1TUPA

Tumor suppressor p53 complexed with dna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
196
structure length
196
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*TP*TP*CP*CP*TP*AP*GP*AP*CP*TP*TP*GP*CP*CP*CP*A
publication title Crystal structure of a p53 tumor suppressor-DNA complex: understanding tumorigenic mutations.
pubmed rcsb
source organism Homo sapiens
molecule tags Antitumor protein/dna
total genus 42
structure length 196
sequence length 196
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1995-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1tupA00
3WTXA 4IBQA 4L0ZA 4AGMA 1CMOA 3Q01A 3D07A 4IBYA 1KZYA 3D0AA 1GZHA 5LGYA 3D05A 2VUKA 1GZHC 4LOFA 2BIQA 5AOIA 2X0UA 1H9DA 2J1WA 4IBUA 4QO1B 2OCJA 2ATAA 3Q06A 5AOKA 5ECGA 5KBDA 4AGNA 2X0WA 3US0A 5AOJA 2IOIA 3EXLA 1HJCA 1LJMA 2BINA 2J1XA 1T4WA 5G4NA 2YBGA 3D08A 2PCXA 4IJTA 4MZIA 2RMNA 1EAOA 1EAQA 1UOLA 3KMDA 3WTUA 4LO9A 5A7BA 2XWRA 4MZRA 2BIMA 3WTTA 4HJEA 4AGLA 2AC0A 2IOOA 4AGQA 4KVPA 3WTSA 2FEJA 1E50A 2BIOA 4AGPA 3VD0A 2ADYA 3TS8A 1HU8A 3D09A 4IBVA 4A63A 5AOLA 5ABAA 2J1YA 2J20A 5LAPA 1TUPA 2H1LM 2XWCA 2MEJB 5BUAA 3KZ8A 3VD2A 3Q05A 3EXJA 4GUQA 3QYNA 2J21A 3US1A 4L18A 2AHIA 3IGKA 4AGOA 3IGLA 4GUOA 2GEQA 3WTWA 2P52A 1TSRA 1EANA 4XR8C 3WTVA 5G4OA 4IBWA 2WGXA 5G4MA 1CO1A 2IOMA 4LOEA 4L0YA 2J1ZA 3ZMEA 1YCSA 4IBZA 1HJBC 4G83A 3QYMA 4IBTA 2BIPA 4G82A 3WU1A 5AOMA 5AB9A 3WTYA 4IBSA 2J6WA 3VD1A 2X0VA 3D06A 1IO4C
chains in the Genus database with same CATH superfamily
3BAXA 3QUZC 3NFPB 4GT7A 5DZJA 4LMQI 5MEPA 5MHSD 4DP1X 2PUQT 1ES0B 1OSPL 4I87A 3GZKA 3GTNA 4JK0D 5IQ7H 1RZJC 5L4IA 5DMYA 4HGWB 4R2GB 3PE9A 2EE2A 5J3HD 5CEZD 5EFIB 4ELDA 3G5YB 1MCLA 1TU2A 3HE6C 2NY6D 3D39A 1AGFB 4OF6A 1OARH 3KGTA 4G6AD 1TJHH 2J44A 2VDKH 1E5AA 2IPTL 2OJZH 1NMCB 5DEFB 3UO1H 1SXAA 2HAZA 3O4LE 1XTLA 3WJJC 1ZGLB 3L16A 3QUZA 4CSZA 1DSFL 2C26A 2XA8H 4LB8A 3FL7A 3HFMH 4K3DL 1YEDB 3N44B 3JUZA 3QUXC 4U1HA 3UG5A 2VLRE 5E2TL 1F4XH 2CR6A 5GZND 3VXRE 1A9VA 1MAMH 2Z91B 3JWDC 2OL3L 1NMAH 4BD4A 3HLAB 5GGQL 5HYSA 3HE6A 1VACA 2UZXB 5AKRA 2IPUK 4HD9A 2BH0A 3DXAE 4Y19D 5DJCA 4LOVA 5DS2A 4BFIB 4HJEA 2ESVA 1MI5E 4POUB 2W80C 4KK9D 2OSWA 3L1OH 3EG9B 4ZTPL 4KXZH 4D8PA 1XCXA 1ZHLB 1NIDA 3D4YA 3SDYL 3QUXA 5B7FA 5FECB 1P5UB 3WIFA 5F7KC 1MVUB 5EUOE 5C09B 5HYJE 2PP7A 4NFCA 1LK2A 3MRLA 2KS0A 2DF3A 4RGOL 4F15C 2PR4L 3II2A 2WLYA 1GYCA 2D3NA 4H2AA 3RZCC 1RJZB 4QUOA 3US1A 3EFFA 4DTGH 1A22B 4AUJA 2JSFA 4I2XE 2IJ0C 2ZYSA 4XZUA 4ZODA 1GS6X 5FKAA 2Y72A 3C8DA 4RFEB 2NY7L 4L9LC 3UBXI 4HIJA 1SXZA 3DJRA 4WIQA 4M03A 3KLKA 4H88L 1QVOB 3ILEA 2Y25A 4OZHF 4Z7WE 1HK6A 2EDDA 5T1JA 1T5XA 2N7SA 4L05A 2D0GA 3OMIB 4NN6C 1YN7A 2A83B 3DIVA 1QEWB 5F71A 2G75B 3RZCA 4AZ8B 2ENQA 1G0DA 4IKLA 4FYQA 1JTPA 1EVUA 4GAGL 1GS8A 3RIKA 1KJ3H 2R27A 2VO8A 4WUKH 4DAGL 3NCEB 1ORQA 4GO9A 3D6GA 4R90H 1ZTXH 1UCTA 4PS4H 3L5JA 3MV7D 4OM0H 4OGAD 2NCMA 2F53B 5C0RL 1DE4B 5EF1A 2BNRD 4O02A 2ZX7A 5LN8A 5FGRA 2K8MA 5ACZA 2YAQA 2FLBT 3H9YA 1G6RH 2XQYA 4L37A 4KAQL 2FEEL 1E9OB 1JZGA 1DBAH 5SV3A 1IGCL 5ICYA 3BYTA 1GYUA 2PCFA 1LWJA 4M5YH 3RZWA 4FNPA 4KFMA 4YDIH 4BZ2A 5D70L 4N8PA 3CG8A 3ULUE 5HHOD 4BWWA 4NQDD 1RJLB 3C5ZB 5DYFA 4PTTB 2ORBL 3S9DB 1ZLUH 1T04A 3HE7B 5CHNB 3QGVA 3ESNA 2EE9A 3LN5B 2A0LC 3P4OB 1MCOL 3TVMA 3FU7B 5DWUH 1IU1A 3LV3A 1F41A 3VXSA 3DJ9A 2OMXB 1QATA 3B3BA 2X38A 4GXFA 1CXLA 4FABH 4XMLL 5ANMB 2OZ4A 2JB6B 2WVVA 4PVLA 1E27B 5AVZB 2CD0A 5I1GH 4M7LT 4ZW7A 4LARH 4G1EA 2BNQD 4WWKC 1OCOB 4GEIA 1NGQL 2HX8A 4NUMA 2F74B 2JB5L 1UVQA 4PRHD 2NW2B 4LSSL 1NEZA 4PJXB 3WN5B 1L7IH 1AQKL 3BKYH 4CGUB 3T5WA 1OHQA 1TPXC 1WUNT 3TASA 4NB7A 5JOPE 4TYUA 3S4SG 5AVWB 2HFFA 1RIHL 3D3VB 2IF7A 4FI7A 2K6ZA 3S7GA 5EU6D 4UTBH 3RWCB 5ALCH 5I1AB 4HIPA 3RWIB 1BQHB 1I1FB 1NAKL 4R4ND 1OOAA 5ESVB 5AAMA 2BSTA 4G6ML 3PPSA 2VR9A 3PWNA 1YNLH 3O3EA 1J0YA 2VITA 4O2CA 2JV6A 5E9AA 2CA3A 2Q8AL 5E8PB 4YWGL 5L0QB 4HPYL 3BX7C 4BA0A 4XXDB 3UEQA 1DJWA 4ZFFA 4FERA 4YN3A 4TSCL 2A73A 3AREB 5IM7B 3NJGA 2K45A 2OMZA 3O6ML 3HC3H 2WXQA 3PDGA 4PTUA 2HCZX 2HH0H 3LN4A 3MODL 3T09A 3OPZH 4OGQC 5FOBB 4QRPB 4LHUA 2VLLB 4K3EL 1QRNE 1ZWIB 2E75C 3AWEA 3NCFB 3OKLA 4UWQB 4JDVA 1RUKH 1AS6A 5MERA 1IM9B 1PNCA 4Y4KB 2W38A 3QBTB 1HKLL 1KY6A 1QSED 1A6UH 2J6WA 2QPDB 2K8QA 1E3XA 1J87A 3EYSH 4XB8A 5F0PB 2PW1B 1U8KA 3X13B 1A6WL 1PZ2A 4TPRH 3VXUE 1EXGA 3EF4A 1SDYA 2A9NL 3WELA 4I48B 1QR1B 3S37L 1EZVY 2JCCF 4OZGB 4UAHA 4OVUA 4KVCL 4TNVF 1PZ5B 4LCWB 4DO4A 4FXKC 1AD9A 1XEDA 4P23B 4C4UA 8FABB 4JRYA 3N40P 2N59A 3H0TB 3KBPA 2C3WA 4IOFC 1TTUA 5T5NG 3KEHA 4XMPL 1FAIH 1WZ1L 4V1DA 3K81A 1OCZB 5IUSA 4LCYA 1R3LB 2GITA 2A9MH 3EHBC 2E7BA 4ODTL 4LOUC 3LEVL 1R3JA 3NP3A 4L8SC 3W9DA 3O3AB 1QQDA 1Z0NA 1LEIA 4Z7VF 4KH9A 5GGUB 5H94A 5AB0A 1TTBA 3EJCA 2VDQB 3PYCA 3QQ3B 2AQ3A 1MNNA 1UD5A 1V3KA 3RJOA 4AMXA 2V37A 4X6EA 5FO8B 3KXFB 4BJLA 1H3PL 2Q7YA 4X5XA 1S9VA 4X6FB 1JZ8A 3SPGA 3H1ZA 4ZMNA 3MMEB 4UOJA 2K70A 5C2BH 2D7OA 3GKZA 3TEYA 1PBYA 3FQTB 4JFUA 4NM4L 3TNNA 1TETH 1KBGH 3RDTC 3PXHA 2MIZA 3MNWB 1AG0A 1AO7A 1FDLL 5DJ2A 3WY2A 15C8L 5F7LB 1NZRA 2MQ0A 3GS4A 4K7FB 1X7TA 2Z93A 4RSYA 5EHFA 1NC2D 4FKHA 4PD4K 4D9RD 4K7PY 3G6JE 1CK0H 1OB0A 5DJZB 1IQWL 1Q9OA 1T0NA 2K78A 1IGJB 1Z9SB 1LEKB 1HILB 4UYQA 5CLTA 3EXJA 1DR9A 5K93A 3HNSL 3INUH 4DN4L 4RGNB 4X99B 1KYAA 3BLKA 2FJGB 2FHBA 3N0PB 3AT9A 2YAHA 3DO4A 4XCEB 3SD2A 3JQOB 3RDTA 4P57A 5JQHC 2X6UA 4FJYA 2WKOA 5AQ0A 4V33A 5DVMA 4BFEA 5G4MA 5D1XA 4HU2A 1OGPA 4OCNC 1DQQB 1DZBA 5DLMH 1BQRA 1PGRB 2E76C 3O0RL 3SDDD 2QGBA 1FFOB 3LH2L 3B9VA 4OZFB 3N85L 3RU8H 2BWQA 5JHAA 3ARSA 3KPQA 1PNDA 3O6LH 2IWFA 4KFZC 3WTYA 3KLQA 2CDFA 4OIFA 1B0GB 3SE8H 4ANWA 4GBXB 3IMVA 1NBZA 2OXGA 1UT2A 1OCWL 5LXVA 1IAIH 3QQNA 2ZOLA 1G1KA 1VFUA 4JFED 4OF7A 2Q76B 3D2UB 3FRPG 5ISZE 5DUPH 1KT2B 3ROOB 3WJLC 1CGSH 2DWYA 3H54A 2WIMA 3N42F 2OYMA 3HZMB 3ABLB 3VFVA 3GSNL 1EH9A 1ZJAA 1WBZB 2AF2A 2AK1H 4N0FA 2QQKL 2OR8A 4JCLA 1E7UA 4AYDC 2FWUA 5FYJL 4QO1B 1UXLA 5IQLA 2X4OB 4Z7QF 4P48A 5HGDA 3VRLE 3ZYJA 4A67A 2Y2YA 2CBOA 4S2SA 3KPSD 5KVFH 2AEPH 4LEXH 2O5ZL 1XF1A 2YPVL 4GXUM 5DA0B 3UEZA 1A7BA 4Z7UF 2Z64C 4NKIH 5AL0A 5T3ZL 4Z7AA 5LHDA 4H5SB 3CLEL 2E6PA 4G8IB 1I8IB 4KKCC 4H2CA 4FQ1H 5F1SA 2ZKHH 2IH9A 5BOJA 4M1DL 5IMKA 1XB3A 4KO6A 4MD0B 3GS7A 3T0EC 2FJFB 4U1JB 1GZPB 1RH8A 1PZDA 2DEXX 4FQJL 4QOKE 5DUJA 1OM3L 1QPXA 4WWPA 3ZDYE 4JZOB 1AMYA 4NKDB 4FNLL 4X6CF 1FYTD 1PG7H 1EFQA 3HVDA 5ESAB 4YXHH 2F7OA 3MRBA 4NHCH 4MA3A 5DO2C 5E03A 2YC1B 4AIZB 1N0XH 2IFFH 3QDJD 3IGAB 3OWEA 3DVNB 3S35H 1PZCA 1Q8MA 3T3PF 1MCDA 1KGYE 3PLYA 4LSQH 3NTCH 5A2JH 1MAKA 1NPNA 3T0EA 3JTTA 4UZSA 4HIHA 3MR9B 1KDIA 4Q52A 4ZAKD 3VFSA 1PZSA 2F7IA 5DA4A 2K3HA 2HYMA 1YMMD 5CN2A 3QAZB 4HZLB 2VDMB 4PV8B 4X4YA 2A6DB 3TBYB 3UDWC 2E4TA 1I9IH 1RU9L 2R0WL 4RZCB 5E2JA 1Q0XL 1A4JA 1FVDA 5F6HI 2Z1KA 2MOGA 5KSAC 4LLQA 5D6CB 4LL9A 4QRUB 4XO4A 2NX5A 1LTXA 4ODHH 4PJBE 3X14B 1MN4A 1A0QL 3NCXA 3D9AH 2COVD 3GM8A 3WXWH 3FB7A 5JIQA 3F83A 3LHAA 4ODWA 4XNZB 5H35B 4AGMA 4QTIH 4TOYH 2MNUA 1AS8A 1AHKA 4JVWA 2UUDK 4KU1A 3ZZQA 1ZANL 4J3WA 4LHQB 3SJVD 1K8DA 2PYEA 3FH5A 4ERSH 4S0TD 5IFAL 4RDQF 5K9OB 2IALB 1IBGH 2HVJA 2M26A 4JL1A 3ARXA 5KSAA 4KKRA 1M7XA 3QUMH 5IREA 3EH4B 4GOSA 1JE6A 4HK0A 4FTDA 3UFIA 4D9QD 4HV8B 4R7XA 4PBVC 3RVWD 1CLZH 2YAEA 1U8MA 5D1ZI 5JMOC 4Z77A 1NBVL 3VWJD 4AQ1A 2GYSA 4Q9RL 1BJ1H 3EFDH 4WDIB 2NUTB 1OB1A 2BK8A 4F24A 1FH5H 5IUCA 4Z5RA 5DJ8B 1KN2H 2OYLA 2QHLA 3L17A 1ED3B 4M5ZH 4BE5A 5EC2B 1X9UA 4XC1H 3HRZA 2B59B 5J6HA 2HJKA 2R2EB 1X5JA 4I18A 2XVKA 4EIBA 4PRPA 3SDCD 1JGUH 2PLTA 3BYYA 2QSCH 3QFJE 3VWKB 5E6IC 1M2VB 4E9QA 3DARA 2LQRA 4IIQC 5E5RB 1JGVH 5D1QC 1SYVA 2WAQA 3OKKA 1K3IA 2PABA 3IF1B 1NTDA 1N64H 5EN2B 4L0PB 2BP8A 3RAJH 3WD5H 2IAAC 2WC7A 1JDCA 2FO8A 2WXHA 3L3IB 4IEFB 1FQ9C 2H5UA 3C2AL 1FE8H 3PWVB 4OF8A 5L8LB 3NZ8A 1G7MB 1JRHI 2DIEA 2Y7QA 4NNYA 4P99A 3KCPB 1WCQA 5KBPA 4RFOL 4UT6H 5B3SB 2YIHA 2WWNA 3ESMA 3MFFB 4GSXA 3RHWK 3RIFF 5E6IA 2Q6WA 4FX5A 4IIQA 5B1CA 2MKWA 4CC4C 1XDTT 2BY3A 3ZR6A 4AEHH 3KYMA 1T5KA 3MLXH 5F1IA 1R3HB 1AZRA 3QJZA 4NIYE 3GIVB 4ZUVA 3OGCB 5KJRL 1F18A 4C55A 5FB8B 2VZVA 2VDRB 4MX7B 4QGTA 5HGAA 1V5JA 2DD8H 4I5BA 1IT9L 3QSKB 3QIUB 3S3BB 1OTUC 1DJZA 3BXNB 5DD3H 2QVIA 3CU1A 2B2XH 2KLRA 3H55A 2WUCL 5KVGE 5HHQA 2ZYIA 5JHLA 4IMLB 2WCSA 4HJ0C 1JPEA 3V2AR 2LV4A 4LKCA 3QJVB 2Q20A 6FABH 1FRGL 1JPTL 1I7UA 2DWDA 1SXCA 3FT2B 5LBSH 1FNAA 2APVA 4ANXA 3H2QA 4YSEA 2MRYA 3I9AA 5JIMA 2WZ5A 4OZHB 1AZZC 4NCC1 1TMCB 4N20A 2VDLL 4YBQC 2EILB 1KEMH 2Z34A 2AVGA 3B43A 3O11B 3O8XD 3Q6GL 4APQD 3L45A 3WG7B 2ID5A 4FQIL 2YRBA 4NFDA 4JO8A 2MQ3A 3B2DC 3S8FB 1NDGB 2I5YL 4L1DA 4KRPC 4P5TA 4KDWA 4QCIB 4EDWH 1S7UB 5DS8A 1GCYA 4R5TA 1S9WA 3TIEA 2X87A 4AGNA 1MXGA 3AG4B 1VRSA 3WLBA 1E4HA 4B41A 4QNPF 2F1AA 2NNRA 3RWJA 4N3UA 4EDXB 3FH7A 4N0YH 2HRHA 2TRHA 3AY4A 1TITA 3DX1A 1IGIL 1EUTA 5BRZE 2X4UA 5AUMA 5F7FA 2WXMA 2CLVA 3EJPA 5I74B 4JRXA 2VR8A 3DX4A 4N0RA 2EC9U 3T8XA 2AERT 4BH7B 5IHZB 4ZO6A 5I76A 3V6OE 2Y5TA 3C5SB 5D93B 1NL0H 1FG2B 3M88A 2WNKA 3FW6A 3L9RA 2VUYA 5FUCC 2N0MA 5IEHA 4AYBA 3CBKB 2DAVA 4FZ8H 3BZDA 3B9KD 3CMOH 4NZDA 4CAGA 1UD6A 2IMMA 5BO0D 2A4ZA 4Y4FC 5B7EA 4G8EB 1N10A 5GS0D 1LP9A 3DRTA 2HVKB 3LSOB 2X89D 1PSKH 1ZAGA 4P3CL 3SYPA 4F2ME 5AW2B 2EUXA 1YRKA 1ZLDA 1KC5H 4P49A 3FQWA 1U8JB 2RCSH 4OQTL 4JPKH 2LFEA 2GBTA 3EJQA 1NANI 2BSDA 1D5IH 1ID2A 2J21A 1A9BA 2BOCB 4OCYH 3MRKB 4U3HA 4UU9A 5JUEH 4J23A 4PRDB 1JGEA 4XPHL 4CKVX 1KIUB 2ILLA 3S3JA 2A6JB 2V33A 4G6KL 3E1F1 1CE6B 1LE9B 1I1YA 2ED6A 2D03H 2K7PA 3SDXA 4LKXA 3MRJB 3MV9D 4N85A 5MEND 1Q1PA 4EOWH 1X3DA 4OCRL 2QQLH 2P24A 3FOLA 3CZFB 3S36L 4LQ1A 5IBUG 5EWIL 4KO5A 3KW8A 4QGYA 3C5XA 1INQA 3M7OA 3ML9A 4JN2B 5C0BB 1UWEH 4B0MM 2CJSA 2DM2A 3EGSA 2ZP9A 1JMZA 3FQ4A 4PCSA 3A4AA 1KLGA 2NYZA 1NWPA 4JREB 3UTSA 2J6EH 1FA4A 3RPBA 3OJMB 3T2LA 2PYFB 3IFPA 4GRLA 4CADB 5EORL 3TBTA 4UBDD 1MJ7H 4H8PA 1XCWA 4QT5B 1KB5L 1A8ZA 4TVPH 4R5VA 4CN4A 4L8BA 3B4NA 1N70A 3QRGH 4U1IA 2BVPB 2EEBA 2PCYA 4UDUB 3I6KB 1ZLWK 4MDIA 2DB8A 1V3MA 2EEDA 1PY4A 5CGTA 5DJYA 2UY6A 3GEFA 4WI0A 1CE1H 1PZAA 1HCVA 4IRJB 3L4ZA 4UAOC 3RG1C 1MLBB 4WHTA 4OD2B 3K71B 2ICWI 5C97A 4J2XA 4OB5L 1JYVA 3KPRB 2QFRA 5D72L 1QTSA 5E1IA 3D69B 4ZNEE 1PEWA 2BSSA 4ODSL 4Y2DD 1IE4A 2WQ8A 5AD0B 4GI8A 1UWXK 3QRBA 4WWID 5A6MA 2PXYB 3WEBA 1V7NH 2ZSWA 5DHYA 1YEGH 1M1XB 2QHRH 1J05A 2GJ6B 2CGRL 4PJDB 3VD0A 2VGLM 3HG0A 1RP8A 1F4WH 1XF5A 4FEMA 2BVEA 1D6EB 3UYOD 3WFCH 4E68A 5JW4Q 3P9WB 2VZSA 4PJ9A 4YNYB 1JZ2A 2DLHA 4NKOB 4NJ9L 3IPFA 4RMVA 4Z7VB 1HNGA 1LMKA 1JK9A 4QHPA 1EA9C 3RPKA 1II4E 2QADD 4JFFE 4PCTA 12E8L 4PQXA 4Y4HC 3NCYP 5H37H 5ID0B 4QTHA 5CR8A 1W0VB 2DKSA 2PPFA 2H26A 3D33A 3FT4A 1H6FA 4TRPL 1URLA 2LTQB 1SDDA 2C3XA 2FD6L 3UZEA 1DQJA 2KT6A 4LCVA 2EDKA 3NZUA 4PJIE 2H2SC 4MJIE 4CVXA 3H7BB 3AXHA 1WIPA 4IBWA 2DLGA 3QNZB 3SO5A 1Q1JL 4U1SB 3S3PA 1RUQL 3S48A 1YCSA 1LDPH 1MRFH 4Y4HA 3VDBA 3KPOA 4I0PC 3S96B 4JFYB 2Z0UA 4Z6AT 3EYOA 4A6YL 4YPJA 1MHEA 1NAMH 4WI4A 4CDHA 3A21A 3TV8A 2BMKA 3L2MA 1BM3H 3JBG7 3L6FB 4PWIA 4KXBA 3BQUC 3QJOA 1E5YA 1GMEA 4JG0H 2HG5A 3QEQD 2Z4QB 3MXVH 1RMFL 2EECA 1HEJC 3UJIH 4YHIB 2HKFL 1Q72L 4NXKA 1CFNA 1DQVA 1DUZB 4RNRA 4AVKA 3ULUL 2WBJA 3V4PL 2ARWA 2J8UB 3FSAA 4NGHL 3UAEA 4NZJA 5DHMC 4LIQH 2HRLA 5JO5B 3CFMA 4HIQA 1MWOA 4I0PA 2NY1D 4JAMA 3EJZC 2G5BB 2PN5A 1TEFA 2D7PA 2AABH 2YAMA 3V4LA 3EGXA 4ZX4A 1KJVB 1OTTD 2X0WA 3FSWA 1OCCB 3JWDH 3AAZA 5T1MA 2OPCA 2ITDA 3K6SA 2M1KA 5IW3A 3RVUC 3H9HA 2EKSB 4WI2A 4GW5B 5F9WB 2ZG3A 3ARFA 1GPOL 1Y6KR 1OM9A 2RFXA 2FLRT 3N42B 5CSGA 5C0IA 1YECH 2UXFA 2OZNA 2AW2A 3OAYH 1I3GH 3Q8CA 3QI9A 4NKMA 3H3KA 3X1BA 5DGQA 4HHAB 4IRSA 4X6DA 5EUOF 3ARDD 1CUOA 5E9DB 3P0VH 2A99A 1CURA 3BUBA 3UTTB 3HB3C 3IKCB 3QR0A 4N2CA 4YO0A 1ILUA 5ESQB 4R2GC 5CEYB 1T7YA 1GOGA 1IM3B 1EWHA 1MRDH 1JPST 1OPOA 2C4FT 2VLJB 3N1PC 2ADYA 2EUZA 4X4XB 1E9QA 2R1YB 4LF3A 5T3XD 1UKTA 2HX7A 1TJGH 1NMCC 4MQXC 3VXMA 4C56E 4LVOC 1H0DB 2PCPA 3V0AC 5A2CA 2VDNH 1NEPA 1XXDC 3NUKA 3VI4B 1AANA 1DJXA 3NFPA 2DZEA 2XT1B 2YSSB 4Z7WF 4XN2A 5AL8A 1RIVH 5JIIA 1A7NH 3NIDB 1A1MB 4FI8A 5C0EB 3FTSA 1BJ8A 1KSRA 3FFCE 4L4JA 4X6CB 4GUOA 3U0WH 1TNNA 5L2KA 4JEGB 4NBZB 3APCA 5EFIA 4Z3FA 3G5YA 3KS0H 4UIKL 4BZ2H 4BWUA 4FD0A 1AGFA 2EO9A 4LOEA 4XP6H 3EH1A 5HYEA 5DEFA 1HIML 5FW8A 1ZGLA 1QP1A 3DTXB 5ID1B 1QG3A 1YEDA 2N0KA 3WNKA 1DHKA 3RPIB 1R6VA 4NQCB 3QXDA 2OZ4H 3I2CL 1F1AA 1GIGL 1KELL 3ME0B 4EMZA 2Z91A 5BO1H 3MTRA 3HLAA 1QO3B 3ET9F 3L95B 2H3XC 4WGKA 4MLSA 1J9RA 3ULUF 2UZXA 1XH0A 1A5FL 4BFIA 4DP2X 4PYGA 1WFOA 2MTAA 3EG9A 3Q1EA 3IB4A 1MUJB 4KKPA 3KDPB 3QAQA 1O9VA 1QNZH 1WA0X 1T0MA 3VE0A 4C4BA 5FECA 1P5UA 3D39E 1WAEA 4DKFH 3NEOA 2PWEA 1IC4H 4K8RC 4YGVA 3UC0L 4WFHE 1T7ZA 2G60H 4BFRA 3NJKA 5CZXC 3SE4C 1YHPA 5FHBL 5TE4H 3GTVA 4KNTA 3IMRA 1TOXA 5EG6C 3UPRB 1YY9D 4F1ZA 4IJTA 2Y6TE 1RJZA 2R9HC 5JHDD 4Z3EA 1FNHA 3KYKL 3BIKB 4AEFA 5CLXA 4RFEA 1EAPB 3ILPB 5E2WH 4U33A 1NGZB 5GRJH 1AKPA 2DQEL 1QVOA 3QZLA 1YEKH 4L2YA 3WY1A 1AR1D 1HE7A 3GBMH 3HOGA 2A83A 2VLKB 2I9LB 1QEWA 5A2KH 2G75A 3Q7JA 3JV5A 5DQDL 1G1CA 5BMFH 1HI6B 4TNVK 3UP6A 1S78C 1EGJA 4NUJB 3AU1B 1EHLH 3HE7C 3EYFB 3LZFH 5LJYH 2DQJH 3T2PA 2F53A 3MJ7B 1DE4A 2DBLH 3L81A 2BHUA 5EZOL 4WGWB 1E9OA 3H3PL 3GRWL 4GI9A 2ZKXA 4ZXBD 5KJ7E 2KQMA 1TTCA 3VGAB 1NFIB 4WCYL 1VZHA 2R2HB 1RZFL 4K9EL 4N8CH 4WEEA 4P9HL 4WY7H 2VC2H 1DQLH 2R1WB 1A2YA 3C5ZA 2NXYC 2A9BA 4J6IA 4PTTA 1F2QA 4JQIA 4OD1H 1UM5L 3HE7A 3QVAA 3RKDD 5CZVL 4FJZA 5IOKA 3LN5A 2Q3XA 5EBWB 3P4OA 5K59E 5J11B 1FLTX 3FU7A 3O9WA 5T33L 1J10A 3I6LD 3ARGC 2OMXA 4OGYL 3D30A 3LYRA 5ANMA 1C1EH 2JB6A 4KXAA 1E27A 1J1OL 4AEIL 1FGNH 4PP1C 5CCHE 1ZA6B 1R3IL 5SWZD 3CXHJ 5J4MA 3LMJH 2F74A 2NW2A 1BG1A 3WN5A 1JZ7A 3RL2B 3KPMB 5L0QC 5FHAL 2GCYB 3DO3A 2VZOA 3UMTA 4FQCH 3VG0H 4E9SA 3HPLB 1EMTL 1CQKA 3OHXC 3D3VA 2F54B 3CC1A 4E5XA 3AREC 3CVBA 3JZYA 4XXCC 1Z9NA 3LKQB 1SM3H 1PG7X 3LZOA 3GLEA 4HH9B 5ECGA 3TM6A 2GKIA 3RYMA 1JPSH 5I1AA 1RZ7L 2VH5H 4O2FB 3RWIA 2MQGA 1BQHA 1I1FA 3ZHLA 5ESVA 1DSWA 4MYPA 4C57C 5J6SA 1T5WB 1ZHKB 4OUUB 5AAPA 3BDYH 1JGLH 2E5EA 3MUGB 5AW6B 3VXSE 4Y4KC 4Z8FL 3W2DL 2OTUB 5E8PA 1SVBA 4LCIL 1CFVH 4KJWC 5A3IC 4XXDA 4FCAA 2IPKB 3MNZB 4KBPA 3AREA 5IM7A 4ZX3A 1M6UA 4KKZA 4OCSH 1J1PL 3UIYA 4N3TA 3W9EB 3ZTDC 4KGLA 2ZUQB 5FOBA 4XO3A 4QRPA 4FNUA 5HHVH 2VLLA 3VFRB 4KK5D 3CDCA 4AM0B 1ZWIA 4KOCA 2XFXA 4LU5L 4F58L 3WIHA 1IM9A 3LKNA 4Y4KA 4P23C 1EFXB 1SXNA 4ENEC 3DHPA 4PJ5D 4NI3A 4M9OA 5TTRA 5I71C 4N9OB 1WISA 2X28A 2CUMA 1A6VL 3W81A 4NZUL 4G8AC 1XHHA 2Y2WA 3F12B 4MAYD 5LWYH 2FYYB 2XYBA 4HJ1A 3PWPB 3X13A 4U6TA 7FABL 3DV6B 1LO0L 4I48A 1ZD6A 3FFDB 1QR1A 4XNUH 2A6KB 2IQAB 1QYGL 3ZUCA 2D0FA 3V8CA 1PZ5A 1ZT7B 3B9DA 3CSYB 4LCWA 3CN3A 4G9FB 4P2OC 2WB7A 3BKML 1CQYA 2LHAA 4P23A 5F3BB 3WNJA 1J5CA 2YQBA 8FABA 3EYUL 3CVIH 1HWGB 4NHUB 5TPWH 1XF3B 2DQGL 4QRRD 4NM8H 4TVSa 1R3LA 4J3VA 1HHKA 5K1JA 4NWTH 4R8WL 3L8QA 4WU7B 3VD1A 3H2PA 4IJ3B 3HN8A 3O3AA 3K80A 5GGUA 3KR3L 3PXJA 3VRLF 3QQ3A 4WNQB 1LK3L 1IBYA 3OZ9L 2BFGA 4JKWA 3KXFA 5DU7A 3SYOA 3BCFA 3D05A 4LVNB 4J27A 2H1PH 3HMXA 4X6FA 4WFGE 3RJDA 3MMEA 4GO6B 4RGNC 4TUKL 3FQTA 2HT3D 4EXKA 3IRZA 4B9IA 4JKKA 2AQSA 1BFOB 3DROA 3MNWA 4JRYE 1UZ6F 4Y8AA 2NR6D 1BIHA 5F9DC 4QRAA 1BBDH 2YQ3A 1FSKC 1W72L 4JY6B 2RBLA 3C08H 1F4AA 2PO6B 4MMZB 4V1DE 4OTXL 3VFPB 3IAQA 2VDLB 4PI0A 5DZNA 1FNGB 5DJZA 1Z6JT 1FNLA 3B8YA 4PYHA 1G7LB 1OO2A 1IGJA 3ZMNA 1Z9SA 1LEKA 1G4RA 1HILA 3CE1A 1QSFD 3ZUNC 3GSVB 5DVLA 2ADFL 4GBXC 5ITFB 3DMMB 3UABA 2J1KA 5JIHA 4X99A 3BW9B 2BC4B 2FJGA 2ZWSA 3MBWB 3B1UA 4XCEA 4OCWL 5C6TL 1RV6X 1NUFA 4J8RB 1OP3K 1B2WL 1HKFA 1TZ8A 2DJ4A 5CUSH 4AUUA 2HT4C 3OJDB 3U4AA 1DQQA 5FDYA 3O6FD 1FFOA 1I1RA 4OZFA 4PRIB 3DHUA 1P9MA 3FT3B 2ZX6A 1RJCA 1XGYL 1S7QB 1EV2E 1AO7E 3AROA 3MA7B 5AVYB 1B0GA 4GBXA 2VDOH 5IZ7A 1WS8A 2AJUL 2FHFA 4G6JH 4M62H 4PLNC 3DUSB 3MLSH 3S98A 5IESL 1ECYA 1EZLA 3JV6A 2Q76A 3D2UA 2A1WL 3TO2B 4XAKE 3SZKC 3TA3B 3ZL1A 1I8MB 1KT2A 3VH8G 3ROOA 2WBKA 3G3LA 4F7MB 4OJFL 2Y07L 3HZMA 5I15L 2Z6FA 2XN9D 1WBZA 2R4SL 2VDPB 1V54B 3UPCA 3BUDA 5KVGL 2HX9A 4K71B 4PJBF 3E80A 4AT6B 5I23A 4RSVA 3Q1SL 2NZ9C 4FLQA 3OLGA 4QO1A 2X4OA 4XBMA 4NP4L 5DRWA 3X17A 2QTEA 1KCVH 3R7RA 5I8OL 5MEOB 4OD3L 5DR5L 2FBJH 3G6AB 3P77B 3TLRA 3GNML 3SE9H 2IGFH 3O6KL 1NKGA 5EPMA 2VR7A 4YSDA 4DP6X 3VFGH 4YZFE 4G70B 4H5SA 4Y16C 2K4AA 1WHPA 4M6OH 3WUZA 3VTTA 1EEUA 3VSQA 1MCJA 3VM7A 3WIIH 3LXBA 1I8IA 3WJMB 5BVJB 4ONHB 4P3WA 3WO4B 2ARJQ 2OS7A 3R4DA 4FE9A 4ZS7L 3V55A 5IBLC 4MD0A 1H8OA 2DLTA 4ZRGA 2FX9H 2FJFA 1FFRA 4JFOB 3LZNA 1TZHB 4U1JA 1GZPA 1TTRA 3QIBC 1R5WB 4FG2A 2ADGB 3SCMB 2HFGH 2YMXL 5TQ2H 3MROB 4JZOA 4UB0L 4AMWA 4NKDA 1J5HA 1P6AB 3QAZC 5IWLA 3KPTA 4XHJC 5ESAA 3RIFK 3WXVH 4AIZA 3RDJA 2YC1A 3L3KB 3DX9B 4YH6A 1T0PB 3CK0L 3H9SD 4UT7H 2CIKB 3IGAA 4M6ML 5E00B 3B9EA 3DVNA 2GY7B 1YZZA 2UX6A 4IGBB 1C5CH 1E6OH 1I8KB 3TF7C 1UXSA 1RURL 3RJQB 4B3VA 4F1SA 2VJXA 4ZMWA 5I5MA 1U91B 3O4LB 3MR9A 1G7PB 4DIXA 1KTLB 4YHKH 1RK0A 3HG1D 5E94B 1FYHB 1KB5B 3L9BA 3PREA 4P5SA 1LO2L 4HZLA 1GL4B 4XNZC 4PV8A 1G9NC 4M3JA 2QSVA 4IIZA 2A6DA 5HI3D 3TBYA 3U9WA 4XNQB 4RRPM 4DEWA 3MYJA 3D85D 1XL4A 4RZCA 4HWZB 1G84A 2H1XA 4EZMA 4PWJA 2WLMA 5JHLH 1MI5B 4KV5E 3P73A 4X5LA 2BCMA 5D6CA 4OLUH 4QRUA 4GG6B 4JM2B 3C5JB 4LLWB 3LKOB 2UZIH 1H5BB 3X14A 4PRHB 3OB0K 3MLUL 3S5YA 5FAAA 1NIAA 1PFCA 2X3BA 5DC9B 2K6YA 2VXSH 3QXVA 1BAWA 2Z35B 3REWB 4FFWD 4XCNB 5B39B 5H35A 4UYPA 3GHEH 1BZ8A 4XPGH 1YSOA 3T0EE 3V9EA 3MXWL 4OM1L 2YA1A 4G5AA 3UBFA 5D2NA 5K9OA 4U6YB 2IALA 3ZL2A 2VLRD 4TQPA 5E1QA 1HWWA 5EZJB 3QUYC 4HF5L 1G43A 3SOBH 4N2OA 1QBMH 3TPKA 1UADC 3MUUA 4QXUH 3RX8A 3WS3B 3NBNA 3MV11 4DUXA 2ZOOA 1PKOA 3C60C 2FJHB 2ICCA 1AKJD 4PV1C 4HV8A 4PJFE 2PWHA 1WFIA 4WUUE 3CXDH 3Q8AA 1EEYB 1CDCA 3GSOB 5KOVC 4ZD3H 4RWHA 5JQIB 2IG2L 2NUTA 5FYLD 4NUGH 4EJ1C 2BDNH 4GSDH 3P3YA 3TT1L 3NA4A 5DJ8A 1GW0A 4I3RH 1ED3A 3DYOA 3WS6A 3VTAA 5EC2A 4BXSV 1HXMA 3GMNB 3IFLL 2B59A 2R2EA 3GI9H 1KGCE 5HYJD 1T6BX 1C5DB 1LO3L 1YMHB 1S7WB 2ZPKL 1T6WA 2PYEE 5CD5C 3Q2LA 2LE9A 4MXQC 1XCQB 2R4RL 3VWKA 4F92B 1M2VA 1AGCB 1EO8L 3FS9A 4LQFH 1URIA 3P4MB 4QRSB 4AENB 3O2DA 4FS0A 4A6YB 3HVNA 3P3UA 3VACA 1ANUA 1RK7A 4JNXA 3Q06A 1G7IB 2I27N 4IEFA 1AHWB 1CGTA 2V8LA 1OV8A 2FEDC 2K1MA 3ATBA 3MREB 4MCYA 3PWVA 3TO4B 5EF0A 4XBEL 1G7MA 1T22B 4AQ8C 1HVXA 1BZ9A 4W81A 4YSAA 3KCPA 3QIUC 1F90H 3V4PB 1U3HC 1YDPB 2WBXA 1QFPA 3ISWA 4XP1L 4QI3A 3MFFA 4NCDA 5HDBB 5CBEB 1BFTA 3U7WH 1J8RA 2G2PA 4BKSC 3C6EA 4R97B 4BH8A 1Z3GL 2H6UA 2F68X 5BZDB 4CMHC 4PB0H 5FEBA 1R3HA 1M2OA 1ASQA 2EVFA 3GIVA 3OGCA 2WUBL 2ZNXA 4TSAH 3HRPA 3QC6X 4MX7A 3GD1C 1KFGA 3MKKA 3OMZA 4I0KA 4AQ8A 4YSQA 1AZNA 1O75A 1BHGA 3T6WA 3QIUA 3VFUB 2DMKA 1SJHB 4OLZH 3BXNA 4P4RB 4JM4H 1IE5A 1VJSA 4YFLI 1D5MB 3BT0A 5IW6B 3NN8B 4QYAA 5LCVA 1MHHB 1KN4H 2Z7ZA 4BZ1L 5B38G 3FT2A 4N8VG 1SY6A 3K6DA 4QJ4B 2ZE0A 2OSLB 4PIRF 4UINL 1I9RH 1A64A 1BBJB 1J5DA 3HI6L 2I7OA 4OZHA 5SX5K 3WNIA 4ALAL 5IFJB 3M07A 3SGDH 3DC0A 2DIBA 3O11A 4HISA 1MPAH 3N50A 1WV7T 1JG9A 1ZIAA 2WWKT 3EJUA 5CWSB 5D1QE 4ZSOE 1HN1A 1DBBL 5AYQA 2NXZB 2ZXWB 3BVDB 3HNVL 4KUZH 5HD8D 5I74C 1RPQA 1NLBL 2DWXA 1NDGA 3SPIA 4N1HB 3WMSA 4QCIA 1ROCA 4JFPB 5JXAL 2F8XC 1S7UA 5B22A 1NGYB 4RETB 5D7LB 5FGCB 2AXGB 3ARBB 3PG2A 4HZ1A 5BRQA 4KDTC 4BUHA 4FULA 1NM4A 5E24E 1IVTA 3QPXL 1J0ZA 1JFQH 4K07A 1NOAA 3U9PH 4EDXA 1F45A 2XJLA 3T2QA 5HSFA 4Y89A 4JHAL 4TULH 1NCBL 5JOPD 5IB4B 1IZKA 4PFEA 2XZCH 3PAZA 4FQXB 2CSPA 4JGJA 2H6PA 3Q5OA 3DI2B 5A40E 1T1ZB 2EICA 3PDOB 3MRMB 5AVUB 3VGFA 2O6FA 1GGBL 3L13A 3ARUA 4BH7A 5D96B 4N6RB 4CA4A 1G87A 3V5HB 3L9YA 3C5SA 1A7RH 2RHEA 1FG2A 2B3IA 3RA7H 2E59A 2X2HA 4PSRA 4W9EC 2CM5A 3BDBA 2KI6A 4KY2A 2ETWA 2Q87A 2LAGB 1WT5C 2GW5A 2B1AH 4I77L 1A3ZA 5AVQB 2OL3A 1GSMA 5EOCJ 2XRAH 3HHSB 2AJXH 3BD4A 4G8EA 4FXLA 5L9DH 2HVKA 3LSOA 4FLSA 3H56A 2V4LA 4GI6A 3OXSB 3V0VA 2NY2B 3D08A 4ZFQA 1U8JA 5EC1B 4ZDHA 4YHNA 1SHXA 3GXIA 4KI5D 2V2WB 5K9JL 1QRND 4R4BB 5HVWA 2CA4A 2BOCA 2KH2B 3MRKA 3KPSB 4PRDA 1KIUA 1LGVA 4FXTA 4FFVC 2WCGA 2A6JA 2X3AA 4O5LL 4Y5XB 1IFRA 2H6OA 3DSFL 4JRXE 1FLRL 1CE6A 1MCEA 2EH7L 2H41A 1LE9A 3BWAB 4JREC 5I75B 1HCFX 1P6FA 5BV7L 1HL9A 1PY0A 4HPOH 3MRJA 1LQBC 3VXUD 1AP2A 3BHBB 3GQFA 3A4DA 5EOTB 1YVLA 2L7EA 3CZFA 4JKLA 4Y1AD 3AXIA 4MNQD 4BA8A 1E4XH 3QEGL 1Z32X 3OGOE 4XE5B 4BDVB 3DPBB 3ZTJH 2VW6A 4A7TA 4JN2A 1OWWA 5C0BA 3TFBA 1E90A 1SXSA 5FKPB 2ZUUA 2JJSC 2XWCA 3PJSB 1RK1B 4IRJC 5LAXB 5IIEB 3IPEA 3LZLA 3B5HA 3RTLA 2KPWA 3MCLL 3QDJB 2XC8A 4OJDH 5FUCE 4M5TA 4OW6A 4WTWA 2FECI 4OJEH 4X9IA 2BVOB 2E7HA 4MNGB 4OSUL 5DZVA 3AUVA 4QT5A 5EZLB 1OTSC 5C0CB 4ZTOH 3SDXE 2PXYC 4F5CA 4UDUA 2BVPA 2AQ1A 3PV7A 3I6KA 3LNHA 2HFTA 2WVUA 2O6PA 3VGDA 4IRJA 2P5PA 7PAZA 1MLBA 2CCWA 4OD2A 3K71A 4K7PH 2CLZB 4FQPA 2MPAL 2R0ZH 4LDCA 3FKUS 5JIPA 2JCCA 1KXQA 3QCUL 1A3RL 1KCRH 1MOEA 3FC8A 4H8WL 1XGPB 2X7LB 1CMOA 4PSPA 5AD0A 3LEYH 4WJKB 4L4VE 4TQIA 2PXYA 3GSWB 3UTSE 2AS5M 1IB5A 4HFWB 5DD1L 1VIWA 2ZX9A 1BEYH 1M1XA 3BH9B 4LGSB 2ZCZA 2GJ6A 4HK3J 5ISZB 1WFNA 2P8MB 4PJDA 2FB4L 4FQ2L 4YSUA 3LPWA 1DJSA 1D6EA 5E9NA 4JM0A 1RZJL 4YNYA 2HKHL 3SJVB 3O41B 4NKOA 4Z7VA 1WBYB 1MSPA 1RZKC 5TE7H 3ETTA 4J5VA 2N56A 3QWRA 3T77B 5ADPL 5ID0A 2J4WH 1KXVC 1W0VA 4EAEA 4DKDC 4OF0A 1Z9LA 1Z9OA 1QTPA 1NJ9A 1CICC 4ZPVA 1QHOA 5L7XH 1WS7A 2JKLA 4A2HA 1HZHH 4NLHA 1BD2B 1W8OA 3MJWA 3QQXA 5FO9B 2EUWA 3H7BA 4M6NL 3QNZA 1MWAL 3NVQA 5JW3H 1T7XA 4U1SA 4Q6IB 2WWKO 2Z9TA 4DGWC 4PMEA 3VW3L 1JNJA 3IDUA 1HINL 1WGVA 5J13C 1MIMH 1KXVA 1M42A 1BP3B 3ZSTA 2APBA 3S96A 1MIEH 4JFYA 4JZJB 4N90D 3SDCB 1BFVL 4LAQH 1KTKE 5C8JB 3T4AC 2AQNA 4XPBL 6PAZA 4TLKA 4ZS6C 1CU4L 3L6FA 4JPIB 5BS0D 4FMFA 4UTCA 4MXWH 1HDMB 2LVEA 2Z4QA 3QDAA 4P5MB 5F9WC 3NCJH 2HWZH 4YHIA 5DD5L 5KVEL 1DUZA 2J8UA 1ZLEA 2N1TE 1YEEL 1JV5A 2WQVA 4OT1H 3WTWA 4P04A 2YUVA 3KGUA 3Q8EA 4DP7X 5JO5A 1FFQA 3MNVB 1M3IA 5KUKA 3EDJA 3QHZL 4JDTL 2B20A 2G5BA 1VA9A 5CSZB 1AIZA 1AQDB 2EIEA 3QZWB 3D0VB 1KJVA 4PMFA 2WOBA 4D9LH 4LESA 3QXAA 3OG6B 4N68A 4YX2H 5LXGH 2EKSA 3PL6B 4QOKD 4UM9D 4GW5A 3ELQA 4O02L 3BLPX 1AFVL 1F1GA 3IU4H 2BWDA 3UTZA 1O6VA 4RX4D 5I16B 4XCCH 5D6DC 1RXLA 2Z31B 4PJBB 1PZUB 5CGYD 4PWEA 4KQ3H 4HHAA 2AI0H 1A1NB 4N25A 1GZHA 3R1GL 4K8RH 1YNTF 5AZUA 4IBLT 1REIA 4KUCF 5E9DA 3T0BA 1D5ZB 1JGDB 3GBNL 3UTTA 5GISH 3IKCA 5E5MB 2PTUA 2J1WA 2AXJA 4Z7UA 1FV1B 2X6CA 5ESQA 3L1GA 3QCTH 5CEYA 1IM3A 1DJIA 2VLJA 3PGFH 4X0NA 5ERWB 3TPUB 2R59A 1CGUA 5D6DA 2R1YA 4W4NA 3O8XB 1XXFC 4JPVL 2AK4D 4Q8BA 4APQB 3CFDB 1BLNB 2ZKMX 4IRZL 2F7RA 1PZBA 1H0DA 4RMWA 4NAMA 5HI5C 4WI6A 1A7PH 1L0PA 3OMAB 2A7BA 4R6UA 2NZIA 3KH3A 2UXGA 1GTNA 1A1MA 1OGAE 4LPWA 1RY7B 4MGXA 1FI8C 5LG1A 4X6CA 2MCAA 2XWRA 2G2RB 4K3JH 4BGDA 5DT1H 1QZ1A 4K55A 3CH8A 2EDFA 4DKEL 1JHKL 4X6DE 3T8VA 1NCTA 1W72B 2FQDA 4ZUTB 3K4ZA 2E3VA 2KBGA 1RQ5A 1G7JB 1VEMA 3JVGA 4KY1L 3GGWA 2FTAA 1J1XH 1R4XA 1B4TA 4XAWL 4DGVH 3WTSA 2VXUL 4DQOH 4XOBA 4JQIH 5E7FA 3WFDL 2IAMC 2J71A 5E2UH 4DCQB 1WG3A 4I1RA 4MA1B 4EI5D 1PEZA 4FHJA 5ID1A 2O93L 3UG3A 1PFOA 1MVYA 5FK9B 4FEIA 3RPIA 4E41A 3GHBH 4NQCA 5E1HB 4HLJA 3UX9B 1G9ML 3ME0A 4XGZB 3VXME 2O4EA 2UWEF 1EJOH 1IC7H 4M4PA 2HP4A 1GGCH 1QO3A 3L95A 2OMYB 5SX4I 3B9KB 5I30H 5F1NA 2QFPA 3KPPB 3S5LG 4QKTA 1K5NB 4XR8C 1MUJA 5K59F 3QPKA 3QIWB 2VO5A 4OLVL 3WLWD 3EUDA 3IJHA 2WQXA 2DQUH 3MUZ1 4A2MA 2XN0A 2QQNH 2H2PD 3RY6C 3DK2A 4YL9A 4BSWB 2CRYA 4LSTH 4DGYH 1B6UA 3C6LD 1CGWA 4AVJA 2PWFA 3EW3B 2E7CA 5C08E 3O3UN 1BMGA 1A3LL 1KBPA 2O5YH 2X9YA 2Y1AA 2OR9L 2AXWA 3ISYA 4NWUL 3MI6A 4UV4H 5C7XH 3UPRA 1GKEA 2CUIA 2GT9B 4DKTA 2BSCA 2G30A 2VZTA 3Q48A 3HJ0A 4YFDB 2DIAA 2WZPA 4FFTA 3BIKA 3ZZ1A 4Q56A 1AGBB 4N0CD 1N5YH 2DTMH 4AJ0A 4KZDH 1EAPA 3GRGA 3RY6A 3ILPA 1RUAL 1YEHL 2P8LB 4N0UE 4XWOC 1NGZA 1AE6L 1ZT4B 4IDJL 2XTJB 2MCG1 3BN3B 2YPVA 1F5WA 2Q10A 1TENA 1DL7L 1QBLL 2AMUA 3BP4B 3MOBH 4GSUA 2VLKA 4WTXA 5IY5B 3WIHH 1U92B 4OFYD 4AW4A 4C54A 3VGAC 3ZIMA 2DIJA 3L4XA 3JWNH 5C09E 1HI6A 5DJAB 4J7RA 3LOWA 3X3GL 1U93B 1SMOA 1Y6MR 4HETA 4NUJA 1FZJA 2W81C 2BHYA 2Z1PA 3EYFA 1N7ML 3NCCB 5DJXB 3HI1B 3MJ7A 3CCHB 2ADIA 1AI1H 1EEQA 2DMGA 4HG4J 5E99H 2J88L 3TWCL 2GSGB 2QR0B 3ATEA 5E70A 3AU0A 3GXMA 1QSZA 2AXFB 4P2RD 2WXFA 2C9VA 1NFIA 3NRPA 1CDUA 3KLHC 2R2HA 4HWBL 3VDAA 2CHZA 3CMGA 5DZOA 4E9YA 1BOYA 4WW2C 1DQDH 3U1QA 4XXWC 1I1AC 4OFDA 5AZ2L 3GMMA 3CFIC 3H2WA 5EBWA 1KULA 1DDTA 4A63A 3LX9A 2GTWB 3IDIB 1JWUB 4FCHA 1MG3C 5K9QI 3L4TA 5AOLA 1CFTB 1MW3A 2VDQH 1BPVA 3MLWL 1SNRA 2JLLA 5KJ4A 3P0YH 5K1NA 4PW9A 3FAXA 1R5VB 2X05A 5ECJE 1ZA6A 2H0EA 3BMVA 3WKML 3RVXD 1NUNB 2RALA 4UIMB 5JW4M 5IROA 3HMXH 3GF8A 5I0YA 4F93B 4XXWA 3RL2A 3KPMA 4Q9BA 2GCYA 3BZ5A 1YEFH 3FU5A 1OQOA 3HPLA 2KLTA 2P28B 3RTQB 5FGBC 2F0CA 1PDKA 2F54A 3PGDB 1QMUA 2VN3A 4QJ3B 4HH9A 3LKQA 2D7QA 2OJ1A 2BNUB 3OKOB 4O2FA 1N18A 2FJUB 2ZUQC 1OPGH 4LNVA 1HL5A 2EO7A 1T5WA 1B0IA 3HS0B 1ZHKA 2X4NB 2ED9A 4OUUA 4GMTL 4Q58C 5ABZA 3MUGA 2ENSA 4HYTB 2TSBA 4EUPB 2ZUWA 4GW4B 3TT3L 5FYKH 2OTUA 5ANME 3UXFA 3WTXA 4I3GA 2IPKA 1IEHA 2CRIA 3MNZA 5FGBA 3T2NH 1XWVA 3QQ9C 5BUGA 1X5AA 3SPVB 5F9AC 1ZSDA 1MF2L 4PJXE 4EVNB 4BM7A 4OZFH 3W9EA 2ADJB 5FM5O 2I60H 2X42A 4L4TD 1B3JA 2X4QB 3KBFA 3QEQB 3VFRA 4AM0A 3LS4H 4BQCA 1XSOA 1NCDH 3D3VE 3ZTCC 1UD8A 2VTFA 2JJWA 1M6OB 3RNQB 1EFXA 2V3FA 1YJDH 1UWGL 4EI6B 3GZPA 4OCMC 3AADB 2LLGA 4M43H 4YHYB 2CK0L 3F12A 2J73A 3D1MC 1OAYH 4DO6A 3P9MB 2ITEA 3PWPA 3DV6A 1OOWA 3SKJL 2OCCB 1EZSA 3FFDA 4X80L 3T2OA 2IQAA 4JKPH 3K2KA 5DUBB 5EN3A 2XBZA 1ZT7A 3BUYB 2OBGA 3CSYA 4PS8A 5F7EH 3I50H 4HFUL 1PX4A 4XRCB 3EJJX 3STZB 1D7CA 3TTSA 3VGGA 5F3BA 3ZKXC 4NHUA 1FUNA 4ZUWB 1XF3A 3MJGX 2X6VA 4LVNC 5GJSH 3ZPDA 4QRPE 1NGPH 2QELA 4PRNB 5J12B 1F6LL 3DGGB 2FWOB 1H6TA 2ZCKH 1WBXA 3CFBB 1KOAA 2DQIH 2H4EA 5JPNB 5TFSH 1B4JH 3L5WB 4OLWH 4WU7A 4D3CH 3JT2A 1K72A 1Z9MA 2NTSP 2CRZA 2Y1VA 1D7FA 3B5TA 4MD5B 3DYMA 2WKOF 3OL2A 1HEHC 3S34L 4AKPA 1OAXH 4WNQA 5IVOA 3GXDA 1WYJA 2DS4A 3LHPH 3OQ3B 2LW3A 4R7DB 2WXOA 1HNYA 4G6AC 4NX0A 2G0LA 3V0WH 4JJOA 3UBXB 5L88L 1KBKA 3HG2A 4OZGE 2X1OA 4OGXH 3ZOAA 5J5EA 4LCWE 4LT7A 2R0KH 4YZFF 5DURB 5HYSG 1JF5A 2EO1A 2TAAA 2NYKA 3Q8FA 1XSIA 4QF1B 1M4KA 5DRZB 1BFOA 3CNKA 4IOIB 5FF6A 4JY6A 4A37A 2R7EB 3TTYA 2HLEB 2APXA 2PO6A 3CSPA 3DI3B 2J5LB 4MMZA 3UYRH 3CPUA 4I3SL 1FNGA 2OMBA 4HAKA 5ICZB 1G7LA 1Z5HA 3DUUB 4OLEA 5J56B 5LBVA 4XTRD 1IKFL 1BQLL 1YEIL 3D06A 3GSVA 4ABUA 4CVUA 2DMCA 5ITFA 3DMMA 3CIQA 3JTSB 1Q9WB 1MFBH 3BW9A 2BC4A 2VDMH 3K1KC 1CZ8H 3MBWA 2HLFC 4FG0A 3U79A 5CINH 4YXLL 4RAUB 4J8RA 2VR5A 3U0PB 4JE0A 3ZSSA 1A1OB 1EAJA 5HHXH 4G42B 1WGOA 2FT7A 1EEZA 5KN5B 3OJDA 3TA3C 1NCWL 4J6RL 1OLLA 4JO5A 5ITBH 4JN1H 4GQ9H 1B2YA 2LFGA 3MACL 3GINA 4PRIA 4XPAL 4ZX6A 3FT3A 1HH6B 3HZVB 5J06A 3QZOA 3DOHA 1IC5H 1JHTB 1S7QA 5I5JA 3Q44A 1C16A 1M53A 2QLYA 3CQFA 1TTGA 1ZLWH 4OZ4B 4NO5B 5ICXB 3I6GB 2NY3D 4M29A 4ODVL 2EXYC 3PNRB 2VT0A 3NSDA 4P4KD 3L3GB 4JPQA 1IC1A 3DUSA 4HOZA 1FZOB 4G71B 1I8MA 3TA3A 3IPBA 3M8OH 1NIFA 4F7MA 2V7HB 2HMID 4KV5F 2VZ3A 4RGNE 4POYA 5EOQH 2D4FA 1XGQB 4LCCC 4NYLA 4YDLB 1KGXA 1HSBB 4KNUA 1UWXH 2FRGP 4AT6A 2PETA 1UM6H 3QDGB 1JOIA 3JYBA 4IHBA 2XSKA 1PX3A 3SDAB 2D7MA 4GXVL 1M71B 3A4EA 1F02I 4YXKL 3WMQA 3C8HA 2XQYG 3HA0A 4PEEA 3WY4A 4FZEH 5JHDB 5FO2A 3B7YA 3N0AA 3SCMC 4OQTA 3P77A 1A4AA 3G6AA 1QFWI 4KTGA 1U33A 4WGVB 1NIBA 2Y36L 2CKBL 2DPKA 3E8VA 2BVUA 4OGAC 4OR1A 3D51A 4YR6B 1EBAA 3WAKA 3U36B 1FL6B 1WD9A 3GZOA 4NZRH 4M4RB 1UACH 3GBDA 4P9ML 3WJMA 4W4OA 3F65A 4ONHA 5BVJA 3QJTB 4IGBC 4YHLL 3GEWB 4UMGA 1QD0A 4Q14A 4PJFF 4A7VA 4ANVA 5BV7B 2YKLL 5BJTB 3BGMB 3T0WA 4C56B 2YJQA 1DZ0A 1IBHA 1WF5A 3SGDI 2E46A 4JHWH 1XGRA 4JFOA 4C4KT 1TZHA 4FFYL 2A77L 5C0EA 5I1HL 2I26N 1R5WA 2ADGA 3O2DH 4S1SH 4XZ4A 1LO4L 3SCMA 5AAWA 2XNAA 3MROA 5G4OA 1LNUB 3PQYE 1DVFD 3FFCB 2NNFA 2BRQA 3MBXL 1G0YR 1T03L 1WFTA 4XVJL 3L3KA 3NCWA 3DX9A 1NEZG 1IARB 1NSNH 3R19A 4PVBA 4KTEL 1AGDB 1I3UA 1L9OA 4MZ2A 1YY8B 5E00A 4GQQA 2ZOTA 3CSFA 2OMWB 4IGBA 3CX5K 1I8KA 4GO8A 4U1KB 4JDZB 4ZXBB 1TJIH 1U91A 2HTKD 2KZKA 2ZG1A 4JM2C 3O4LA 3EYVA 4UQDA 1G7PA 1T1WB 1KTLA 5EDXA 1KFAL 1THAA 5ENWB 5E94A 1KB5A 4NP9A 4TVPD 1E8WA 5J1SC 3ZR5A 3VXRA 2IV8A 1ADQL 1BWWA 1BVOA 3VXNB 2FX7H 2X4TB 2JTDA 2VDRH 1IQDB 1XZWA 2VUKA 1TFPA 4XNQA 4G7RB 2O5NA 4MS8D 3POCA 4HWZA 1HZKA 1C08B 2EIKB 3DXAA 1A7OH 1E4JA 2EDEA 3K8MA 4R4NC 1JNNH 1MI5A 4WV1B 1AHMA 4YHML 5EBMB 2FH8A 3LRMA 1XTMA 2NY5L 3C5JA 4JM2A 3GXUB 3LKOA 4LLWA 5LCVH 1H5BA 3ABGA 2MNJB 1QBBA 1B9KA 1SY6H 3QJUB 4Y9EA 3VSVA 5KG9B 4LHUG 1X5MA 3REWA 3UOAB 2Z35A 4XCNA 5B39A 2YBGA 3O45B 3T0AA 1JMXA 1YNTB 3ZGHA 3WFBL 3ECVA 1CD8A 4MA8L 3Q9QA 4H26A 5F6HJ 2OXHB 1CBVL 3AM8C 2YUZA 1T2QL 5T1KB 2YBRB 1J8HD 4KMTL 4CN1A 1RPUA 4F80A 4U6YA 3X2QB 5EZJA 5D7KE 4U49A 1FVCB 1KCSL 2VE6B 2GI7A 3FN3A 3WS3A 5FR3A 2M8XA 4W9ZA 4NZ8A 2FJHA 4DP8X 2BXYA 2CNZA 4IYKA 2XWBB 1CD0A 1G9HA 1EEYA 4F8PA 3GSOA 3X12B 1OSPH 2P5EE 4MJ5B 4ZT1A 4WNJA 1NOFA 2VQ1B 1E4XI 3GUTB 3MRRB 1VFMA 2WNGA 3AM8A 4W9HC 5E8DL 4AIXA 2C3GA 3GSRB 1U8LB 3ILQD 3D39D 5KVDL 1JXJA 3GMNA 1MWAB 3HKFA 2CHXA 4TF4A 2IPTH 1XH3B 3NMEA 3CBJB 5ILTL 3H53A 4HJIA 1C5DA 3RB5A 3QUZD 1YMHA 2D0HA 4JY4B 1ODAA 1DSFH 4UQEA 3GJEB 1XCQA 3IETA 4PJEF 4K3DH 1AD0B 1AGCA 2XN1A 2A9DA 4R97C 4HDIB 3P4MA 4QRSA 5E2TH 4AENA 4A6YA 1P2CB 1I53A 4A55A 1ET8A 5KVMC 1XAKA 2EYSB 3IXAA 4NO3B 2OL3H 2XFGB 1G7IA 1I7RB 2ICEB 1AHWA 3TO4A 2UWEB 3MREA 5GGQH 2CAKA 1HAWA 4LASL 4L1BA 1T22A 4NC2B 2JKTM 2ESVD 4OVVA 3H4FA 3V4PA 1YDPA 1TEGA 5DQ9B 1U8NB 3K2IA 5CBEA 4ZTPH 1CDJA 4AC2A 2P47B 3BAEL 4PG2A 3QUXD 3QO1B 5F88B 3SDYH 3FNKA 2BS8A 1QFWM 1L4IA 5C07E 4QRRB 4ODBD 5J1AA 3V8OA 5BZDA 5EEWA 2VIRB 2G9HB 1EXHA 5IHWA 5AW1B 4UM8B 4L9LB 2X44D 4RGOH 4NENB 3TEXA 2PR4H 5EULV 2C9PA 3MHZA 4AOFA 1KXTB 1N26A 1ZE3H 3AGWA 2OX5B 2Y69B 3RVTD 3VFUA 1SJHA 3QUKB 4P4RA 4BQ8A 1D5MA 3CZUB 5IW6A 3NN8A 5GRYA 2VQTA 2C3VB 4GRWB 4XH2B 1MHHA 2V2XB 2NY7H 3FUIA 3O2VL 1F3DJ 2ENPA 5F3HB 3IWUA 1UQSB 4H88H 3LRSB 1CF8L 2K0RA 2OSLA 3AW5A 1BBJA 1EAOA 5IFJA 3FTYA 3LPPA 2M83A 2YXVA 5A7BA 3FK3A 3RZCD 4CGTA 5B8CA 2FAUA 4GIOA 4HWNA 1IBDA 5CWSA 4GAGH 3DRQB 4APXB 1T4KB 1JHLL 1UD3A 4LFHG 4NT6B 1GGTA 4C4KO 2ZXEB 3WFEL 4DAGH 4JFPA 5ETUB 2Z7YA 4YSPA 1NGYA 1U3NA 1AMXA 5D7LA 5EDSA 4GFTB 2AXGA 1IKNA 3ARBA 3WKYA 5C0RH 1R0AL 1WZKA 4TQEL 5FO7B 2NY4D 4LPXA 4KAQH 2DLIA 1IGCH 2J1YA 5IB4A 1S2EA 4XMKL 1DUYB 1X6LA 4X5QA 4FQXA 4PU2A 3UPAA 5IBTL 1Z2KA 5D70H 3SDXF 3KAAA 1T1ZA 1N8ZB 3PDOA 3MRMA 5AW8B 1BIIB 2ORBH 2VABB 4N6RA 3V5HA 1RLWA 4WWKB 2IANB 1A7QL 1EUUA 2OMUB 2C9UA 3TVMD 4EBQL 1MCOH 1YUKB 1INDL 4FTVB 1DEEB 4QHUA 3VXSD 2JWYA 3GIZL 4J4PA 1CD9B 2V17L 1KWKA 4XMLH 3RURA 3KPLB 2C9SA 4OBSA 4TL5A 4ZDHB 1D5RA 4S1QL 4M7LL 3TYGL 4UOW1 5I75C 1BZ7B 3HHSA 3B1TA 2PWGA 3T65B 1NGQH 3PP4L 2JB5H 4XN7A 3WU1A 4S0SD 3FONB 3T1WA 4LSSH 3LXUX 4CUCA 5E51A 3TF4A 1AQKH 2OYKA 3QJFB 5LB1A 3HN5A 4WO4B 5EC1A 2V2WA 5SWSE 5DK3A 1XZ0B 4WK0B 1RIHH 3DX3A 5DC0A 1KIQB 1KV7A 3AZUA 3Q5YA 4OBRA 5DZ9A 4ZUUB 2GFBB 4PCYA 5H4ZA 3K4AA 3CDFA 4Y5XA 4UOW0 1OE3A 1NAKH 3BWAA 3BAWA 4G6MH 3L3JA 3QQDB 3AS2A 4CC1A 4NRYA 2VAJA 1OWRM 1S7VB 3V6FB 3TH3T 1MCWW 3U7AA 1EQWA 3BHBA 2Q8AH 4YWGH 4HPYH 2ZJSL 4NNXB 4W6XB 4I9WE 5D1ZB 4BDVA 4X9HA 3DPBA 1CTNA 4ACPA 3C75A 5C2UB 1CLOL 4JB9L 4TSCH 4N8UA 4O58L 4UQ9A 1EDQA 3O6MH 5FKPA 4NC1C 4CMMB 5LGJB 1S8DA 1RK1A 1CG9B 3PJSA 5FW7A 3II3A 3IYLW 2CDGB 3MODH 3K74B 2XZZA 4FP8L 4YBHA 5LAXA 4DP5X 5IIEA 4LHUD 2JKSA 1SQMA 2C7FA 4K3EH 2B08A 5IQ9B 1SDAB 4NZTL 2P80A 2BVOA 4MNGA 3V7MA 1IKOP 1F6AB 4FDWA 3W5NA 1HKLH 3FYIB 4QLRA 3L5HA 5EZLA 5TDOB 2WQSA 4PLJC 4FXKB 5C0CA 1J5IA 3QULB 2NNXA 3W39B 4B0MB 2ZYRA 4LEEA 2BIOA 4W9IC 4U2YA 3BMWA 1A6WH 1UJ3B 2VRAA 2A9NH 5F96L 3S37H 4A2EA 1UB6B 4KZ0A 3ZL4L 2CLZA 4KVCH 3ENEA 2XKSA 3GRWA 1RPKA 3D85B 5C0BE 3VD3A 5GGSB 2P5WB 1QR4A 4HKBB 1XGPA 4JRYD 2X7LA 2ZONA 4W9LC 3MOAL 1SLUA 2HSIA 5D4QA 3P0GB 3U4KA 4AEEA 5BPPA 3GSWA 4V1DD 3F5WB 1AXIB 1WZ1H 3QFDB 4XMPH 4HFWA 3OVUB 4HC1L 5A2IH 3GXTA 3BH9A 2BHZA 3RVWC 2BSEA 1KGWA 5ISZA 4ODTH 4UNVA 4ONFL 2P8MA 3LEVH 2MTPA 3VWJC 3LKRB 3V5KB 4GS7B 1HQRA 1ACYL 3NSXA 1GGIL 3R4RA 1A25A 1Z5LB 1L0XA 3O41A 3HR5B 1WBYA 3N5AA 4MHHG 2GHWB 3GO1L 4Q6IC 4BFOA 4GRMB 5DVNA 5KZCB 3T77A 1H3PH 1R17A 4GLRH 5AB9A 3BPLB 4K9JA 2EIJB 2LABA 4L48A 3QUHA 4ETQA 2F18A 3EHBD 3SDCC 3KPRE 4NM4H 4J1UA 4NQVA 1KXQE 4LOUD 1AO7D 1BD2A 1A8JH 4Z0BL 5FO9A 1FDLH 2W1NA 15C8H 2BFVL 3OAYK 5FUOL 3EFOB 3FHQA 3NSJA 5TF1L 1ACZA 1VEOA 2F5BL 3AC0A 2PPEA 4Q6IA 2MWCA 5L2JB 1R19A 1IQWH 5F21B 2GJ6E 3OLDA 4M1CD 4PJDE 2ZXQA 2X10A 1AGEB 2ATPB 3ASOB 3HNSH 4DN4H 4JZJA 4NRZB 3UTOA 1IGTB 5A7EA 2B3RA 3US0A 2EJ1A 3SDCA 3RDTD 2AQTA 5C8JA 4JPIA 5D1XD 3ATDA 5G4NA 3A23A 1HDMA 4RCAA 4AYEC 3KNBB 3O0RH 2TRYA 3LH2H 4P5MA 25C8L 4YSOA 2DQTL 3FH8A 3N85H 4W1TA 5KANG 3S3DB 1FNEB 1TLKA 3KVQA 2Z31C 4AVHA 1UB5B 4S1RL 4X5WB 3T71A 2CPCA 3MNVA 4HJSA 1EDHA 2XQYK 4ZFOL 3I9PA 2N01B 1N19A 2EQDA 1OCWH 2BS71 1AQDA 5F8RC 4X7DC 3QZWA 3D0VA 1EGJL 5A43C 4HMDA 6CGTA 3IJSB 4ZW8A 4LFHD 2W9EL 5LDSA 3VUAA 1OZUA 4B9KC 5KTEL 1ZT1B 2NMSA 3PL6A 3GSNH 4PBWD 4X98B 1YYML 1ML0A 2GB2A 3DIDA 1LWHA 1P84K 2QQKH 5I16A 2A74C 3AQXA 2Z31A 3O8XC 4APQC 1AY1L 4PJBA 5FYJH 1JI2A 2B8OT 1FGVL 3MC0A 3RLSA 3EDKA 5TQ0L 1A1NA 4MJ4A 1TEYA 3L4YA 3OAUL 3IFNL 2E9JA 2O5ZH 4GKZB 4ZQTA 2J8UE 1D5ZA 1JGDA 2YPVH 3ULAB 5T3ZH 3VXTB 5E5MA 1SMDA 1KMGA 1IEAB 1PX8A 4AITA 1FV1A 5IHUL 4WEMB 2GAZB 3CLEH 4UNUA 4NAJA 4HGKC 3JV0A 2XCMC 2QV2A 4JVUA 1GJUA 4M1DH 1NWOA 2H32B 3O8XA 4APQA 3D4GA 3PDDA 3CFDA 1BLNA 4U05A 4PJFB 4A1RA 4FQJH 1OM3H 1R9FA 4MA1C 4GH7B 2BZDA 4FNLH 3MZTA 1BXVA 5D7EA 1NKOA 2G2RA 2BSBA 3H3BC 2BERA 3GHPA 4XVSL 1P7QD 3QNXB 1W72A 5G5DB 1TIUA 4MS6A 4EN3B 4ZUTA 3ZKMC 1QBAA 3B9KC 5PCYA 4JFXB 2OTPA 1GOFA 3T0ED 3UTTE 2Q8BL 1CI3M 3DDFA 4AVIA 2FCBA 5GS0C 3EGDB 4DCQA 3FCSB 1LM8V 3FZUD 1FCCA 1EO7A 1T89C 4CN6A 3QFJA 2DQHL 2AMGA 1Y18B 4LLUB 1PJWA 3BT2L 4U7MA 4HXBL 5FK9A 5L4FA 3CD4A 4N1CA 3GM0A 3HBPA 3QCVL 5CXPA 4XGZA 4OKVB 3TBBA 1PYWB 1E2ZA 2GC7C 2ICWB 3THML 1CI5A 2CPUA 4HUKB 5A16B 3UJTL 3VI4E 1RU9H 2R0WH 2Y7OA 2OMYA 1Q0XH 4ZOBA 3B9KA 1DQTA 4PGEB 3IMSA 5BZXA 3NIDE 5DRXB 3KPPA 4XCFL 2NX5D 1J9CT 4JJ5B 1K5NA 1A6ZB 2JQZA 5CS7A 5AYUL 1A0QH 3QIWA 4XPTH 3WDIA 2GQHA 4BSWA 3IAPA 4AW7A 1Q38A 2V8MA 3DX7B 5HHME 2XTJC 4AGPA 3AQYA 4UQAA 5CZKA 3WEOA 1ZANH 2PYED 1JIBA 4JO4L 2R2BB 5IFAH 1F8TL 4KKLC 2YUWA 2GT9A 5KSAD 2YWZA 3BSGA 2B4CC 3OB0H 4NQCE 5EZIL 1VGEL 3V0HA 1UZGA 2CCLA 1JN6B 3NJFA 4UBDC 1AGBA 4Y1AB 4GUQA 1MVFA 3X11B 1CLVA 1XGTB 1NBVH 2P8LA 3AABA 4KRLB 1NCNA 1ZT4A 5FFLA 4Q9RH 3ZT7A 1OP5K 2C7UB 4GPVA 4LLYB 5EO9B 5IMOB 4ZMOA 5I8KL 2CKBB 3BP4A 2YAOA 3ABKB 4LVHB 1CGXA 1NH6A 2ZWNA 1MLCB 4KK6C 1VFBB 2YA0A 1U92A 3CZSA 5D1QB 1P7KB 2WYTA 3BEWB 3OTTA 4X7FC 1OSYA 4YK4B 5DJAA 4PRPD 1U93A 2V5RA 1W15A 5JDSB 4Y2DC 2EDRA 3E6FB 1X5LA 2DQFB 3MLRL 2WK2A 5DJXA 4PJXF 3WYRA 3HI1A 3CCHA 4PJEB 3VA6A 5DK2B 4ZMYA 2GSGA 4ZMTA 2QR0A 1NMBL 2B15A 2CK2A 3EO9L 3HG3A 4N5ED 5EIIB 2NDFA 3MLVL 4V2BA 2AXFA 2VXTL 1CXHA 3C2AH 1GA2A 1ICTA 1TZIB 2XG4A 5KBDA 3I02B 1G1YA 1BM7A 1K2DB 1DLHB 1E2VA 1KBVA 4XN1A 4JHZA 5E8EA 3FJTA 4RFOH 3MSPA 5J7CC 1A4KB 5TK2A 2DH3A 4RWYL 3HBGA 3V6OA 3VXOA 4R0LC 4URTB 5GGVL 1E7VA 4P2CG 5E6ID 2VLKE 3TJEL 4ODUB 3RTQC 4CBPA 3ORJA 1DYZA 1RFDL 4GUPB 5E4AA 2GTWA 3IDIA 4PY7B 5FC9A 4B96A 5I6MA 5KJRH 3ZQWA 3T9WA 1CFTA 1X5FA 3G04A 3S0PA 4WK2B 4LCUB 4HKXB 2NNCA 3TH2T 4N86A 1R5VA 2YN5A 1W0YT 4XWGL 1IT9H 5I1LB 4CBZA 3ZTJG 1QNIA 2WUCH 4CVZB 1QAWA 1RJYB 1RUML 4BSVB 3CVDA 4OCLC 1FRGH 5D5MB 3RTQA 1JPTH 1CDHA 3ETSA 4W93A 3BVUA 2P49B 4KXDA 3BQVA 4WLCA 3PGDA 5FA4B 2ZWLT 4KRPB 3R8QA 2BNUA 3KW7A 1NEUA 3OKOA 3DTDA 3QG7L 4OFQA 2VDLH 2AKRB 1UHVA 2MCPL 1A6PA 1AG6A 1AXTL 2WWOA 3Q6GH 3IJ7A 3QA3B 5GGSY 5FM5M 1MCQA 1OTUD 2UX7A 2X4NA 3HS0A 4FQIH 4LRIC 3EO0B 3NIFB 1GKOA 3OR7B 1GHFL 4OZGF 4EUPA 1JDAA 1OLZA 4GW4A 2AAAA 4HJ0D 4GAJL 2KQNA 3CFCL 4JFQB 2I5YH 4P5TD 4HK3N 1BG9A 4TLTA 2VOTA 4PHZA 4RIRB 2NY1C 1X44A 2VUOA 3A6BL 4JFWA 5T8IA 1AOHA 4A04A 1RZGB 2Z8WC 1OTTC 4EVNA 3MRPB 2ADJA 3NABL 5BS0B 1WZLA 5DMIL 1F4HA 3H6JA 1IMHC 2X4QA 3QEQA 4XBPB 4ESKA 1IGIH 3CH1B 4LRIA 4LLMB 3RIAF 1SN5A 5B38B 4S10A 4X50A 3TCTA 1KNOB 1IV8A 4JRXD 3RNQA 4JDEA 4M7KL 4EI6A 1FCGA 5E56A 1QI5A 4F8OA 4Y4FB 1F97A 2WCPA 3BKJL 2YEZA 5AALA 1MHPL 2D7TL 1PVHA 4FN0A 4DPRA 1J9TA 3VFNB 1JTTA 3ARDC 3ESOA 3P9MA 5JPNC 1ZIBA 3X1FA 3CDGB 3OC8A 4ADGA 4CDGC 3PHOB 3STBA 2NQDA 1N68A 3CUPA 1HOEA 4IBYA 4BYHA 2Y6SD 3BUYA 2XZAL 3QZNA 1QHPA 5GRZA 1TYEB 4P3CH 3KWVA 3STZA 2OSYA 2XPGB 3QXTA 2QT6A 1AC0A 4L4VB 2VSDA 4ZUWA 1TQTA 4OQTH 2B7DT 3L5XL 5AG8A 5M95B 1FNSL 1VFAB 4PRNA 3IU3B 5DD6B 1XSJA 3DGGA 2FWOA 5HDRA 4XPHH 3CFBA 3IK2A 3EDDA 4OQ1A 5JPNA 4G6KH 4WVRA 2FWLB 2CALA 1P6WA 4YDJA 4AYFB 4TN9A 2YUXA 4MD5A 4UMSA 1R3KB 3NQIA 4YFLF 4KQ0A 4DZ8B 2J5LC 5DFVC 4JFFA 3WFHB 4R7DA 2WD0A 4OCRH 5GRVL 3S36H 1R5IB 1M7UA 4JKNA 3TONA 5EWIH 3VX1A 3KLAB 3UBXA 4LP8A 4P46B 3UGEA 3U4EB 4G9FE 5C7ZA 2I07B 4UNIA 5D71L 2UVEA 4QF1A 5DRZA 2YQ2A 4A39A 3M17B 4NO0B 4MJIA 4Z3HA 3ULVL 1HX0A 4IOIA 2R1XB 1U2CA 35C8L 3UTSD 1RD6A 2FECL 2L04A 3CSGA 1G9NL 4KWUA 2E0PA 4GRLD 4L2LA 4RISL 1WHOA 5HJBA 4GT0A 4MMYB 5ICZA 5EORH 4Y7OC 3LXCA 3DUUA 2GTQA 1ZTMA 1KB5H 5AKSA 1NICA 2QGEA 2VR3A 3KYNB 4L3FA 2DLFL 1MCCA 3MRFB 3JTSA 4M8UA 3CX5J 1Q9WA 1NINA 4QEGA 5I18L 4NXSA 2EYRA 4M7JL 4R26L 1XBDA 2WIIB 3LPOA 1ID5I 4RAUA 3U0PA 3G6DL 1A1OA 4H8UA 5KN5A 4ANKA 1BJ1J 1M7IB 1GYAA 2H8PB 3CSBA 4ATWA 4HOMA 3DLQR 3OQRA 1A14L 3MA9L 3PAVA 4OB5H 2YFOA 4LPCA 4YDLC 5D72H 1HH6A 4WENB 3U48A 4E0RB 2R23B 3RBGA 1JHTA 4ODSH 5MHSE 3GKWL 3V6ZB 3NACL 1CLCA 2QTVA 3NPSB 4H0LC 4A7SA 5IP4A 4ZW5A 3SDAC 3QR1A 4JFVA 4OZ4A 4NO5A 5ICXA 3I6GA 2QZ5A 2OK0L 3UACA 2BRRL 2GJPA 3L3GA 3DX8A 1OP9A 3OJVC 5CEZE 4JQXC 1AYRA 1FZOA 3MV8B 4NRXB 3BVXA 3RGVD 1T66C 2CGRH 1MFDL 3CIAA 4TSBL 2AFNA 2V7HA 3TIDB 5I82A 4PJ9D 1NUDA 1AR1C 1XGQA 4MBRA 3GPSA 4NJ9H 3T6QC 5KAQF 4WTZA 3QDGA 3M1CA 5I1IL 12E8H 5GSRB 4UQCA 3SDAA 3MJ9L 2E7LA 1M71A 3S97C 3PFUA 4ATTA 3WKNA 4WWOA 2XQBL 3Q2VA 5JHDA 4TRPH 1OSZB 4HEPA 3BUTA 1XAUA 5CGMA 2FD6H 1S7SB 4JQXA 4R84A 2XWTB 1SJEB 4M48L 1M05B 3FTXA 4YR6A 4DFHA 4Y19E 4P2QB 4EO5A 1KYFA 4B50A 5F3FA 4E9LA 5HPMB 2KL6A 3U36A 1FL6A 3TFKC 1J11A 3NJLA 1Q1JH 4PGJA 5C0FB 1KYOJ 2EIZB 5FLVA 4WJ5B 4D0BB 3WAJA 2FT8A 1EIBA 1RUQH 2D4DA 4UOQA 3BQUB 4ZXBC 5BJTA 3BGMA 4Y4HD 4C58B 3WDJA 3QEUB 4C56A 2G3MA 4W9CC 4HBQA 5DGRA 1HH9B 1ZV9A 1XB8A 1MFNA 5D4IA 4A6YH 2CO6B 1OGAB 4L3AA 1RERA 2FDBP 1LNUA 3FFCA 4N2GA 3LTVA 2ZAGA 4LP4A 5TE6L 3CVCA 3MGOB 5E4OA 3ERXA 4ODXB 1RMFH 4HUCA 1AGDA 5ES4B 1YY8A 1U95B 2HKFH 1Q72H 3B7SA 2OMWA 4JVPA 2WBJD 2FUQA 4PCKA 3ULUH 3V4PH 3UROR 4NGHH 3LDBC 4JDZA 4U1KA 4WV1C 4ZXBA 4E5XG 2YK1L 1SN2A 5I1KL 1E30A 1OP4A 4I0PD 4X7SL 1T1WA 4PIBA 4LDOB 4D0DB 1BQHG 2FX8L 3O3BB 5ENWA 5HVHB 4Q7DA 1S7TB 2PNDA 2X2UA 4PPTA 1NCCL 3T0VA 3VXNA 4M9PA 2C9AA 1IQDA 3LNEA 5AVRB 5FIEA 4I88A 4Z3JA 3ARFD 4CU6A 5JHBA 5DF0A 1GPOH 4JBSA 4R4FL 4GINA 1C08A 2L0DA 3HB3B 4WHYH 3D12B 3FT1A 4WV1A 3VU1A 4F8QA 3MLYL 5EBMA 3QI9D 43C9A 2Y7NA 4NJAL 2BNRE 1HAUA 1U8IA 3I9IA 4UCFA 1L0YA 4IRSD 3B83A 1JVKA 3IDGB 1MEXL 4MDRA 4B9JA 5KG9A 2CXGA 3O45A 3ETBJ 1YNTA 1PPIA 5DZAA 5EBLB 5C08B 4LVOB 3TU6A 4KJPC 3RVUD 4Z3TA 2X0VA 3OV6A 2OXHA 3JWNG 4LSDA 1IO4C 5FA3B 4OJYA 5T1KA 1O7DC 4F8TA 2YBRA 4MQTB 1G4MA 2XHNA 3SQOL 4K15A 1ETB1 1FVCA 1U2HA 1GC1C 3AXLA 4KZCA 3ZE1B 1SZNA 3A4FA 3HR6A 1W9XA 4HUMB 4ZMQA 2OJEA 2VSCA 1RUPL 2XWBA 1JP5A 1PZ3A 4N0UB 1BDYA 4V11A 5AB1A 1OT4A 2IFGA 5CNHA 3NJXA 4LVEA 4Z18A 1AIFB 4MJ5A 3QORB 2VQ1A 3X1EA 4KX8A 4GG6E 3WJJA 4R2GD 3MRRA 2EDQA 5L2KD 2W88A 4PRHE 1JWSB 2ICEC 2RJMA 4DGUA 3GSRA 1U8LA 3L3DB 4UIKH 1DVYA 2QPFA 1T4WA 2XTLA 4X9YA 1MWAA 4L4TB 2WNXA 4MQXD 3T0DA 1XH3A 3ZZLA 1HIMH 3MGAA 3LRKA 2VXQL 5EU6E 4JY4A 3GJEA 1BXUA 3G5WA 2XWXA 2HJFB 3DTUB 4HDIA 1ZPUA 4RA0C 3BSHA 4W9DC 3U9UB 3L4CA 3I2CH 2Y4SA 1GIGH 1KELH 1PLCA 2IO5A 5HVGB 3MNDA 2EYSA 4NO3A 3CC5B 1I7RA 2ICEA 4P8QA 2PF6A 1XMEB 2UWEA 3VM5A 4UTAL 5I6OA 5LLIC 5KSBB 3V0GA 2XX1A 1A5FH 3DURB 3JWOC 1KLUB 1DVTA 4D94A 4DJMA 1W0WB 3RB7A 5CU5A 3TL5A 5KYNA 5DQ9A 2HRPL 1U8NA 5KW9L 1ZHNB 3AFLA 4U6XB 5F88A 3QO1A 3F6JA 4ZFOB 2J25A 1BZEA 1FL3B 2VIRA 3UC0H 1QKZL 2AXHA 1FVEA 3W82A 4L18A 2G9HA 4KQ4L 4JQVC 4YLCA 3BP5B 1F6FB 4UM8A 5FHBH 4HWEL 4L9LA 2DI7A 1K4DB 1X4YA 2NR6C 1U3ZA 3A67L 4GXUN 1KXTA 2OX5A 4BHUA 1HXYB 3R06B 3QUKA 1JD9A 4RGMB 1MCNA 3PNWB 5FGSA 1KB9K 3MLTA 5L8KB 3KYKH 3TEWA 1T7VA 3F7KA 1H3TA 1I1CA 5IJVB 2EC9T 1OE1A 1MQKL 2YRLA 3UAAA 1LE5B 1GVIA 2IWKA 4OZFG 5IMLB 2WN3A 5F3HA 4Y88A 3ALWA 3PUUA 3K46A 1UQSA 2DQEH 4K8RD 3TGXA 1UZ8B 5IHHA 3KH4A 5CZXD 4JQVA 4MLIA 1H8NA 3V9FA 4NDMB 5HDBE 2RR3A 3L7EB 4OLYL 2IV9A 4L0ZA 3FB6B 4XMTA 1HYSD 3MRCB 4UUJB 2HB0A 3O6FC 5DQDH 1QOKA 2R9HD 3DRQA 1HT6A 3QE5A 4HULB 5JPMB 5F89B 1T4KA 4APXA 4NT6A 1KENL 1MDTA 5ETUA 2WKLA 2ZD0A 4IRZA 1GY2A 3VVWA 2D9CA 3PU7A 2F53D 1WLHA 4YHOL 2J57A 3SO3B 3MRDB 4YQXL 3TESA 5EZOH 2DEYX 1RHHA 2NXYB 2VMJA 5JDJA 5FO7A 3BEVB 1L0QA 1JXDA 1BSIA 1I75A 4J3SA 1F42A 1G9MC 3EJRA 3GRWH 3H3PH 3FQ1A 3FN9A 3IMUA 5IK3B 1E6JL 1DUYA 4WCYH 1ITCA 4K5PA 3ARGB 1PCXA 1RZFH 4K9EH 3NEXA 1WK0A 4P9HH 1S78D 1N8ZA 2WTRB 2N4IA 3C5ZD 1Q9KB 1I8LC 3VDCA 2VABA 2JJVA 1BIIA 1RZKL 3BPOB 3FN0L 5LN4A 3HE7D 4WO4C 1UM5H 4WWKA 5CZVH 2IANA 2OMUA 3BO8B 2YOAA 3ZRFC 4FTVA 1RI8A 1DCLA 3O9WD 3EKCA 1X5YA 4QRTB 5T33H 1L6XA 2DYPB 3QC5