1TUWA

Structural and functional analysis of tetracenomycin f2 cyclase from streptomyces glaucescens: a type-ii polyketide cyclase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
AYRALMVLRMDPADAEHVAAAFAEHDTTELPLEIGVRRRVLFRFHDLYMHLIEADDDIMERLYQARSHPLFQEVNERVGQYLTPYAQDWEELKDSKAEVFYSWTAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of tetracenomycin F2 cyclase from Streptomyces glaucescens. A type II polyketide cyclase.
pubmed doi rcsb
source organism Streptomyces glaucescens
molecule tags Unknown function
molecule keywords Tetracenomycin polyketide synthesis protein tcmI
total genus 26
structure length 106
sequence length 106
ec nomenclature ec 4.2.1.154: Tetracenomycin F2 cyclase.
pdb deposition date 2004-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04673 Cyclase_polyket Polyketide synthesis cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1090 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Dimeric alpha+beta barrel. 1tuwA00
1TUWA
chains in the Genus database with same CATH superfamily
2GQ2A 1S0OA 1JX4A 2CWXA 3TEHB 1KLMB 4EBCA 2BQ3A 2F5GA 5MLCV 2DVIA 3DMJB 4R5PA 4ECSA 1U1MA 2CJXB 3NGUA 1RSCA 3PX0A 4G1PA 2BQUA 1JXVA 2AX0A 3UPFA 3TAPA 3CD6S 2DO0A 3RB6A 4OX7A 4ANCA 4X4OA 2ALZA 2OD6A 3OFGA 1RDRA 3BPDA 2MLYA 2XGQA 4ED5A 3BN4A 1MU2A 1X4HA 2N7CA 4LF9J 4TU7A 3R27A 1W2BR 3NLCA 4JV2A 3CD0A 4NXMJ 1IBCB 4OJ1A 1U0SA 2MPUA 1T8EA 4ZITA 1FD2A 4O44A 4X4NA 1TQLA 2AT1B 5DQHA 4DFKA 4AXJA 2L41A 2VASA 5A6PA 1XERA 5F9LA 1WF2A 3F41A 2JOQA 1VQSA 2KFNA 1IR2A 3RBDA 3DLGA 3ILJA 4PZVA 1FE4A 1X4DA 3PIPQ 2D3O1 1ROFA 2C1EB 2HIQA 3R97A 1IBLF 2G4BA 2VONA 1J2VA 3KUGA 3S01A 2X3GA 2D7SA 2RF2B 2EK6A 2ILZA 2IYIA 4KE5A 2RKIA 2GGPA 1C1BA 2M2BA 3DXSX 2MQQA 5JXSA 1S9EA 2G2OA 1NDLA 2J7WA 2KHCA 1WC3A 5A8RA 2J6UA 2DNGA 3AA9A 3BB5A 3HSJA 3AAWB 3MM8B 2YKMA 5U47A 4CLSA 4FNHA 3QWUA 2HHQA 1JLCB 3O1LA 3KWMA 4GVBA 1GMUA 3JSYA 5IQQA 3K58A 1FO1A 1HW9A 4OZJA 1N0VC 4ECXA 2KZZA 4X4SA 4I2PA 1NK8A 3ADAC 4DR3F 4I64A 2DBBA 2YWWA 2D74B 4EZ6A 2ZFHA 3ZC4A 4JI6J 1CPZA 2NUUG 3DRXA 4NLXA 3W64A 3MXHP 1NSKL 3GE9A 2KU7A 4IFYA 1SV5A 1ELOA 1PSDA 2N4CA 4RW7A 3SIPB 5HROB 4URQU 2VOPA 5EUHA 2HVIA 1IJFB 3BBCA 3KG0A 5D78A 3KLFA 2MYFA 2R4FA 4EZ9A 4ECTA 3DHWC 5T14A 2CVIA 4NA1A 1NJIT 1GH8A 2VG6A 3BR8A 3Q89A 4CLFA 1RT5B 3ZZRA 4DBQA 4K4UA 1WOPA 2C2RA 3W66A 1X4CA 4OYBA 4XPEA 3DRYA 1TK8A 2B9WA 2CPIA 3BO3A 4A8YA 4PWDB 3EZUA 2LECA 3PIOQ 4OHXA 4J9SA 3Q8VA 3UVJA 1RWOB 4DPOA 1S77D 1P9QC 3Q8UA 5DJBA 2JEFA 3BBFA 4QWBA 2K3KA 1VRUB 2B9XA 2CJ9A 3MCOA 2H5JB 2V5HG 3PTWA 2B5JB 4OZ0A 4B17A 2Z4PA 2X3DA 2AGPA 2RU3A 1AROP 4ILMA 3HKZD 3TAQA 4W90B 1X4AA 2ZH1A 2I0XA 5KFGA 2KVQE 3GQCA 3RUBL 2VQFJ 5CD4H 1OWXA 2B9YA 2FGOA 4DHVA 2R7OA 3SI8A 1ZM3A 3N5BA 4B3MF 4DX7A 1W26A 2KJVA 1FDAA 2MKYA 2HWHA 4ZN1A 4DUZF 4F4XA 5DGAA 1HYSB 1OYEA 2HVDA 4F4YA 3HKWA 2LDIA 2YNIB 2Z56B 4X84A 1S99A 3GILA 4KH1B 2C3UA 2Q6CA 3M2VB 1NK4A 3I9ZA 3OTEA 2XLJA 2DB1A 2J5AA 1EKRA 2DGUA 4ZVFA 4B3RF 2H5EA 2NUHA 3AY0A 5E33A 5DQGA 4YR2A 4E2FB 3LAMA 1PGZA 3M2UA 3DC2A 4P74A 4FPRA 3BSOA 1WTFA 5A6WA 3KHGA 1PBAA 5F3ZA 3CUNA 3O3LA 2MKHA 2RUGA 4K4YA 1JXEA 2FQQB 2HURA 3C6UA 3P6YC 3TANA 4LSZB 3E01A 1S6OA 3D4JA 3MM7B 3ZTRA 5HI7A 3KUHA 3THVA 4PCQA 4P71A 4NLOA 2XS5A 1FWLA 3DMJA 2C3MA 1VQNS 1A6LA 4IO9Q 3IAS9 3PHEA 4F0HA 3I32A 1RQ0A 1UZHA 3JB9k 1Q78A 2KZMA 2R7XA 4JI0F 1TFYA 3PRBA 2WCXA 2FDNA 1LWFB 3BKFA 2OD4A 2HPUA 3L7UA 5THWA 1S72S 2AKWB 2VPWB 4CLPA 2A2DA 2WVBA 4NL5A 5DG9A 1SC4B 4FYYB 1N33J 1U26A 2KL8A 2BOPA 1D9AA 1LWEB 2EVZA 1TL1B 1Q4RA 2P8IA 1R43A 2BJ1A 2WZ1A 3HI9A 4OV1A 5C42B 2FB0A 2Z30B 3BO2A 4V19J 3BSCA 3HHKA 1TKTA 3A8IA 1YJUA 5IOLA 2E29A 2MJNA 3OL9A 5BJRA 2H4YB 4HHJA 2ZBCA 5IZHA 4DSFA 4OZ1A 5FDLB 2FLPA 3CJ8A 3IFEA 1ACMB 1KVKA 1RHRB 1Q1KA 4NCGA 4ENOA 1C1BB 4AYBD 3C3LA 4IH7A 3ELHA 5A8RB 3QMQA 2W7PA 7FDRA 3CD7A 3DU5A 2YWKA 3K2YA 3KOAA 4LRAA 1Y4ZB 3VGVA 2IY5B 1RCOB 3CJ5A 3MEKA 2E7WA 4NA3A 1LWCB 2ILYA 2RJZA 1D8YA 2IHR1 2D3ZA 2XNQA 2KH9A 1QUPA 1H2TZ 3R5AA 3NEKA 1RWNB 4DN9A 1EP4B 3H5YA 1F6TA 2PEBA 3MPWA 4OYAA 5CYQB 1U1LA 1DTTB 1R7IA 3I0SB 4UUXA 1SV5B 1XWLA 2BV3A 4K5RA 3R5JB 3QZ8A 1K73T 5BR8J 1Q16B 3R5BA 4HYKA 1WHVA 1UVIA 3CDWA 5D3GB 1CEZA 3CCES 1MN9A 1NSQA 2IAJB 2GHWA 1GEHA 2XWXA 5J2QB 3JTOA 1UWBA 2HQGA 2MKJA 1HHQA 4QPXA 2MQ8A 2LMIA 1CQNA 4PG8A 4KGZB 3KHHA 4NMLA 1VQYA 5ETQA 1VQMS 2W9CA 1VJWA 2BJ7A 3SEOA 1CVJA 2YPYA 2JWNA 4X66F 3QT6A 1RT7A 5ETLA 4XTTA 3NCPA 2B5JA 2OPQB 1VFJA 1FRIA 5AE2A 4PYDA 4JB8B 1HIYA 1RHUB 2RHQB 3IG1B 3CF5Q 2RSQA 3G96A 4DV1J 3NCQA 4QIVA 2V2KA 3OJSA 1IBKJ 4I7FA 1HWJA 4AUKA 4MIBA 2EW9A 3T3FA 3D1QA 3MGJA 3TJAA 3VQSA 4LF8J 2DEIA 4K59A 5A8KA 4WU2A 3C2PA 5KG1A 3C8YA 1M0SA 3ZZUA 5KT7A 5L1JA 1UVMA 4Y2MA 2HBQB 1Q8BA 3PG9A 3JAMY 1HARA 2YNIA 2XMVA 2ZZNA 2H51B 4WE1B 5KT5A 2XEXA 5AXNA 3LW5C 5HQ8A 1QSSA 4IFYB 1X5OA 1HI8A 2LQBA 5KFHA 1B0VA 1YLXA 1LW2B 2DGQA 3LQVA 4MK7A 3MPUB 5I4MA 4QWDA 5L1KA 4NLYA 2Z8QA 5KFKA 3WX4A 1BY9A 1RHMB 2PIIA 3EWGA 4NEYA 2DD8S 4ZVHA 2HW3A 2Y0SD 1X9WA 4CO5A 1Q53A 4GVLA 4ICLA 2XMKA 2PSZA 4P10A 1NBEB 3HULA 1SQGA 3PNIA 4USKA 4NE9C 1LV5A 1URNA 4DR7F 4PWDA 4Q0BA 3FBFA 3K0JA 2KTQA 1RWUA 2DNZA 3MDFA 2R9LA 1ITPA 1B4SA 1XN9A 2UVUA 1Y0HA 2AEFA 1AW0A 2COLA 2W9BB 2EFVA 5CQGA 3FBCA 3VQTA 5F41A 5IFMA 3M6VA 2ZBRA 3MEDA 5A76A 2XMTA 3MR3A 4JI7J 1GX6A 3I96A 3M30B 5IXUA 1LWFA 1QM9A 2YWEA 1HBOA 4K2XA 1AYEA 2L3MA 3RJMB 3T5HA 4QIFA 4CZCA 1C4CA 4F8RA 4DG1A 2KKHA 3DLGB 5E3AA 3HK2A 1WD6A 2XBPA 2Z0GA 1SKWA 3P96A 2VC0A 1SPBP 2YNGB 2YX1A 3GJSB 1F9HA 4DR7J 3GJRB 3D0IE 1HYSA 3ITHA 1GK8A 2F63A 4NLQA 2QA2A 2FJEB 3S7RA 5H9EJ 2B8PA 1U6BA 1ZH5A 1H7XA 1TKTB 2W2OP 3T5KA 2BDPA 5HVGA 4F3QA 3KLEB 1NZAA 1WWHA 2BOAA 4DSIA 3OXLA 3FSYA 3GV5B 1H3DA 3M2RB 1FTCA 4DR5F 3DLEA 4N5SA 3RRGA 1HFEL 1JLGB 5D4LA 2OO4A 4IG0B 4ZVRB 2ZBIA 4HR2A 4I1TA 5K5MA 3PJ9A 1SJRA 2QA4S 3GIRA 1DBDA 3HHLB 3IR7B 3PJWA 4FP9A 4DV4F 2OIHA 4OZ3A 2GJIA 2UUBJ 3UN5A 3DRRA 3MM7A 1T9VA 4FYVB 4OJ3A 3O2IA 1FJEB 3FBBA 1FX2A 2CAJA 1VBXA 3BKUA 2V8PA 3LP0B 2V4JA 1ZS6A 1KONA 1NO8A 2RD5C 4O3PA 4YDXA 4CLZA 8ATCB 3EZ5A 3NNCA 3NGRA 1DTQB 3CMAS 5LXYA 4EUVA 2OPRA 1A7GE 4KQZA 3RRHA 2CNKB 4C0BA 1U1RA 1EAYC 4EO6A 2BANA 4DUTA 2HFUA 3H98A 4H4MA 4DFPA 2FJVA 2VA3A 3GJQB 4DV6J 1MROB 2CJYB 3EDQB 3LH2S 3PYFA 2UVRA 4JI5F 4V19X 3C16B 2F4VF 4DR4J 2VICA 4CT9A 3UVJB 4Q43A 5J2QA 3LP1B 2FHJD 2ACMA 5KG5A 1D0EA 7AT1B 1L3TA 4ZK7M 3LGHA 3NOCA 4DV0F 1HR0F 3AOCA 1PC5A 1IM6A 2J9DE 3ISZA 4O4RA 1RWPB 1VHIA 5DS7A 5DG7A 2FY1A 2HHHJ 1FWPA 1V6HA 1R31A 2DKOB 2YXLA 4QJVA 3EX7B 1YK9A 1EX8A 3T6BA 1M1HA 4JV1A 2FJWA 2RNEA 2DHHA 3HJVA 4YP3A 1WI6A 2M5YA 4RW8A 4J9RA 5F8NA 4DR1J 1RT3A 1N5YA 1V3ZA 3VGUA 1X31C 3AJ1A 2AWZA 3N0VA 2V2QA 2OPSB 4ZP8A 4CYUB 1QE1B 1Q86T 2D9PA 3DU6A 2EKYA 1VQ6S 1NKCA 1FVSA 2GMHA 3AD7C 2QRRA 1T9YA 3CWJA 3QIDA 2BABA 4ZA1A 1FDNA 2V63A 3CXCR 3M2VA 4CO1A 3VAIA 3CMES 1Q0NA 1OQ3A 3DRSA 4U6PA 3WQPA 3ZTPA 1RKJA 5A8WA 2OEJA 1M1GA 4ZJQA 5B08A 3ILOA 1ZAXA 2XM3A 3ETMA 1PC4A 4UF4A 4DOZA 4JV0A 1RWMB 1FKOB 2JDJA 5BXIA 2A0FB 3D66A 4RL1A 3BYPA 5KFCA 1I94J 2G0IA 5ETPA 3LP2B 3T1YJ 2C28A 1ZA1B 3FNNA 3K5NA 3B54A 4RO0A 2FHKA 3H20A 4U7CA 2Q66A 5HBMA 3ICLA 3CW2C 2HZAA 5D3GA 5J2PA 1HNIA 3DLBA 4M5GA 3MF5A 4N76A 1FXLA 2LDYA 1YBTA 3BGUA 1B0PA 1IKXB 2IRYA 1HWIA 1W25A 4MKYA 2HWTA 2BMBA 3GJTB 1RWVB 1X4BA 3NGKA 3TA1A 2MQOA 4FBUA 1KFDA 5B09A 2R8KA 1S6QA 1URRA 4S0MA 5F8IA 3BPSP 5D0HA 3GIKA 1CJKB 2BUNA 2FZGB 3HVTA 2FVRA 3RR7A 2V94A 3PKMA 2HNYB 2Z58B 1LWEA 3Q2SC 1Z2ZA 2QLJB 3BGLA 2LA4A 3BSNA 2CQ1A 2W01A 1NCLA 2R3VA 2B51A 4CLKA 4WXOA 1VQOS 3WZ0A 3G6VA 4ECVA 5CCMA 4CP5A 3R8YA 4USTA 4KFBB 1T11A 4A8MP 5FDLA 1HBMB 2M8HA 2Q79A 3EUNA 4IQXA 3TRGA 1DHMA 1HBNB 2FVQA 3EXYA 3AOBA 2LVWA 3AXMA 3D68A 3L7OA 1RE1B 4R0JA 5HP1A 4DR2J 3RW7A 1FWKA 1R6YA 4QIEA 4FYDA 1K44A 4QW8A 1NDCA 4GKJF 1KQKA 1RB0A 3GU0A 3KG4A 3L4BC 3LWMA 1UPMB 2XO6A 1VQPS 4BDPA 1TFWA 2UXCJ 2DXDA 2J7KA 2FHJA 3TO8A 2X1FA 3OVBA 4CT8A 2AEJA 1BUXA 4O3NA 2W8KA 1QAJA 2E1RA 4B3OB 2B4VA 4K7QA 3FJ2A 1S6PB 4DUZJ 1N5TA 3CCMS 1N5SA 4JP8A 1WEXA 4USIA 3U02A 4ETXA 1T03B 1UP1A 2I38A 3TYTA 5KFQA 2UXBF 1VBYA 1UVNA 4ZP9A 1SIZA 3MEEA 1S1UB 2W7AA 2AJ2A 4NPOA 1RTIA 3H2UB 4NWBA 2W9BA 3PEJA 4YHHJ 2RS2A 1YBAA 2APOA 4R25A 2Z2MA 3SDEB 3VR1A 5KG2A 1N5VA 3POTA 2Q3PA 4C3KA 3GP9A 1LWXA 4OYZA 3KMQA 3V81B 1FK9A 4J9KA 1N6QB 4HT5A 3BDPA 1TKXA 1HI1A 1TL3B 4JI1F 3TA2A 1WEZA 3L95X 5DDQC 5DDPC 4KO0A 2W4CA 4X64F 4LFAJ 2OFGX 2AGOA 3A3NB 2NQPA 3PX4A 1R89A 4ZVSB 4ED1A 1G2EA 3RYLA 2E5IA 3Q0AA 2NLWA 1BMQB 2RT3A 4B9SA 5GVQA 4EWTA 4TU8A 3SCJE 4WP8A 4J9PA 4DV3J 2XY6A 2MXYA 1MSWD 2V68A 2YTCA 1VC6A 4I6WA 4IH6A 3UR0A 3AOAA 3B6BA 1I1GA 1F3FA 3EE3A 4RW8B 5IV3A 1CJVA 2C42A 4D3HA 4CLLA 3RAXA 3I56S 3NRBA 3OHAA 1Y9OA 2AYGA 4WZMA 2IMOA 2H65B 2XCAA 1T05B 3HVWA 5C42A 2VPYB 2HK2A 2JC0A 1NRKA 1IJEB 1BGXT 1X5SA 2BE2A 5IV4A 1W7WA 1BWVA 4YR0A 1VQ9S 1TK0A 5E3RA 4F3OA 5L9NA 4C8KA 1HKAA 4GKKJ 1S1WA 2EG1A 4J9VA 4H4OA 2JEIA 1LW2A 3MCSA 3GV8B 3GR1A 1DTQA 4ELTA 4LF7F 3M1VB 3QLHA 3C6TA 1N0UA 3DDNA 1V5VA 1X4GA 4TKTA 1KEKA 1N32F 4C11B 2ZKUA 1IKYB 3PR5B 3QZ7A 1M5HA 1T9TA 2HQIA 4FKXA 5KG6A 1P9YA 1N54B 4A4JA 1BC6A 3QBCA 3CJRA 1DFDA 1F2HA 4N41A 2EBGA 3OR2B 3RRKA 1LOUA 1PJ6A 1AUSL 2VL1A 1NU4A 3AQPA 1T0TV 1IKXA 3LGMA 4RW7B 3H90A 4WXWA 2NPIA 3VTIA 4IKAA 4UT4A 4C6AA 5J1EA 2QSWA 2DGXA 2Y0BB 3QPIA 3NGTA 1VRTA 4Y2KA 1U02A 3CJ3A 4ITSA 5LMNJ 4NXMF 3IWXA 2J7UA 4MH8A 5I42A 1RT3B 1WF0A 1CJTA 3J81U 1N5YB 4P73A 1QAIA 1RT6B 2HNYA 4WIQA 5C25A 4DV3F 3CJKB 1JJCB 4KJIA 8AT1B 1WEYA 2B4UA 2HS0A 5LSOA 5BR8F 2JLEA 1ZAVA 1X0FA 3HVAA 4J5OA 2J76E 5D4NA 3TQ1A 3RR8A 3DRSB 3M05A 2CPYA 3SCIE 3JAMU 3H8YA 3KK1B 4NLUA 3GFHA 1FTRA 5A8WB 4KFBA 4DL7A 4ES1A 2Y1JA 4PUOB 3OXGA 4PPDA 1KP6A 1JLQB 1S12A 4J9OA 3MMCA 4FF1A 4XDCA 3HFKA 1MLAA 4IDKB 3KDOA 3MM9A 3NGSA 2DR5A 1X60A 3B8HA 4CIOA 5FIIA 4ZPCA 5BYQA 2V8VA 1HNZF 1G7CB 1KKHA 1S1XB 3MMAA 1D9FA 1NHVA 3NAIA 3BQ2A 2R7TA 4KHPF 1S48A 4JI4F 1P6TA 2G2YA 3J7ZT 3FFIB 5BYRA 4LFBJ 1U2CA 4ZHRA 2VFSA 3HHNB 1YDLA 2ZD1B 2CQGA 3JSRA 4K8RA 5EDWA 3CC4S 2CJQA 4J90A 5K8MA 2BRKA 2W9AA 4ECRA 2UUAF 2M52A 1QLNA 1VBZA 3QJJA 3K5MA 3BV8A 4DSEA 3D6MB 4HT7A 4MMOA 1F9FA 1U7LA 2YKAA 4NEZA 4JI8J 2KXNB 3W65A 5ETRA 4F04B 1OY6A 5AJ3J 1S1VB 3TJ8A 1DQ8A 3M4XA 2HLUA 3TI0A 1FERA 4EFAC 3HVRA 1E6YB 2NS1B 4I6AA 3QGHA 2GW8A 2DNOA 2PFDA 2FD2A 3IC1A 1TUWA 5L1LA 3OHBA 3PY8A 4CI0B 2MQNA 1S4EA 5H9EK 3SCKE 1SJ4P 1N6QA 5KFXA 4RU2A 1VGYA 2WBRA 5F8LA 1RAHB 1PJ5A 1P1LA 3FVYA 4RW4B 2BXJA 5IT9Y 4DF8A 1T9WA 4RPFA 4P72A 4ZVGA 2I8EA 1UW4A 5EN1A 3D7SB 4CLUA 5KT2A 4RNNA 3NP5A 3EVMA 5HL7Q 1RK8A 2WRMA 1HMVB 4GO7X 4WFNQ 4QPTA 2D69A 4YB5A 3CIMA 3NL0A 3KG1A 4BWJA 4PABA 5L9XA 1XTZA 2DO4A 1NEEA 2Z2YB 3AB4B 4OLPA 1ZZNA 2GVDB 1J5EJ 3DOKB 2VODA 2MLXA 2HEKA 4IOAQ 4I0WA 2BW7A 2DH9A 2OEKA 5GAGI 2VBZA 2CQ3A 1TU0B 3OTDA 3GG1A 2DIUA 5LJ3Y 3V6JA 2ASLA 1VQ4S 2XMWA 2HVZA 2N3LA 4NCGB 4F50A 5KT4A 3T1HJ 1M1KT 1O0PA 1N34F 2YKPA 2MZ1A 1S7IA 3MEEB 2O66A 3K89A 1KBRA 4LR8A 1A0OB 1QDUB 1NB2A 4MFBA 4NLSA 4KRWA 1F60B 4E98A 1UVJA 3NS7B 3T1YF 3U1NA 1AT1B 1RI7A 1NUEA 2DIVA 3IR5B 3W1YC 2DNRA 4YB6A 1JLEB 3PDNA 2XI2A 3V81A 3LA0A 1MMLA 2V67A 3MM5A 3WIUA 3CCJS 3SSQA 5LMUJ 1HNZJ 3CIZA 3J7YU 2MZRA 2VQFF 5EX3A 1EP4A 5KG7A 4DV2F 2NCKL 2BACA 3US5A 1FKAF 2NXCA 1S6QB 2EI5A 4Q44A 4DV7J 1GMVA 2MKCA 3PACA 5F0WA 4CH1A 2LXIA 3ONQA 3MPVA 1AFIA 4QIGA 4WK1A 4E8UA 1G4CA 4OI1A 4LF5J 3CNQP 2O1PA 3IAM9 1AUDA 5IT0A 3QYYA 2DGVA 2HK3A 4DQQA 3WHIA 2WHOA 1KOHA 1BE4A 1ZA2B 1HNXJ 4DWIA 3OL8A 3TUPA 1YITS 3K7RA 4OZNA 3HD2A 3A1YG 4C48A 1TVRA 1OSCA 3KLHA 4ZP6A 2RH3A 4LMZA 4DV5J 3P5BP 1S1TA 4Y65A 2KG0A 3GR0A 2ZJRQ 1NJZA 2DNMA 2E9ZA 3TX8A 1T3OA 4C98A 3H7HB 4DV0J 4FBTA 2VG5B 4DXLA 4LF5F 3NY0A 2WSCC 3KJFB 4Y28C 3U27A 1YVFA 4AFFA 1R8HA 3JTPA 4F36A 5I3UA 2DGOA 4X2BA 4LF2A 1IBMJ 2HGMA 1S7HA 1NHKL 1SKUB 1NPPA 3I5CA 3NMRA 4LRDA 4JI6F 4WFZA 1L3VA 1C0UB 1WC1A 3HFZB 3J80U 2RUSA 1RTHB 3H4BA 2R7QA 4G1QA 4XDDA 1P8GA 1VDHA 2HQFA 1LW0B 1LFPA 1YZ7A 2VPXB 3FUYA 3OUYB 3P4UB 1N48A 5AE1A 1N32J 2IM0A 3MTJA 3LOUA 1DLOB 4NLTA 4Q5VA 1SJ1A 2BKPA 1U09A 3UDLA 3BJYA 4DL6A 3A8JA 3R5DA 4TY8B 1UZDA 4U7UK 1XC9A 1N34J 1R8PA 3DLLQ 1I51B 2CQCA 1Q5VA 4NZ7A 5KT3A 1LK7A 1UWAA 2FZCB 3CB4A 4GKJJ 2RIJA 1PKUA 2ADBA 4G65A 2MGZB 3MR2A 5C24B 1AZSB 3SCLE 2LYVA 2PE8A 2QL7B 2ZVSA 4J9LA 1QTMA 2IA6A 3QRPA 4P9SA 4DZ6A 2VDHA 2CIMA 4LF1A 1NJYA 4A8WA 4NZ6A 2JL9A 4L6V3 3LALA 4RNHA 1CULB 5CXTA 4GC6A 3LTOA 2XS7A 3PKYA 4AE5A 1EQ0A 2HNZA 1RT1B 3T19A 2DNLA 4PUOA 1T02A 2H5IB 3OL6A 2AZ1A 4DX6A 5A0YA 3W62A 3V2UC 1UKUA 3SZ2A 2MMYA 5ETTA 3W2WA 5T7LB 4NXNJ 2QTWA 5IT4A 2E44A 4JI1J 3F44A 4JUZA 5GAHU 2NXEA 2JJ4D 1XR5A 4ZLPA 1YZ6A 3EDRB 3M8PB 4X4QA 1KHVA 4CTAA 3ENQA 1YBUA 4X4RA 4B9TA 2ZEJA 1RHJB 4W4MA 4W92B 3BH7B 3NWGA 4ZHRB 2KM8C 2WVEA 3DYAA 1HNWF 5I3QA 5DRKA 2E5GA 2MHEA 3DOLB 5KFYA 1ZAWA 2VHGA 4WK3A 1K0VA 1CJUB 1H7WA 3C6TB 5HATA 1REVB 4J9MA 1GX5A 3M8WA 3ZZPA 4LFBF 4A8OA 1YKWA 4EO8A 4JI4J 5KFVA 1NPRA 1OYDA 1JMTA 4URSA 3T1HF 2KXFA 4ZP7A 3L9ZA 3MUVP 1RAJA 2UXCF 3CJTA 5C2CA 4RZRA 4Y00A 4KKOB 2HG4A 4NYPA 4I56A 3ZZZA 2R7SA 3RU0A 4P6QA 3I9V9 1WKJA 2QLBB 2VF3A 2JVRA 1FFSB 4MAKA 3VV2B 2IYGA 4RUBA 2MEWA 3CJ0A 1SUQB 3PYGA 2I9SA 4NLWA 1KWMA 1Y3KA 4O0NA 4FF4A 1IM4A 4C8ZA 1VS3A 4F67A 1FJGJ 4PXDA 1U0HB 2PT0A 4CO4A 4ZPAA 4DR4F 2K8GA 3MEGB 3NS6A 2VH7A 3CD5A 3KFWX 3J81j 1H74A 1N88A 2Y9HA 1QVFR 2B4PA 3G8QA 3QNWB 2FZKB 2FY8A 1DQAA 2IDEA 5E3QA 5B0DA 4QWEA 2UU9F 1IWAA 1JLQA 2ACYA 5LMNF 3CULA 1FJGF 2HIYA 3KLVA 2W2PP 4ZOSA 4CCHA 1AXQA 4JI5J 4UQTA 4XAKA 2G1HA 4WE1A 4YOEA 4XPCA 5KFTA 3UDEA 2K1RB 2JLGA 4ED0A 2HVHA 4XIUA 2P2CB 3JXOA 3MMBA 4ZCKA 4WJBA 4CYUA 4O3SA 2DRDA 1QE1A 3AH6A 3FEYB 3BS9A 3KXDA 2HFVA 3P5TL 3FSIA 4DLGA 2YKMB 3GCXP 3EPIA 2HRYA 4JI8F 1LNQA 1T3NA 3BBBA 5K9FA 5HVHA 3V6DA 4A8FA 2R2SA 3RAQA 1VHFA 1JLEA 3UCZP 4B9UA 1YX2A 1TL5A 2B43A 2EG2A 4DL0C 2A6MA 3TVZA 3UDCA 1VC0A 3V4IB 1BWEA 5J2MB 3ENWA 4PXBA 1WACA 2E1MC 3TVYA 1TL4A 3D0GE 2VPZB 2IVYA 4DPTA 4DV4J 2GVZB 2DR7A 1OSDA 1RTZA 2EC0A 2VA2A 2F8MA 4RUAA 4F02A 3MURP 2D41A 2JH3A 4DCJB 2QN6B 2IJFA 4PG4A 4F0MA 4X62J 3G6YA 3BGRB 5GMEA 3RW6A 1B0TA 2B7BB 1VIXA 2DY1A 3FGVA 4TQSA 2LFVA 4G3IA 3M9NB 1HNWJ 2YNGA 1C2PA 2BKOA 4RW4A 1XK8A 4WU3A 2X1BA 3QT5A 3UD3P 1ZZFA 3ZXWA 1PJ7A 3W2VB 5KOWA 3W63A 2DRAA 1Z1ZA 4F26A 1Y5LB 2PA3A 1I3OB 4HI1A 1MG7A 4NYZA 2PI5A 2L08A 1PYOB 3FZBA 1FRLA 2XLIA 1HNXF 4KT0C 1HPZB 2BVZA 4C4WA 3KLIB 4LFAF 2C2EA 4JI7F 2NYHA 3ET6B 3FDSA 1JLGA 3L09A 3Q8YA 5KAKA 4TN2A 3WDOA 1WDDA 2QV6A 2RQKA 3FSXA 4KIAA 2K7KA 5B7WA 4CO0A 4JI0J 4MJKA 2F4FA 1YRXA 4XK8C 4PRFA 1XR6A 3QFHA 4LVOP 1VIOA 1FHTA 1R0CB 2YH0A 1VCTA 2CJBA 4DPYA 2V69A 2HAFA 2QMXA 1KQGB 3KYLA 4QWCA 1SKSA 4KSEB 1ZOTA 4EMDA 1FJCA 2MSSA 1B70B 2LEAA 2NZCA 3MOZA 2GJFA 2KYXA 3R6GB 2W24A 1RWKB 2B3TB 4C8OA 4OZLA 5LT5A 2AYEA 3B4MA 3OFHA 5T41A 3RGIA 2CQ2A 2W2QP 2OPRB 3PO4A 4PG6A 4F7VA 5KFZA 1E6VB 2ZHOA 1RXOB 4TXSA 3U1LA 1X5TA 3TWZA 3I0RB 2V4RA 3L3CA 3AD8C 4I2PB 3VCDA 2DH8A 2W7OA 4USUA 2DNPA 2ZH9A 4NA2A 3BF4A 1SH0A 3RG6A 1J27A 2VV5A 2NXNA 4B9MA 3OL7A 3KLGA 1KSPA 2FVSA 3EJMA 1F5CA 2K3IA 2MQPA 3NNAA 4OLOA 2P9CA 1Q8KA 5ADZA 2XC9A 1K0TA 1KVIA 1UPPA 1GXLA 1OPIA 3RB3A 3FEZA 2FJXA 3HSZA 2ZZTA 4RUHA 3HP6A 4O44B 1RUSA 5K8OA 1TKZA 2XQCA 4E0DA 2J0SD 2HKEA 2PDAA 4C8NA 2XYGB 1FK9B 3TEGA 3IGNA 1NKEA 4ZDNA 3DLHA 3FCVA 5T7LA 4YN3B 3G2XA 1JKHB 2V6AA 3E3XA 3GSIA 3BH6B 4ZVUB 5KFEA 2KXHA 1T94A 4KHMA 4WFYA 4C7QA 1KR4A 1WSRA 2NYIA 3CSKA 4L76A 4USHA 4ED7A 1Y5NB 2LXFA 3HFVA 5JUMA 4EBEA 4WKRA 4CTAB 4K50A 4LVNP 4OYOA 1O6XA 1SI9A 3ISND 1A9NB 2ALYB 2C3OA 2DTJA 4NRUA 4WTOB 4ZJOA 5HMWA 5IM0B 2Q1LA 4OI3A 4O4GB 5CD4A 3KJVA 4GVBB 1FCAA 3UI3A 2G2ZA 1NH7A 3PXGa 1KD1T 2FLLA 5KFPA 2AW0A 3PJXA 4KHRA 3LP2A 4QYZK 1RZMA 3B78A 3SQOP 2YNHB 1AA1B 1VMBA 2GQQA 4L3NA 1X0PA 3PRDA 4YHHF 2JRSA 3OLAA 2MY7A 4C8LA 1SIWB 2FJBB 4IH5A 4YQWA 2YQ0A 5H9FK 2AX1A 3V6DB 2BZ2A 3AFGA 2EXUA 2DEJA 1GQEA 1MWQA 1B7FA 2PEHA 1U6ZA 1QSYA 5HROA 1MWZA 2MY8A 2VBYA 2NXJA 1VOMA 2MJUA 3EMTA 2MKIA 3VAMA 4H4OB 2XY5A 4ZN3A 2UZAA 5J2MA 1M5PC 2ZBQA 2UXDJ 1RT4B 2P6SA 1SJFA 1FVQA 1AZSA 1WELA 1KQFB 3K5OA 3PO5A 2YX7A 3FMBA 1JLBA 3KJNB 5J2NA 2ATLA 4P2XA 3THPA 2IFXA 2WVDA 2CYYA 2RRNA 4P52A 2E1AA 3J7YI 3CCVS 2WTFA 4GC7A 3MEGA 2ZOGA 5D6GA 3EGZA 1TTHB 3G6ES 3TJ9A 1RA6A 3C14B 4FYXB 2UVWA 1H98A 1ZETA 3NXZA 4CNZA 1UWBB 3HHLC 3HHDA 2MZJA 2B4OA 4MKAA 5IWAJ 4QOTA 5L1IA 2CPEA 3ETOA 4X4TA 4X66J 1VRTB 5L8RC 5HSPA 2B6AA 1UJ6A 5DDRC 2L48A 3DLKB 1CS4A 1H72C 4P2SA 2DGSA 2C2ZB 2DISA 4P75A 4TVAB 4UOHA 5DO2A 4ZKAA 3CCUS 3TQEA 1WC6A 3CDUA 2Y1IA 3MPYA 2G0JA 2N82B 2F65A 2PMWA 3M8PA 3KK2B 2NR0A 5HMXA 3K17A 2PN6A 2XCPA 4DV6F 4UUWA 4USMA 4K4WA 1TMJA 4MT1A 1YJVA 2XMAA 2XMJA 4WF9Q 4ALZA 3UD4P 1JIHA 1HWLA 4RLEA 5L46A 2BJEA 4IRDA 2ASJA 3VHQA 1FJ7A 2CZVC 2GHPA 1DARA 3T9NA 3TW0A 1KDNA 3NGDA 1PAEX 5AE3A 5FJ4A 3QT8A 1HD1A 1P1TA 3MM9B 4USWA 5JVHQ 1S1UA 1R27B 2P9EA 3PV8A 3M6UA 1L3SA 1V3SA 5IQ6A 2HS3A 1K9MT 3ENAA 2BJ8A 5AJ3F 1U1OA 1S0VA 4B3RJ 1TV6A 2M4MA 6FDRA 2M88A 3VVTA 3M32A 3GYXB 3I0RA 2YX4A 4HHHA 4HLBA 5E41A 5JMNA 4XO0A 4B3MJ 2WSFC 3R7BB 2UUAJ 5LJ5Y 1OY8A 2V2ZA 4EYHB 4KPYA 2V9KA 4I4BA 2XS2A 1ZPVA 2HNDB 2OI2A 3JQMA 3PYDA 4CWBA 4ECWA 1W2IA 2J9EA 1IBMF 1LXNA 4OYWA 3W61A 4QW9A 1EZZB 3I55S 1OJ4A 2DRBA 4UY85 2ZOMA 4BC7A 4C2MA 2PD1A 5AXMA 1UFKA 3QIPB 1TK5A 1JNZB 4ZVQB 1VBKA 1E6YA 3HO1A 5A2QU 2YQ1A 2XZWA 3H4DA 4DR1F 3I4PA 4RR5A 3RB0A 1FRMA 4KH0B 3CMQA 3MAQA 1XQIA 1ZTTA 3W8GA 5F8MA 3V4MA 4KBIA 3UE2A 2LQ8A 1N33F 3CCZA 2CG4A 4LQ9A 2DNNA 5G0RA 1JLFB 3DN9A 2LQ9A 1FRJA 4F0KA 1IQZA 1H0HB 2F8EX 3PW5A 1MMNA 3D67A 2VD3A 3EGWB 3R7NB 4WWSA 2GJ2A 1QD1A 4B9VA 1TZ0A 3LPEA 5F9NA 3KJVB 2HWIA 2YWHA 3D6FB 1H38A 1YJRA 2XHWA 5LMUF 4L73A 2ZE2B 4U67Q 4YB7A 5HAOA 3CCLS 2CPFA 5HJXA 4A8XA 1N8RT 3QJLA 1WHYA 4DQIA 2W25A 2YWGA 4DI6A 1UEVA 4I6YA 1FNOA 1RBLA 2XTJP 2KO1A 1GXTA 2BEFA 2HFOA 2QZ8A 3DGPB 1RCXB 3DOMA 3P45B 3P8BB 4NLGA 4Q8FA 5GADU 1QJHA 1NAQA 2ZHBA 1DZ5A 4GKKF 2R2RA 1CC7A 1NPKA 4BS2A 4PG5A 2CNNB 3QGPA 4EYIB 1Y11A 5HMZA 1TKZB 3GG0A 2R8HA 3GONA 4UY8T 2IAJA 4KAIA 2H3EB 1EARA 1KHWA 3LO3A 3OBIA 4LQ3A 2HFZA 4WP3A 2BANB 4AQYJ 4Y0FA 4LF7J 4OI0A 2LCWA 4UW2A 2IM3A 2MSTA 3GB0A 1O51A 3SXLA 5HN0A 4DS5A 4RW6B 2ZJQQ 3PFOA 3H5XA 1IWGA 2FHOB 3C16A 2P9GA 4DPUA 1JXLA 4Q7AA 2OLWA 1SB6A 4RBVA 4HDGA 3GWCA 2EFNA 2NSCA 1IQTA 4DSKA 1S5ZA 2QC3A 2SXLA 3OR1B 2VG7B 3KLIA 3T1AA 4FZVA 1UETA 2V50A 3H2VE 4WFXA 4YMEA 2A2CA 1U1NA 1FRXA 1GFWB 4IFVA 1RA7A 5M2RA 3MM6A 2Q6BA 1EB0A 4LUBA 2GA7A 1WC0A 4M5JA 3WX8A 2C3YA 1Q79A 5F8HA 3AT1B 2QA4G 4ECZA 1KFSA 4DV5F 1U48A 2UUWA 1CBKA 5AT1B 1RWXB 2QE5A 2XO7A 1RBOB 2CNLB 2RAQA 3VVUA 1EKSA 4ES2A 2AJFE 1F9EB 2YKNB 5B0EA 3IN5A 2NZ4A 2F8HA 5D0RA 4O3OA 2XSJA 1UL3A 3R3TA 4LRCA 4X64J 3TZYA 5LM7E 5KFAA 1MWYA 2BX6A 1UA1A 1Q5YA 2GX8A 3DFEA 4DS4A 2ZUGA 2OGUA 4RBUA 1E6VA 1FKOA 5D15A 4DV7F 4ZVTB 2J8SA 2BQRA 5DM7Q 2HQCA 1RISA 4FXVA 4MKVA 1JLBB 5J2NB 4ICLB 3W5ZA 2ZH8A 3DKDA 2VZ9A 4TY9A 4DR3J 3GPAA 3ILLA 3KLGB 5BYSA 4TQRA 2LEBA 4ID5B 5LXRA 1S0NA 4QU7A 2UXBJ 4I67A 3CCQS 4IRKA 1WC5A 4R5PB 2CPXA 2RHSB 4WKYA 3QJPA 1BLUA 3NOGA 5ETSA 5KG3A 4P2MA 4USVA 3TUJC 3A3PB 3ZZTA 4C9DA 2GHVC 2IJNA 4PWWA 2L9WA 2GMLA 4ZPVR 1AB8A 3EICA 4M94A 3MAAA 4K4ZA 4DG1B 2LU1A 3O5TB 4DQRA 1FFGB 2X1AA 1FFWB 1XJWB 2JHEA 3L7PA 5KFSA 1JJ2R 4JV5F 1HMVA 2HHSA 5C7PA 2XULA 1RAGB 4KGVB 1VYAA 3LP1A 4KPCA 1S79A 1CULA 3MUTP 3W9JA 1VLYA 1M5VC 5SZTA 3VZHA 2N7YA 4OZ2A 2X1GA 2M70A 4PQAA 3VZIA 3ZZYA 1U47A 1GNKA 2HNZB 2VQEF 2XB2D 3MECA 5KFWA 1FDDA 2MTLA 2CXEA 5HO4A 3JQJA 5EWGA 3PW7A 1VQLS 2BKNA 1HHSA 2IMWP 2IDLA 3WBZA 3OTBA 1M5KC 4TU9A 2HS4A 3J80Y 3W2WB 1S9EB 1NNDA 2YNHA 5CZVA 3D3CJ 2KM8B 4Z2XA 1YHQS 5J1NA 3I6PA 5LL6d 3MM8A 5E5NA 4M5HA 4KV8A 5DG8A 1V9OA 2DPIA 4M8LA 1NK0A 4RBTA 2CDQA 1YQHA 2XMUA 3DRRB 2LA6A 5DZ6A 3QWPA 1TV6B 1HI0P 1WORA 3ZFVA 1WJ9A 3SV4A 4DSLA 1HLWA 5GAEU 3KDNA 2WW4A 3C19A 4KGXB 3H59A 2DXFA 1S6PA 1S57A 2E66A 4ZVEA 3D3BJ 2AJ0A 2VC1A 2NPFA 4B9NA 3OQ2A 3GIMA 4QYZJ 3AD9C 2ZHAA 3T9ZA 4H54A 5LSLA 3O44A 2GIQA 4FYWB 2E7XA 3VAKA 2ZH6A 2J6TA 4K0KF 3TZZA 1H2UX 2HQ3A 2UUCF 4PWUA 5IC4B 3IRXA 5DETA 4DR5J 1RYSA 2J9CA 3GYGA 1NDPA 4DL4A 2WVFA 2A3JA 4BWMA 2MZQA 2VG6B 4UQGA 4YY3J 3Q86A 4IOCQ 3CT9A 5K14A 1ZM9A 5KFBA 1U1KA 3P49B 3QRQA 3FCWA 3AB2B 3OSNA 4EBDA 1S9GB 1GMWA 4Q2LA 2CUYA 2KT3A 3T41A 4LREA 2W4DA 1C1CA 5EGYA 4Y34A 5EHHA 4FS2A 1SJ3P 4X4UA 5ETMA 3CDEA 4ZVOB 3V6KA 3U1MA 3K5LA 1WG4A 2CZ9A 2LP4A 4CO2A 2J8AA 2XGPA 4LF4J 3KK3B 3CJQA 1KTVA 4A47A 2OPSA 1D09B 1TELA 2U2FA 1R3NA 2FJDB 1VJQA 5CYMB 3TOQA 2JZ5A 2ZJPQ 4BCAA 5LSRA 1FF2A 1PG5B 1RAFB 4OJGA 1IR1A 5FLXU 2ZM6F 3N6LA 2PFFB 2KHDA 2DHSA 2FYXA 4PQUB 4ZLJA 3PEHA 2KYZA 4RNMA 4ZPBA 1C4AA 4GMKA 4NX9A 2VIHA 1QAYA 3RBXA 1G6BA 2M9KA 4N47A 2Z2ZA 4CRJA 1HR0J 3JQKA 1I6JA 3DM2A 4ED4A 1Y7PA 2DXEA 1RACB 1SXLA 2XG8A 2G1DA 2I2YA 3IBFB 3BZQA 1R6VA 2CVEA 2HHXA 2GZOA 2V0NA 3I82A 4HTIA 2IIHA 2GNKA 2X51A 4ZMMA 3DDKA 5HBMB 3HZGA 5HQMA 4MK8A 5DLGA 2FPHX 1D9DA 2HHPA 3M2UB 2I1RA 2LLZA 4ECUA 2OTJS 1YI2S 1ZM4A 5E7OB 2O01C 1PIEA 4IUFA 2YH1A 4U8YA 4QR2A 1SVDA 1IKYA 2AD9A 3ZZOA 5AXLA 2DNKA 1WHWA 4ELVA 4LF6F 3IWLA 4RX6A 2HVEA 4ANDA 1WF1A 3QIPA 4TYAA 3JYTA 3DCAA 1LK5A 2VJVA 3X1LB 2UUBF 3R2CJ 2WAQD 1MMDA 1FKPA 1RAIB 2IM1A 1TAQA 1S76D 2VOOA 3MM6B 1TKXB 2PO4A 4DZDA 1VQ5S 1C0TB 3M9OB 1CJTB 2AHOB 4CLYA 1SJQA 1RT6A 4JI2F 1IR0A 3H42A 5C25B 3W7BA 4TLQA 1HBMA 1XBWA 2HLTA 5G0RB 4B08A 3OXFA 2HHUA 4V1Ak 2RF2A 2GGPB 1K47A 4J37A 3OW2R 1YTYA 2O5DA 4ED8A 2G13A 1ZM2A 4DN0A 4M5DA 3IM9A 3UD5A 2FIUA 1BQMA 3PM9A 4FPIA 4JYAF 4YFUA 2OUGA 2ERRA 2QL9B 4J9NA 2POKA 3ET6A 2E5JA 3QGIA 1Q82T 2BJ3A 2DJWA 2QLWA 1WG5A 2DNHA 3QATA 2AF6A 3HXMA 2XY7A 2DHXA 2W2NP 1OS5A 4JI3J 5DM6Q 2I5JB 2OEMA 2ZH4A 1RBAA 5I3PA 4O0IA 1NJXA 4FXDA 1S1XA 4Z37A 3D9BA 4TNOA 1NZ8A 2GMJA 2KRBA 2X7IA 3DGPA 3DOMB 2WOMB 5KFRA 4X62F 2QEXS 2QL5B 2V9WA 4NASA 5HLFB 1I94F 3CC2S 1RTIB 2AEMA 2QSFA 2XI3A 2FTRA 4X65J 3OVAA 3SDEA 3IM8A 2IM2A 5KFIA 1IKVB 4QWAA 2CA9A 2DGTA 3H5SA 5GAEI 3RB4A 2QFIA 1Q7LB 2V8HA 4LSLB 3I0SA 1DQ9A 1JQGA 4L72B 3UCGA 2XWYA 1RWWB 2KJWA 2V2VA 4RNOA 3E8OA 2F9DA 1TL3A 2KRRA 4OYIA 2B0GA 4C8MA 5B0CA 2V4QA 2OMLA 5F8GA 3QO9B 1FRHA 3THTA 4J9UE 4C8YA 1TL1A 2YY3A 3CCTA 2JNJA 1YWXA 4TYBA 3H5UA 3ULHA 1VRUA 3NG8A 3F0NA 4UOCA 4B02A 4ZS6A 4DV1F 1TUVA 1F2GA 2VFVA 4IG3A 2CJAA 1SBRA 4ZCLA 2OMOA 5JVGQ 1J5EF 4NMXA 3PW0A 5M2UA 4K4SA 4A8SA 4AL7A 1CC8A 1RKIA 3MMBB 3AODA 3H2LA 2ZDPA 2OPQA 2QIFA 3GZ7A 4LJMA 5KFLA 2ASDA 1S10A 2KT5A 1N56A 4RWXA 4CM2A 2UU9J 2CQHA 4KV8B 2R7VA 2DITA 2PA8D 3QSIA 3TR5A 2I6WA 3CDBA 2YKNA 4I7FB 3QGGA 2YNFB 3SV3A 1H6KX 2GVDA 4OHZA 5A8KB 2GO8A 5E3PA 2CDRB 1SC3B 3W5XA 4RWWA 4HH1A 4KTQA 4PEOA 2WK4A 2ZZMA 2JX2A 4WYWA 5IM0A 3NKYA 5CYQA 2BA9A 3IP0A 2ZNYA 3CCWA 3LANA 3F56A 2HMIA 1K1QA 2CZ4A 2RB7A 2LKZA 4ZPWR 3D54A 3V5RA 5EWEA 3DGVA 2C2NA 2MZTA 3TARA 3IRXB 4JBCA 1QAXA 1NJWA 1VQ8S 2E1CA 1AFJA 3BGRA 5FLXY 3RAMA 3MUMP 2VUGA 1HD0A 2FVCA 1HQUB 1BQXA 2CNOB 2VJUA 3MHYA 4M5KA 3FZ2A 1M5SA 4HACB 1HNVA 1FXDA 3MR6A 2ZBPA 1C1CB 4KHPJ 4KC5A 4DU8A 2AJ1A 2E9RX 1M90T 2J9DA 2M7SA 3W2VA 3CTRA 3GIJA 5D8HB 6FD1A 5F8JA 3D28A 3QT7A 5HVFA 3G8TA 2DHGA 3SBMA 5I42B 1WNEA 1S1VA 3IO1A 2DH7A 3S6EA 4YR3A 3FQLA 1R0AB 3O8WA 2RVJA 3D1OA 2YPZA 3N6NA 5K8NA 3SYZA 4LRFA 1FD8A 5IC6B 4EU0A 1V5IB 2E5HA 2ROGA 3FKBA 1SCJB 4M5LA 5LOQA 2RDDA 1NLKL 5MAOA 4OHWA 2ZUAA 1N36J 4DFMA 3I5BA 2ZKTA 4OV6A 3MD3A 2F9JA 1UJ4A 4WYLA 4Q8EA 3Q8PB 2J0QD 5G4DA 1RTJA 3R6LB 1OY9A 2DY9A 2IA0A 3Q8RB 2VG5A 2MB0B 3IBWA 2FHMA 1B7YB 1CS4B 1U25A 2DT9A 3NS5A 1S49A 4Y3CA 4X4PA 4HEA9 3H40A 1BQMB 2QT7A 3D6TB 1U24A 2IVMA 3KK2A 2RRAA 4NLVA 1HQEA 2OSRA 4AD6A 4RUCA 1QVGR 2RQ4A 1C0UA 3FQKA 2EFQA 3C15A 3FFIA 4LFCF 2HGLA 3AXKA 4NYOA 4B3SF 3DNCA 4OIXA 5KFJA 1G3OA 2I5JA 4FDFA 4LT6A 4AT1B 4WZQA 4PR6A 1ZTWA 3GFXA 3HHEA 3B4DA 4Q0BB 5KFDA 3HT3A 1DLOA 1M5OC 2E1PA 1KVJA 1EJ7L 3GIIA 1F0XA 1Y10A 3DXBA 4HTJA 4NRTA 1IUJA 3BQ1A 1R8AA 2H54B 2FC8A 1IKVA 1NK5A 4DSJA 4F4AA 2Y8YA 3CO9A 1U8SA 2CADA 1U2RA 3Q22A 5C24A 3M6WA 1YJWS 2PGCA 1JKHA 2DHAA 2YKOA 4WIIA 5HMYA 5DDOC 2FVPA 1MROA 1F3VA 2WB1D 3QO9A 5DZ7A 4CLTA 3VAHA 2JLFA 1RTDA 3NNHA 2W9CB 1GTEA 4OI4A 4CQ1A 1VQ7S 1CLFA 4K5SA 1XEZA 2KB2A 1MU2B 3CJ4A 1NDKA 4LBPA 4UZCA 2JFDA 2HFNA 5CYMA 1TR0A 2CPDA 2MHNA 2ZNZA 3IG1A 4OX9F 2AJ4A 4DFJA 4CO3A 1EETA 4O4GA 1TUGB 1YG0A 2QFJA 4DL5A 4ZJLA 2EEYA 2LXUA 4K2JA 3JS9A 3M8RA 1S59A 1CG2A 2RU9A 1RHKB 4IG0A 4I2QA 4L74A 3OJUA 4LF9F 4ERDA 1XMBA 1YRTA 4MTPA 4WFBQ 2BJ9A 2VBXA 1OQ6A 4F25A 3RBEA 4OX6A 2R42A 2WONA 2EKNA 3BKTA 3OPKA 4J9QA 1VQKS 4B3SJ 2WOMA 2V8GA 3GYNA 3CPWR 2LU2A 5HLFA 2HZCA 2KG1A 4EI2A 2FUG9 3LP0A 3ZTOA 2V4JB 2FLOA 1NMEB 7FD1A 2AQ4A 2DR9A 5FD1A 1TL7A 3GLJA 4GRSA 4LIRA 3BO4A 1CJUA 3A3OB 2OJ3A 2O67A 1B3TA 4YB1P 4ECQA 3OFFA 5KG0A 4OMFG 2PMZD 2P6TA 4ZIWA 2H4WB 4FS1A 2JEGA 3ZTQA 4CH7A 3BDEA 2XMMA 3Q83A 1U6FA 4QZVB 3Q2TC 3N4WA 4DQPA 2DCUB 4K4VA 4U7UD 3GMGA 2WB4A 3TAMA 1HNIB 2PMHA 5IS2A 1FE0A 1PAUB 2HYIB 1XNRF 9ATCB 3GFYA 3TX0A 1APSA 1DY3A 4DU7A 4L3KA 1GXUA 5KOXA 3D5MA 4HH0A 1J5OA 3R5GA 2MKKA 1NH8A 1KS2A 2JC1A 3UWTA 4WP9A 3VWSA 1Q81T 3KNGA 4B3TJ 2QYGA 4ETZA 4CDIA 1FEEA 2OSQA 3NAHA 4ZIVA 3MR7A 3E51A 3U7JA 2GS8A 1CJKA 1Q95G 1RT5A 4DL3A 3KLHB 3JSMA 3CCSS 1S1TB 3IGVA 4DR2F 1OPZA 3FC9A 1L3UA 2UV8G 4GO5X 5B0AA 3NWRA 1RABB 3UN2A 1BQNB 3HMJG 5C5JA 1F5BA 5F3TA 3EXCX 5AXKA 2YNFA 3SSRA 4PKDB 1NK6A 3ZNJ1 2F3JA 2OTLS 1R0BG 3M2RA 4EGLA 4M5MA 1D8ZA 3DI6B 2ZH5A 1YSJA 3K8WA 5A0YB 3LAKA 2VDIA 2CQPA 2EFPA 4IFVB 2UUTA 5KFMA 2GAHC 3QSYB 1UFLA 4HI2A 4YUDA 2R2UA 3OV7A 2QYCA 4NZ0A 5SUHA 3D0HE 3HHLA 3EM1A 2RMLA 1UEUA 2HFSA 5GAHI 2O3DA 3MPDA 1S9FA 3TZWA 2DPJA 4Q2MA 2IBKA 1VISA 2E7VA 3KUEA 2AU0A 4WBFA 1L5UA 4KR0B 3OVSA 3HSGA 4N56A 1X8DA 4ANEA 3CC7S 5J2PB 3ZTSA 2FJAB 3IR6B 1OMSA 2W1BA 5HQLA 1LEOA 1NK7A 1FI4A 3OTCA 3T5JA 4LBIA 3DOLA 4ILLA 3HT0A 2RE1A 1JJ4A 4QCLA 4N77A 2KVIA 3UO0A 3R2DJ 3HF5A 5J1PA 2VQEJ 2CWKA 5B0FA 4Z7CA 5D0EA 1UVLA 4DX8H 3GCWP 3DHXA 3KHRA 2GVZA 3HVTB 3UDVA 4X4VA 3KHLA 1K8AT 3HPOA 4J91A 1U45A 4J7CA 1KTQA 1IBKF 2WBMA 4JV5J 1BD6A 5IWAF 3I5AA 3OSPA 9RUBA 3MTKA 2FC9A 2OHDA 3ZZ0A 3BM7A 4ER8A 2UVVA 4MYUA 1BHNA 3GTYX 4IG3B 4R8UB 2H48B 3EVOA 1KOOA 2B56A 2EBEA 4KO0B 5DLFA 1JLFA 3C46A 4LIWA 2JVOA 1RHQB 3PFEA 4IR1A 2ZOFA 2ADCA 5CA5A 1UW9A 1REGX 4M1KA 2BW2A 3N79A 4OI6A 4OYPA 4F2RA 1Q8LA 3SMZA 5CH7B 3R9LA 1R8CA 2C22A 1U1PA 3A8EA 1JNRB 1TAUA 2AYBA 1HPZA 3R1LA 2V34A 1P27B 4YEAA 4RNFA 4X65F 4FXWA 4QU6A 2BE9B 2RQMA 2Y8WA 3C15B 4I2QB 2YQ3A 5HK4A 4ATNA 3DYAB 2HHHF 4R0EA 1FDBA 1GMWD 1PILA 4RW9B 5HANA 1NK9A 3DLJA 5D4OA 2D1CA 3PCOB 3D2WA 2QX0A 5DGBA 1T03A 4NLRA 2VFUA 1T7PA 2Y1LB 3GV7B 4AL5A 1VI7A 3BGOP 4DJBA 2EPIA 2MQMA 2CRLA 3AHPA 1IXKA 4M5IA 3DRPB 3W60A 2IRXA 1TL7B 2HAIA 4PXEA 4WCEQ 4NCAA 3M9MB 3HCXA 4JYAJ 2R7UA 3BR9A 1FESA 2HHTA 1WI8A 2DNQA 2XLKA 2AMCB 2QMUB 3LWLA 1HQUA 3K8VA 4EEYA 1H73A 2QO3A 1QY7A 5H9FJ 4OHYA 4KKOA 3EVWA 2D3UA 3MR5A 4DR6J 3V4IA 3I31A 1JLAB 4NI2A 5RUBA 4HL9A 3SQGA 5KTQA 1NXIA 2LQ5A 2GFFA 4A46A 3EYZA 2BE7D 4DQSA 1DTTA 3OR2A 2J6SA 5IT9U 2GIRA 3HM9A 2IC3B 4FKYA 4M5NA 4BC9A 1ULRA 2Z57B 3CJSA 2DK2A 1HBUA 1U0HA 2EFGA 4NLDA 4YDDB 2VG7A 3KNAA 3NBPB 1JK9B 2NREA 3IS9A 1IBLJ 4OX9J 1SC1B 4P7TA 1K1SA 3MD1A 4YS2A 3G86A 4FF2A 2CQBA 1CJVB 2V8DA 4AQYF 2D3OR 2VBWA 1XMQJ 4ZLLA 1B64A 1X7VA 2GAGC 1LKZA 2VFRA 2AJQA 1WUUA 1HBNA 2D9OA 2ZC4A 3MCNA 4ID8A 1SH3A 3LGNA 4G6VB 4M63A 5KG4A 2BE2B 4DMZA 5KT6A 4P2FA 2WVCA 1RT7B 2BM0A 4A8KA 1WTBA 4O3RA 3HD1A 3BGFA 3N9UC 2UV8A 2RDJA 1UFWA 1WOOA 2RQCA 1NHUA 4HVZA 5CABA 3J7A1 4OI2A 1Q8IA 4UTGA 4F4ZA 1KNZA 3AA8A 4Y6IA 4QBUA 3MWBA 4DDFA 4DR6F 5ETKA 1X4FA 1F5AA 4K4XA 2GO9A 2B7CB 2ZH7A 3KJQB 1VK3A 1X4EA 2GCFA 4PAAA 1O5JA 4C11A 2AP6A 2MZSA 3PW2A 5KFFA 4P7VA 1FX4A 1GT8A 2KDOA 2QMWA 4CH0S 3J7Z5 1IKWA 3EGVA 3BEGB 4NOHA 3IRWP 1YJ9S 2QJ3A 2Y1RI 4OX8A 2A10A 2H9ZA 5L39A 2DR8A 1H2VZ 1WDTA 2BJDA 2KT2A 2OPPB 2WW8A 3FMWA 3N28A 3QRRA 4DUYJ 5DQIA 1RLDA 1RT4A 1UAWA 2DNYA 2Y3YA 3AQOA 3M8ZA 1Z4UA 4WTYA 5HJYA 2C2KB 2U1AA 3M8YA 4LF4F 3TNVA 3G82A 4PXCA 2IPOB 4BLGA 2E9TA 1RTDB 3MOJB 1N52B 2WSEC 5CZXA 3CJKA 3K5PA 1R8BA 2QLXA 1L3KA 3WC0A 3ZO7A 4CM0A 3TUZC 1RAEB 3D6HB 2EWHA 4OFZA 4ZPTR 3T6JA 1SL1A 3MMJA 5D4PA 1JWWA 1BQNA 4ZCMA 3FK4A 3BYRA 1XMQF 4R8UA 4IRCA 2Q43A 3N6MA 2JSXA 2M3DA 3MEDB 3K57A 1EETB 2QG9B 3VAJA 3M30A 4ELUA 1U1QA 3MI7X 2B8QA 3GSDA 4OZ5A 1UJ5A 1YJ7A 2PC6A 1NKBA 1IVZA 3R5CA 4N7TA 4ZVPB 1XR7A 2VKZG 1RGVA 4MIAA 5ETOA 1QUVA 2H1YA 4EK2A 2ZH2A 4DF4A 4C3MA 1QSLA 2K7JA 1T05A 3UW1A 3N5FA 2WONB 3MMAB 4L75A 1LWCA 4LRBA 2RDIA 3M8QA 4TLRA 2AIRB 4Q45A 2HGNA 3DOKA 2HQDA 3KLEA 1S1WB 4M5DB 3QQCD 4ILRA 5EX0A 2ZC3A 3Q23A 3M1VA 3QLHB 2EFOA 2XHCA 2GIFA 1RT2A 5D0GA 2OELA 3V6HA 1XMOJ 2PI4A 4Y2AA 2RRBA 3IBCB 4IOBA 4IO1A 5CHCB 2OAUA 3G6XA 2AV5A 1WOSA 2IRUA 5F0UA 3DRPA 2ZWOA 1OO0B 5CYJA 4LFCJ 1NSPA 2AGQA 1XIQA 4DEZA 3S8SA 3MZIA 2JEJA 3BN7A 1TMMA 1T95A 2CKWA 1PCAA 2XSFA 6AT1B 5KFNA 3M32B 1KLNA 3MM5B 3WC2A 4F2SA 2HSEB 4NCBA 1RAOA 2HBZB 3M8SA 1S9GA 4H4KA 1U49A 4ZCIA 3F73A 1J5OB 4BBYA 1XNQJ 3J7AN 3IXQA 4U95A 3LUYA 4IQMA 2J0XA 1S6UA 3SQGB 3G71S 1SQEA 1U8WA 3A4TA 1G1XA 4KGMA 3HLUA 5D77A 3Q8QB 1S97A 3CE8A 1MN7A 2VKRA 2CQDA 3HZEA 3X3UA 4QR1A 2QGFB 4F4KA 4H4MB 1I5OB 4K4TA 3JSMB 3W3SA 4DPXA 1EQMA 2VFTA 5A2QY 1VK8A 1WSVA 2EC2A 3IS9B 4O3QA 2LEPA 3FBEA 3OTOJ 2YVSA 3C14A 3OTOF 2AZ3A 2KFYA 3HJFA 4DCOB 2B9EA 4PQUA 3KK1A 2ZH3A 3T5LA 1TVRB 1UTAA 1HWKA 4FNIA 8RUCA 5L38A 3OLBA 2CFXA 3DI6A 4I69A 3UQSA 3G8SA 2UXDF 3O6QA 5GAGU 4RW9A 1PYSB 3PZPA 4B3TF 2C2OB 4IDKA 1D3WA 4USJC 3DM2B 4HKQA 5GMDA 3KKFA 3ENVA 3DLKA 2QA1A 1RJJA 3BREA 2RKIB 2MLZA 4C0HA 1SQFA 2ASYA 2IJRA 3CVKA 1HL6A 4DX5A 4Z7YA 1FNXH 2L9NA 1UA0A 4NLPA 4MFBB 3BQ0A 1KRPA 1T9UA 4LSNA 3ZNUA 3H25A 2HHVA 1ZYQA 1JJHA 1RTHA 4U96A 5KFUA 2OP5A 1F1BB 1FXRA 2BM1A 2ZD1A 3CDAA 2L9DA 3CO0P 4N8OA 4U9RA 3PW4A 2EK1A 4MK9A 2F4VJ 5C2GA 1HA1A 1YRUA 2BRLA 3FRYA 3UN3A 4D3GA 4OL8A 1CSJA 2A18A 1LXJA 1X9SA 4MYTA 1ZPWX 3W5YA 3NMAA 3DDIA 4ED3A 4Y2CA 1DURA 4F4WA 2IC3A 4NXNF 3W8PA 2HRUA 2CPJA 3M7VA 1WKLA 1HBUB 2MKSA 4C0OC 2OPPA 3IMQJ 5K20B 2HMIB 2E5LJ 1FKPB 3E2EA 3EZOA 3PR4A 3HX9A 3KTQA 1MNEA 1HBOB 3IWNC 2F40A 1HQ2A 2C3PA 4CLWA 3OT9A 3CCRS 1C0TA 3FRZA 3G82B 2M8DB 2YBVA 4HACA 5E3CA 1GAOA 4IYQA 3FEXB 2ATCB 3R7SB 1N5QA 2CPHA 1FT8A 3N01A 4G1IA 5GMKa 1HWUA 3ITHB 5GADI 3MFHA 2R7RA 4JI2J 2XNRA 3JTNA 2B6AB 3G4SS 1OIAA 3OD2A 4LF6J 1PBUA 4QYRA 3W9HA 4F3MA 1BXNA 1R0AA 2J0WA 4LR9A 3VAGA 2FGCA 4MIWA 5JJBA 3DLEB 2N4DA 4M95A 2ROEA 4WPAA 3WIVA 1RLCL 1ZBTA 4N8NA 1KC8T 1GTHA 4G1QB 4OQJA 2DYAA 2XYHB 3TP2A 1LW0A 1NSAA 2DGWA 4ZLNA 5K8PA 1D1UA 2C2MB 4DL2A 1XNRJ 2CQIA 2HBRB 1WHXA 1Y5IB 2Z2LA 3M8QB 3W9IA 5HP1B 3Q24A 4PG7A 2CJKA 2HRTA 2MQLA 2XSJB 1IN0A 3IA0A 3NCRA 3H0PA 3UFCX 3BSAA 1HHTP 5ETNA 1HQEB 2BBEA 3PX6A 5EWFA 4LSLA 2ZE2A 4C3LA 1Q7YT 4HDHA 2G0CA 1KLMA 1RU1A 4ED6A 2LQJA 4RJVA 1RAAB 2ZM6J 1FA0A 1JLAA 3PRVA 4NI2B 4QIWD 4ED2A 4JI3F 2CG8A 3AJDA 3C6UB 4WFAQ 3TUIC 1QTNB 1SKRA 4BHQA 3E01B 1YJTA 2HNDA 5ITHA 4CNYA 3QAEA 3QFWA 4UOGA 3TZXA 1EHWA 3TVKA 1SL2A 2XYPB 2YKQA 4DCPB 2CPZA 2BYCA 4KGKA 5E2QA 2GV1A 2KFZA 5B0BA 3NBPA 1UVKA 1X9MA 1RT1A 1KQSR 2HHWA 2K2PA 3KLFB 4RKUC 2HBYB 1RU2A 2NXUA 2OFHX 1X5PA 4QR0A 3J81Y 1WC4A 4W98A 1Y3JA 1MW7A 2VU5A 2ZITA 4C97A 5CCLA 1TKDA 3I87A 2F1FA 1WG1A 3A12A 2YWFA 2ABYA 3P3DA 4O23A 2FLNA 3Q8SB 2A6OA 3PYEA 3HSDA 3HDSA 4LF8F 1YGYA 4DPWA 2R7WA 2UP1A 2UUCJ 4DV2J 4URGA 3R1HA 1DAXA 3LPYA 3HHLD 1UCNA 4I68A 5KFOA 5I3UB 4U8VA 2R8JA 3AJ2A 1UEKA 2W4PA 3OR1A 2C2DA 1HW8A 4B9LA 1JB0C 2G9OA 3ILIA 3MFIA 4IR9A 2M0GB 3MECB 5E0OA 1JLCA 2XZDB 4OYXA 3LF0A 2ZVIA 3G9CA 4FN5A 2XZTB 3VAFA 2GQCA 1SL0A 3RTVA 3CEDA 4OYMA 1PYTA 1FRKA 3OUYA 1DJ0A 1B99A 1Y00A 1N4LA 2W2MP 3MAHA 3SFGA 1VC5A 3JSBA 1FEHA 3VALA 3ISNC 1VLOA 1IKWB 2OH2A 3CJ2A 3RZAA 4TY8A 1KN6A 1YIJS 1XMOF 2QLFB 3QAUA 3VF0B 2E5LF 3UCUP 4LBHA 2R8GA 3GFZA 1HNVB 2ZWPA 4AXIA 4UZBA 2MGZA 2JFKA 3MCMA 1DRZA 3VGSA 2N3OA 4ZPDA 1SUQA 1WKKA 3SSSA 2RILA 1LQ9A 5ETVA 4KYZA 2NSBA 2BR0A 4FF3A 3G87A 3EPGA 3A8KA 4JOUA 4LR7A 4Y2IA 4A48A 1NB7A 4RW6A 4ID5A 2CQ0A 3OFEA 4AL6A 1YJNS 4RU9A 2F7VA 3EGNA 3TAMB 2KN4A 3B82A 2OKQA 4KB7A 2ZDOA 3D1HA 1S4FA 4OJHA 4HHUA 1U4BA 2DCLA 4ES3A 5K14B 1VR6A 4MKBA 3FCHA 2R8IA 2DR6A 1ICEB 1SH2A 1V3RA 5J1EB 5M2PA 1UMJA 2CQ4A 1N36F 4ECYA 1RTJB 4FVCA 2VB6A 2RS8A 4PYAA 3UNYA 1RP5A 1PO6A 1LFWA 3MAAB 2R2TA 2K1RA 3M6XA 4KY3A 3KK3A 3RBZA 3S1TA 1RYRA 3UNGC 4H4KC 3UR3C 3I4HX 2A1BA 3PHTA 3K59A 1Z2LA 2P5VA 4LSNB 4A8QA 4YY3F 1U2FA 3KMSA 3JYTB 1O8BA 5B0GA 1EIYB 1VRQC 3VGTA 2W8LA 1CQMA 4DUYF 4DLEA 4B3OA 4K0KJ 3C66A 2K06A 4OHVA 3TA0A 2MDAA 1T9XA 3MMCB 2ROPA 1RT2B 3CGIA 2GC8A 1FNMA 4FVMA 2HZVA 2KI2A 1REVA 3SFUA 1TP7A 3A13A 4UOFA 5CAAA 2AYMA 3PVXA 1NM2A 5H1SV 1RADB 4PPZA 1XNQF 4QQBA 3POTB 1SC6A 2IBOA 1S0MA 2IVFB
chains in the Genus database with same CATH topology
1TUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUW A; 
#chains in the Genus database with same CATH topology
 2GQ2 A;  1S0O A;  1JX4 A;  2CWX A;  3TEH B;  1KLM B;  4EBC A;  2BQ3 A;  2F5G A;  5MLC V;  2DVI A;  3DMJ B;  4R5P A;  4ECS A;  1U1M A;  2CJX B;  3NGU A;  1RSC A;  3PX0 A;  4G1P A;  2BQU A;  1JXV A;  2AX0 A;  3UPF A;  3TAP A;  3CD6 S;  2DO0 A;  3RB6 A;  4OX7 A;  4ANC A;  4X4O A;  2ALZ A;  2OD6 A;  3OFG A;  1RDR A;  3BPD A;  2MLY A;  2XGQ A;  4ED5 A;  3BN4 A;  1MU2 A;  1X4H A;  2N7C A;  4LF9 J;  4TU7 A;  3R27 A;  1W2B R;  3NLC A;  4JV2 A;  3CD0 A;  4NXM J;  1IBC B;  4OJ1 A;  1U0S A;  2MPU A;  1T8E A;  4ZIT A;  1FD2 A;  4O44 A;  4X4N A;  1TQL A;  2AT1 B;  5DQH A;  4DFK A;  4AXJ A;  2L41 A;  2VAS A;  5A6P A;  1XER A;  5F9L A;  1WF2 A;  3F41 A;  2JOQ A;  1VQS A;  2KFN A;  1IR2 A;  3RBD A;  3DLG A;  3ILJ A;  4PZV A;  1FE4 A;  1X4D A;  3PIP Q;  2D3O 1;  1ROF A;  2C1E B;  2HIQ A;  3R97 A;  1IBL F;  2G4B A;  2VON A;  1J2V A;  3KUG A;  3S01 A;  2X3G A;  2D7S A;  2RF2 B;  2EK6 A;  2ILZ A;  2IYI A;  4KE5 A;  2RKI A;  2GGP A;  1C1B A;  2M2B A;  3DXS X;  2MQQ A;  5JXS A;  1S9E A;  2G2O A;  1NDL A;  2J7W A;  2KHC A;  1WC3 A;  5A8R A;  2J6U A;  2DNG A;  3AA9 A;  3BB5 A;  3HSJ A;  3AAW B;  3MM8 B;  2YKM A;  5U47 A;  4CLS A;  4FNH A;  3QWU A;  2HHQ A;  1JLC B;  3O1L A;  3KWM A;  4GVB A;  1GMU A;  3JSY A;  5IQQ A;  3K58 A;  1FO1 A;  1HW9 A;  4OZJ A;  1N0V C;  4ECX A;  2KZZ A;  4X4S A;  4I2P A;  1NK8 A;  3ADA C;  4DR3 F;  4I64 A;  2DBB A;  2YWW A;  2D74 B;  4EZ6 A;  2ZFH A;  3ZC4 A;  4JI6 J;  1CPZ A;  2NUU G;  3DRX A;  4NLX A;  3W64 A;  3MXH P;  1NSK L;  3GE9 A;  2KU7 A;  4IFY A;  1SV5 A;  1ELO A;  1PSD A;  2N4C A;  4RW7 A;  3SIP B;  5HRO B;  4URQ U;  2VOP A;  5EUH A;  2HVI A;  1IJF B;  3BBC A;  3KG0 A;  5D78 A;  3KLF A;  2MYF A;  2R4F A;  4EZ9 A;  4ECT A;  3DHW C;  5T14 A;  2CVI A;  4NA1 A;  1NJI T;  1GH8 A;  2VG6 A;  3BR8 A;  3Q89 A;  4CLF A;  1RT5 B;  3ZZR A;  4DBQ A;  4K4U A;  1WOP A;  2C2R A;  3W66 A;  1X4C A;  4OYB A;  4XPE A;  3DRY A;  1TK8 A;  2B9W A;  2CPI A;  3BO3 A;  4A8Y A;  4PWD B;  3EZU A;  2LEC A;  3PIO Q;  4OHX A;  4J9S A;  3Q8V A;  3UVJ A;  1RWO B;  4DPO A;  1S77 D;  1P9Q C;  3Q8U A;  5DJB A;  2JEF A;  3BBF A;  4QWB A;  2K3K A;  1VRU B;  2B9X A;  2CJ9 A;  3MCO A;  2H5J B;  2V5H G;  3PTW A;  2B5J B;  4OZ0 A;  4B17 A;  2Z4P A;  2X3D A;  2AGP A;  2RU3 A;  1ARO P;  4ILM A;  3HKZ D;  3TAQ A;  4W90 B;  1X4A A;  2ZH1 A;  2I0X A;  5KFG A;  2KVQ E;  3GQC A;  3RUB L;  2VQF J;  5CD4 H;  1OWX A;  2B9Y A;  2FGO A;  4DHV A;  2R7O A;  3SI8 A;  1ZM3 A;  3N5B A;  4B3M F;  4DX7 A;  1W26 A;  2KJV A;  1FDA A;  2MKY A;  2HWH A;  4ZN1 A;  4DUZ F;  4F4X A;  5DGA A;  1HYS B;  1OYE A;  2HVD A;  4F4Y A;  3HKW A;  2LDI A;  2YNI B;  2Z56 B;  4X84 A;  1S99 A;  3GIL A;  4KH1 B;  2C3U A;  2Q6C A;  3M2V B;  1NK4 A;  3I9Z A;  3OTE A;  2XLJ A;  2DB1 A;  2J5A A;  1EKR A;  2DGU A;  4ZVF A;  4B3R F;  2H5E A;  2NUH A;  3AY0 A;  5E33 A;  5DQG A;  4YR2 A;  4E2F B;  3LAM A;  1PGZ A;  3M2U A;  3DC2 A;  4P74 A;  4FPR A;  3BSO A;  1WTF A;  5A6W A;  3KHG A;  1PBA A;  5F3Z A;  3CUN A;  3O3L A;  2MKH A;  2RUG A;  4K4Y A;  1JXE A;  2FQQ B;  2HUR A;  3C6U A;  3P6Y C;  3TAN A;  4LSZ B;  3E01 A;  1S6O A;  3D4J A;  3MM7 B;  3ZTR A;  5HI7 A;  3KUH A;  3THV A;  4PCQ A;  4P71 A;  4NLO A;  2XS5 A;  1FWL A;  3DMJ A;  2C3M A;  1VQN S;  1A6L A;  4IO9 Q;  3IAS 9;  3PHE A;  4F0H A;  3I32 A;  1RQ0 A;  1UZH A;  3JB9 k;  1Q78 A;  2KZM A;  2R7X A;  4JI0 F;  1TFY A;  3PRB A;  2WCX A;  2FDN A;  1LWF B;  3BKF A;  2OD4 A;  2HPU A;  3L7U A;  5THW A;  1S72 S;  2AKW B;  2VPW B;  4CLP A;  2A2D A;  2WVB A;  4NL5 A;  5DG9 A;  1SC4 B;  4FYY B;  1N33 J;  1U26 A;  2KL8 A;  2BOP A;  1D9A A;  1LWE B;  2EVZ A;  1TL1 B;  1Q4R A;  2P8I A;  1R43 A;  2BJ1 A;  2WZ1 A;  3HI9 A;  4OV1 A;  5C42 B;  2FB0 A;  2Z30 B;  3BO2 A;  4V19 J;  3BSC A;  3HHK A;  1TKT A;  3A8I A;  1YJU A;  5IOL A;  2E29 A;  2MJN A;  3OL9 A;  5BJR A;  2H4Y B;  4HHJ A;  2ZBC A;  5IZH A;  4DSF A;  4OZ1 A;  5FDL B;  2FLP A;  3CJ8 A;  3IFE A;  1ACM B;  1KVK A;  1RHR B;  1Q1K A;  4NCG A;  4ENO A;  1C1B B;  4AYB D;  3C3L A;  4IH7 A;  3ELH A;  5A8R B;  3QMQ A;  2W7P A;  7FDR A;  3CD7 A;  3DU5 A;  2YWK A;  3K2Y A;  3KOA A;  4LRA A;  1Y4Z B;  3VGV A;  2IY5 B;  1RCO B;  3CJ5 A;  3MEK A;  2E7W A;  4NA3 A;  1LWC B;  2ILY A;  2RJZ A;  1D8Y A;  2IHR 1;  2D3Z A;  2XNQ A;  2KH9 A;  1QUP A;  1H2T Z;  3R5A A;  3NEK A;  1RWN B;  4DN9 A;  1EP4 B;  3H5Y A;  1F6T A;  2PEB A;  3MPW A;  4OYA A;  5CYQ B;  1U1L A;  1DTT B;  1R7I A;  3I0S B;  4UUX A;  1SV5 B;  1XWL A;  2BV3 A;  4K5R A;  3R5J B;  3QZ8 A;  1K73 T;  5BR8 J;  1Q16 B;  3R5B A;  4HYK A;  1WHV A;  1UVI A;  3CDW A;  5D3G B;  1CEZ A;  3CCE S;  1MN9 A;  1NSQ A;  2IAJ B;  2GHW A;  1GEH A;  2XWX A;  5J2Q B;  3JTO A;  1UWB A;  2HQG A;  2MKJ A;  1HHQ A;  4QPX A;  2MQ8 A;  2LMI A;  1CQN A;  4PG8 A;  4KGZ B;  3KHH A;  4NML A;  1VQY A;  5ETQ A;  1VQM S;  2W9C A;  1VJW A;  2BJ7 A;  3SEO A;  1CVJ A;  2YPY A;  2JWN A;  4X66 F;  3QT6 A;  1RT7 A;  5ETL A;  4XTT A;  3NCP A;  2B5J A;  2OPQ B;  1VFJ A;  1FRI A;  5AE2 A;  4PYD A;  4JB8 B;  1HIY A;  1RHU B;  2RHQ B;  3IG1 B;  3CF5 Q;  2RSQ A;  3G96 A;  4DV1 J;  3NCQ A;  4QIV A;  2V2K A;  3OJS A;  1IBK J;  4I7F A;  1HWJ A;  4AUK A;  4MIB A;  2EW9 A;  3T3F A;  3D1Q A;  3MGJ A;  3TJA A;  3VQS A;  4LF8 J;  2DEI A;  4K59 A;  5A8K A;  4WU2 A;  3C2P A;  5KG1 A;  3C8Y A;  1M0S A;  3ZZU A;  5KT7 A;  5L1J A;  1UVM A;  4Y2M A;  2HBQ B;  1Q8B A;  3PG9 A;  3JAM Y;  1HAR A;  2YNI A;  2XMV A;  2ZZN A;  2H51 B;  4WE1 B;  5KT5 A;  2XEX A;  5AXN A;  3LW5 C;  5HQ8 A;  1QSS A;  4IFY B;  1X5O A;  1HI8 A;  2LQB A;  5KFH A;  1B0V A;  1YLX A;  1LW2 B;  2DGQ A;  3LQV A;  4MK7 A;  3MPU B;  5I4M A;  4QWD A;  5L1K A;  4NLY A;  2Z8Q A;  5KFK A;  3WX4 A;  1BY9 A;  1RHM B;  2PII A;  3EWG A;  4NEY A;  2DD8 S;  4ZVH A;  2HW3 A;  2Y0S D;  1X9W A;  4CO5 A;  1Q53 A;  4GVL A;  4ICL A;  2XMK A;  2PSZ A;  4P10 A;  1NBE B;  3HUL A;  1SQG A;  3PNI A;  4USK A;  4NE9 C;  1LV5 A;  1URN A;  4DR7 F;  4PWD A;  4Q0B A;  3FBF A;  3K0J A;  2KTQ A;  1RWU A;  2DNZ A;  3MDF A;  2R9L A;  1ITP A;  1B4S A;  1XN9 A;  2UVU A;  1Y0H A;  2AEF A;  1AW0 A;  2COL A;  2W9B B;  2EFV A;  5CQG A;  3FBC A;  3VQT A;  5F41 A;  5IFM A;  3M6V A;  2ZBR A;  3MED A;  5A76 A;  2XMT A;  3MR3 A;  4JI7 J;  1GX6 A;  3I96 A;  3M30 B;  5IXU A;  1LWF A;  1QM9 A;  2YWE A;  1HBO A;  4K2X A;  1AYE A;  2L3M A;  3RJM B;  3T5H A;  4QIF A;  4CZC A;  1C4C A;  4F8R A;  4DG1 A;  2KKH A;  3DLG B;  5E3A A;  3HK2 A;  1WD6 A;  2XBP A;  2Z0G A;  1SKW A;  3P96 A;  2VC0 A;  1SPB P;  2YNG B;  2YX1 A;  3GJS B;  1F9H A;  4DR7 J;  3GJR B;  3D0I E;  1HYS A;  3ITH A;  1GK8 A;  2F63 A;  4NLQ A;  2QA2 A;  2FJE B;  3S7R A;  5H9E J;  2B8P A;  1U6B A;  1ZH5 A;  1H7X A;  1TKT B;  2W2O P;  3T5K A;  2BDP A;  5HVG A;  4F3Q A;  3KLE B;  1NZA A;  1WWH A;  2BOA A;  4DSI A;  3OXL A;  3FSY A;  3GV5 B;  1H3D A;  3M2R B;  1FTC A;  4DR5 F;  3DLE A;  4N5S A;  3RRG A;  1HFE L;  1JLG B;  5D4L A;  2OO4 A;  4IG0 B;  4ZVR B;  2ZBI A;  4HR2 A;  4I1T A;  5K5M A;  3PJ9 A;  1SJR A;  2QA4 S;  3GIR A;  1DBD A;  3HHL B;  3IR7 B;  3PJW A;  4FP9 A;  4DV4 F;  2OIH A;  4OZ3 A;  2GJI A;  2UUB J;  3UN5 A;  3DRR A;  3MM7 A;  1T9V A;  4FYV B;  4OJ3 A;  3O2I A;  1FJE B;  3FBB A;  1FX2 A;  2CAJ A;  1VBX A;  3BKU A;  2V8P A;  3LP0 B;  2V4J A;  1ZS6 A;  1KON A;  1NO8 A;  2RD5 C;  4O3P A;  4YDX A;  4CLZ A;  8ATC B;  3EZ5 A;  3NNC A;  3NGR A;  1DTQ B;  3CMA S;  5LXY A;  4EUV A;  2OPR A;  1A7G E;  4KQZ A;  3RRH A;  2CNK B;  4C0B A;  1U1R A;  1EAY C;  4EO6 A;  2BAN A;  4DUT A;  2HFU A;  3H98 A;  4H4M A;  4DFP A;  2FJV A;  2VA3 A;  3GJQ B;  4DV6 J;  1MRO B;  2CJY B;  3EDQ B;  3LH2 S;  3PYF A;  2UVR A;  4JI5 F;  4V19 X;  3C16 B;  2F4V F;  4DR4 J;  2VIC A;  4CT9 A;  3UVJ B;  4Q43 A;  5J2Q A;  3LP1 B;  2FHJ D;  2ACM A;  5KG5 A;  1D0E A;  7AT1 B;  1L3T A;  4ZK7 M;  3LGH A;  3NOC A;  4DV0 F;  1HR0 F;  3AOC A;  1PC5 A;  1IM6 A;  2J9D E;  3ISZ A;  4O4R A;  1RWP B;  1VHI A;  5DS7 A;  5DG7 A;  2FY1 A;  2HHH J;  1FWP A;  1V6H A;  1R31 A;  2DKO B;  2YXL A;  4QJV A;  3EX7 B;  1YK9 A;  1EX8 A;  3T6B A;  1M1H A;  4JV1 A;  2FJW A;  2RNE A;  2DHH A;  3HJV A;  4YP3 A;  1WI6 A;  2M5Y A;  4RW8 A;  4J9R A;  5F8N A;  4DR1 J;  1RT3 A;  1N5Y A;  1V3Z A;  3VGU A;  1X31 C;  3AJ1 A;  2AWZ A;  3N0V A;  2V2Q A;  2OPS B;  4ZP8 A;  4CYU B;  1QE1 B;  1Q86 T;  2D9P A;  3DU6 A;  2EKY A;  1VQ6 S;  1NKC A;  1FVS A;  2GMH A;  3AD7 C;  2QRR A;  1T9Y A;  3CWJ A;  3QID A;  2BAB A;  4ZA1 A;  1FDN A;  2V63 A;  3CXC R;  3M2V A;  4CO1 A;  3VAI A;  3CME S;  1Q0N A;  1OQ3 A;  3DRS A;  4U6P A;  3WQP A;  3ZTP A;  1RKJ A;  5A8W A;  2OEJ A;  1M1G A;  4ZJQ A;  5B08 A;  3ILO A;  1ZAX A;  2XM3 A;  3ETM A;  1PC4 A;  4UF4 A;  4DOZ A;  4JV0 A;  1RWM B;  1FKO B;  2JDJ A;  5BXI A;  2A0F B;  3D66 A;  4RL1 A;  3BYP A;  5KFC A;  1I94 J;  2G0I A;  5ETP A;  3LP2 B;  3T1Y J;  2C28 A;  1ZA1 B;  3FNN A;  3K5N A;  3B54 A;  4RO0 A;  2FHK A;  3H20 A;  4U7C A;  2Q66 A;  5HBM A;  3ICL A;  3CW2 C;  2HZA A;  5D3G A;  5J2P A;  1HNI A;  3DLB A;  4M5G A;  3MF5 A;  4N76 A;  1FXL A;  2LDY A;  1YBT A;  3BGU A;  1B0P A;  1IKX B;  2IRY A;  1HWI A;  1W25 A;  4MKY A;  2HWT A;  2BMB A;  3GJT B;  1RWV B;  1X4B A;  3NGK A;  3TA1 A;  2MQO A;  4FBU A;  1KFD A;  5B09 A;  2R8K A;  1S6Q A;  1URR A;  4S0M A;  5F8I A;  3BPS P;  5D0H A;  3GIK A;  1CJK B;  2BUN A;  2FZG B;  3HVT A;  2FVR A;  3RR7 A;  2V94 A;  3PKM A;  2HNY B;  2Z58 B;  1LWE A;  3Q2S C;  1Z2Z A;  2QLJ B;  3BGL A;  2LA4 A;  3BSN A;  2CQ1 A;  2W01 A;  1NCL A;  2R3V A;  2B51 A;  4CLK A;  4WXO A;  1VQO S;  3WZ0 A;  3G6V A;  4ECV A;  5CCM A;  4CP5 A;  3R8Y A;  4UST A;  4KFB B;  1T11 A;  4A8M P;  5FDL A;  1HBM B;  2M8H A;  2Q79 A;  3EUN A;  4IQX A;  3TRG A;  1DHM A;  1HBN B;  2FVQ A;  3EXY A;  3AOB A;  2LVW A;  3AXM A;  3D68 A;  3L7O A;  1RE1 B;  4R0J A;  5HP1 A;  4DR2 J;  3RW7 A;  1FWK A;  1R6Y A;  4QIE A;  4FYD A;  1K44 A;  4QW8 A;  1NDC A;  4GKJ F;  1KQK A;  1RB0 A;  3GU0 A;  3KG4 A;  3L4B C;  3LWM A;  1UPM B;  2XO6 A;  1VQP S;  4BDP A;  1TFW A;  2UXC J;  2DXD A;  2J7K A;  2FHJ A;  3TO8 A;  2X1F A;  3OVB A;  4CT8 A;  2AEJ A;  1BUX A;  4O3N A;  2W8K A;  1QAJ A;  2E1R A;  4B3O B;  2B4V A;  4K7Q A;  3FJ2 A;  1S6P B;  4DUZ J;  1N5T A;  3CCM S;  1N5S A;  4JP8 A;  1WEX A;  4USI A;  3U02 A;  4ETX A;  1T03 B;  1UP1 A;  2I38 A;  3TYT A;  5KFQ A;  2UXB F;  1VBY A;  1UVN A;  4ZP9 A;  1SIZ A;  3MEE A;  1S1U B;  2W7A A;  2AJ2 A;  4NPO A;  1RTI A;  3H2U B;  4NWB A;  2W9B A;  3PEJ A;  4YHH J;  2RS2 A;  1YBA A;  2APO A;  4R25 A;  2Z2M A;  3SDE B;  3VR1 A;  5KG2 A;  1N5V A;  3POT A;  2Q3P A;  4C3K A;  3GP9 A;  1LWX A;  4OYZ A;  3KMQ A;  3V81 B;  1FK9 A;  4J9K A;  1N6Q B;  4HT5 A;  3BDP A;  1TKX A;  1HI1 A;  1TL3 B;  4JI1 F;  3TA2 A;  1WEZ A;  3L95 X;  5DDQ C;  5DDP C;  4KO0 A;  2W4C A;  4X64 F;  4LFA J;  2OFG X;  2AGO A;  3A3N B;  2NQP A;  3PX4 A;  1R89 A;  4ZVS B;  4ED1 A;  1G2E A;  3RYL A;  2E5I A;  3Q0A A;  2NLW A;  1BMQ B;  2RT3 A;  4B9S A;  5GVQ A;  4EWT A;  4TU8 A;  3SCJ E;  4WP8 A;  4J9P A;  4DV3 J;  2XY6 A;  2MXY A;  1MSW D;  2V68 A;  2YTC A;  1VC6 A;  4I6W A;  4IH6 A;  3UR0 A;  3AOA A;  3B6B A;  1I1G A;  1F3F A;  3EE3 A;  4RW8 B;  5IV3 A;  1CJV A;  2C42 A;  4D3H A;  4CLL A;  3RAX A;  3I56 S;  3NRB A;  3OHA A;  1Y9O A;  2AYG A;  4WZM A;  2IMO A;  2H65 B;  2XCA A;  1T05 B;  3HVW A;  5C42 A;  2VPY B;  2HK2 A;  2JC0 A;  1NRK A;  1IJE B;  1BGX T;  1X5S A;  2BE2 A;  5IV4 A;  1W7W A;  1BWV A;  4YR0 A;  1VQ9 S;  1TK0 A;  5E3R A;  4F3O A;  5L9N A;  4C8K A;  1HKA A;  4GKK J;  1S1W A;  2EG1 A;  4J9V A;  4H4O A;  2JEI A;  1LW2 A;  3MCS A;  3GV8 B;  3GR1 A;  1DTQ A;  4ELT A;  4LF7 F;  3M1V B;  3QLH A;  3C6T A;  1N0U A;  3DDN A;  1V5V A;  1X4G A;  4TKT A;  1KEK A;  1N32 F;  4C11 B;  2ZKU A;  1IKY B;  3PR5 B;  3QZ7 A;  1M5H A;  1T9T A;  2HQI A;  4FKX A;  5KG6 A;  1P9Y A;  1N54 B;  4A4J A;  1BC6 A;  3QBC A;  3CJR A;  1DFD A;  1F2H A;  4N41 A;  2EBG A;  3OR2 B;  3RRK A;  1LOU A;  1PJ6 A;  1AUS L;  2VL1 A;  1NU4 A;  3AQP A;  1T0T V;  1IKX A;  3LGM A;  4RW7 B;  3H90 A;  4WXW A;  2NPI A;  3VTI A;  4IKA A;  4UT4 A;  4C6A A;  5J1E A;  2QSW A;  2DGX A;  2Y0B B;  3QPI A;  3NGT A;  1VRT A;  4Y2K A;  1U02 A;  3CJ3 A;  4ITS A;  5LMN J;  4NXM F;  3IWX A;  2J7U A;  4MH8 A;  5I42 A;  1RT3 B;  1WF0 A;  1CJT A;  3J81 U;  1N5Y B;  4P73 A;  1QAI A;  1RT6 B;  2HNY A;  4WIQ A;  5C25 A;  4DV3 F;  3CJK B;  1JJC B;  4KJI A;  8AT1 B;  1WEY A;  2B4U A;  2HS0 A;  5LSO A;  5BR8 F;  2JLE A;  1ZAV A;  1X0F A;  3HVA A;  4J5O A;  2J76 E;  5D4N A;  3TQ1 A;  3RR8 A;  3DRS B;  3M05 A;  2CPY A;  3SCI E;  3JAM U;  3H8Y A;  3KK1 B;  4NLU A;  3GFH A;  1FTR A;  5A8W B;  4KFB A;  4DL7 A;  4ES1 A;  2Y1J A;  4PUO B;  3OXG A;  4PPD A;  1KP6 A;  1JLQ B;  1S12 A;  4J9O A;  3MMC A;  4FF1 A;  4XDC A;  3HFK A;  1MLA A;  4IDK B;  3KDO A;  3MM9 A;  3NGS A;  2DR5 A;  1X60 A;  3B8H A;  4CIO A;  5FII A;  4ZPC A;  5BYQ A;  2V8V A;  1HNZ F;  1G7C B;  1KKH A;  1S1X B;  3MMA A;  1D9F A;  1NHV A;  3NAI A;  3BQ2 A;  2R7T A;  4KHP F;  1S48 A;  4JI4 F;  1P6T A;  2G2Y A;  3J7Z T;  3FFI B;  5BYR A;  4LFB J;  1U2C A;  4ZHR A;  2VFS A;  3HHN B;  1YDL A;  2ZD1 B;  2CQG A;  3JSR A;  4K8R A;  5EDW A;  3CC4 S;  2CJQ A;  4J90 A;  5K8M A;  2BRK A;  2W9A A;  4ECR A;  2UUA F;  2M52 A;  1QLN A;  1VBZ A;  3QJJ A;  3K5M A;  3BV8 A;  4DSE A;  3D6M B;  4HT7 A;  4MMO A;  1F9F A;  1U7L A;  2YKA A;  4NEZ A;  4JI8 J;  2KXN B;  3W65 A;  5ETR A;  4F04 B;  1OY6 A;  5AJ3 J;  1S1V B;  3TJ8 A;  1DQ8 A;  3M4X A;  2HLU A;  3TI0 A;  1FER A;  4EFA C;  3HVR A;  1E6Y B;  2NS1 B;  4I6A A;  3QGH A;  2GW8 A;  2DNO A;  2PFD A;  2FD2 A;  3IC1 A;  1TUW A;  5L1L A;  3OHB A;  3PY8 A;  4CI0 B;  2MQN A;  1S4E A;  5H9E K;  3SCK E;  1SJ4 P;  1N6Q A;  5KFX A;  4RU2 A;  1VGY A;  2WBR A;  5F8L A;  1RAH B;  1PJ5 A;  1P1L A;  3FVY A;  4RW4 B;  2BXJ A;  5IT9 Y;  4DF8 A;  1T9W A;  4RPF A;  4P72 A;  4ZVG A;  2I8E A;  1UW4 A;  5EN1 A;  3D7S B;  4CLU A;  5KT2 A;  4RNN A;  3NP5 A;  3EVM A;  5HL7 Q;  1RK8 A;  2WRM A;  1HMV B;  4GO7 X;  4WFN Q;  4QPT A;  2D69 A;  4YB5 A;  3CIM A;  3NL0 A;  3KG1 A;  4BWJ A;  4PAB A;  5L9X A;  1XTZ A;  2DO4 A;  1NEE A;  2Z2Y B;  3AB4 B;  4OLP A;  1ZZN A;  2GVD B;  1J5E J;  3DOK B;  2VOD A;  2MLX A;  2HEK A;  4IOA Q;  4I0W A;  2BW7 A;  2DH9 A;  2OEK A;  5GAG I;  2VBZ A;  2CQ3 A;  1TU0 B;  3OTD A;  3GG1 A;  2DIU A;  5LJ3 Y;  3V6J A;  2ASL A;  1VQ4 S;  2XMW A;  2HVZ A;  2N3L A;  4NCG B;  4F50 A;  5KT4 A;  3T1H J;  1M1K T;  1O0P A;  1N34 F;  2YKP A;  2MZ1 A;  1S7I A;  3MEE B;  2O66 A;  3K89 A;  1KBR A;  4LR8 A;  1A0O B;  1QDU B;  1NB2 A;  4MFB A;  4NLS A;  4KRW A;  1F60 B;  4E98 A;  1UVJ A;  3NS7 B;  3T1Y F;  3U1N A;  1AT1 B;  1RI7 A;  1NUE A;  2DIV A;  3IR5 B;  3W1Y C;  2DNR A;  4YB6 A;  1JLE B;  3PDN A;  2XI2 A;  3V81 A;  3LA0 A;  1MML A;  2V67 A;  3MM5 A;  3WIU A;  3CCJ S;  3SSQ A;  5LMU J;  1HNZ J;  3CIZ A;  3J7Y U;  2MZR A;  2VQF F;  5EX3 A;  1EP4 A;  5KG7 A;  4DV2 F;  2NCK L;  2BAC A;  3US5 A;  1FKA F;  2NXC A;  1S6Q B;  2EI5 A;  4Q44 A;  4DV7 J;  1GMV A;  2MKC A;  3PAC A;  5F0W A;  4CH1 A;  2LXI A;  3ONQ A;  3MPV A;  1AFI A;  4QIG A;  4WK1 A;  4E8U A;  1G4C A;  4OI1 A;  4LF5 J;  3CNQ P;  2O1P A;  3IAM 9;  1AUD A;  5IT0 A;  3QYY A;  2DGV A;  2HK3 A;  4DQQ A;  3WHI A;  2WHO A;  1KOH A;  1BE4 A;  1ZA2 B;  1HNX J;  4DWI A;  3OL8 A;  3TUP A;  1YIT S;  3K7R A;  4OZN A;  3HD2 A;  3A1Y G;  4C48 A;  1TVR A;  1OSC A;  3KLH A;  4ZP6 A;  2RH3 A;  4LMZ A;  4DV5 J;  3P5B P;  1S1T A;  4Y65 A;  2KG0 A;  3GR0 A;  2ZJR Q;  1NJZ A;  2DNM A;  2E9Z A;  3TX8 A;  1T3O A;  4C98 A;  3H7H B;  4DV0 J;  4FBT A;  2VG5 B;  4DXL A;  4LF5 F;  3NY0 A;  2WSC C;  3KJF B;  4Y28 C;  3U27 A;  1YVF A;  4AFF A;  1R8H A;  3JTP A;  4F36 A;  5I3U A;  2DGO A;  4X2B A;  4LF2 A;  1IBM J;  2HGM A;  1S7H A;  1NHK L;  1SKU B;  1NPP A;  3I5C A;  3NMR A;  4LRD A;  4JI6 F;  4WFZ A;  1L3V A;  1C0U B;  1WC1 A;  3HFZ B;  3J80 U;  2RUS A;  1RTH B;  3H4B A;  2R7Q A;  4G1Q A;  4XDD A;  1P8G A;  1VDH A;  2HQF A;  1LW0 B;  1LFP A;  1YZ7 A;  2VPX B;  3FUY A;  3OUY B;  3P4U B;  1N48 A;  5AE1 A;  1N32 J;  2IM0 A;  3MTJ A;  3LOU A;  1DLO B;  4NLT A;  4Q5V A;  1SJ1 A;  2BKP A;  1U09 A;  3UDL A;  3BJY A;  4DL6 A;  3A8J A;  3R5D A;  4TY8 B;  1UZD A;  4U7U K;  1XC9 A;  1N34 J;  1R8P A;  3DLL Q;  1I51 B;  2CQC A;  1Q5V A;  4NZ7 A;  5KT3 A;  1LK7 A;  1UWA A;  2FZC B;  3CB4 A;  4GKJ J;  2RIJ A;  1PKU A;  2ADB A;  4G65 A;  2MGZ B;  3MR2 A;  5C24 B;  1AZS B;  3SCL E;  2LYV A;  2PE8 A;  2QL7 B;  2ZVS A;  4J9L A;  1QTM A;  2IA6 A;  3QRP A;  4P9S A;  4DZ6 A;  2VDH A;  2CIM A;  4LF1 A;  1NJY A;  4A8W A;  4NZ6 A;  2JL9 A;  4L6V 3;  3LAL A;  4RNH A;  1CUL B;  5CXT A;  4GC6 A;  3LTO A;  2XS7 A;  3PKY A;  4AE5 A;  1EQ0 A;  2HNZ A;  1RT1 B;  3T19 A;  2DNL A;  4PUO A;  1T02 A;  2H5I B;  3OL6 A;  2AZ1 A;  4DX6 A;  5A0Y A;  3W62 A;  3V2U C;  1UKU A;  3SZ2 A;  2MMY A;  5ETT A;  3W2W A;  5T7L B;  4NXN J;  2QTW A;  5IT4 A;  2E44 A;  4JI1 J;  3F44 A;  4JUZ A;  5GAH U;  2NXE A;  2JJ4 D;  1XR5 A;  4ZLP A;  1YZ6 A;  3EDR B;  3M8P B;  4X4Q A;  1KHV A;  4CTA A;  3ENQ A;  1YBU A;  4X4R A;  4B9T A;  2ZEJ A;  1RHJ B;  4W4M A;  4W92 B;  3BH7 B;  3NWG A;  4ZHR B;  2KM8 C;  2WVE A;  3DYA A;  1HNW F;  5I3Q A;  5DRK A;  2E5G A;  2MHE A;  3DOL B;  5KFY A;  1ZAW A;  2VHG A;  4WK3 A;  1K0V A;  1CJU B;  1H7W A;  3C6T B;  5HAT A;  1REV B;  4J9M A;  1GX5 A;  3M8W A;  3ZZP A;  4LFB F;  4A8O A;  1YKW A;  4EO8 A;  4JI4 J;  5KFV A;  1NPR A;  1OYD A;  1JMT A;  4URS A;  3T1H F;  2KXF A;  4ZP7 A;  3L9Z A;  3MUV P;  1RAJ A;  2UXC F;  3CJT A;  5C2C A;  4RZR A;  4Y00 A;  4KKO B;  2HG4 A;  4NYP A;  4I56 A;  3ZZZ A;  2R7S A;  3RU0 A;  4P6Q A;  3I9V 9;  1WKJ A;  2QLB B;  2VF3 A;  2JVR A;  1FFS B;  4MAK A;  3VV2 B;  2IYG A;  4RUB A;  2MEW A;  3CJ0 A;  1SUQ B;  3PYG A;  2I9S A;  4NLW A;  1KWM A;  1Y3K A;  4O0N A;  4FF4 A;  1IM4 A;  4C8Z A;  1VS3 A;  4F67 A;  1FJG J;  4PXD A;  1U0H B;  2PT0 A;  4CO4 A;  4ZPA A;  4DR4 F;  2K8G A;  3MEG B;  3NS6 A;  2VH7 A;  3CD5 A;  3KFW X;  3J81 j;  1H74 A;  1N88 A;  2Y9H A;  1QVF R;  2B4P A;  3G8Q A;  3QNW B;  2FZK B;  2FY8 A;  1DQA A;  2IDE A;  5E3Q A;  5B0D A;  4QWE A;  2UU9 F;  1IWA A;  1JLQ A;  2ACY A;  5LMN F;  3CUL A;  1FJG F;  2HIY A;  3KLV A;  2W2P P;  4ZOS A;  4CCH A;  1AXQ A;  4JI5 J;  4UQT A;  4XAK A;  2G1H A;  4WE1 A;  4YOE A;  4XPC A;  5KFT A;  3UDE A;  2K1R B;  2JLG A;  4ED0 A;  2HVH A;  4XIU A;  2P2C B;  3JXO A;  3MMB A;  4ZCK A;  4WJB A;  4CYU A;  4O3S A;  2DRD A;  1QE1 A;  3AH6 A;  3FEY B;  3BS9 A;  3KXD A;  2HFV A;  3P5T L;  3FSI A;  4DLG A;  2YKM B;  3GCX P;  3EPI A;  2HRY A;  4JI8 F;  1LNQ A;  1T3N A;  3BBB A;  5K9F A;  5HVH A;  3V6D A;  4A8F A;  2R2S A;  3RAQ A;  1VHF A;  1JLE A;  3UCZ P;  4B9U A;  1YX2 A;  1TL5 A;  2B43 A;  2EG2 A;  4DL0 C;  2A6M A;  3TVZ A;  3UDC A;  1VC0 A;  3V4I B;  1BWE A;  5J2M B;  3ENW A;  4PXB A;  1WAC A;  2E1M C;  3TVY A;  1TL4 A;  3D0G E;  2VPZ B;  2IVY A;  4DPT A;  4DV4 J;  2GVZ B;  2DR7 A;  1OSD A;  1RTZ A;  2EC0 A;  2VA2 A;  2F8M A;  4RUA A;  4F02 A;  3MUR P;  2D41 A;  2JH3 A;  4DCJ B;  2QN6 B;  2IJF A;  4PG4 A;  4F0M A;  4X62 J;  3G6Y A;  3BGR B;  5GME A;  3RW6 A;  1B0T A;  2B7B B;  1VIX A;  2DY1 A;  3FGV A;  4TQS A;  2LFV A;  4G3I A;  3M9N B;  1HNW J;  2YNG A;  1C2P A;  2BKO A;  4RW4 A;  1XK8 A;  4WU3 A;  2X1B A;  3QT5 A;  3UD3 P;  1ZZF A;  3ZXW A;  1PJ7 A;  3W2V B;  5KOW A;  3W63 A;  2DRA A;  1Z1Z A;  4F26 A;  1Y5L B;  2PA3 A;  1I3O B;  4HI1 A;  1MG7 A;  4NYZ A;  2PI5 A;  2L08 A;  1PYO B;  3FZB A;  1FRL A;  2XLI A;  1HNX F;  4KT0 C;  1HPZ B;  2BVZ A;  4C4W A;  3KLI B;  4LFA F;  2C2E A;  4JI7 F;  2NYH A;  3ET6 B;  3FDS A;  1JLG A;  3L09 A;  3Q8Y A;  5KAK A;  4TN2 A;  3WDO A;  1WDD A;  2QV6 A;  2RQK A;  3FSX A;  4KIA A;  2K7K A;  5B7W A;  4CO0 A;  4JI0 J;  4MJK A;  2F4F A;  1YRX A;  4XK8 C;  4PRF A;  1XR6 A;  3QFH A;  4LVO P;  1VIO A;  1FHT A;  1R0C B;  2YH0 A;  1VCT A;  2CJB A;  4DPY A;  2V69 A;  2HAF A;  2QMX A;  1KQG B;  3KYL A;  4QWC A;  1SKS A;  4KSE B;  1ZOT A;  4EMD A;  1FJC A;  2MSS A;  1B70 B;  2LEA A;  2NZC A;  3MOZ A;  2GJF A;  2KYX A;  3R6G B;  2W24 A;  1RWK B;  2B3T B;  4C8O A;  4OZL A;  5LT5 A;  2AYE A;  3B4M A;  3OFH A;  5T41 A;  3RGI A;  2CQ2 A;  2W2Q P;  2OPR B;  3PO4 A;  4PG6 A;  4F7V A;  5KFZ A;  1E6V B;  2ZHO A;  1RXO B;  4TXS A;  3U1L A;  1X5T A;  3TWZ A;  3I0R B;  2V4R A;  3L3C A;  3AD8 C;  4I2P B;  3VCD A;  2DH8 A;  2W7O A;  4USU A;  2DNP A;  2ZH9 A;  4NA2 A;  3BF4 A;  1SH0 A;  3RG6 A;  1J27 A;  2VV5 A;  2NXN A;  4B9M A;  3OL7 A;  3KLG A;  1KSP A;  2FVS A;  3EJM A;  1F5C A;  2K3I A;  2MQP A;  3NNA A;  4OLO A;  2P9C A;  1Q8K A;  5ADZ A;  2XC9 A;  1K0T A;  1KVI A;  1UPP A;  1GXL A;  1OPI A;  3RB3 A;  3FEZ A;  2FJX A;  3HSZ A;  2ZZT A;  4RUH A;  3HP6 A;  4O44 B;  1RUS A;  5K8O A;  1TKZ A;  2XQC A;  4E0D A;  2J0S D;  2HKE A;  2PDA A;  4C8N A;  2XYG B;  1FK9 B;  3TEG A;  3IGN A;  1NKE A;  4ZDN A;  3DLH A;  3FCV A;  5T7L A;  4YN3 B;  3G2X A;  1JKH B;  2V6A A;  3E3X A;  3GSI A;  3BH6 B;  4ZVU B;  5KFE A;  2KXH A;  1T94 A;  4KHM A;  4WFY A;  4C7Q A;  1KR4 A;  1WSR A;  2NYI A;  3CSK A;  4L76 A;  4USH A;  4ED7 A;  1Y5N B;  2LXF A;  3HFV A;  5JUM A;  4EBE A;  4WKR A;  4CTA B;  4K50 A;  4LVN P;  4OYO A;  1O6X A;  1SI9 A;  3ISN D;  1A9N B;  2ALY B;  2C3O A;  2DTJ A;  4NRU A;  4WTO B;  4ZJO A;  5HMW A;  5IM0 B;  2Q1L A;  4OI3 A;  4O4G B;  5CD4 A;  3KJV A;  4GVB B;  1FCA A;  3UI3 A;  2G2Z A;  1NH7 A;  3PXG a;  1KD1 T;  2FLL A;  5KFP A;  2AW0 A;  3PJX A;  4KHR A;  3LP2 A;  4QYZ K;  1RZM A;  3B78 A;  3SQO P;  2YNH B;  1AA1 B;  1VMB A;  2GQQ A;  4L3N A;  1X0P A;  3PRD A;  4YHH F;  2JRS A;  3OLA A;  2MY7 A;  4C8L A;  1SIW B;  2FJB B;  4IH5 A;  4YQW A;  2YQ0 A;  5H9F K;  2AX1 A;  3V6D B;  2BZ2 A;  3AFG A;  2EXU A;  2DEJ A;  1GQE A;  1MWQ A;  1B7F A;  2PEH A;  1U6Z A;  1QSY A;  5HRO A;  1MWZ A;  2MY8 A;  2VBY A;  2NXJ A;  1VOM A;  2MJU A;  3EMT A;  2MKI A;  3VAM A;  4H4O B;  2XY5 A;  4ZN3 A;  2UZA A;  5J2M A;  1M5P C;  2ZBQ A;  2UXD J;  1RT4 B;  2P6S A;  1SJF A;  1FVQ A;  1AZS A;  1WEL A;  1KQF B;  3K5O A;  3PO5 A;  2YX7 A;  3FMB A;  1JLB A;  3KJN B;  5J2N A;  2ATL A;  4P2X A;  3THP A;  2IFX A;  2WVD A;  2CYY A;  2RRN A;  4P52 A;  2E1A A;  3J7Y I;  3CCV S;  2WTF A;  4GC7 A;  3MEG A;  2ZOG A;  5D6G A;  3EGZ A;  1TTH B;  3G6E S;  3TJ9 A;  1RA6 A;  3C14 B;  4FYX B;  2UVW A;  1H98 A;  1ZET A;  3NXZ A;  4CNZ A;  1UWB B;  3HHL C;  3HHD A;  2MZJ A;  2B4O A;  4MKA A;  5IWA J;  4QOT A;  5L1I A;  2CPE A;  3ETO A;  4X4T A;  4X66 J;  1VRT B;  5L8R C;  5HSP A;  2B6A A;  1UJ6 A;  5DDR C;  2L48 A;  3DLK B;  1CS4 A;  1H72 C;  4P2S A;  2DGS A;  2C2Z B;  2DIS A;  4P75 A;  4TVA B;  4UOH A;  5DO2 A;  4ZKA A;  3CCU S;  3TQE A;  1WC6 A;  3CDU A;  2Y1I A;  3MPY A;  2G0J A;  2N82 B;  2F65 A;  2PMW A;  3M8P A;  3KK2 B;  2NR0 A;  5HMX A;  3K17 A;  2PN6 A;  2XCP A;  4DV6 F;  4UUW A;  4USM A;  4K4W A;  1TMJ A;  4MT1 A;  1YJV A;  2XMA A;  2XMJ A;  4WF9 Q;  4ALZ A;  3UD4 P;  1JIH A;  1HWL A;  4RLE A;  5L46 A;  2BJE A;  4IRD A;  2ASJ A;  3VHQ A;  1FJ7 A;  2CZV C;  2GHP A;  1DAR A;  3T9N A;  3TW0 A;  1KDN A;  3NGD A;  1PAE X;  5AE3 A;  5FJ4 A;  3QT8 A;  1HD1 A;  1P1T A;  3MM9 B;  4USW A;  5JVH Q;  1S1U A;  1R27 B;  2P9E A;  3PV8 A;  3M6U A;  1L3S A;  1V3S A;  5IQ6 A;  2HS3 A;  1K9M T;  3ENA A;  2BJ8 A;  5AJ3 F;  1U1O A;  1S0V A;  4B3R J;  1TV6 A;  2M4M A;  6FDR A;  2M88 A;  3VVT A;  3M32 A;  3GYX B;  3I0R A;  2YX4 A;  4HHH A;  4HLB A;  5E41 A;  5JMN A;  4XO0 A;  4B3M J;  2WSF C;  3R7B B;  2UUA J;  5LJ5 Y;  1OY8 A;  2V2Z A;  4EYH B;  4KPY A;  2V9K A;  4I4B A;  2XS2 A;  1ZPV A;  2HND B;  2OI2 A;  3JQM A;  3PYD A;  4CWB A;  4ECW A;  1W2I A;  2J9E A;  1IBM F;  1LXN A;  4OYW A;  3W61 A;  4QW9 A;  1EZZ B;  3I55 S;  1OJ4 A;  2DRB A;  4UY8 5;  2ZOM A;  4BC7 A;  4C2M A;  2PD1 A;  5AXM A;  1UFK A;  3QIP B;  1TK5 A;  1JNZ B;  4ZVQ B;  1VBK A;  1E6Y A;  3HO1 A;  5A2Q U;  2YQ1 A;  2XZW A;  3H4D A;  4DR1 F;  3I4P A;  4RR5 A;  3RB0 A;  1FRM A;  4KH0 B;  3CMQ A;  3MAQ A;  1XQI A;  1ZTT A;  3W8G A;  5F8M A;  3V4M A;  4KBI A;  3UE2 A;  2LQ8 A;  1N33 F;  3CCZ A;  2CG4 A;  4LQ9 A;  2DNN A;  5G0R A;  1JLF B;  3DN9 A;  2LQ9 A;  1FRJ A;  4F0K A;  1IQZ A;  1H0H B;  2F8E X;  3PW5 A;  1MMN A;  3D67 A;  2VD3 A;  3EGW B;  3R7N B;  4WWS A;  2GJ2 A;  1QD1 A;  4B9V A;  1TZ0 A;  3LPE A;  5F9N A;  3KJV B;  2HWI A;  2YWH A;  3D6F B;  1H38 A;  1YJR A;  2XHW A;  5LMU F;  4L73 A;  2ZE2 B;  4U67 Q;  4YB7 A;  5HAO A;  3CCL S;  2CPF A;  5HJX A;  4A8X A;  1N8R T;  3QJL A;  1WHY A;  4DQI A;  2W25 A;  2YWG A;  4DI6 A;  1UEV A;  4I6Y A;  1FNO A;  1RBL A;  2XTJ P;  2KO1 A;  1GXT A;  2BEF A;  2HFO A;  2QZ8 A;  3DGP B;  1RCX B;  3DOM A;  3P45 B;  3P8B B;  4NLG A;  4Q8F A;  5GAD U;  1QJH A;  1NAQ A;  2ZHB A;  1DZ5 A;  4GKK F;  2R2R A;  1CC7 A;  1NPK A;  4BS2 A;  4PG5 A;  2CNN B;  3QGP A;  4EYI B;  1Y11 A;  5HMZ A;  1TKZ B;  3GG0 A;  2R8H A;  3GON A;  4UY8 T;  2IAJ A;  4KAI A;  2H3E B;  1EAR A;  1KHW A;  3LO3 A;  3OBI A;  4LQ3 A;  2HFZ A;  4WP3 A;  2BAN B;  4AQY J;  4Y0F A;  4LF7 J;  4OI0 A;  2LCW A;  4UW2 A;  2IM3 A;  2MST A;  3GB0 A;  1O51 A;  3SXL A;  5HN0 A;  4DS5 A;  4RW6 B;  2ZJQ Q;  3PFO A;  3H5X A;  1IWG A;  2FHO B;  3C16 A;  2P9G A;  4DPU A;  1JXL A;  4Q7A A;  2OLW A;  1SB6 A;  4RBV A;  4HDG A;  3GWC A;  2EFN A;  2NSC A;  1IQT A;  4DSK A;  1S5Z A;  2QC3 A;  2SXL A;  3OR1 B;  2VG7 B;  3KLI A;  3T1A A;  4FZV A;  1UET A;  2V50 A;  3H2V E;  4WFX A;  4YME A;  2A2C A;  1U1N A;  1FRX A;  1GFW B;  4IFV A;  1RA7 A;  5M2R A;  3MM6 A;  2Q6B A;  1EB0 A;  4LUB A;  2GA7 A;  1WC0 A;  4M5J A;  3WX8 A;  2C3Y A;  1Q79 A;  5F8H A;  3AT1 B;  2QA4 G;  4ECZ A;  1KFS A;  4DV5 F;  1U48 A;  2UUW A;  1CBK A;  5AT1 B;  1RWX B;  2QE5 A;  2XO7 A;  1RBO B;  2CNL B;  2RAQ A;  3VVU A;  1EKS A;  4ES2 A;  2AJF E;  1F9E B;  2YKN B;  5B0E A;  3IN5 A;  2NZ4 A;  2F8H A;  5D0R A;  4O3O A;  2XSJ A;  1UL3 A;  3R3T A;  4LRC A;  4X64 J;  3TZY A;  5LM7 E;  5KFA A;  1MWY A;  2BX6 A;  1UA1 A;  1Q5Y A;  2GX8 A;  3DFE A;  4DS4 A;  2ZUG A;  2OGU A;  4RBU A;  1E6V A;  1FKO A;  5D15 A;  4DV7 F;  4ZVT B;  2J8S A;  2BQR A;  5DM7 Q;  2HQC A;  1RIS A;  4FXV A;  4MKV A;  1JLB B;  5J2N B;  4ICL B;  3W5Z A;  2ZH8 A;  3DKD A;  2VZ9 A;  4TY9 A;  4DR3 J;  3GPA A;  3ILL A;  3KLG B;  5BYS A;  4TQR A;  2LEB A;  4ID5 B;  5LXR A;  1S0N A;  4QU7 A;  2UXB J;  4I67 A;  3CCQ S;  4IRK A;  1WC5 A;  4R5P B;  2CPX A;  2RHS B;  4WKY A;  3QJP A;  1BLU A;  3NOG A;  5ETS A;  5KG3 A;  4P2M A;  4USV A;  3TUJ C;  3A3P B;  3ZZT A;  4C9D A;  2GHV C;  2IJN A;  4PWW A;  2L9W A;  2GML A;  4ZPV R;  1AB8 A;  3EIC A;  4M94 A;  3MAA A;  4K4Z A;  4DG1 B;  2LU1 A;  3O5T B;  4DQR A;  1FFG B;  2X1A A;  1FFW B;  1XJW B;  2JHE A;  3L7P A;  5KFS A;  1JJ2 R;  4JV5 F;  1HMV A;  2HHS A;  5C7P A;  2XUL A;  1RAG B;  4KGV B;  1VYA A;  3LP1 A;  4KPC A;  1S79 A;  1CUL A;  3MUT P;  3W9J A;  1VLY A;  1M5V C;  5SZT A;  3VZH A;  2N7Y A;  4OZ2 A;  2X1G A;  2M70 A;  4PQA A;  3VZI A;  3ZZY A;  1U47 A;  1GNK A;  2HNZ B;  2VQE F;  2XB2 D;  3MEC A;  5KFW A;  1FDD A;  2MTL A;  2CXE A;  5HO4 A;  3JQJ A;  5EWG A;  3PW7 A;  1VQL S;  2BKN A;  1HHS A;  2IMW P;  2IDL A;  3WBZ A;  3OTB A;  1M5K C;  4TU9 A;  2HS4 A;  3J80 Y;  3W2W B;  1S9E B;  1NND A;  2YNH A;  5CZV A;  3D3C J;  2KM8 B;  4Z2X A;  1YHQ S;  5J1N A;  3I6P A;  5LL6 d;  3MM8 A;  5E5N A;  4M5H A;  4KV8 A;  5DG8 A;  1V9O A;  2DPI A;  4M8L A;  1NK0 A;  4RBT A;  2CDQ A;  1YQH A;  2XMU A;  3DRR B;  2LA6 A;  5DZ6 A;  3QWP A;  1TV6 B;  1HI0 P;  1WOR A;  3ZFV A;  1WJ9 A;  3SV4 A;  4DSL A;  1HLW A;  5GAE U;  3KDN A;  2WW4 A;  3C19 A;  4KGX B;  3H59 A;  2DXF A;  1S6P A;  1S57 A;  2E66 A;  4ZVE A;  3D3B J;  2AJ0 A;  2VC1 A;  2NPF A;  4B9N A;  3OQ2 A;  3GIM A;  4QYZ J;  3AD9 C;  2ZHA A;  3T9Z A;  4H54 A;  5LSL A;  3O44 A;  2GIQ A;  4FYW B;  2E7X A;  3VAK A;  2ZH6 A;  2J6T A;  4K0K F;  3TZZ A;  1H2U X;  2HQ3 A;  2UUC F;  4PWU A;  5IC4 B;  3IRX A;  5DET A;  4DR5 J;  1RYS A;  2J9C A;  3GYG A;  1NDP A;  4DL4 A;  2WVF A;  2A3J A;  4BWM A;  2MZQ A;  2VG6 B;  4UQG A;  4YY3 J;  3Q86 A;  4IOC Q;  3CT9 A;  5K14 A;  1ZM9 A;  5KFB A;  1U1K A;  3P49 B;  3QRQ A;  3FCW A;  3AB2 B;  3OSN A;  4EBD A;  1S9G B;  1GMW A;  4Q2L A;  2CUY A;  2KT3 A;  3T41 A;  4LRE A;  2W4D A;  1C1C A;  5EGY A;  4Y34 A;  5EHH A;  4FS2 A;  1SJ3 P;  4X4U A;  5ETM A;  3CDE A;  4ZVO B;  3V6K A;  3U1M A;  3K5L A;  1WG4 A;  2CZ9 A;  2LP4 A;  4CO2 A;  2J8A A;  2XGP A;  4LF4 J;  3KK3 B;  3CJQ A;  1KTV A;  4A47 A;  2OPS A;  1D09 B;  1TEL A;  2U2F A;  1R3N A;  2FJD B;  1VJQ A;  5CYM B;  3TOQ A;  2JZ5 A;  2ZJP Q;  4BCA A;  5LSR A;  1FF2 A;  1PG5 B;  1RAF B;  4OJG A;  1IR1 A;  5FLX U;  2ZM6 F;  3N6L A;  2PFF B;  2KHD A;  2DHS A;  2FYX A;  4PQU B;  4ZLJ A;  3PEH A;  2KYZ A;  4RNM A;  4ZPB A;  1C4A A;  4GMK A;  4NX9 A;  2VIH A;  1QAY A;  3RBX A;  1G6B A;  2M9K A;  4N47 A;  2Z2Z A;  4CRJ A;  1HR0 J;  3JQK A;  1I6J A;  3DM2 A;  4ED4 A;  1Y7P A;  2DXE A;  1RAC B;  1SXL A;  2XG8 A;  2G1D A;  2I2Y A;  3IBF B;  3BZQ A;  1R6V A;  2CVE A;  2HHX A;  2GZO A;  2V0N A;  3I82 A;  4HTI A;  2IIH A;  2GNK A;  2X51 A;  4ZMM A;  3DDK A;  5HBM B;  3HZG A;  5HQM A;  4MK8 A;  5DLG A;  2FPH X;  1D9D A;  2HHP A;  3M2U B;  2I1R A;  2LLZ A;  4ECU A;  2OTJ S;  1YI2 S;  1ZM4 A;  5E7O B;  2O01 C;  1PIE A;  4IUF A;  2YH1 A;  4U8Y A;  4QR2 A;  1SVD A;  1IKY A;  2AD9 A;  3ZZO A;  5AXL A;  2DNK A;  1WHW A;  4ELV A;  4LF6 F;  3IWL A;  4RX6 A;  2HVE A;  4AND A;  1WF1 A;  3QIP A;  4TYA A;  3JYT A;  3DCA A;  1LK5 A;  2VJV A;  3X1L B;  2UUB F;  3R2C J;  2WAQ D;  1MMD A;  1FKP A;  1RAI B;  2IM1 A;  1TAQ A;  1S76 D;  2VOO A;  3MM6 B;  1TKX B;  2PO4 A;  4DZD A;  1VQ5 S;  1C0T B;  3M9O B;  1CJT B;  2AHO B;  4CLY A;  1SJQ A;  1RT6 A;  4JI2 F;  1IR0 A;  3H42 A;  5C25 B;  3W7B A;  4TLQ A;  1HBM A;  1XBW A;  2HLT A;  5G0R B;  4B08 A;  3OXF A;  2HHU A;  4V1A k;  2RF2 A;  2GGP B;  1K47 A;  4J37 A;  3OW2 R;  1YTY A;  2O5D A;  4ED8 A;  2G13 A;  1ZM2 A;  4DN0 A;  4M5D A;  3IM9 A;  3UD5 A;  2FIU A;  1BQM A;  3PM9 A;  4FPI A;  4JYA F;  4YFU A;  2OUG A;  2ERR A;  2QL9 B;  4J9N A;  2POK A;  3ET6 A;  2E5J A;  3QGI A;  1Q82 T;  2BJ3 A;  2DJW A;  2QLW A;  1WG5 A;  2DNH A;  3QAT A;  2AF6 A;  3HXM A;  2XY7 A;  2DHX A;  2W2N P;  1OS5 A;  4JI3 J;  5DM6 Q;  2I5J B;  2OEM A;  2ZH4 A;  1RBA A;  5I3P A;  4O0I A;  1NJX A;  4FXD A;  1S1X A;  4Z37 A;  3D9B A;  4TNO A;  1NZ8 A;  2GMJ A;  2KRB A;  2X7I A;  3DGP A;  3DOM B;  2WOM B;  5KFR A;  4X62 F;  2QEX S;  2QL5 B;  2V9W A;  4NAS A;  5HLF B;  1I94 F;  3CC2 S;  1RTI B;  2AEM A;  2QSF A;  2XI3 A;  2FTR A;  4X65 J;  3OVA A;  3SDE A;  3IM8 A;  2IM2 A;  5KFI A;  1IKV B;  4QWA A;  2CA9 A;  2DGT A;  3H5S A;  5GAE I;  3RB4 A;  2QFI A;  1Q7L B;  2V8H A;  4LSL B;  3I0S A;  1DQ9 A;  1JQG A;  4L72 B;  3UCG A;  2XWY A;  1RWW B;  2KJW A;  2V2V A;  4RNO A;  3E8O A;  2F9D A;  1TL3 A;  2KRR A;  4OYI A;  2B0G A;  4C8M A;  5B0C A;  2V4Q A;  2OML A;  5F8G A;  3QO9 B;  1FRH A;  3THT A;  4J9U E;  4C8Y A;  1TL1 A;  2YY3 A;  3CCT A;  2JNJ A;  1YWX A;  4TYB A;  3H5U A;  3ULH A;  1VRU A;  3NG8 A;  3F0N A;  4UOC A;  4B02 A;  4ZS6 A;  4DV1 F;  1TUV A;  1F2G A;  2VFV A;  4IG3 A;  2CJA A;  1SBR A;  4ZCL A;  2OMO A;  5JVG Q;  1J5E F;  4NMX A;  3PW0 A;  5M2U A;  4K4S A;  4A8S A;  4AL7 A;  1CC8 A;  1RKI A;  3MMB B;  3AOD A;  3H2L A;  2ZDP A;  2OPQ A;  2QIF A;  3GZ7 A;  4LJM A;  5KFL A;  2ASD A;  1S10 A;  2KT5 A;  1N56 A;  4RWX A;  4CM2 A;  2UU9 J;  2CQH A;  4KV8 B;  2R7V A;  2DIT A;  2PA8 D;  3QSI A;  3TR5 A;  2I6W A;  3CDB A;  2YKN A;  4I7F B;  3QGG A;  2YNF B;  3SV3 A;  1H6K X;  2GVD A;  4OHZ A;  5A8K B;  2GO8 A;  5E3P A;  2CDR B;  1SC3 B;  3W5X A;  4RWW A;  4HH1 A;  4KTQ A;  4PEO A;  2WK4 A;  2ZZM A;  2JX2 A;  4WYW A;  5IM0 A;  3NKY A;  5CYQ A;  2BA9 A;  3IP0 A;  2ZNY A;  3CCW A;  3LAN A;  3F56 A;  2HMI A;  1K1Q A;  2CZ4 A;  2RB7 A;  2LKZ A;  4ZPW R;  3D54 A;  3V5R A;  5EWE A;  3DGV A;  2C2N A;  2MZT A;  3TAR A;  3IRX B;  4JBC A;  1QAX A;  1NJW A;  1VQ8 S;  2E1C A;  1AFJ A;  3BGR A;  5FLX Y;  3RAM A;  3MUM P;  2VUG A;  1HD0 A;  2FVC A;  1HQU B;  1BQX A;  2CNO B;  2VJU A;  3MHY A;  4M5K A;  3FZ2 A;  1M5S A;  4HAC B;  1HNV A;  1FXD A;  3MR6 A;  2ZBP A;  1C1C B;  4KHP J;  4KC5 A;  4DU8 A;  2AJ1 A;  2E9R X;  1M90 T;  2J9D A;  2M7S A;  3W2V A;  3CTR A;  3GIJ A;  5D8H B;  6FD1 A;  5F8J A;  3D28 A;  3QT7 A;  5HVF A;  3G8T A;  2DHG A;  3SBM A;  5I42 B;  1WNE A;  1S1V A;  3IO1 A;  2DH7 A;  3S6E A;  4YR3 A;  3FQL A;  1R0A B;  3O8W A;  2RVJ A;  3D1O A;  2YPZ A;  3N6N A;  5K8N A;  3SYZ A;  4LRF A;  1FD8 A;  5IC6 B;  4EU0 A;  1V5I B;  2E5H A;  2ROG A;  3FKB A;  1SCJ B;  4M5L A;  5LOQ A;  2RDD A;  1NLK L;  5MAO A;  4OHW A;  2ZUA A;  1N36 J;  4DFM A;  3I5B A;  2ZKT A;  4OV6 A;  3MD3 A;  2F9J A;  1UJ4 A;  4WYL A;  4Q8E A;  3Q8P B;  2J0Q D;  5G4D A;  1RTJ A;  3R6L B;  1OY9 A;  2DY9 A;  2IA0 A;  3Q8R B;  2VG5 A;  2MB0 B;  3IBW A;  2FHM A;  1B7Y B;  1CS4 B;  1U25 A;  2DT9 A;  3NS5 A;  1S49 A;  4Y3C A;  4X4P A;  4HEA 9;  3H40 A;  1BQM B;  2QT7 A;  3D6T B;  1U24 A;  2IVM A;  3KK2 A;  2RRA A;  4NLV A;  1HQE A;  2OSR A;  4AD6 A;  4RUC A;  1QVG R;  2RQ4 A;  1C0U A;  3FQK A;  2EFQ A;  3C15 A;  3FFI A;  4LFC F;  2HGL A;  3AXK A;  4NYO A;  4B3S F;  3DNC A;  4OIX A;  5KFJ A;  1G3O A;  2I5J A;  4FDF A;  4LT6 A;  4AT1 B;  4WZQ A;  4PR6 A;  1ZTW A;  3GFX A;  3HHE A;  3B4D A;  4Q0B B;  5KFD A;  3HT3 A;  1DLO A;  1M5O C;  2E1P A;  1KVJ A;  1EJ7 L;  3GII A;  1F0X A;  1Y10 A;  3DXB A;  4HTJ A;  4NRT A;  1IUJ A;  3BQ1 A;  1R8A A;  2H54 B;  2FC8 A;  1IKV A;  1NK5 A;  4DSJ A;  4F4A A;  2Y8Y A;  3CO9 A;  1U8S A;  2CAD A;  1U2R A;  3Q22 A;  5C24 A;  3M6W A;  1YJW S;  2PGC A;  1JKH A;  2DHA A;  2YKO A;  4WII A;  5HMY A;  5DDO C;  2FVP A;  1MRO A;  1F3V A;  2WB1 D;  3QO9 A;  5DZ7 A;  4CLT A;  3VAH A;  2JLF A;  1RTD A;  3NNH A;  2W9C B;  1GTE A;  4OI4 A;  4CQ1 A;  1VQ7 S;  1CLF A;  4K5S A;  1XEZ A;  2KB2 A;  1MU2 B;  3CJ4 A;  1NDK A;  4LBP A;  4UZC A;  2JFD A;  2HFN A;  5CYM A;  1TR0 A;  2CPD A;  2MHN A;  2ZNZ A;  3IG1 A;  4OX9 F;  2AJ4 A;  4DFJ A;  4CO3 A;  1EET A;  4O4G A;  1TUG B;  1YG0 A;  2QFJ A;  4DL5 A;  4ZJL A;  2EEY A;  2LXU A;  4K2J A;  3JS9 A;  3M8R A;  1S59 A;  1CG2 A;  2RU9 A;  1RHK B;  4IG0 A;  4I2Q A;  4L74 A;  3OJU A;  4LF9 F;  4ERD A;  1XMB A;  1YRT A;  4MTP A;  4WFB Q;  2BJ9 A;  2VBX A;  1OQ6 A;  4F25 A;  3RBE A;  4OX6 A;  2R42 A;  2WON A;  2EKN A;  3BKT A;  3OPK A;  4J9Q A;  1VQK S;  4B3S J;  2WOM A;  2V8G A;  3GYN A;  3CPW R;  2LU2 A;  5HLF A;  2HZC A;  2KG1 A;  4EI2 A;  2FUG 9;  3LP0 A;  3ZTO A;  2V4J B;  2FLO A;  1NME B;  7FD1 A;  2AQ4 A;  2DR9 A;  5FD1 A;  1TL7 A;  3GLJ A;  4GRS A;  4LIR A;  3BO4 A;  1CJU A;  3A3O B;  2OJ3 A;  2O67 A;  1B3T A;  4YB1 P;  4ECQ A;  3OFF A;  5KG0 A;  4OMF G;  2PMZ D;  2P6T A;  4ZIW A;  2H4W B;  4FS1 A;  2JEG A;  3ZTQ A;  4CH7 A;  3BDE A;  2XMM A;  3Q83 A;  1U6F A;  4QZV B;  3Q2T C;  3N4W A;  4DQP A;  2DCU B;  4K4V A;  4U7U D;  3GMG A;  2WB4 A;  3TAM A;  1HNI B;  2PMH A;  5IS2 A;  1FE0 A;  1PAU B;  2HYI B;  1XNR F;  9ATC B;  3GFY A;  3TX0 A;  1APS A;  1DY3 A;  4DU7 A;  4L3K A;  1GXU A;  5KOX A;  3D5M A;  4HH0 A;  1J5O A;  3R5G A;  2MKK A;  1NH8 A;  1KS2 A;  2JC1 A;  3UWT A;  4WP9 A;  3VWS A;  1Q81 T;  3KNG A;  4B3T J;  2QYG A;  4ETZ A;  4CDI A;  1FEE A;  2OSQ A;  3NAH A;  4ZIV A;  3MR7 A;  3E51 A;  3U7J A;  2GS8 A;  1CJK A;  1Q95 G;  1RT5 A;  4DL3 A;  3KLH B;  3JSM A;  3CCS S;  1S1T B;  3IGV A;  4DR2 F;  1OPZ A;  3FC9 A;  1L3U A;  2UV8 G;  4GO5 X;  5B0A A;  3NWR A;  1RAB B;  3UN2 A;  1BQN B;  3HMJ G;  5C5J A;  1F5B A;  5F3T A;  3EXC X;  5AXK A;  2YNF A;  3SSR A;  4PKD B;  1NK6 A;  3ZNJ 1;  2F3J A;  2OTL S;  1R0B G;  3M2R A;  4EGL A;  4M5M A;  1D8Z A;  3DI6 B;  2ZH5 A;  1YSJ A;  3K8W A;  5A0Y B;  3LAK A;  2VDI A;  2CQP A;  2EFP A;  4IFV B;  2UUT A;  5KFM A;  2GAH C;  3QSY B;  1UFL A;  4HI2 A;  4YUD A;  2R2U A;  3OV7 A;  2QYC A;  4NZ0 A;  5SUH A;  3D0H E;  3HHL A;  3EM1 A;  2RML A;  1UEU A;  2HFS A;  5GAH I;  2O3D A;  3MPD A;  1S9F A;  3TZW A;  2DPJ A;  4Q2M A;  2IBK A;  1VIS A;  2E7V A;  3KUE A;  2AU0 A;  4WBF A;  1L5U A;  4KR0 B;  3OVS A;  3HSG A;  4N56 A;  1X8D A;  4ANE A;  3CC7 S;  5J2P B;  3ZTS A;  2FJA B;  3IR6 B;  1OMS A;  2W1B A;  5HQL A;  1LEO A;  1NK7 A;  1FI4 A;  3OTC A;  3T5J A;  4LBI A;  3DOL A;  4ILL A;  3HT0 A;  2RE1 A;  1JJ4 A;  4QCL A;  4N77 A;  2KVI A;  3UO0 A;  3R2D J;  3HF5 A;  5J1P A;  2VQE J;  2CWK A;  5B0F A;  4Z7C A;  5D0E A;  1UVL A;  4DX8 H;  3GCW P;  3DHX A;  3KHR A;  2GVZ A;  3HVT B;  3UDV A;  4X4V A;  3KHL A;  1K8A T;  3HPO A;  4J91 A;  1U45 A;  4J7C A;  1KTQ A;  1IBK F;  2WBM A;  4JV5 J;  1BD6 A;  5IWA F;  3I5A A;  3OSP A;  9RUB A;  3MTK A;  2FC9 A;  2OHD A;  3ZZ0 A;  3BM7 A;  4ER8 A;  2UVV A;  4MYU A;  1BHN A;  3GTY X;  4IG3 B;  4R8U B;  2H48 B;  3EVO A;  1KOO A;  2B56 A;  2EBE A;  4KO0 B;  5DLF A;  1JLF A;  3C46 A;  4LIW A;  2JVO A;  1RHQ B;  3PFE A;  4IR1 A;  2ZOF A;  2ADC A;  5CA5 A;  1UW9 A;  1REG X;  4M1K A;  2BW2 A;  3N79 A;  4OI6 A;  4OYP A;  4F2R A;  1Q8L A;  3SMZ A;  5CH7 B;  3R9L A;  1R8C A;  2C22 A;  1U1P A;  3A8E A;  1JNR B;  1TAU A;  2AYB A;  1HPZ A;  3R1L A;  2V34 A;  1P27 B;  4YEA A;  4RNF A;  4X65 F;  4FXW A;  4QU6 A;  2BE9 B;  2RQM A;  2Y8W A;  3C15 B;  4I2Q B;  2YQ3 A;  5HK4 A;  4ATN A;  3DYA B;  2HHH F;  4R0E A;  1FDB A;  1GMW D;  1PIL A;  4RW9 B;  5HAN A;  1NK9 A;  3DLJ A;  5D4O A;  2D1C A;  3PCO B;  3D2W A;  2QX0 A;  5DGB A;  1T03 A;  4NLR A;  2VFU A;  1T7P A;  2Y1L B;  3GV7 B;  4AL5 A;  1VI7 A;  3BGO P;  4DJB A;  2EPI A;  2MQM A;  2CRL A;  3AHP A;  1IXK A;  4M5I A;  3DRP B;  3W60 A;  2IRX A;  1TL7 B;  2HAI A;  4PXE A;  4WCE Q;  4NCA A;  3M9M B;  3HCX A;  4JYA J;  2R7U A;  3BR9 A;  1FES A;  2HHT A;  1WI8 A;  2DNQ A;  2XLK A;  2AMC B;  2QMU B;  3LWL A;  1HQU A;  3K8V A;  4EEY A;  1H73 A;  2QO3 A;  1QY7 A;  5H9F J;  4OHY A;  4KKO A;  3EVW A;  2D3U A;  3MR5 A;  4DR6 J;  3V4I A;  3I31 A;  1JLA B;  4NI2 A;  5RUB A;  4HL9 A;  3SQG A;  5KTQ A;  1NXI A;  2LQ5 A;  2GFF A;  4A46 A;  3EYZ A;  2BE7 D;  4DQS A;  1DTT A;  3OR2 A;  2J6S A;  5IT9 U;  2GIR A;  3HM9 A;  2IC3 B;  4FKY A;  4M5N A;  4BC9 A;  1ULR A;  2Z57 B;  3CJS A;  2DK2 A;  1HBU A;  1U0H A;  2EFG A;  4NLD A;  4YDD B;  2VG7 A;  3KNA A;  3NBP B;  1JK9 B;  2NRE A;  3IS9 A;  1IBL J;  4OX9 J;  1SC1 B;  4P7T A;  1K1S A;  3MD1 A;  4YS2 A;  3G86 A;  4FF2 A;  2CQB A;  1CJV B;  2V8D A;  4AQY F;  2D3O R;  2VBW A;  1XMQ J;  4ZLL A;  1B64 A;  1X7V A;  2GAG C;  1LKZ A;  2VFR A;  2AJQ A;  1WUU A;  1HBN A;  2D9O A;  2ZC4 A;  3MCN A;  4ID8 A;  1SH3 A;  3LGN A;  4G6V B;  4M63 A;  5KG4 A;  2BE2 B;  4DMZ A;  5KT6 A;  4P2F A;  2WVC A;  1RT7 B;  2BM0 A;  4A8K A;  1WTB A;  4O3R A;  3HD1 A;  3BGF A;  3N9U C;  2UV8 A;  2RDJ A;  1UFW A;  1WOO A;  2RQC A;  1NHU A;  4HVZ A;  5CAB A;  3J7A 1;  4OI2 A;  1Q8I A;  4UTG A;  4F4Z A;  1KNZ A;  3AA8 A;  4Y6I A;  4QBU A;  3MWB A;  4DDF A;  4DR6 F;  5ETK A;  1X4F A;  1F5A A;  4K4X A;  2GO9 A;  2B7C B;  2ZH7 A;  3KJQ B;  1VK3 A;  1X4E A;  2GCF A;  4PAA A;  1O5J A;  4C11 A;  2AP6 A;  2MZS A;  3PW2 A;  5KFF A;  4P7V A;  1FX4 A;  1GT8 A;  2KDO A;  2QMW A;  4CH0 S;  3J7Z 5;  1IKW A;  3EGV A;  3BEG B;  4NOH A;  3IRW P;  1YJ9 S;  2QJ3 A;  2Y1R I;  4OX8 A;  2A10 A;  2H9Z A;  5L39 A;  2DR8 A;  1H2V Z;  1WDT A;  2BJD A;  2KT2 A;  2OPP B;  2WW8 A;  3FMW A;  3N28 A;  3QRR A;  4DUY J;  5DQI A;  1RLD A;  1RT4 A;  1UAW A;  2DNY A;  2Y3Y A;  3AQO A;  3M8Z A;  1Z4U A;  4WTY A;  5HJY A;  2C2K B;  2U1A A;  3M8Y A;  4LF4 F;  3TNV A;  3G82 A;  4PXC A;  2IPO B;  4BLG A;  2E9T A;  1RTD B;  3MOJ B;  1N52 B;  2WSE C;  5CZX A;  3CJK A;  3K5P A;  1R8B A;  2QLX A;  1L3K A;  3WC0 A;  3ZO7 A;  4CM0 A;  3TUZ C;  1RAE B;  3D6H B;  2EWH A;  4OFZ A;  4ZPT R;  3T6J A;  1SL1 A;  3MMJ A;  5D4P A;  1JWW A;  1BQN A;  4ZCM A;  3FK4 A;  3BYR A;  1XMQ F;  4R8U A;  4IRC A;  2Q43 A;  3N6M A;  2JSX A;  2M3D A;  3MED B;  3K57 A;  1EET B;  2QG9 B;  3VAJ A;  3M30 A;  4ELU A;  1U1Q A;  3MI7 X;  2B8Q A;  3GSD A;  4OZ5 A;  1UJ5 A;  1YJ7 A;  2PC6 A;  1NKB A;  1IVZ A;  3R5C A;  4N7T A;  4ZVP B;  1XR7 A;  2VKZ G;  1RGV A;  4MIA A;  5ETO A;  1QUV A;  2H1Y A;  4EK2 A;  2ZH2 A;  4DF4 A;  4C3M A;  1QSL A;  2K7J A;  1T05 A;  3UW1 A;  3N5F A;  2WON B;  3MMA B;  4L75 A;  1LWC A;  4LRB A;  2RDI A;  3M8Q A;  4TLR A;  2AIR B;  4Q45 A;  2HGN A;  3DOK A;  2HQD A;  3KLE A;  1S1W B;  4M5D B;  3QQC D;  4ILR A;  5EX0 A;  2ZC3 A;  3Q23 A;  3M1V A;  3QLH B;  2EFO A;  2XHC A;  2GIF A;  1RT2 A;  5D0G A;  2OEL A;  3V6H A;  1XMO J;  2PI4 A;  4Y2A A;  2RRB A;  3IBC B;  4IOB A;  4IO1 A;  5CHC B;  2OAU A;  3G6X A;  2AV5 A;  1WOS A;  2IRU A;  5F0U A;  3DRP A;  2ZWO A;  1OO0 B;  5CYJ A;  4LFC J;  1NSP A;  2AGQ A;  1XIQ A;  4DEZ A;  3S8S A;  3MZI A;  2JEJ A;  3BN7 A;  1TMM A;  1T95 A;  2CKW A;  1PCA A;  2XSF A;  6AT1 B;  5KFN A;  3M32 B;  1KLN A;  3MM5 B;  3WC2 A;  4F2S A;  2HSE B;  4NCB A;  1RAO A;  2HBZ B;  3M8S A;  1S9G A;  4H4K A;  1U49 A;  4ZCI A;  3F73 A;  1J5O B;  4BBY A;  1XNQ J;  3J7A N;  3IXQ A;  4U95 A;  3LUY A;  4IQM A;  2J0X A;  1S6U A;  3SQG B;  3G71 S;  1SQE A;  1U8W A;  3A4T A;  1G1X A;  4KGM A;  3HLU A;  5D77 A;  3Q8Q B;  1S97 A;  3CE8 A;  1MN7 A;  2VKR A;  2CQD A;  3HZE A;  3X3U A;  4QR1 A;  2QGF B;  4F4K A;  4H4M B;  1I5O B;  4K4T A;  3JSM B;  3W3S A;  4DPX A;  1EQM A;  2VFT A;  5A2Q Y;  1VK8 A;  1WSV A;  2EC2 A;  3IS9 B;  4O3Q A;  2LEP A;  3FBE A;  3OTO J;  2YVS A;  3C14 A;  3OTO F;  2AZ3 A;  2KFY A;  3HJF A;  4DCO B;  2B9E A;  4PQU A;  3KK1 A;  2ZH3 A;  3T5L A;  1TVR B;  1UTA A;  1HWK A;  4FNI A;  8RUC A;  5L38 A;  3OLB A;  2CFX A;  3DI6 A;  4I69 A;  3UQS A;  3G8S A;  2UXD F;  3O6Q A;  5GAG U;  4RW9 A;  1PYS B;  3PZP A;  4B3T F;  2C2O B;  4IDK A;  1D3W A;  4USJ C;  3DM2 B;  4HKQ A;  5GMD A;  3KKF A;  3ENV A;  3DLK A;  2QA1 A;  1RJJ A;  3BRE A;  2RKI B;  2MLZ A;  4C0H A;  1SQF A;  2ASY A;  2IJR A;  3CVK A;  1HL6 A;  4DX5 A;  4Z7Y A;  1FNX H;  2L9N A;  1UA0 A;  4NLP A;  4MFB B;  3BQ0 A;  1KRP A;  1T9U A;  4LSN A;  3ZNU A;  3H25 A;  2HHV A;  1ZYQ A;  1JJH A;  1RTH A;  4U96 A;  5KFU A;  2OP5 A;  1F1B B;  1FXR A;  2BM1 A;  2ZD1 A;  3CDA A;  2L9D A;  3CO0 P;  4N8O A;  4U9R A;  3PW4 A;  2EK1 A;  4MK9 A;  2F4V J;  5C2G A;  1HA1 A;  1YRU A;  2BRL A;  3FRY A;  3UN3 A;  4D3G A;  4OL8 A;  1CSJ A;  2A18 A;  1LXJ A;  1X9S A;  4MYT A;  1ZPW X;  3W5Y A;  3NMA A;  3DDI A;  4ED3 A;  4Y2C A;  1DUR A;  4F4W A;  2IC3 A;  4NXN F;  3W8P A;  2HRU A;  2CPJ A;  3M7V A;  1WKL A;  1HBU B;  2MKS A;  4C0O C;  2OPP A;  3IMQ J;  5K20 B;  2HMI B;  2E5L J;  1FKP B;  3E2E A;  3EZO A;  3PR4 A;  3HX9 A;  3KTQ A;  1MNE A;  1HBO B;  3IWN C;  2F40 A;  1HQ2 A;  2C3P A;  4CLW A;  3OT9 A;  3CCR S;  1C0T A;  3FRZ A;  3G82 B;  2M8D B;  2YBV A;  4HAC A;  5E3C A;  1GAO A;  4IYQ A;  3FEX B;  2ATC B;  3R7S B;  1N5Q A;  2CPH A;  1FT8 A;  3N01 A;  4G1I A;  5GMK a;  1HWU A;  3ITH B;  5GAD I;  3MFH A;  2R7R A;  4JI2 J;  2XNR A;  3JTN A;  2B6A B;  3G4S S;  1OIA A;  3OD2 A;  4LF6 J;  1PBU A;  4QYR A;  3W9H A;  4F3M A;  1BXN A;  1R0A A;  2J0W A;  4LR9 A;  3VAG A;  2FGC A;  4MIW A;  5JJB A;  3DLE B;  2N4D A;  4M95 A;  2ROE A;  4WPA A;  3WIV A;  1RLC L;  1ZBT A;  4N8N A;  1KC8 T;  1GTH A;  4G1Q B;  4OQJ A;  2DYA A;  2XYH B;  3TP2 A;  1LW0 A;  1NSA A;  2DGW A;  4ZLN A;  5K8P A;  1D1U A;  2C2M B;  4DL2 A;  1XNR J;  2CQI A;  2HBR B;  1WHX A;  1Y5I B;  2Z2L A;  3M8Q B;  3W9I A;  5HP1 B;  3Q24 A;  4PG7 A;  2CJK A;  2HRT A;  2MQL A;  2XSJ B;  1IN0 A;  3IA0 A;  3NCR A;  3H0P A;  3UFC X;  3BSA A;  1HHT P;  5ETN A;  1HQE B;  2BBE A;  3PX6 A;  5EWF A;  4LSL A;  2ZE2 A;  4C3L A;  1Q7Y T;  4HDH A;  2G0C A;  1KLM A;  1RU1 A;  4ED6 A;  2LQJ A;  4RJV A;  1RAA B;  2ZM6 J;  1FA0 A;  1JLA A;  3PRV A;  4NI2 B;  4QIW D;  4ED2 A;  4JI3 F;  2CG8 A;  3AJD A;  3C6U B;  4WFA Q;  3TUI C;  1QTN B;  1SKR A;  4BHQ A;  3E01 B;  1YJT A;  2HND A;  5ITH A;  4CNY A;  3QAE A;  3QFW A;  4UOG A;  3TZX A;  1EHW A;  3TVK A;  1SL2 A;  2XYP B;  2YKQ A;  4DCP B;  2CPZ A;  2BYC A;  4KGK A;  5E2Q A;  2GV1 A;  2KFZ A;  5B0B A;  3NBP A;  1UVK A;  1X9M A;  1RT1 A;  1KQS R;  2HHW A;  2K2P A;  3KLF B;  4RKU C;  2HBY B;  1RU2 A;  2NXU A;  2OFH X;  1X5P A;  4QR0 A;  3J81 Y;  1WC4 A;  4W98 A;  1Y3J A;  1MW7 A;  2VU5 A;  2ZIT A;  4C97 A;  5CCL A;  1TKD A;  3I87 A;  2F1F A;  1WG1 A;  3A12 A;  2YWF A;  2ABY A;  3P3D A;  4O23 A;  2FLN A;  3Q8S B;  2A6O A;  3PYE A;  3HSD A;  3HDS A;  4LF8 F;  1YGY A;  4DPW A;  2R7W A;  2UP1 A;  2UUC J;  4DV2 J;  4URG A;  3R1H A;  1DAX A;  3LPY A;  3HHL D;  1UCN A;  4I68 A;  5KFO A;  5I3U B;  4U8V A;  2R8J A;  3AJ2 A;  1UEK A;  2W4P A;  3OR1 A;  2C2D A;  1HW8 A;  4B9L A;  1JB0 C;  2G9O A;  3ILI A;  3MFI A;  4IR9 A;  2M0G B;  3MEC B;  5E0O A;  1JLC A;  2XZD B;  4OYX A;  3LF0 A;  2ZVI A;  3G9C A;  4FN5 A;  2XZT B;  3VAF A;  2GQC A;  1SL0 A;  3RTV A;  3CED A;  4OYM A;  1PYT A;  1FRK A;  3OUY A;  1DJ0 A;  1B99 A;  1Y00 A;  1N4L A;  2W2M P;  3MAH A;  3SFG A;  1VC5 A;  3JSB A;  1FEH A;  3VAL A;  3ISN C;  1VLO A;  1IKW B;  2OH2 A;  3CJ2 A;  3RZA A;  4TY8 A;  1KN6 A;  1YIJ S;  1XMO F;  2QLF B;  3QAU A;  3VF0 B;  2E5L F;  3UCU P;  4LBH A;  2R8G A;  3GFZ A;  1HNV B;  2ZWP A;  4AXI A;  4UZB A;  2MGZ A;  2JFK A;  3MCM A;  1DRZ A;  3VGS A;  2N3O A;  4ZPD A;  1SUQ A;  1WKK A;  3SSS A;  2RIL A;  1LQ9 A;  5ETV A;  4KYZ A;  2NSB A;  2BR0 A;  4FF3 A;  3G87 A;  3EPG A;  3A8K A;  4JOU A;  4LR7 A;  4Y2I A;  4A48 A;  1NB7 A;  4RW6 A;  4ID5 A;  2CQ0 A;  3OFE A;  4AL6 A;  1YJN S;  4RU9 A;  2F7V A;  3EGN A;  3TAM B;  2KN4 A;  3B82 A;  2OKQ A;  4KB7 A;  2ZDO A;  3D1H A;  1S4F A;  4OJH A;  4HHU A;  1U4B A;  2DCL A;  4ES3 A;  5K14 B;  1VR6 A;  4MKB A;  3FCH A;  2R8I A;  2DR6 A;  1ICE B;  1SH2 A;  1V3R A;  5J1E B;  5M2P A;  1UMJ A;  2CQ4 A;  1N36 F;  4ECY A;  1RTJ B;  4FVC A;  2VB6 A;  2RS8 A;  4PYA A;  3UNY A;  1RP5 A;  1PO6 A;  1LFW A;  3MAA B;  2R2T A;  2K1R A;  3M6X A;  4KY3 A;  3KK3 A;  3RBZ A;  3S1T A;  1RYR A;  3UNG C;  4H4K C;  3UR3 C;  3I4H X;  2A1B A;  3PHT A;  3K59 A;  1Z2L A;  2P5V A;  4LSN B;  4A8Q A;  4YY3 F;  1U2F A;  3KMS A;  3JYT B;  1O8B A;  5B0G A;  1EIY B;  1VRQ C;  3VGT A;  2W8L A;  1CQM A;  4DUY F;  4DLE A;  4B3O A;  4K0K J;  3C66 A;  2K06 A;  4OHV A;  3TA0 A;  2MDA A;  1T9X A;  3MMC B;  2ROP A;  1RT2 B;  3CGI A;  2GC8 A;  1FNM A;  4FVM A;  2HZV A;  2KI2 A;  1REV A;  3SFU A;  1TP7 A;  3A13 A;  4UOF A;  5CAA A;  2AYM A;  3PVX A;  1NM2 A;  5H1S V;  1RAD B;  4PPZ A;  1XNQ F;  4QQB A;  3POT B;  1SC6 A;  2IBO A;  1S0M A;  2IVF B; 
#chains in the Genus database with same CATH homology
 1TUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...