1TUDA

Alpha-spectrin src homology 3 domain, circular permutant, cut at n47-d48
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
RQGFVPAAYVKKLDSGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The order of secondary structure elements does not determine the structure of a protein but does affect its folding kinetics.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
molecule keywords ALPHA-SPECTRIN
total genus 11
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-02-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1tudA00
4Z8AA 2DM1A 2RQWA 2YSQA 4LNPA 3R6NA 2RQVA 5FWBA 2L3QA 3JV3A 2GTJA 4AG2C 1M3BA 4Y92A 5FW9A 3EG3A 2LJ3A 2W0ZA 1NEBA 1X43A 3I5RA 2ESWA 5IXBA 2EYXA 4LN2A 2DRMA 2YUOA 3NGPA 2AKLA 4IIOA 3I35A 1X2QA 3EG2A 1AZGB 3H0HA 2DYBA 4JJBA 1T3SA 2C0TA 3H0IA 3IQLA 1YP5A 1LCKA 2K6DA 3VS7A 2RQUA 1KFZA 1ARKA 2EVRA 2EYZA 1UHFA 1T3LA 3H0FA 3M0PA 1W70A 4J9DA 2KGTA 4D8DA 1QWFA 3NPFA 4LUEA 2LCSA 1NYFA 5FWCA 2KNBB 2NWMA 2YT6A 1CKAA 2YDLA 1X2KA 3RNJA 2MIOA 2AZSA 2YUNA 1QKWA 3EHRA 1K0SA 2DA9A 1GCQA 1M3AA 2BZYA 2KT8A 2JMAA 2OAWA 2O9VA 4X1VA 1PKTA 4CC4B 2KYMA 2XMFA 2KEAA 4AFQC 3TSWA 1KIKA 1ABQA 2CSIA 3SEMA 1ZUYA 1UFFA 1QCFA 3M0QA 1PRMC 2OI3A 3CQTA 1VYUA 1B07A 2CUDA 2O31A 1ZX6A 4Z89A 2JW4A 4D8KA 2FPEA 1EFNA 4OMPA 4QT7A 4JJDA 1GRIA 4AFZC 3U23A 2ROTA 2SEMA 4J9CA 3VS6A 3EGUA 3ZL7C 2A37A 2L3PA 1OOTA 2DBMA 3VRYA 3QWXX 2D8JA 1UJYA 2LP5A 2RPNA 2O2OA 3FJ5A 2RMOA 5I22A 2KROA 1WLPB 4EIKA 4Z88A 2ROLA 4JZ3A 4RTWA 2L0AA 5IHNA 1BBZA 1K4US 4JPBW 4CC7A 5GJVB 1X6BA 1YNZA 2JTEA 2K79A 4GLMA 1WX6A 2LQNA 1GL5A 4RTUA 2ECZA 1ZSGA 1YN8A 3REAB 1PHTA 1QKXA 1MV0B 1QWEA 1TG0A 1WXUA 1YCSB 2ABLA 3TVTA 2LJ0A 2RNAA 2YUPA 1JXOA 1M30A 1AD5A 4DEXA 2B86A 3KFVA 3UATA 2KXDA 2J05A 4OMMA 2VKNA 3EG1A 3QWYA 3THKA 2GGRA 2M51A 1CSKA 2BZ8A 3C0CA 3GBQA 1SEMA 2LJ1A 2EW3A 3EG0A 4K11A 1H3HA 2LMJA 5GJWB 2AKKA 2A28A 1UGVA 1I0CA 2GBQA 2HCKA 2V1RA 4GBQA 5I11A 5L23A 3REBB 1SHFA 2EGCA 1VYVA 2RQRA 1X69A 1BK2A 2EGEA 2DRKA 5EC7A 4F17A 3M0UA 1Y57A 2M0YA 1PNJA 1SPKA 2KRNA 2P4RA 4AFUC 2A08A 1NLOC 1WXTA 2VWFA 2KXCA 2EQIA 2HSPA 4HVVA 5ECAA 1AWJA 1E7OA 1FMKA 1UDLA 2X3WD 2O88A 3NMZC 1SRLA 1UJ0A 2NUZA 2DILA 4KRTA 3VS5A 2KRSA 2D1XA 1NEGA 3VS2A 3H41A 2EGAA 1E6HA 1I1JA 2F2WA 1PKSA 1V1CA 2EKHA 1YWPA 2DL5A 1M3CA 3EHQA 1GBQA 2CT3A 2KT1A 2KR3A 3PVLA 2KBTA 2EYYA 4J9BA 4CC2A 2SRCA 1W1FA 2FRYA 1Z9ZA 2CSQA 1T0HA 2MCNA 2FG0A 3VRZA 1N5ZA 1AZEA 4J9GA 4ZNXA 2DL4A 2F2XA 4LE9A 2H8HA 3I5SA 1AWXA 2ED1A 2CH4W 2J6KA 2OJ2A 2HEQA 1B3QA 4E6RA 2EBPA 2C0IA 2CREA 5HCKA 2A36A 2L3SA 3SHWA 2C0OA 2BTTA 3M0SA 1NYGA 4JJCA 1YWOA 2DL7A 2GQIA 4RTXA 4HVWA 4OMOA 2QDLA 1W6XA 2PNIA 2L2PA 1GCPA 2J7IA 2J6OA 2JM9A 2VVKA 3I9QA 1NLPC 4J9IA 2GNCA 1HD3A 1IO6A 1U06A 1GCQC 2EYWA 2RQTA 3PE0A 2K7AA 2LX7A 1I07A 2I0NA 1H8KA 4J9FA 1E6GA 3TSZA 4LUDA 3UA7A 1SRMA 2PZ1A 1TUCA 2LNHB 4OMLA 1JEGA 1UUEA 4HVUA 2JM8A 1TUDA 1AWOA 4HXJA 2YUQA 1RLPC 1WXBA 4F16A 1MV3A 2G6FX 2CDTA 2V1QA 1NG2A 1WDXA 1JU5C 1JXMA 3O5ZA 4CC3A 2D0NA 2DF6A 4A63B 4WCIA 2CUBA 2HDAA 1BB9A 5IHKA 2KYBA 1K76A 1G83A 1OPLA 2DNUA 4M4ZA 2HBWA 2LQWA 1K9AA 2BZXA 1WIEA 2RF0A 1PRLC 1M8MA 3M0RA 1OV3A 1CKBA 2JS0A 4JZ4A 1JQQA 1WA7A 2J6FA 3VS0A 2DX1A 1AEYA 2RN8A 1T0JA 2FRWA 1SSHA 2DL3A 2GTOA 2AZVA 1RI9A 1S1NA 2AK5A 2D8HA 4OMNA 2W10A 3PVQA 1U5SA 1BU1A 2F2VA 3VS1A 1K1ZA 1UG1A 1WFWA 4RUGA 2DMOA 4FSSA 2KE9A 4HCKA 1AWWA 2DL8A 2JMCA 3RBBB 1UE9A 1ZUUA 4RTTA 2O9SA 1RUWA 2MOXA 1KJWA 1GFCA 1A0NB 1WI7A 2JT4A 1PWTA 2CT4A 1X6GA 1ZLMA 4J9HA 3UF4A 1FYNA 1U3OA 2DVJA 2E5KA 1UHCA 2JS2A 2DBKA 4AFSC 3VS4A 2J06A 1XOVA 2FEIA 2LZ6B 1G2BA 3VS3A 4F14A 2K2MA 1UTIA 2DJQA 1VYTA 3LH5A 2K9GA 3M0TA 1HSQA 4RTVA 1WYXA 2JXBA 2CH4A 4AG1C 1ZBJA 4DEYA 3A98A 1ABOA 1M27C 2DE0X 4OMQA 1AOJA 1SHGA 2DLPA 2FPDA 2ENMA 1NM7A 3ULRB 1OEBA 4ORZA 1AVZC 5IXFA 1GFDA 2IIMA 4ESRA 1JO8A 1MUZA 2ED0A 1QLYA 2K3BA 1Z9QA 1ZUKA 1GBRA 1UECA 1KSWA 2X3XD 4IIMA 5IHIA 3UA6A 3NHNA 1H92A 1X27A 2EPDA 4RTYA 4RTZA 2FO0A 5IH2A 1OPKA 4J9EA 2PTKA 1Y0MA 1RLQC 2KRMA 1VA7A 2FPFA 1HJDA 1J3TA 1K0XA 4R0KA
chains in the Genus database with same CATH superfamily
3J80E 1WQ7A 4LNPA 3R6NA 1F1BB 3VYHB 2GTJA 4AG2C 3CCLT 1M3BA 1VQOA 1QMCA 2CP5A 3QJ6A 3EG3A 1VOMA 3HSBA 1Q81C 1YIJT 2DRMA 2HNIA 5FU7C 3CCQA 2VUBA 4IIOA 1PD1A 1AZGB 2RHUA 1AHJB 4OB1B 2P0KA 1YP5A 2MPXC 3L2VA 4MMLA 5LJ5h 3VS7A 2RQUA 2EYZA 1IXDA 1T3LA 3RKXA 3H0FA 4M7AD 4QQGA 3CMAQ 1BI0A 3CCRQ 1VQ4Q 1NYFA 5FWCA 4FW1A 4N4GA 2KNBB 2RA2A 4M7AB 1YITT 1Q7YU 2YT6A 3BE3A 3QO3A 4MZPA 3QSUA 4X9DA 3EFOB 2DTHA 3CCQT 5GMKj 1QKWA 3EHRA 4GLKA 1VQLQ 3SDZA 2YHTA 1RAHB 5CIUA 5I2SA 5FRMA 2JMAA 1H3ZA 2NLUA 1YITA 2O9VA 4CC4B 2YRCA 1RAGB 4M7DA 4UC4A 3VUZA 4CI0C 3TSWA 5GAMj 3CC4A 2A3LA 1ZUYA 1QCFA 1NJIR 2RJCA 2XG8D 2VV5A 4F7UF 4Z89A 2JW4A 1ZSZC 3MEUA 2FPEA 1EFNA 4OMPA 4QT7A 4JJDA 1GRIA 2CP7A 2JTMA 3VS6A 5GAMh 3FB9A 1OQKA 1LJOA 2XICA 3AT1B 3JSCA 1OOTA 1M4ZA 2D8JA 2PVOB 1UJYA 3CCQQ 1P92A 2QDYB 5GMKe 3M55A 2RMOA 1WLPB 3PIOA 1SKUB 4DOWA 4OGCA 3RERA 3MJXA 1M90U 4F7UG 2RH2A 2CGHA 2ECZA 1ZSGA 5GANj 3REAB 2H3EB 3BW1A 4RCCA 3QG1A 2D9TA 1WXUA 4CRIA 1WNLA 2RJEA 3UDCA 4C8QE 1M30A 1R77A 4J7IA 3UT1A 3UATA 3CMEA 1N27A 4OMMA 2VKNA 3QWYA 3PIPA 3H8ZA 2HSEB 2M51A 1CSKA 4C92B 2BZ8A 3CCUA 2OTJA 3GBQA 4FW2A 1SEMA 2LJ1A 5FU7B 4C92E 1UEBA 1UB4A 1UGVA 1K9MR 1I0CA 2V1RA 5I11A 1PC0A 3FJPA 3REBB 5HK3A 4RMOA 3CCET 4C8QB 3JCMQ 2DFUA 4C92G 1PNJA 1SPKA 2P4RA 2A08A 4MDWA 5KYXB 1Y96B 1RACB 2E12A 2DJZA 3OYGA 1R0CB 1FMKA 1UDLA 1OZ2A 3V7SA 4N4HA 5LJ5d 3CCVT 4PLIA 3VS5A 5GMKh 1NEGA 1YJ9A 3RIRA 3FLGA 1HYOA 1M3CA 4BI4A 1G3TA 4A4HA 2H3JA 4JDSA 1GBQA 2CT3A 2KT1A 5KYYB 2O4XB 2KR3A 4BI3A 3PVLA 1Q81U 2DIQA 2DXTA 2KBTA 3QXEB 4J9BA 1M1FA 2CP2A 2FRYA 1UGRB 2LDMA 2MCNA 5GAMf 2E3IA 1TUGB 2FYKA 4C0DC 1XJWB 4Y28E 4MDXA 3E1SA 3HFNA 4L5GA 2H8HA 1AWXA 2OJ2A 5GAN2 2HEQA 2MYSA 4E6RA 4M78B 2FZGB 3BDLA 5HCKA 4JLIA 2VASA 3OSVA 1PCXA 2R5AA 2VXFA 1BI3A 2GQIA 3S3MA 3CCJT 1VQOQ 3G1JA 2L2PA 1GCPA 1WJRA 1VQKQ 1LNXA 1S72T 1U06A 3LW5E 5GANh 1KQSP 3MEWA 2RHIA 3BFMA 5KYNA 2DIGA 4M7DB 3KUFA 1I07A 4EDUA 2K3YA 2I0NA 3ME9A 4PJOD 4J9FA 3TSZA 2DO3A 2WSEE 4M75E 5KYYA 3EH1A 2CZ1B 4J83A 4HXJA 2L5QA 4PJOF 3TEEA 2YUQA 1NJIU 4F16A 2BE7D 3CCEA 1VQ5Q 2E64A 2ZPFB 3SWNC 2EQJA 4D6WA 2HDAA 4E7LA 1OZ3A 3CCJQ 1U8RA 1G83A 3QDFA 4JUVA 3OYKA 2DNUA 1WHHA 2HBWA 3CCUQ 1QCNA 4RG2A 5C6SA 2OTJQ 1K9AA 1PRLC 4O5VA 3M0RA 2KSSA 2JUFA 2V26A 3EGXA 4NS5A 2RK1A 1PD0A 2DX1A 3FIFA 1AEYA 2RN8A 2V8JA 1T0JA 5CQYA 2LQKA 5LJ3f 5GAMe 2AZVA 2QI2A 1M90R 1S1NA 2COZA 2L8DA 2X51A 1ZQ1A 1U5SA 2F2VA 3FC3A 4M7DE 1AWWA 2JMCA 3L2UA 1VIFA 3HP9A 2O9SA 1RUWA 1JJ2A 2OTLT 1KJWA 3OYCA 2JT4A 1WPYA 1PWTA 5LJ5j 1K8AC 3P8BB 4PJOB 4XTVA 1ZLMA 1I5OB 2EQKA 3M5AA 4J9HA 3CCUT 1MMDA 1U3OA 4J7FA 2DVJA 1UHCA 2KY9A 1SSFA 1KC8C 2BUDA 3VS4A 4PNOA 3JB9H 4PFOA 1XOVA 4E7HA 3QPHA 1M1KU 4M7DF 2FEIA 5DLOA 1VQ6Q 1G2BA 2B8AA 3VS3A 3I55A 3BDUA 3OYLA 2K2MA 4FM4B 3NTHA 2DK3A 1VYTA 1QVGA 2K9GA 4HCZA 2PVGB 4ZGEB 4RTVA 2FVUA 1W2BA 1VQMQ 3LGFA 2MWPA 3PMIA 1PM3A 1QCOA 1MMAA 1TWBA 3OS0A 3JCMJ 1BI1A 3OYNA 3M56A 2QTVA 1YIJQ 4ORZA 3JB9G 2I2LA 4ESRA 2RB6A 2ED0A 5GMKm 2MMPA 2K3BA 2GFAA 4IIMA 2QG9B 2IVWA 5IHIA 5M9OA 2FZKB 2O4XA 4A4EA 2EPDA 4A53A 2LT1A 2FO0A 4PJOA 1OPKA 3RUXA 2PTKA 2F5TX 3G71T 1RLQC 3CC2T 3VJPA 4HT8A 2FPFA 2YXYA 1HJDA 3FDRA 4Z8AA 4A4KA 3I55T 3ZEHA 2HQEA 4ZN1A 4LDXA 3CD6A 2E6NA 3NTKA 4FCYA 1JB0E 1X43A 4BY6C 5A0LA 5D7UA 4C0FA 4HCCA 1O75A 1YIJA 1YJ9Q 2YUOA 4OVAA 3FEOA 2AKLA 2PVDB 3I35A 3OYAA 1X2QA 3EG2A 5CCAA 1LPLA 3H0HA 2DYBA 4KUIA 2C0TA 3CCMQ 2VXEA 4QVZA 1LCKA 3I56A 1EX4A 1FMWA 2PUKB 1KFZA 2EKOA 1UHFA 4XU3A 1W70A 5FLXE 4J9DA 3G6EQ 2KGTA 4D8DA 5LJ3j 4C92D 2LCSA 2KDSA 3O8VA 1BYMA 2YDLA 3I55Q 1NPPA 2MWOA 2YUNA 3X24B 2DXBA 1GCQA 3G4SA 1WHKA 3OS5A 2OAWA 3L42A 4X1VA 3JCMW 2KYMA 1Q82R 1TS9A 2XMFA 3E9FA 4AFQC 3MO8A 3QZ5B 4FT4A 2CSIA 1NE8A 3CCMT 3G6EA 1VYUA 2RO0A 1JBMA 1PSEA 2O31A 3QDRB 4D8KA 1KD1R 3M54A 4AFZC 3U23A 2HZYA 1MGQA 1YITQ 3ZL7C 2OX7A 2WACA 4Y91A 3CC7Q 3JCMg 3LGLA 4QW2A 5GAMg 2VYTA 3FJ5A 1VQLT 3M4GA 2KROA 3MP1A 1RABB 2E10A 3TCJA 1MMNA 4Z88A 1KQSA 1QVFP 2NUTA 3CEYA 2E41A 4JPBW 1XNIA 5FRNA 1X6BA 1YNZA 4GLMA 1UGPB 2QA4A 2DEUA 3CPWS 1KQ1A 5GANd 1IRXA 4XU0A 4OB2B 1UGQB 4C8QF 2YUPA 2DD5A 3QIIA 2LT4A 4M78D 1D3BA 2B86A 4DBFA 2KXDA 3G4ST 5CKBA 2F1LA 2QK0A 3DLMA 1G3SA 3CCVQ 3VU3C 4A54A 3C0CA 3OYIA 3JCMX 2M16A 4DQ2A 2K57A 4PL6A 5GAOl 1M2VB 2EW3A 4P5NA 2G3RA 5GJWB 2A28A 2QXFA 2RHZA 3OYJA 1R8OB 3G7ZA 3MP6A 1M9SA 5DM7R 2MAMA 1VYVA 5KE2A 3CPWP 5KYWB 2EGEA 4F17A 3OMCA 4DBRA 1QP3A 2EWNA 2LC4A 3LX7A 3CBOA 2QEXQ 4AFUC 2VWFA 1BI2A 3X20B 4IUPA 5ECAA 3DB4A 3PT9A 2MK5A 4N0AC 1B34A 1TSFA 1PSFA 2AT1B 4KRTA 2D1XA 3VS2A 3VUBA 2EGAA 5GAN3 1I1JA 2F2WA 4M77B 1V1CA 1QP2A 4C8QC 1YWPA 3MEVA 4OGEA 2NUPA 4N4IA 1I8FA 4HA8A 2PU9B 2M0OA 1WGSA 1RAFB 4FIBA 4F7UE 3LWHA 2XKOC 1G3WA 2E3HA 1Y96A 3N5BB 4CC2A 1OX9A 1G8XA 2SRCA 1Z9ZA 2V8KA 2ZPHB 5CK9A 4ANJA 3F70A 1G3YA 1AZEA 1QVPA 2DL4A 2O01E 3EG9A 5D6YA 1BCOA 3QYHB 1B3QA 2CREA 5KYUB 1YJNQ 3WVEB 2K4YA 1O9SA 3SHWA 2C0OA 1OX8A 1NYGA 2KQWA 1YWOA 2DL7A 2E4HA 4OMOA 1I81A 4AMCA 4AT1B 2J7IA 2VVKA 2OTJT 4MMKA 1Q82C 2GNCA 1AT1B 1HD3A 1IO6A 2XI9A 4Z02A 5J3BA 4ZTFA 4FL6A 2EYWA 3GPLA 1R0BG 2EJ9A 3JAME 5GANe 5EG2A 2K7AA 3BY7A 3OQ5A 1VQ8A 4FYVB 1YCYA 4C8QA 1E6GA 4J6WA 3UA7A 1SRMA 4M78G 1TUCA 1JEGA 4HVUA 3EGXB 1TUDA 1Q86R 4KH0B 1NPRA 1MV3A 1WDXA 1BIBA 1JU5C 5DY9A 3M57A 4IKFA 3LH0A 5LJ3h 3TU4K 4KBMB 3R6OA 1YI2A 5IHKA 1K9MU 2R57A 1N9SA 1K76A 4M77E 4JRKA 1VQOT 3CCLA 2LQWA 2BZXA 3HRUA 3CCRA 1D0XA 1OV3A 1W4SA 1EZZB 1XQHA 4L59A 3OYFA 3G71A 1M8VA 2FRWA 3LWIA 1N8RU 1SSHA 2HMAA 3CCST 4IURA 1QQJA 3MKDA 1FXXA 1VQ5A 4M78E 3RR6A 5GAOq 3T9NA 1KQSS 1RI9A 2LNVA 2CS7A 4OMNA 4ZTJA 1VQMT 4OB0B 3PVQA 3RKYA 2QQSA 5AT1B 4RUGA 4E7KA 4Q5WA 1YJWT 1ZUUA 1YI2Q 3P8DA 1MMGA 1RADB 4QVDA 1VQ7A 3UF4A 1FYNA 2ATCB 2E5KA 1YJWA 4BE0A 1Y7XA 4AFSC 4R55A 2ZCFB 2J06A 1M2OA 1SF9A 1NBEB 3S3OA 4A4GA 4M77G 4LDUA 5KE3A 2LZ6B 1WHLA 3JB9J 5I21A 2DJQA 2F5KA 3CC2Q 3HKSA 2DZCA 4QQDA 3CCSA 2CH4A 4AG1C 2HL3A 3CXCS 2JNGA 5LJ3d 3A98A 2ZPGB 1ABOA 4NOYA 1ZSZB 1M27C 4O6JA 3HRSA 2OTLA 3ULRB 1OEBA 2AHJB 1AVZC 3EAEA 1G5VA 3OBYA 1GXIE 5GAOn 1MUZA 1KG1A 1D0ZA 1ZUKA 1GBRA 2RJFA 1UECA 1KSWA 2X3XD 1UGSB 4M7AG 2PQWA 4LD6A 1VQ6T 2DPPB 3CC7A 4JRQA 4J9EA 3A8MB 2E5QA 3OW2P 3PGGA 3CXCP 3DKMA 1VQKA 1K73C 1J3TA 2LQ8A 1K0XA 4R0KA 3C12A 2DM1A 2XDBA 1RAIB 3M53A 2RQVA 3SWNB 2L3QA 3KXTA 4BDYA 1ZBXA 5FW9A 2FL7A 4J8OA 1NEBA 4DBHA 3I5RA 4II1A 2EYXA 4QQ6A 1IREB 4M75G 1IHVA 4N0AA 4NL3A 1WQWA 3CD6Q 4M7DD 2HKNA 5GAOr 4JJBA 1KQ2A 1X75C 4V2SA 3M4YA 3A8HB 2YLCA 3OW2A 3SB2A 3OW2S 2EVRA 4EPCA 3EFSA 3OB9A 3G71Q 1NZ9A 1D3BB 1OU9A 1QWFA 2E6ZA 3NPFA 1C1AA 2DYIA 1IHWA 2EAYA 1RI0A 2NWMA 4C0GA 5IT9E 4PFZA 3RNJA 2MIOA 3HFOA 2AZSA 1RAAB 3CCLQ 3E2UA 5IAYA 1WZOA 1QVGS 3GIBA 4E2FB 4ZGDB 1YJ9T 4FSXA 2WSCE 1PKTA 1D1AA 2M02A 5DLQE 5KYWA 4X9CA 1KIKA 1ABQA 4VUBA 3SEMA 2YLBA 3M0QA 1PRMC 4OB3B 2Y4XA 3CQTA 1B07A 2CUDA 2P0PA 1ZX6A 2K3XA 2P0QA 4M7AF 1YHQA 1HK9A 2DTIA 1JJ2S 4PJOE 4XU1A 3CMAT 3EGDB 5LJ3e 2ROTA 4J9CA 4BE2A 3G4SQ 2JVVA 3EGUA 1RL2A 2L3PA 2DBMA 3QWXX 2X4JA 2O2OA 5I22A 4M78C 4EIKA 2F69A 4JZ3A 2L0AA 5IHNA 4OP0A 5CO7A 4M7AA 1K4US 4CC7A 5GJVB 2RI5A 5KYXA 4C8QD 1GL5A 4RTUA 5LJ3g 3CC2A 4KH1B 3UPUA 1YN8A 1PHTA 1MV0B 1QWEA 1TG0A 2VGNA 1WHGA 3TREA 2XK0A 3OA6A 5L8RE 1FWZA 2P84A 2RNAA 2HD0A 4KULA 1JXOA 1C6VX 4DEXA 3VYGA 2M1HA 4HKEA 3GLXA 2GGRA 2DVEA 1VQPA 1TXQA 4IUTA 1I4K1 2C06A 2QGGA 3M9QA 2X4XA 4K11A 2ZPEB 2DETA 2AKKA 2IPOB 5GAN4 1KHIA 4LDYA 3M58A 3MPUB 1V29B 4M77F 2RI2A 4XQ3A 1VQ9A 1SHFA 2EGCA 4C5EA 3UWNA 2RQRA 4M78A 1YHQQ 3JCMd 5EC7A 1IGUA 3CC4Q 4EMKB 4FU6A 3RMQA 2M0YA 2KRNA 4F04B 1X01A 1NLOC 3EH2A 1WXTA 5KCHA 2KXCA 1YFNA 2EQIA 2HSPA 4HVVA 5GANf 1AWJA 1E7OA 2JJ9A 4IUVA 2CZ0B 1M1KR 2RJDA 1SRLA 4R56A 2DILA 1JRIA 2D6FA 3H41A 2A7YA 2QASA 1PKSA 2EKHA 2DL5A 4JRPA 3JB9I 3EHQA 1SG5A 3PNWC 2HBPA 4MZMA 2FB7A 4B6MA 2COWA 2EYYA 2CSQA 2IG0A 2FG0A 3VRZA 4LDWA 1MHNA 1N5ZA 3JRZA 4E7SA 4J9GA 4E7JA 2QEXT 2CH4W 5IN1A 4M77C 3I56T 2C0IA 3URGA 3E19A 4BD3A 1VQ7T 4ELZC 3RESA 4EMKA 2A36A 1VQ5T 3OS1A 3M0SA 4RTXA 3JCMV 1KD1C 4J6YA 2LCCA 3RMSA 5FU6B 2QDLA 1H641 2J6OA 2JM9A 2ZZDA 3I9QA 1NLPC 4WF2A 4J9IA 4HCBA 1VQMA 1GCQC 1WHJA 2RHXA 3OSSC 2RQTA 9ATCB 2VB6A 1H8KA 3S3NA 1Q86U 3HPWA 4LUDA 3MCAB 4BDZA 2PZ1A 2JTFA 4RCBA 4OMLA 1VQ4A 2QYZA 1UUEA 2LRQA 2DXUA 1AWOA 4M7AC 4EMGA 4M7AE 1RLPC 1WXBA 1ZSZA 2JOYA 2CDTA 2G6FX 2QAZA 1VQNA 1JXMA 1YJNT 2XU8A 3O5ZA 1KD1U 4FT2A 4YTLA 4M75D 4PJLA 5GAN8 1YI2T 4A63B 4WCIA 2CUBA 3GF5A 1BB9A 3V8KA 2OTLQ 2KYBA 1DJ7B 4M7DC 2K5LA 4DOVA 2D0QB 4BUGA 4M77A 4M4ZA 1ZA1B 2ZPIB 4XTZA 4M78F 1WIEA 2RF0A 5GAN7 1M8MA 1S72Q 2JS0A 2XDDA 3CMEQ 1M1KC 4JZ4A 1WA7A 2J6FA 3LLRA 4M75A 5A0GA 5LJ5g 2DZ9A 2DL3A 3A8LB 5A2QE 1NJIC 2QQ9A 2GTOA 2COYA 3L2QA 3JCMf 2D8HA 2W10A 2EQMA 5HY6A 3EG9B 2L3RA 5CKDA 1UG1A 1WFWA 4EMHA 2KMTA 2DMOA 1VQ8T 2KE9A 2Z0WA 3RBBB 1UE9A 3D7SB 5D6WA 4PFPA 2MOXA 1GFCA 1S72A 1WI7A 4C92A 1MNDA 2HKQB 1KK7A 4PJOG 2CP6A 1IB8A 3JCMb 3HRTA 3WVDB 2DBKA 5I2MA 1U1TA 4B9XA 3OYHA 2EQUA 2DEQA 2PUOB 4WTOB 1W2BP 3NFCA 1UTIA 3QYGB 3M0TA 1HSQA 4C92F 1WYXA 5C0MA 4B9WA 5CR2A 3HTRA 1ZBJA 3C94A 4ELYC 2M9UA 4M75C 2P4TA 2LTOA 4OMQA 2MI6A 1YJWQ 1Q81R 3L2WA 1FMVA 3DB3A 1OULA 2DLPA 4E7ZA 2FPDA 3KBGA 1NM7A 2AIRB 3JCMP 1GFDA 1KC8U 1QLYA 3L1AA 3LYIA 3SFMA 1VIEA 3CMAA 2RM4A 3CCVA 3NHNA 4OMFB 1QVFA 1H92A 4RTZA 5LJ5f 2CP0A 5IH2A 2LVMA 1Q86C 3G6ET 2HQHA 5GMKl 2CZ6B 3JCMe 5LL6S 1C0MA 4NL2A 3M59A 1QVGP 2RQWA 2YSQA 4E47A 8AT1B 5FWBA 4M7DG 3JV3A 4XK8E 3QZ9B 4Y92A 2A0FB 2LJ3A 2W0ZA 1PG5B 4C92C 5CKHA 2BE9B 3PMTA 2KK4A 2ESWA 3QBYA 5IXBA 3P8HA 2RD1A 4LN2A 2HL5C 3NGPA 4M75F 3JB9D 4PJMA 3EFRA 4RG8A 1ZA2B 2GCXA 2GQVA 3X28B 1T3SA 5CKFA 5GAOp 3H0IA 2DKGA 3IQLA 3META 1BKBA 1U1SA 3OMGA 2K6DA 1OI1A 4BE1A 1ARKA 1WJSA 3SWNA 3M0PA 2QQAA 1V76A 4PK4A 4RKUE 2KAFA 5KYUA 4BACA 3QJYA 4LUEA 2R5MA 4LD9K 1M5Q1 3INZA 1CKAA 4PJOC 1X2KA 3V8LA 2NYSA 2XD0A 2RI3A 2EYQA 2KI7A 1K0SA 2DA9A 1VQNQ 2EJFA 4XTUA 1OU8A 2X35A 1M3AA 2BZYA 2KT8A 2LCLA 4KGVB 3X26B 3V8JA 4QVCA 3SD4A 4PKCC 2KEAA 5HK0A 1MNEA 5AYFA 2HQXA 1N8RR 1UFFA 5A0DA 2WSFE 2QEXA 2OI3A 3V7CA 4OF1A 1VUBA 3HL8A 3OY9A 1X6OA 3EFOA 4C0DB 5CVIA 1N8RC 1M2VA 4A4FA 1TOVA 5GANg 2SEMA 2XIDA 1VQ4T 1YBYA 2K2VA 3E9GA 4JS5A 4QKUA 2A37A 4C8QG 3VRYA 1Y71A 3DLLA 2LP5A 2RPNA 3A8OB 1VQNT 1ACMB 3OYDA 3CPFA 1JJ2P 2ROLA 5KH6A 4RTWA 1Q95G 5CQXA 1TTHB 1BBZA 4C5GA 3A1PA 3VKIA 1LOJA 2JTEA 2K79A 1N6AA 1WX6A 2LQNA 3CCEQ 3GNFB 3EGDA 3QHSA 3CXCA 1QKXA 3CC4T 5FU6C 1Y07A 4KUDK 1YCSB 2ABLA 3X25B 2QTXA 3TVTA 2LJ0A 2K5IA 4KGXB 2DAQA 4TVRA 1VQ9T 3J81E 1HXDA 2E65A 1AD5A 4XTYA 3KFVA 4MZTA 2J05A 2DERA 3EG1A 4JLGA 3THKA 2QQBA 4XU2A 2EIFA 3CC7T 2E1HA 4PJNA 3PTAA 1Q82U 1VQPT 1KHCA 4IUQA 1QVFS 3EG0A 2JZ2A 1H3HA 2LMJA 4J5YA 1EIFA 3A5ZB 4GBQA 2GBQA 2HCKA 5L23A 2DTOA 1D0YA 1X69A 1BK2A 2DRKA 3GNGA 3M0UA 1Y57A 1K9MC 1ZHIA 3OYYA 2XHCA 1RAEB 2QGFB 2E70A 3CBMA 1VQ9Q 3QUIA 3OBWA 1XTDA 3H9NA 3OYMA 2X3WD 4GY5A 2O88A 3NMZC 1UJ0A 4PLLA 2NUZA 5J26A 4BB7A 2KRSA 1K73U 1E6HA 1VQPQ 1TU0B 2X4YA 3GP8A 3NTIA 4XTXA 1IZ6A 3Q1JA 2ZPBB 4C0ZA 2XDPA 1LVKA 2FZCB 4FYWB 1TH7A 4ZN3A 2V8IA 4ATOA 1W1FA 4KGZB 1YHQT 1T0HA 3L2ZA 3JCMh 4E7IA 3MHXA 5GAMd 2CZ7B 4ZNXA 5GMKi 3J7AF 2F2XA 4LE9A 2EFIA 2L89A 3I5SA 2ED1A 3QKJA 1OYXA 2J6KA 8ATCB 3TQ7P 1Q7YR 7AT1B 2EBPA 3ZFJA 1IGQA 1QW1A 2L3SA 2DXCA 2BTTA 4JRIA 1BCMA 2VC8A 4JJCA 4BY6B 4DBQA 3MEAA 3CCJA 4C5IA 4HVWA 2DD4A 4ME7A 1W6XA 2PNIA 2CKKA 3JCMc 2BKDN 4X34A 3PFSA 6AT1B 2VGMA 1M1GA 4KT0E 3PE0A 2LX7A 2X9HA 2KVQG 3OYEA 1D1BA 4HT9A 3OYBA 3CCSQ 2LNHB 4ZGJB 2JM8A 4M77D 3I56Q 2Y90A 2QQRA 2YWWA 1VQ7Q 2K5FA 2V1QA 3A8GB 1NG2A 4CC3A 5GAN6 2CYZB 2D0NA 2DF6A 2ZAEA 1WHMA 3RDVA 1OPLA 3ASKA 1VQLA 5FROA 2YRVA 3HHTB 1VQKT 4BI8B 1CKBA 2NUTB 1N9RA 1JQQA 4F7UB 1BIAA 3VS0A 1VQ6A 5J39A 3CBPA 2AK5A 3L2RA 4J6XA 4IUUA 1BU1A 3OS2A 3VS1A 1K1ZA 5GAOm 2RK2A 2QA4T 4FSSA 4HCKA 2LX9A 1YJNA 2DL8A 2GF7A 4RTTA 1D1CA 3VV0A 2JN0A 1A0NB 4FYYB 2BIVA 2CT4A 1X6GA 5CAIA 4DA4A 2EJGA 1K8AR 2JS2A 3CMET 1D09B 5CKEA 2YRDA 3JB9F 2ZGWA 4F14A 1KC8R 4LXCA 3ZBDA 5LJ5e 3LH5A 1K73R 1K8AU 1I5LA 2JXBA 5KCOA 3C4SA 3CPWA 4F7UA 4LDVA 4DEYA 2HAXA 3ER0A 1FX7A 2QA4Q 1VQ8Q 1WJQA 1W2BS 2DE0X 4L6V5 3GOXA 2CP3A 1B34B 1AOJA 1SHGA 2GFUA 3WXMB 2ENMA 5IXFA 3C95A 4PJJA 1Q7YC 4C5HA 2IIMA 1JO8A 4JS4A 1M90C 3MP8A 3CD6T 2NUPB 4FYXB 1Z9QA 4XAXB 5HKCA 3UA6A 3AHUA 5GAN5 4EMKC 1X27A 3FRNA 2MF2A 4RTYA 2FHDA 4JJNK 2X4WA 4M75B 3RKWA 1Y0MA 3H6ZA 4XTWA 2KRMA 3S6WA 2RHYA 1VA7A 2OAUA 2Y4YA 3CCRT 3V7RA 3CCMA 1B7TA 5D6XA 2R58A
chains in the Genus database with same CATH topology
4Z8AA 2DM1A 2RQWA 2YSQA 4LNPA 3R6NA 2RQVA 5FWBA 2L3QA 3JV3A 2GTJA 4AG2C 1M3BA 4Y92A 5FW9A 3EG3A 2LJ3A 2W0ZA 1NEBA 1X43A 3I5RA 2ESWA 5IXBA 2EYXA 4LN2A 2DRMA 2YUOA 3NGPA 2AKLA 4IIOA 3I35A 1X2QA 3EG2A 1AZGB 3H0HA 2DYBA 4JJBA 1T3SA 2C0TA 3H0IA 3IQLA 1YP5A 1LCKA 2K6DA 3VS7A 2RQUA 1KFZA 1ARKA 2EVRA 2EYZA 1UHFA 1T3LA 3H0FA 3M0PA 1W70A 4J9DA 2KGTA 4D8DA 1QWFA 3NPFA 4LUEA 2LCSA 1NYFA 5FWCA 2KNBB 2NWMA 2YT6A 1CKAA 2YDLA 1X2KA 3RNJA 2MIOA 2AZSA 2YUNA 1QKWA 3EHRA 1K0SA 2DA9A 1GCQA 1M3AA 2BZYA 2KT8A 2JMAA 2OAWA 2O9VA 4X1VA 1PKTA 4CC4B 2KYMA 2XMFA 2KEAA 4AFQC 3TSWA 1KIKA 1ABQA 2CSIA 3SEMA 1ZUYA 1UFFA 1QCFA 3M0QA 1PRMC 2OI3A 3CQTA 1VYUA 1B07A 2CUDA 2O31A 1ZX6A 4Z89A 2JW4A 4D8KA 2FPEA 1EFNA 4OMPA 4QT7A 4JJDA 1GRIA 4AFZC 3U23A 2ROTA 2SEMA 4J9CA 3VS6A 3EGUA 3ZL7C 2A37A 2L3PA 1OOTA 2DBMA 3VRYA 3QWXX 2D8JA 1UJYA 2LP5A 2RPNA 2O2OA 3FJ5A 2RMOA 5I22A 2KROA 1WLPB 4EIKA 4Z88A 2ROLA 4JZ3A 4RTWA 2L0AA 5IHNA 1BBZA 1K4US 4JPBW 4CC7A 5GJVB 1X6BA 1YNZA 2JTEA 2K79A 4GLMA 1WX6A 2LQNA 1GL5A 4RTUA 2ECZA 1ZSGA 1YN8A 3REAB 1PHTA 1QKXA 1MV0B 1QWEA 1TG0A 1WXUA 1YCSB 2ABLA 3TVTA 2LJ0A 2RNAA 2YUPA 1JXOA 1M30A 1AD5A 4DEXA 2B86A 3KFVA 3UATA 2KXDA 2J05A 4OMMA 2VKNA 3EG1A 3QWYA 3THKA 2GGRA 2M51A 1CSKA 2BZ8A 3C0CA 3GBQA 1SEMA 2LJ1A 2EW3A 3EG0A 4K11A 1H3HA 2LMJA 5GJWB 2AKKA 2A28A 1UGVA 1I0CA 2GBQA 2HCKA 2V1RA 4GBQA 5I11A 5L23A 3REBB 1SHFA 2EGCA 1VYVA 2RQRA 1X69A 1BK2A 2EGEA 2DRKA 5EC7A 4F17A 3M0UA 1Y57A 2M0YA 1PNJA 1SPKA 2KRNA 2P4RA 4AFUC 2A08A 1NLOC 1WXTA 2VWFA 2KXCA 2EQIA 2HSPA 4HVVA 5ECAA 1AWJA 1E7OA 1FMKA 1UDLA 2X3WD 2O88A 3NMZC 1SRLA 1UJ0A 2NUZA 2DILA 4KRTA 3VS5A 2KRSA 2D1XA 1NEGA 3VS2A 3H41A 2EGAA 1E6HA 1I1JA 2F2WA 1PKSA 1V1CA 2EKHA 1YWPA 2DL5A 1M3CA 3EHQA 1GBQA 2CT3A 2KT1A 2KR3A 3PVLA 2KBTA 2EYYA 4J9BA 4CC2A 2SRCA 1W1FA 2FRYA 1Z9ZA 2CSQA 1T0HA 2MCNA 2FG0A 3VRZA 1N5ZA 1AZEA 4J9GA 4ZNXA 2DL4A 2F2XA 4LE9A 2H8HA 3I5SA 1AWXA 2ED1A 2CH4W 2J6KA 2OJ2A 2HEQA 1B3QA 4E6RA 2EBPA 2C0IA 2CREA 5HCKA 2A36A 2L3SA 3SHWA 2C0OA 2BTTA 3M0SA 1NYGA 4JJCA 1YWOA 2DL7A 2GQIA 4RTXA 4HVWA 4OMOA 2QDLA 1W6XA 2PNIA 2L2PA 1GCPA 2J7IA 2J6OA 2JM9A 2VVKA 3I9QA 1NLPC 4J9IA 2GNCA 1HD3A 1IO6A 1U06A 1GCQC 2EYWA 2RQTA 3PE0A 2K7AA 2LX7A 1I07A 2I0NA 1H8KA 4J9FA 1E6GA 3TSZA 4LUDA 3UA7A 1SRMA 2PZ1A 1TUCA 2LNHB 4OMLA 1JEGA 1UUEA 4HVUA 2JM8A 1TUDA 1AWOA 4HXJA 2YUQA 1RLPC 1WXBA 4F16A 1MV3A 2G6FX 2CDTA 2V1QA 1NG2A 1WDXA 1JU5C 1JXMA 3O5ZA 4CC3A 2D0NA 2DF6A 4A63B 4WCIA 2CUBA 2HDAA 1BB9A 5IHKA 2KYBA 1K76A 1G83A 1OPLA 2DNUA 4M4ZA 2HBWA 2LQWA 1K9AA 2BZXA 1WIEA 2RF0A 1PRLC 1M8MA 3M0RA 1OV3A 1CKBA 2JS0A 4JZ4A 1JQQA 1WA7A 2J6FA 3VS0A 2DX1A 1AEYA 2RN8A 1T0JA 2FRWA 1SSHA 2DL3A 2GTOA 2AZVA 1RI9A 1S1NA 2AK5A 2D8HA 4OMNA 2W10A 3PVQA 1U5SA 1BU1A 2F2VA 3VS1A 1K1ZA 1UG1A 1WFWA 4RUGA 2DMOA 4FSSA 2KE9A 4HCKA 1AWWA 2DL8A 2JMCA 3RBBB 1UE9A 1ZUUA 4RTTA 2O9SA 1RUWA 2MOXA 1KJWA 1GFCA 1A0NB 1WI7A 2JT4A 1PWTA 2CT4A 1X6GA 1ZLMA 4J9HA 3UF4A 1FYNA 1U3OA 2DVJA 2E5KA 1UHCA 2JS2A 2DBKA 4AFSC 3VS4A 2J06A 1XOVA 2FEIA 2LZ6B 1G2BA 3VS3A 4F14A 2K2MA 1UTIA 2DJQA 1VYTA 3LH5A 2K9GA 3M0TA 1HSQA 4RTVA 1WYXA 2JXBA 2CH4A 4AG1C 1ZBJA 4DEYA 3A98A 1ABOA 1M27C 2DE0X 4OMQA 1AOJA 1SHGA 2DLPA 2FPDA 2ENMA 1NM7A 3ULRB 1OEBA 4ORZA 1AVZC 5IXFA 1GFDA 2IIMA 4ESRA 1JO8A 1MUZA 2ED0A 1QLYA 2K3BA 1Z9QA 1ZUKA 1GBRA 1UECA 1KSWA 2X3XD 4IIMA 5IHIA 3UA6A 3NHNA 1H92A 1X27A 2EPDA 4RTYA 4RTZA 2FO0A 5IH2A 1OPKA 4J9EA 2PTKA 1Y0MA 1RLQC 2KRMA 1VA7A 2FPFA 1HJDA 1J3TA 1K0XA 4R0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z8A A;  2DM1 A;  2RQW A;  2YSQ A;  4LNP A;  3R6N A;  2RQV A;  5FWB A;  2L3Q A;  3JV3 A;  2GTJ A;  4AG2 C;  1M3B A;  4Y92 A;  5FW9 A;  3EG3 A;  2LJ3 A;  2W0Z A;  1NEB A;  1X43 A;  3I5R A;  2ESW A;  5IXB A;  2EYX A;  4LN2 A;  2DRM A;  2YUO A;  3NGP A;  2AKL A;  4IIO A;  3I35 A;  1X2Q A;  3EG2 A;  1AZG B;  3H0H A;  2DYB A;  4JJB A;  1T3S A;  2C0T A;  3H0I A;  3IQL A;  1YP5 A;  1LCK A;  2K6D A;  3VS7 A;  2RQU A;  1KFZ A;  1ARK A;  2EVR A;  2EYZ A;  1UHF A;  1T3L A;  3H0F A;  3M0P A;  1W70 A;  4J9D A;  2KGT A;  4D8D A;  1QWF A;  3NPF A;  4LUE A;  2LCS A;  1NYF A;  5FWC A;  2KNB B;  2NWM A;  2YT6 A;  1CKA A;  2YDL A;  1X2K A;  3RNJ A;  2MIO A;  2AZS A;  2YUN A;  1QKW A;  3EHR A;  1K0S A;  2DA9 A;  1GCQ A;  1M3A A;  2BZY A;  2KT8 A;  2JMA A;  2OAW A;  2O9V A;  4X1V A;  1PKT A;  4CC4 B;  2KYM A;  2XMF A;  2KEA A;  4AFQ C;  3TSW A;  1KIK A;  1ABQ A;  2CSI A;  3SEM A;  1ZUY A;  1UFF A;  1QCF A;  3M0Q A;  1PRM C;  2OI3 A;  3CQT A;  1VYU A;  1B07 A;  2CUD A;  2O31 A;  1ZX6 A;  4Z89 A;  2JW4 A;  4D8K A;  2FPE A;  1EFN A;  4OMP A;  4QT7 A;  4JJD A;  1GRI A;  4AFZ C;  3U23 A;  2ROT A;  2SEM A;  4J9C A;  3VS6 A;  3EGU A;  3ZL7 C;  2A37 A;  2L3P A;  1OOT A;  2DBM A;  3VRY A;  3QWX X;  2D8J A;  1UJY A;  2LP5 A;  2RPN A;  2O2O A;  3FJ5 A;  2RMO A;  5I22 A;  2KRO A;  1WLP B;  4EIK A;  4Z88 A;  2ROL A;  4JZ3 A;  4RTW A;  2L0A A;  5IHN A;  1BBZ A;  1K4U S;  4JPB W;  4CC7 A;  5GJV B;  1X6B A;  1YNZ A;  2JTE A;  2K79 A;  4GLM A;  1WX6 A;  2LQN A;  1GL5 A;  4RTU A;  2ECZ A;  1ZSG A;  1YN8 A;  3REA B;  1PHT A;  1QKX A;  1MV0 B;  1QWE A;  1TG0 A;  1WXU A;  1YCS B;  2ABL A;  3TVT A;  2LJ0 A;  2RNA A;  2YUP A;  1JXO A;  1M30 A;  1AD5 A;  4DEX A;  2B86 A;  3KFV A;  3UAT A;  2KXD A;  2J05 A;  4OMM A;  2VKN A;  3EG1 A;  3QWY A;  3THK A;  2GGR A;  2M51 A;  1CSK A;  2BZ8 A;  3C0C A;  3GBQ A;  1SEM A;  2LJ1 A;  2EW3 A;  3EG0 A;  4K11 A;  1H3H A;  2LMJ A;  5GJW B;  2AKK A;  2A28 A;  1UGV A;  1I0C A;  2GBQ A;  2HCK A;  2V1R A;  4GBQ A;  5I11 A;  5L23 A;  3REB B;  1SHF A;  2EGC A;  1VYV A;  2RQR A;  1X69 A;  1BK2 A;  2EGE A;  2DRK A;  5EC7 A;  4F17 A;  3M0U A;  1Y57 A;  2M0Y A;  1PNJ A;  1SPK A;  2KRN A;  2P4R A;  4AFU C;  2A08 A;  1NLO C;  1WXT A;  2VWF A;  2KXC A;  2EQI A;  2HSP A;  4HVV A;  5ECA A;  1AWJ A;  1E7O A;  1FMK A;  1UDL A;  2X3W D;  2O88 A;  3NMZ C;  1SRL A;  1UJ0 A;  2NUZ A;  2DIL A;  4KRT A;  3VS5 A;  2KRS A;  2D1X A;  1NEG A;  3VS2 A;  3H41 A;  2EGA A;  1E6H A;  1I1J A;  2F2W A;  1PKS A;  1V1C A;  2EKH A;  1YWP A;  2DL5 A;  1M3C A;  3EHQ A;  1GBQ A;  2CT3 A;  2KT1 A;  2KR3 A;  3PVL A;  2KBT A;  2EYY A;  4J9B A;  4CC2 A;  2SRC A;  1W1F A;  2FRY A;  1Z9Z A;  2CSQ A;  1T0H A;  2MCN A;  2FG0 A;  3VRZ A;  1N5Z A;  1AZE A;  4J9G A;  4ZNX A;  2DL4 A;  2F2X A;  4LE9 A;  2H8H A;  3I5S A;  1AWX A;  2ED1 A;  2CH4 W;  2J6K A;  2OJ2 A;  2HEQ A;  1B3Q A;  4E6R A;  2EBP A;  2C0I A;  2CRE A;  5HCK A;  2A36 A;  2L3S A;  3SHW A;  2C0O A;  2BTT A;  3M0S A;  1NYG A;  4JJC A;  1YWO A;  2DL7 A;  2GQI A;  4RTX A;  4HVW A;  4OMO A;  2QDL A;  1W6X A;  2PNI A;  2L2P A;  1GCP A;  2J7I A;  2J6O A;  2JM9 A;  2VVK A;  3I9Q A;  1NLP C;  4J9I A;  2GNC A;  1HD3 A;  1IO6 A;  1U06 A;  1GCQ C;  2EYW A;  2RQT A;  3PE0 A;  2K7A A;  2LX7 A;  1I07 A;  2I0N A;  1H8K A;  4J9F A;  1E6G A;  3TSZ A;  4LUD A;  3UA7 A;  1SRM A;  2PZ1 A;  1TUC A;  2LNH B;  4OML A;  1JEG A;  1UUE A;  4HVU A;  2JM8 A;  1TUD A;  1AWO A;  4HXJ A;  2YUQ A;  1RLP C;  1WXB A;  4F16 A;  1MV3 A;  2G6F X;  2CDT A;  2V1Q A;  1NG2 A;  1WDX A;  1JU5 C;  1JXM A;  3O5Z A;  4CC3 A;  2D0N A;  2DF6 A;  4A63 B;  4WCI A;  2CUB A;  2HDA A;  1BB9 A;  5IHK A;  2KYB A;  1K76 A;  1G83 A;  1OPL A;  2DNU A;  4M4Z A;  2HBW A;  2LQW A;  1K9A A;  2BZX A;  1WIE A;  2RF0 A;  1PRL C;  1M8M A;  3M0R A;  1OV3 A;  1CKB A;  2JS0 A;  4JZ4 A;  1JQQ A;  1WA7 A;  2J6F A;  3VS0 A;  2DX1 A;  1AEY A;  2RN8 A;  1T0J A;  2FRW A;  1SSH A;  2DL3 A;  2GTO A;  2AZV A;  1RI9 A;  1S1N A;  2AK5 A;  2D8H A;  4OMN A;  2W10 A;  3PVQ A;  1U5S A;  1BU1 A;  2F2V A;  3VS1 A;  1K1Z A;  1UG1 A;  1WFW A;  4RUG A;  2DMO A;  4FSS A;  2KE9 A;  4HCK A;  1AWW A;  2DL8 A;  2JMC A;  3RBB B;  1UE9 A;  1ZUU A;  4RTT A;  2O9S A;  1RUW A;  2MOX A;  1KJW A;  1GFC A;  1A0N B;  1WI7 A;  2JT4 A;  1PWT A;  2CT4 A;  1X6G A;  1ZLM A;  4J9H A;  3UF4 A;  1FYN A;  1U3O A;  2DVJ A;  2E5K A;  1UHC A;  2JS2 A;  2DBK A;  4AFS C;  3VS4 A;  2J06 A;  1XOV A;  2FEI A;  2LZ6 B;  1G2B A;  3VS3 A;  4F14 A;  2K2M A;  1UTI A;  2DJQ A;  1VYT A;  3LH5 A;  2K9G A;  3M0T A;  1HSQ A;  4RTV A;  1WYX A;  2JXB A;  2CH4 A;  4AG1 C;  1ZBJ A;  4DEY A;  3A98 A;  1ABO A;  1M27 C;  2DE0 X;  4OMQ A;  1AOJ A;  1SHG A;  2DLP A;  2FPD A;  2ENM A;  1NM7 A;  3ULR B;  1OEB A;  4ORZ A;  1AVZ C;  5IXF A;  1GFD A;  2IIM A;  4ESR A;  1JO8 A;  1MUZ A;  2ED0 A;  1QLY A;  2K3B A;  1Z9Q A;  1ZUK A;  1GBR A;  1UEC A;  1KSW A;  2X3X D;  4IIM A;  5IHI A;  3UA6 A;  3NHN A;  1H92 A;  1X27 A;  2EPD A;  4RTY A;  4RTZ A;  2FO0 A;  5IH2 A;  1OPK A;  4J9E A;  2PTK A;  1Y0M A;  1RLQ C;  2KRM A;  1VA7 A;  2FPF A;  1HJD A;  1J3T A;  1K0X A;  4R0K A; 
#chains in the Genus database with same CATH topology
 3J80 E;  1WQ7 A;  4LNP A;  3R6N A;  1F1B B;  3VYH B;  2GTJ A;  4AG2 C;  3CCL T;  1M3B A;  1VQO A;  1QMC A;  2CP5 A;  3QJ6 A;  3EG3 A;  1VOM A;  3HSB A;  1Q81 C;  1YIJ T;  2DRM A;  2HNI A;  5FU7 C;  3CCQ A;  2VUB A;  4IIO A;  1PD1 A;  1AZG B;  2RHU A;  1AHJ B;  4OB1 B;  2P0K A;  1YP5 A;  2MPX C;  3L2V A;  4MML A;  5LJ5 h;  3VS7 A;  2RQU A;  2EYZ A;  1IXD A;  1T3L A;  3RKX A;  3H0F A;  4M7A D;  4QQG A;  3CMA Q;  1BI0 A;  3CCR Q;  1VQ4 Q;  1NYF A;  5FWC A;  4FW1 A;  4N4G A;  2KNB B;  2RA2 A;  4M7A B;  1YIT T;  1Q7Y U;  2YT6 A;  3BE3 A;  3QO3 A;  4MZP A;  3QSU A;  4X9D A;  3EFO B;  2DTH A;  3CCQ T;  5GMK j;  1QKW A;  3EHR A;  4GLK A;  1VQL Q;  3SDZ A;  2YHT A;  1RAH B;  5CIU A;  5I2S A;  5FRM A;  2JMA A;  1H3Z A;  2NLU A;  1YIT A;  2O9V A;  4CC4 B;  2YRC A;  1RAG B;  4M7D A;  4UC4 A;  3VUZ A;  4CI0 C;  3TSW A;  5GAM j;  3CC4 A;  2A3L A;  1ZUY A;  1QCF A;  1NJI R;  2RJC A;  2XG8 D;  2VV5 A;  4F7U F;  4Z89 A;  2JW4 A;  1ZSZ C;  3MEU A;  2FPE A;  1EFN A;  4OMP A;  4QT7 A;  4JJD A;  1GRI A;  2CP7 A;  2JTM A;  3VS6 A;  5GAM h;  3FB9 A;  1OQK A;  1LJO A;  2XIC A;  3AT1 B;  3JSC A;  1OOT A;  1M4Z A;  2D8J A;  2PVO B;  1UJY A;  3CCQ Q;  1P92 A;  2QDY B;  5GMK e;  3M55 A;  2RMO A;  1WLP B;  3PIO A;  1SKU B;  4DOW A;  4OGC A;  3RER A;  3MJX A;  1M90 U;  4F7U G;  2RH2 A;  2CGH A;  2ECZ A;  1ZSG A;  5GAN j;  3REA B;  2H3E B;  3BW1 A;  4RCC A;  3QG1 A;  2D9T A;  1WXU A;  4CRI A;  1WNL A;  2RJE A;  3UDC A;  4C8Q E;  1M30 A;  1R77 A;  4J7I A;  3UT1 A;  3UAT A;  3CME A;  1N27 A;  4OMM A;  2VKN A;  3QWY A;  3PIP A;  3H8Z A;  2HSE B;  2M51 A;  1CSK A;  4C92 B;  2BZ8 A;  3CCU A;  2OTJ A;  3GBQ A;  4FW2 A;  1SEM A;  2LJ1 A;  5FU7 B;  4C92 E;  1UEB A;  1UB4 A;  1UGV A;  1K9M R;  1I0C A;  2V1R A;  5I11 A;  1PC0 A;  3FJP A;  3REB B;  5HK3 A;  4RMO A;  3CCE T;  4C8Q B;  3JCM Q;  2DFU A;  4C92 G;  1PNJ A;  1SPK A;  2P4R A;  2A08 A;  4MDW A;  5KYX B;  1Y96 B;  1RAC B;  2E12 A;  2DJZ A;  3OYG A;  1R0C B;  1FMK A;  1UDL A;  1OZ2 A;  3V7S A;  4N4H A;  5LJ5 d;  3CCV T;  4PLI A;  3VS5 A;  5GMK h;  1NEG A;  1YJ9 A;  3RIR A;  3FLG A;  1HYO A;  1M3C A;  4BI4 A;  1G3T A;  4A4H A;  2H3J A;  4JDS A;  1GBQ A;  2CT3 A;  2KT1 A;  5KYY B;  2O4X B;  2KR3 A;  4BI3 A;  3PVL A;  1Q81 U;  2DIQ A;  2DXT A;  2KBT A;  3QXE B;  4J9B A;  1M1F A;  2CP2 A;  2FRY A;  1UGR B;  2LDM A;  2MCN A;  5GAM f;  2E3I A;  1TUG B;  2FYK A;  4C0D C;  1XJW B;  4Y28 E;  4MDX A;  3E1S A;  3HFN A;  4L5G A;  2H8H A;  1AWX A;  2OJ2 A;  5GAN 2;  2HEQ A;  2MYS A;  4E6R A;  4M78 B;  2FZG B;  3BDL A;  5HCK A;  4JLI A;  2VAS A;  3OSV A;  1PCX A;  2R5A A;  2VXF A;  1BI3 A;  2GQI A;  3S3M A;  3CCJ T;  1VQO Q;  3G1J A;  2L2P A;  1GCP A;  1WJR A;  1VQK Q;  1LNX A;  1S72 T;  1U06 A;  3LW5 E;  5GAN h;  1KQS P;  3MEW A;  2RHI A;  3BFM A;  5KYN A;  2DIG A;  4M7D B;  3KUF A;  1I07 A;  4EDU A;  2K3Y A;  2I0N A;  3ME9 A;  4PJO D;  4J9F A;  3TSZ A;  2DO3 A;  2WSE E;  4M75 E;  5KYY A;  3EH1 A;  2CZ1 B;  4J83 A;  4HXJ A;  2L5Q A;  4PJO F;  3TEE A;  2YUQ A;  1NJI U;  4F16 A;  2BE7 D;  3CCE A;  1VQ5 Q;  2E64 A;  2ZPF B;  3SWN C;  2EQJ A;  4D6W A;  2HDA A;  4E7L A;  1OZ3 A;  3CCJ Q;  1U8R A;  1G83 A;  3QDF A;  4JUV A;  3OYK A;  2DNU A;  1WHH A;  2HBW A;  3CCU Q;  1QCN A;  4RG2 A;  5C6S A;  2OTJ Q;  1K9A A;  1PRL C;  4O5V A;  3M0R A;  2KSS A;  2JUF A;  2V26 A;  3EGX A;  4NS5 A;  2RK1 A;  1PD0 A;  2DX1 A;  3FIF A;  1AEY A;  2RN8 A;  2V8J A;  1T0J A;  5CQY A;  2LQK A;  5LJ3 f;  5GAM e;  2AZV A;  2QI2 A;  1M90 R;  1S1N A;  2COZ A;  2L8D A;  2X51 A;  1ZQ1 A;  1U5S A;  2F2V A;  3FC3 A;  4M7D E;  1AWW A;  2JMC A;  3L2U A;  1VIF A;  3HP9 A;  2O9S A;  1RUW A;  1JJ2 A;  2OTL T;  1KJW A;  3OYC A;  2JT4 A;  1WPY A;  1PWT A;  5LJ5 j;  1K8A C;  3P8B B;  4PJO B;  4XTV A;  1ZLM A;  1I5O B;  2EQK A;  3M5A A;  4J9H A;  3CCU T;  1MMD A;  1U3O A;  4J7F A;  2DVJ A;  1UHC A;  2KY9 A;  1SSF A;  1KC8 C;  2BUD A;  3VS4 A;  4PNO A;  3JB9 H;  4PFO A;  1XOV A;  4E7H A;  3QPH A;  1M1K U;  4M7D F;  2FEI A;  5DLO A;  1VQ6 Q;  1G2B A;  2B8A A;  3VS3 A;  3I55 A;  3BDU A;  3OYL A;  2K2M A;  4FM4 B;  3NTH A;  2DK3 A;  1VYT A;  1QVG A;  2K9G A;  4HCZ A;  2PVG B;  4ZGE B;  4RTV A;  2FVU A;  1W2B A;  1VQM Q;  3LGF A;  2MWP A;  3PMI A;  1PM3 A;  1QCO A;  1MMA A;  1TWB A;  3OS0 A;  3JCM J;  1BI1 A;  3OYN A;  3M56 A;  2QTV A;  1YIJ Q;  4ORZ A;  3JB9 G;  2I2L A;  4ESR A;  2RB6 A;  2ED0 A;  5GMK m;  2MMP A;  2K3B A;  2GFA A;  4IIM A;  2QG9 B;  2IVW A;  5IHI A;  5M9O A;  2FZK B;  2O4X A;  4A4E A;  2EPD A;  4A53 A;  2LT1 A;  2FO0 A;  4PJO A;  1OPK A;  3RUX A;  2PTK A;  2F5T X;  3G71 T;  1RLQ C;  3CC2 T;  3VJP A;  4HT8 A;  2FPF A;  2YXY A;  1HJD A;  3FDR A;  4Z8A A;  4A4K A;  3I55 T;  3ZEH A;  2HQE A;  4ZN1 A;  4LDX A;  3CD6 A;  2E6N A;  3NTK A;  4FCY A;  1JB0 E;  1X43 A;  4BY6 C;  5A0L A;  5D7U A;  4C0F A;  4HCC A;  1O75 A;  1YIJ A;  1YJ9 Q;  2YUO A;  4OVA A;  3FEO A;  2AKL A;  2PVD B;  3I35 A;  3OYA A;  1X2Q A;  3EG2 A;  5CCA A;  1LPL A;  3H0H A;  2DYB A;  4KUI A;  2C0T A;  3CCM Q;  2VXE A;  4QVZ A;  1LCK A;  3I56 A;  1EX4 A;  1FMW A;  2PUK B;  1KFZ A;  2EKO A;  1UHF A;  4XU3 A;  1W70 A;  5FLX E;  4J9D A;  3G6E Q;  2KGT A;  4D8D A;  5LJ3 j;  4C92 D;  2LCS A;  2KDS A;  3O8V A;  1BYM A;  2YDL A;  3I55 Q;  1NPP A;  2MWO A;  2YUN A;  3X24 B;  2DXB A;  1GCQ A;  3G4S A;  1WHK A;  3OS5 A;  2OAW A;  3L42 A;  4X1V A;  3JCM W;  2KYM A;  1Q82 R;  1TS9 A;  2XMF A;  3E9F A;  4AFQ C;  3MO8 A;  3QZ5 B;  4FT4 A;  2CSI A;  1NE8 A;  3CCM T;  3G6E A;  1VYU A;  2RO0 A;  1JBM A;  1PSE A;  2O31 A;  3QDR B;  4D8K A;  1KD1 R;  3M54 A;  4AFZ C;  3U23 A;  2HZY A;  1MGQ A;  1YIT Q;  3ZL7 C;  2OX7 A;  2WAC A;  4Y91 A;  3CC7 Q;  3JCM g;  3LGL A;  4QW2 A;  5GAM g;  2VYT A;  3FJ5 A;  1VQL T;  3M4G A;  2KRO A;  3MP1 A;  1RAB B;  2E10 A;  3TCJ A;  1MMN A;  4Z88 A;  1KQS A;  1QVF P;  2NUT A;  3CEY A;  2E41 A;  4JPB W;  1XNI A;  5FRN A;  1X6B A;  1YNZ A;  4GLM A;  1UGP B;  2QA4 A;  2DEU A;  3CPW S;  1KQ1 A;  5GAN d;  1IRX A;  4XU0 A;  4OB2 B;  1UGQ B;  4C8Q F;  2YUP A;  2DD5 A;  3QII A;  2LT4 A;  4M78 D;  1D3B A;  2B86 A;  4DBF A;  2KXD A;  3G4S T;  5CKB A;  2F1L A;  2QK0 A;  3DLM A;  1G3S A;  3CCV Q;  3VU3 C;  4A54 A;  3C0C A;  3OYI A;  3JCM X;  2M16 A;  4DQ2 A;  2K57 A;  4PL6 A;  5GAO l;  1M2V B;  2EW3 A;  4P5N A;  2G3R A;  5GJW B;  2A28 A;  2QXF A;  2RHZ A;  3OYJ A;  1R8O B;  3G7Z A;  3MP6 A;  1M9S A;  5DM7 R;  2MAM A;  1VYV A;  5KE2 A;  3CPW P;  5KYW B;  2EGE A;  4F17 A;  3OMC A;  4DBR A;  1QP3 A;  2EWN A;  2LC4 A;  3LX7 A;  3CBO A;  2QEX Q;  4AFU C;  2VWF A;  1BI2 A;  3X20 B;  4IUP A;  5ECA A;  3DB4 A;  3PT9 A;  2MK5 A;  4N0A C;  1B34 A;  1TSF A;  1PSF A;  2AT1 B;  4KRT A;  2D1X A;  3VS2 A;  3VUB A;  2EGA A;  5GAN 3;  1I1J A;  2F2W A;  4M77 B;  1V1C A;  1QP2 A;  4C8Q C;  1YWP A;  3MEV A;  4OGE A;  2NUP A;  4N4I A;  1I8F A;  4HA8 A;  2PU9 B;  2M0O A;  1WGS A;  1RAF B;  4FIB A;  4F7U E;  3LWH A;  2XKO C;  1G3W A;  2E3H A;  1Y96 A;  3N5B B;  4CC2 A;  1OX9 A;  1G8X A;  2SRC A;  1Z9Z A;  2V8K A;  2ZPH B;  5CK9 A;  4ANJ A;  3F70 A;  1G3Y A;  1AZE A;  1QVP A;  2DL4 A;  2O01 E;  3EG9 A;  5D6Y A;  1BCO A;  3QYH B;  1B3Q A;  2CRE A;  5KYU B;  1YJN Q;  3WVE B;  2K4Y A;  1O9S A;  3SHW A;  2C0O A;  1OX8 A;  1NYG A;  2KQW A;  1YWO A;  2DL7 A;  2E4H A;  4OMO A;  1I81 A;  4AMC A;  4AT1 B;  2J7I A;  2VVK A;  2OTJ T;  4MMK A;  1Q82 C;  2GNC A;  1AT1 B;  1HD3 A;  1IO6 A;  2XI9 A;  4Z02 A;  5J3B A;  4ZTF A;  4FL6 A;  2EYW A;  3GPL A;  1R0B G;  2EJ9 A;  3JAM E;  5GAN e;  5EG2 A;  2K7A A;  3BY7 A;  3OQ5 A;  1VQ8 A;  4FYV B;  1YCY A;  4C8Q A;  1E6G A;  4J6W A;  3UA7 A;  1SRM A;  4M78 G;  1TUC A;  1JEG A;  4HVU A;  3EGX B;  1TUD A;  1Q86 R;  4KH0 B;  1NPR A;  1MV3 A;  1WDX A;  1BIB A;  1JU5 C;  5DY9 A;  3M57 A;  4IKF A;  3LH0 A;  5LJ3 h;  3TU4 K;  4KBM B;  3R6O A;  1YI2 A;  5IHK A;  1K9M U;  2R57 A;  1N9S A;  1K76 A;  4M77 E;  4JRK A;  1VQO T;  3CCL A;  2LQW A;  2BZX A;  3HRU A;  3CCR A;  1D0X A;  1OV3 A;  1W4S A;  1EZZ B;  1XQH A;  4L59 A;  3OYF A;  3G71 A;  1M8V A;  2FRW A;  3LWI A;  1N8R U;  1SSH A;  2HMA A;  3CCS T;  4IUR A;  1QQJ A;  3MKD A;  1FXX A;  1VQ5 A;  4M78 E;  3RR6 A;  5GAO q;  3T9N A;  1KQS S;  1RI9 A;  2LNV A;  2CS7 A;  4OMN A;  4ZTJ A;  1VQM T;  4OB0 B;  3PVQ A;  3RKY A;  2QQS A;  5AT1 B;  4RUG A;  4E7K A;  4Q5W A;  1YJW T;  1ZUU A;  1YI2 Q;  3P8D A;  1MMG A;  1RAD B;  4QVD A;  1VQ7 A;  3UF4 A;  1FYN A;  2ATC B;  2E5K A;  1YJW A;  4BE0 A;  1Y7X A;  4AFS C;  4R55 A;  2ZCF B;  2J06 A;  1M2O A;  1SF9 A;  1NBE B;  3S3O A;  4A4G A;  4M77 G;  4LDU A;  5KE3 A;  2LZ6 B;  1WHL A;  3JB9 J;  5I21 A;  2DJQ A;  2F5K A;  3CC2 Q;  3HKS A;  2DZC A;  4QQD A;  3CCS A;  2CH4 A;  4AG1 C;  2HL3 A;  3CXC S;  2JNG A;  5LJ3 d;  3A98 A;  2ZPG B;  1ABO A;  4NOY A;  1ZSZ B;  1M27 C;  4O6J A;  3HRS A;  2OTL A;  3ULR B;  1OEB A;  2AHJ B;  1AVZ C;  3EAE A;  1G5V A;  3OBY A;  1GXI E;  5GAO n;  1MUZ A;  1KG1 A;  1D0Z A;  1ZUK A;  1GBR A;  2RJF A;  1UEC A;  1KSW A;  2X3X D;  1UGS B;  4M7A G;  2PQW A;  4LD6 A;  1VQ6 T;  2DPP B;  3CC7 A;  4JRQ A;  4J9E A;  3A8M B;  2E5Q A;  3OW2 P;  3PGG A;  3CXC P;  3DKM A;  1VQK A;  1K73 C;  1J3T A;  2LQ8 A;  1K0X A;  4R0K A;  3C12 A;  2DM1 A;  2XDB A;  1RAI B;  3M53 A;  2RQV A;  3SWN B;  2L3Q A;  3KXT A;  4BDY A;  1ZBX A;  5FW9 A;  2FL7 A;  4J8O A;  1NEB A;  4DBH A;  3I5R A;  4II1 A;  2EYX A;  4QQ6 A;  1IRE B;  4M75 G;  1IHV A;  4N0A A;  4NL3 A;  1WQW A;  3CD6 Q;  4M7D D;  2HKN A;  5GAO r;  4JJB A;  1KQ2 A;  1X75 C;  4V2S A;  3M4Y A;  3A8H B;  2YLC A;  3OW2 A;  3SB2 A;  3OW2 S;  2EVR A;  4EPC A;  3EFS A;  3OB9 A;  3G71 Q;  1NZ9 A;  1D3B B;  1OU9 A;  1QWF A;  2E6Z A;  3NPF A;  1C1A A;  2DYI A;  1IHW A;  2EAY A;  1RI0 A;  2NWM A;  4C0G A;  5IT9 E;  4PFZ A;  3RNJ A;  2MIO A;  3HFO A;  2AZS A;  1RAA B;  3CCL Q;  3E2U A;  5IAY A;  1WZO A;  1QVG S;  3GIB A;  4E2F B;  4ZGD B;  1YJ9 T;  4FSX A;  2WSC E;  1PKT A;  1D1A A;  2M02 A;  5DLQ E;  5KYW A;  4X9C A;  1KIK A;  1ABQ A;  4VUB A;  3SEM A;  2YLB A;  3M0Q A;  1PRM C;  4OB3 B;  2Y4X A;  3CQT A;  1B07 A;  2CUD A;  2P0P A;  1ZX6 A;  2K3X A;  2P0Q A;  4M7A F;  1YHQ A;  1HK9 A;  2DTI A;  1JJ2 S;  4PJO E;  4XU1 A;  3CMA T;  3EGD B;  5LJ3 e;  2ROT A;  4J9C A;  4BE2 A;  3G4S Q;  2JVV A;  3EGU A;  1RL2 A;  2L3P A;  2DBM A;  3QWX X;  2X4J A;  2O2O A;  5I22 A;  4M78 C;  4EIK A;  2F69 A;  4JZ3 A;  2L0A A;  5IHN A;  4OP0 A;  5CO7 A;  4M7A A;  1K4U S;  4CC7 A;  5GJV B;  2RI5 A;  5KYX A;  4C8Q D;  1GL5 A;  4RTU A;  5LJ3 g;  3CC2 A;  4KH1 B;  3UPU A;  1YN8 A;  1PHT A;  1MV0 B;  1QWE A;  1TG0 A;  2VGN A;  1WHG A;  3TRE A;  2XK0 A;  3OA6 A;  5L8R E;  1FWZ A;  2P84 A;  2RNA A;  2HD0 A;  4KUL A;  1JXO A;  1C6V X;  4DEX A;  3VYG A;  2M1H A;  4HKE A;  3GLX A;  2GGR A;  2DVE A;  1VQP A;  1TXQ A;  4IUT A;  1I4K 1;  2C06 A;  2QGG A;  3M9Q A;  2X4X A;  4K11 A;  2ZPE B;  2DET A;  2AKK A;  2IPO B;  5GAN 4;  1KHI A;  4LDY A;  3M58 A;  3MPU B;  1V29 B;  4M77 F;  2RI2 A;  4XQ3 A;  1VQ9 A;  1SHF A;  2EGC A;  4C5E A;  3UWN A;  2RQR A;  4M78 A;  1YHQ Q;  3JCM d;  5EC7 A;  1IGU A;  3CC4 Q;  4EMK B;  4FU6 A;  3RMQ A;  2M0Y A;  2KRN A;  4F04 B;  1X01 A;  1NLO C;  3EH2 A;  1WXT A;  5KCH A;  2KXC A;  1YFN A;  2EQI A;  2HSP A;  4HVV A;  5GAN f;  1AWJ A;  1E7O A;  2JJ9 A;  4IUV A;  2CZ0 B;  1M1K R;  2RJD A;  1SRL A;  4R56 A;  2DIL A;  1JRI A;  2D6F A;  3H41 A;  2A7Y A;  2QAS A;  1PKS A;  2EKH A;  2DL5 A;  4JRP A;  3JB9 I;  3EHQ A;  1SG5 A;  3PNW C;  2HBP A;  4MZM A;  2FB7 A;  4B6M A;  2COW A;  2EYY A;  2CSQ A;  2IG0 A;  2FG0 A;  3VRZ A;  4LDW A;  1MHN A;  1N5Z A;  3JRZ A;  4E7S A;  4J9G A;  4E7J A;  2QEX T;  2CH4 W;  5IN1 A;  4M77 C;  3I56 T;  2C0I A;  3URG A;  3E19 A;  4BD3 A;  1VQ7 T;  4ELZ C;  3RES A;  4EMK A;  2A36 A;  1VQ5 T;  3OS1 A;  3M0S A;  4RTX A;  3JCM V;  1KD1 C;  4J6Y A;  2LCC A;  3RMS A;  5FU6 B;  2QDL A;  1H64 1;  2J6O A;  2JM9 A;  2ZZD A;  3I9Q A;  1NLP C;  4WF2 A;  4J9I A;  4HCB A;  1VQM A;  1GCQ C;  1WHJ A;  2RHX A;  3OSS C;  2RQT A;  9ATC B;  2VB6 A;  1H8K A;  3S3N A;  1Q86 U;  3HPW A;  4LUD A;  3MCA B;  4BDZ A;  2PZ1 A;  2JTF A;  4RCB A;  4OML A;  1VQ4 A;  2QYZ A;  1UUE A;  2LRQ A;  2DXU A;  1AWO A;  4M7A C;  4EMG A;  4M7A E;  1RLP C;  1WXB A;  1ZSZ A;  2JOY A;  2CDT A;  2G6F X;  2QAZ A;  1VQN A;  1JXM A;  1YJN T;  2XU8 A;  3O5Z A;  1KD1 U;  4FT2 A;  4YTL A;  4M75 D;  4PJL A;  5GAN 8;  1YI2 T;  4A63 B;  4WCI A;  2CUB A;  3GF5 A;  1BB9 A;  3V8K A;  2OTL Q;  2KYB A;  1DJ7 B;  4M7D C;  2K5L A;  4DOV A;  2D0Q B;  4BUG A;  4M77 A;  4M4Z A;  1ZA1 B;  2ZPI B;  4XTZ A;  4M78 F;  1WIE A;  2RF0 A;  5GAN 7;  1M8M A;  1S72 Q;  2JS0 A;  2XDD A;  3CME Q;  1M1K C;  4JZ4 A;  1WA7 A;  2J6F A;  3LLR A;  4M75 A;  5A0G A;  5LJ5 g;  2DZ9 A;  2DL3 A;  3A8L B;  5A2Q E;  1NJI C;  2QQ9 A;  2GTO A;  2COY A;  3L2Q A;  3JCM f;  2D8H A;  2W10 A;  2EQM A;  5HY6 A;  3EG9 B;  2L3R A;  5CKD A;  1UG1 A;  1WFW A;  4EMH A;  2KMT A;  2DMO A;  1VQ8 T;  2KE9 A;  2Z0W A;  3RBB B;  1UE9 A;  3D7S B;  5D6W A;  4PFP A;  2MOX A;  1GFC A;  1S72 A;  1WI7 A;  4C92 A;  1MND A;  2HKQ B;  1KK7 A;  4PJO G;  2CP6 A;  1IB8 A;  3JCM b;  3HRT A;  3WVD B;  2DBK A;  5I2M A;  1U1T A;  4B9X A;  3OYH A;  2EQU A;  2DEQ A;  2PUO B;  4WTO B;  1W2B P;  3NFC A;  1UTI A;  3QYG B;  3M0T A;  1HSQ A;  4C92 F;  1WYX A;  5C0M A;  4B9W A;  5CR2 A;  3HTR A;  1ZBJ A;  3C94 A;  4ELY C;  2M9U A;  4M75 C;  2P4T A;  2LTO A;  4OMQ A;  2MI6 A;  1YJW Q;  1Q81 R;  3L2W A;  1FMV A;  3DB3 A;  1OUL A;  2DLP A;  4E7Z A;  2FPD A;  3KBG A;  1NM7 A;  2AIR B;  3JCM P;  1GFD A;  1KC8 U;  1QLY A;  3L1A A;  3LYI A;  3SFM A;  1VIE A;  3CMA A;  2RM4 A;  3CCV A;  3NHN A;  4OMF B;  1QVF A;  1H92 A;  4RTZ A;  5LJ5 f;  2CP0 A;  5IH2 A;  2LVM A;  1Q86 C;  3G6E T;  2HQH A;  5GMK l;  2CZ6 B;  3JCM e;  5LL6 S;  1C0M A;  4NL2 A;  3M59 A;  1QVG P;  2RQW A;  2YSQ A;  4E47 A;  8AT1 B;  5FWB A;  4M7D G;  3JV3 A;  4XK8 E;  3QZ9 B;  4Y92 A;  2A0F B;  2LJ3 A;  2W0Z A;  1PG5 B;  4C92 C;  5CKH A;  2BE9 B;  3PMT A;  2KK4 A;  2ESW A;  3QBY A;  5IXB A;  3P8H A;  2RD1 A;  4LN2 A;  2HL5 C;  3NGP A;  4M75 F;  3JB9 D;  4PJM A;  3EFR A;  4RG8 A;  1ZA2 B;  2GCX A;  2GQV A;  3X28 B;  1T3S A;  5CKF A;  5GAO p;  3H0I A;  2DKG A;  3IQL A;  3MET A;  1BKB A;  1U1S A;  3OMG A;  2K6D A;  1OI1 A;  4BE1 A;  1ARK A;  1WJS A;  3SWN A;  3M0P A;  2QQA A;  1V76 A;  4PK4 A;  4RKU E;  2KAF A;  5KYU A;  4BAC A;  3QJY A;  4LUE A;  2R5M A;  4LD9 K;  1M5Q 1;  3INZ A;  1CKA A;  4PJO C;  1X2K A;  3V8L A;  2NYS A;  2XD0 A;  2RI3 A;  2EYQ A;  2KI7 A;  1K0S A;  2DA9 A;  1VQN Q;  2EJF A;  4XTU A;  1OU8 A;  2X35 A;  1M3A A;  2BZY A;  2KT8 A;  2LCL A;  4KGV B;  3X26 B;  3V8J A;  4QVC A;  3SD4 A;  4PKC C;  2KEA A;  5HK0 A;  1MNE A;  5AYF A;  2HQX A;  1N8R R;  1UFF A;  5A0D A;  2WSF E;  2QEX A;  2OI3 A;  3V7C A;  4OF1 A;  1VUB A;  3HL8 A;  3OY9 A;  1X6O A;  3EFO A;  4C0D B;  5CVI A;  1N8R C;  1M2V A;  4A4F A;  1TOV A;  5GAN g;  2SEM A;  2XID A;  1VQ4 T;  1YBY A;  2K2V A;  3E9G A;  4JS5 A;  4QKU A;  2A37 A;  4C8Q G;  3VRY A;  1Y71 A;  3DLL A;  2LP5 A;  2RPN A;  3A8O B;  1VQN T;  1ACM B;  3OYD A;  3CPF A;  1JJ2 P;  2ROL A;  5KH6 A;  4RTW A;  1Q95 G;  5CQX A;  1TTH B;  1BBZ A;  4C5G A;  3A1P A;  3VKI A;  1LOJ A;  2JTE A;  2K79 A;  1N6A A;  1WX6 A;  2LQN A;  3CCE Q;  3GNF B;  3EGD A;  3QHS A;  3CXC A;  1QKX A;  3CC4 T;  5FU6 C;  1Y07 A;  4KUD K;  1YCS B;  2ABL A;  3X25 B;  2QTX A;  3TVT A;  2LJ0 A;  2K5I A;  4KGX B;  2DAQ A;  4TVR A;  1VQ9 T;  3J81 E;  1HXD A;  2E65 A;  1AD5 A;  4XTY A;  3KFV A;  4MZT A;  2J05 A;  2DER A;  3EG1 A;  4JLG A;  3THK A;  2QQB A;  4XU2 A;  2EIF A;  3CC7 T;  2E1H A;  4PJN A;  3PTA A;  1Q82 U;  1VQP T;  1KHC A;  4IUQ A;  1QVF S;  3EG0 A;  2JZ2 A;  1H3H A;  2LMJ A;  4J5Y A;  1EIF A;  3A5Z B;  4GBQ A;  2GBQ A;  2HCK A;  5L23 A;  2DTO A;  1D0Y A;  1X69 A;  1BK2 A;  2DRK A;  3GNG A;  3M0U A;  1Y57 A;  1K9M C;  1ZHI A;  3OYY A;  2XHC A;  1RAE B;  2QGF B;  2E70 A;  3CBM A;  1VQ9 Q;  3QUI A;  3OBW A;  1XTD A;  3H9N A;  3OYM A;  2X3W D;  4GY5 A;  2O88 A;  3NMZ C;  1UJ0 A;  4PLL A;  2NUZ A;  5J26 A;  4BB7 A;  2KRS A;  1K73 U;  1E6H A;  1VQP Q;  1TU0 B;  2X4Y A;  3GP8 A;  3NTI A;  4XTX A;  1IZ6 A;  3Q1J A;  2ZPB B;  4C0Z A;  2XDP A;  1LVK A;  2FZC B;  4FYW B;  1TH7 A;  4ZN3 A;  2V8I A;  4ATO A;  1W1F A;  4KGZ B;  1YHQ T;  1T0H A;  3L2Z A;  3JCM h;  4E7I A;  3MHX A;  5GAM d;  2CZ7 B;  4ZNX A;  5GMK i;  3J7A F;  2F2X A;  4LE9 A;  2EFI A;  2L89 A;  3I5S A;  2ED1 A;  3QKJ A;  1OYX A;  2J6K A;  8ATC B;  3TQ7 P;  1Q7Y R;  7AT1 B;  2EBP A;  3ZFJ A;  1IGQ A;  1QW1 A;  2L3S A;  2DXC A;  2BTT A;  4JRI A;  1BCM A;  2VC8 A;  4JJC A;  4BY6 B;  4DBQ A;  3MEA A;  3CCJ A;  4C5I A;  4HVW A;  2DD4 A;  4ME7 A;  1W6X A;  2PNI A;  2CKK A;  3JCM c;  2BKD N;  4X34 A;  3PFS A;  6AT1 B;  2VGM A;  1M1G A;  4KT0 E;  3PE0 A;  2LX7 A;  2X9H A;  2KVQ G;  3OYE A;  1D1B A;  4HT9 A;  3OYB A;  3CCS Q;  2LNH B;  4ZGJ B;  2JM8 A;  4M77 D;  3I56 Q;  2Y90 A;  2QQR A;  2YWW A;  1VQ7 Q;  2K5F A;  2V1Q A;  3A8G B;  1NG2 A;  4CC3 A;  5GAN 6;  2CYZ B;  2D0N A;  2DF6 A;  2ZAE A;  1WHM A;  3RDV A;  1OPL A;  3ASK A;  1VQL A;  5FRO A;  2YRV A;  3HHT B;  1VQK T;  4BI8 B;  1CKB A;  2NUT B;  1N9R A;  1JQQ A;  4F7U B;  1BIA A;  3VS0 A;  1VQ6 A;  5J39 A;  3CBP A;  2AK5 A;  3L2R A;  4J6X A;  4IUU A;  1BU1 A;  3OS2 A;  3VS1 A;  1K1Z A;  5GAO m;  2RK2 A;  2QA4 T;  4FSS A;  4HCK A;  2LX9 A;  1YJN A;  2DL8 A;  2GF7 A;  4RTT A;  1D1C A;  3VV0 A;  2JN0 A;  1A0N B;  4FYY B;  2BIV A;  2CT4 A;  1X6G A;  5CAI A;  4DA4 A;  2EJG A;  1K8A R;  2JS2 A;  3CME T;  1D09 B;  5CKE A;  2YRD A;  3JB9 F;  2ZGW A;  4F14 A;  1KC8 R;  4LXC A;  3ZBD A;  5LJ5 e;  3LH5 A;  1K73 R;  1K8A U;  1I5L A;  2JXB A;  5KCO A;  3C4S A;  3CPW A;  4F7U A;  4LDV A;  4DEY A;  2HAX A;  3ER0 A;  1FX7 A;  2QA4 Q;  1VQ8 Q;  1WJQ A;  1W2B S;  2DE0 X;  4L6V 5;  3GOX A;  2CP3 A;  1B34 B;  1AOJ A;  1SHG A;  2GFU A;  3WXM B;  2ENM A;  5IXF A;  3C95 A;  4PJJ A;  1Q7Y C;  4C5H A;  2IIM A;  1JO8 A;  4JS4 A;  1M90 C;  3MP8 A;  3CD6 T;  2NUP B;  4FYX B;  1Z9Q A;  4XAX B;  5HKC A;  3UA6 A;  3AHU A;  5GAN 5;  4EMK C;  1X27 A;  3FRN A;  2MF2 A;  4RTY A;  2FHD A;  4JJN K;  2X4W A;  4M75 B;  3RKW A;  1Y0M A;  3H6Z A;  4XTW A;  2KRM A;  3S6W A;  2RHY A;  1VA7 A;  2OAU A;  2Y4Y A;  3CCR T;  3V7R A;  3CCM A;  1B7T A;  5D6X A;  2R58 A; 
#chains in the Genus database with same CATH homology
 4Z8A A;  2DM1 A;  2RQW A;  2YSQ A;  4LNP A;  3R6N A;  2RQV A;  5FWB A;  2L3Q A;  3JV3 A;  2GTJ A;  4AG2 C;  1M3B A;  4Y92 A;  5FW9 A;  3EG3 A;  2LJ3 A;  2W0Z A;  1NEB A;  1X43 A;  3I5R A;  2ESW A;  5IXB A;  2EYX A;  4LN2 A;  2DRM A;  2YUO A;  3NGP A;  2AKL A;  4IIO A;  3I35 A;  1X2Q A;  3EG2 A;  1AZG B;  3H0H A;  2DYB A;  4JJB A;  1T3S A;  2C0T A;  3H0I A;  3IQL A;  1YP5 A;  1LCK A;  2K6D A;  3VS7 A;  2RQU A;  1KFZ A;  1ARK A;  2EVR A;  2EYZ A;  1UHF A;  1T3L A;  3H0F A;  3M0P A;  1W70 A;  4J9D A;  2KGT A;  4D8D A;  1QWF A;  3NPF A;  4LUE A;  2LCS A;  1NYF A;  5FWC A;  2KNB B;  2NWM A;  2YT6 A;  1CKA A;  2YDL A;  1X2K A;  3RNJ A;  2MIO A;  2AZS A;  2YUN A;  1QKW A;  3EHR A;  1K0S A;  2DA9 A;  1GCQ A;  1M3A A;  2BZY A;  2KT8 A;  2JMA A;  2OAW A;  2O9V A;  4X1V A;  1PKT A;  4CC4 B;  2KYM A;  2XMF A;  2KEA A;  4AFQ C;  3TSW A;  1KIK A;  1ABQ A;  2CSI A;  3SEM A;  1ZUY A;  1UFF A;  1QCF A;  3M0Q A;  1PRM C;  2OI3 A;  3CQT A;  1VYU A;  1B07 A;  2CUD A;  2O31 A;  1ZX6 A;  4Z89 A;  2JW4 A;  4D8K A;  2FPE A;  1EFN A;  4OMP A;  4QT7 A;  4JJD A;  1GRI A;  4AFZ C;  3U23 A;  2ROT A;  2SEM A;  4J9C A;  3VS6 A;  3EGU A;  3ZL7 C;  2A37 A;  2L3P A;  1OOT A;  2DBM A;  3VRY A;  3QWX X;  2D8J A;  1UJY A;  2LP5 A;  2RPN A;  2O2O A;  3FJ5 A;  2RMO A;  5I22 A;  2KRO A;  1WLP B;  4EIK A;  4Z88 A;  2ROL A;  4JZ3 A;  4RTW A;  2L0A A;  5IHN A;  1BBZ A;  1K4U S;  4JPB W;  4CC7 A;  5GJV B;  1X6B A;  1YNZ A;  2JTE A;  2K79 A;  4GLM A;  1WX6 A;  2LQN A;  1GL5 A;  4RTU A;  2ECZ A;  1ZSG A;  1YN8 A;  3REA B;  1PHT A;  1QKX A;  1MV0 B;  1QWE A;  1TG0 A;  1WXU A;  1YCS B;  2ABL A;  3TVT A;  2LJ0 A;  2RNA A;  2YUP A;  1JXO A;  1M30 A;  1AD5 A;  4DEX A;  2B86 A;  3KFV A;  3UAT A;  2KXD A;  2J05 A;  4OMM A;  2VKN A;  3EG1 A;  3QWY A;  3THK A;  2GGR A;  2M51 A;  1CSK A;  2BZ8 A;  3C0C A;  3GBQ A;  1SEM A;  2LJ1 A;  2EW3 A;  3EG0 A;  4K11 A;  1H3H A;  2LMJ A;  5GJW B;  2AKK A;  2A28 A;  1UGV A;  1I0C A;  2GBQ A;  2HCK A;  2V1R A;  4GBQ A;  5I11 A;  5L23 A;  3REB B;  1SHF A;  2EGC A;  1VYV A;  2RQR A;  1X69 A;  1BK2 A;  2EGE A;  2DRK A;  5EC7 A;  4F17 A;  3M0U A;  1Y57 A;  2M0Y A;  1PNJ A;  1SPK A;  2KRN A;  2P4R A;  4AFU C;  2A08 A;  1NLO C;  1WXT A;  2VWF A;  2KXC A;  2EQI A;  2HSP A;  4HVV A;  5ECA A;  1AWJ A;  1E7O A;  1FMK A;  1UDL A;  2X3W D;  2O88 A;  3NMZ C;  1SRL A;  1UJ0 A;  2NUZ A;  2DIL A;  4KRT A;  3VS5 A;  2KRS A;  2D1X A;  1NEG A;  3VS2 A;  3H41 A;  2EGA A;  1E6H A;  1I1J A;  2F2W A;  1PKS A;  1V1C A;  2EKH A;  1YWP A;  2DL5 A;  1M3C A;  3EHQ A;  1GBQ A;  2CT3 A;  2KT1 A;  2KR3 A;  3PVL A;  2KBT A;  2EYY A;  4J9B A;  4CC2 A;  2SRC A;  1W1F A;  2FRY A;  1Z9Z A;  2CSQ A;  1T0H A;  2MCN A;  2FG0 A;  3VRZ A;  1N5Z A;  1AZE A;  4J9G A;  4ZNX A;  2DL4 A;  2F2X A;  4LE9 A;  2H8H A;  3I5S A;  1AWX A;  2ED1 A;  2CH4 W;  2J6K A;  2OJ2 A;  2HEQ A;  1B3Q A;  4E6R A;  2EBP A;  2C0I A;  2CRE A;  5HCK A;  2A36 A;  2L3S A;  3SHW A;  2C0O A;  2BTT A;  3M0S A;  1NYG A;  4JJC A;  1YWO A;  2DL7 A;  2GQI A;  4RTX A;  4HVW A;  4OMO A;  2QDL A;  1W6X A;  2PNI A;  2L2P A;  1GCP A;  2J7I A;  2J6O A;  2JM9 A;  2VVK A;  3I9Q A;  1NLP C;  4J9I A;  2GNC A;  1HD3 A;  1IO6 A;  1U06 A;  1GCQ C;  2EYW A;  2RQT A;  3PE0 A;  2K7A A;  2LX7 A;  1I07 A;  2I0N A;  1H8K A;  4J9F A;  1E6G A;  3TSZ A;  4LUD A;  3UA7 A;  1SRM A;  2PZ1 A;  1TUC A;  2LNH B;  4OML A;  1JEG A;  1UUE A;  4HVU A;  2JM8 A;  1TUD A;  1AWO A;  4HXJ A;  2YUQ A;  1RLP C;  1WXB A;  4F16 A;  1MV3 A;  2G6F X;  2CDT A;  2V1Q A;  1NG2 A;  1WDX A;  1JU5 C;  1JXM A;  3O5Z A;  4CC3 A;  2D0N A;  2DF6 A;  4A63 B;  4WCI A;  2CUB A;  2HDA A;  1BB9 A;  5IHK A;  2KYB A;  1K76 A;  1G83 A;  1OPL A;  2DNU A;  4M4Z A;  2HBW A;  2LQW A;  1K9A A;  2BZX A;  1WIE A;  2RF0 A;  1PRL C;  1M8M A;  3M0R A;  1OV3 A;  1CKB A;  2JS0 A;  4JZ4 A;  1JQQ A;  1WA7 A;  2J6F A;  3VS0 A;  2DX1 A;  1AEY A;  2RN8 A;  1T0J A;  2FRW A;  1SSH A;  2DL3 A;  2GTO A;  2AZV A;  1RI9 A;  1S1N A;  2AK5 A;  2D8H A;  4OMN A;  2W10 A;  3PVQ A;  1U5S A;  1BU1 A;  2F2V A;  3VS1 A;  1K1Z A;  1UG1 A;  1WFW A;  4RUG A;  2DMO A;  4FSS A;  2KE9 A;  4HCK A;  1AWW A;  2DL8 A;  2JMC A;  3RBB B;  1UE9 A;  1ZUU A;  4RTT A;  2O9S A;  1RUW A;  2MOX A;  1KJW A;  1GFC A;  1A0N B;  1WI7 A;  2JT4 A;  1PWT A;  2CT4 A;  1X6G A;  1ZLM A;  4J9H A;  3UF4 A;  1FYN A;  1U3O A;  2DVJ A;  2E5K A;  1UHC A;  2JS2 A;  2DBK A;  4AFS C;  3VS4 A;  2J06 A;  1XOV A;  2FEI A;  2LZ6 B;  1G2B A;  3VS3 A;  4F14 A;  2K2M A;  1UTI A;  2DJQ A;  1VYT A;  3LH5 A;  2K9G A;  3M0T A;  1HSQ A;  4RTV A;  1WYX A;  2JXB A;  2CH4 A;  4AG1 C;  1ZBJ A;  4DEY A;  3A98 A;  1ABO A;  1M27 C;  2DE0 X;  4OMQ A;  1AOJ A;  1SHG A;  2DLP A;  2FPD A;  2ENM A;  1NM7 A;  3ULR B;  1OEB A;  4ORZ A;  1AVZ C;  5IXF A;  1GFD A;  2IIM A;  4ESR A;  1JO8 A;  1MUZ A;  2ED0 A;  1QLY A;  2K3B A;  1Z9Q A;  1ZUK A;  1GBR A;  1UEC A;  1KSW A;  2X3X D;  4IIM A;  5IHI A;  3UA6 A;  3NHN A;  1H92 A;  1X27 A;  2EPD A;  4RTY A;  4RTZ A;  2FO0 A;  5IH2 A;  1OPK A;  4J9E A;  2PTK A;  1Y0M A;  1RLQ C;  2KRM A;  1VA7 A;  2FPF A;  1HJD A;  1J3T A;  1K0X A;  4R0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...