1TUDA

Alpha-spectrin src homology 3 domain, circular permutant, cut at n47-d48
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
b'RQGFVPAAYVKKLDSGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-SPECTRIN
publication title The order of secondary structure elements does not determine the structure of a protein but does affect its folding kinetics.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
total genus 11
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1tudA00
3U23A 2KEAA 2RF0A 1UUEA 4F17A 3M0SA 2LP5A 1NLPC 2PTKA 2JT4A 2RQWA 1S1NA 4CC3A 2EVRA 2IIMA 1M3BA 1UHCA 1ABQA 4ORZA 1GRIA 1X69A 1VYVA 2EKHA 1G2BA 1GBQA 2HSPA 2MCNA 2KNBB 3UF4A 4GBQA 2EGCA 3TSWA 4IIMA 2AZVA 3VRZA 2DL7A 2EYWA 5IXBA 2KRNA 1X6GA 1TUCA 4CC4B 2LMJA 1VYTA 2F2XA 3GBQA 4LNPA 2C0IA 2CT3A 1HJDA 3EHRA 5I11A 5HCKA 4AFSC 1AWXA 1QWFA 2J7IA 2FO0A 1UFFA 2L2PA 1QLYA 1PRMC 1CKAA 2O9VA 2ESWA 4F16A 2EYZA 1CKBA 2XMFA 3TSZA 1YWOA 1YP5A 2RMOA 1Z9ZA 1SRLA 2FPDA 3PVQA 4RTXA 5IH2A 2AKLA 1AOJA 2M51A 3VS5A 2O2OA 2LJ3A 4X1VA 2ENMA 1WLPB 4E6RA 2J6KA 3NPFA 2E5KA 1ZBJA 2LJ1A 1AVZC 2BZYA 1UTIA 2GGRA 2YUQA 4OMLA 1FMKA 1VA7A 2EBPA 1LCKA 1Z9QA 1JQQA 2C0TA 2PZ1A 5ECAA 1B07A 4Z89A 2H8HA 4D8DA 2YSQA 3VS6A 1WIEA 3SEMA 1YN8A 2GBQA 2HDAA 1UG1A 2RN8A 3IQLA 2PNIA 4J9IA 1UECA 1KIKA 2RNAA 3H0IA 1NEBA 2LZ6B 3QWXX 4OMPA 1OPLA 5EC7A 3O5ZA 4CC7A 2O31A 4HVVA 2FPEA 2JTEA 2K7AA 4KRTA 1BBZA 2YT6A 1WXTA 4LE9A 4DEYA 1QCFA 5IHKA 4RTVA 1MUZA 4J9DA 4Y92A 1SSHA 4JJDA 3PE0A 1M8MA 2CH4A 3R6NA 3EG2A 1E7OA 1WDXA 2D8JA 2DBMA 4JJCA 2L0AA 1BK2A 2D8HA 2DL5A 1V1CA 5GJVB 4Z88A 4RTWA 4Z8AA 2K6DA 4J9EA 2HEQA 4J9GA 1SHFA 1Y57A 2VWFA 2ABLA 1YCSB 1SHGA 2LJ0A 1IO6A 2LQWA 4OMMA 1M27C 3H41A 1M30A 1PHTA 2RQUA 1UHFA 1XOVA 1E6HA 2RQVA 1NYFA 3NHNA 2ED0A 2DNUA 2RPNA 3EG0A 4AFUC 2D1XA 2DRMA 1YWPA 2X3XD 1X27A 3CQTA 1GBRA 1U5SA 2OAWA 3UA7A 2K2MA 2L3QA 2V1QA 1NYGA 4OMNA 1YNZA 1B3QA 2LX7A 2GTOA 4J9CA 4LUEA 2BZ8A 1I0CA 5IHNA 1GCQA 2KRSA 1QKXA 3REAB 1NEGA 3M0RA 1PWTA 4RUGA 4LN2A 1HD3A 1X2KA 2KROA 2A37A 2JM8A 4OMOA 2EGEA 1T0JA 2LQNA 3VS7A 2DX1A 2QDLA 4JZ4A 4JZ3A 3I9QA 2P4RA 3VS0A 4A63B 1UGVA 1TUDA 2KT1A 1UE9A 2ROTA 2K9GA 2A28A 1WYXA 1PKSA 1MV0B 1UJYA 3I35A 1SEMA 2J05A 1WA7A 4HXJA 2KYBA 3PVLA 1RI9A 3M0QA 1NLOC 2SEMA 4JPBW 2AK5A 2JW4A 1PKTA 2D0NA 1NG2A 1OOTA 2ECZA 2K3BA 1HSQA 1W1FA 3A98A 2RQRA 4R0KA 1AWJA 2JS2A 4EIKA 1ZX6A 3M0UA 4J9BA 2F2VA 1KSWA 2NWMA 2MOXA 1W70A 2DRKA 2KYMA 2YUPA 3VRYA 1SRMA 5GJWB 2K79A 1ZUUA 2KE9A 1K1ZA 2FG0A 5I22A 1AD5A 1ZLMA 4RTZA 1PNJA 4IIOA 1ZUKA 2JMAA 2NUZA 4OMQA 4QT7A 4F14A 1BB9A 2J6OA 1NM7A 2F2WA 3THKA 1PRLC 1RUWA 1GFCA 2DJQA 2VKNA 1RLQC 1GCQC 2M0YA 2DMOA 1K0XA 1U06A 4ZNXA 2FRYA 2O88A 1A0NB 2EQIA 4HCKA 1GFDA 4FSSA 1TG0A 5FW9A 2G6FX 3NGPA 4LUDA 4D8KA 3M0TA 4RTYA 1T3SA 1K76A 2DM1A 1CSKA 2HCKA 2EW3A 3REBB 1OEBA 4J9HA 2DLPA 2ED1A 2LCSA 2W10A 1T0HA 1UDLA 2GNCA 3VS1A 2KT8A 2A36A 2LNHB 1JEGA 1EFNA 3C0CA 4CC2A 1ZSGA 4HVUA 3UA6A 2DF6A 2JM9A 3VS3A 2CH4W 2W0ZA 1WX6A 1H92A 2VVKA 4AFQC 1AZGB 3EHQA 2X3WD 2YDLA 2FEIA 2OI3A 4RTTA 3EGUA 3QWYA 5FWCA 2V1RA 1WFWA 2CUBA 2JMCA 3UATA 2ROLA 2EPDA 2DVJA 3H0FA 1FYNA 2L3PA 2DL4A 3NMZC 4AG2C 1QWEA 3JV3A 2DL3A 2GTJA 1I07A 2CSIA 2EYXA 1OPKA 1AWOA 1ZUYA 4RTUA 3VS2A 1M3AA 4J9FA 2DBKA 2KGTA 2KXDA 1MV3A 1RLPC 1KFZA 2RQTA 1M3CA 2CREA 1N5ZA 2KR3A 1Y0MA 4GLMA 1J3TA 4WCIA 3EG1A 4JJBA 2DA9A 2KRMA 1X2QA 1X43A 3LH5A 3ZL7C 1W6XA 3TVTA 3FJ5A 2YUNA 2J06A 2JXBA 1SPKA 1JO8A 1WI7A 1WXUA 2MIOA 3M0PA 2DYBA 1X6BA 1H8KA 4AG1C 3ULRB 4M4ZA 1UJ0A 1OV3A 2J6FA 2YUOA 1GCPA 2CSQA 4DEXA 2OJ2A 3RBBB 2BZXA 4HVWA 2AZSA 1GL5A 1KJWA 1AWWA 2O9SA 3SHWA 5IXFA 1K4US 5FWBA 3RNJA 2DE0X 2CUDA 1VYUA 1K9AA 5L23A 2HBWA 1K0SA 1JXOA 2EYYA 1JU5C 2CDTA 1E6GA 1WXBA 1AZEA 2AKKA 2KXCA 4AFZC 3I5RA 3VS4A 2B86A 1ABOA 2CT4A 2GQIA 2FPFA 2L3SA 1U3OA 1ARKA 2C0OA 3EG3A 1JXMA 2DILA 2BTTA 2I0NA 3I5SA 2KBTA 1I1JA 2A08A 2JS0A 2SRCA 1QKWA 4ESRA 2FRWA 1T3LA 1G83A 4K11A 1H3HA 1AEYA 5IHIA 1BU1A 3KFVA 2DL8A 2EGAA 3H0HA
chains in the Genus database with same CATH superfamily
2ZGWA 4E2FB 2RF0A 2K57A 2ZPHB 2CP2A 4Y28E 1NLPC 2PTKA 1FWZA 4VUBA 1ZSZC 2COYA 4L6V5 2EVRA 1M3BA 1UHCA 4Z02A 3JCMc 3DB3A 4EMGA 1TSFA 5GAOl 2EKHA 4M75C 2ZPEB 3UF4A 3TSWA 2K5FA 2VASA 2E41A 1Q7YU 3FC3A 4X9CA 1M1KU 1VYTA 4JRKA 5I11A 3EG9B 1AWXA 1QWFA 5HKCA 3JCMV 1PRMC 2ESWA 2JJ9A 2EYZA 3P8BB 4F16A 2XMFA 1YP5A 3I56A 2E4HA 5KE2A 3PVQA 2B8AA 2FZCB 2AKLA 4ZTFA 2JUFA 5DLOA 1PC0A 3VS5A 2Y4YA 2O2OA 4MDXA 4X1VA 2J6KA 3A8OB 3VUZA 2E5KA 5KYNA 1W2BP 4JLIA 1K73R 1ZBJA 1AVZC 4KUIA 5I2MA 3QO3A 1C1AA 2VB6A 1UTIA 2R5MA 2YUQA 4OMLA 1FMKA 4A4FA 1Z9QA 1JQQA 2PZ1A 4C8QD 5GMKi 4JS4A 3A5ZB 1B07A 1YJNQ 2H8HA 4PJNA 1QVGA 2YSQA 1ZA2B 1MNDA 3VKIA 3IQLA 4OVAA 2H3EB 1UECA 1BI2A 4BE0A 3C12A 4NS5A 5GAN7 4PJJA 3BDUA 3JSCA 3C94A 4ZTJA 2F1LA 3CCQA 4FW1A 4LE9A 1VQKT 4F7UF 4FW2A 4M7AF 2RK2A 4CRIA 2VGNA 3OYAA 4JJDA 5J26A 3OS2A 2DBMA 2L0AA 4LD6A 2D8HA 4Z88A 4RTWA 2K6DA 2HD0A 1U8RA 3P8DA 1SHFA 1Y57A 2L8DA 4C8QF 2VWFA 3CCSQ 3J7AF 1SHGA 1IO6A 4OMMA 1M27C 4X9DA 1VQOA 1PHTA 4ZN1A 4M77G 2RI2A 3NHNA 2ED0A 2DNUA 2KAFA 3EG0A 1OI1A 3PMTA 3DB4A 3HRSA 3DLMA 4C5HA 1WHGA 1KQSS 3J80E 3UA7A 1K73C 2EAYA 1B3QA 4LUEA 1QMCA 2BZ8A 3CCJA 4FT4A 1YJ9Q 3M0RA 2QQSA 1D1AA 1PWTA 4PJOD 4RUGA 4LN2A 2EKOA 2O01E 3CD6Q 5GMKm 3LX7A 1UEBA 4JZ4A 3S6WA 2LRQA 2ZAEA 1FXXA 3VS0A 2KDSA 2KT1A 2ROTA 2K9GA 1VQ7A 2J05A 3CC4A 1EIFA 2KYBA 1RI9A 3MEAA 2XG8D 2DAQA 1NLOC 2PUKB 3L2QA 3BY7A 1MMAA 4LDWA 2ECZA 3RMQA 1W1FA 4XTXA 2FB7A 1VQLA 4M7DF 1VQ8Q 1KSWA 4BI8B 1ACMB 2MOXA 3FB9A 1LNXA 2DRKA 2LC4A 3QBYA 1KQ2A 1KHCA 1NJIC 2HQHA 5L8RE 3JCMX 2A0FB 4A4HA 4N0AA 1D1CA 2KE9A 1YHQA 1K1ZA 3UWNA 3GPLA 1YBYA 3NTIA 3G6ET 1ZLMA 1PNJA 2FL7A 4OMQA 1BB9A 4KH0B 3THKA 1RUWA 2DJQA 4J6YA 3M56A 4M77E 1K0XA 2PU9B 1D0XA 4E7HA 2FRYA 1VQ9Q 2O88A 2DD5A 4XTZA 1A0NB 3OYJA 4ZGJB 1PCXA 1GFDA 2PQWA 4JRQA 5FW9A 2HNIA 4LUDA 3S3OA 2KK4A 1Q81U 1K76A 2DM1A 4QQDA 2MK5A 4RG2A 3KXTA 1OEBA 5CCAA 1RABB 4RCBA 2LCSA 3CPWA 4M78A 1UDLA 3EAEA 5GAOp 3ASKA 3CC7T 3GF5A 2KT8A 5GAN2 2EQKA 1VIEA 4BD3A 1WJQA 1EFNA 2QQAA 1QVGP 2DO3A 3O8VA 2DF6A 4F7UG 3VS3A 4M7AG 2W0ZA 4KGZB 1H92A 2V8JA 4AFQC 1Q7YR 2CP3A 3UDCA 2QQRA 1M1KR 3EGUA 4OB0B 3QWYA 5FWCA 3T9NA 3DKMA 2ROLA 2EPDA 4N0AC 2DVJA 1ZA1B 2CGHA 4DQ2A 5A0DA 2GFAA 2E70A 4GY5A 2XIDA 3QJYA 2DL3A 2GTJA 3OYHA 1M3AA 2JZ2A 4M78B 4DBFA 3OA6A 3JCMe 4OB1B 3CXCA 3JCMJ 1TU0B 1RAFB 1N5ZA 1D0YA 1KD1U 2QYZA 3EG1A 2KRMA 4KGXB 1QCNA 4B6MA 3FJ5A 2PVGB 2RHUA 3CMAA 2MMPA 2V8KA 1SPKA 2M1HA 3E9GA 5GAMd 2RI5A 2MIOA 2A7YA 3L42A 4LDVA 4NL3A 5IT9E 2DYBA 4PJLA 5GAN6 1X6BA 5KYWA 4M78C 1N9SA 1OX8A 5LJ3d 3TEEA 1OV3A 2YUOA 4V2SA 3CCLQ 2RO0A 2CSQA 5KH6A 4PJOA 1Q7YC 2VGMA 1M8VA 1K73U 4HVWA 5GANd 2AZSA 1S72A 3CCUT 1GL5A 3RKXA 4BACA 1M1KC 4M7DG 2VXEA 1MMNA 3HTRA 1RAAB 5GAMe 2LCLA 3RKYA 1QQJA 5CQXA 1VYUA 4ELZC 4F7UE 4DA4A 4M7AE 1K9AA 5LJ3e 2M16A 2EYYA 2R5AA 1WXBA 2E6NA 5D6XA 1ZBXA 3J81E 2FPFA 3GNFB 4QVDA 5KYWB 1JJ2S 4HA8A 2PUOB 3EG3A 4C8QE 2BTTA 4QQGA 3CCQQ 2KBTA 1I1JA 2SRCA 1QKWA 3CD6A 4PK4A 2FRWA 4J5YA 1KC8U 3JB9F 5GAMf 1AEYA 4PJOB 4PLIA 2ZCFB 3CPFA 4C5EA 3VUBA 2K5IA 1N27A 4J7FA 3U23A 2YHTA 5LJ3f 1WJSA 2RQWA 1S1NA 1Y71A 2COZA 4CC3A 3I56T 5GAOn 5GANf 3G4SA 4ORZA 1YFNA 1EZZB 3M5AA 1VQOQ 3OS1A 2K3XA 1OQKA 3CBMA 2HZYA 2HSPA 2MCNA 2KNBB 2QGFB 2EGCA 1UGPB 2HAXA 4N4IA 4IIMA 3OSSC 2AZVA 4KULA 4PJOC 1EX4A 2EYWA 3MEVA 1X6GA 5DM7R 2LT1A 3GBQA 2F2XA 4LNPA 2RB6A 3CCJQ 4FU6A 1RAEB 2CZ1B 2J7IA 3URGA 3CPWP 1CKAA 2O9VA 1CKBA 4M77D 4JDSA 3TSZA 1WHHA 1YWOA 3L2VA 2RMOA 3RERA 1K8AU 4RTXA 5CVIA 1AOJA 1JJ2P 2QAZA 2M51A 2ENMA 2ZPBB 2Y90A 1WZOA 1SKUB 3PGGA 4B9WA 4A4KA 3A8GB 1VQ9A 3S3NA 2GGRA 1VA7A 2OTLQ 2YLCA 4RCCA 3G1JA 1F1BB 1Y96A 3QDRB 1YJWA 1M1FA 1NE8A 4Z89A 4JUVA 3CMEA 3VS6A 1WIEA 3SEMA 3CCMQ 1UG1A 2RN8A 3M57A 1AHJB 2PNIA 1KIKA 3CC2A 1Q81R 1WHLA 3O5ZA 1BKBA 2JTEA 3SWNA 3CCVA 3OS0A 3CBOA 1YHQQ 2BKDN 4E7JA 1I5LA 1WXTA 1LVKA 1FMVA 1RAIB 2M0OA 4J9DA 3L2WA 1SSHA 1IHVA 3PE0A 4E7SA 3OYBA 3R6NA 3EG2A 1WDXA 1D09B 3LGFA 4Z8AA 1QVPA 1MNEA 3HPWA 1PM3A 5D6YA 4J9GA 4XTYA 2FHDA 4ELYC 1Y96B 1YCSB 1W4SA 2YLBA 4MMLA 1M30A 5AT1B 3MHXA 2RQVA 1D0ZA 1NYFA 1VQ7T 5KE3A 1YITT 2DRMA 1YWPA 4X34A 1X27A 3G71A 1U5SA 5FROA 1NYGA 2L3RA 3SWNB 1YNZA 2LX7A 1TUGB 2HBPA 5IHNA 1QKXA 3CCRQ 2NLUA 1NEGA 5C0MA 1X2KA 2QEXQ 1KQSA 4J83A 5GAMg 1KD1R 3JB9G 1MGQA 2QDLA 3FLGA 2YRCA 4A63B 1UGVA 2VC8A 5LJ3g 1V29B 1VQMT 1Q81C 2A28A 3PTAA 1PKSA 2EJGA 1VQ6T 3I35A 1Y7XA 1NPPA 1VQKQ 3PVLA 5FU7B 3SWNC 5GANg 3CCLA 1QVFS 5C6SA 4FYWB 1U1SA 2X4YA 5CR2A 3CCEA 2VXFA 2D0NA 2DPPB 4M7AD 4R0KA 4EIKA 2JS2A 1ZX6A 3A8HB 2QA4T 2F2VA 2P0KA 6AT1B 3KBGA 1N9RA 4HCBA 1KG1A 3OYLA 2YUPA 1WPYA 4PFZA 1BI0A 4II1A 1VQ4Q 4L5GA 1ZUUA 2EIFA 3I55Q 4QKUA 3QZ5B 5FU7C 2V8IA 2D6FA 4LDYA 1QW1A 1AD5A 3CMAQ 1I5OB 5J3BA 3EH1A 4E7ZA 2QXFA 4IIOA 1ZUKA 2E6ZA 3GP8A 2ZPIB 4AMCA 2JMAA 2NUZA 4F14A 4QT7A 1PRLC 3SB2A 2O4XA 3NTHA 3EH2A 4ZGDB 2E3HA 2DMOA 1U06A 3QG1A 1KD1C 1KC8R 3PT9A 3JAME 1M1GA 1NZ9A 3OYDA 4JS5A 1H641 4HCKA 2E10A 2VV5A 2DK3A 3OMCA 4FSSA 5I2SA 2KSSA 1B34A 1S72Q 4O5VA 4ME7A 1TTHB 2KY9A 3CEYA 3RIRA 1K9MU 1T3SA 5GAN3 1LJOA 2MPXC 3E1SA 2OTJQ 2XDBA 1RACB 1YI2Q 1G5VA 1G3TA 2JTMA 3PIPA 2ED1A 2W10A 4PFOA 4WTOB 1T0HA 3LWIA 2GNCA 3M4GA 3X20B 4NL2A 4OMFB 1SSFA 2LNHB 9ATCB 1I81A 4J8OA 4HVUA 5LL6S 3UA6A 5LJ5e 2CH4W 4M7DD 2VVKA 1AZGB 3MP1A 2NUTA 5EG2A 1PSFA 2A3LA 2O4XB 2PVDB 5GAN5 2OI3A 4HKEA 4RTTA 4UC4A 1YJNT 3EFOB 5FU6B 5GMKh 2QTXA 1BI3A 2CZ0B 1B34B 1FYNA 1VQNQ 1JB0E 4AG2C 2DL4A 3NMZC 2R58A 1K8AR 2Z0WA 4RG8A 1IB8A 5LJ5f 4OF1A 3OYCA 3G4SQ 4C92D 1SG5A 4PLLA 2KXDA 2OTLA 4EMHA 2AHJB 1KC8C 2CREA 5DY9A 2KR3A 2PVOB 3QXEB 5FU6C 4WCIA 2DA9A 2YXYA 1X2QA 1X43A 3CCMA 4GLKA 3ZL7C 4MZMA 2NUTB 1I8FA 3CCST 3JB9J 3TVTA 5A0LA 1YIJQ 4BDYA 2J06A 4M77C 4LDXA 1WXUA 2DYIA 2XDDA 3M0PA 4E7LA 1H8KA 2YWWA 3ULRB 1X01A 1KQSP 4OGCA 2F5TX 2E5QA 2LDMA 2F5KA 3FEOA 1YJ9T 3RBBB 3RMSA 1TXQA 5CKHA 2BZXA 3X25B 4C92F 4OB2B 3HHTB 1H3ZA 2LCCA 3MP8A 3OW2S 3LH0A 2DEUA 2QI2A 2DE0X 3S3MA 3OQ5A 2DKGA 1YJWQ 3CMEQ 3PNWC 1E6GA 2HQXA 1K8AC 1RAHB 2AKKA 3INZA 4AFZC 3CC2Q 2G3RA 2ZZDA 5HK0A 2GQIA 3QIIA 4F7UA 4HT8A 4M7AA 1U3OA 3OYMA 2C0OA 1N6AA 1JXMA 2DILA 3CCRA 1M9SA 3CCVQ 3QYHB 1VQ8T 1VUBA 4XU3A 2JS0A 4C0GA 3HRUA 3UT1A 2GCXA 3LWHA 2QEXA 3F70A 3OBWA 1JBMA 1BU1A 3KUFA 1IZ6A 3KFVA 1JJ2A 2EFIA 3H0HA 4C8QA 3JB9H 2IVWA 4F17A 3JCMd 1VQPQ 2LQ8A 3M0SA 2LP5A 2JT4A 1D1BA 4DBRA 4DOVA 3P8HA 2HSEB 3OYFA 1VQKA 1ABQA 4M78G 2MF2A 3OYKA 1GRIA 5CQYA 1X69A 5M9OA 1G2BA 4RMOA 4GBQA 5CKEA 4KH1B 1GXIE 3L1AA 4QVZA 1KK7A 4F7UB 3G71Q 4M7AB 1OZ3A 1VQ9T 1N8RU 4YTLA 5IXBA 2KRNA 4NOYA 4CC4B 5GAMh 3C95A 2LMJA 3HRTA 2C0IA 5FLXE 3EHRA 5HCKA 4AFSC 1VQ4A 2QQ9A 2E3IA 3V8JA 3V8KA 1UFFA 4XTWA 2L2PA 5LJ3h 3JCMP 3I55A 3OYGA 1B7TA 1HXDA 4C8QB 4A54A 1Z9ZA 2R57A 3MKDA 2FPDA 4KBMB 5GANh 1M2OA 1Q82U 1MMGA 4RKUE 5KYYA 4M75F 2LJ3A 5GAOm 2EQJA 1WLPB 3LW5E 5DLQE 1QP2A 3RR6A 2LNVA 3NPFA 4M7AC 3JCMf 5CKBA 2BZYA 1IHWA 2EBPA 3JB9D 1XQHA 3CCEQ 1LCKA 4MDWA 2C0TA 1P92A 4D8DA 2XDPA 2GBQA 4C8QC 3QUIA 2OTJA 3H0IA 1YI2A 1K9MR 1G3WA 1NEBA 1XJWB 2LZ6B 2DVEA 3M53A 3PFSA 5EC7A 2O31A 2RJDA 4F04B 2K7AA 4KRTA 2BE7D 4DEYA 2DERA 3CBPA 2GF7A 1QCFA 5IHKA 1PSEA 2XK0A 3TREA 5KYYB 2CH4A 1X6OA 1E7OA 2XKOC 4QW2A 2LX9A 4HCZA 4JJCA 5GMKl 2DXCA 2DL5A 4FCYA 5GJVB 2P0QA 2XI9A 1VQ5Q 4C92G 2DIQA 2RJFA 2HEQA 1IGQA 3BW1A 4OGEA 5KYUA 1WGSA 2ABLA 3E2UA 1VOMA 1VQNA 1NBEB 2RK1A 2LJ0A 2LQWA 5CKFA 2LVMA 1Q95G 1UHFA 1E6HA 4OB3B 2RPNA 1XNIA 3H9NA 3CCLT 1GBRA 2BE9B 2K2MA 2V1QA 2X4JA 3SDZA 1X75C 4OMNA 2GTOA 1JRIA 4BI3A 3SFMA 5CK9A 2XD0A 3JCMQ 2KRSA 2K4YA 1RL2A 2K2VA 4D6WA 3EFSA 2A37A 1R77A 2JM8A 4JZ3A 3I9QA 2AIRB 1YIJA 2P4RA 4L59A 2MYSA 1WQWA 1K9MC 5CO7A 5KYUB 4JRPA 1ZQ1A 3FIFA 3MJXA 1SEMA 8AT1B 1D3BA 4HXJA 4PL6A 2I2LA 4M7DE 2DETA 3ZBDA 3JB9I 1KQ1A 1OYXA 3G7ZA 4PFPA 3OBYA 1R0CB 4MZPA 5GAN4 3CCQT 1PKTA 5GMKj 2K3BA 3A98A 2RQRA 4J9BA 3V8LA 2DZCA 2NWMA 2RH2A 1QVFA 2QQBA 2KYMA 4BUGA 4ZGEB 1LOJA 1FMWA 1UGRB 3FJPA 4QQ6A 1O9SA 5HK3A 3H8ZA 2RA2A 2FG0A 1YITQ 5I22A 4XTVA 4C92E 1VQOT 2X4XA 4RTZA 2C06A 2KQWA 2IG0A 2KMTA 1D3BB 2X9HA 2J6OA 1NM7A 1M4ZA 2EWNA 4M75G 1GFCA 1TWBA 2VKNA 2M0YA 3JCMg 2Y4XA 2D9TA 1BIAA 4ZNXA 3ZFJA 1VIFA 3CCJT 2MAMA 2DZ9A 1TG0A 1PG5B 4IUQA 2G6FX 3NGPA 1VQPA 1VQMQ 3NFCA 4JLGA 4D8KA 3M0TA 1CSKA 2AT1B 2EW3A 2OAUA 4J9HA 3HP9A 2DD4A 3EGDA 3E9FA 3VS1A 4XAXB 2A36A 3V7RA 4PJMA 3CC4T 1JEGA 1WHMA 2BUDA 1W2BS 2QA4Q 2RJCA 4KUDK 2OTLT 2DXUA 1FX7A 2LQKA 3EHQA 1N8RR 3SD4A 2CZ7B 2YDLA 4ATOA 4LDUA 1VQLT 3DLLA 4IURA 3CCMT 1WFWA 3UATA 2COWA 7AT1B 3QYGB 4HCCA 4FSXA 2GQVA 3JV3A 1YHQT 1I07A 3LGLA 3BDLA 3META 1OPKA 1ZUYA 3VS2A 1Q82R 3QKJA 3EGDB 3BE3A 4BI4A 4BE2A 2X4WA 2KGTA 2QASA 1RLPC 1WHJA 2RQTA 1M3CA 2EQMA 1PD1A 4A53A 1SF9A 5I21A 3QSUA 1UB4A 1BCOA 2X51A 3QJ6A 4JJBA 4DBQA 1W6XA 3FRNA 1RAGB 3MEUA 4DOWA 2XU8A 2V26A 4M75E 2YUNA 4FYVB 3JCMb 2E65A 2WSCE 2DTOA 2FVUA 4EDUA 3M4YA 5KCOA 4R56A 4BE1A 4M78D 3AT1B 2BIVA 1OX9A 3AHUA 1TH7A 4AG1C 5GAMj 3A8MB 1UJ0A 1M2VA 5LJ5h 2RJEA 1GCPA 4J6WA 4DEXA 2OJ2A 3CCRT 2JN0A 5LJ3j 1N8RC 4A4GA 4A4EA 3X26B 2QEXT 2CP6A 3LLRA 1VQ5A 4N4HA 1AWWA 2O9SA 3EFOA 3SHWA 3A1PA 1K4US 3ME9A 5GANj 5FWBA 5GAOq 2CUDA 3VV0A 4C0DB 3N5BB 5LJ5d 4B9XA 5L23A 2HBWA 4FT2A 1JXOA 3OW2A 2M9UA 2CDTA 2ATCB 4M77A 4PKCC 4C5IA 2HL5C 4AT1B 2JOYA 4M78F 1Q82C 4KT0E 3I5RA 4XK8E 1G8XA 2X35A 3QZ9B 1ABOA 2CT4A 1QVFP 2L3SA 4LXCA 1TS9A 4XU2A 3OYIA 1WJRA 3LYIA 3I5SA 2I0NA 1M2VB 2A08A 2RHIA 1IREB 1T3LA 1G83A 1HK9A 2L89A 3ZEHA 5CIUA 4QVCA 4Y91A 2ZPFB 1NJIR 2NYSA 1VQ4T 4C0DC 4EPCA 2KEAA 1UUEA 1QP3A 3I55T 3HFOA 4XU0A 1BIBA 3BFMA 3R6OA 2ZPGB 2IIMA 3CMAT 2M02A 5A0GA 1Q86U 1RI0A 3G6EQ 1VYVA 1I4K1 4M77B 1GBQA 3V7CA 3UPUA 4Q5WA 3QDFA 2P4TA 4DBHA 2XHCA 5D7UA 3OMGA 3VRZA 2DL7A 4C0FA 1TUCA 2CP7A 3GOXA 2JNGA 2CT3A 1HJDA 2EJ9A 1S72T 2FO0A 4IKFA 2EQUA 2HKNA 1QLYA 1RADB 4JRIA 2OTJT 1YI2T 1YITA 3VU3C 1UGQB 3HL8A 1SRLA 5IH2A 3M9QA 3CC7Q 1HYOA 4E6RA 1G3SA 2JTFA 1QVGS 2QGGA 4XTUA 2LJ1A 1M90R 4PJOF 3Q1JA 2CP0A 3HFNA 4PNOA 5ECAA 3CD6T 1WNLA 1IRXA 5GMKe 1VQMA 4EMKA 3MP6A 1KHIA 1YN8A 3NTKA 2HDAA 3MO8A 3M58A 1VQ6A 4J9IA 1VQNT 2WSFE 1LPLA 5IAYA 2RNAA 2CKKA 2P0PA 1NPRA 2FZKB 1OULA 3QWXX 4OMPA 1OPLA 2WACA 3RUXA 4CC7A 4HVVA 3E19A 2FPEA 1BBZA 2YT6A 3GLXA 3G4ST 2QA4A 4RTVA 3X24B 1MUZA 2K3YA 4Y92A 3JCMh 1M8MA 2K5LA 2RI3A 2D8JA 4MZTA 4BY6B 1BK2A 1R8OB 3FDRA 1V1CA 3M55A 2QTVA 4J9EA 4R55A 3C4SA 1YIJT 1IXDA 4FIBA 3EGXA 3WVEB 4FYXB 3M54A 4C5GA 4EMKB 3H41A 2RHZA 4OP0A 2DIGA 2RQUA 1XOVA 5KCHA 2DTHA 4AFUC 3OYEA 2D1XA 2DFUA 2X3XD 3CQTA 2OAWA 4M75D 2L3QA 3D7SB 2F69A 4J9CA 1M90C 2MWOA 4IUTA 1I0CA 4BY6C 1GCQA 3REAB 5J39A 3MCAB 2IPOB 2EYQA 4IUVA 1HD3A 2KROA 3CCUQ 3QHSA 4OMOA 2EGEA 1T0JA 3OW2P 2LQNA 3VS7A 2DX1A 3TCJA 4XU1A 4C8QG 4EMKC 1R0BG 1TUDA 1YJWT 2LTOA 3CMET 1UE9A 3EGXB 4BB7A 1WYXA 3H6ZA 1MV0B 1UJYA 3CC2T 5IN1A 5GAN8 1WA7A 2EJFA 3M0QA 3V7SA 2SEMA 3OSVA 4JPBW 2AK5A 2DTIA 2JW4A 3CCVT 2DEQA 1NG2A 2RM4A 1OOTA 2LT4A 8ATCB 1HSQA 1AWJA 1YCYA 3M0UA 1YJNA 2E64A 5LJ5g 2YRDA 2D0QB 4M7DA 1W70A 4C0ZA 4E47A 2CS7A 3A8LB 4ZN3A 3VRYA 1BCMA 1SRMA 4FM4B 1VQPT 2FZGB 5GJWB 3RDVA 2K79A 3X28B 4J6XA 3I56Q 1BI1A 3OS5A 5D6WA 2F2WA 4P5NA 3PMIA 2KVQG 3G71T 3ER0A 1RLQC 1GCQC 3VJPA 4C92A 5A2QE 1O75A 1QCOA 3CCSA 2E1HA 2EQIA 2GFUA 4PJOG 4M78E 3CPWS 1WQ7A 4HT9A 1ZHIA 4M7DB 4J7IA 4JJNK 3M59A 2CYZB 1G3YA 4RTYA 5LJ5j 4BDZA 2HCKA 2L5QA 3OYNA 3REBB 2XICA 2DLPA 4TVRA 3G6EA 5GANe 1C0MA 1UGSB 5AYFA 1C6VX 1Q86R 1YJ9A 4O6JA 2FYKA 3C0CA 4FYYB 4CC2A 4E7KA 1ZSGA 2DXTA 2JM9A 3JRZA 2DJZA 1WX6A 3WXMB 3CCET 3QPHA 3JCMW 5FRNA 2X3WD 2FEIA 1DJ7B 4M7DC 3VYHB 4C92B 2V1RA 1W2BA 2CUBA 2JMCA 1NJIU 1IGUA 3L2RA 2DXBA 2NUPA 3H0FA 2JVVA 2L3PA 2E12A 3CXCS 1QWEA 2CSIA 2EYXA 1AWOA 2QG9B 4RTUA 3CC7A 3OYYA 1VQ8A 4J9FA 1OU9A 4WF2A 2YRVA 2DBKA 4MMKA 3MPUB 1MV3A 1KFZA 3L2UA 4C92C 1VQ5T 1Y0MA 1M5Q1 4GLMA 1J3TA 3LH5A 4CI0C 2CZ6B 4IUUA 2OX7A 2WSEE 5KYXA 2JXBA 2CP5A 1TOVA 1ZSZA 1WHKA 5GAOr 1MHNA 2VUBA 1JO8A 1WI7A 1PD0A 4PJOE 1Q86C 4E7IA 2NUPB 4LD9K 1VQ7Q 4ANJA 4N4GA 3CC4Q 2QK0A 4M75A 2HQEA 3L2ZA 4M4ZA 2RD1A 2J6FA 2KI7A 3HSBA 1BYMA 2MI6A 3WVDB 2MWPA 3GIBA 3OB9A 1Y07A 1VQLQ 1M90U 2QDYB 1KJWA 2VYTA 4KGVB 1AT1B 3TU4K 5IXFA 1MMDA 1V76A 3RNJA 3RKWA 4IUPA 2HKQB 3PIOA 3MEWA 4M77F 3CXCP 3EFRA 1XTDA 1K0SA 1JU5C 3OY9A 2RHYA 5KYXB 2H3JA 3GNGA 1AZEA 1VQ6Q 2HMAA 1ZSZB 5CAIA 2KXCA 4FL6A 3VS4A 2B86A 5HY6A 5CKDA 1ARKA 3RESA 2HL3A 3VYGA 4M75B 1OU8A 1U1TA 4XQ3A 4ESRA 3EG9A 2RHXA 3CCUA 4K11A 3TQ7P 1H3HA 5IHIA 2P84A 3HKSA 2DL8A 2EGAA 5FRMA 1OZ2A
chains in the Genus database with same CATH topology
3U23A 2KEAA 2RF0A 1UUEA 4F17A 3M0SA 2LP5A 1NLPC 2PTKA 2JT4A 2RQWA 1S1NA 4CC3A 2EVRA 2IIMA 1M3BA 1UHCA 1ABQA 4ORZA 1GRIA 1X69A 1VYVA 2EKHA 1G2BA 1GBQA 2HSPA 2MCNA 2KNBB 3UF4A 4GBQA 2EGCA 3TSWA 4IIMA 2AZVA 3VRZA 2DL7A 2EYWA 5IXBA 2KRNA 1X6GA 1TUCA 4CC4B 2LMJA 1VYTA 2F2XA 3GBQA 4LNPA 2C0IA 2CT3A 1HJDA 3EHRA 5I11A 5HCKA 4AFSC 1AWXA 1QWFA 2J7IA 2FO0A 1UFFA 2L2PA 1QLYA 1PRMC 1CKAA 2O9VA 2ESWA 4F16A 2EYZA 1CKBA 2XMFA 3TSZA 1YWOA 1YP5A 2RMOA 1Z9ZA 1SRLA 2FPDA 3PVQA 4RTXA 5IH2A 2AKLA 1AOJA 2M51A 3VS5A 2O2OA 2LJ3A 4X1VA 2ENMA 1WLPB 4E6RA 2J6KA 3NPFA 2E5KA 1ZBJA 2LJ1A 1AVZC 2BZYA 1UTIA 2GGRA 2YUQA 4OMLA 1FMKA 1VA7A 2EBPA 1LCKA 1Z9QA 1JQQA 2C0TA 2PZ1A 5ECAA 1B07A 4Z89A 2H8HA 4D8DA 2YSQA 3VS6A 1WIEA 3SEMA 1YN8A 2GBQA 2HDAA 1UG1A 2RN8A 3IQLA 2PNIA 4J9IA 1UECA 1KIKA 2RNAA 3H0IA 1NEBA 2LZ6B 3QWXX 4OMPA 1OPLA 5EC7A 3O5ZA 4CC7A 2O31A 4HVVA 2FPEA 2JTEA 2K7AA 4KRTA 1BBZA 2YT6A 1WXTA 4LE9A 4DEYA 1QCFA 5IHKA 4RTVA 1MUZA 4J9DA 4Y92A 1SSHA 4JJDA 3PE0A 1M8MA 2CH4A 3R6NA 3EG2A 1E7OA 1WDXA 2D8JA 2DBMA 4JJCA 2L0AA 1BK2A 2D8HA 2DL5A 1V1CA 5GJVB 4Z88A 4RTWA 4Z8AA 2K6DA 4J9EA 2HEQA 4J9GA 1SHFA 1Y57A 2VWFA 2ABLA 1YCSB 1SHGA 2LJ0A 1IO6A 2LQWA 4OMMA 1M27C 3H41A 1M30A 1PHTA 2RQUA 1UHFA 1XOVA 1E6HA 2RQVA 1NYFA 3NHNA 2ED0A 2DNUA 2RPNA 3EG0A 4AFUC 2D1XA 2DRMA 1YWPA 2X3XD 1X27A 3CQTA 1GBRA 1U5SA 2OAWA 3UA7A 2K2MA 2L3QA 2V1QA 1NYGA 4OMNA 1YNZA 1B3QA 2LX7A 2GTOA 4J9CA 4LUEA 2BZ8A 1I0CA 5IHNA 1GCQA 2KRSA 1QKXA 3REAB 1NEGA 3M0RA 1PWTA 4RUGA 4LN2A 1HD3A 1X2KA 2KROA 2A37A 2JM8A 4OMOA 2EGEA 1T0JA 2LQNA 3VS7A 2DX1A 2QDLA 4JZ4A 4JZ3A 3I9QA 2P4RA 3VS0A 4A63B 1UGVA 1TUDA 2KT1A 1UE9A 2ROTA 2K9GA 2A28A 1WYXA 1PKSA 1MV0B 1UJYA 3I35A 1SEMA 2J05A 1WA7A 4HXJA 2KYBA 3PVLA 1RI9A 3M0QA 1NLOC 2SEMA 4JPBW 2AK5A 2JW4A 1PKTA 2D0NA 1NG2A 1OOTA 2ECZA 2K3BA 1HSQA 1W1FA 3A98A 2RQRA 4R0KA 1AWJA 2JS2A 4EIKA 1ZX6A 3M0UA 4J9BA 2F2VA 1KSWA 2NWMA 2MOXA 1W70A 2DRKA 2KYMA 2YUPA 3VRYA 1SRMA 5GJWB 2K79A 1ZUUA 2KE9A 1K1ZA 2FG0A 5I22A 1AD5A 1ZLMA 4RTZA 1PNJA 4IIOA 1ZUKA 2JMAA 2NUZA 4OMQA 4QT7A 4F14A 1BB9A 2J6OA 1NM7A 2F2WA 3THKA 1PRLC 1RUWA 1GFCA 2DJQA 2VKNA 1RLQC 1GCQC 2M0YA 2DMOA 1K0XA 1U06A 4ZNXA 2FRYA 2O88A 1A0NB 2EQIA 4HCKA 1GFDA 4FSSA 1TG0A 5FW9A 2G6FX 3NGPA 4LUDA 4D8KA 3M0TA 4RTYA 1T3SA 1K76A 2DM1A 1CSKA 2HCKA 2EW3A 3REBB 1OEBA 4J9HA 2DLPA 2ED1A 2LCSA 2W10A 1T0HA 1UDLA 2GNCA 3VS1A 2KT8A 2A36A 2LNHB 1JEGA 1EFNA 3C0CA 4CC2A 1ZSGA 4HVUA 3UA6A 2DF6A 2JM9A 3VS3A 2CH4W 2W0ZA 1WX6A 1H92A 2VVKA 4AFQC 1AZGB 3EHQA 2X3WD 2YDLA 2FEIA 2OI3A 4RTTA 3EGUA 3QWYA 5FWCA 2V1RA 1WFWA 2CUBA 2JMCA 3UATA 2ROLA 2EPDA 2DVJA 3H0FA 1FYNA 2L3PA 2DL4A 3NMZC 4AG2C 1QWEA 3JV3A 2DL3A 2GTJA 1I07A 2CSIA 2EYXA 1OPKA 1AWOA 1ZUYA 4RTUA 3VS2A 1M3AA 4J9FA 2DBKA 2KGTA 2KXDA 1MV3A 1RLPC 1KFZA 2RQTA 1M3CA 2CREA 1N5ZA 2KR3A 1Y0MA 4GLMA 1J3TA 4WCIA 3EG1A 4JJBA 2DA9A 2KRMA 1X2QA 1X43A 3LH5A 3ZL7C 1W6XA 3TVTA 3FJ5A 2YUNA 2J06A 2JXBA 1SPKA 1JO8A 1WI7A 1WXUA 2MIOA 3M0PA 2DYBA 1X6BA 1H8KA 4AG1C 3ULRB 4M4ZA 1UJ0A 1OV3A 2J6FA 2YUOA 1GCPA 2CSQA 4DEXA 2OJ2A 3RBBB 2BZXA 4HVWA 2AZSA 1GL5A 1KJWA 1AWWA 2O9SA 3SHWA 5IXFA 1K4US 5FWBA 3RNJA 2DE0X 2CUDA 1VYUA 1K9AA 5L23A 2HBWA 1K0SA 1JXOA 2EYYA 1JU5C 2CDTA 1E6GA 1WXBA 1AZEA 2AKKA 2KXCA 4AFZC 3I5RA 3VS4A 2B86A 1ABOA 2CT4A 2GQIA 2FPFA 2L3SA 1U3OA 1ARKA 2C0OA 3EG3A 1JXMA 2DILA 2BTTA 2I0NA 3I5SA 2KBTA 1I1JA 2A08A 2JS0A 2SRCA 1QKWA 4ESRA 2FRWA 1T3LA 1G83A 4K11A 1H3HA 1AEYA 5IHIA 1BU1A 3KFVA 2DL8A 2EGAA 3H0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U23 A;  2KEA A;  2RF0 A;  1UUE A;  4F17 A;  3M0S A;  2LP5 A;  1NLP C;  2PTK A;  2JT4 A;  2RQW A;  1S1N A;  4CC3 A;  2EVR A;  2IIM A;  1M3B A;  1UHC A;  1ABQ A;  4ORZ A;  1GRI A;  1X69 A;  1VYV A;  2EKH A;  1G2B A;  1GBQ A;  2HSP A;  2MCN A;  2KNB B;  3UF4 A;  4GBQ A;  2EGC A;  3TSW A;  4IIM A;  2AZV A;  3VRZ A;  2DL7 A;  2EYW A;  5IXB A;  2KRN A;  1X6G A;  1TUC A;  4CC4 B;  2LMJ A;  1VYT A;  2F2X A;  3GBQ A;  4LNP A;  2C0I A;  2CT3 A;  1HJD A;  3EHR A;  5I11 A;  5HCK A;  4AFS C;  1AWX A;  1QWF A;  2J7I A;  2FO0 A;  1UFF A;  2L2P A;  1QLY A;  1PRM C;  1CKA A;  2O9V A;  2ESW A;  4F16 A;  2EYZ A;  1CKB A;  2XMF A;  3TSZ A;  1YWO A;  1YP5 A;  2RMO A;  1Z9Z A;  1SRL A;  2FPD A;  3PVQ A;  4RTX A;  5IH2 A;  2AKL A;  1AOJ A;  2M51 A;  3VS5 A;  2O2O A;  2LJ3 A;  4X1V A;  2ENM A;  1WLP B;  4E6R A;  2J6K A;  3NPF A;  2E5K A;  1ZBJ A;  2LJ1 A;  1AVZ C;  2BZY A;  1UTI A;  2GGR A;  2YUQ A;  4OML A;  1FMK A;  1VA7 A;  2EBP A;  1LCK A;  1Z9Q A;  1JQQ A;  2C0T A;  2PZ1 A;  5ECA A;  1B07 A;  4Z89 A;  2H8H A;  4D8D A;  2YSQ A;  3VS6 A;  1WIE A;  3SEM A;  1YN8 A;  2GBQ A;  2HDA A;  1UG1 A;  2RN8 A;  3IQL A;  2PNI A;  4J9I A;  1UEC A;  1KIK A;  2RNA A;  3H0I A;  1NEB A;  2LZ6 B;  3QWX X;  4OMP A;  1OPL A;  5EC7 A;  3O5Z A;  4CC7 A;  2O31 A;  4HVV A;  2FPE A;  2JTE A;  2K7A A;  4KRT A;  1BBZ A;  2YT6 A;  1WXT A;  4LE9 A;  4DEY A;  1QCF A;  5IHK A;  4RTV A;  1MUZ A;  4J9D A;  4Y92 A;  1SSH A;  4JJD A;  3PE0 A;  1M8M A;  2CH4 A;  3R6N A;  3EG2 A;  1E7O A;  1WDX A;  2D8J A;  2DBM A;  4JJC A;  2L0A A;  1BK2 A;  2D8H A;  2DL5 A;  1V1C A;  5GJV B;  4Z88 A;  4RTW A;  4Z8A A;  2K6D A;  4J9E A;  2HEQ A;  4J9G A;  1SHF A;  1Y57 A;  2VWF A;  2ABL A;  1YCS B;  1SHG A;  2LJ0 A;  1IO6 A;  2LQW A;  4OMM A;  1M27 C;  3H41 A;  1M30 A;  1PHT A;  2RQU A;  1UHF A;  1XOV A;  1E6H A;  2RQV A;  1NYF A;  3NHN A;  2ED0 A;  2DNU A;  2RPN A;  3EG0 A;  4AFU C;  2D1X A;  2DRM A;  1YWP A;  2X3X D;  1X27 A;  3CQT A;  1GBR A;  1U5S A;  2OAW A;  3UA7 A;  2K2M A;  2L3Q A;  2V1Q A;  1NYG A;  4OMN A;  1YNZ A;  1B3Q A;  2LX7 A;  2GTO A;  4J9C A;  4LUE A;  2BZ8 A;  1I0C A;  5IHN A;  1GCQ A;  2KRS A;  1QKX A;  3REA B;  1NEG A;  3M0R A;  1PWT A;  4RUG A;  4LN2 A;  1HD3 A;  1X2K A;  2KRO A;  2A37 A;  2JM8 A;  4OMO A;  2EGE A;  1T0J A;  2LQN A;  3VS7 A;  2DX1 A;  2QDL A;  4JZ4 A;  4JZ3 A;  3I9Q A;  2P4R A;  3VS0 A;  4A63 B;  1UGV A;  1TUD A;  2KT1 A;  1UE9 A;  2ROT A;  2K9G A;  2A28 A;  1WYX A;  1PKS A;  1MV0 B;  1UJY A;  3I35 A;  1SEM A;  2J05 A;  1WA7 A;  4HXJ A;  2KYB A;  3PVL A;  1RI9 A;  3M0Q A;  1NLO C;  2SEM A;  4JPB W;  2AK5 A;  2JW4 A;  1PKT A;  2D0N A;  1NG2 A;  1OOT A;  2ECZ A;  2K3B A;  1HSQ A;  1W1F A;  3A98 A;  2RQR A;  4R0K A;  1AWJ A;  2JS2 A;  4EIK A;  1ZX6 A;  3M0U A;  4J9B A;  2F2V A;  1KSW A;  2NWM A;  2MOX A;  1W70 A;  2DRK A;  2KYM A;  2YUP A;  3VRY A;  1SRM A;  5GJW B;  2K79 A;  1ZUU A;  2KE9 A;  1K1Z A;  2FG0 A;  5I22 A;  1AD5 A;  1ZLM A;  4RTZ A;  1PNJ A;  4IIO A;  1ZUK A;  2JMA A;  2NUZ A;  4OMQ A;  4QT7 A;  4F14 A;  1BB9 A;  2J6O A;  1NM7 A;  2F2W A;  3THK A;  1PRL C;  1RUW A;  1GFC A;  2DJQ A;  2VKN A;  1RLQ C;  1GCQ C;  2M0Y A;  2DMO A;  1K0X A;  1U06 A;  4ZNX A;  2FRY A;  2O88 A;  1A0N B;  2EQI A;  4HCK A;  1GFD A;  4FSS A;  1TG0 A;  5FW9 A;  2G6F X;  3NGP A;  4LUD A;  4D8K A;  3M0T A;  4RTY A;  1T3S A;  1K76 A;  2DM1 A;  1CSK A;  2HCK A;  2EW3 A;  3REB B;  1OEB A;  4J9H A;  2DLP A;  2ED1 A;  2LCS A;  2W10 A;  1T0H A;  1UDL A;  2GNC A;  3VS1 A;  2KT8 A;  2A36 A;  2LNH B;  1JEG A;  1EFN A;  3C0C A;  4CC2 A;  1ZSG A;  4HVU A;  3UA6 A;  2DF6 A;  2JM9 A;  3VS3 A;  2CH4 W;  2W0Z A;  1WX6 A;  1H92 A;  2VVK A;  4AFQ C;  1AZG B;  3EHQ A;  2X3W D;  2YDL A;  2FEI A;  2OI3 A;  4RTT A;  3EGU A;  3QWY A;  5FWC A;  2V1R A;  1WFW A;  2CUB A;  2JMC A;  3UAT A;  2ROL A;  2EPD A;  2DVJ A;  3H0F A;  1FYN A;  2L3P A;  2DL4 A;  3NMZ C;  4AG2 C;  1QWE A;  3JV3 A;  2DL3 A;  2GTJ A;  1I07 A;  2CSI A;  2EYX A;  1OPK A;  1AWO A;  1ZUY A;  4RTU A;  3VS2 A;  1M3A A;  4J9F A;  2DBK A;  2KGT A;  2KXD A;  1MV3 A;  1RLP C;  1KFZ A;  2RQT A;  1M3C A;  2CRE A;  1N5Z A;  2KR3 A;  1Y0M A;  4GLM A;  1J3T A;  4WCI A;  3EG1 A;  4JJB A;  2DA9 A;  2KRM A;  1X2Q A;  1X43 A;  3LH5 A;  3ZL7 C;  1W6X A;  3TVT A;  3FJ5 A;  2YUN A;  2J06 A;  2JXB A;  1SPK A;  1JO8 A;  1WI7 A;  1WXU A;  2MIO A;  3M0P A;  2DYB A;  1X6B A;  1H8K A;  4AG1 C;  3ULR B;  4M4Z A;  1UJ0 A;  1OV3 A;  2J6F A;  2YUO A;  1GCP A;  2CSQ A;  4DEX A;  2OJ2 A;  3RBB B;  2BZX A;  4HVW A;  2AZS A;  1GL5 A;  1KJW A;  1AWW A;  2O9S A;  3SHW A;  5IXF A;  1K4U S;  5FWB A;  3RNJ A;  2DE0 X;  2CUD A;  1VYU A;  1K9A A;  5L23 A;  2HBW A;  1K0S A;  1JXO A;  2EYY A;  1JU5 C;  2CDT A;  1E6G A;  1WXB A;  1AZE A;  2AKK A;  2KXC A;  4AFZ C;  3I5R A;  3VS4 A;  2B86 A;  1ABO A;  2CT4 A;  2GQI A;  2FPF A;  2L3S A;  1U3O A;  1ARK A;  2C0O A;  3EG3 A;  1JXM A;  2DIL A;  2BTT A;  2I0N A;  3I5S A;  2KBT A;  1I1J A;  2A08 A;  2JS0 A;  2SRC A;  1QKW A;  4ESR A;  2FRW A;  1T3L A;  1G83 A;  4K11 A;  1H3H A;  1AEY A;  5IHI A;  1BU1 A;  3KFV A;  2DL8 A;  2EGA A;  3H0H A; 
#chains in the Genus database with same CATH topology
 2ZGW A;  4E2F B;  2RF0 A;  2K57 A;  2ZPH B;  2CP2 A;  4Y28 E;  1NLP C;  2PTK A;  1FWZ A;  4VUB A;  1ZSZ C;  2COY A;  4L6V 5;  2EVR A;  1M3B A;  1UHC A;  4Z02 A;  3JCM c;  3DB3 A;  4EMG A;  1TSF A;  5GAO l;  2EKH A;  4M75 C;  2ZPE B;  3UF4 A;  3TSW A;  2K5F A;  2VAS A;  2E41 A;  1Q7Y U;  3FC3 A;  4X9C A;  1M1K U;  1VYT A;  4JRK A;  5I11 A;  3EG9 B;  1AWX A;  1QWF A;  5HKC A;  3JCM V;  1PRM C;  2ESW A;  2JJ9 A;  2EYZ A;  3P8B B;  4F16 A;  2XMF A;  1YP5 A;  3I56 A;  2E4H A;  5KE2 A;  3PVQ A;  2B8A A;  2FZC B;  2AKL A;  4ZTF A;  2JUF A;  5DLO A;  1PC0 A;  3VS5 A;  2Y4Y A;  2O2O A;  4MDX A;  4X1V A;  2J6K A;  3A8O B;  3VUZ A;  2E5K A;  5KYN A;  1W2B P;  4JLI A;  1K73 R;  1ZBJ A;  1AVZ C;  4KUI A;  5I2M A;  3QO3 A;  1C1A A;  2VB6 A;  1UTI A;  2R5M A;  2YUQ A;  4OML A;  1FMK A;  4A4F A;  1Z9Q A;  1JQQ A;  2PZ1 A;  4C8Q D;  5GMK i;  4JS4 A;  3A5Z B;  1B07 A;  1YJN Q;  2H8H A;  4PJN A;  1QVG A;  2YSQ A;  1ZA2 B;  1MND A;  3VKI A;  3IQL A;  4OVA A;  2H3E B;  1UEC A;  1BI2 A;  4BE0 A;  3C12 A;  4NS5 A;  5GAN 7;  4PJJ A;  3BDU A;  3JSC A;  3C94 A;  4ZTJ A;  2F1L A;  3CCQ A;  4FW1 A;  4LE9 A;  1VQK T;  4F7U F;  4FW2 A;  4M7A F;  2RK2 A;  4CRI A;  2VGN A;  3OYA A;  4JJD A;  5J26 A;  3OS2 A;  2DBM A;  2L0A A;  4LD6 A;  2D8H A;  4Z88 A;  4RTW A;  2K6D A;  2HD0 A;  1U8R A;  3P8D A;  1SHF A;  1Y57 A;  2L8D A;  4C8Q F;  2VWF A;  3CCS Q;  3J7A F;  1SHG A;  1IO6 A;  4OMM A;  1M27 C;  4X9D A;  1VQO A;  1PHT A;  4ZN1 A;  4M77 G;  2RI2 A;  3NHN A;  2ED0 A;  2DNU A;  2KAF A;  3EG0 A;  1OI1 A;  3PMT A;  3DB4 A;  3HRS A;  3DLM A;  4C5H A;  1WHG A;  1KQS S;  3J80 E;  3UA7 A;  1K73 C;  2EAY A;  1B3Q A;  4LUE A;  1QMC A;  2BZ8 A;  3CCJ A;  4FT4 A;  1YJ9 Q;  3M0R A;  2QQS A;  1D1A A;  1PWT A;  4PJO D;  4RUG A;  4LN2 A;  2EKO A;  2O01 E;  3CD6 Q;  5GMK m;  3LX7 A;  1UEB A;  4JZ4 A;  3S6W A;  2LRQ A;  2ZAE A;  1FXX A;  3VS0 A;  2KDS A;  2KT1 A;  2ROT A;  2K9G A;  1VQ7 A;  2J05 A;  3CC4 A;  1EIF A;  2KYB A;  1RI9 A;  3MEA A;  2XG8 D;  2DAQ A;  1NLO C;  2PUK B;  3L2Q A;  3BY7 A;  1MMA A;  4LDW A;  2ECZ A;  3RMQ A;  1W1F A;  4XTX A;  2FB7 A;  1VQL A;  4M7D F;  1VQ8 Q;  1KSW A;  4BI8 B;  1ACM B;  2MOX A;  3FB9 A;  1LNX A;  2DRK A;  2LC4 A;  3QBY A;  1KQ2 A;  1KHC A;  1NJI C;  2HQH A;  5L8R E;  3JCM X;  2A0F B;  4A4H A;  4N0A A;  1D1C A;  2KE9 A;  1YHQ A;  1K1Z A;  3UWN A;  3GPL A;  1YBY A;  3NTI A;  3G6E T;  1ZLM A;  1PNJ A;  2FL7 A;  4OMQ A;  1BB9 A;  4KH0 B;  3THK A;  1RUW A;  2DJQ A;  4J6Y A;  3M56 A;  4M77 E;  1K0X A;  2PU9 B;  1D0X A;  4E7H A;  2FRY A;  1VQ9 Q;  2O88 A;  2DD5 A;  4XTZ A;  1A0N B;  3OYJ A;  4ZGJ B;  1PCX A;  1GFD A;  2PQW A;  4JRQ A;  5FW9 A;  2HNI A;  4LUD A;  3S3O A;  2KK4 A;  1Q81 U;  1K76 A;  2DM1 A;  4QQD A;  2MK5 A;  4RG2 A;  3KXT A;  1OEB A;  5CCA A;  1RAB B;  4RCB A;  2LCS A;  3CPW A;  4M78 A;  1UDL A;  3EAE A;  5GAO p;  3ASK A;  3CC7 T;  3GF5 A;  2KT8 A;  5GAN 2;  2EQK A;  1VIE A;  4BD3 A;  1WJQ A;  1EFN A;  2QQA A;  1QVG P;  2DO3 A;  3O8V A;  2DF6 A;  4F7U G;  3VS3 A;  4M7A G;  2W0Z A;  4KGZ B;  1H92 A;  2V8J A;  4AFQ C;  1Q7Y R;  2CP3 A;  3UDC A;  2QQR A;  1M1K R;  3EGU A;  4OB0 B;  3QWY A;  5FWC A;  3T9N A;  3DKM A;  2ROL A;  2EPD A;  4N0A C;  2DVJ A;  1ZA1 B;  2CGH A;  4DQ2 A;  5A0D A;  2GFA A;  2E70 A;  4GY5 A;  2XID A;  3QJY A;  2DL3 A;  2GTJ A;  3OYH A;  1M3A A;  2JZ2 A;  4M78 B;  4DBF A;  3OA6 A;  3JCM e;  4OB1 B;  3CXC A;  3JCM J;  1TU0 B;  1RAF B;  1N5Z A;  1D0Y A;  1KD1 U;  2QYZ A;  3EG1 A;  2KRM A;  4KGX B;  1QCN A;  4B6M A;  3FJ5 A;  2PVG B;  2RHU A;  3CMA A;  2MMP A;  2V8K A;  1SPK A;  2M1H A;  3E9G A;  5GAM d;  2RI5 A;  2MIO A;  2A7Y A;  3L42 A;  4LDV A;  4NL3 A;  5IT9 E;  2DYB A;  4PJL A;  5GAN 6;  1X6B A;  5KYW A;  4M78 C;  1N9S A;  1OX8 A;  5LJ3 d;  3TEE A;  1OV3 A;  2YUO A;  4V2S A;  3CCL Q;  2RO0 A;  2CSQ A;  5KH6 A;  4PJO A;  1Q7Y C;  2VGM A;  1M8V A;  1K73 U;  4HVW A;  5GAN d;  2AZS A;  1S72 A;  3CCU T;  1GL5 A;  3RKX A;  4BAC A;  1M1K C;  4M7D G;  2VXE A;  1MMN A;  3HTR A;  1RAA B;  5GAM e;  2LCL A;  3RKY A;  1QQJ A;  5CQX A;  1VYU A;  4ELZ C;  4F7U E;  4DA4 A;  4M7A E;  1K9A A;  5LJ3 e;  2M16 A;  2EYY A;  2R5A A;  1WXB A;  2E6N A;  5D6X A;  1ZBX A;  3J81 E;  2FPF A;  3GNF B;  4QVD A;  5KYW B;  1JJ2 S;  4HA8 A;  2PUO B;  3EG3 A;  4C8Q E;  2BTT A;  4QQG A;  3CCQ Q;  2KBT A;  1I1J A;  2SRC A;  1QKW A;  3CD6 A;  4PK4 A;  2FRW A;  4J5Y A;  1KC8 U;  3JB9 F;  5GAM f;  1AEY A;  4PJO B;  4PLI A;  2ZCF B;  3CPF A;  4C5E A;  3VUB A;  2K5I A;  1N27 A;  4J7F A;  3U23 A;  2YHT A;  5LJ3 f;  1WJS A;  2RQW A;  1S1N A;  1Y71 A;  2COZ A;  4CC3 A;  3I56 T;  5GAO n;  5GAN f;  3G4S A;  4ORZ A;  1YFN A;  1EZZ B;  3M5A A;  1VQO Q;  3OS1 A;  2K3X A;  1OQK A;  3CBM A;  2HZY A;  2HSP A;  2MCN A;  2KNB B;  2QGF B;  2EGC A;  1UGP B;  2HAX A;  4N4I A;  4IIM A;  3OSS C;  2AZV A;  4KUL A;  4PJO C;  1EX4 A;  2EYW A;  3MEV A;  1X6G A;  5DM7 R;  2LT1 A;  3GBQ A;  2F2X A;  4LNP A;  2RB6 A;  3CCJ Q;  4FU6 A;  1RAE B;  2CZ1 B;  2J7I A;  3URG A;  3CPW P;  1CKA A;  2O9V A;  1CKB A;  4M77 D;  4JDS A;  3TSZ A;  1WHH A;  1YWO A;  3L2V A;  2RMO A;  3RER A;  1K8A U;  4RTX A;  5CVI A;  1AOJ A;  1JJ2 P;  2QAZ A;  2M51 A;  2ENM A;  2ZPB B;  2Y90 A;  1WZO A;  1SKU B;  3PGG A;  4B9W A;  4A4K A;  3A8G B;  1VQ9 A;  3S3N A;  2GGR A;  1VA7 A;  2OTL Q;  2YLC A;  4RCC A;  3G1J A;  1F1B B;  1Y96 A;  3QDR B;  1YJW A;  1M1F A;  1NE8 A;  4Z89 A;  4JUV A;  3CME A;  3VS6 A;  1WIE A;  3SEM A;  3CCM Q;  1UG1 A;  2RN8 A;  3M57 A;  1AHJ B;  2PNI A;  1KIK A;  3CC2 A;  1Q81 R;  1WHL A;  3O5Z A;  1BKB A;  2JTE A;  3SWN A;  3CCV A;  3OS0 A;  3CBO A;  1YHQ Q;  2BKD N;  4E7J A;  1I5L A;  1WXT A;  1LVK A;  1FMV A;  1RAI B;  2M0O A;  4J9D A;  3L2W A;  1SSH A;  1IHV A;  3PE0 A;  4E7S A;  3OYB A;  3R6N A;  3EG2 A;  1WDX A;  1D09 B;  3LGF A;  4Z8A A;  1QVP A;  1MNE A;  3HPW A;  1PM3 A;  5D6Y A;  4J9G A;  4XTY A;  2FHD A;  4ELY C;  1Y96 B;  1YCS B;  1W4S A;  2YLB A;  4MML A;  1M30 A;  5AT1 B;  3MHX A;  2RQV A;  1D0Z A;  1NYF A;  1VQ7 T;  5KE3 A;  1YIT T;  2DRM A;  1YWP A;  4X34 A;  1X27 A;  3G71 A;  1U5S A;  5FRO A;  1NYG A;  2L3R A;  3SWN B;  1YNZ A;  2LX7 A;  1TUG B;  2HBP A;  5IHN A;  1QKX A;  3CCR Q;  2NLU A;  1NEG A;  5C0M A;  1X2K A;  2QEX Q;  1KQS A;  4J83 A;  5GAM g;  1KD1 R;  3JB9 G;  1MGQ A;  2QDL A;  3FLG A;  2YRC A;  4A63 B;  1UGV A;  2VC8 A;  5LJ3 g;  1V29 B;  1VQM T;  1Q81 C;  2A28 A;  3PTA A;  1PKS A;  2EJG A;  1VQ6 T;  3I35 A;  1Y7X A;  1NPP A;  1VQK Q;  3PVL A;  5FU7 B;  3SWN C;  5GAN g;  3CCL A;  1QVF S;  5C6S A;  4FYW B;  1U1S A;  2X4Y A;  5CR2 A;  3CCE A;  2VXF A;  2D0N A;  2DPP B;  4M7A D;  4R0K A;  4EIK A;  2JS2 A;  1ZX6 A;  3A8H B;  2QA4 T;  2F2V A;  2P0K A;  6AT1 B;  3KBG A;  1N9R A;  4HCB A;  1KG1 A;  3OYL A;  2YUP A;  1WPY A;  4PFZ A;  1BI0 A;  4II1 A;  1VQ4 Q;  4L5G A;  1ZUU A;  2EIF A;  3I55 Q;  4QKU A;  3QZ5 B;  5FU7 C;  2V8I A;  2D6F A;  4LDY A;  1QW1 A;  1AD5 A;  3CMA Q;  1I5O B;  5J3B A;  3EH1 A;  4E7Z A;  2QXF A;  4IIO A;  1ZUK A;  2E6Z A;  3GP8 A;  2ZPI B;  4AMC A;  2JMA A;  2NUZ A;  4F14 A;  4QT7 A;  1PRL C;  3SB2 A;  2O4X A;  3NTH A;  3EH2 A;  4ZGD B;  2E3H A;  2DMO A;  1U06 A;  3QG1 A;  1KD1 C;  1KC8 R;  3PT9 A;  3JAM E;  1M1G A;  1NZ9 A;  3OYD A;  4JS5 A;  1H64 1;  4HCK A;  2E10 A;  2VV5 A;  2DK3 A;  3OMC A;  4FSS A;  5I2S A;  2KSS A;  1B34 A;  1S72 Q;  4O5V A;  4ME7 A;  1TTH B;  2KY9 A;  3CEY A;  3RIR A;  1K9M U;  1T3S A;  5GAN 3;  1LJO A;  2MPX C;  3E1S A;  2OTJ Q;  2XDB A;  1RAC B;  1YI2 Q;  1G5V A;  1G3T A;  2JTM A;  3PIP A;  2ED1 A;  2W10 A;  4PFO A;  4WTO B;  1T0H A;  3LWI A;  2GNC A;  3M4G A;  3X20 B;  4NL2 A;  4OMF B;  1SSF A;  2LNH B;  9ATC B;  1I81 A;  4J8O A;  4HVU A;  5LL6 S;  3UA6 A;  5LJ5 e;  2CH4 W;  4M7D D;  2VVK A;  1AZG B;  3MP1 A;  2NUT A;  5EG2 A;  1PSF A;  2A3L A;  2O4X B;  2PVD B;  5GAN 5;  2OI3 A;  4HKE A;  4RTT A;  4UC4 A;  1YJN T;  3EFO B;  5FU6 B;  5GMK h;  2QTX A;  1BI3 A;  2CZ0 B;  1B34 B;  1FYN A;  1VQN Q;  1JB0 E;  4AG2 C;  2DL4 A;  3NMZ C;  2R58 A;  1K8A R;  2Z0W A;  4RG8 A;  1IB8 A;  5LJ5 f;  4OF1 A;  3OYC A;  3G4S Q;  4C92 D;  1SG5 A;  4PLL A;  2KXD A;  2OTL A;  4EMH A;  2AHJ B;  1KC8 C;  2CRE A;  5DY9 A;  2KR3 A;  2PVO B;  3QXE B;  5FU6 C;  4WCI A;  2DA9 A;  2YXY A;  1X2Q A;  1X43 A;  3CCM A;  4GLK A;  3ZL7 C;  4MZM A;  2NUT B;  1I8F A;  3CCS T;  3JB9 J;  3TVT A;  5A0L A;  1YIJ Q;  4BDY A;  2J06 A;  4M77 C;  4LDX A;  1WXU A;  2DYI A;  2XDD A;  3M0P A;  4E7L A;  1H8K A;  2YWW A;  3ULR B;  1X01 A;  1KQS P;  4OGC A;  2F5T X;  2E5Q A;  2LDM A;  2F5K A;  3FEO A;  1YJ9 T;  3RBB B;  3RMS A;  1TXQ A;  5CKH A;  2BZX A;  3X25 B;  4C92 F;  4OB2 B;  3HHT B;  1H3Z A;  2LCC A;  3MP8 A;  3OW2 S;  3LH0 A;  2DEU A;  2QI2 A;  2DE0 X;  3S3M A;  3OQ5 A;  2DKG A;  1YJW Q;  3CME Q;  3PNW C;  1E6G A;  2HQX A;  1K8A C;  1RAH B;  2AKK A;  3INZ A;  4AFZ C;  3CC2 Q;  2G3R A;  2ZZD A;  5HK0 A;  2GQI A;  3QII A;  4F7U A;  4HT8 A;  4M7A A;  1U3O A;  3OYM A;  2C0O A;  1N6A A;  1JXM A;  2DIL A;  3CCR A;  1M9S A;  3CCV Q;  3QYH B;  1VQ8 T;  1VUB A;  4XU3 A;  2JS0 A;  4C0G A;  3HRU A;  3UT1 A;  2GCX A;  3LWH A;  2QEX A;  3F70 A;  3OBW A;  1JBM A;  1BU1 A;  3KUF A;  1IZ6 A;  3KFV A;  1JJ2 A;  2EFI A;  3H0H A;  4C8Q A;  3JB9 H;  2IVW A;  4F17 A;  3JCM d;  1VQP Q;  2LQ8 A;  3M0S A;  2LP5 A;  2JT4 A;  1D1B A;  4DBR A;  4DOV A;  3P8H A;  2HSE B;  3OYF A;  1VQK A;  1ABQ A;  4M78 G;  2MF2 A;  3OYK A;  1GRI A;  5CQY A;  1X69 A;  5M9O A;  1G2B A;  4RMO A;  4GBQ A;  5CKE A;  4KH1 B;  1GXI E;  3L1A A;  4QVZ A;  1KK7 A;  4F7U B;  3G71 Q;  4M7A B;  1OZ3 A;  1VQ9 T;  1N8R U;  4YTL A;  5IXB A;  2KRN A;  4NOY A;  4CC4 B;  5GAM h;  3C95 A;  2LMJ A;  3HRT A;  2C0I A;  5FLX E;  3EHR A;  5HCK A;  4AFS C;  1VQ4 A;  2QQ9 A;  2E3I A;  3V8J A;  3V8K A;  1UFF A;  4XTW A;  2L2P A;  5LJ3 h;  3JCM P;  3I55 A;  3OYG A;  1B7T A;  1HXD A;  4C8Q B;  4A54 A;  1Z9Z A;  2R57 A;  3MKD A;  2FPD A;  4KBM B;  5GAN h;  1M2O A;  1Q82 U;  1MMG A;  4RKU E;  5KYY A;  4M75 F;  2LJ3 A;  5GAO m;  2EQJ A;  1WLP B;  3LW5 E;  5DLQ E;  1QP2 A;  3RR6 A;  2LNV A;  3NPF A;  4M7A C;  3JCM f;  5CKB A;  2BZY A;  1IHW A;  2EBP A;  3JB9 D;  1XQH A;  3CCE Q;  1LCK A;  4MDW A;  2C0T A;  1P92 A;  4D8D A;  2XDP A;  2GBQ A;  4C8Q C;  3QUI A;  2OTJ A;  3H0I A;  1YI2 A;  1K9M R;  1G3W A;  1NEB A;  1XJW B;  2LZ6 B;  2DVE A;  3M53 A;  3PFS A;  5EC7 A;  2O31 A;  2RJD A;  4F04 B;  2K7A A;  4KRT A;  2BE7 D;  4DEY A;  2DER A;  3CBP A;  2GF7 A;  1QCF A;  5IHK A;  1PSE A;  2XK0 A;  3TRE A;  5KYY B;  2CH4 A;  1X6O A;  1E7O A;  2XKO C;  4QW2 A;  2LX9 A;  4HCZ A;  4JJC A;  5GMK l;  2DXC A;  2DL5 A;  4FCY A;  5GJV B;  2P0Q A;  2XI9 A;  1VQ5 Q;  4C92 G;  2DIQ A;  2RJF A;  2HEQ A;  1IGQ A;  3BW1 A;  4OGE A;  5KYU A;  1WGS A;  2ABL A;  3E2U A;  1VOM A;  1VQN A;  1NBE B;  2RK1 A;  2LJ0 A;  2LQW A;  5CKF A;  2LVM A;  1Q95 G;  1UHF A;  1E6H A;  4OB3 B;  2RPN A;  1XNI A;  3H9N A;  3CCL T;  1GBR A;  2BE9 B;  2K2M A;  2V1Q A;  2X4J A;  3SDZ A;  1X75 C;  4OMN A;  2GTO A;  1JRI A;  4BI3 A;  3SFM A;  5CK9 A;  2XD0 A;  3JCM Q;  2KRS A;  2K4Y A;  1RL2 A;  2K2V A;  4D6W A;  3EFS A;  2A37 A;  1R77 A;  2JM8 A;  4JZ3 A;  3I9Q A;  2AIR B;  1YIJ A;  2P4R A;  4L59 A;  2MYS A;  1WQW A;  1K9M C;  5CO7 A;  5KYU B;  4JRP A;  1ZQ1 A;  3FIF A;  3MJX A;  1SEM A;  8AT1 B;  1D3B A;  4HXJ A;  4PL6 A;  2I2L A;  4M7D E;  2DET A;  3ZBD A;  3JB9 I;  1KQ1 A;  1OYX A;  3G7Z A;  4PFP A;  3OBY A;  1R0C B;  4MZP A;  5GAN 4;  3CCQ T;  1PKT A;  5GMK j;  2K3B A;  3A98 A;  2RQR A;  4J9B A;  3V8L A;  2DZC A;  2NWM A;  2RH2 A;  1QVF A;  2QQB A;  2KYM A;  4BUG A;  4ZGE B;  1LOJ A;  1FMW A;  1UGR B;  3FJP A;  4QQ6 A;  1O9S A;  5HK3 A;  3H8Z A;  2RA2 A;  2FG0 A;  1YIT Q;  5I22 A;  4XTV A;  4C92 E;  1VQO T;  2X4X A;  4RTZ A;  2C06 A;  2KQW A;  2IG0 A;  2KMT A;  1D3B B;  2X9H A;  2J6O A;  1NM7 A;  1M4Z A;  2EWN A;  4M75 G;  1GFC A;  1TWB A;  2VKN A;  2M0Y A;  3JCM g;  2Y4X A;  2D9T A;  1BIA A;  4ZNX A;  3ZFJ A;  1VIF A;  3CCJ T;  2MAM A;  2DZ9 A;  1TG0 A;  1PG5 B;  4IUQ A;  2G6F X;  3NGP A;  1VQP A;  1VQM Q;  3NFC A;  4JLG A;  4D8K A;  3M0T A;  1CSK A;  2AT1 B;  2EW3 A;  2OAU A;  4J9H A;  3HP9 A;  2DD4 A;  3EGD A;  3E9F A;  3VS1 A;  4XAX B;  2A36 A;  3V7R A;  4PJM A;  3CC4 T;  1JEG A;  1WHM A;  2BUD A;  1W2B S;  2QA4 Q;  2RJC A;  4KUD K;  2OTL T;  2DXU A;  1FX7 A;  2LQK A;  3EHQ A;  1N8R R;  3SD4 A;  2CZ7 B;  2YDL A;  4ATO A;  4LDU A;  1VQL T;  3DLL A;  4IUR A;  3CCM T;  1WFW A;  3UAT A;  2COW A;  7AT1 B;  3QYG B;  4HCC A;  4FSX A;  2GQV A;  3JV3 A;  1YHQ T;  1I07 A;  3LGL A;  3BDL A;  3MET A;  1OPK A;  1ZUY A;  3VS2 A;  1Q82 R;  3QKJ A;  3EGD B;  3BE3 A;  4BI4 A;  4BE2 A;  2X4W A;  2KGT A;  2QAS A;  1RLP C;  1WHJ A;  2RQT A;  1M3C A;  2EQM A;  1PD1 A;  4A53 A;  1SF9 A;  5I21 A;  3QSU A;  1UB4 A;  1BCO A;  2X51 A;  3QJ6 A;  4JJB A;  4DBQ A;  1W6X A;  3FRN A;  1RAG B;  3MEU A;  4DOW A;  2XU8 A;  2V26 A;  4M75 E;  2YUN A;  4FYV B;  3JCM b;  2E65 A;  2WSC E;  2DTO A;  2FVU A;  4EDU A;  3M4Y A;  5KCO A;  4R56 A;  4BE1 A;  4M78 D;  3AT1 B;  2BIV A;  1OX9 A;  3AHU A;  1TH7 A;  4AG1 C;  5GAM j;  3A8M B;  1UJ0 A;  1M2V A;  5LJ5 h;  2RJE A;  1GCP A;  4J6W A;  4DEX A;  2OJ2 A;  3CCR T;  2JN0 A;  5LJ3 j;  1N8R C;  4A4G A;  4A4E A;  3X26 B;  2QEX T;  2CP6 A;  3LLR A;  1VQ5 A;  4N4H A;  1AWW A;  2O9S A;  3EFO A;  3SHW A;  3A1P A;  1K4U S;  3ME9 A;  5GAN j;  5FWB A;  5GAO q;  2CUD A;  3VV0 A;  4C0D B;  3N5B B;  5LJ5 d;  4B9X A;  5L23 A;  2HBW A;  4FT2 A;  1JXO A;  3OW2 A;  2M9U A;  2CDT A;  2ATC B;  4M77 A;  4PKC C;  4C5I A;  2HL5 C;  4AT1 B;  2JOY A;  4M78 F;  1Q82 C;  4KT0 E;  3I5R A;  4XK8 E;  1G8X A;  2X35 A;  3QZ9 B;  1ABO A;  2CT4 A;  1QVF P;  2L3S A;  4LXC A;  1TS9 A;  4XU2 A;  3OYI A;  1WJR A;  3LYI A;  3I5S A;  2I0N A;  1M2V B;  2A08 A;  2RHI A;  1IRE B;  1T3L A;  1G83 A;  1HK9 A;  2L89 A;  3ZEH A;  5CIU A;  4QVC A;  4Y91 A;  2ZPF B;  1NJI R;  2NYS A;  1VQ4 T;  4C0D C;  4EPC A;  2KEA A;  1UUE A;  1QP3 A;  3I55 T;  3HFO A;  4XU0 A;  1BIB A;  3BFM A;  3R6O A;  2ZPG B;  2IIM A;  3CMA T;  2M02 A;  5A0G A;  1Q86 U;  1RI0 A;  3G6E Q;  1VYV A;  1I4K 1;  4M77 B;  1GBQ A;  3V7C A;  3UPU A;  4Q5W A;  3QDF A;  2P4T A;  4DBH A;  2XHC A;  5D7U A;  3OMG A;  3VRZ A;  2DL7 A;  4C0F A;  1TUC A;  2CP7 A;  3GOX A;  2JNG A;  2CT3 A;  1HJD A;  2EJ9 A;  1S72 T;  2FO0 A;  4IKF A;  2EQU A;  2HKN A;  1QLY A;  1RAD B;  4JRI A;  2OTJ T;  1YI2 T;  1YIT A;  3VU3 C;  1UGQ B;  3HL8 A;  1SRL A;  5IH2 A;  3M9Q A;  3CC7 Q;  1HYO A;  4E6R A;  1G3S A;  2JTF A;  1QVG S;  2QGG A;  4XTU A;  2LJ1 A;  1M90 R;  4PJO F;  3Q1J A;  2CP0 A;  3HFN A;  4PNO A;  5ECA A;  3CD6 T;  1WNL A;  1IRX A;  5GMK e;  1VQM A;  4EMK A;  3MP6 A;  1KHI A;  1YN8 A;  3NTK A;  2HDA A;  3MO8 A;  3M58 A;  1VQ6 A;  4J9I A;  1VQN T;  2WSF E;  1LPL A;  5IAY A;  2RNA A;  2CKK A;  2P0P A;  1NPR A;  2FZK B;  1OUL A;  3QWX X;  4OMP A;  1OPL A;  2WAC A;  3RUX A;  4CC7 A;  4HVV A;  3E19 A;  2FPE A;  1BBZ A;  2YT6 A;  3GLX A;  3G4S T;  2QA4 A;  4RTV A;  3X24 B;  1MUZ A;  2K3Y A;  4Y92 A;  3JCM h;  1M8M A;  2K5L A;  2RI3 A;  2D8J A;  4MZT A;  4BY6 B;  1BK2 A;  1R8O B;  3FDR A;  1V1C A;  3M55 A;  2QTV A;  4J9E A;  4R55 A;  3C4S A;  1YIJ T;  1IXD A;  4FIB A;  3EGX A;  3WVE B;  4FYX B;  3M54 A;  4C5G A;  4EMK B;  3H41 A;  2RHZ A;  4OP0 A;  2DIG A;  2RQU A;  1XOV A;  5KCH A;  2DTH A;  4AFU C;  3OYE A;  2D1X A;  2DFU A;  2X3X D;  3CQT A;  2OAW A;  4M75 D;  2L3Q A;  3D7S B;  2F69 A;  4J9C A;  1M90 C;  2MWO A;  4IUT A;  1I0C A;  4BY6 C;  1GCQ A;  3REA B;  5J39 A;  3MCA B;  2IPO B;  2EYQ A;  4IUV A;  1HD3 A;  2KRO A;  3CCU Q;  3QHS A;  4OMO A;  2EGE A;  1T0J A;  3OW2 P;  2LQN A;  3VS7 A;  2DX1 A;  3TCJ A;  4XU1 A;  4C8Q G;  4EMK C;  1R0B G;  1TUD A;  1YJW T;  2LTO A;  3CME T;  1UE9 A;  3EGX B;  4BB7 A;  1WYX A;  3H6Z A;  1MV0 B;  1UJY A;  3CC2 T;  5IN1 A;  5GAN 8;  1WA7 A;  2EJF A;  3M0Q A;  3V7S A;  2SEM A;  3OSV A;  4JPB W;  2AK5 A;  2DTI A;  2JW4 A;  3CCV T;  2DEQ A;  1NG2 A;  2RM4 A;  1OOT A;  2LT4 A;  8ATC B;  1HSQ A;  1AWJ A;  1YCY A;  3M0U A;  1YJN A;  2E64 A;  5LJ5 g;  2YRD A;  2D0Q B;  4M7D A;  1W70 A;  4C0Z A;  4E47 A;  2CS7 A;  3A8L B;  4ZN3 A;  3VRY A;  1BCM A;  1SRM A;  4FM4 B;  1VQP T;  2FZG B;  5GJW B;  3RDV A;  2K79 A;  3X28 B;  4J6X A;  3I56 Q;  1BI1 A;  3OS5 A;  5D6W A;  2F2W A;  4P5N A;  3PMI A;  2KVQ G;  3G71 T;  3ER0 A;  1RLQ C;  1GCQ C;  3VJP A;  4C92 A;  5A2Q E;  1O75 A;  1QCO A;  3CCS A;  2E1H A;  2EQI A;  2GFU A;  4PJO G;  4M78 E;  3CPW S;  1WQ7 A;  4HT9 A;  1ZHI A;  4M7D B;  4J7I A;  4JJN K;  3M59 A;  2CYZ B;  1G3Y A;  4RTY A;  5LJ5 j;  4BDZ A;  2HCK A;  2L5Q A;  3OYN A;  3REB B;  2XIC A;  2DLP A;  4TVR A;  3G6E A;  5GAN e;  1C0M A;  1UGS B;  5AYF A;  1C6V X;  1Q86 R;  1YJ9 A;  4O6J A;  2FYK A;  3C0C A;  4FYY B;  4CC2 A;  4E7K A;  1ZSG A;  2DXT A;  2JM9 A;  3JRZ A;  2DJZ A;  1WX6 A;  3WXM B;  3CCE T;  3QPH A;  3JCM W;  5FRN A;  2X3W D;  2FEI A;  1DJ7 B;  4M7D C;  3VYH B;  4C92 B;  2V1R A;  1W2B A;  2CUB A;  2JMC A;  1NJI U;  1IGU A;  3L2R A;  2DXB A;  2NUP A;  3H0F A;  2JVV A;  2L3P A;  2E12 A;  3CXC S;  1QWE A;  2CSI A;  2EYX A;  1AWO A;  2QG9 B;  4RTU A;  3CC7 A;  3OYY A;  1VQ8 A;  4J9F A;  1OU9 A;  4WF2 A;  2YRV A;  2DBK A;  4MMK A;  3MPU B;  1MV3 A;  1KFZ A;  3L2U A;  4C92 C;  1VQ5 T;  1Y0M A;  1M5Q 1;  4GLM A;  1J3T A;  3LH5 A;  4CI0 C;  2CZ6 B;  4IUU A;  2OX7 A;  2WSE E;  5KYX A;  2JXB A;  2CP5 A;  1TOV A;  1ZSZ A;  1WHK A;  5GAO r;  1MHN A;  2VUB A;  1JO8 A;  1WI7 A;  1PD0 A;  4PJO E;  1Q86 C;  4E7I A;  2NUP B;  4LD9 K;  1VQ7 Q;  4ANJ A;  4N4G A;  3CC4 Q;  2QK0 A;  4M75 A;  2HQE A;  3L2Z A;  4M4Z A;  2RD1 A;  2J6F A;  2KI7 A;  3HSB A;  1BYM A;  2MI6 A;  3WVD B;  2MWP A;  3GIB A;  3OB9 A;  1Y07 A;  1VQL Q;  1M90 U;  2QDY B;  1KJW A;  2VYT A;  4KGV B;  1AT1 B;  3TU4 K;  5IXF A;  1MMD A;  1V76 A;  3RNJ A;  3RKW A;  4IUP A;  2HKQ B;  3PIO A;  3MEW A;  4M77 F;  3CXC P;  3EFR A;  1XTD A;  1K0S A;  1JU5 C;  3OY9 A;  2RHY A;  5KYX B;  2H3J A;  3GNG A;  1AZE A;  1VQ6 Q;  2HMA A;  1ZSZ B;  5CAI A;  2KXC A;  4FL6 A;  3VS4 A;  2B86 A;  5HY6 A;  5CKD A;  1ARK A;  3RES A;  2HL3 A;  3VYG A;  4M75 B;  1OU8 A;  1U1T A;  4XQ3 A;  4ESR A;  3EG9 A;  2RHX A;  3CCU A;  4K11 A;  3TQ7 P;  1H3H A;  5IHI A;  2P84 A;  3HKS A;  2DL8 A;  2EGA A;  5FRM A;  1OZ2 A; 
#chains in the Genus database with same CATH homology
 3U23 A;  2KEA A;  2RF0 A;  1UUE A;  4F17 A;  3M0S A;  2LP5 A;  1NLP C;  2PTK A;  2JT4 A;  2RQW A;  1S1N A;  4CC3 A;  2EVR A;  2IIM A;  1M3B A;  1UHC A;  1ABQ A;  4ORZ A;  1GRI A;  1X69 A;  1VYV A;  2EKH A;  1G2B A;  1GBQ A;  2HSP A;  2MCN A;  2KNB B;  3UF4 A;  4GBQ A;  2EGC A;  3TSW A;  4IIM A;  2AZV A;  3VRZ A;  2DL7 A;  2EYW A;  5IXB A;  2KRN A;  1X6G A;  1TUC A;  4CC4 B;  2LMJ A;  1VYT A;  2F2X A;  3GBQ A;  4LNP A;  2C0I A;  2CT3 A;  1HJD A;  3EHR A;  5I11 A;  5HCK A;  4AFS C;  1AWX A;  1QWF A;  2J7I A;  2FO0 A;  1UFF A;  2L2P A;  1QLY A;  1PRM C;  1CKA A;  2O9V A;  2ESW A;  4F16 A;  2EYZ A;  1CKB A;  2XMF A;  3TSZ A;  1YWO A;  1YP5 A;  2RMO A;  1Z9Z A;  1SRL A;  2FPD A;  3PVQ A;  4RTX A;  5IH2 A;  2AKL A;  1AOJ A;  2M51 A;  3VS5 A;  2O2O A;  2LJ3 A;  4X1V A;  2ENM A;  1WLP B;  4E6R A;  2J6K A;  3NPF A;  2E5K A;  1ZBJ A;  2LJ1 A;  1AVZ C;  2BZY A;  1UTI A;  2GGR A;  2YUQ A;  4OML A;  1FMK A;  1VA7 A;  2EBP A;  1LCK A;  1Z9Q A;  1JQQ A;  2C0T A;  2PZ1 A;  5ECA A;  1B07 A;  4Z89 A;  2H8H A;  4D8D A;  2YSQ A;  3VS6 A;  1WIE A;  3SEM A;  1YN8 A;  2GBQ A;  2HDA A;  1UG1 A;  2RN8 A;  3IQL A;  2PNI A;  4J9I A;  1UEC A;  1KIK A;  2RNA A;  3H0I A;  1NEB A;  2LZ6 B;  3QWX X;  4OMP A;  1OPL A;  5EC7 A;  3O5Z A;  4CC7 A;  2O31 A;  4HVV A;  2FPE A;  2JTE A;  2K7A A;  4KRT A;  1BBZ A;  2YT6 A;  1WXT A;  4LE9 A;  4DEY A;  1QCF A;  5IHK A;  4RTV A;  1MUZ A;  4J9D A;  4Y92 A;  1SSH A;  4JJD A;  3PE0 A;  1M8M A;  2CH4 A;  3R6N A;  3EG2 A;  1E7O A;  1WDX A;  2D8J A;  2DBM A;  4JJC A;  2L0A A;  1BK2 A;  2D8H A;  2DL5 A;  1V1C A;  5GJV B;  4Z88 A;  4RTW A;  4Z8A A;  2K6D A;  4J9E A;  2HEQ A;  4J9G A;  1SHF A;  1Y57 A;  2VWF A;  2ABL A;  1YCS B;  1SHG A;  2LJ0 A;  1IO6 A;  2LQW A;  4OMM A;  1M27 C;  3H41 A;  1M30 A;  1PHT A;  2RQU A;  1UHF A;  1XOV A;  1E6H A;  2RQV A;  1NYF A;  3NHN A;  2ED0 A;  2DNU A;  2RPN A;  3EG0 A;  4AFU C;  2D1X A;  2DRM A;  1YWP A;  2X3X D;  1X27 A;  3CQT A;  1GBR A;  1U5S A;  2OAW A;  3UA7 A;  2K2M A;  2L3Q A;  2V1Q A;  1NYG A;  4OMN A;  1YNZ A;  1B3Q A;  2LX7 A;  2GTO A;  4J9C A;  4LUE A;  2BZ8 A;  1I0C A;  5IHN A;  1GCQ A;  2KRS A;  1QKX A;  3REA B;  1NEG A;  3M0R A;  1PWT A;  4RUG A;  4LN2 A;  1HD3 A;  1X2K A;  2KRO A;  2A37 A;  2JM8 A;  4OMO A;  2EGE A;  1T0J A;  2LQN A;  3VS7 A;  2DX1 A;  2QDL A;  4JZ4 A;  4JZ3 A;  3I9Q A;  2P4R A;  3VS0 A;  4A63 B;  1UGV A;  1TUD A;  2KT1 A;  1UE9 A;  2ROT A;  2K9G A;  2A28 A;  1WYX A;  1PKS A;  1MV0 B;  1UJY A;  3I35 A;  1SEM A;  2J05 A;  1WA7 A;  4HXJ A;  2KYB A;  3PVL A;  1RI9 A;  3M0Q A;  1NLO C;  2SEM A;  4JPB W;  2AK5 A;  2JW4 A;  1PKT A;  2D0N A;  1NG2 A;  1OOT A;  2ECZ A;  2K3B A;  1HSQ A;  1W1F A;  3A98 A;  2RQR A;  4R0K A;  1AWJ A;  2JS2 A;  4EIK A;  1ZX6 A;  3M0U A;  4J9B A;  2F2V A;  1KSW A;  2NWM A;  2MOX A;  1W70 A;  2DRK A;  2KYM A;  2YUP A;  3VRY A;  1SRM A;  5GJW B;  2K79 A;  1ZUU A;  2KE9 A;  1K1Z A;  2FG0 A;  5I22 A;  1AD5 A;  1ZLM A;  4RTZ A;  1PNJ A;  4IIO A;  1ZUK A;  2JMA A;  2NUZ A;  4OMQ A;  4QT7 A;  4F14 A;  1BB9 A;  2J6O A;  1NM7 A;  2F2W A;  3THK A;  1PRL C;  1RUW A;  1GFC A;  2DJQ A;  2VKN A;  1RLQ C;  1GCQ C;  2M0Y A;  2DMO A;  1K0X A;  1U06 A;  4ZNX A;  2FRY A;  2O88 A;  1A0N B;  2EQI A;  4HCK A;  1GFD A;  4FSS A;  1TG0 A;  5FW9 A;  2G6F X;  3NGP A;  4LUD A;  4D8K A;  3M0T A;  4RTY A;  1T3S A;  1K76 A;  2DM1 A;  1CSK A;  2HCK A;  2EW3 A;  3REB B;  1OEB A;  4J9H A;  2DLP A;  2ED1 A;  2LCS A;  2W10 A;  1T0H A;  1UDL A;  2GNC A;  3VS1 A;  2KT8 A;  2A36 A;  2LNH B;  1JEG A;  1EFN A;  3C0C A;  4CC2 A;  1ZSG A;  4HVU A;  3UA6 A;  2DF6 A;  2JM9 A;  3VS3 A;  2CH4 W;  2W0Z A;  1WX6 A;  1H92 A;  2VVK A;  4AFQ C;  1AZG B;  3EHQ A;  2X3W D;  2YDL A;  2FEI A;  2OI3 A;  4RTT A;  3EGU A;  3QWY A;  5FWC A;  2V1R A;  1WFW A;  2CUB A;  2JMC A;  3UAT A;  2ROL A;  2EPD A;  2DVJ A;  3H0F A;  1FYN A;  2L3P A;  2DL4 A;  3NMZ C;  4AG2 C;  1QWE A;  3JV3 A;  2DL3 A;  2GTJ A;  1I07 A;  2CSI A;  2EYX A;  1OPK A;  1AWO A;  1ZUY A;  4RTU A;  3VS2 A;  1M3A A;  4J9F A;  2DBK A;  2KGT A;  2KXD A;  1MV3 A;  1RLP C;  1KFZ A;  2RQT A;  1M3C A;  2CRE A;  1N5Z A;  2KR3 A;  1Y0M A;  4GLM A;  1J3T A;  4WCI A;  3EG1 A;  4JJB A;  2DA9 A;  2KRM A;  1X2Q A;  1X43 A;  3LH5 A;  3ZL7 C;  1W6X A;  3TVT A;  3FJ5 A;  2YUN A;  2J06 A;  2JXB A;  1SPK A;  1JO8 A;  1WI7 A;  1WXU A;  2MIO A;  3M0P A;  2DYB A;  1X6B A;  1H8K A;  4AG1 C;  3ULR B;  4M4Z A;  1UJ0 A;  1OV3 A;  2J6F A;  2YUO A;  1GCP A;  2CSQ A;  4DEX A;  2OJ2 A;  3RBB B;  2BZX A;  4HVW A;  2AZS A;  1GL5 A;  1KJW A;  1AWW A;  2O9S A;  3SHW A;  5IXF A;  1K4U S;  5FWB A;  3RNJ A;  2DE0 X;  2CUD A;  1VYU A;  1K9A A;  5L23 A;  2HBW A;  1K0S A;  1JXO A;  2EYY A;  1JU5 C;  2CDT A;  1E6G A;  1WXB A;  1AZE A;  2AKK A;  2KXC A;  4AFZ C;  3I5R A;  3VS4 A;  2B86 A;  1ABO A;  2CT4 A;  2GQI A;  2FPF A;  2L3S A;  1U3O A;  1ARK A;  2C0O A;  3EG3 A;  1JXM A;  2DIL A;  2BTT A;  2I0N A;  3I5S A;  2KBT A;  1I1J A;  2A08 A;  2JS0 A;  2SRC A;  1QKW A;  4ESR A;  2FRW A;  1T3L A;  1G83 A;  4K11 A;  1H3H A;  1AEY A;  5IHI A;  1BU1 A;  3KFV A;  2DL8 A;  2EGA A;  3H0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...