1TUPA

Tumor suppressor p53 complexed with dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
196
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*TP*TP*CP*CP*TP*AP*GP*AP*CP*TP*TP*GP*CP*CP*CP*A
publication title Crystal structure of a p53 tumor suppressor-DNA complex: understanding tumorigenic mutations.
pubmed rcsb
source organism Homo sapiens
molecule tags Antitumor protein/dna
total genus 42
structure length 196
sequence length 196
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1995-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1tupA00
2J21A 3VD0A 2ATAA 4AGQA 1CO1A 3WTTA 3Q06A 3D05A 1HJBC 1E50A 3KZ8A 5G4OA 4LOFA 4L0YA 4GUOA 5AOIA 4IBQA 4IBZA 4IBTA 3WU1A 2J1YA 2BINA 3Q01A 2RMNA 3VD1A 2AHIA 2ADYA 5AOMA 1GZHC 3D0AA 4LOEA 2MEJB 3WTWA 2J1ZA 3US1A 2J20A 2VUKA 1HU8A 5ECGA 3D09A 3QYNA 1EANA 2FEJA 2YBGA 5AOLA 2IOOA 2H1LM 2X0UA 3IGLA 3D08A 4IBWA 4IBVA 4IJTA 2BIOA 1CMOA 4AGLA 4G82A 5AOKA 5ABAA 4MZIA 1GZHA 3EXJA 4IBSA 1UOLA 3EXLA 4MZRA 1IO4C 1TSRA 3WTSA 4G83A 5LGYA 3QYMA 4GUQA 3VD2A 3D06A 2GEQA 3D07A 4L0ZA 2BIQA 2J1WA 1EAQA 4AGMA 2P52A 4IBYA 2IOMA 5AOJA 1HJCA 2AC0A 1EAOA 1YCSA 4L18A 3WTUA 2BIPA 4KVPA 2J1XA 4QO1B 4XR8C 5A7BA 3Q05A 3TS8A 2XWCA 3US0A 4LO9A 5KBDA 3IGKA 2OCJA 3WTYA 2X0WA 3KMDA 2IOIA 2X0VA 2PCXA 2BIMA 3WTVA 5AB9A 4AGOA 4IBUA 2J6WA 1TUPA 5G4NA 2XWRA 4HJEA 1KZYA 5LAPA 5BUAA 5G4MA 3WTXA 4AGNA 4A63A 2WGXA 1LJMA 1H9DA 4AGPA 1T4WA 3ZMEA
chains in the Genus database with same CATH superfamily
2J12B 5J11C 3NIGE 1C7TA 4OAWB 4XHJC 2DLFH 1JG9A 2VJ8A 5MEPA 2DWYA 5EWIH 5MEQB 2IBBA 4JRXD 3BH9B 4L23A 2BY1A 3RDTA 4PBXA 4ILDA 1JGVH 1MCEA 4G8FB 3UJTL 2JJSA 3GEWB 3N42B 5I71B 3TCTA 2A1WH 1A6VL 2RMNA 5IJVA 2FQEA 3SE4A 3MV7A 3AB0C 1GZQA 3GB7B 3B5HA 4FFZH 3DX2A 2NSMA 4F37F 4PWGA 2O93L 3MFFB 1MNUL 1A7NL 1OF2A 3ILPA 5M94B 4PEEA 4PJBE 3FUNA 3O4LB 4XPFH 3PGCA 5FEBA 5DJ8A 3FQTB 4I3RL 4TLKA 4PRPB 3T6QC 5LAXB 1SY6H 4J23A 4WFEE 5C71A 3RY4A 5GGRB 1ZLWH 4UTAH 3DIVA 2WQRA 3D39E 3H54A 2MCAA 1A7OH 2P5WB 4I18C 5DJXA 2ZX9A 5D2NE 2D0FA 4J2QA 4YBLB 1CGYA 1JPST 5A2AA 3STLA 3BRDA 4OV5A 1F2QA 1ZHBA 5ABAA 3N40F 1CLZH 4PV1C 4C57C 5BRPA 1MCQA 4B7LA 1AY1H 4EI5D 2CKBB 4UUJA 4PG2A 4B60A 2X6AA 3DO7B 4X6DA 4AOFA 4WWPA 4U1KA 1A0QL 2BOBA 5KVGL 4RBPH 2BNQB 3N41F 3X1BA 3EH1A 1F86A 1S9YB 3GKWH 3GMLA 3QZBA 3EJPA 1TNMA 3IN2A 2YSSB 2Z8SA 4FXTA 4FHJA 5MI0B 3X1FA 4AE1A 3MCYA 3HFMH 3QWRD 2JQAA 4GT0A 4OGXH 1UA3A 2ZCLH 3KPLA 1MJ8H 4MDJB 5CS7A 4TVUA 4LDOB 2GKIA 2J5LB 4KKCD 1CYXA 2A3TA 1UJ3A 1XXFC 1D3CA 2XQYK 1IEBB 3EBHA 5I73B 1OQOA 1TJMA 5CCHE 1CZ8H 3V52L 2WZ5A 4DKDC 4OF0A 3L4UA 1KYOJ 3ARBD 2YXFA 3FZUD 3RNKB 1WFNA 2LHAA 2NY3C 3UG4A 3VXTA 1IM3B 4DP8X 5JZ7C 4IRJD 4UZSA 3EOBB 5D1QA 4HPYH 4P2CG 1DLFL 1NBYB 5FC9A 4JG1L 3RDTD 2HWZH 3FU3A 1H8SA 3VJ6A 1Y6NR 2NX5B 2CDGB 3RL2B 1J8HD 4JQIA 1OKEA 2C9VA 3OR7A 3WN5A 3QULB 5ETUA 5GRZA 2Z7ZA 2VDMH 3QUKA 1XWVA 4O02H 1JPGB 4WV1B 1UT1A 5JHBA 5B1KA 1NPUA 4N0YH 4U1SB 1BM7A 3VG0L 2WBJB 4BKLA 5L6YL 3RZCB 2O4EA 1DDHB 4OJEH 1U95A 4PJHF 3QJSB 2W92A 3CHQA 3ZRSA 1AG0A 1DO5A 1KXQE 1MRDL 2IH3A 3EYUL 4HQQH 1YMHA 1ZVSB 2ZWZA 2IANE 2O6EA 1R19A 4LQFH 4NQXA 4UDUB 3U6XA 3D0AA 1SYSB 1P4BL 3IWUA 4QO1A 3TONA 2XN9E 3L1OL 1UACH 4RWYL 4NM4L 3IETB 3VNZA 1N6QH 2R1WA 3U9PL 5L8LB 2PCFA 4AYMC 1KLGB 1UVQA 3NVQA 4DOHE 5FR3A 3OGCB 5FYKL 1HL8A 1MFBH 1RD6A 4HU2A 4O2FB 1SJHA 4F9LC 4D0DB 4XN5A 1GR7A 1A22B 3NAAL 2K45A 2XRAL 3EDJA 2A4EA 2OXGB 4MQXC 1PZAA 2HAZA 3PHAA 3ARFB 3L3GA 3KR3H 3QPKA 5KYUB 2HN7B 4OFIA 1HDMA 5IQ9B 4WJG3 1JGUL 3D2UD 4JZNA 4RMUA 5AYTA 2XZCH 5AENA 1GZHA 4GKZB 3ZKMD 3PDOA 5J1AA 1RVFH 1I1YB 4Z7VE 3PGDA 1AO7B 4J1UB 3E38A 1J18A 1AZNA 2XFXB 1UQSA 3CLFL 1N4XH 3FUKA 1P5VB 1E27A 1SPDA 2P7TA 1JZEA 3TO4A 2BSSB 3TH3T 1CICC 3ZY7A 4K9EC 2VDPH 1A9BA 4KY1L 4Q52A 3KJ4B 4BXVA 1HS6A 3BCFA 3BDYL 3LKPA 4UQ3A 5J3HC 4BCZA 4R7VA 4LDEB 1HI6B 2HTKD 2ROYA 4I5BA 1RJZA 2QHRH 2ATKA 2GY5A 1CD9B 3PP3H 3GWJA 4CSSA 1T7ZA 2BCKA 3RUGA 5FWQA 5C0AD 1A9EA 1OGAA 3TIDA 1JK9B 5BO0D 4A2HA 5GGVH 2NY6C 2ED7A 3HE6A 4EAEA 1FAKT 5JLZB 1KN2H 1OVZA 1UWEL 2MJWA 1Q9KA 3ESNA 3NGBC 5G4NA 1QI3A 1Z9SB 3OPZL 3ZL2A 3ZUNC 5FB8A 5JW3H 2YOAA 1D5MA 1GVIA 2VUOA 4GUPA 3HRPA 1G7PB 3CFJB 3GRBA 4JHAH 1BD2E 1K4CB 3ARGA 4PREB 4Q4IA 4AMKH 3LZPA 4JBSA 2XI9A 1AI1L 4AGQA 5JXAL 5C0RH 1HILB 1KN4L 2VRKA 4P2RA 4ALAC 2KERA 2WXPA 4W9KC 3VH8B 3FK3A 2ADFH 5CINL 4B3VA 2BXZA 4V1DE 2L7JA 4OF3A 5C07B 3U36A 3KWTA 2IV8A 4Y1TA 4GG6A 1QSZA 3DSNB 4N0CD 5AB1A 2WXRA 4C59B 3ZL4L 3RILA 4ZFGH 4ANVA 3FRUA 4RA3A 1ZT4B 1NUGA 2YGNA 3NZSA 4I2XE 4G9DB 1DQMH 4HX1A 1RZ7L 2J20A 5I18H 3ZO0A 5J13C 1UM4H 1A6TB 1IJNA 3D09A 1NBZB 3IDGB 1P4IH 5DD0H 1CD0A 5HVWA 5EF2A 3FS9A 2CM6A 2RA1A 4ZYKA 4NNPH 2Y36L 5HHOA 5E00A 3KEDA 4GSQA 3TO4D 1AYRA 35C8L 2XZQH 1U42A 5FCUL 1J10A 1NUNB 4A66A 4F8QA 2WTRA 4YS4A 4MZ2A 3KG5A 4KXCA 4PJ7E 3CLEL 7TAAA 1ROWA 1TJGL 3WIHA 4HAKA 3WFDL 3C5XA 4GW5A 3FUJA 5H37H 1AZVA 2EEAA 4R0LA 4X9GA 3UTQA 1P2CA 1SGKA 3ZHDA 1NFIB 3R4RA 1NDMA 1IBGL 4LLWB 3TT1H 1UWYA 3SCMC 5I0ZA 4M7LH 2YA0A 12E8L 1OAJA 1RMFH 3NABL 5C0EA 2YFNA 1UZ8B 4NKOA 2IXQB 2VN7A 3DOHA 3KPSE 3FTUA 5E9DB 1BMWA 1SRDA 3HE6D 2XPZA 1GCYA 4GXUN 2C1OA 3TBTA 4XAWH 1H15A 2BX5A 4KBPA 3QCVH 4FFVD 2ZQKA 2PPEA 4A2FA 4BQBA 1HOCA 3VSUA 1S7QB 5D7KD 3TBVB 5GGVY 1ZEAL 4XXCA 4ZUVB 2WM0A 1EBPA 2PTUA 5EU5A 1O6TA 1NM9A 5EU4A 1J1OH 2GK0A 4AVKA 3TEZA 2QQLH 1AHWB 3AG4B 4PM1A 3C87A 3QUYB 1I8LA 3FSAA 5CIPH 5B38B 3QXVA 5CGYD 5C08A 4KTEL 4L3CB 3KPTA 3FT3A 5IQOA 4MDIB 3VWKC 1EFXB 1HAUA 4K5NA 1KXHA 3ARDC 1NAML 4PAZA 1CLOL 2D7TH 3HE7B 3K1KC 3CV5A 1OPGL 5K9QI 2VOTA 3RHWK 3T0WA 1BG9A 1L9QA 4AJYV 4HF5L 1OTUC 2N1KA 1I9RL 4Y16A 1JV5A 3MR9B 4NAJA 4W9DC 2O72A 1R33A 5LDSA 3OWRA 3BO8B 4C56E 5DJYB 4K4KA 3V5KA 4Z7NB 1JCKA 5MENE 1FHGA 4PRIA 3RAJL 1QW9A 4O2CB 3U7WH 4F3FB 5IJBC 1CL7L 3EHBC 4MCYA 2EYSB 2ICEC 3F01A 5DHVH 2W94A 1P6WA 1X5GA 3GSXB 3PGFH 3QXDB 3EH3B 3BPCA 5KZCD 1R5VB 1XB6A 3LKOB 4HJSA 4WFHE 1XH0A 2QELA 4FP8H 2P28B 4NQSB 2RH0A 5HHVH 5IESH 5CP3H 2BOCA 1GAFH 1SDAB 4PJ9B 1N8OE 3VMNA 4NZ8A 4B0MB 5KVEH 1KYFA 2VJXA 2H32H 2BSEA 3E3QC 4CN1A 2OTPA 1BCIA 5G5DA 3KWWA 3ZTNL 3GI9L 1KC5H 2PP9A 4UQCA 2VISB 5JHLH 1MELA 4UINL 2E59A 4XNXH 5I0VA 1SMAA 3WEAA 4MA3A 2G2RB 3R8BB 2VUYA 5ENWA 3O3EB 5ID1B 2XG5A 3WTSA 1JHTB 3QB7C 3FHEA 4GS7C 1P0SE 4ATTA 5I6NA 5SWSD 2DQTL 2X4OA 3BKCH 4FQPA 5AW0B 4XNYH 3VFVB 4M6ML 1FA4A 3RPIB 1DQLL 1E9QA 2NY4D 3T3ME 4W6XB 2FD6H 2Q6WB 4J6IA 1MWAL 5F1SA 1SEBA 1ROCA 1EAPB 3OWEA 3WL9B 2IADA 5TDPB 4JM2B 3CZNA 4R7XA 4TUKH 3VCLB 2YEZA 4JY4A 4XH2B 3MRFB 1YN7A 2NNXA 4YIQB 2ZOTA 4Y5VB 4NQTA 4NQCA 4EDWH 4JN1L 2EXYC 5JIMA 4K3EL 3H56A 3H9ZA 2BVPA 3TT3L 2V0AA 3DIDA 4PSRA 2ZUXA 2R4SL 1JZ5A 2YD2A 3H3PH 1B0RA 3D0LA 4UTBL 1UH4A 2WC7A 1S9VA 4BQ6A 2IV9A 1JSYA 1YUHB 1F13A 4GAGL 2R4RH 2C3VA 4LNRA 3DYPA 4GQPH 2GW5A 3IAPA 1E5CA 1XH3B 2DKSA 1HVXA 5E5MB 2XZAL 4G9FA 2NYKA 2OYMA 4KHTL 1J9QA 1CFVL 1U8JA 5D8JH 1HINL 2IDCA 2WXKA 5CUSL 5H4YA 5HHNA 3TZVB 3R1GL 3DRTA 3FQ4A 3GNMH 3ZE1B 1KLUA 1RU9H 2A74B 3L5XL 4OZIA 2F53D 1HN1A 1ZT7B 3VFMA 5DC4B 2B1OA 4OU3A 1BQLL 3VWJB 4W9LC 3H1ZA 3BD3A 1T83A 5JO5B 2X3AA 4Q9RH 4OCXH 3OMZA 2EDNA 3Q6GH 2RCSH 3O3BA 2LLNA 1GGBL 5I76B 1L6ZA 3T3PE 4FQLH 5F6IC 1BX2B 1K6QH 2FAUA 4XMLH 3UBXI 2E0PA 3BPNB 5GS0D 1SBBA 3HAEG 5F88B 4QXGH 3BH8B 3X3GH 2XWJB 4KQ4L 4L29B 1Z0NA 2AJXH 3WEXA 5ICXA 3NCMA 2MQCA 4HMEA 1D5BB 4FFWC 4F9LA 2X4RB 3UZQA 1PNDA 1A3RH 4NQDA 4PRAB 2ZNXA 1A6PA 3WAJA 4NKMB 1XCTA 3KPRB 1E2VA 4YR6A 2BNUB 3VGAC 3IF1A 1IGYA 1HC1A 2VQUA 4V33A 5DCCA 4X4ME 3FQNA 1P7QB 3MSPA 5F9OL 4N25A 4FFYA 4PJCF 5K59E 4YOKA 5KJ4A 2OTWB 4MAYB 3P4NB 1AXSB 5JOFB 4PU2A 3MACH 4MJIB 3MI6A 2EJ1A 1I1AA 1PZSA 1ETZA 4F57H 3VDCA 2B1AH 4UOW1 3TJPA 3AGWA 4FA8A 1KBPA 4ORGA 4NQCD 3APDA 3S4SB 1KCLA 2J1WA 1H0DB 4ELMF 1CTMA 2WZAA 3W0WD 5JPMC 5LVEA 2FJGA 3MLSH 1L6PA 1T20A 1VERA 2Q76B 3I6GB 2BIHA 4M93B 4NFCA 4IM8A 4XTRD 5IIEB 4NNXB 3EKCA 1HQ4B 4AEIH 2CJUL 1J9CT 1G1KA 2WSKA 4MA8L 5EBWA 3M6DA 3CX2A 3QIWC 4J39A 3INUL 1EXGA 3LRKA 4IKLA 3SD2A 3QQDA 4GAJH 4PV8B 3TA3A 1UTDA 2AK4E 3OHXB 1IGIH 1JVLA 4K15A 4YUEH 4L8BA 3FU6A 4OQTL 3L9RA 1AZUA 2AVFA 3EBGA 3BSZH 5IMOB 5E6YA 5I17A 5IW6B 4MNHB 4CNIB 4LFHD 4NZTH 2Y23A 3B8SA 3VFWB 1EWHA 1Z2KA 3BGAA 4HOWA 3H42L 3H9SE 4L4VE 2BERA 2VMEA 1CL7I 1JZGA 3GMNA 4UM8A 1ADQH 4X80H 4AW4A 4PJCA 1W0WB 1OT2A 3POCA 5ADPH 3L4ZA 1NUFA 4HP5A 4BK4A 2DYPA 2VH5L 5F1OB 2QSVA 3K6OA 3SDYL 1ES0B 5FF6A 2F1AA 2BHUA 2K3TA 2Y3NA 5I19H 4WNSA 4GRLA 5KOMC 3X17A 1DVZA 3N85H 4A6YA 1AIFB 2V5TA 2B7DT 3SQOL 4IHBA 1JUFA 4NQDD 2W60B 3QS2A 5D55A 5GS1C 2WKGA 5EU3B 1WH0A 1ZHLB 3FCTA 1ZS8A 3VGGA 5DZOA 2ENJA 3LEXB 4RFOH 3VFOA 1LMIA 4KZEL 5D1ZI 2X9XA 4KGJA 1CGVA 4J3BA 3OKOA 1P1ZB 3SDDD 2OMNA 3VGDA 1DLHA 1FNEA 4RLDA 1N3NB 1ZGLP 1DEEB 2WWKO 5E2UL 3V4PL 4WHTA 3T6XA 5SX5H 1E5BA 1NKRA 4MJHA 4IHOB 2X10A 2DBLL 2KS0A 2Y6SC 3QZPA 4TOYH 3O6FB 4L37A 5IEHB 2HFEB 4GKSA 1N19A 3EIFA 1HH9A 4MNQA 3T0AA 3VGHA 4WGKA 1TQCB 4PJ5A 4POZD 1JF1A 5C0BE 1P1VA 4H40A 3KS0H 4G5ZL 3QIUC 2WCGA 3SDXA 4WI6A 4H0HB 4LRNL 4Q6IC 1EAOA 5FA3A 3TBCA 2Y0SA 2X4UA 2CUIA 2DF3A 5KSBB 1CIUA 5L9DL 1D6VL 4OI7A 4X6FB 3KPPA 3SDAC 2Y2YA 3LEVH 5EU6E 3LN9A 4YSCA 3KGUA 2W88A 3DVGB 4ZS6C 2NY0C 4QAMB 1U6AL 1SY6A 1AGFB 4OV6F 1XGTA 5EO9B 3WNLA 3EFDL 4UTAA 1L0PA 2ICCA 2EH8H 3LRHA 4BFBD 1YNLH 1MHCA 4IBLT 3SZ6A 1TZGH 2RGSA 4LSDA 4YL9A 2GT9A 4F20A 3RKPA 2ZUSA 2WZ6A 4E42A 3H2WA 1CFTB 2VR3A 4NQVB 4YHKL 1P5UC 3WSQH 5KBMA 4DHLA 3GLDA 5BZZA 3PL6B 1MY5A 2HJFA 4MD5B 2YEQA 5TJWK 1Z5LB 2DM4A 2KKQA 4NO3A 4PTTB 2WQSA 3I74A 3QRBA 5D4IA 4ZXBB 1ACZA 2O26U 5IB4B 5ABZA 5TQ0L 3LH2L 1D9KC 1A7QL 4BZ1H 3DUUB 4XN4A 5AG9A 1UOKA 2NNFA 3DYMA 1BWWA 4L1LA 4ZFFB 4ZJ9A 1IGCH 1AIZA 2QPFA 2QVIA 4ETYA 1S5HB 1KOAA 1JMXA 3ARPA 3QUMA 1E3ZA 4NCDA 2RQ8A 2NY2D 2ADIB 4TN9A 5AVSB 3QDAA 2YZ8A 5DFVD 2CZNA 4K0OA 3WDJA 5CEZE 1KGCD 1QHPA 2HJKA 4PGCB 3KD4A 2VL5A 5KVDE 1K5NA 4K94L 2EDLA 2VL4A 1SJEA 4YC2B 1T0PB 4Y1SA 3MJ9H 1CLYL 2ZCKH 4A55A 1TETL 4LDLB 5HVFB 2R56L 1L9OA 4JDZA 4KK5D 1JGLH 4LEXH 3AM8A 4YXKL 3DWTA 2IF7A 2NY1C 4WK2B 4B0MM 5IK3B 5I8CA 1PX4A 5EZLA 3RNQB 1MCIA 4KJWC 4AQ1A 4Y4FC 4NO2A 3QUXD 4OD2B 3AXIA 4J3VA 4MNQD 3SDCA 5KVMC 3THML 1ACYL 2PR9A 3Q2LA 2PWHA 1DVXA 4GI9A 3FTSA 5E7FA 1KPRB 4DIXA 4TQEH 2JJVA 5TQ2L 4D9LH 3TWCH 4JRYA 3L95A 4PRBA 1RHFA 2N7SA 5IR1A 3CN0A 4ZTPL 3TVMD 1HXMB 2DTMH 3WENA 1BF8A 3I75A 5MEPB 1E4XH 3II3A 3MUJA 4M5TA 3UG3A 1DBKH 5TE4H 3MLUH 2EDDA 1V7ML 1YAZA 2FNWA 3MLYH 2H0FA 1VGEL 2R69H 5AKSA 4Y1AB 5IJVB 1WVZA 3ULAB 4FMVA 3MV7B 1GZQB 3BD5A 2KDGA 4EN3C 2KMWA 3DJZA 3DOIA 2BOLA 4FYSA 2P48B 2HT3D 4YSAA 1OF2B 3ILPB 3QUZA 4EUPH 3NUKA 1AOZA 5JXED 3HKFA 1G5AA 4QRUA 3DETC 1GGIH 4HIPA 4L8DA 3I50L 4AW7A 5KBDA 5AW2B 3PGCB 4LSPH 1MIML 2DI7A 4GT7A 5DJ8B 4JQXC 3CVCA 5AW3B 3PHQA 5HTSA 4KPHL 4C55A 3T0EC 3LNHA 5LUMA 2XXFA 1U3HD 3L3HA 4RISH 5F7HA 5E56A 4OUOA 1OHQA 2YRLA 5FM8A 2WXMA 3IDNA 3WTXA 2R39A 3STLB 4OV5B 2W81C 4Z7WA 5D6CA 1TKWA 4UUJB 1NCBH 4AWJC 2NXYC 1YEDA 2OZ4H 3QIBB 4X6DB 1CO1A 4U1KB 2BOBB 4QHLA 1DSYA 2KPWA 4GSXA 4JO2L 3GMLB 2LTQB 3IDYB 1AC0A 2YWZA 3IJ8A 2V7HA 1FNSL 1IKFL 1XZ0A 2WZPA 3MNWB 1FZOB 2APWA 2EO1A 4JY6A 4ZQKB 1MCNA 1FZMA 3CDZB 3KPLB 5E24E 1U21A 1W91A 1GMIA 1OB1A 4NJAL 3EUUA 4IIQA 4ZQTA 1UJ3B 2BHFA 4TLTA 3K71A 1BXVA 5ICUA 2FB4L 3F64A 2WUCL 2Z65C 1IE4A 4BFJA 3JWDH 5TFSH 3FDWA 1MCDA 1OTTD 3IPBA 4PD4J 2DWXA 1WBZA 5AKVA 1BA9A 5MHSE 2IO5A 2X05A 1FGNH 5D1QB 3PPSA 3V0EA 1WAPA 2K9FB 2WSPA 4XCEA 3BW9A 1OAUL 2C4FT 2VDQB 5E5LA 1RIVH 2HP4A 4OF7A 2IOOA 3VJ6B 3FF7A 3F7PC 2PUQT 5F1IA 5LXGH 4K8RD 5ICZA 4OGZA 3GQFA 3OR7B 2Z8WC 4FQ1L 5CCGE 4UYPA 3WN5B 2G4EA 3JWOL 3N43F 2PWEA 1SOQA 2WVVA 4L1SA 5DD1L 5HD8D 4G82A 3CDCA 3HN3A 4YWGL 4DEPB 2RR3A 2IH1A 4OSUH 4D94A 5I8KH 2FIKA 5K39A 4HBCH 1DSFL 2R83A 4LKCA 1DO6A 3O0RH 2QZQA 5F89B 3EYSL 3CIQA 5TPWL 1I9IH 4NJ9H 1U95B 3ZE1F 4P46D 2FVNA 5K33A 5J6HA 4L9DA 2B14A 3L3OC 2IH3B 2M2DA 5KS9A 1YMHB 4NQXB 2DI9A 1QRNE 3LCYA 1P7KA 4UT9L 2F54B 4Y19D 5L7XL 2I7SA 4QO1B 1PKOA 3RTLA 5J7CC 3ZQ9A 3PWVB 1UWGH 2VERA 2R1WB 1HT6A 3S98A 2PCFB 5KSUA 5D1XA 2ZUQC 1Q1JL 4Y8AA 2WCPA 4NIKB 1IQWH 4LCWD 4AQ8C 1KENH 2I07A 1BYNA 1FG2B 2K6YA 5DFTA 5TTRA 3K8KA 2DQHH 2WZPD 3SBPA 1FO0A 2CSPA 3L3GB 3OAUH 1FVEA 1HDMB 5E4IA 3MNZA 2AMGA 3RWFB 2ENYA 3ZTJG 1I8MA 3WNMA 4IW4C 3E8UH 2ZJSH 5CSGA 5GZOA 3PDOB 2SEBA 5J1AB 2XKNA 1E6OH 3UBFA 1U3JA 5IOPB 3PGDB 3B56A 1A6UH 3WJJA 1UQSB 3IDXH 3WXWH 2BSDA 1E5YA 3CIAA 1E27B 2P7TB 3TO4B 2GK2A 4KI5E 3ARVA 1XBDA 2VCOA 1PVHA 1A9BB 1O9ZA 4QTIH 3V6OC 3SE6A 2X1WL 2BSCA 4UQ3B 2VRQA 3LKPB 1TMQA 2I32A 2G3MA 3QZOA 1IBZA 4PJFA 1OSPL 4I5BB 1RJZB 2BM3A 5JYMA 2ATKB 1CTOA 4M8RA 1KELH 1O7SA 3GZPA 1FORL 2VDRB 1RJLA 4CADA 5FW8A 3L9YA 2BCKB 5I1IL 1FLTX 5CJXA 3CXDH 1A9EB 4L4JA 1OGAB 5PAZA 3CD4A 3TIDB 2Z3FA 4AQZA 1PZDA 2D31A 3T8XA 1QHQA 1K2DA 4TRPL 3RIKA 3VRIA 2KZWA 3HE6B 1JNHA 4JFDA 3L2LA 1T5WB 3P4LA 4M3KB 1Q9KB 5J12C 4YBHA 3CHRA 5FB8B 4XCNA 1CGXA 1S9WB 4J3OF 1D5MB 4F8TA 4YHZH 4HGKC 3OKDA 3I02A 2X12A 1PD1A 1AR1C 4WCYL 4AQAA 1U3YA 1E65A 1CQYA 2LQRA 3ARGB 4JFOA 3U1QA 3VU2A 4DNLA 1MFEH 1J9RA 5KEZA 3MODL 3TP4A 5IHLB 5F9JA 4AL8L 1JNNL 2PPAA 3WJLC 3VI3A 3G9VA 4P2RB 1E43A 1T6WA 1TJHL 4JZOA 4HZLA 2ZXGA 5DJCA 1PLCA 1MH5A 1UXSA 4XN7A 4YSUA 5D1XD 5ANHA 4RMSA 5E1AA 3FH7A 4GG6B 1YEKL 4XVSH 4AKOA 1RLBA 4WO4C 4IKJA 1FFNA 5CZXC 1QBBA 4UV7H 5T33H 3UJJH 1NSNH 3APCA 3BPLC 4KXBA 3FRUB 3HMXH 3QIUA 3VVVA 1HJCA 3IXTA 2ZZUT 4HKJA 3IRCA 4IRZL 3KM2A 3MRDB 4TS6A 2VLME 3HHSA 2APXA 5HPOA 5E9NA 5D5MA 5B8CC 3QEQA 1GKOA 4IOSA 5GZOD 4J27A 4K94C 1QUNA 1RULL 5KTEH 2ZTBA 1U4EA 2P24B 2IOIA 5DUMH 4JR9L 5DJ0A 1BQHA 2DN7A 4LPVA 4ZMQA 4ZYKB 5HHOB 1KFAL 2XTJE 4X8JB 5E00B 5EUOA 4NIYE 2X70A 1TPXC 3CXFA 4WEBH 1KGYE 3FBQA 5CP3A 3FUFA 5DA4A 4MTMA 4P5TD 2WTRB 4OF6A 5D7IF 4ZUUA 4N8UA 4Q0XH 3FCBA 5GJTL 5BUGA 1KIPA 4JEGB 1LJMA 1UGNA 4GW5B 4KFZC 2B2XL 3NIDB 2IDQA 4LSUH 4R0LB 3M1OA 3UTQB 5HJDA 1QUPA 1ESOA 4CGUB 1QBLL 1Q4NX 1E50A 1WUZA 1IKNC 3WKYA 4L0PB 5AVTB 4NKOB 5EIIA 2Z92A 2GITA 1MREH 2BLFA 4JFDD 2C1OB 1P9MA 3TBTB 1H15B 4IGBC 4N5EC 2G3XA 2PABA 3FUHA 4QRRA 3IMBA 3AREC 3ZE2F 1R6VA 1HOCB 4PB0L 4CN4A 2XOTA 3HC3L 1SVCP 1UT9A 4FGMA 2ZCHL 1H3TA 4KUZH 4KOBA 2OMXA 3QQXA 5EU5B 5IVXE 5EU4B 3T0VA 1CT8A 3PHSA 4PJEF 2GK0B 1DVQA 3LQZA 1QX1A 2QADC 2F58H 4PLKD 1PZ3A 2XV2A 2GQHA 3MOAL 3P2DA 4NQEE 5B1CA 2CHWA 5JIPA 1MZYA 2DIAA 3ZDXB 1O75A 4ONHA 1MRFH 4OT1L 3CDGA 3FF8A 2BY3A 4DVRL 3UAFA 5KYXA 3GRWH 2NQCA 1SN5A 2FT6A 5C86A 3FT3B 1CLCA 3F04A 4DGYH 4GMSL 4YSRA 2NT0A 4KRNA 4OZGE 5IBUG 4JFFB 4NPYA 2H41A 1NFKA 4TVPL 1MCKA 3FT9A 4M6NL 4CMHB 2O5XH 4XC1H 4QNPF 3QFJD 2P8PB 1PZUB 2HSIA 4DO4A 4XBGA 2DH2A 4IOSD 3NTCL 3ARXA 1KB5H 1X4XA 1THCA 4FQQA 4DSYA 4Y16B 2R23A 4HS8H 4P23A 5I0XA 5ACLA 2BS8A 2AJ3A 2HG0A 5I1CH 3K8MA 4M7ZC 3AB0B 3PPEA 3V5KB 3UTOA 4EN3A 3JWDC 3L4TA 4PJBA 4N87A 4PRIB 4Z7IA 1XMEB 2YGPA 3FN0L 4YDZA 5FDWA 4AITA 4MCYB 3MN8A 4ENZA 1YAIA 5BV7L 2VITA 4EO5A 1LQSR 4UQIM 3RY5A 1B3IA 4NUJA 4RQQB 4Z8FH 4P2QE 2KLTA 3D39A 3ES6A 3BPCB 3R0NA 5C92A 2DYSB 4JKMA 4KK9C 4NKIL 2J2ZA 5D2NA 2FJUB 2DQGH 2HT2C 3FQUB 4P8QA 3WEOA 3CVHH 1A5FL 4BQ9A 5C6TH 1ET7A 2ODHA 2QSCH 4XCCH 5J1SC 4XO4A 1FFOB 1O6SA 3KWWB 4QRRD 2AW2A 2A6DA 4R8WL 4UOQA 3ZZQA 5JHDE 2O5NA 4MLSA 2WUBH 3CWGA 1BZ8A 1NFDE 3F05A 3F58H 4ORZC 5EA0L 5ENWB 1R3IH 1PZ2A 3BKJH 2EIZB 2XG5B 4Z7UF 5T1LB 2R2BA 4QYAA 4OFKA 4XB3A 4GXUM 3L17A 2FSDA 4LPCA 2Q8BH 4ZMZA 3WNIA 4R83A 5DS2A 1WAAF 1XEUA 1T04A 2AJYL 2BVTA 4XO8A 2X4OB 5EV7A 3KLLA 4W6WB 4M7KL 2JKJA 2Z1KA 5CEZH 2HFTA 3MUZ1 5KVDH 1F41A 3LNDA 3PWPD 2ODIA 1SEBB 1D7CA 4MA1B 4M5YH 1YNTA 3S5ZA 2MEJB 4M62H 1GYUA 2IADB 1NJ9A 2YEZB 2Z93B 4JY4B 1TTUA 1YN7B 1VZHA 3QCUL 4NQCB 3T8VA 2HJLA 4QMEA 2BVPB 1WO2A 1G6RL 1SFDA 5F72S 3UP6A 5ALCL 4ENED 4FOMA 3SJVE 2FSEA 1HNFA 4ONFH 1B0RB 2Y5QA 4JL1A 1N0XH 3D0LB 3KLQA 3AXLA 2CBPA 3QUGA 2WIMA 1S9VB 3OC5A 2F7OA 2OYPA 2C3VB 3EG9B 4LNRB 3REVA 1QD0A 3DUSA 4QRSA 3SSGA 1JZJA 3C6LD 4G9FB 1ADQA 5CNHA 1FFQA 3B7YA 1U8JB 5AOKA 1T80A 4X4KA 2G60L 3BUYA 3GHBL 2YS4A 4EZJA 3ULVH 3DRTB 5HI5C 4JVUA 4UANA 1DANU 5A2BA 1FNGA 3UMTA 1KLUB 4WFED 5FM4A 3UPRA 4OZIB 4KKQA 4PBDA 4YE4H 4A2MA 3VFMB 1KXQA 4LSVL 3U6RA 5AB0A 3EO9H 2JE8A 3WUWG 4YHYB 3RX8A 2IANA 5HYQA 2DQDL 4L3FA 3MZGB 2PYEE 4OLZL 43C9A 2QFPA 1LK2A 4H8QA 5E2WH 2IGFH 2KI6A 3O3BB 5ITBH 1S7WA 4OF5A 3UYPA 2XN9A 4WHDA 4YDLC 1I75A 2C3XA 1KJ2H 3MV01 2XBZA 3DBXA 4DAGH 1NMAH 4D9RE 4PRNB 4BA0A 8PAZA 3UJTH 1CGTA 3QEGH 3V4VA 5EUKB 2ZUVA 2FBJL 3WEXB 1EDHA 5D7JC 4XBPA 4RZKA 3UGUA 4BQCA 3IXAA 2EEFA 3UZQB 4WVRA 1ZV9A 2BRQA 2XQYA 3GBML 5CKAA 1XB8A 1T3FA 1F4WH 3D4YA 2JB6A 5HYSG 1R3HA 3IF1B 1IGYB 2CLVA 5CU5A 3CVIH 3FQNB 4Z7VA 4W9GC 4AENB 1F11A 1PSKH 4H88L 2Y7QA 1F3JA 3QDGE 2PCYA 1I1AB 2QV4A 2AF2A 2E6QA 3RVTC 1ETZB 5EU7E 1S3KH 5GGQH 4LL4A 3W9DA 4MCZB 3ZKNC 3LKRA 4I88A 3GUTA 1BBDH 3A4EA 2QGBA 5F3BB 3OXRA 4KKAC 3C9NA 2FYYA 2IBZX 2FJGB 4TNWF 3FMGH 3NSXA 2DL2A 3C2SA 3ZIMA 2QGCA 1SOKA 2H6OA 1UZ6E 1XL4A 4GXFA 1B4LA 2J57A 3DMMC 5EBWB 3F7LA 1AZZC 1PLBA 3PQYD 3QQDB 2D7QA 3UTTD 3TA3B 4MBRA 1LO3H 4L8BB 2NY7L 2NY6B 3HTLX 4GBXC 1TJIL 2AEWA 1LO2L 5C0FA 3L9RB 5E8OA 3MGAA 3B5TA 4KTDL 3QHZL 3MRMA 1BD2A 4L2LA 5I17B 3EOAA 4B50A 4LDCA 2UZPA 3C2AH 5KAQF 3C8KA 2H6PA 2H0EA 4PP1D 4D7BA 3HI6H 1Z9OA 1NIFA 2EE9A 4CUCA 3VI4F 2VXVL 4NKQB 3GMNB 4UM8B 1JPTH 5I6KA 3MRKA 1B9ZA 4BZ1A 1CFSA 4V1DA 4U1MA 3OZ9H 2VLKE 2DYPB 4Y89A 5FF6B 4DP5X 1Z0MA 2Q1EA 4DQOL 4GRLB 3ENEA 4QTFA 4ZOCA 4A6YB 3KPOA 4GW4A 4KOCA 2NYYD 2JK5A 4I2XA 1JUFB 2WXFA 2QTVA 2DBJA 3K2MC 3MJ9A 4KROC 1AJ7L 3TPKA 3FCTB 4G6JL 4Z7AA 2ESVE 1ZS8B 4MD0B 1EZSA 4PJ6A 4JREB 3L1GA 1J87A 4Y5XA 2Y5TA 1FE8L 2FQGA 3VFOB 5B8CA 2MCPH 4XNQA 2AXHA 4QHKJ 2CJTA 1BEYL 2OJZL 1RK1A 4D3CH 3FCUB 3OKOB 1I1CA 4L9LC 2GTZA 3GXPA 2GC7C 1DLHB 1KTDA 3U79A 2I25N 1QTSA 3RB5A 4PJ7A 4OD3L 3X14A 3FL7A 1KFGA 1HE8A 5EPMA 1Q9OA 5F9DC 4WI3A 1QA9A 4WHTB 5JIDA 4FNLL 5IKCA 5H2BA 4FD0A 3UTSE 4L37B 3D48R 4QAWA 5C09E 4GKSB 2LGNA 4HAFA 5GGSY 2C4FU 3SCMB 1QLRA 2R69A 3KPSA 4JGUA 4ZFZA 1PGRB 2XRAH 3WN6A 5HHQA 3NH7H 3M17A 3NCXA 5L88L 4PJ5B 2FECI 1PFOA 1RZJC 5D93B 2QBWA 1T0NA 2XVKA 3FSZA 3ET9F 2VMFA 4LARH 5MERA 4OZFH 1BQ5A 3VD1A 5FA3B 2GSIB 4B5ZA 5DZAA 3L13A 1Q0XL 4FYTA 1ID5I 4PJDF 4CJ1A 3SE3A 1WA2X 3KH4A 1GY1A 3KPPB 4JFZH 2R1XB 2CBQA 5JUEH 1ZSDA 5T1KA 5E5RB 5EZOH 3IDUA 5IZ7A 3DLQR 5HDBB 1NBQA 5DHXB 1XGTB 2FJSA 3K74B 4NUMA 1TZ8A 2VMCA 3VRLE 4V1DD 1KXTA 3P30L 3S3SA 3HMWH 5DJZA 3SKJL 4ZMNA 4MJ5B 3GBLA 3APFA 3PIQA 2GT9B 3WOVA 2ZXWB 1RP9A 1K3ZA 4MCNA 1CF1A 4TSCH 3ZDYF 5F2FA 3MRJB 4YHOH 1SHWA 1J1XH 3NDYE 1R46A 2HJFB 4GSRA 4BUHA 5CCKH 1PZCA 2EVGA 2OZ4A 3MX0A 5I8EA 3G5XA 4H13C 4H1LH 4NO3B 1NGZA 4U1GB 5DJAB 3QDJE 4KDTC 2EINB 3BWUC 3BZ4A 5BZXA 2ICES 1HZLA 2F19H 3ARQA 3EJYC 4S1DC 5K1NA 2C9SA 3DXAE 2YPLD 2VLJD 1H3PL 4GUQA 1U2YA 7FABH 4C56A 4UIMA 2DKUA 3F3HA 1FBIL 3WV0A 1QYGL 5I1JH 5D4QA 5MENA 1UUSA 4OLWL 2P44B 1P84J 2HJKB 3LY6A 4X7SH 3U30C 2VL5B 1WITA 1K5NB 5F9WB 3RG1C 3RHWF 4JY5L 4JDZB 3CJJA 3EHBB 3RIFK 4OGAD 2MSPA 2D4DA 4L8SC 5I8CB 3ZDZB 3ILDA 4HPOL 5EZLB 2G2PA 3MLTB 2APVA 4NO2B 3ZL4H 1EV2E 1MVFA 3SDCB 3N9GH 3F7YA 3WY3A 4JDTH 3CFNA 2J1KA 2UXTA 1ZSHA 4JRYB 4PRBB 2VDMB 5IR1B 1EJ8A 1UURA 1H8LA 3GMPB 3NCEB 1I8KA 3OKYA 1MCSA 4O02B 4Z0BH 3ESVF 3ULVC 3I75B 5DD3H 5ESAA 3EOTH 4Y4KD 4E9SA 3UDWC 4HSCX 1DJZA 4JKWA 3TA4D 4UBDC 4WW1B 3SE9L 3TLRA 5AYUH 3CCHA 2X4QA 2G4GA 2HRPH 3LD8C 1KBVA 3X1EA 4EZMA 3GSUA 3QORD 2R15A 2ZOLA 1WHPA 3VXQA 4WEEA 3FB7A 4LOFA 4GYBA 4XMPH 1CXEA 1DQVA 5JW5B 4GS7B 3ARWA 1VEMA 3GMRB 4R7DA 5JQHC 1S8DA 1EQWA 3HRZC 5EC2A 3VA2C 2ORBH 5DZJA 3AU1A 4HISA 4HWBL 1R24A 4LLUA 1AZBA 1NCJA 1ZGLB 4Z3IA 4HAGA 3AMKA 4P5RA 3TH4T 3QUZB 4JHWH 2PF6A 2P45B 1OAYH 2IJ0C 3NCBB 2YA1A 3QNYA 4L8DB 2H2SD 5A6IA 4LOEA 3I6LE 3NABH 3PHQB 4MVBD 1V27A 2HMIC 2NDFA 4ICWA 5FS5A 2UYLA 4V2BA 3B9DA 2PP8A 5LXVA 1L4IA 2YUZA 1TTCA 3L3HB 3RU8H 1FFPA 4QYOA 1FNLA 1XL6A 2IALB 2YBGA 1ZPUA 5B3JF 2WP3T 5EG6C 1AC6A 3IDNB 1KCUH 5AZ2L 1NH6A 1ZEAH 3F83A 3TBSA 4N2IA 4C56D 3SYOA 4Z7WB 5D6CB 1NANI 2XXCB 5MEND 4PS8A 3D4GA 3S37L 3OKEA 4WI9A 1YEDB 2KYIA 3BQUD 4QHLB 1VZGA 3DSFL 3BMWA 2VDOH 5FHAH 4KK6C 3P4MA 3IRPX 3D2TA 5IVZA 3U9WA 5KYWA 1DBAH 2V7HB 3PAZA 1HXKA 1XZ0B 5DK3A 2J43A 3U4EA 3FN9A 4S1QH 2ZWSA 4AYGA 4WFHD 3QUHA 1FZMB 1A6AB 3HBQA 4KTEH 4LSTH 4FZEL 4TVSa 1OB1B 2UUDK 2Z31C 4G3YL 4IIQB 1DFBH 4DP9X 1T1ZA 4QXWA 3K71B 1TEFA 2KQNA 2VZUA 2A4CA 4P2OC 1T03H 1OO2A 1TYEB 1SNRA 5E6IC 4GO8A 3STZA 1PEWA 1WBZB 4LCIL 1A25A 1X5LA 4FJZA 2WCSA 4F7PA 1OAXL 2GIYA 3KDMA 5HDOA 1GJWA 4LHUA 4UDTA 4XCEB 2WQAA 1IGML 3QH3B 2HX9A 1TZIA 3VFNA 2QLVB 3PV6A 1HHKB 1J8SA 2N7BA 5LGHL 4WW2C 1HYSC 4EOWL 4OTXH 5F1IB 4DZBA 1LEKA 5ICZB 3SQBA 4X4MA 1TG8A 4J8QA 4JO3H 4JFVA 2FRGP 4ZMTA 1INEL 1CGUA 2X1XR 1SM3H 2WVVB 2D7MA 5I28A 5JYLA 4HG4K 1KEGL 2IH1B 1CU4H 1L0YA 2FIKB 5EN2B 4EN2A 5K39B 2PP7A 2JQMA 1M7IB 4LKCB 4PPTA 1U58A 3P0GB 4DH2A 3AS0A 2MIZA 2OL3L 2CCVA 2ZWYA 4X4ZA 5J6HB 2XA8H 2NYZA 3A6CH 1D5RA 5GS0L 4ISVB 5CJOH 4HIQA 5KS9B 1ACCA 3FFCE 5JPMB 1LVEA 4Q9BA 2VWEE 1SLWA 5IW3A 2GTWA 2GBTA 2ZOWA 2AJVH 3O9WA 3FQ2A 1YPZF 5AVQB 2QQNH 1QFWI 1NMCB 5KSUB 2AJUL 5DEJA 4MYPA 1BJ1H 5I1GH 3SBWA 2Z0UA 1CD8A 4TSBH 2P8MA 3FT2A 4XP6H 2A0LD 4RAUB 1C5DA 2I07B 3OJMB 1NLDL 1B0WA 4GBXA 5DMGC 1JV2A 1MHHA 1RFDL 1CD1A 2BNRD 1FO0B 2JXMA 4XHJD 4BFIA 4ZX6A 3VH8G 2IAMC 3D33A 3QJTB 4O58L 5AAWA 1FVEB 3KLHC 3P2TA 3MNZB 4BZYA 4J28A 3H9SA 4L4VA 2XWTB 5D71H 1IAIM 5HXMA 2K70A 3MBWB 3LDBB 2H3NA 4UWQB 4FX5A 1KNOA 2SEBB 3OLDA 3LQAL 4HT1H 4X42A 2XKNB 4UQDA 2C9AA 4OLYL 1WC7A 5DUPH 4Y2OA 4FXGC 1HH6A 2ENPA 1ZCRA 3DJTA 3FUIA 3HOGA 4FTVE 4NC0B 3G5VA 4LHUD 1FFTB 2WNKA 5IHZA 1N70A 3WLBA 1XGYH 1R3JA 4PWIA 4JFED 3OAYK 3QG6A 3IVKA 2UVFA 4G1EA 2XZAH 3D25A 1J0ZA 4DN3H 5JR1H 2IOMA 3QPXH 4BK8A 4QDGA 4CADB 4G7VL 1RJLB 4FDWA 5CLYA 2HVBA 3W2DH 1QEXA 5BRZE 1A3LH 2CBMA 4OI8A 4TSAL 2EH7H 2D31B 4PS4L 3T8XB 1UEYA 1K2DB 2OV0A 3VRIB 3M7OA 1RH8A 2MPVA 4PFEA 4J8RA 1JNHB 3QI9A 2H0JA 1YYML 5KSAC 4QF1A 4XCNB 3RVWC 4FA7B 2F8IA 4QGYA 4I3SL 1UD5A 3KLDA 4XE5B 3F8UB 5CIPB 1GGBH 4PWFA 4ANXA 2J6WA 3OKDB 5MP6H 2CU9A 2QJDA 3GRWA 4Q4EA 1FVCA 4AQAB 4JFOB 2UY6A 4JPKH 2EP6A 2B9AA 1G7MA 4GRWF 3TJHD 4N4YB 1BG1A 5F9JB 5TE7H 2E8ZA 3VI3B 4NPKA 2X87A 3T04D 3IGFA 4YHMH 1TTGA 4HZLB 4AV4A 3O9WD 3DX6A 5EDXA 2AQSA 5DJCB 1KB5A 1MH5B 1UXSB 1J0YA 5IJKC 5C0BA 2Y9RT 4IK6A 2YAMA 3Q13A 4DPBX 4GFTB 1FFNB 3LPOA 3QIUB 4ZMPA 5LWYH 3IXTB 4NGHH 4OFYA 4Q6IB 5F7EL 1EX0A 5EU6A 2EDKA 4L4VD 2CKBL 2HUHA 5D5MB 5DHVB 2WQ8A 3QEQB 3BYTA 3MUUA 4KRPC 5B38G 1QUNB 4MAZA 5GZNA 1QMUA 4IRSC 1QWNA 4JQVA 1RCYA 3GLAA 1T66D 2NY0B 4IOFC 4JM0A 3V0WH 3V95A 1H8NA 5DJ0B 1BQHB 4H8VA 1N59A 2Y7NA 2WLIA 4WI2A 5EUOB 2X70B 3JXAA 2VDLH 4XPHH 4TMPA 4YLBA 2OQJA 4ZUUB 3AY4A 5FO2A 1OM3H 3ORJA 1Y18A 2I9LA 5E2VL 1KIPB 4BSJA 3HBPA 2VE6A 1G1CA 4MA8H 1P5UB 1Z9PA 3AT9A 4XPGL 3MGOA 1JYXA 1B2WH 5CN1A 4TNVF 5JW4M 3IS1X 4M48L 1I9JL 3G6JE 4DEWA 4YK4C 3Q6FA 5ILTH 4UV4H 3QT2A 2BFVL 2VSKB 1CB4A 5HDQL 4WWKD 4G7QB 1D9KB 4X5WA 2XKSA 5E99L 3AW5A 2GAZA 2VR4A 4LQ1A 1A1MA 2Z92B 5C08D 2GITB 4LGPB 3QI9D 4LBAA 3HNSH 3KBFA 1WZLA 2PTVA 5HGDA 5DXWA 2QQKH 3EFFA 3H42H 1WWWX 4X7TB 2YMXL 1EGJL 2C26A 4TULL 4HJ0C 3RJQB 2OMXB 1NDGA 5J89A 2I27N 4APQC 1CT8B 1IX2A 1UH2A 2COQA 2XWCA 3MLVH 4MQXD 3JVGA 2BO0A 5FYLD 4XBEH 3QBTB 2BVYA 2NY1B 3BN9C 3K81A 1NMBH 3CG8A 3LQZB 1RIHH 5IHWA 5JPNC 4RFEA 4MQSB 2DY2A 1G84A 2X0VA 2DQFA 4ONHB 2FR4B 4F2MB 4FEIA 3CDGB 4OJAA 3IKKA 4HWEL 4P4RA 2GJZA 4BK5A 3NIGB 1DBJL 2EUVA 1XF5A 3K80A 3E80A 3PYCA 1T1WA 2QMJA 1VSCA 3FQRB 3NJKA 4YHPB 2W1NA 1N10A 4XX1E 4NPYB 4OFYD 5C9KA 2V9UA 1CICD 1FGVH 1GSMA 5KVFL 2EDJA 5CR1A 1ZGLM 5I66A 2WBKA 3IU3A 1UCBH 4HH9A 3B6SA 4XBGB 5J3HD 4U1JA 2QVMA 4QWWC 4FQQB 4G8GE 2R23B 2XIBA 4P23B 3KL0A 1DUZA 2AJ3B 5GGRY 3MA9H 1JZ4A 4LVNC 1PFCA 4R26L 1UD6A 3RTQA 3RVUC 3IKCA 4WI8A 4YDVA 5DC2A 4EN3B 1DZBA 1A3ZA 1GHFH 1OSYA 2FATH 4PJBB 4CVUA 4NM8L 1CXKA 2Q9OA 2XBTA 5FDWB 5AVXB 3UH8A 3T6WA 3WIAA 1QAWA 3FPXA 5E4EC 5H94B 2PWDA 3EH4B 4NUJB 4XT1C 3D39B 3ES6B 4FQXA 2YAHA 1G1YA 1XBRA 1INDH 1J8KA 1XAKA 2GI0A 2FO8A 1DVFA 4ZAKC 5D2NB 4LRNH 5LN8A 2LFEA 3C60D 5FHBL 4WUUE 1TLMA 3HW7A 4NI6A 2XNAA 2H1LM 3DPBA 1FN4A 1O6SB 3HS0A 4XOCA 5J8OA 4WF7A 1WEJH 2A6DB 1GRWA 4PW9A 3JTTB 1ED3A 5DVNA 1VEOA 3A6BL 3MV8E 2NXYB 4N68A 3CN3A 4DT2A 1TFPA 2R8SL 1J0KA 1KBKA 3AADB 1IVTA 2W0KA 4F2EA 1IO4C 1P4UA 3UABA 1NCNA 2R29L 1AFVH 5GGSA 3QFDA 1UB6B 2ARJQ 3CHSA 4U0RB 4LLDA 2VC2L 3TF4A 1YEFH 1IL1A 2X41A 3UOAB 4Z3EA 3ZT5A 4N2OA 2CK0L 3SYCA 5D1ZC 4XXDA 1ZA3A 2AQ1A 1YNTB 3BVVA 5E9AA 1KGUA 5C70A 4ZRGA 4L1TA 1NJ9B 5KANI 4TNFA 2UZXA 3MBEA 2DDQL 1OLLA 2HJLB 2OCJA 4LXFA 2HKHL 3KDPB 4H8UA 3CFDA 1R3KB 2GI7A 5DMKA 1JHKH 1ORSA 1B4RA 1JWMA 3PY9A 2NT1A 3AXLB 3WS6C 4K7FA 1SXSA 4UOZA 1DN2A 3L3DA 4ZOEA 3TGXA 4Z0XB 1F1AA 1G7JB 1F3RB 3GIVA 5FUCE 4JM4L 2Q86A 3DUSB 4QRSB 1KYDA 4HVBA 4HCFA 4XPTL 3V6BR 4G6KH 4Y4HC 1HHIA 3S4SG 3SKOA 2PMZA 3BUYB 3ZMEA 3NJXA 4OVVA 4LL1A 4TPRL 1P6FA 2NR6C 2FHCA 2R0LH 1FNGB 2UWEF 1JTOA 3A22A 3FOLA 4HS6B 2VMDA 4A38A 3PNWA 4G6MH 4AYFA 3U6RB 3FONA 2ZT9C 4CA4A 2IANB 3GSOB 4WNJA 3B5GA 5EZPA 2BMKA 5HYQB 1E40A 1QRNA 3H2QA 43C9B 1LK2B 1D6EA 1DVFD 1DQQA 5DQDL 4JPWH 3QZWA 5B21A 1E2WA 1S7WB 9PCYA 3MRPA 3IS0X 3UYPB 2XN9B 5IB3A 1Z3GH 3DBXB 4J3OG 1EMTH 4AEHL 3N44F 3FTVA 4DOHB 1JXFA 1XTLA 2JNZA 4W6YB 1NGXB 4ICXA 2E9IA 5I82A 4J5VA 1R34A 3S3JA 2DQIH 4APXA 3S88L 2WK2A 4JFPA 4XBPB 4BELD 5KOVC 3IXAB 4MMXC 3NA4A 2CPUA 3VWKD 1ITCA 1OQXA 4Y2LA 3OG6B 2JB6B 1R3HB 2CLVB 2WOYA 4UT7H 1MW0A 4UQEA 2HT4D 2EYTB 4LKXA 1FAIL 4Z7VB 5EO1A 1OTUD 4YDIH 3SOTA 1F11B 1J8HE 2E4TA 2Y7QB 5AG8A 1UWFA 4AT6A 4HEPG 1C5CH 4LCCC 2VQ1A 4OLVH 2BP8A 4Q8BA 3P11L 3BZFA 2ZKWA 2OS7A 4IKKA 5IF0A 1FHNA 4OB5H 2WTPA 1OK8A 3W9DB 3MBED 2OI9B 4QIRA 1ZHNA 2A77L 3D4ZA 3LKRB 2DD8H 3MJGX 4PVBA 5MEOA 3OXRB 4OZFA 3C9NB 2JH2A 2JTDA 5LBSH 2BSBA 3WS3A 4YXLH 3CFCH 4NWTH 4M7JL 1AS8A 1NCDH 4GAAA 1BGXH 1C08A 4KVCH 2AKRA 2FT7A 4MNGE 3QQ4A 4JO2H 1YY8A 5SWZD 2K7QA 1FUNA 3CSPA 4YBLC 5T8IA 2V2TA 3E1ZA 4CDHA 1HL5A 3IU4H 4XWGH 5FYJL 3VD4A 3IRZA 3WD5H 2ED9A 4J4PA 4RDBA 2V9QA 3DRQA 4MAUH 1N6VA 1OE2A 1I8IA 1WQVT 5C0FB 1NBVL 4K71B 3LXCA 1TVBB 1ZOXA 5E8OB 2WYTA 3MRMB 1BD2B 3DUHA 3F5WA 2P1YA 3EOAB 4L3AA 3UYRH 4XCFH 3MOBL 3VTTA 4CSTA 1BLIA 2UXVA 3UJIH 1RY7B 4AIZB 5ISZD 2H6PB 3S34H 1AR1B 2Y1AA 2HA1A 4NRZA 3S3BB 5KJRL 4PVNA 1CF8H 3TN0C 2CWRA 2IFFH 3WAKA 2C9RA 1EHXA 4PCYA 3ZE0F 2E9WA 1Q90A 3QRGL 1QNZL 2IWEA 2CA3A 4QJ3B 3MRKB 1CFSB 3JUZA 4V1DB 1IC7H 4U1MB 3BWZA 1GGYA 3L5HA 4PGDA 3TV8A 4DO5A 4EIZC 2PXYA 1KBWA 3ECBA 1YUKB 4YSDA 5IVOA 3TBWA 3JWOH 3ATAA 3KPOB 3RY6A 3R7RA 2JK5B 4I2XB 2OMTB 2OXHA 3LEYH 3BPLB 3MXWH 5IBTH 2Q87A 3MV9D 4FABL 2IGLA 4X0NA 1A7PL 3NEXA 1R0AL 4Y5XB 2Y5TB 1KCRL 3EJSA 5FYKD 5B8CB 4XNQB 5IROA 1MJ7L 1NC4B 5BZWA 4DZ8A 4WV1C 4DCQA 1RK1B 3NCWA 4TTGA 2GTZB 4I4WB 5C0AE 1KTDB 4D7PA 4GSDL 1TPXB 1T7XA 4PJ7B 3X14B 3HZYB 1FC1A 5EPMB 1Q9OB 4Z3JA 25C8L 3L3IA 5TDNA 1H8OA 1KSRA 3HBGA 4OLXL 3AMLA 5IKCB 1HXYB 5H2BB 1LLAA 3FJTA 1N5AA 1UT2A 1IGFL 5I0WA 3G5YA 1CLVA 3MTXA 3TCXA 5BW7C 1QLRB 3KPSB 1QSEE 3EXLA 2WTOA 3NRQA 3L1FA 4PJAF 4KMTL 4JJOA 1X9UA 1T0NB 4U4BA 2N7AA 5G2NA 2UVEA 3T65A 1M6OB 4ZD3L 3IFPA 2CJSA 4JPVL 3K46A 1L9MA 4AXWA 3BJ91 3D87B 3H4FA 3AREB 2B59A 2H5UA 3DX0A 2ZUWA 3J8F7 4GJTB 4R90L 5IFAH 3MAWA 1XGZA 3BP5A 4PS3A 5IVXA 3IMWA 5D70H 3ARFC 4R4NC 1RURH 4LCUA 3IEAA 1ZSDB 5T1KB 4ZPTA 3FO0L 4LSRL 3WXVH 3EO0A 1J5OL 3BAEH 4NHCL 4NQEA 4EQ3A 3F6LA 5KW9H 1KXTB 3HCVA 4KXZI 5DJZB 2JSFA 4P3CL 3PIQB 3HG0A 3X11A 3NZUA 2EVFA 5ALBH 4KKPA 4ZPVA 4XGZA 4OZGA 4OKVA 5LAPA 4RGNC 3KJ4C 3UO8B 3MX0B 5I8EB 3G5XB 1NGZB 3RWDA 1MI5D 3BAWA 5ADOH 3BZ4B 4OH2A 3OX8A 3D85A 4QHPA 1N5YH 1VKXA 4PJHE 1Q8MA 4WKZA 4XE0A 1AXTH 2ZP9A 3CQPA 4A1RA 1AVAA 4YVNA 3JZYA 5IROD 3RVVD 5DWUH 5EO0A 3HB3D 5C0CD 3O11A 3IDMA 3RX7A 2XTJD 4UIMB 4F8PA 3MLXH 4P4KC 3X3FH 3TH2T 4BYHA 4DW2L 5MENB 5DHDA 2FX7H 5T3XH 4M7ZB 5L4JA 5BOJA 1IAKB 3I3BA 3BUQA 4PY7A 3ZGIA 4B97A 3AQZA 3UAAA 4KKNA 3H7BA 2GY7B 1NAMA 2V4LA 5F71A 3BRFA 2MNJB 4IQHA 3ZQXA 3B9EA 2BW4A 1KMGA 2D7PA 3C5ZA 4P2QA 3BP6A 1RUML 5FUZL 1RERA 4OLUH 4HDIA 5D7KE 5C0IB 4OM1H 2BZ7A 3WFBL 3JV0A 2A5UA 3LN4B 1QZ1A 4ZOAA 1CDJA 3UADA 4CC4C 4E9VA 3F7YB 5A3IC 3OAYH 2B0SH 5C9JA 4E9RA 4JO1L 2OMVA 2VNCA 2X0UA 4P9HL 3W56A 4HIXH 5JHDA 2J8UF 4U6VL 3GZQA 5ESAB 3BIKB 3EJTA 1NFDA 5GGTL 1ZLSH 3GK8H 2WW8A 2W91A 5JW4R 3CCHB 2X4QB 4RAHA 3P0YH 4O5LL 4OCYH 3AXHA 1UOLA 2ZOLB 3VXQB 1YEIH 3HN5A 5EZIH 3FB7B 3MRBA 1R5WA 4QUOA 4R7DB 5IM7A 1S8DB 4OCWL 5GJTH 5EC2B 3T3MB 1U8QA 3AU1B 1PMYA 1R24B 4LLUB 3PREA 4XVTL 2ZONA 2IVFC 3F7VA 1KLFA 3DROA 1YQ2A 1MXDA 3G08A 3OPUA 3MZTA 3IJYA 2JIXA 4QKXB 1IGTA 3QNYB 4JFHD 1PY4A 1SBSH 3VXUE 3BKML 1NDTA 2OYLA 1AE6L 1V3LA 1ITBB 2GYSA 2UYLB 1M3IA 3NJFA 3SJVA 1MFCL 5DS8A 2XY2A 1OY3B 5TD4A 3D0VA 2P43B 4QYOB 1M53A 4M61B 5FKAA 1UXWA 4H20H 3Q1SL 4IBUA 1MWAA 4OFQA 4WY7L 3UCRA 4AZ8A 3TBSB 1CYGA 3O3UN 3UEQA 3ESUF 1KZYA 3LB6D 3RGVC 3OKEB 1T6VN 4G6AC 3UERA 3HG1D 2G0LA 2YRZA 3SGJC 3LXUX 3I9AA 3V4UH 2MQ0A 1OWWA 3VFUA 3MOAH 5IVZB 4P2QD 2NR6A 4ODUA 5DEFA 4UTBA 3EF7A 3S36L 1G9ML 3U4EB 2PYEA 2VXUL 5CU9A 3L9BA 2FX9L 5F21B 3SDAD 1KCSH 3T3PB 4YQXH 5AAPA 4ABUA 1XFPA 1T1ZB 2MFNA 3NOIA 4EBQH 1TIUA 3QUYC 5SWSE 3HPJA 4NP4H 4YDLB 5JIQA 4PJIF 4KK8C 4MB3A 1DVSA 3KHOA 5D2LF 1O5DT 3MRNA 3SPVA 4U31A 2VW6A 1ORQA 4F7PB 3KDMB 3QG7L 4LHUB 4UDTB 1LNUA 5B4MC 2FO4B 5AEAA 2FH6A 3JV5A 3B2PA 4QOKD 1TZIB 3VFNB 3MUHL 3PV6B 4JKPH 3L1EA 1YEGL 1OARL 4IIZA 5EEWA 3OF6A 4DZBB 5EDSA 1LEKB 3R19A 4NN5B 4X50A 3SQBB 1RPKA 2D03H 1AGBA 3C8HA 5EMYA 1FIGL 4B9GA 1XCQA 2DQCL 1EUUA 4XP5L 4ODWA 2J72A 1VAHA 1OP3K 3QDGA 4DKTA 4A7GF 1JD7A 3DGGA 5TF0A 1CR9L 3DTUB 2PN5A 1YECH 2JIXD 1FPTL 4NZJA 4ZO7A 1U58B 1OIOA 2V3EA 2A4ZA 5DRNA 5D9SB 1M4KA 1CYWA 1LK3L 3LKQA 3SBQA 1FRGL 4JKKA 2VWEC 3VDAA 2Q0ZX 3SJVD 3O8XA 1DVYA 5FGRA 4ANWA 4I9WE 2ADJA 4ZNEE 3A4DA 1UWXK 3EZJB 3WKNA 1JERA 4KITB 2F53E 1CK0L 1RK0A 1YY9C 2GTWB 4PJ9C 1U93A 1NEZA 3ZZSA 3O9WB 4Y4FD 2YAOA 5D72H 1DJHA 5A6LA 2LFGA 5AVRB 3V4LA 4HCRL 1Q9WB 1M9SA 2AK4B 3DMMB 4PCSA 5DHYB 2PO6A 3BGFB 2P8MB 3FT2B 1NINA 5EC1B 4LO9A 5EFIA 3IGKA 1C5DB 5DRZA 4DKEH 4GBXB 1JV2B 1MHHB 4BFIB 1CD1B 4XN8A 3PP4L 4TQ8A 1QWUA 5GSVA 2A6JA 3MREB 4HLZH 2WINA 3TURA 3G5ZA 3H9SB 4J7RA 4X6EA 4AV5A 5I9QC 3B8YA 2H3NB 1TNNA 4UAHA 4Y9FA 3UC0L 1JBJA 3KPNA 4OW6A 4FULA 3R0MA 5BUPA 4D9RD 2HPOA 1M7DA 3TN0A 1LO0H 4OJFH 1WC7B 4Y2OB 3WKMH 3SGEH 3R4DA 5EOQH 1HH6B 5E1QA 3BVUA 4QGTA 2ED6A 2VLRE 5F93C 3GPSA 1DL7H 1GGCH 4N2MA 4NXKA 2A99A 1J05B 4JM2C 3KZ8A 2UX7A 5TK4A 5IHZB 1KPUA 3WLBB 1NZRA 15C8H 1R3JB 1ZTMA 2YMTA 3BDBA 4K73A 2NDGA 3MLWL 3QG6B 3T09A 2BK8A 3IVKB 4G1EB 4Y9BA 2ESVA 3D25B 3T0ED 1GKEA 4Y7OC 1V7NL 4UIKH 3KYAA 1HFUA 3DK0A 4MQTB 4KROB 4W70A 1GXEA 3W0WE 3MLRH 2XTSA 1SZNA 1M1SA 2H1PH 1IBYA 3QZMA 1BXAA 3D30A 5C3LD 1OCOB 4J8RB 2ZF9A 2I60H 4QF1B 4YHNA 2WKLA 4JO4H 1T5KA 2IWFA 1HNGA 1YVLA 5I5JA 1I3GH 4I13B 3ROLA 2A74C 1FVCB 2UY6B 2QV2A 1BM3L 5EULV 1XCWA 2NXZC 3VWJC 3D08A 1G7MB 2HKFL 3C08L 1S5IH 3NA9L 1ASQA 4JN2A 3UTSA 1JNJA 1YC7A 3LHPH 5C09A 2EAEA 5HHXL 1RZKL 4O9HL 4NZRL 4NUQA 3DX6B 3O2WH 4U7MA 1CCZA 1KB5B 1C1EH 2A9MH 4Z18A 4L3ED 3HJ0A 2PO6D 3BPNC 5C0BB 4JANB 2FQFA 5H35A 1MRCH 2Y22A 3HUJF 4XN9A 4YDKH 3X1NA 2FZ3B 2DQ6A 3CBJB 3JYCA 4FKKA 2ISDA 2F5AH 3MTRA 1AAJA 5HYIA 1WTGT 2R0WL 2YIHA 3ABZA 3LKNB 5EU6B 4NBXB 2YK1L 2WVSA 1MW2A 2O30A 4U6HA 2BIPA 1U30A 2I5YH 2J1XA 5DURB 4F93B 5A7BA 2CGRL 3QJZA 3RP1A 1LO4H 2E7LC 5I1EL 2AXFA 1SVZA 2HRLA 4OY9A 1AZCA 4MAYC 1N59B 3O3AA 5DK0A 2WLIB 5KWYC 1MG3C 2IQ9L 4YDNA 2A9NL 1RZFH 3PRZA 4I87A 2PCXA 2WWMC 2ZP0T 3TJEL 2OQJB 2AI0L 3STBA 1Y18B 2I9LB 2X28A 5E8EB 2VE6B 3NJVA 3VXPA 1JL8A 2JKXA 2RTTA 1BFVL 3MGOB 3QDJA 1JZIA 2XQ0A 4L1DA 1TENA 2OP4H 3Q6FB 4M93C 4P9HC 6PAZA 5IHUL 4PBWD 3FBKA 2R2HA 4LLYA 4R5TA 4P5SA 5DR5H 1OD9A 2A9AA 3DXAA 3HIZA 2QPSA 4FZ8L 4X5WB 1XSKA 4O00A 2Y69B 1WS7A 2GAZB 2VDQL 4KTDH 2ZPKH 3WFZA 5H4ZA 1A1MB 2XPGA 4PHZA 1WDAA 2O6PA 3GBNL 3I3EA 4GIAA 2HKAA 3ZKSD 3MNVA 3OHXC 4PJ8A 5HGDB 3IJSA 4P4KA 1L9TA 3EFFB 4YHIA 5E8PB 2L7UA 4KV5F 1KY6A 3S35L 3T5WA 3NEOA 3MRRA 3H3BC 4HLEA 2CGYA 1D5IL 5I1LA 5D96B 1NDGB 2CNYA 4ODSH 5IT2H 3KVQA 3O6KL 4JQIH 3MJ8B 2ITDA 2JB5H 3AC0A 3OKNA 1IBHA 3VXRD 1MNNA 1IE5A 3ZUCA 4P3DA 2YAFA 3SO3B 1XGRA 4PGJA 1WISA 4RFEB 2EYRA 4KQ0A 2KC0A 4N6QA 3LVEA 4WI7A 2NX5E 4YDJA 4Z77A 2WPGA 2DQFB 5EORH 3NQIA 4FCHA 1MCPH 4P4RB 2TRYA 1NANH 2GJZB 2VRAA 4M43L 3SOBH 4G6JH 4PJCE 3P9WB 1KCVH 1XF5B 2HH0L 3O2VL 4P9MH 1T1WB 5E08H 3KM1A 5DUJA 1C16A 1YDPA 4ZW8A 3F65A 1DBMH 3TYFA 3EDKA 1XTMA 4XNMA 4HUVA 5I66B 3IU3B 4HH9B 2G9KA 3B6SB 1JXKA 3LD8B 4U1JB 3GSNL 4PVLA 5CP7A 1RP8A 4ELME 4K3GA 5CJQH 4ZUSA 3GJFK 1HIML 5IHHA 3KS0J 1DUZB 1VFOA 5I1KH 4AQEA 1X5MA 2EDEA 4O4YL 3RTQB 4YDVB 1G9MC 4OKDA 4H8PA 3TC9A 4G72B 3UO1H 4RGMB 3GMMA 2FEDC 3NIFB 4DN4L 1HKLL 5D7LB 3P9MB 1XF2A 1MIEL 3W37A 1RSYA 4R7LA 3QDJD 1J0IA 2QPEB 1KGCE 3RGHA 1JFQL 3ZMRA 4FQXB 3HAEA 5CJBA 2C9QA 1NCCH 5DQ9A 5EOTA 3O6FC 5CLZA 3RWGA 3MRCA 4YSOA 1DQJB 3M8OL 5AW7B 1HNYA 1QBAA 4MXQC 3CMGA 1KDIA 1URLA 3WTVA 1WYJA 1BAFH 2XNAB 3DPBB 3ISWA 1KULA 1FN4B 4LSQH 5HGBA 3KBEA 2FGWH 4NCC1 2ZG2A 3HS0B 2FWUA 4PJ8D 1XDTT 1B4JH 1JFHA 3SPGA 1ED3B 1E6JL 1I9EA 4PD4K 3RGVA 4HOZA 4A63A 4TL4A 4WO4D 3SGJA 1WGOA 3BT2L 5CZXD 3CXHJ 4JB9L 3NDZE 3TPUA 3AG2B 4K3DL 1OM9A 3QQ9C 3SD5A 2VM9A 1A9VA 2AGJH 2VDRH 2VO5A 2ARWA 5GGSB 1E9PA 4K7PL 1AGEA 5FGBC 5LBSA 4LLDB 4FQCH 5A43C 3IDJB 4M1CC 1IL1B 2ITCA 2B16A 4D0CA 4X6CF 1EJ6A 1OW0A 5FW7A 4PGBA 4I85A 4WWNA 4XXDB 1MPAL 1QFWH 1ZA3B 2X4NA 3HLKA 4PRHE 5DU7A 5T1DL 3UC2A 1BMZA 5I8OL 1Q0YH 1BJ8A 2GCYA 2UZXB 3PL6C 4FNQA 4PCTA 1SQMA 3LS4L 1HWWA 4B9IA 1F4YH 3CN1A 1XH1A 4ZXBC 3CFDB 4R97C 1AOHA 5DMKB 3U4BH 1ORSB 4P49A 3NP3A 4KQ3H 4M03A 2P26A 1JWMB 3UBGA 3AQYA 5FUCC 5C2BL 1NCHA 1FDLH 4K7FB 4N8VA 4WW2B 4IDJL 1D7BA 3DBSA 1GC1L 4W1TA 1NGWA 3GIVB 1USZA 4XO9A 1N7ML 3B9KA 2Q86B 5CN2A 3RURA 3CZGA 4TUUA 4KO7A 4QXUL 3QJHA 2LE9A 4KVNH 3BE1H 5DZ9A 3ZK0A 1XIWA 4IGBD 4FQJH 5DO2D 2DI8A 4K23H 3PNWB 1JRHI 1RIUL 4AYFB 4Z95H 4N2BA 3FONB 1WZ1L 4RSYA 2QGDA 3RIAF 4TQIA 2WKOA 3FFCA 4NRYA 3O6LL 2BMKB 3OLIA 1QRNB 3ISRA 2WXJA 1N26A 3F7QA 5LGYA 1D6EB 4FTDA 2C3WA 3QZWB 4TNEA 3SE8H 3TV3L 4XC3H 1ET8A 3VMPA 3MRPB 5IB3B 3CC5A 1CBVL 1CTNA 5E5UB 1W72L 5IFHH 3LMJL 3WNOA 4LPWA 4WU5A 3G5WA 4MYWB 4X8CA 3ATDA 4OZHF 3FZUC 5F1KC 2FT8A 1DQIA 3ZKQD 1USQA 3J7HA 4APXB 1CE6A 4JFPB 1X3DA 2C34A 2LAAA 1BXUA 2F0CA 3WIHH 3GMQB 4GXVL 1S9XB 1F58L 5SV3A 3S6CA 1MUJA 3QCTH 3IMRA 5LNEA 3RDTC 2BHYA 2GBVA 1TTBA 4ZSOE 3WKQA 2JJSC 2O5ZL 3Q8AA 4FYQA 3CFEB 3G6DH 4KHXH 1A6ZA 4FQIH 3GI8H 3E6FA 4LKXB 5EO1B 1MF2H 1H3GA 4ZUTA 3WIIL 4KZCA 4OCRH 3CSTA 3D52A 3BAYA 3UTZB 1TSHA 4JFXA 4AT6B 2EE2A 2VQ1B 2BP8B 4FTVA 3VD0A 3M07A 3BZFB 2VSCA 2UY7A 3TFKD 3QHFH 2WLLA 5T3ZL 3WI9A 3OVUB 2W9DH 1PX3A 1ZHNB 3OL2A 4P57A 4C83A 4EI6A 5MEOB 2FUTA 4OZFB 2QL1A 5DTFA 3FU8A 2Y3AA 1Y6KR 4WGVB 3QJUB 3WS3B 3E7JA 1EBAA 3HHMA 2A9DA 4JFTA 1NCAH 2CO6A 2HTLD 1BOGA 1NGPL 2E7MA 2GJJA 4C47A 4JUTA 5E2TL 3GO1L 5I1HH 3WU1A 2RAMA 1C08B 5AVVB 2AKRB 5BRZA 2JELL 3MO1A 3QQ4B 2VXTL 1QKZH 2BW5A 4MB5A 5JIHA 3DX3A 1VFMA 2BDNL 1L7TH 4GFXA 4Y19E 3ESOA 2Q8AL 1T21A 3DRQB 4PG2C 3S2AA 5K9JH 1JOIA 1UD2A 3L4YA 5GHWL 4XP4L 1Y7VA 1I8IB 4B9FA 1P7HL 1CE1L 5KSAB 3RJDA 3PABA 4HC1L 4YXHL 6FABL 2IPTL 3FFCD 1YEEL 4LCWE 4R4BA 3CLWA 3L3KA 2YC1A 3VAEA 2VTFA 4NRZB 4D8PA 2XETA 1OLZA 4P5MB 2BVOA 1PLGH 5FLVA 3IGUA 4U6XA 3ZKMC 4BFOA 3OB0K 4ZS7H 1Z32X 5J9PA 3GSWA 3CZFA 1V3JA 4RX4D 5BO1H 4LLQA 4N2AA 4PGDB 1EHLH 1GS7A 5FPIA 2PXYB 4JFYA 4H5SA 3ECBB 2NLJA 2LU5A 3H2PA 4EOWH 4FNTA 4BE6A 5JQ6L 4MASA 5I6LA 5CZVL 5BS0D 5D1QC 1ZT1A 2V5RA 1YEHH 3TBWB 5FOBB 2YWYA 1L9NA 2XVBA 2WNWA 2OXHB 3K2IA 4JJHA 4G42A 2OBGA 1G94A 2HTKC 2IPUG 1KTJA 1FNHA 1VIWA 1CFQA 2WVUA 1XR9B 2AC0A 4KKZA 3WN5C 3FO1A 3PJSA 4DGUA 3MJ7A 5BZWB 2P5ED 4DEPC 2WLMA 1AKJA 1QFPA 3WE1A 4DUVA 4DCQB 3D5OF 1JI2A 4EIGB 3CZLA 1B0GA 3RYMA 3MXVH 3QDMD 2BRRH 1FF5A 1UM6L 1PYWA 2WWKT 4WUKL 5CR8A 4UNVA 1URIA 3FKUS 4A7UA 3ARTA 3UIYA 1MAJA 4AGOA 5HI5D 3L3IB 1IC0A 5TDNB 5KUKA 3G6JA 2AXWA 1LEIA 5G4MA 2YJQA 1N5AB 1Q72H 4MCMA 2D8KA 3G5YB 1ZLDA 2ENSA 3DX9A 4YK4B 5SWQA 2LT9A 1QSFB 2D3NA 2F08A 2HLFC 1QFUH 1E4WH 1IARB 2GSMB 3IJEA 2ROXA 2ZD0A 4XMKH 3GXTA 1OAQL 4R5VA 4WO0A 3T65B 3F6JA 3FO9B 4RIRA 3IFPB 4N0CC 3UBXB 1M71A 4HIHA 1F8TH 4Z7QF 4AXWB 1C5BL 3BCDA 4S0TD 2V6HA 2EIDA 3BP5B 3V7AG 4OD1H 1S7TA 3N04A 1MHEA 4LCUB 4YZFF 3APMA 3HFFA 4ZPTB 5FA4A 3B3BA 1OP5H 2ADYA 3EO0B 1IC4H 3OKKA 3GS7A 4APQB 1LP9F 3UGXA 1J48A 5AOMA 3LIZH 1GZHC 3ULUC 4NQEB 4XVOA 2NSQA 3HCVB 1D7DA 4W9EC 2ZAHA 4BWTA 5JPNB 1GL4B 2P80D 3B2VH 4POUB 3C5JB 3BDXA 4ZUWA 3X11B 3SYPA 2ZOKA 1M05A 1MEXL 2I69A 4XO5A 2QQQA 3CHOA 4JLRB 3TO4C 4ZPVB 4XGZB 4OZGB 3ZHLA 5DS1A 1MQKH 1A7BA 4OKVB 3RVTD 4X8XA 5DT1H 1VGKA 3U7YL 3IGLA 4HWNA 1KEMH 3RWDB 1II4E 2JI1A 3ZKND 2VDOB 3QEHA 2BSRA 3OX8B 3D85B 3QS3A 4UMSA 3ZE1E 5C0DB 2ZKHH 5DJDB 5BMFL 5I30H 4WKZB 1VKXB 4PYGA 4G8GA 1TYJA 3BWUF 2X53A 4UT6L 4XRCB 1SFHA 5EO0B 1J9SA 2L3BA 1AKJD 3D3VD 3O11B 3ROOA 4EIBA 5C7XL 3HE6C 4M8VA 1PG7H 3B34A 4IKNA 1NL0L 4FQHA 4LVNB 4PY7B 1ETJA 4PY8I 3H7BB 2X89A 1SLUA 3D12B 4JFDE 4FFYL 3HZVA 2NNCA 3M45A 1L3WA 1X5IA 2YOCA 1HSBA 3C5ZB 4P2QB 5B7MA 1HHHA 3BP6B 2FNBA 4GP5B 3GSRA 4XR8C 4N6RA 4MHHI 4ETQA 2XC8A 2AABH 3M46A 4YSPA 4AY0A 4O51A 4G6FD 4WUUA 2ICWA 2LLGA 2ZYIA 3AU0A 5AW9B 4GIPD 4K3JL 4K9EL 3D6GA 3SKNB 1PJWA 3N3EA 5C9JB 3E6HA 2OMVB 4ES8A 5LCVH 5JHDB 1JPFA 2JWYA 3L2NA 4V2CB 3D34A 1Z66A 1YMMD 4UB0H 5CGYC 1K5WA 3MV8A 1MJJB 5IHBA 2WBXA 1NFDB 1NGQH 1S7XA 1UZGA 5FUOL 4LLVA 4WTQA 3IN0A 4KX9A 1GC1C 1KB9J 3ULVF 2CMRL 2EIBA 3OQ3B 4K2UH 2VDKL 4HIJB 1KTBA 2ATAA 1Z9MA 2MQ3A 2PR4H 3SY6A 4M02A 3VFPA 1R5WB 3LSOA 3GDBA 1CGSL 4P07A 1QOKA 4X6BA 3QJFB 5D6DA 1PJ9A 5IM7B 1BLNA 1MHPL 5F96L 1TZHB 5E2VH 3BOVA 1GPOL 2BP3A 3QFJE 1T2QL 2PW2A 3GIZH 4NNYA 4JGMA 4F58H 2W9EH 1TZOA 1KJ3L 2DQUL 3F7VB 4X5PA 1A6WH 3L4XA 3DROB 1FNAA 2J88L 5F6HI 1QR4A 2IWKA 3IJYB 2X9ZA 3JBG7 1BZ9A 1X6NA 4J3WA 5D1ZB 3U0PA 1OV8A 1VHPA 3NIFF 4NEHB 3SQRA 3K5SA 1PW3A 2X4TA 1AMXA 1YEJH 3MLPA 4WSJA 4ALAL 1ZS2A 4ZW6A 1OAZH 4R0LC 4G8EA 1BIHA 3I9GH 5DS8B 1E5ZA 3DVFA 3SJVB 5IVNA 1W0VA 3VD9A 3D0VB 1IT9H 4BBWA 4G8GD 1C7SA 2WYIA 3KJ6H 5FKAB 3A67L 1MLCB 3F6IA 4A6YL 1LDPH 1MWAB 2JI2A 4FKEA 1R9FA 1IAIH 3H0TA 4NENA 1JZDC 1WFUA 1BAWA 2L4OA 4LESA 4TVPD 1QTYT 2FHBA 4OJDH 3FU5A 3T2NH 4EI5A 3VFUB 4XXCC 4YE0A 4PJXF 5DEFB 1AQKH 4S1RL 4HJUA 1AGDA 2PYEB 3T4AA 4NWUL 3N40P 3CUPB 2A6KB 5GJSL 2YAQA 2NY5L 4F7EA 3S8GB 1UASA 5JORA 3OBAA 3DIFA 1KB3A 4E41A 3QWRA 5ESQA 4GQ9H 1TZAA 1YYLH 4ODTH 4NOBA 2DLFL 1I8LC 2NY4C 5EWIL 5KG9A 1ZMYA 1U8IA 2ITEA 4IBYA 3VB8A 1K8IA 1WCBB 3MRNB 3SKUD 4DGVH 1ORQB 1JGVL 4N20A 3RWJA 2OK0L 1CURA 3ARBA 2VZSA 1LNUB 2HFGH 3DA0A 3IPEA 3PWPE 2A1WL 5H37G 4IRJA 1OOWA 1DQTA 5D7IE 3MDJA 4ZFOL 3PE9A 1QQDA 4AM0Q 4CMHC 4FFZL 4MMXB 4ZW7A 1PG7W 3MJWA 3P40A 5AB9A 1F1GA 4Y16C 4WW2F 1AGBB 2Q5BA 4JRWA 1XCQB 1XF4B 1TQBB 1J8HA 3NJHA 4FE9A 4ODWB 2GJRA 4K9JA 3LKSB 3QDGB 1G7QA 1MCBA 3MYZA 5TE6H 1U8NB 3DGGB 1IM9D 4LBEA 1GYAA 1MFDH 1SY6L 4PJGF 1WZMA 5L2KD 1UA6H 2ZP8A 4UTAL 4LCCB 1MAMH 2CD0A 1A7OL 3LKQB 3CHPA 3HLAA 3IE9A 3ZE2E 1PTZA 2GHWB 3O8XB 3FCSA 4N85A 4S1SH 4AG4H 1XH2A 2ADJB 2MTAA 1V3KA 2CO7A 1E7VA 1CLZL 6CGTA 4MNGA 1AY1L 2L7QA 1MFUA 2NW3A 4IS6A 1U93B 1NEZB 4PJEE 4FG6D 2LAGB 1IGJA 4M8QA 3GKWL 2PO6B 2XXMB 4PQXA 4DUXA 3KLKA 5EFIB 3FCGA 5AW4B 5ERWA 1DSWA 3BUBA 4N9GB 2VC2H 2VDLB 3HFML 5IQ7L 4OGXL 1KT2A 5EBLA 1MJ8L 5I16B 3Q9PA 4UM9B 1XSJA 5SX4H 2EDFA 2JCCF 2JQZA 3EJUA 5GSVB 3WIFA 2A6JB 3CH8A 2CK0H 4NSKA 4UBDD 1CQKA 2WINB 5C97A 3ZN6A 1CZ8L 4X6EB 1CXFA 1WIOA 5GPRA 4KXDA 4QLRA 4NAQA 4DESA 4Z5RA 4JG0H 1JGDA 1X5KA 3KPNB 4E41D 4QNPE 1M7DB 3D2UA 4MLIA 1X5HA 5DEGA 3TN0B 4BM7A 4DQAA 2AITA 4OCSH 1M6UA 3QUMH 4YH6A 5KYYB 4HPYL 4RMWA 2VLKB 3RDJA 2DAVA 2YPVL 3N0AA 5HHMD 3VD7A 1OWRM 1VF5C 4MA1C 4UQ2A 1E4HA 2HWZL 3CFIC 4AIEA 4E9YA 3K3QA 2X3BA 1KPUB 3ZRCC 4X99A 2EO7A 3AT8A 2J8HA 4XCYA 1RUAH 2ESVB 3RB7A 4YMPA 2HMID 2VDML 4XTRC 1BQHG 3EJJX 4O02L 5ESVA 1L9SA 4N0YL 3EDDA 4WTZG 4DVBA 1B9KA 2AEQH 3QRFM 4F15B 5K5YA 4KXZH 4J3SA 3EJZD 3RWHB 2K3HA 1NFAA 3KBHE 5C0AA 4GG8A 4YHNB 3PQYE 1OT1A 2C7UA 1L0QA 1NC2A 2E46A 4HQQL 4Q7DA 4YLCA 4LQFL 1PG7X 1U2HA 3UTTE 1UFUA 1XXDC 3T8MA 4A2DA 3M1BA 1JIBA 3NPZB 2AEPH 4KK6D 4N1CA 1X44A 4YHYC 1T83C 4OZ4A 1UACL 3K6FA 4JN2B 3I9IA 3UTSB 3WMSA 4K8RH 4Z7UE 2PWFA 1N6QL 5C09B 1G7HA 1FV1B 3L5IA 1MFBL 1QSEA 3DX4A 5DEZA 1DZ0A 1QLFB 1U9KA 1WAAE 1ZY9A 2Z31D 4Y1AE 4X98B 5EEYA 2BY0A 3BKYH 3IBOA 5IQMA 2YD4A 5H35B 2QFRA 5DSCA 4LSSH 2DZEA 3KR3L 5E6ID 3NCYP 3BIAX 4I0PA 2A2QT 5E03A 1XAUA 1ZANH 2XZCL 3L3JA 5CLXA 1UADC 4NC1C 4W9JC 2OSXA 1RVFL 3KL5A 4LASH 4S0HA 2AV1A 1EFQA 2XWXA 4U6HB 3WFEH 1DJWA 1GA2A 5CMAB 1N4XL 1K8DA 5D7SL 1PQZA 2H1XA 4H0LC 1F6FB 5EHFA 2AXFB 4HFUH 3W9EA 3NN8A 3F12B 4R96A 3O3AB 5DK0B 2VDPL 2AQTA 4TNWK 3NP4A 1I1AC 4FQ2H 4R6UA 1N2RA 3SDDC 2XY1A 4A39A 5K9OA 2J44A 1PBYA 2QHRL 3DDGA 2RACA 3VQMA 4LAQH 1WHOA 4RGNB 3OJDA 4Y5YA 4HJGA 4PJHA 4BKTC 5GGVL 4N1HB 4X9IA 2R2HB 4LLYB 2CO3A 3KBPA 3DXAB 1GSKA 1KN2L 3PJN