1TUXA

High resolution crystal structure of a thermostable xylanase from thermoascus aurantiacus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
301
structure length
301
Chain Sequence
AAAQSVDQLIDARGKVYFGVATDQNRLTTGKNAAIIQADFGQVTPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIRGHTLVWHSQLPSWVVSITDKNTLTNVMKNHITTIMTRYIGKIRAWDVVNEAFNEDGSLRQTVFNNVIGEDYIPIAFRTARAADPNAKLYINDYNLDSASKPKTSAIVKRVKKWRAAGVPIDGIGSQTHLSAGQGASIDAALPNLASAGTPEVAITELDIAGATSTDYVDVVNACLDVDSCIGITVWGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure at 1.8 A resolution and proposed amino acid sequence of a thermostable xylanase from Thermoascus aurantiacus.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords XYLANASE
total genus 116
structure length 301
sequence length 301
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1998-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tuxA00
3MV11 1KCKA 1V0MA 2ZE0A 4ACZB 1UD2A 1N82A 2DDXA 3WY1A 5A94A 2Q8XA 2GK1B 1MQRA 4UR9A 4UCFA 4TOQA 5BWFA 5D8ZA 1V03A 4AEFA 5A6JA 1JAEA 2ZWYA 1WCGA 4N0RA 3WBAA 2OWCA 3CHEA 2UWFA 4BA0A 1E73M 2J47A 3VNZA 4AC1X 4CU6A 2YA1A 1EDQA 5BXRA 4ATLA 3SCSA 2XSBA 1UWIA 3GXMA 1ISWA 3RMEA 2YL8A 5JIPA 1GJUA 2XG9A 1VIWA 1CGVA 4MDPA 1ISYA 3RM4A 2G8ZA 1PZ2A 1RH9A 1QW9A 2BY1A 4U2ZA 3WL1A 1UA7A 4EAMA 4JCMA 4J3TA 5CLTA 2C0HA 2BFGA 4JHOA 2YA0A 3AHYA 4UZSA 1XSIA 3K4AA 2EXOA 3VMNA 4Y7EA 3WFZA 1ZU8A 1QI4A 3WDQA 3BAJA 3M46A 2DSKA 1XHGA 1BAGA 2BHUA 1VB9A 1XCXA 1SR0A 5A8NA 4UQEA 3OA5A 4JFUA 1GNXA 1PIGA 4P8XA 4TTGA 1UWSA 1FFQA 3DHPA 1HKJA 2WB5A 5EB8A 1E6QM 2BV9A 1JFXA 3HJEA 2CKRA 1J12A 4P8WA 3W53A 2XWEA 1AQHA 5CJ5A 4TUFA 1LLOA 2CBUA 3AZSA 3K4DA 2CEQA 4PMUA 5GPRA 5E0FA 1V3IA 1VBRA 2VNCA 1H0GA 4H8HA 2V3DA 4D71A 1WNOA 1GHSA 1X6LA 2WLZA 1ITCA 2JF6A 4AIOA 5IHRA 1XD1A 1JXJA 4WLCA 5AC4A 3WL0A 4JFTA 1ISVA 2X2YA 3AHTA 3PZVA 1FH9A 1V6UA 1B3YA 3ZIZA 3MSDA 1GQLA 2Y8KA 2J25A 2X8RA 3AMLA 3SURA 4EK7A 2DT1A 4M80A 5M5DA 2VZSA 2FDMA 3W37A 3QHNA 1BTCA 2ZICA 4H2CA 1ISXA 5BRPA 3O9NA 4J3XA 1IT0A 2WXDM 3QOMA 3EYPA 5I24A 4DUVA 3OBAA 1J18A 2WW5A 3VD9A 4UFJA 2ZX7A 4LX4A 1UYQA 4W8BA 4PN2A 1ZJAA 4KGLA 1W2PA 2CXGA 3CH9A 3ZQ9A 3TONA 4BS0A 3OZOA 2GUYA 1GUVA 1OWQA 2OLHA 3AISA 3T2QA 1AQMA 3ZMRA 4W7UA 5KEZA 4JZ5A 1QOXA 1HT6A 3ARXA 1JZ4A 5AYBA 3WDRA 3TTQA 1BHGA 4GZEA 1I1WA 2CESA 4F66A 1C8XA 1WDPA 2A3BA 1VFOA 1ECEA 1S46A 2BVYA 2WBKA 3CUGA 3NYDA 1ODZA 1QHOA 3AZRA 2J74A 3CZ8A 4UOZA 1K9DA 2XIIA 3ARRA 1C8QA 1GCYA 2J8GA 5EMYA 3FAXA 1BLIA 2J78A 4HTYA 1ITXA 1XH0A 1JDCA 2PBGA 4Z2GA 1U30A 4UFIA 3N1AA 2E9BA 1RP8A 2BS9A 3DYMA 3WMCA 5D9OA 1TE1A 1B3XA 1JZ3A 4WK9A 1W1TA 2EPKX 3MUIA 3OGSA 2XTKA 4E8DA 2QHAA 3EMZA 3S6TA 1KXVA 4AD3A 4Z2JA 5JBEA 3EBVA 1E6NA 2YL9A 4GZJA 1HNYA 3VX1A 1CLVA 3LPOA 3ZSTA 1FH8A 2CKSA 3VGGA 3GDBA 1TVNA 3AS2A 3F5JA 3RJXA 4FLSA 3WH5A 1AQ0A 3A4WA 3WH9A 3LPFA 4PUDA 1E6RA 1WAWA 4FMVA 4CVUA 2CHNA 4KGJA 1CYGA 2FHFA 1B3VA 3ZJ7A 3EMQA 3PZIA 1UD8A 3BLKA 3IAQA 3KL3A 4C7DA 4S3KA 1JDAA 1GZJA 2OYLA 3GTNA 4V28A 5A6BA 3N9KA 1UKOA 3CIVA 1XC6A 1UR9A 2G41A 3MUY1 1KGUA 1HVXA 3PZTA 5I2UA 2DSZA 2D3LA 4X0NA 5E09A 1GPFA 1M03A 4GKLA 4AYSA 4DWSD 4MNMA 4BQ4A 1OBAA 2J7FA 1KQYA 2Y8VA 4JFVA 4HPGA 4LGXA 3K8MA 1LL4A 3WBEA 1JZ7A 2WSPA 4ZFMA 3ALFA 4AD1A 6CGTA 3LMYA 3N18A 2G3JA 2DSWA 4JFWA 5EBAA 1NP0A 3BLPX 2DPEA 4HA4A 4MNLA 2QV4A 3WQ4A 1WZKA 5CGTA 3PBGA 1CWYA 3RILA 5ABEA 3W81A 2V3FA 3G6LA 2Y2WA 4OOZA 1U2YA 4MB4A 3RJYA 4XZBA 2CHOA 5AC5A 1B3WA 3EDFA 2F2HA 4M8UA 1HF6A 4IPNB 3BMVA 3VDHA 3RIKA 3WF4A 5E6ZA 1YQ2A 1V6WA 4LPCA 2IUZA 3EDJA 1ZL1A 3UR7A 4UTFA 2J7GA 4HZ8A 4KRUA 2QLYA 3WQ6A 1MWOA 3T08A 2WMGA 3GNPA 4M81A 2BY0A 4NI3A 3CPUA 4BF7A 2RGMA 2QMJA 1E72M 2ZUSA 1U33A 4UQDA 4HMCA 3S2CA 3BAYA 3PZUA 2VI0A 1WPCA 3AIRA 2WHMA 2WKGA 4CKQA 3AMGA 1E6PA 3WUFA 1PPIA 2NT0A 3GXIA 2O9OA 1QNQA 3AOFA 1NOUA 4CCEA 1OD0A 2F61A 3WD3A 3U7VA 1C93A 2GFTA 3UG3A 2O9RA 3SCRA 1V3MA 7A3HA 2GVYA 1QI2A 4J3VA 3TP4A 1UWQA 2ZXAA 3OG2A 3FN9A 4AZ7A 4ATDA 3N13A 3WH7A 2D24A 4UFHA 5CGMA 1RP9A 5I77A 2QF8A 3CUFA 3MANA 3QGVA 4W5ZA 4LQ1A 1NWUA 1GVYA 2G3IA 1HP5A 4DWSA 1OIMA 2G4FA 1EQCA 1DWJM 3SEPA 1LF1A 1H41A 4P7QA 2IXUA 4YHEA 4CU7A 3UERA 1UZ4A 4KH2A 2PF0A 4M24A 5BRQA 3AS3A 1E6SM 2WMJA 1JNDA 2BY3A 5IXEA 2WVUA 1I1XA 2BVTA 1AVAA 2BXZA 1CIUA 4PCTA 5HPCA 3K46A 1JZ5A 1UD3A 5A6BD 2EQDA 2WK2A 3AJ7A 1UR8A 4PBGA 4PMYA 2OSWA 3SCUA 1QNPA 5CSUA 3TTSA 3CTTA 3ARQA 1WDRA 2DIJA 1IV8A 4OKDA 4J3UA 3BMWA 4D6FA 2ZX6A 2CBVA 1VF8A 4HPHA 3EDDA 1M04A 4Z2LA 2W62A 3ARYA 4CVWA 1BSIA 1W3HA 2WM0A 1NQ6A 3A3HA 4QCFA 3VDCA 3AXIA 3WUBA 3AIEA 2JEQA 3GXDA 2Y4SA 3QHOA 3VKKA 4P7RA 4CN4A 1E70M 2JIEA 5HBFA 2V3EA 3AYSA 2AAAA 3B8SA 2WMFA 1TA3A 1UH4A 3PTMA 3AIUA 3WENA 5IDIA 1JYWA 1A3HA 2XM2A 4UQ9A 1CECA 4JCLA 4W84A 2BXYA 4QAWA 4CGTA 3AIBA 3PZGA 1JFHA 4GPNA 5GNZA 1EH9A 2ZWZA 1WKYA 1XSJA 3VNYA 2YL6A 3VIMA 3W6LA 1UR2A 4LYRA 1L8NA 1PBGA 2D0GA 2OWWA 1US3A 4J7RA 1OD8A 4MNKA 5CPQA 4PEEA 2XVLA 3WD4A 5E70A 3UCQA 3BSGA 2UY4A 1JAKA 2DT3A 1M53A 3KEHA 1Q6GA 2D23A 3AS1A 1HJUA 1XGZA 1UHVA 1VRXA 2WSKA 2Y24A 5ABFB 2XVPA 3DHUA 1JXKA 1UKPA 5LA2A 4MDOA 1C91A 1VFMA 2ZUVA 2X0YA 1JI2A 1UUQA 3HMCA 1CXEA 3BGAA 4UOJA 1SMDA 3NJ3A 2VZOA 1KCLA 2ZUMA 1F4AA 1GQIA 4D6EA 3VGEA 1W1YA 5I3DA 3OLDA 1KWKA 4B9YA 2HISA 3ARUA 3IJ8A 2PB1A 1D2KA 3VD4A 1E0XA 4W8LA 1EO5A 3BCDA 3K8LA 3GH4A 1XSKA 2J75A 2FHCA 4UZUA 4RE3A 2ZOXA 1V08A 3CMJA 3ZO9A 3AXHA 1W1PA 2J7DA 4NRSA 1H49A 5GNXA 4AIEA 2VZTA 1E0WA 2CETA 3CUJA 8A3HA 2CYGA 1C7TA 5JBFA 5I5RA 3N17A 1JF6A 4BQ3A 3WQ8A 3OLGA 1LG1A 4FK9A 5CPTA 4JKKA 3ALGA 3ZT7A 1HL9A 2VUYA 3ZM8A 5F7UA 4YN5A 1V3HA 3VUPA 3SIMA 4B16A 3M6DA 4HA3A 2XFFA 3WDHA 2CITA 2V38A 2J8FA 1QNOA 5AYIA 3WEMA 1OSEA 4OUEA 4CU8A 1W9BM 3NDZA 1V6VA 4Z2KA 1VEMA 1J0JA 4PMVA 3IK2A 2VO5A 3UESA 4AY1A 2XGIA 3I3BA 2WVSA 4GI9A 1YHTA 6TAAA 1MVYA 4XB3A 2XFRA 4LXFA 3ZJ6A 1MXDA 2QPSA 3B9AA 3CZLA 4TX8A 1E55A 2ZX5A 3NSMA 1CXKA 5FOOA 1UWUA 3OGRA 3NDYA 2WHLA 9CGTA 4U3CA 1XH1A 3AIVA 1K9TA 2W4XA 3CBWA 1KBKA 3N12A 4H41A 4JL2A 4NZCA 1W3LA 1MFVA 2X09A 1EO7A 4XUYA 1EOKA 1KXHA 1CXLA 1H11A 4JHZA 2GDVA 1TUXA 3ZT6A 5CLWA 3MUZ1 1G5AA 3FNDA 3AMKA 4UFKA 1G1YA 4P7NA 2VCBA 1UD6A 2D20A 3KWXA 4BZYA 1KXQA 3WSUA 5I6SA 2TAAA 1HKIA 1GORA 1IZKA 4AWEA 1E40A 3D5HA 3II1A 4QLLA 3WN6A 1PX8A 3WF0A 2J77A 2WCSA 3WDIA 5DMYA 3ARVA 4DUWA 3AHVA 5C8BB 4QLKA 3WDJA 4GO8A 4ML4A 5CXPA 1Q6DA 5JBDA 3W0KA 1TCMA 2VX4A 3BCFA 2D0HA 1KQZA 3CHDA 3T09A 5M3WA 4GINA 3WD0A 1CXFA 3L2MA 5DEZA 5BXTA 1LQ0A 3VD3A 3EMCA 1ZBVA 2JEPA 1V0NA 1LWJA 4A4AA 1KWGA 4NRRA 2OYKA 3UR8A 1OGBA 4BQ2A 4M56A 3JUGA 2XVNA 3NSXA 1UG6A 1K6AA 2J7HA 1B31A 1NOFA 4TVDA 4JFSA 2YL5A 3ARSA 4WF7A 2WMKA 4OIFA 1HJXA 4AD4A 5BYWA 3CUIA 3W38A 4IUGA 4D6CA 2VCAA 1QI5A 3U57A 4JKMA 1SYTA 2PC8A 3CZGA 1CXIA 4M1RA 3VDBA 4W93A 3OZPA 1MW2A 1QHPA 2IXVA 2WZIA 4FLQA 3GZAA 1JD7A 1J10A 1WZLA 1E4NA 3BAWA 1O6IA 4TVCA 2EPMX 3AZTA 3WD2A 2CERA 4HMDA 2XM1A 4J27A 3APGA 3NCOA 2B31A 8CGTA 5ABGA 4PSRA 3LPGA 1BFNA 3BAKA 1E43A 1J0ZA 1QW8A 1C92A 4HU0A 1J0YA 1B1YA 3J7HA 3SUWA 4AW7A 3L4YA 3AIWA 4D1JA 2VVNA 1QBAA 1CZ1A 1OM0A 1GOMA 3VINA 4ACYA 1HJSA 2XWDA 1CTNA 2D1ZA 5I0DA 3VD7A 1JZ2A 4MAVA 1R7OA 1SMAA 3WQ5A 4HOWA 2GJXB 1HKMA 2WVTA 2E9MA 3ZJKA 4WJXA 1V02A 1BYCA 3IJ7A 5EFDA 3BXWA 1CGXA 4QFUA 4PMZA 2D3NA 3W4RA 5A6AA 3WNMA 4WKFA 1D3CA 1R8LA 4GIAA 3L4UA 2G3NA 1GONA 1W9XA 1C7SA 1E0VA 1WO2A 1NM9A 1BF2A 2VVSA 1AMYA 2WC3A 1GVIA 1CLXA 4WKHA 3TOPA 1UQZA 5DF0A 1W91A 2VOTA 5LA1A 2DSVA 4IPLA 4XX6A 1HN1A 1PX4A 2PWFA 4ZE5A 3AQUA 3A4XA 3WQWA 1UZ1A 2DT0A 1R87A 2ZXBA 2XVGA 3TTOA 4AZIA 4MPKA 4X0VA 1W9PA 2UY3A 4CD7A 2YBUA 4C7FA 1QVBA 1CGYA 4KRTA 2D22A 3ZOAA 3QR3A 1PIFA 4GXPA 1NP2A 4MJ4A 3WNLA 1JG9A 1ZJBA 4W88A 2J7CA 1J01A 3WNPA 1HVQA 1LL6A 3RCNA 2E8YA 1QI3A 5A6MA 3SCNA 3GBEA 3WH8A 1RPKA 4Q22A 5E9AA 2XFYA 3POHA 2WKLA 2PI6A 1NWTA 5A6KA 1QNSA 1EXPA 3AI0A 4MB5A 4D6HA 2WMIB 3WEOA 2YBTA 1E6XM 1KFWA 1W9DM 1BGGA 4H8VA 3THDA 1WP6A 5BCAA 2VQTA 1JZ8A 1GOIA 1V6XA 2VX5A 4ACZA 3VIOA 4PMXA 3SUSA 1MW3A 4F9JA 2WC4A 4H04A 4UQAA 4P8UA 4NF7A 2G3MA 2EPNA 4W5UA 4B15A 1JZ6A 2PWGA 1X6NA 5C71A 4KWUA 4IM4A 3FAWA 1FHDA 4HA1A 2XPKA 1JF5A 1UWRA 1OCQA 2J79A 3DYOA 4W86A 2YJQA 2EJ1A 4AZBA 3DECA 4W85A 1HJWA 1TFVA 3CO4A 5M17A 1VJZA 4MJ2A 3GBDA 1Y7VA 1XH2A 1JNEA 2WWDA 3VM5A 3FHQA 4WKAA 1XV8A 1FHLA 4P8VA 4RL3A 1CENA 1HL8A 3OIHA 1K9EA 1TVPA 1UOKA 4PTMA 5D9NA 1JD9A 2WC7A 3AIQA 5D9MA 1PAMA 1W9VA 2OSYA 3O2LA 1PEZA 1GQKA 2EEXA 2VZUA 3PZOA 1CGWA 1VBUA 2NT1A 1X1NA 5DFAA 4ZEPA 3PN8A 5A1AA 5CG0A 4D1IA 1ODUA 4B3LA 2UY2A 2CBJA 1KGXA 3W28A 4CUCA 1UKTA 2ZIDA 1QHZA 2W66A 1GW1A 1E4IA 3RM9A 4ZENA 3F5LA 2E0PA 2DIEA 1DTUA 2W61A 4TX6A 2YDSA 1V02E 4R5EA 1JIBA 3KE0A 3WEZA 4W89A 5A8OA 1B0IA 1UH2A 1KB3A 3PZQA 4UFLA 3IANA 2ZUTA 3ZT5A 3FHAA 3ZR5A 3GM8A 2XSAA 2GJXA 4F8XA 4CD8A 1XRVA 1RD6A 1H1NA 2X1IA 1UH3A 3N04A 1FA2A 1V3KA 1WDSA 1MXGA 3AROA 5D4YA 3VIKA 3WDPP 4PMNA 1EA9C 2YLLA 2E3ZA 4GZIA 3NUKA 1UD5A 5IFPA 3AHXA 3EDEA 5A2BA 1OGSA 1SFSA 4DM1A 1Q6CA 4R27A 5CSYA 5IFTA 4H7VA 4PTVA 1BYAA 5I78A 2D2OA 3GH7A 2VQUA 3BAXA 1V0KA 3VGFA 2NSXA 2YLAA 3AXXA 2E4TA 4OOUA 3W25A 2E40A 4CD6A 2W5FA 1VAHA 2W92A 3WUEA 4E2OA 3VX0A 4D6IA 2A3AA 3SUVA 4LYPA 3SCPA 3VIJA 1PJ9A 4UQCA 3VO0A 2GK1A 1R86A 1E3XA 3B9EA 2PWDA 1VFUA 1WE5A 3CHFA 5JUVA 2VC9A 4FLOA 4CD4A 4HZ7A 2WMIA 4DUXA 5HDRA 1OGGA 5FIPA 1BG4A 3UG5A 3VGDA 3WQVA 1HXJA 4E8CA 4CCCA 3SCTA 3OGVA 3W24A 5JIWA 1GOKA 4DWSB 5A8MA 1JI1A 1IZJA 1W3JA 1Q6EA 4CD5A 4U5IA 1W9UA 2W67A 3PZMA 4PRWA 2DT2A 1UKQA 1EDGA 3MKKA 2WPGA 1G9HA 3FXYA 3VPLA 1XD0A 2A3CA 2ZXDA 3N11A 3I3EA 4J28A 1W3KA 3MS8A 2XHYA 2DQXA 2HVMA 3CZKA 4AD5A 2QMKA 3U5UA 1ZBCA 4E4PA 2VZVA 4FF5A 7CGTA 4U2YA 1E6ZA 2YDRA 4TXEA 3FW6A 1ZB5A 3TTYA 6A3HA 5CPSA 4F9DA 3WUGA 1NOWA 4EE9A 5A6LA 5LYRA 4U31A 4PTWA 1WZAA 2WNWA 1OINA 2FGZA 3QHMA 4CN6A 4H8UA 1BYBA 4AD0A 1BYDA 3FY1A 3MU7A 3AICA 3VOCA 3THCA 2JE8A 5TD4A 1Q4NX 2JALA 2ZXQA 3TA9A 2YKKA 1V3JA 4L4PA 3GYCA 1CBGA 2YOCA 2YA2A 1I75A 1D7FA 2VURA 3T2PA 4D6DA 1NARA 3L4TA 3T0BA 5BXPA 1EHAA 2DH2A 3AS0A 1R85A 2VTFA 3EDKA 3UETA 1BVNP 3KL5A 3ARPA 4XZWA 1UWTA 4PMQA 5KZ6A 1V0LA 4PMOA 1FFRA 3WNOA 1O7AA 1PZ3A 4MADA 2EPOA 4A3YA 4EANA 4PTXA 2PBOA 2VX6A 3VILA 1M01A 4J3WA 1TG7A 4PUEA 3VD5A 2AMGA 1ZBWA 3MSGA 3D3AA 3WNNA 4AZCB 2FH8A 1EQPA 4W87A 4TTUA 1UD4A 1E71M 1FP9A 2WYSA 1CGTA 4IISA 3N15A 1DP0A 4URIA 3SUTA 1EGZA 5A8PA 1HJQA 4ATWA 4PMRA 3B9DA 1H5VA 2PWEA 3VMOA 4MB3A 1HKKA 1KR1A 4ZXLA 1HIZA 3WFLA 1H2JA 2X05A 4B9ZA 2ZX8A 4HZ6A 1XYZA 5I23A 3CZJA 4GQRA 3MV01 1KBBA 3F4VA 1QI0A 2ZX9A 3HN3A 2EBNA 3KL0A 4U5KA 4W7VA 1DWHM 4GI6A 1F4HA 4D72A 3T0DA 2XIBA 2F8QA 2XUCA 1DWFM 1CPUA 3M7SA 1JL8A 1E3ZA 4KMQA 2PWHA 2VMFA 2EPLX 4UOQA 1BG9A 3WELA 4S3JA 4AXNA 1TMQA 2WHJA 2VT0A 3KZSA 3UG4A 4HOXA 1XCWA 3VIHA 1XYFA 3WH6A 3O6AA 1B3ZA 1OIFA 3U7BA 1WB0A 3CGTA 2FGLA 4QCEA 1EDTA 1UA3A 3MMUA 5D9PA 3VTRA 1V6YA 1E4MM 1GOQA 1DWAM 3CZEA 1UKSA 3WF1A 2YIHA 1J0IA 5DT5A 3W82A 1MW1A 2W63A 2V5DA 3GNRA 1TA3B 1QNRA 1US2A 2J4GA 4B3KA 1OT1A 5C70A 4MB1A 2WHKA 3AHZA 3MUAA 1JYNA 3A4AA 5HNNA 1G01A 4MAZA 4UQBA 4MNJA 4YPJA 3OLEA 5M03A 3VIGA 3E1F1 4J3SA 1E4LA 1BGAA 1TR1A 1ESWA 3VDAA 3DYPA 3W27A 3VU2A 3WNKA 5FD0A 1H4PA 3SCWA 2WZHA 4D6JA 4V27A 5A2CA 3QOKA 2WWCA 3RM8A 3A47A 4HP5A 4PCSA 1B30A 2OWXA 2JF7A 4PSPA 2BHYA 1ZS2A 3W6MA 4AZGA 4AZ6A 4U33A 2V5CA 1VFFA 4JL1A 4WSKA 3UEQA 4HU8A 4W8AA 1TZ7A 2BNJA 4QDMA 3WKZA 3AYRA 4MTVA 4DM2A 2WANA 2CBIA 1CGUA 1LG2A 3RDKA 4EKJA 1E1FA 3AMCA 4OBSA 4OJYA 4RE4A 3VGHA 3ARZA 4AD2A 1VEPA 3BC9A 1EOMA 4LYQA 2VRQA 2CNCA 2WBGA 3GNOA 1VEOA 1VENA 3W26A 3PZNA 1UR0A 2O92A 3SUUA 4P7LA 3M07A 4RE2A 4CCDA 4UFMA 1DWGM 1UQYA 4L4OA 4WIWA 4P7OA 1CDGA 4JAWA 2GJRA 2VL4A 5HPOA 1GOWA 2FH6A 3L4XA 5GNYA 1MQPA 2O9PA 1JGIA 2QPUA 2EO7A 2Z1KA 3VIFA 3SCQA 1A47A 1MYRA 3F5KA 5DT7A 1W32A 3WD1A 1HJVA 2JFEX 3HU7A 1JDDA 4HMEA 5FKYA 2CPUA 4AZCA 2WLYA 3MMWA 3PZ9A 4C7GA 3RO8A 3ECQA 2DEPA 3GXFA 3PTKA 4UNIA 5I79A 3WF3A 2VRKA 1NWSA 4F79A 1LJYA 4AZ5A 2UY5A 4XV0A 3ZSSA 4NSBA 2VR4A 3WMSA 1GQJA 3ARWA 3LPPA 3CMGA 1OB0A 4OZOA 2XJ7A 3PTQA 4OBRA 2W91A 1UR4A 2VR5A 1B90A 2E8ZA 3L4WA 4D6GA 3NIYA 4DWSC 1CEOA 1G0CA 4Q7NA 3BAIA 1L0PA 7TAAA 4V2XA 1E15A 1P6WA 1NWRA 2DGAA 5HOSA 1DHKA 2BVDA 3VIIA 3VMPA 4AZHA 5A3HA 4FLRA 1H0IA 3MMDA 4AEEA 5CQ1A 3AMDA 1G94A 3MO4A 4ZXOA 2RGLA 2V3GA 5LA0A 2D0FA 1H3GA 2XGBA 1C90A 3CHCA 3CLWA 2VCCA 5ABHA 3OLIA 5ECUA 1KGWA 2BY2A 2ZUUA 1LWHA 1Z32X 3L2LA 4AISA 3A6OA 1BPLB 2WZEA 1EHNA 1B2YA 5A6SA 5FL1A 4GO9A 3CUHA 3SCVA 4M29A 2VX7A 4TVUA 1QPKA 1DEDA 5BROA 1J9YA 4WSJA 4AMCA 5FCZA 2E9LA 1KR0A 5A95A 1MW0A 1C3FA 1WDQA 2DSUA 2ZUNA 3K1DA 1C8YA 5BXSA 3RPMA 2YDQA 2J7BA 2CIPA 1CNVA 1W1VA 1E1EA 3NSNA 5E6YA 1E5NA 1GJWA 2GJPA 3ARTA 5AY7A 5GQBA 3ZR6A 2JIWA 2DH3A 3W29A 2OYMA 2OSXA 1J11A 5CZKA 4HOZA 2AOSA 2WCGA 5A69A 2J7EA 1B9ZA 2WMHA 3POCA 1FH7A 5E0CA 1VJSA 3U5YA 1NH6A 3T2OA 1KXTA 4YHGA 5A8QA 3VVGA 2C8NA 4JKLA 1UR1A 3IAPA 1QBBA 4A3HA 1OT2A 3PHAA 3VIPA 1BQCA 3I3DA 4X9YA 1PX3A 1FP8A 2Z1SA 3VGBA 1R7AA 3WIJA 2XYLA 3OB8A 2WVVB 2WCAA 2XVKA 2BHZA 3GH5A 3L4VA 4CN1A 1E56A 3BSHA 1DWIM 4N42A 5EFFA 4AIUA 4BCEA 4GQQA 1J0HA 2NW0A 1E9LA 1GHRA 1E5JA 3IJ9A 1HP4A 3DC0A 1EIBA 1CXHA 2FHBA 4W7WA 2Y5EA 2A3HA 1FOBA 4BQ5A 5ABFA 1JYXA 1HX0A 4M82A 2VJXA 3VM7A 4GI8A 1MFUA 3T0AA 3L4ZA 1M7XA 5DO8A 2J62A 3AFBA 4K68A 4QLJA 2ZUWA 2A3EA 3G6MA 5D8WA 3K8KA 3ZJ8A 1JYVA 2WVVA 1BVZA 5FL0A 1GOOA 3SCOA 1WZMA 2C7FA 5A2AA 1Q6FA 1ISZA 4JIEA 1LL7A 4PYSA 1W2VA 2CCRA 1V3LA 3WF2A 2GDUA 4PMDA 2X0HA 4ZE4A 2VRJA 2WAGA 3BH4A 5HXMA 4Z2HA 1K9FA 2ESCA 2O9TA 2MANA 3WMBA 2GSJA 4QP0A 1ZBKA 1J0KA 5IHSA 4U3AA 1MQQA 1H09A 4Z2IA
chains in the Genus database with same CATH superfamily
2OEJA 2OELA 1JJKA 2ZE0A 3MV11 4MUPA 1UD2A 4H9MA 2DP3A 5FJUA 3LU2A 3GDLA 5BWFA 1PKMA 4N0RA 2OWCA 1B9BA 3VNZA 4DQWA 4CU6A 2YA1A 5LXXA 5BXRA 4ATLA 1QW7A 2ZE3A 2FVLA 1UWIA 3T7VA 2YL8A 4KEMA 1VCVA 4L4MA 3S0CA 5JIPA 2LLEA 1X39A 2ZZ4A 2XG9A 3DFQA 3I7QA 5DANA 1CGVA 4ZOCA 4Z0JA 3RM4A 4HNTA 2TPSA 4Z1YA 1UA7A 4EAMA 3QW4B 1QAPA 2C0HA 4JHOA 2ACQA 2XIMA 2CC0A 1NDZA 4UZSA 4KEZA 1XSIA 1B54A 3RNDA 2EXOA 3VMNA 1ZU8A 3KW3A 2DZTA 1MSSA 5D03A 2VD9A 4QDWA 1KBLA 2CZFA 4F3HA 5ECVA 1SR0A 5A8NA 2A6LA 3OA5A 3H7UA 2A6NA 4JFUA 5KZMA 1ADDA 2DVTA 1PIGA 1FFQA 4C5ZA 1H7NA 4KFNA 4IX2A 4FS9A 2NUWA 1YTDA 1FWCC 1JFXA 1PSCA 3W53A 1PIIA 2OX1A 2Y62A 2Z2UA 2DUXA 4X22A 4TUFA 2CBUA 1Q8JA 1W5PA 2CEQA 4PMUA 1SJBA 2VNCA 4FNRA 3R10A 2V3DA 1NQKA 4PGLA 1WOBA 1Z6KA 3FA4A 4INFA 4AIOA 5AC4A 3WL0A 1ISVA 3TFXA 3AHTA 2F7FA 5U7SA 2VWSA 4UR7A 2Y8KA 1F3XA 1Z3NA 4WJEA 2VZSA 4QS5A 4NYUA 1H7OA 3W86A 3W37A 2CZVA 3FJNA 1ISXA 1KFEA 3OPSA 1IT0A 4XZNX 1OFOA 3QOMA 1R46A 2WW5A 4UFJA 1XPGA 1RUSA 4TV6A 3TNBA 3QC0A 4HNVA 4O10A 4M0XA 3ZQ9A 1TPC1 2GUYA 3A12A 3TKFA 4DBUA 3BTNA 4ZOAA 1YRRA 1JZ4A 1WA3A 3WDRA 4F0MA 4Q8PA 4DXXA 1DJNA 4LB4A 3EWUA 2PEVA 5D02A 2WBKA 4IIEA 1YLVA 1Y8BA 4DNHA 3NYDA 4LCQA 2J74A 3CZ8A 1KBJA 1C8QA 3APTA 2OU4A 1K1DA 1TO3A 5EMYA 6ENLA 3RG6A 4L7ZA 1XH0A 2R82A 2FPVA 3K13A 1RP8A 2BS9A 5D9OA 3LG3A 3ZWTA 1TE1A 3G18A 1B3XA 1JZ3A 3NL2A 4LVFA 3IGHX 2Y7FA 3VUSA 2WNNA 2XZ9A 3M4HA 2HMCA 2C3ZA 4DF2A 3S6TA 1E6NA 4ROPA 3VX1A 3NO5A 2O4MA 2BOFX 3RJXA 1J6OA 1AQ0A 3WH9A 1Q6OA 3VZXA 1WAWA 3U6WA 1LRTA 1WXZA 5C2GA 2QZRA 4KGJA 1KM0A 3G1YA 4OUIA 3RGTA 1O5QA 2JQXA 3EMQA 1Z7AA 4K38A 4LV9A 1GK8A 1Y5VA 3W7PA 3N9KA 5FF7A 3USZA 3T4CA 1A80A 5LNRA 1XC6A 2PLKA 1UP2A 2PU0A 4KT2A 1GYMA 4Q6XA 1KGUA 3ORWA 2GZXA 3LV6A 4O1FA 4GKLA 4QG8A 4BQ4A 1OBAA 3NOYA 4FNTA 3GRIA 5EPDA 3WBEA 4PUNA 4ZFMA 1TPWA 1QOQA 1KCXA 3W2MA 2WJDA 4EXQA 3ES8A 2DSWA 3AALA 1QWKA 4IMFA 1GVRA 3CTLA 3WQ4A 3KP0A 1WZKA 5CGTA 3G1DA 5ABTA 4JQ3A 3PPFA 2V3FA 3WLKX 4OOZA 1UJPA 1FWNA 5AC5A 1B3WA 3EDFA 5CC5A 1HKWA 2W9MA 3CV6A 3WF4A 2HNHA 1YPIA 3EDJA 3UD6A 1XWYA 4C1NB 2QLYA 3WQ6A 3MP3A 2X16A 4M81A 1TMLA 2RGMA 2QMJA 1U33A 1GKRA 4UQDA 3DFPA 3LNPA 1IXQA 3BAYA 5C2XA 3IIVA 2GUUA 3SAZA 4EXBA 1YX1A 3AOFA 3S5ZA 1QNQA 4K8HA 3KCJA 3GS6A 5LIXX 1XFCA 4X3ZA 2GVYA 2P0OA 5LIUX 1UWQA 3PB2A 3FN9A 4AZ7A 4DBDA 4LNYA 1DJHA 2D24A 4UFHA 3NGJA 1YBQA 4PR4A 2QF8A 3CUFA 1XLGA 5A5WA 2CLMA 5FJPA 2YXGA 4GQBA 2XIQA 1GZGA 1OCJA 3HPZA 5DN1A 1A50A 1NDWA 3MUXA 1LF1A 3GIQA 2IXUA 4LU0A 4FB7A 2PP3A 3DAQA 4Z08A 1E6SM 5IOBA 4MYAA 3KDOA 1RBAA 2WVUA 2BXZA 5CAHA 4PCTA 2PDPA 4QXIA 1ZJHA 1UD3A 2WK2A 3AJ7A 4YCOA 1TRIA 4PBGA 4PMYA 2OSWA 3LTPA 4QBXA 1QNPA 5CSUA 1ZFJA 3TTSA 2I9EA 3ARQA 4OKDA 3QRHA 4HSHA 4YWIA 4D6FA 2ZX6A 4D8ZA 1ZAIA 1M04A 3ENLA 4Z2LA 2W62A 4CVWA 1W3HA 3OODA 4MY9A 2XU2A 3A3HA 4LRSA 1DJZA 4K37A 3WUBA 3TSDA 1R2TA 4AQLA 3C3NA 2Y4SA 3QHOA 3NFUA 3LXCA 4P7RA 3UZJA 1E70M 2AAAA 1TA3A 1UH4A 3PTMA 3AIUA 3QPZA 4CCZA 3HQ1A 3GG7A 2PTYA 3VABA 1F9CA 1F8IA 2WZTA 3DHFA 3DUGA 1CECA 3NXFA 4MKNA 5DQPA 3OOQA 4W84A 5I09A 1RXOB 1JFHA 2YXOA 2NLYA 4Q8NA 1WKYA 1XSJA 3MVIA 1L6WA 3W6LA 3PWGA 2E09A 1XYCA 2D0GA 3TZFA 1F6YA 4KFOA 1OD8A 4C6LA 3HM7A 3CWOX 3WD4A 4L1WA 3KEHA 3DERA 4ZL1A 2D23A 1UHVA 1VRXA 3PJXA 2Y24A 5BW6A 3IV8A 6PTDA 1DJQA 1F07A 2XVPA 1OG6A 4I5RA 1QK2A 4MDOA 1C91A 2YDAA 3TROA 2X0YA 4O18A 3VNJA 1X8FA 3TV8A 3HGRA 4RJEA 1QO2A 1S2WA 2ZUMA 2OB3A 3P6LA 3VGEA 5AHMA 3OLDA 4B9YA 2HISA 3LHUA 3LQGA 1D2KA 3ANVA 3BCDA 3K8LA 3BV4A 3GH4A 1XSKA 2FHCA 4HKPA 3H55A 3AXHA 3L0KA 5D05A 3SADA 3S1XA 3LENA 1I0BA 4MWAA 4M6VA 2CETA 1XGEA 2CYGA 2YGYA 1XIMA 3N17A 1JCMP 1PYMA 3WQ8A 2TMDA 4FK9A 5CPTA 5E1QA 4JKKA 3ZWSA 3ALGA 1I2QA 3ZM8A 1LOLA 5F7UA 1V3HA 1PCKA 4HJWA 3LB0A 4LALA 1P4CA 4FF7A 3M6DA 4HA3A 4RE0A 3CIXA 1A5MC 3WEMA 5EA9A 4RNFA 1L6FA 1UOZA 5C9RA 4OUEA 2PPGA 3U4AA 1EP3A 1VEMA 1ZZMA 1G4SA 3IK2A 2VO5A 3UESA 2XGIA 3I3BA 5ENLA 6TAAA 1ZCOA 3RLVA 3VC6A 4LXFA 3ZJ6A 3N3MA 3B9AA 1E55A 3HZ3A 2V63A 2X1TA 1UWUA 3OGRA 1JUKA 4Z1CA 2WHLA 2QT3A 2GJNA 4XZHA 2NV2A 3OVRA 2RFGA 3S5NA 1FUYA 1KBKA 4H41A 1TSIA 1B4KA 2X09A 3P8IA 2YFOA 5HUPA 1CXLA 1MEIA 4WSHA 2GDVA 1AQFA 3TAOA 5CLWA 3MUZ1 1G5AA 3AMKA 3R89A 2VCBA 2D20A 3KWXA 1EC8A 1KXQA 3KVKA 5H2ZA 4IP4A 3INPA 2J88A 1HKIA 1GORA 3CYJA 4JTAA 2C1IA 3FKKA 4QLLA 1E9IA 3KUMA 3WDIA 2DJXA 3U2ZA 4NNCA 3V35A 5C8BB 4GO8A 1QNVA 4C6BA 5D30A 1TCMA 2FJUB 3PUDA 1KQZA 3CHDA 3W1XA 3A3WA 3WD0A 1C9DA 3L12A 3N73A 1LWJA 1EJTC 2FIQA 5K2ZA 1IYXA 1XQKA 2OYKA 3ZYZA 1OGBA 1RALA 4MWAD 2XVNA 1S2TA 1NOFA 3H70A 5FJOA 5DMMA 4A29A 5C5YA 1KFBA 4JY9A 1HJXA 3WYZA 4AUBA 1R9YA 1DVJA 1FHVA 2KX9A 4ZQRA 2VCAA 1QI5A 1UW9A 1XLLA 4AX6A 3WJSA 4JKMA 4JTHA 2E5DA 1SYTA 3NQEA 4M1RA 3P82A 1PL9A 4FLQA 3ITOA 2OO6A 3UY7A 3LXAA 3MJYA 5AB3A 3AZTA 1ZPTA 3R25A 5DY2A 2XM1A 1FWFC 3APGA 3URBA 2B31A 4PSRA 2XH7A 4ZB0A 1TX2A 1DL3A 1CI1A 1AJ0A 3VKCA 1J0ZA 4KIEA 1XS2A 3KTSA 2GPTA 3U3HA 3AIWA 2F6XA 1T96A 1QBAA 1CZ1A 1TR9A 1EX5A 1GOMA 2WM1A 4QEHA 1NSJA 3M6YA 1R7OA 3UA3A 4HOWA 5RUBA 2GJXB 4ICCX 2VGFA 3KZPA 1A3WA 4AXKA 5EFDA 3BXWA 3G0SA 4IMDA 4TMBA 4F48A 3KBJA 4B5WA 5PTDA 2JBMA 1LBLA 4NNAA 4WKFA 3M0LA 3L4UA 1AW1A 2G3NA 4IFRA 1XLHA 1WO2A 1FWSA 4J40A 3I6TA 1NM9A 3W88A 3TWAA 5GVJA 3EPMA 4WKHA 4DJDC 2OLAA 3CXOA 1VD6A 1W91A 2VOTA 1VBGA 4CQ8A 3EEGA 4Q4PA 1OYCA 2J6XA 1PX4A 4FA3A 3A4XA 3WQWA 3TYDA 2DT0A 4OECA 1QUMA 1UB3A 4ZODA 4IGSA 2ZXBA 4GFSA 4AZIA 2Y7EA 4MPKA 4ERAA 5CJNA 4CD7A 1WOAA 4C7FA 3PWAA 2RHGA 3VKAA 4C1LA 1QWGA 4KRTA 2E28A 4AYGA 2D22A 3ZOAA 3KBNA 1TV8A 5CZ0A 2OKTA 2J7CA 3SCNA 2PGFA 2Y7GA 1RVGA 2XIJA 1RJRA 4DJEC 2ZC8A 4ZBCA 3MY9A 2PI6A 3E2RA 2RUSA 3AI0A 4D6HA 3B8DA 2YBTA 3MW7A 1OVDA 4H8VA 3W1PA 1WP6A 4XKYB 2ZYFA 3KOZA 4R3UA 2DZVA 1V6XA 3REQA 3VIOA 1T41A 3CT7A 4H00A 2V69A 4PZVA 4NF7A 3VKDA 4B15A 2EPNA 2PLMA 5C71A 1T99A 1FHDA 3LV5A 4NAFA 2BASA 4W86A 2XPKA 1JF5A 1OCQA 3UGRA 5K3VA 4X60A 3NEVA 5KZDA 1I2NA 3ZXWA 5M17A 3Q58A 3W74A 1VJZA 2WPBA 2YCJA 4MJ2A 3GBDA 3HURA 3VM5A 3FHQA 1XV8A 1TPFA 1VYPX 3B8TA 1CENA 1HL8A 3OIHA 3OA3A 2PRLA 3ICJA 1UOKA 1R30A 3H2EA 5D9MA 1W9VA 3O2LA 4F0LA 1PEZA 2VZUA 3PZOA 3KBVA 1CGWA 1X1NA 4ZEPA 3PFRA 4M51A 4KS0A 1NDVA 5A1AA 1ODUA 4QEEA 2UY2A 1VS1A 4H4IA 2ZIDA 2W66A 1GW1A 3I65A 3EPNA 3MUCA 1V6TA 1GTHA 4TX6A 1V51A 3LM7A 3QZ6A 4LT9A 3SGZA 3N6JA 5T8GA 3MKVA 1TUFA 1TQJA 2V0TA 4FOUA 3PZQA 3R0DA 2IKGA 5HR6A 3R8GA 4O4WA 3ZR5A 3GM8A 2GJXA 5AHIA 3IGSA 2ISFA 5BNKA 4PCFA 4FOKA 1M9HA 4ZTXA 5D4YA 2HVOA 3TQKA 3HF3A 1GPWA 1VFSA 4NAEA 1FDYA 5A2BA 4B2DA 4RW3A 4C6OA 3LYEA 4R27A 5AOUA 3KRBA 5CSYA 3S83A 5IFTA 2PDBA 3GH7A 2VQUA 4GVIA 1A5KC 2DIKA 1S2VA 2YLAA 2VGGA 1ZTVA 1V77A 2Z29A 4CD6A 2A21A 4AF0A 2W92A 1QDSA 4E2OA 5HJLA 3DZ1A 3CEUA 4KWVA 4RCXA 3SCPA 3TR2A 4DI8A 4GVHA 2C18A 1R86A 2QJJA 3B9EA 2PWDA 3UZYA 4Q8TA 4JTCA 4C6KA 4A3UA 5JUVA 7ODCA 4FLOA 4M7SA 3NL6A 3UG5A 1XRTA 3SCTA 1P0NA 4DWSB 5A8MA 4B5SA 3Q2DA 1H5YA 4DEFA 1IZJA 1KFCA 2GYIA 3WBWA 7REQA 1W3JA 3GK0A 1Q6EA 4NZ3A 4CD5A 3NVDA 1XJBA 1EDGA 2VGBA 3MKKA 1XD0A 4N9EA 4KF1A 4Q4SA 3FOKA 3N11A 3R1ZA 3LCHA 4DZ5A 1XLAA 3WLJA 2QIWA 3O6CA 3MS8A 2HVMA 3CZKA 2HDJA 4PBEA 1ZBCA 2RKXA 3UW6A 3B03A 3BQ6A 2PMQA 3GNNA 1P1MA 1DIEA 2YDRA 4IJRA 4RDVA 5CEWA 3GTIA 6A3HA 3H26A 1UMYA 2BMBA 3NQGA 4EE9A 4YTTA 3U2EA 5LYRA 3L66A 3ATZA 1X1ZA 4US5D 1ECQA 2WNWA 4XO7A 1OINA 2HXTA 5LIWX 4I6KA 2Q09A 4H8UA 1BYBA 4S3GA 3L5AA 1GVSA 4AD0A 1BYDA 4Y9PA 3TYEA 3MU7A 4IPIA 4I8DA 3THCA 4IJBA 5TD4A 2JALA 3BOFA 3VNDA 4C6MA 4IQLA 5I7GA 2ZZ7A 2HTMA 3PNUA 5K7JA 1I75A 3QMTA 3L4TA 1N8WA 1QPQA 3BW3A 3AS0A 4KCVA 3D3FA 3GUGA 4O53A 9XIAA 1S3TC 3KL5A 5LSMA 4PMQA 2IPWA 5KZ6A 4B2DD 4RXFA 1FFRA 1O7AA 2HZGA 1DQUA 3CAWA 3LN3A 3PBMA 1FWDC 4JTRA 3ZVHA 2PBOA 4H3DA 4NYYA 1TG7A 3M0ZA 4JIHA 2AMGA 2QXWA 1ZALA 3MSGA 5I00A 3APYA 3D3AA 4ZQPA 3QTPA 1K70A 5I3IA 3VOIA 4JD4A 4W87A 5AVNA 3TYZA 2IQ0A 3DFYA 3WLMA 4QITA 3TUUA 4Q4OA 3CL6A 3SRHA 1HJQA 3WLIA 4TO8A 3USBA 4K1WA 1KR1A 1E9ZB 3BCJA 4B9ZA 3H54A 2RDTA 3NQDA 2HJPA 1LOQA 3QKEA 1MI3A 2Z1XA 3TYCA 3XINA 1R9XA 3C61A 1WKDA 4W7VA 1NDYA 3GUWA 1R5YA 1PKYA 1ZGDA 3SW6A 2J6VA 4D72A 3T0DA 1ZAHA 2XUCA 1DWFM 1J2WA 4JTFA 1FWAC 1E3ZA 2PWHA 2VMFA 1ZCCA 1UPMB 8RUCA 3SO7A 2WSRA 3IUIA 5LNSA 4WDXA 1DQWA 3VZZA 1WB0A 2ISDA 3OP2A 2FGLA 3MMUA 1V6YA 4S3FA 1Q6RA 3H6OA 1UKSA 3OZMA 1J0IA 3W82A 2DZSA 3GWQA 4FX6M 1WBHA 1EFZA 1PE1A 5EMUA 1EYEA 3MCOA 4RNJA 1TA3B 1QNRA 5C70A 3KOYA 1IZCA 4B4FA 4GIRA 1DE6A 2JKEA 2Q6ZA 1IHIA 4QISA 4UTHA 2WHKA 3BZJA 3AHZA 3MUAA 4B91A 1G01A 4BK9A 4DB7A 4Y96A 4YPJA 1KM5A 2XGZA 4XZ9A 3KS6A 3C8FA 1Z89A 3PPHA 1TR1A 1H62A 5EKYA 3DYPA 5FD0A 1RR2A 1Q2RA 1E1CA 2WZHA 4ZO7A 2I1OA 1R3YA 3A47A 3WK3A 4C6PA 4A2SA 1B30A 1M5WA 2CLKA 4Z17A 4PSPA 1B57A 3L65A 1ZS2A 3THQA 2HS6A 3LUTA 4C60A 4ZO8A 3T8QA 4HD5A 3DFNA 1OF6A 1TZ7A 4ADSA 1XL9A 1KFJA 2G97A 4MTVA 4Z1AA 1N7KA 3FCPA 4IIFA 3ARZA 3NM1A 3BC9A 4PEKA 1G4TA 1S2CA 5AYYA 3GAYA 4O0QA 3UZZA 3PZNA 1KTNA 1UR0A 3SUUA 4CCDA 4UB9A 1K4GA 4JNZA 3C86A 1EKOA 2ZVRA 4P7OA 1QATA 4NXKA 4JAWA 1PZ1A 4WD0A 3PULA 2VL4A 1YDNA 2E25A 2FH6A 4H6EA 1JGIA 1O5XA 1V79A 2PGRA 3LRKA 2EO7A 3TLLA 4BKNA 3VIFA 3SCQA 1YTKA 4GYJA 3LS9A 1ZP3A 3L9CA 2P3ZA 5DT7A 3TK7A 1TV3A 1O5KA 3WD1A 4ECLA 1W1IE 2F9RA 3GVRA 1BXNA 3FSTA 3MMWA 2X1RA 2FMOA 3H2FA 2DEPA 3GXFA 2DVXA 1SZFA 3I6EA 3M0VA 5I79A 2ZZ2A 1LBFA 2ZDRA 2JKPA 4QG6A 3KHDA 4V15A 2VR4A 4WDTA 5CPMA 4LUIA 1JQVA 1FXQA 4OBRA 1ZJIA 1B90A 3TSMA 3L4WA 3NIYA 2VDHA 3S1WA 3BAIA 2VWTA 3U2OA 2NXGA 5HMEA 4L1XA 1VH7A 4Q3MA 2QF7A 2YCIX 2WKJA 1DHKA 2QDDA 3VIIA 4AZHA 4K3ZA 3C3UA 3MMDA 5FESA 4GMEA 3AMDA 2RGLA 4BEQA 1HO4A 1H3GA 5FF0A 1AW5A 3CHCA 4L6HA 3CLWA 3LTYA 3LLXA 3WMLA 2BY2A 4E0CA 2ZUUA 4AISA 3A6OA 1FCQA 3C0SA 4Z1BA 5A6SA 1VFLA 4AY8A 1JVNA 2GSEA 2VX7A 2XZ7A 5BROA 1MW0A 1KFLA 2FYMA 3L5LA 4N6FA 3SRKA 5BXSA 4GE8A 1TJ0A 3ITXA 4UMCA 3DG6A 2CIPA 4PB3A 2X0SA 5CBJA 1CNVA 4DO5A 1BEUA 2GJPA 2DW6A 4UMAA 3ZR6A 2IQTA 2JIWA 2OYMA 2OODA 3EXRA 4MG4A 1HFBA 2AOSA 5F4SA 1B9ZA 1DXEA 2I17A 2QCLA 3EZ4A 1FH7A 5E0CA 1UIOA 1KXTA 2YR1A 3T1GA 3TJLA 3GLCA 1EC7A 4A3HA 4ZGYA 3KHJA 1UBSA 3PHAA 3NPWA 1BQCA 4GVGA 1FP8A 1A4MA 3NQMA 1R7AA 3WIJA 4GJ1A 1E51A 3QY8A 1TYGA 3L4VA 3LMZA 2PDJA 1DWIM 5MHBA 1J0HA 2NW0A 1YE4A 1HP4A 5B7YA 2XH0A 1EIBA 3AAMA 2E5BA 3H23A 5FJIA 4CQ9A 1MUMA 1JYXA 3A5VA 4NZ4A 1HX0A 4M82A 4GVFA 1TWIA 2C79A 4GI8A 3L4ZA 3TFCA 1GQNA 4TX9A 3IIOA 4K68A 3KM8A 4HYRA 3PY2A 1JYVA 4AH7A 1F74A 3V75A 2Z6IA 3VZYA 4KPLA 3BE7A 5XIMA 4JIEA 4N9CA 1LL7A 3WF2A 2Y6ZA 5J5DA 4UTTC 2FDSA 2MANA 3WMBA 2GSJA 1ELSA 2D69A 5LZLA 2XN1A 3NQ2A 1H09A 1SZNA 3WQDA 4LVAA 2Q8XA 4TOQA 4LBUA 1V03A 4AEFA 5A6JA 1XYLA 4MZYA 5G2IA 1E73M 2EF9A 4AC1X 4D9PA 1EDQA 4LAOA 4IMCA 1XQLA 3M0YA 1W5MA 4JX5A 3B05A 3QV8A 4YS1A 1MRQA 4JY8A 4LAMA 4O50A 4YVXA 1GJUA 1XKYA 2AQVA 1KKRA 2QCNA 2BTMA 5DCDA 1ZENA 1ISYA 1Z44A 2ADAA 3C2OA 4LW7A 1RH9A 2C0AA 2BY1A 4E4FA 3GHUA 3BLEA 3BZGA 3WQPA 1FCVA 4JCMA 4EF8A 3MDUA 3HPAA 2Q01A 5CLTA 2PCEA 1KRAC 3IJ6A 1GKQA 2YA0A 1J5TA 4CQDA 4S3EA 3K4AA 1IIGA 4JOMA 3F4NA 4Y7EA 3WFZA 4ZA0A 2CZEA 1A5AA 2QCMA 1N8IA 5EMLA 4N4PA 2RDUA 3TVAA 1QJWA 2DSKA 1XHGA 1BAGA 1VB9A 1P1XA 2ZKMX 2QR6A 3V4BA 1T7LA 3M0HA 3UPWA 4PE8A 1A5CA 3VFLA 1GVOA 3WG6A 1XGDA 4B3ZA 1GYLA 2R1MA 1YDYA 5LNWA 1O95A 3KFTA 1AQHA 1XW8A 4LB3A 3TXVA 2IPJA 5CJ5A 1LLOA 3RF9A 2PS2A 2HQAA 3UJEA 4MZ8A 3KBMA 5C6MA 1O68A 3GXTA 3TA6A 3K4DA 3E49A 3CB3A 5E0FA 3VOFA 1V3IA 1H0GA 5CZJA 3XISA 3U4FA 3S9ZA 4H8HA 1WNOA 4NILA 3M5XA 1ITCA 2JF6A 1JXJA 1XIIA 4WXZA 4PODA 2X2YA 4HK6A 1Z48A 2Z6JA 3PZVA 3GR7A 3NQFA 3ZIZA 3MSDA 3AMLA 4EK7A 5HULA 2FDMA 4FXRA 3QHNA 4IG2B 4H2CA 5BRPA 2VGIA 4J3XA 3HFYA 2WXDM 4QE5A 1R3VA 2V68A 5DXXA 4GISA 1J2BA 3OBAA 1J18A 4UCGA 4B5XA 3LHVA 2ZX7A 3UXAA 4LX4A 1XC4A 1UYQA 1SFJA 1ZJAA 2CXGA 1P43A 1I4NA 3WQEA 4BS0A 2BGQA 3TIMA 3SJNA 4W7UA 4AC7C 4H19A 4JZ5A 1QOXA 1JCLA 4LCRA 3NA8A 5DY3A 3DKJA 3CV1A 4DXKA 4RX0A 1UASA 1S46A 2BVYA 3PR2A 3CUGA 1EXBA 2J24A 4DJDA 3RYSA 1K7XA 2MNRA 3FAXA 1BLIA 3GDMA 4N4QA 2PCQA 1ITXA 4PFMA 3KLKA 4WUIA 1CX9A 3LCIA 1J96A 3S5SA 4UFIA 4NJGA 1QPNA 3WMCA 4QAIA 1H7WA 3K5XA 4FSAA 5C9ZA 3VAVA 3I7RA 3V0TA 1TTJA 3EWCA 3N4AA 3R12A 5EL1A 3OGSA 3IV3A 4E8DA 4ERGA 4AD3A 1VQTA 3EBVA 2YL9A 3WLLA 3CV2A 1HNYA 2IKIA 3TNOA 1TJ1A 3AYTA 3ZSTA 2CKSA 4IG2A 3GDBA 1OFAA 4M19A 3F5JA 4FIQA 3WH5A 5A8GA 5FACA 3LPFA 1E6RA 3THAA 1IXNA 4CVUA 5LIYX 4F2BA 2YW3A 4DJFD 1EA0A 1OQFA 3IAQA 4C7DA 4S3KA 1A4LA 2BGNE 4G1NA 2QKFA 3M1ZA 2DZAA 4OQVA 4HPNA 3MUY1 5I2UA 2DSZA 2D3LA 4J2MA 5E09A 1JDFA 1GPFA 1POJA 1M03A 1W56A 4M1BA 4DWSD 4MNMA 2Y8VA 4K36A 4JFVA 4PUKA 1JZ7A 3AU6A 4E38A 2NX3A 3EB3A 2WSPA 1XDMA 1ME9A 3UYCA 1FWWA 5AC6A 3VI2A 4OGZA 4HPJA 3BLPX 2VOMA 4TMCA 2BG5A 1FDJA 2GVJA 2REQA 4WY0F 3QJAA 4IIBA 3RILA 2IKHA 4JQAA 3HOJA 1U2YA 4MB4A 2R1KA 3RJYA 5D2XA 4NZJA 5HMFA 1HF6A 3TN4A 4J1OA 3S47A 1JEZA 1YQ2A 2Y70A 5E6ZA 3FYPA 4LPCA 1ZL1A 4DO6A 4JYDA 1MWOA 3T08A 2WMGA 4RDZA 4AB4A 3GNPA 5IBXA 3UPMA 3S6DA 2E67A 2J66A 1E72M 2ZUSA 4QTGA 4NNBA 3S2CA 3VFCA 2VI0A 2QCDB 3AIRA 5HQLA 4K7YA 4LVDA 2WKGA 1BD0A 2I5IA 4LNCA 2OQHA 1PPIA 1TWSA 1SM9A 1NOUA 4CCEA 3KWSA 4JTUA 1BRLB 1W5QA 3R4IA 5E5CA 2DZBA 3E0VA 2TSYA 3T0TA 5G2WA 4A8IA 3QGVA 1NWUA 1L2UA 1N8FA 1OIMA 1NELA 2X40A 1JCJA 4I7VA 1OJXA 4P7QA 1IEWA 3GNDA 4NJHA 1X8CA 4N9BA 3UR2A 2VYOA 4PC8A 4R9OA 2BY3A 3CK5A 4V33A 1EZWA 3NDOA 1XIFA 4RKAA 4LAUA 1Z69A 7ENLA 1UMLA 2XIOA 1UR8A 1ONXA 4W4QA 1WDRA 3PP7A 1IV8A 4DYKA 4GQGA 3PM6A 3GC4A 3EDDA 2PDHA 5DXYA 1P48A 2OEMA 5I3GA 3R5EA 1MNSA 3PBVA 4QCFA 3GXDA 4GY1A 1OADA 1D7KA 3P67A 3R94A 3P74A 4CN4A 1R47A 1ZNNA 2JIEA 3TMLA 2W27A 4ERIA 3LY0A 2YXXA 5HBFA 1OCNA 2WMFA 5FF4A 3WENA 3W87A 1IR1A 3NR0A 5IDIA 4A3QA 1TPEA 1JYWA 1A3HA 2XM2A 2BBFA 1IEIA 2DU2A 2HBVA 5H8MA 2V67A 1VKFA 1ZY9A 1KD0A 1EJVC 4LTSA 4M5PA 4PUUA 5GNZA 1EH9A 4JHMA 2R24A 1W3TA 3DGBA 3W7IA 1UR2A 4XAGA 1L8NA 2X2GA 5D37A 3H7RA 3G1XA 3OW1A 1W5OA 1S5MA 4PEEA 1A49A 5I3FA 5HMDA 1NAL1 5E70A 1M53A 1Q6GA 3GW3A 5CSRA 1XGZA 2WSKA 3RR4A 3QYSA 1JXKA 3BJFA 3T44A 1UKPA 5LA2A 1VFMA 2DZWA 2ZUVA 1JI2A 1SU5A 1EF2A 3HMCA 1OZQA 1K8XA 4UOJA 3NJ3A 4JX6A 1KCLA 1EF3A 3BLLA 1S5NA 3MBDA 1R3QA 3GX9A 1KWKA 1G67A 3IJ8A 4LFYA 3CL8A 1FKXA 4DF0A 1EO5A 2J75A 4UZUA 4RE3A 1V08A 1W1PA 3EX3A 1E0WA 1OK4A 3RN6A 3TC7A 2WJEA 1HGWA 3CUJA 1TQXA 3M7WA 4A22A 1JF6A 5G2HA 3VUPA 4B16A 3A13A 2XFFA 3BGJA 2CITA 2QAFA 3ANUA 4GNJA 4HJFA 2INEA 1ONRA 2YYUA 3GDKA 1OSEA 1LORA 2NLIA 3W3OA 4PB4A 3NQCA 2ZFAA 3LOTA 4K6AA 1HUVA 3DH7A 4HYWA 3WLPA 3ABXA 4N6EA 4ADTA 1J0JA 3K2GA 3UWQA 3QFWA 1A5OC 3MYPA 3PUGA 4XAYA 4GI9A 5FJRA 1O60A 1WX0A 3CZLA 4GG9A 4IMEA 2ZX5A 3WK2A 6ALDA 1CXKA 2GQ9A 1XH1A 3AIVA 1K9TA 1PXGA 2I5QA 4KFPA 3TLQA 3N12A 4JL2A 4DJFC 4NZCA 4HYVA 3UQNA 1H11A 2INZA 2YCLA 2YSWA 3GVWA 1TUXA 4LRTA 2NXIA 3FNDA 3LCLA 3N2MA 4IMGA 1G1YA 4NI8A 4BHYA 3TOYA 2Q8LA 3O16A 2V8ZA 5I6SA 1J93A 2PTZA 3E02A 1CCWB 4IWWA 1XBVA 1XF0A 3FYOA 1TELA 3D5HA 3G8RA 2NQJA 4FX8A 3Q37A 2WCSA 3ARVA 3WDJA 3JVAA 3HA1A 1TJ2A 5JBDA 2I5GA 2BGSA 3BCFA 2D0HA 3FEQA 2ZBTA 3KDNA 4AWUA 1CXFA 1RY0A 1LT8A 1LQ0A 4KWWA 2HSAA 3VD3A 1ZBVA 5KINA 5KSWA 3QXBA 3UR8A 4PB5A 2VHLA 1XFBA 2WJFA 4BQ2A 4M56A 3EWXA 3CASA 2PDIA 1MO0A 1K6AA 2J7HA 3TAKA 1OEPA 4TVDA 4MLRA 1OABA 5CPNA 4FXJA 2YL5A 3P8JA 4JDBA 3WLQA 2WMKA 3P60A 4OIFA 4AD4A 5BYWA 3T6CA 2H90A 4D6CA 2ANUA 3U57A 4IF2A 2PC8A 1CXIA 9XIMA 4NJIA 3GC2A 5C54A 1QHPA 4C6DA 3AUOA 2D2JA 5H8PA 1JD7A 2RJGA 3QR0A 5FF2A 1W1A1 3CQKA 4O57A 3DXIA 1WZLA 4GD0A 4P2VA 3BAWA 2EPMX 2ISWA 3UA4A 2CERA 4IL2A 4J27A 3S1GA 4S2BA 1EP2A 2IS7A 1RJPA 1RK5A 3CO8A 2BP1A 3LPGA 2HPMA 1E43A 1QW8A 1QTWA 3LCGA 2E5CA 3G0XA 4QM1A 2NVDA 4AW7A 3L4YA 3UXIA 3PPCA 5LHEA 3VINA 3KXQA 4EP8C 4ACYA 3OYZA 3FIGA 2D1ZA 1T5AA 4UR8A 1JZ2A 3WQ5A 2KAUC 1YTEA 1V02A 1CGXA 2O56A 3N2CA 4PMZA 3AWNA 1R8LA 1U1HA 4ZSUA 2P50A 2Q8ZA 3PFMA 1W9XA 4KRZA 2VVSA 4QG9A 2WC3A 4OHQA 3PWIA 4LY4A 4L80A 3TOPA 5DF0A 5BOEA 1DTNA 1Q65A 4XX6A 3KLLA 2HWGA 3EB4A 3I4EA 1ITUA 1UZ1A 4Q4QA 2XVGA 1W5NA 4X0VA 3N4EA 1YXCA 2FZ8A 2J9XA 1QO5A 2RDXA 2VP8A 4GI4A 4R88A 2AQOA 4GH3A 2YBUA 4LANA 4MFEA 3KVMA 1CGYA 4YVPA 4HQVA 3H4GA 1JRCA 3QR3A 5EMMA 4GXPA 3O15A 4MJ4A 3H2OA 3ONBA 2XN2A 4C6EA 1DE5A 3RCNA 2E8YA 1M68A 1QI3A 5A6MA 4MFDA 1GKPA 1RPKA 4Q22A 2GDQA 4U28A 5E9AA 2XFYA 2YCLB 4RLIA 2ZZ3A 1EIXA 1V7AA 2HNEA 4QX4A 1SW0A 2PDFA 2EG8A 4MB5A 2WMIB 4HPXA 3SQMA 1RA0A 5JQ9A 1J6PA 4F0HA 3E74A 1BKSA 3N19B 1BGGA 2OKOA 3THDA 2VQTA 2BDQA 1JZ8A 1GOIA 3WQCA 3RX4A 3LXBA 4DI9A 3E2VA 1MW3A 3QM3A 4F9JA 1UWAA 4H04A 2PD5A 3SFKA 1SZEA 4LJ3A 3W01A 5G4EA 4RDYA 1NY1A 1X6NA 1HL2A 2E6FA 1G7VA 1M65A 1X1OA 3FJLA 3NO3A 4IFKB 5D2TA 3PJUA 2OZTA 4LUJA 1XLMA 5REQA 3TE9A 2J27A 1HJWA 3V36A 3CO4A 1IWPA 1TJRA 4HGXA 4PTDA 5LKYA 1I9CB 1Y7VA 1XH2A 2YB1A 3IACA 4B90A 4RL3A 7TIMA 3YPIA 4S39A 4ENLA 1TVPA 1D9EA 1Q8AA 3AIQA 3QVQA 1BWKA 2J9YA 1HG3A 1IR2A 2NT1A 1VBUA 4QQ3A 3N4FA 5DFAA 3RXZA 5D2VA 4D1IA 1WUFA 4EWND 2CBJA 3W28A 5CBIA 1RZMA 1Q2SA 3W7RA 2F6KA 2PF8A 4K8EA 3MJMA 1DTUA 4IGMA 4ROQA 1JIBA 1QK0A 3SSZA 3WEZA 3T81A 1KM2A 3IRDA 3ES7A 4BI7A 5JVLA 1V8EA 3IANA 3W1LA 3EEZA 1NF0A 2X7VA 3WLOA 1QPOA 4QS6A 5IRPA 1SO6A 1KV5A 3UNTA 1H1ZA 1FWHC 3EOLA 4Q33A 1Z9AA 3OYXA 6XIMA 3C2VA 1V3KA 1WDSA 4GKTA 3EOOA 3VIKA 3EX2A 2GVGA 3WDPP 2YCKX 2E3ZA 3U9IA 4GZIA 3NUKA 1UD5A 5IFPA 3AHXA 1O1HA 1YDVA 4TQTA 1OGSA 3PUEA 1Q6CA 3TQPA 4PTVA 4L56A 4O1AA 2F2KA 3FFSA 5I78A 3BANA 1VCGA 3RR1A 3LEPA 1X6UA 4LUSB 1TPDA 3OHIA 2E4TA 4OOUA 4MWAB 4A35A 3N34A 1VAHA 4Q4MA 2QIIA 3W7QA 4AHOA 4MVAA 3SUVA 2QVHA 3LBCA 3W2JA 3JS3A 5D2YA 3VIJA 3VO0A 1TPUA 2V9DA 2RH9A 1WE5A 5I3KA 1I0DA 4QR6A 4PCNA 4DUXA 3KTCA 5HA7A 4I8YA 3GNXA 1BG4A 1ZSXA 3WQVA 2JGQA 4J2PA 4JX4A 1OC7A 1KLZA 4GBDA 4CCCA 1FXPA 1UZDA 3OGVA 4BI6A 1GOKA 2HCVA 4J35A 2OCZA 3W02A 1PV8A 4CNUA 2C1HA 5HNTA 4U5IA 5K4ZA 2ALDA 2W67A 4MWAC 4C6FA 4HZMA 1DIDA 1UKQA 4HA0A 3ZR4A 2WPGA 1L6SA 1G9HA 3GHSA 3FXYA 1XYAA 4S3CA 2ZXDA 5J8LA 3GSMA 3T78A 3GU1A 3GAKA 2W3ZA 3C0LA 1H1YA 4MPQA 5E93A 4H8NA 1QR7A 4E4PA 7CGTA 4UMBA 1E6ZA 3PG9A 3DI1A 2Z28A 2PLJA 4TXEA 1ZB5A 4MWAE 5CPSA 3ELFA 3UZWA 1NOWA 1B3OA 4I9JA 5A6LA 1M3UA 4IZGA 4U31A 4PTWA 3IJDA 4DWDA 2OZ8A 3HGOA 4HK7A 4CN6A 4NG3A 2PE4A 4RUBA 3THUA 1F2JA 2JE8A 1Q4NX 2ZXQA 1WQ5A 2YKKA 1W54A 2X30A 1V3JA 4GGHA 3Q45A 2BOEX 3N2BA 4NU7A 3GYCA 2ZADA 2YOCA 4DJED 4UWMA 3EXTA 4QE4A 4LY8A 2OPJA 2VTFA 4ZB5A 4Q7BA 1UWTA 3PAOA 2W79A 2WJZA 4K2SA 4PMOA 2PDGA 1TIMA 3NQ8A 4PRTA 1PZ3A 4GX9A 4MADA 4A3YA 4EANA 4XWUA 4B5VA 3VILA 2VX6A 3NWRA 1F3TA 3WNNA 5REQB 4XUGA 3BLOA 1C8VA 1E71M 5JMUA 1EGZA 2FTYA 3H2MA 3NURA 5A8PA 1XBYA 5HK4A 1H5VA 1YYAA 1JQXA 4R33A 4ZXLA 1H2JA 3UYIA 2X05A 3FKRA 1JPKA 2O55A 4HZ6A 4GUGA 1FWJC 3CZJA 4XTDA 5DRCA 3MV01 2QS8A 3SBFA 1KBBA 2PC4A 5M2FX 3QQ0A 2ZX9A 2EBNA 1U5JA 4U5KA 2PU1A 5FEPA 3GIPA 4GI6A 4HNNA 4L61A 4U4MA 2Q3RA 1CPUA 3VE7A 4L9XA 4GNVA 3LLDA 5AZ0A 1KLYA 4KMQA 1DXIA 3KAOA 4UOQA 1BG9A 3WELA 4S3JA 4XAPA 3LQLA 2VT0A 2QJIA 3KZSA 3UG4A 1G7UA 3WQGA 4HOXA 3FJ4A 1XLEA 2WSYA 3VA8A 4ZMGA 6REQA 1XYFA 4W9TA 3O6AA 3LHZA 3V5FA 5LXEA 2KZHA 3BURA 4MUZA 4YLWA 1GOQA 1OX4B 3C56A 1DWAM 3WF1A 4LC6A 1MDRA 2YIHA 4XD3A 5DT5A 3P5ZA 2A85A 4I90A 1MW1A 2W63A 3HQOA 2V5DA 2VM8A 5T9CE 3V16A 1J4EA 1US2A 1YNPA 4C6NA 1IEVA 3E38A 4IP5A 1JYNA 4HHLA 4MOZA 2VC6A 4MAZA 4UQBA 2XSXA 4F0RA 3OLEA 5M03A 4BF5A 1E4LA 1ESWA 3VDAA 3W27A 1H4PA 3RRAA 2Z4GA 4HK5A 4D6JA 4V27A 5A2CA 2WWCA 4BFAA 1DYSA 3DG3A 2JF7A 3MCNA 3CYVA 4WQ6A 3Q65A 1FVPA 1D3HA 4AZGA 1EYWA 1NF7A 2B81A 3PANA 3QV6A 1LT7A 4HU8A 3ABRA 2OQYA 4QDMA 1S39A 1CGUA 5TF0A 4EKJA 3TH6A 3KBWA 4FP1A 3TC6A 4IT1A 3IWPA 1YADA 4AD2A 2FZMA 1U5VA 1U1UA 3GG1A 3GZ3A 1AJ2A 4RV3A 3TDFA 2CLLA 4X2PA 2OJPA 1V5XA 4F0KA 1UJQA 2O92A 1J8VA 1J5SA 3GKFA 3WLHA 1OC5A 4WIWA 1CB2A 1RLCL 3N9SA 3UNDA 1GOWA 1Z41A 1MQPA 2O9PA 2Z1KA 4LS1A 2PDLA 3CWHA 2JFEX 4IQJA 3MZ2A 4FEZA 4LUSA 2CPUA 5FKYA 2WLYA 3GG8A 3LCXA 5TIMA 4F2UA 3PZ9A 3SGGA 1KV8A 2Z27A 3DC8A 4WGXA 3LTSA 4AY7A 2PTDA 4A05A 4EF9A 2QDHA 1YXYA 1IGWA 4L6OA 4AIBA 1KM4A 3AJXA 1VR6A 3PNZA 4GBUA 5BMXA 4L64A 1DXFA 4CNPA 1NFPA 4NSBA 2R1NA 3CQ0A 3DDMA 1OCBA 4Y9AA 2GQ3A 4Y9MA 4JGDA 1OB0A 2XJ7A 3PTQA 3EA3A 2W91A 2QPXA 2E8ZA 2POZA 1IT8A 1X98A 3ME3A 4D6GA 4O19A 4DWSC 1ICSA 1G0CA 4Q7NA 1L0PA 1AZ1A 2VUNA 7TAAA 2GJLA 4ADUA 1S3HA 3P62A 3MO7A 2ZTKA 4AU0A 1RQHA 1XLKA 5FEXA 2DGAA 4GOAA 5I3JA 2BVDA 3VMPA 5A3HA 1H0IA 4UTJA 4AEEA 5CQ1A 1PS9A 3DBNA 1ME8A 3W83A 5J5RA 3H4WA 3EKZA 3UG8A 1XLDA 2D0FA 3UWYA 1MZHA 2OTDA 1ICQA 4LF2A 3OLIA 1GEQA 5ECUA 4B4HA 4DBWA 3BSMA 1Z8AA 3TJXA 1V7YA 1ZAJA 3RCYA 2BSLA 3UJSA 1BPLB 2WZEA 3O63A 2HBXA 3CUHA 2H6RA 4K7VA 1OG0A 3SRDA 4K39A 2DZPA 1KM1A 2E9LA 5A95A 4BJHA 5K4XA 1LM1A 3N29A 4L9YA 1R0MA 1XIEA 2DSUA 4HHPA 3K1DA 2BLEA 3GC5A 3RPMA 3VNMA 1SO3A 1XCFA 1TZ9A 1LOSA 3WJYA 4DZAA 3BLDA 2DH3A 3W29A 3DEQA 2OSXA 2NQHA 1LLZA 3R11A 4D8AA 5A69A 5LHFA 5C9XA 3VKJA 1SGJA 3U5YA 3WLSA 1NH6A 1KO0A 7XIMA 4PUJA 3G5EA 3VVGA 4FR1A 1DIOA 1UR1A 3N6QA 3TXZA 1QBBA 3KBSA 1W17A 3VIPA 3I3DA 3LCWA 1QASA 4O1DA 2Z1SA 1VYRA 5DCBA 3DX5A 4J9JA 2XVKA 5DBTA 2BHZA 5FSDC 1AUSL 3OIXA 2FZDA 3BSHA 4N42A 1DJIA 4AIUA 3NZ1A 1X97A 4GQQA 2EPHA 2CLFA 3ONCA 3PPGA 3P61A 2NV9A 3F03K 4RV8A 2PDXA 2A3HA 1FOBA 2EG6A 4E2BA 1JCXA 3G1SA 2B4GA 4XIAA 2IPFA 3HJZA 2D73A 1MFUA 3T0AA 4ZTYA 3DFOA 4OBTA 3PB0A 4LS2A 5AC8A 3LGGA 3GD6A 3ZJ8A 4YNGA 2POTA 3ABOA 4AMAA 4JIIX 3BMXA 4D2JA 1WZMA 2C7FA 4UTIA 4YWSA 1TKKA 2GGIA 5CZSA 3OQ8A 3XIMA 4PYSA 2GDUA 2X0HA 2WAGA 4JIQA 3BH4A 3DCPA 1K9FA 3VNKA 1MDLA 2OGYA 3GTFA 3PSWA 4QP0A 1ZBKA 1R3WA 4U3AA 3VOJA 4MZ1A 1FHUA 2CZ5A 4GXWA 3W22A 4QHRA 1MQQA 4Z2IA 1KCKA 1V0MA 3NQBA 3WY1A 1MQRA 4UR9A 4UCFA 3MWCA 4RNHA 2ZWYA 4N9DA 4AF0B 3GY1A 4O8AA 2H3BA 3WBAA 4RW5A 2UWFA 2Z24A 2J47A 1D3GA 1ZUAX 2Q71A 2Z2AA 3N2TA 3SCSA 1TMHA 4UXDA 5AN7A 2XSBA 3O3RA 2W6RA 2OOGA 3GXMA 1ISWA 3RMEA 4RPQA 4MIMA 4K1GA 2OOFA 3A21A 1VIWA 5IDZA 3FX4A 2NX1A 4MDPA 4ILSA 2OZ3A 3UR5A 4C6IA 2QUTA 1K3UA 4ML9A 5B7ZA 3CJPA 3A3XA 1PZ2A 4YTUA 4U2ZA 3TW6A 1XYMA 5G1YA 2GLKA 1FWGC 3E12A 5F1UA 3AHYA 2TYSA 1K77A 2DZUA 3F1QA 1YNQA 1MEHA 1QI4A 1LBMA 2JGYA 4FIRA 3WDQA 2HE8A 3BAJA 3M46A 4UTWC 4NL1A 3W6YA 1XCXA 4GC4A 4UQEA 1H7PA 1UWSA 3QH2A 3DHPA 3DKLA 3B0UX 1HKJA 2NWRA 2WB5A 2BV9A 1ITQA 3TWBA 2VDGA 2XWEA 5LGXA 3VNIA 3LK6A 2QDEA 3EWWA 3K4WA 4RNIA 1ML1A 3P93A 3VKBA 4QGCA 2VEMA 3CAQA 2UV8G 3W1AA 1Q5MA 5GPRA 3N9RA 4D71A 2Y5JA 1RCXB 1GHSA 4UNLA 5IHRA 3H22A 4WLCA 4DRSA 3TQVA 1LQ2A 3S9YA 2OR2A 2X7WA 1RCQA 1V6UA 1GQLA 3COTA 2Z7KA 4JICA 3IGUA 3SURA 2E6AA 2DT1A 4A6GA 4X9SA 2REQB 1BTCA 2ZICA 1BXBA 3O9NA 1MUWA 5HNRA 3EYPA 3GIYA 4DUVA 3MB9A 1IXOA 2OLSA 1SSGA 2V2CA 3DBPA 3BOLA 4PN2A 1W2PA 3CH9A 5HINA 3OZOA 1GUVA 1CLKA 1OWQA 3KOXA 5B80A 1AQMA 3E5BA 3ZMRA 5KEZA 5AYBA 1MZRA 1XLFA 1BHGA 5CKSA 1I1WA 2CESA 4F66A 1TX0A 2QJHA 1C8XA 1WDPA 5I3HA 1US0A 1VFOA 3S2LA 4MJZA 4P61A 4F0SA 4OE7A 3MHGA 3QV9A 4PUMA 4MF4A 1ODZA 1AH4A 2C13A 3I7SA 2E1DA 3ARRA 1GCYA 2CZDA 2J8GA 4A3RA 2FZ9A 2PDCA 4XSLA 4HTYA 2NVCA 2ONEA 4N2YA 1M7PA 1JCNA 2YX0A 1JDCA 2PBGA 2E68A 1U30A 1S1PA 3LBMA 5SWUA 3TW7A 4A8LA 5BOFA 1K03A 2E9BA 4NUWA 4WR3A 3IVUA 1TTPA 3MP5A 1KW1A 4WK9A 1W1TA 2F84A 4AVOA 3KOFA 4OVXA 2VD8A 2W0UA 1HTIA 2QDGA 4KWSA 3EMZA 1KXVA 4DX3A 2PODA 5JBEA 4Z2JA 2A3LA 1OZMA 1TTIA 1F3EA 2GL5A 3B0PA 3AWOA 5L9FA 1CLVA 3VGGA 3M9YA 2ZZ1A 1TVNA 3EX4A 4PULA 4WZHA 4ZFCA 4FLSA 2ALRA 1OX6A 4NIRA 1XIGA 4O15A 3UU0A 1TZZA 2H3DA 2VELA 3O7UA 1B3VA 1I2RA 4CNSA 3ZJ7A 4F4RA 1ADSA 4I5XA 2JK2A 4DLFA 4ASTA 3PZIA 1UD8A 1PUDA 2Z0IA 3SECA 2I9UA 3W07A 1WXYA 1DQXA 1JDAA 3O8AA 2OYLA 3GTNA 1EJWC 5EMKA 1UKOA 3C6CA 5BU9A 1B5TA 3MMTA 2DORA 1RPXA 3R2GA 3ERPA 1SR9A 4AYSA 1AODA 4O14A 1KQYA 1KM6A 4IH3A 2FFCA 4HPGA 4LGXA 3K8MA 4DHGA 1ICPA 2ZA1A 1AA1B 3DESA 3T07A 3SN4A 1UP3A 4JR5A 3ALFA 3G77A 1RSCA 3CS2A 4AD1A 6CGTA 1L8PA 2AL2B 1K02A 4MHBA 4JFWA 1NP0A 3B04A 2DPEA 4HA4A 2PRMA 3AC0A 1AJZA 4PCPA 1CWYA 1S1RA 2QCGA 3I10A 3QFEA 5ABEA 2G50A 3QYQA 2Y2WA 5KTLA 2PDKA 2CHOA 3L0GA 2PFHA 2F2HA 3CWNA 4PTNA 2FTPA 3VDHA 3TU9A 3RIKA 3UJRA 1KFKA 1V6WA 3T4WA 2IUZA 5CBBA 4JEQA 5HQMA 4UTFA 4HMNA 4QJ1A 4KRUA 4I9MA 5DMNA 3CPUA 5HATA 3UWZA 3U0HA 1UROA 4OTKA 4HMCA 1ZLPA 4GUFA 3MHFA 1WPCA 1DBTA 5BU6A 1MXSA 3URNA 1I8JA 3A64A 2OXNA 4CKQA 3AMGA 3P2VA 4DJFA 3GXIA 2O9OA 2QUVA 1VJIA 1X7FA 2GVEA 1IEQA 1OD0A 2F61A 3WD3A 4KCTA 1C93A 2H8XA 3W7DA 3HQNA 3W7JA 4U10A 3TP4A 1W1ZA 4DBEA 3OG2A 3WH7A 5CGMA 1RP9A 5I77A 4W5ZA 1IGSA 4LQ1A 4HTBA 1GVYA 2G3IA 2XH2A 4DWSA 2AL2A 3DENA 3G8EA 3IRSA 2G4FA 1EQCA 1XYBA 3CLMA 3IJQA 1DWJM 5E0KA 4YHEA 4CU7A 3UVIA 2PD9A 1Q7ZA 3KX6A 2PF0A 3M64A 3V7PA 4ZOBA 5HQEA 4LEFA 1L9WA 3PUOA 2WMJA 1O4UA 3E9AA 1KC7A 1FY6A 1ENUA 2WQPA 1I1XA 1CIUA 2ZA3A 3K46A 2CLHA 2ZZ5A 4E4UA 5HJYA 3EA1A 1P5BA 1SW7A 3CTTA 2I56A 3D47A 3BMWA 1VF8A 1XM3A 4AWTA 1EGMA 1U83A 3ARYA 2WM0A 1NQ6A 3AXIA 1SPQA 1TPH1 3UCDA 2G0WA 3HG2A 3ZZ1A 2V3EA 1WUEA 1G4EA 5D32A 3AYVA 3NQ7A 5C2CA 4JCLA 1F73A 3TTEA 2R94A 2BXYA 4QAWA 1EJ7L 5MF5A 1FWEC 3AIBA 3PZGA 2FB3A 5K9DA 4GPNA 5XINA 2ZWZA 1F6KA 4KEVA 5G5IA 1H50A 3FA3A 2OWWA 1US3A 4J7RA 2GGEA 2BVWA 5I07A 1V93A 2XVLA 4HNCA 1ZP4A 3UCQA 3BSGA 2EKCA 2UY4A 2J13A 1JAKA 2L5HA 1TWWA 4AX7A 3C2RA 5ABFB 2ZZ6A 3G22A 1A53A 4EX4A 3PBYA 1WDDA 3W1RA 5D33A 4FNQA 1RCOB 2Z25A 3SI9A 4UTLA 3V18A 3LGEA 3C2FA 4D6EA 5I3DA 4LF1A 3L2IA 4AVNA 2NV1A 4DO4A 3MPGA 3ARUA 3B4YA 5BOOA 3VD4A 1E0XA 1NFBA 1MNZA 3EPOA 1R9ZA 4KW2A 2ZOXA 3ZO9A 2J7DA 3W70A 4EACA 4NRSA 2QCCA 1EGVA 3LCFA 4IQDA 4HNLA 5GNXA 1QOPA 1EWDA 1BSLA 4TU1A 2EAWA 4WDWA 1L6GA 8A3HA 3ITLA 4LH8A 1C7TA 5JBFA 3MSYA 4O12A 5MKGA 4FXFA 4BQ3A 4S1FA 2I16A 3OLGA 4G6CA 4JIRA 3ZT7A 1HL9A 2YFNA 2VUYA 4YN5A 1FCUA 3SIMA 1TV4A 3L7RA 3WDHA 1FWRA 2V38A 1BWLA 4XK2A 2J8FA 3W75A 1QNOA 5AYIA 3LZ5A 1F7BA 3S46A 3P0XA 4CU8A 4QSFA 1W9BM 3QGKC 5G4HC 5DRIA 3ABQA 1V6VA 4Z2KA 2RJHA 4JQ2A 3S5YA 4HB7A 4AY1A 2FJKA 4WGHA 1XBZA 2WVSA 3VNLA 5CSSA 4GH1A 4LAZA 3ITTA 4GCAA 4NZ5A 4EPBC 1EC9A 5AKQA 3AUJA 5AZ1A 2ZTJA 3NSMA 5FOOA 9CGTA 1RA5A 1FRBA 1TV7A 3CEPA 1TJPA 1GOXA 4JEJA 1W3LA 1EOKA 1KXHA 4GQ0A 3V0UA 4JHZA 3EWBX 3ZT6A 2OZ0A 4UFKA 2QCHA 3Q94A 2ASHA 1W8SA 3MI3A 1UD6A 5AECA 1FWBC 4BZYA 4WOZA 1XLBA 3WSUA 3HV9A 2HS8A 3EB2A 3F4DA 3UXDA 1IZKA 3HPFA 1PVNA 4AWEA 3II1A 2OMAA 3WN6A 1PX8A 3PTDA 3WF0A 4O0KA 4O13A 1O94A 5LGZA 2HPIA 3AHVA 5TAOA 4QDPA 5CXPA 4PBFA 1Q6DA 2VX4A 3T40A 1VRDA 3RO6A 3WJXA 4GINA 5DEZA 3RPTA 4MY1A 5BXTA 2JEPA 1V0NA 4UUIA 5HR7A 1W3IA 1HZYA 5CPLA 2PDUA 4A4AA 2PLCA 4GC3A 4G7FA 4NRRA 1KCZA 1K7EA 1NTHA 3S9IA 4IP7A 2R1PA 4C6QA 3NSXA 3O6DA 1B31A 1SO5A 3N2OA 3QF0A 4JFSA 3V1HA 3V0SA 4XVDA 3CUIA 4JN6A 3TJ4A 4WRHA 2QJMA 3QKZA 3CZGA 3TMQA 3LERA 4W93A 3FV9A 2IXVA 2RAGA 3UP8A 1GYNA 5EYWA 3I68A 3GZAA 3SQSA 3G1AA 4XBSA 1OC6A 1SJDA 1O6IA 4TVCA 3WD2A 5EGRA 1TB3A 1AMKA 8CGTA 5ABGA 1XKJA 1YEYA 3Q4DA 4GZ7A 4KEUA 4E6MA 4EOUA 1BFNA 4B5UA 1XPYA 2H8ZA 3BAKA 2XH4A 4NXSA 2H9AB 1XBXA 1RV8A 3CT2A 1GVFA 3TZNA 4NASA 3ZVHB 3W7NA 2PDNA 1PWLA 2VVNA 1OM0A 3R43A 2Y0FA 3U48A 1CTNA 5AHFA 3VD7A 2B0MA 3FLUA 4MAVA 4XZLX 2WVTA 3ZJKA 1BYCA 2A7RA 7REQB 2BODX 3FYYA 4QFUA 4GIEA 2D3NA 5CGQA 1OFQA 1JULA 3QN3A 3WNMA 3OBKA 1O12A 1GONA 1E0VA 1BF2A 3LI0A 4XTIA 2A0NA 2VXNA 1GVIA 1CLXA 2DJLA 1H7RA 1UQZA 2QULA 1FQ0A 5JH2A 2DSVA 1HN1A 3JZEA 1SFLA 2X1SA 2PWFA 2QGHA 1M41A 4ZE5A 3AQUA 4EPDC 3B0VC 3QC3A 4CLMA 3GXNA 3IIZA 1GJPA 2GUBA 2ZRUA 1B4EA 1F3WA 2J8TA 1AL8A 1HO1A 4FZIA 3C4UA 2UY3A 1QVBA 1XG4A 2IQDA 4H9XA 4DZHA 1XRSA 5U4NA 4XQ6A 1NP2A 3WNLA 3KRUA 5G1MA 2D2GA 1ZJBA 5D2WA 4ZO9A 3Q67A 1J01A 1HVQA 1F61A 1BRLA 3VYLA 3GBEA 3WH8A 2WSQA 3F2BA 4Y6GA 1ZHAA 4JTLA 3HIJA 2R1LA 3MI6A 2WKLA 1NWTA 3P5YA 4IFKA 2TODA 4YMZA 2EG7A 3WJWA 3B4UA 3EOUA 3GW0A 5BCAA 3EOSA 1D8WA 3BW2A 2VX5A 4XIMA 3EKGA 2WQDA 1JCYA 2VFDA 1YW1A 4US6A 4W5UA 2PWGA 4A8NA 2F6UA 4GJIA 4IM4A 3FAWA 4XBJA 3MI2A 1X7IA 1LYXA 1KTCA 3NZQA 2EJ1A 2ACSA 4AZBA 1IE7C 2C91A 3DECA 1QRQA 4W85A 1DKWA 2VEPA 1TFVA 2OG9A 1OHLA 1S38A 4F2TA 2V2HA 4ZSTA