX6 A;  4WCI A;  3TVT A;  2HSP A;  1QKW A;  4JJD A;  3VS3 A;  2W0Z A;  1WFW A;  2B86 A;  1EFN A;  3TSZ A;  2RQT A;  1XOV A;  2P4R A;  3VS2 A;  4AFS C;  1K4U S;  3REA B;  2JMA A;  2JS2 A;  2KRS A;  1I07 A;  1UJ0 A;  1KFZ A;  1W70 A;  3EG0 A;  1JXO A;  1VYV A;  1UG1 A;  2L0A A;  3VS5 A;  2JM8 A;  2KEA A;  2C0T A;  2KRN A;  2LJ1 A;  2DA9 A;  1SEM A;  1GFC A;  2FO0 A;  2PTK A;  3UA7 A;  3EG2 A;  2DF6 A;  1AWW A;  1X43 A;  1Z9Z A;  1M3A A;  3VS1 A;  1X2Q A;  2DJQ A;  4KRT A;  3GBQ A;  3UA6 A;  1X27 A;  3PVL A;  2LZ6 B;  3RNJ A;  1E7O A;  1HD3 A;  1UFF A;  2YT6 A;  1GFD A;  1Z9Q A;  2ROT A;  4F14 A;  1AWO A;  1ABQ A;  1X69 A;  5FWB A;  1RLP C;  5HCK A;  2DNU A;  2JT4 A;  2DL4 A;  2FG0 A;  3NHN A;  1E6H A;  4JZ3 A;  4HVV A;  4AFZ C;  3I9Q A;  1WYX A;  3I35 A;  1VYT A;  1HJD A;  3M0U A;  2A28 A;  2J06 A;  2FEI A;  1K0S A;  4CC3 A;  2LQW A;  2D8H A;  1W6X A;  1PWT A;  2EGA A;  2CT4 A;  1I1J A;  2KGT A;  3LH5 A;  2XMF A;  2O88 A;  3M0S A;  1UTI A;  4HCK A;  4RTW A;  2C0I A;  1AZG B;  2KNB B;  2DM1 A;  1U06 A;  1WIE A;  2PNI A;  3VS4 A;  5FWC A;  1BK2 A;  2AK5 A;  2GGR A;  2DBM A;  3FJ5 A;  2F2V A;  1T3L A;  2CSI A;  3M0Q A;  3THK A;  1YN8 A;  2AKL A;  1E6G A;  2M51 A;  4J9I A;  4QT7 A;  2LNH B;  1ZBJ A;  1BBZ A;  4DEX A;  1GBR A;  2DLP A;  2BTT A;  1OPL A;  2K7A A;  3H0H A;  2KXC A;  2MIO A;  1KSW A;  1B3Q A;  1ZUU A;  2GNC A;  2RPN A;  2J7I A;  2HBW A;  2ABL A;  4OML A;  1ZUY A;  4AG2 C;  5IXF A;  5IHK A;  1W1F A;  4JPB W;  1B07 A;  1VA7 A;  2NWM A;  3CQT A;  4J9C A;  1TUD A;  3VS6 A;  1GL5 A;  1U5S A;  1GBQ A;  2K2M A;  1VYU A;  2FPE A;  2JW4 A;  2EQI A;  3NGP A;  2A36 A;  2D1X A;  4RTU A;  4ORZ A;  2CUD A;  3PE0 A;  2LX7 A;  4OMO A;  4EIK A;  4RUG A;  3EHR A;  2KE9 A;  3H0I A;  4ZNX A;  5I22 A;  1K9A A;  2OJ2 A;  2RMO A;  1CSK A;  2KBT A;  1CKB A;  2RQR A;  4HVW A;  3KFV A;  1NM7 A;  1WXT A;  2YSQ A;  2VKN A;  2RQV A;  1PKT A;  1WLP B;  2O9S A;  4Z89 A;  2BZX A;  1JU5 C;  1RLQ C;  2PZ1 A;  2L3Q A;  5IXB A;  1UUE A;  4CC4 B;  3RBB B;  2D8J A;  2YUN A;  1U3O A;  4F17 A;  3PVQ A;  4M4Z A;  2YUP A;  4J9E A;  4OMN A;  1OPK A;  2BZ8 A;  2F2X A;  2KXD A;  3EG3 A;  1PHT A;  2OI3 A;  5IHN A;  2MCN A;  1TG0 A;  1M3C A;  1GCQ C;  1AZE A;  2K9G A;  1PNJ A;  1RI9 A;  2O31 A;  3SHW A;  2AKK A;  1QCF A;  1FMK A;  2GTO A;  3NMZ C;  3NPF A;  1WA7 A;  2V1Q A;  2HCK A;  4X1V A;  3SEM A;  1KIK A;  2ENM A;  2VVK A;  2DMO A;  1J3T A;  1UDL A;  1AWJ A;  1JO8 A;  1T0H A;  1ZUK A;  2CUB A;  2JMC A;  2F2W A;  4OMQ A;  2EVR A;  2LJ0 A;  4E6R A;  1UHC A;  1YP5 A;  2RQU A;  2LQN A;  2ROL A;  2SEM A;  4OMM A;  4CC2 A;  1X2K A;  1JEG A;  3QWX X;  2K3B A;  4LUE A;  1GCP A;  1WX6 A;  2JS0 A;  1NLP C;  4ESR A;  2M0Y A;  1M8M A;  2HDA A;  4Z8A A;  5FW9 A;  1OEB A;  5IHI A;  1ZSG A;  2CH4 A;  4HVU A;  1YWO A;  3EHQ A;  3H41 A;  2ED0 A;  5I11 A;  2QDL A;  4J9B A;  2RN8 A;  3M0P A;  1QLY A;  4CC7 A;  2CT3 A;  2AZV A;  2DL7 A;  1SPK A;  1QWF A;  1PRM C;  2O9V A;  2EGE A;  3ULR B;  3VRZ A;  1NEG A;  1TUC A;  4A63 B;  4GLM A;  2NUZ A;  1PRL C;  1ZLM A;  1K76 A;  1UEC A;  2FPD A;  1HSQ A;  2H8H A;  2KT1 A;  1QWE A;  3A98 A;  1YNZ A;  3C0C A;  4JJC A;  2C0O A;  4J9G A;  4Y92 A;  1N5Z A;  2RF0 A;  1H92 A;  3VS7 A;  4D8K A;  1H8K A;  2AZS A;  4LNP A;  3JV3 A;  2L3P A;  2FRY A;  2E5K A;  2YDL A;  3EGU A;  2DRK A;  1Y57 A;  1UHF A;  1AEY A;  4LE9 A;  1NYF A;  1T3S A;  2DBK A;  2DVJ A;  3U23 A;  2DX1 A;  3IQL A;  2KRO A;  2L2P A;  2J6F A;  1YCS B;  3VRY A;  1ARK A;  3QWY A;  2J6K A;  4J9F A;  3EG1 A;  4AFQ C;  2GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...