1TV6A

Hiv-1 reverse transcriptase complexed with cp-94,707
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
539
structure length
535
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords reverse transcriptase p66 subunit
publication title Structure of HIV-1 reverse transcriptase bound to an inhibitor active against mutant RTs resistant to other non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 139
structure length 535
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tv6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tv6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tv6A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tv6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tv6A05
1BL3A 2HVHA 2KFNA 3HVAA 2OPRA 4DF8A 1N48A 5C25B 2QKBA 4CF0A 2UUWA 1RA7A 4AILC 5F8LA 2IM0A 4JLHA 3CDWA 4BWJA 4DQSA 3CVKA 1LWEA 1VK0A 5SZTA 3V6HA 3E01B 3G6XA 3BDPA 4JV2A 2UVVA 2XRIA 4ECZA 2VG7B 4ZVEA 5F8HA 3NKYA 4DL3A 5FRMA 4ED1A 4G1QB 3G10A 3SQ2A 5CYQA 3KIOA 2RKIA 4K4ZA 3NH2A 1J53A 1VRTB 4LSNB 4QWDA 2CJQA 4RW8A 3OJSA 3RWUA 2QE5A 1NOYA 1IO2A 1C0TA 4Q8FA 1WNSA 2HMIB 3LP2A 1Q9XA 1KVBA 2JEIA 4HYKA 3MEGB 3NFAA 1BCMA 2BDPA 4U7CA 4I9QA 3KJVA 4AHVA 1MU2A 3CDUA 2IJFA 3C6UA 4IH7A 3LWMA 4AHRA 1N56A 5KT7A 3AA4A 3F73A 3VA3A 4EO6A 3GILA 1VRUA 4LH4A 1TKTB 4RZRA 3PY8A 3GQCA 2HNZB 3AVIA 5KFYA 5DMRA 3PR5B 4ED3A 1DTTB 2IOCA 2P51A 3N6LA 1RTDB 2ITGA 4CGGA 3HPHA 5C25A 1Y97A 1NNDA 5KFPA 3CG7A 3KLEA 4IBNA 3NF8A 4DTRA 3M8QB 4KB0A 5SWMA 3CFOA 4B9VA 1TQLA 5FRNA 5J2MB 1WSHA 4Y2CA 3RB0A 3E01A 3TVKA 4HCCA 2XGPA 2ASJA 5HROB 2VG7A 2YNGB 1ASUA 2ATQA 3V9SA 4TLRA 3FFIA 5F8GA 1K1QA 3KMQA 4G1QA 1JLEA 3TARA 2W9CB 3V1RA 4WFYA 2D41A 4ECTA 2WCXA 2IM2A 1QE1B 1VRTA 3JYTB 3ZSXA 4LSNA 2XY7A 2W7OA 3VQCA 1KTQA 1RTHA 4FVMA 4F50A 1TVRB 3SUPA 1LWFB 2EC0A 4CHPA 2YNHB 2HMIA 5KFLA 3SUOA 1QQCA 2VWKA 4DS4A 1YT3A 4CF1A 3MEGA 3SV4A 1N5YB 4J2BA 3BREA 2DTUA 1SV5B 1XI1A 4DSEA 3HVTB 1RDAA 3QZ7A 1ZYQA 3KLVA 3DLEB 2ZQBA 3KD5E 5HRSA 4CEAA 2IGIA 2BANB 1N4LA 1NKEA 2UUTA 3O4NA 4E1MA 3OYGA 1JLQB 2BRKA 1TKTA 2JC1A 3GV8B 4EP4A 2HNZA 3DYAA 4NLTA 1NK7A 5KFOA 3L2UA 1DTTA 3DLGB 4ECWA 1RT6B 1RTDA 1BQMB 1SL2A 5JS2A 5EWGA 4HCBA 3CJ2A 3MF5A 3RMCA 1S0MA 4KHYA 5F8MA 4OKKA 3M8QA 4F2SA 1L3SA 5C5JA 1BHLA 4MKBA 5KT2A 5KFRA 5J2MA 4JUZA 5KFDA 3DRSB 3V9ZA 5HROA 2E9TA 3MR6A 2YNGA 4O0JA 5KRTA 2IM1A 4CECA 4FLXA 1RNHA 4TY8B 2W9CA 2Z1IA 2FVQA 4RW7B 3MEEB 1QE1A 3JYTA 5DQHA 1A5VA 4HUGA 2G8FA 1TVRA 3BSCA 3V9XA 1LWFA 1TKXB 2YNHA 4TQSA 3ASMA 5JS1A 1S9EB 3NCIA 2FJWA 4KPYA 5EUHA 2WTFA 3RBDA 2HHTA 4KHWA 5HRRA 1Z4UA 4ID5B 1SV5A 1WLJA 3HVTA 4IR9A 1GOBA 3DLEA 4FBTA 4B08A 3HT3A 3LAKA 4CE9A 1KHVA 1XHZA 4C8KA 5FDLB 1I6JA 1JKHB 2BANA 2OPSB 4HTUA 1U49A 2GIQA 1KHWA 1JLQA 4Y34A 2X6NA 4IRDA 2Z1JA 2FC0A 2O5DA 1J5OB 4RU9A 3OL7A 1N6QA 2FBXA 2J6SA 3KHRA 5K14A 4M3UA 3DLGA 1BQMA 1QHTA 1ASVA 4AHSA 3NGIA 4EYHB 2XI3A 2FVPA 3FSIA 3NDKA 2FJXA 3QGHA 2P1JA 4I2PB 4M42A 3KNAA 3SPZA 2E6LA 5KFIA 4EEYA 5HRPA 4O4GB 2JLEA 4URQU 1F21A 3DRSA 1NKBA 2X74A 3D5MA 2GUIA 3RB4A 4O3PA 2E4LA 5HLFB 5F9LA 3QGGA 4YR3A 4TY8A 3QERA 4ECUA 4G3IA 4RW7A 3MEEA 5KFWA 4DSLA 3AVKA 4Z4EA 3LANA 4BACA 4J9NA 1TKXA 4DU4A 3KLIB 1S0OA 2DFHA 4YP3A 2YNIB 2W9AA 1GOAA 3N6MA 4ID5A 1IKYB 4KREA 3MAQA 1C2PA 4ED2A 3QIOA 3D45A 4J2DA 4J9OA 3MR5A 2HHVA 5FDLA 4B9MA 4BDPA 1JKHA 2OPSA 3VQDA 4NLSA 3MECB 4OPKA 4ZTFA 4Q8EA 2D0BA 3AVAA 1J5OA 4CK1A 3CJ4A 4FLUA 4QWCA 1RBUA 4YFUA 1VSLA 5JUMA 4ID1A 5KFGA 4QWAA 1RDBA 2ZD1B 3BJYA 4B8AB 4DTMA 5KFSA 4B9SA 1L5UA 4I2PA 3G86A 5DLGA 3HP9A 3I5CA 2OH2A 4KKOB 1S4FA 4O4GA 4FLVA 3THVA 1S0NA 4DSJA 3DRPA 1WSJA 4CHYA 3K5MA 3H2LA 2V9WA 4CJKA 5HLFA 3VQ5A 1U48A 3H59A 3ZCMA 4OGEA 4DU1A 4J9MA 1TKDA 4BDYA 2HWIA 3H08A 2QXFA 4IDKB 1L3UA 3TI0A 2DY4A 3ZSWA 3V81B 3KLIA 3H4BA 4NLXA 5KGWA 4PY5A 4O44B 2YNIA 2F8EX 1QAIA 1S9GB 3M8PB 1IKYA 3V6KA 4DFPA 2O4IA 4Y3CA 3QETA 1CSJA 4NLVA 3RMBA 1HQEB 5DLFA 4LD0A 3OYMA 3NGZA 3MECA 4CGJA 3HHKA 2XHBA 4FJIA 4FJ9A 2BRLA 5EWEA 3DM2B 3ALYA 3KLFB 2ETJA 1D1UA 2X6SA 3OJUA 4CJ4A 3GIKA 1HNIA 3C6TB 4AH9A 2ZD1A 4IG3B 4MKAA 3BQ2A 4Q45A 1EX4A 2BQ3A 1JL1A 1RT2B 3T5HA 3K5LA 3I5BA 3HYFA 3OHBA 1S48A 5KFZA 5L1JA 4CJWA 4KKOA 3K58A 3OY9A 4F3TA 4WFZA 1U4BA 3VQBA 1RDCA 4RG8A 2YNFB 4R5PB 2LSNA 4LY7A 3PUFA 4CFBA 4DLEA 4DL6A 5CZ1A 4FJHA 1NJXA 4Z0UA 1LAWA 1GX6A 4CEBA 3O3FA 1CZBA 4HVJA 3VQ9A 4ECYA 4IDKA 1RDRA 3VQ7A 4LQ9A 3OSPA 3AO2A 4KTQA 2ATLA 2KZZA 1CLQA 2FVSA 3HKWA 4CJ5A 3C94A 2XY5A 5DG8A 4O44A 1QAJA 1VSHA 1S9GA 3M8PA 4J2AA 1HYVA 3K2PA 1RYRA 3L3UA 1QTMA 1S1UA 3AVCA 4O3SA 1C1CB 1RILA 1DLOB 4DTSA 3RB6A 4E19A 3QNOA 5J2PB 1HQEA 2R2UA 4OL8A 3L3VA 4RUAA 4N41A 2P5GA 4OVLA 3BSOA 4Z4HA 4K4YA 4GW6A 2C22A 3TAGA 3DM2A 1ASWA 3DOKB 3KLFA 1FKPB 3IGVA 5KG0A 2KQ2A 2AU0A 1YTUA 4FM2A 4FLWA 4TYBA 4NLOA 3C6TA 4IG0B 1S10A 1TKZB 1KSPA 4IG3A 1RA6A 4ZVFA 4R8UB 4F4XA 5KT4A 3PW2A 1RT2A 1B9FA 5HRNA 1NK6A 1BI4A 4M3ZA 4JRQA 3SZ2A 5DQGA 4KHSA 4ED7A 4QWBA 4E1NA 1VSKA 4K4WA 2D7SA 4KE5A 4ECRA 2F8SA 2G8WA 1HMVB 3KKRA 4CEOA 2QV6A 2YNFA 4R5PA 1UAXA 1RBRA 2R7YA 3BQ0A 4FJKA 3ZSVA 3VA0A 1WSIA 3HM9A 1I39A 5L1KA 3DLRA 4JS5A 3QESA 1KRPA 4JV1A 3AV9A 2FBYA 2D0CA 3VQSA 3PVXA 2IJNA 5FROA 2XWYA 4F4KA 2RN2A 1HNVB 4DSIA 4IFVB 2J6UA 4NYNA 2OZSA 5C42B 1D0EA 1LW2B 3LP0B 1C1CA 5KFQA 3KKSA 4RNMA 1DLOA 3T5JA 5J2PA 1Q8IA 1QUVA 4BE2A 2ILZA 3WNEA 2BE2A 3DOKA 4CJSA 1FKPA 3HPGA 2Z1GA 1Q9YA 4O3OA 4IG0A 3P1GA 3AA5X 5I42B 2UVUA 2Y1JA 4RNHA 2WB4A 4R8UA 2Q3SA 3MXIA 4DU3A 5KT6A 2HHSA 4H4OB 3F9KA 1RBSA 1S5JA 2NUBA 3DRRB 4CJUA 1W25A 1ZETA 1VSDA 3OSNA 3TAPA 1HMVA 3IG1B 4FK4A 4NCBA 4RNFA 3V6JA 4CJFA 1HYZA 3GIMA 3OL6A 5KFMA 1RAJA 1LW0B 3UPFA 3OYNA 4HUEA 3OYCA 4WXOA 3RBEA 2YV0X 2ALZA 2YKNB 1HJRA 4RW6B 3G6VA 4FJXA 3PZPA 4CJPA 5DQIA 1JLCB 4IH6A 1RT7B 2VG6B 2W9BB 3SPYA 4URSA 1HNVA 1WSGA 4I7FB 4IFVA 1S97A 1TL1B 4W5NA 2ZE2B 1WN7A 5C42A 3MTKA 4RNOA 4CF8A 3PJWA 3ZSZA 3NL0A 4J2EA 1LW2A 4OJRA 5HBMB 3LP0A 5L1IA 3RMDA 3L2RA 4CJ3A 5F8NA 3LZJA 3OYFA 3CQ8A 3RAXA 3RTVA 1SH0A 4EBEA 1SL0A 3M9OB 3KLHB 3DI6B 1D8YA 3M9MB 1S9FA 4FW2A 5DG7A 1S6QB 3TABA 1S1WB 2F96A 2BGGA 5I42A 1T03B 3NF9A 4W5TA 3D0PA 3MR2A 4N47A 2IA6A 4CJVA 3VQAA 5KI6A 4GMJB 3SI8A 3Q8QB 5KG4A 4ZHRB 2D5RA 2OA8A 2JEGA 4NRTA 3VQ4A 1IH7A 3CM6A 3WNGA 1GOCA 1KLNA 3IG1A 3G6YA 3NGYA 1RBTA 2VA2A 1LW0A 4NZ0A 3VQ6A 3K59A 4ZPBA 4JS4A 3HVRA 1WAJA 4I9LA 4YQWA 3T5LA 3JSMB 2FLPA 4MIAA 1Z26A 2YKNA 4KAZA 2HNYB 3PX4A 4KFBB 4MK7A 2ASLA 3QEVA 1RT7A 2VG6A 1D9DA 4KHNA 1FK9B 2W9BA 1S49A 4TXSA 4IKAA 3NBPB 1TL3B 3ZT1A 1RTJB 1TAUA 4I7FA 2FVRA 3H5XA 1TL1A 4FJ5A 2ZE2A 3IN5A 5HBMA 2OPQB 4DSKA 4CIFA 1N5YA 3CO9A 1YTAA 3GV5B 3MR3A 3KLHA 3H5UA 4W5OA 2FJVA 4TY9A 2E6MA 3OS2A 1GX5A 3ZSQA 1S6QA 1S1WA 1REVB 3LAMA 1T03A 3VN5A 4FJNA 4I2QB 2X78A 4ECVA 1Z25A 3O4QA 4CHZA 1RT6A 1JLFB 1OS5A 3PJXA 2W42A 1RT4B 4ZHRA 4ZP7A 3L8BA 2OYQA 4K8XA 4H4MB 1T8EA 2W8LA 4GC7A 4W5QA 1L3VA 3SQ4A 1NHUA 1SKWA 3G0ZA 3GV7B 4ZTJA 5DGBA 2VG5B 1VSIA 4DSFA 3ZSYA 3QZ8A 3H4DA 3HL8A 2HNDB 3QNNA 1C0UB 2R8KA 3JSMA 4CJQA 4OPJA 4LSLB 1C1AA 2HNYA 4NRUA 1O1WA 1BISA 2Z1HA 3RRHA 1FK9A 4KAIA 3NBPA 1TL3A 4Z4GA 4O3NA 4IRCA 1RTJA 4EYIB 4EBCA 1QSLA 3LP1B 4CF2A 2RDJA 5JXSA 4DS5A 1LWCB 4E7KA 1S9EA 5KRSA 3CYMA 3AVNA 1W0HA 4DTPA 3QIDA 4E89A 3QEIA 2R8HA 1X9SA 2G8IA 1WNEA 3MFIA 1U09A 3P5JA 4CCHA 1UA1A 1REVA 2G8KA 4YNQA 4N5SA 1XR7A 3PW5A 3O3GA 4I2QA 4ZPCA 2HVIA 3PV8A 1RT4A 1UA0A 3SQ1A 1VSFA 3OS1A 4KBIA 2HW3A 4H4MA 3VQEA 2PYJA 1XR5A 3SQ0A 4MIBA 4JRPA 3M8RA 3PX0A 2VG5A 1TK0A 1SH2A 4IH5A 4O3QA 5E41A 2XY6A 2DFEA 3SFUA 2HNDA 3QIPB 3M8SA 1C0UA 4B9UA 3QEWA 4LSLA 1WSFA 3DMJB 3WNFA 2XC9A 2O4GA 1R0AB 3E51A 5T14A 3UQSA 4CEFA 4WFXA 4DL5A 4KTZA 1RTIB 3PO5A 5CZ2A 3KHGA 4FBUA 3TAQA 4H54A 3OS0A 3LP1A 4CGFA 3EYZA 2B5JB 4AHUA 1LWCA 3RR8A 4ECXA 1J9AA 4N76A 4JV0A 2QK9A 4OGCA 2XO7A 3PX6A 2A1SA 4E7HA 1NK0A 4MK8A 5J2NB 4DMNA 3ISNC 4TQRA 3T5KA 4O0IA 2GBZA 3K57A 3AO3A 3V4IB 4PQUB 4KHQA 2B43A 1XHXA 2E9RX 4B9NA 3WNHA 4Q0BB 2R8IA 3TQ1A 2WONB 2P5OA 2WHOA 2HB5A 2D3UA 3KK1B 3NE6A 1BQNB 3AVJA 2CKWA 4CK3A 3LDSA 3EPIA 3CJ5A 4BDZA 1TV6B 4RW9B 5DG9A 5KG2A 4TSXA 4F8RA 2HHWA 2JGUA 4X2BA 3QIPA 2GV9A 4K8ZA 2R8JA 3K5NA 4U6PA 2BQRA 5KFNA 4FJ8A 1UWBB 3DMJA 2E9ZA 4MQ3A 3GIJA 4B3OB 3TWHA 3ITHB 3QGIA 3TR8A 1X1PA 1A5WA 4EBDA 4KB7A 2DPJA 3AVMA 1RTIA 4QW9A 3C95A 2IS3A 2VA3A 3AVFA 2AGQA 1VSMA 3MEDB 1NOZA 1NK5A 4FLYA 4NLGA 5KFKA 1BCOA 3V81A 2A1RA 4RUCA 3MFHA 4FW1A 2YHAA 4CFDA 3NAEA 3OLBA 3KK2B 1VSEA 3T19A 2ZKUA 5J2NA 4CGHA 1L3TA 1KVCA 1VSJA 1JL2A 4QAGA 3RAQA 4CFCA 2XCPA 1YVUA 3O3HA 4KRFA 4CJEA 2G8HA 3V4IA 4PQUA 5F8JA 1IM4A 4XPCA 1BIZA 4DTUA 4F3OA 3NH1A 3NHGA 3MXJA 3DLBA 3SNNA 4RW8B 3LP3A 4URGA 4Q0BA 4FK0A 2WONA 1XC9A 2KFZA 3AO1A 3AA2A 2GIRA 4AHTA 3KK1A 5KGXA 4EZ6A 3CWJA 3VQ8A 1BQNA 5F8IA 3KK3B 4R0EA 4DFMA 4DQRA 4ED8A 1TV6A 5KG1A 3T1AA 3AA3A 4RW9A 5KG3A 3H40A 5KFCA 4FJGA 3DDKA 4H8KA 3I0SB 4O3RA 1XR6A 4IR1A 3KD1E 1TP7A 3QEXA 2DFFA 5C24B 4M41A 4Y2AA 1UWBA 3AVGA 3SUQA 5HP1B 3ITHA 3AVBA 2IBKA 1TK8A 1UOCA 4BE0A 4EZ9A 3MEDA 3SJJA 3KLEB 1SKRA 3LWLA 3HP6A 2R2RA 4RW4B 2VWJA 3L2VA 4ZPDA 1NHVA 5CYMB 3FQLA 4ECQA 4MK9A 3N6NA 1IG9A 1J54A 5KFEA 1S1TB 3KK2A 4IRKA 2ASDA 4K4UA 5I3UB 3NGDA 3KHHA 4J9RA 1RCHA 3FFIB 3NAIA 3KTQA 1JLEB 1ZBLA 4DTNA 1RT1B 2C28A 1T7PA 4NLRA 1S6PB 2ILYA 4FXDA 3ISND 3T3FA 1RTHB 5EWFA 1C1BB 2R8GA 4KTWA 3BSNA 4E7IA 4CGIA 1ITGA 4Z4CA 4C8MA 3AVHA 4F4YA 4KI4A 1TKZA 4FJJA 4E3SA 4TYAA 1U04A 3BR9A 3KK3A 3HPOA 3S3NA 2R2TA 4ED0A 3HSTB 3RR7A 3IAYA 2OPPB 1MMLA 3I0SA 3UR0A 2IDOA 4CIEA 3EZ5A 4PA1A 3NF7A 3QEPA 1JXEA 4IOBA 1U45A 2YHBA 5C24A 5EDWA 4DQQA 3DYAB 4QCLA 4FLTA 3OYJA 5HP1A 3NAHA 4O4RA 4CGDA 2FLLA 2RPIA 5KT5A 1JXBA 3GIIA 3HJFA 1W9HA 3EZUA 3ZT3A 3LALA 3S3MA 4RW4A 4ZVHA 3QLHB 4DG1B 4O55A 2WOMB 1HRHA 3SUNA 5CYMA 4FCYA 1KVAA 4OKJA 4OLAA 3Q8SB 1JXLA 1S1TA 5J1EB 3CFPA 5I3UA 1TK5A 4KI6A 3OL8A 1HQUB 4WZMA 2W7PA 5KFHA 4B9TA 1D5AA 2C2EA 3RRGA 1RT1A 1KFDA 2PY5A 4WXWA 1S6PA 2IAJB 4CF9A 3V6DB 3SFGA 4WYLA 1KLMB 2HHXA 1C0MA 1ZTWA 4DF4A 1QSYA 3NF6A 1C1BA 1FKOB 2J6TA 3AVLA 2IC3B 4XPEA 4FJLA 3Q8PB 2XY8A 5KFJA 5DGAA 2IMWP 3OYIA 3LZIA 1CXQA 1HPZB 1NK8A 4LH5A 4M95A 1G15A 2R2SA 3RB3A 1CXUA 1HARA 1KFSA 3VQQA 3TAEA 5L9XA 3PO4A 4HUFA 4H4OA 2OPPA 4Y1DA 3ZT0A 3V1OA 1FXXA 5EU7A 3DRRA 4XIUA 4CJTA 4DTOA 1SKSA 3SV3A 4DLGA 3V1QA 1N6QB 4DQIA 5D3GB 3EY1A 3ICLA 5K14B 2KZMA 4Q43A 1SH3A 4FZZA 4KHMA 2IM3A 3B6PA 4RW6A 4K4VA 3K5OA 3Q8RB 2AWZA 1JLCA 4BE1A 3QLHA 1T3NA 4DG1A 4WE1B 4DFKA 2WOMA 1QS4A 2FVCA 4QPXA 4CEEA 4NLYA 3P83D 4NYZA 5J1EA 4CERA 3I8DA 1HQUA 1NJWA 1T05B 4M3RA 4NCAA 4KHUA 4FJ7A 4ZP6A 4CFAA 4FM0A 4L8RB 3OYEA 4ECSA 2IAJA 2G8VA 1SUQB 3V6DA 1DTQB 4CHQA 1KLMA 3CIZA 4K4TA 2AX1A 3HK2A 3OLAA 3ZT2A 3HO1A 3DI6A 4M3TA 2JEFA 1FKOA 4C8OA 2IC3A 1NKCA 1S1VB 3PW7A 2B4JA 4KHRA 4O5BA 4FJMA 5J2QB 2BR0A 1HPZA 1S1XB 2RDIA 3PW0A 1RDDA 2W8KA 3U6FA 3FRZA 3D28A 2C2DA 2V0NA 4ELVA 2AGPA 1EETB 4FS1A 3U3YA 4Q44A 4C8NA 3PW4A 2YKMB 2BQUA 5KFUA 3OYHA 4CIGA 2FBVA 4XO0A 5D3GA 4NLPA 4E7LA 4ELTA 4QOZB 3ZSRA 1LAVA 1K1SA 4Z4IA 3LPTA 4RNNA 1XWLA 1A5XA 5KFVA 4KFBA 4ZP9A 3OYKA 1IKWB 4WE1A 3I0RB 3ULDA 3HVWA 5KFAA 2PYLA 4FZXC 3FDSA 1EP4B 3DLKB 1RT3B 2GC8A 3DRPB 4B8CA 4F2RA 5KFXA 3H98A 4DL2A 1T05A 2OPQA 1YVFA 1NK9A 3OL9A 4BWMA 4CEZA 4CHNA 1NJZA 4KO0B 1SL1A 3CJ3A 2KW4A 4OLBA 4B9LA 4WZQA 3AO4A 4ZP8A 4E0DA 1SUQA 3M9NB 1DTQA 4NLUA 4F4WA 2I5JB 4NYFA 1QSSA 2JEJA 3TAMB 3EPGA 1S1VA 2FBTA 4MH8A 3BSAA 5J2QA 1S1XA 2EHGA 3KLGB 4M3YA 1IKVB 1IKXB 3FQKA 2DPIA 4FYDA 5KT3A 1HYSB 4KB1A 4CEDA 4DL4A 1JLFA 4NCGB 2XI2A 1JLGB 3PHEA 4ED6A 4C8LA 3SCXA 1NJYA 4CEQA 1EETA 1BIUA 4ICLB 3IS9B 3QO9B 4PUOB 4CJRA 4ZVGA 2YKMA 3H5SA 3QINA 1T94A 2AQ4A 3OHAA 4DTXA 2RF2B 2Y1IA 1TGOA 4DTJA 1HNIB 3I5AA 3DLHA 5KFTA 1ZBHA 2AJQA 3KOAA 4W5RA 1C6VA 1EXQA 1RT5B 4HKQA 1JLAB 3OYBA 1IKWA 4IFYB 2WRMA 5F9NA 2D3ZA 3I0RA 2PZSA 4J9SA 1CZ9A 1EP4A 4Z4FA 3OYLA 3DLKA 1RT3A 3AO5A 1RYSA 4F4ZA 4CK2A 4KV8B 3CJ0A 1EKEA 3H5YA 1ZBUA 1U47A 4OKEA 4WYWA 3UIQA 4UQGA 4K50A 4KO0A 4YR2A 3S9HA 2HHQA 1B92A 3B6OA 4J9KA 4FLZA 4YR0A 4N56A 2F8TA 1RBVA 2I5JA 1JLBB 4IKFA 4QWEA 4HHTA 2QKKA 3TAMA 4GC6A 1B9DA 3DOLB 2B6AB 4Q5VA 4M94A 3IRXB 1ZBIA 3KLGA 2G8UA 1IKVA 1IKXA 3V9UA 4FM1A 2XCAA 3OYAA 1S1UB 1HYSA 4Y1CA 4DEZA 3TAFA 4MFBB 2KTQA 3IGNA 5KG6A 4NCGA 2V4RA 2AX0A 1JIHA 1JLGA 3L2WA 3S3OA 1K6YA 4PWDB 4ELUA 4ICLA 3IS9A 5KG7A 3QO9A 4PUOA 3UDLA 4K4XA 4AHCA 4FZYA 1X9WA 2WK4A 1KCFA 3ZSOA 3TANA 4ZPAA 2RF2A 2FLNA 1WAFA 3BGRB 5KTQA 4KSEB 3CDEA 1BGXT 3L2QA 3VQPA 3OVNA 4ZMMA 5KG5A 5DK5A 1NK4A 1RT5A 4J9PA 1R0AA 1JLAA 3SI6A 2OPRB 4IFYA 1BI4B 4NLDA 4CHOA 4FK2A 2XGQA 3BQ1A 5KFFA 4EO8A 2B5JA 4DWIA 4KV8A 4FS2A 2D0AA 4DFJA 5T7BA 1LWEB 3V9WA 4DQPA 3NMAA 4GVMA 3KMSA 2OZMA 4QW8A 3RMAA 3LPUA 3A2FA 3SYZA 4LQ3A 2HWHA 2HHUA 3MXMA 1JLBA 1ZTTA 5CYQB 4DL7A 4K4SA 2RKIB 3QYYA 3DOLA 3U3GA 4EP5A 2B6AA 1JX4A 3IRXA 1I3AA 5KFBA 4YMEA 4NLWA 3KHLA 1WSEA 1TAQA 1C0TB 4J9QA 3LP2B 4MFBA 1D9FA 4E7JA 4NLQA 4M45A 2EX3A 3PR4A 1ZBFA 4J9LA 4PWDA 2HAIA 3NH0A 3KJVB 4M3WA 2UVWA 1MU2B 3CM5A 3OYDA 3ZT4A 2C2RA 4IQXA 2BE2B 3HXMA 4CESA 3C6UB 5CY4A 3CFRA 2I1RA 4TN2A 1X9MA 3BGRA 1VRUB 4M3XA 2UVRA 5L1LA 2V4QA 3GYNA 2AGOA 1LV5A 4CJLA 2JC0A 4B3OA
chains in the Genus database with same CATH superfamily
2GW8A 3UE2A 1HD0A 3GR0A 4DF8A 1PYSB 2MKHA 3U7JA 3I9V9 2BUPA 3HFZB 1VIXA 3A3OB 4JLHA 3CDWA 4TU9A 4A8FA 2DNZA 3B8HA 1RADB 4DR6K 4OZ3A 3W7BA 4UQTA 4JV2A 4ECZA 1GK8A 3EDRB 5F8HA 4OJ3A 3HLUA 4BR2A 4LIWA 1XERA 4HTIA 2RKIA 1K8KB 4EHUA 4K4ZA 1VRTB 1HNZJ 4KH4A 2ZOGA 2M5YA 2NRWA 4IO8A 1UVLA 4ZVSB 1WNSA 4N7TA 2HMIB 5IFMA 3LP2A 1YG0A 2KM8B 1NRKA 4U8YA 2KXFA 2C2NA 1NM1A 2JEIA 3MEGB 1BCMA 5ETOA 4U7CA 2LQ8A 2VJVA 1FE4A 4YHHK 3C6UA 4U9RA 3F9MA 5D0GA 5KT7A 3AA4A 1R6YA 3ZZPA 3CMES 4EO6A 3GILA 1VRUA 1MMNA 4C11A 2NNWA 2RDDA 2J76E 1TKTB 2NLXA 3AVIA 3EO3A 3PR5B 1DTTB 2ITGA 1FJGK 4P2XA 4CGGA 3A13A 3HPHA 1X4AA 2VQFF 3WT0A 5GIOA 1NDKA 2HK2A 1UTAA 2HRYA 4DTRA 4NL5A 3M8QB 4KB0A 2VGMA 2BVZA 3FZHA 5SWMA 3CFOA 3KJNB 1N36J 2C3YA 2ZBIA 2FYXA 1GXUA 4FP9A 5FRNA 5J2MB 4LF8K 1RK8A 3TVKA 2ASJA 4UOCA 2YNGB 1ASUA 1IJJA 5HMZA 3O9SA 3FFIA 1UETA 3JTPA 4DV0F 4G1QA 1CVJA 4H0YB 3UDEA 2PEBA 3Q7CA 3V1RA 4WFYA 4ECTA 2FGOA 1MNEA 3JYTB 3ZSXA 4LSNA 4X66F 2W7OA 1RTHA 1HR0F 2CZ4A 3FJ2A 4DI6A 1TVRB 1C0GA 3RGIA 2DB1A 1QQCA 2A40A 3P39A 3PG9A 4KYZA 1N5YB 1Q8BA 1SV5B 1FRXA 4LFCF 3L3CA 1PIEA 1PJ5A 3DLEB 4GRSA 3KLVA 4O23A 3OBYA 1NLKL 3W61A 4UOGA 2BANB 1N4LA 1NKEA 1I3OB 1JLQB 3DYAA 3X3UA 3BS9A 3L2UA 1RT6B 4A48A 3UVJB 1BQMB 5EWGA 3VVUA 4DCJB 2G2ZA 2KHCA 3WC0A 3FCVA 2AT1B 4X4NA 1V9OA 3TPQA 4MKBA 5KFRA 1IBKK 1RHQB 1FRKA 3V9ZA 5KRTA 2Q3PA 3C7NA 4CECA 3O9TA 2VUGA 4WJBA 4FLXA 2UXBK 4ANEA 4ES2A 2MHEA 3W2WB 3P5BP 3N4WA 2FVQA 1QE1A 4M5JA 3AD8C 1A5VA 4HUGA 3ZTQA 1XK8A 2E44A 1LWFA 2YNHA 5JS1A 4X65F 2FJWA 2HBQB 3JSBA 3CJKA 2DR7A 4KPYA 3OR2A 4LFBK 2H54B 1IBLK 4KHWA 5HRRA 4DX7A 4DR6F 2GVZB 3HVTA 1MWYA 5U47A 3BGLA 3HKZD 3BZQA 3LAKA 4CE9A 1KHVA 2QA1A 2ZNYA 1K47A 5HANA 5GMEA 1PGZA 1VQKS 1KHWA 2BJ9A 1IG8A 4RU9A 1N6QA 2FBXA 1XMOF 1M5OC 4CLWA 4M3UA 3DLGA 2HF4A 4I6MB 2KKHA 2HG4A 3UDCA 4EYHB 2ATCB 3ZTOA 3QGHA 1OH7A 1U1QA 4BG8A 3QFPA 2CG8A 2J5AA 1O0PA 2E6LA 1IXKA 5IT9U 2ZHOA 1F21A 3DRSA 2KG1A 1KR4A 3D3BJ 2CQIA 2EFPA 2WVEA 1PYTA 4Y00A 2OAUA 3FLCO 2GMJA 1HX1A 1QY7A 4BRCA 5A0YA 1N52B 2AJ1A 3BO3A 4OZLA 1NDPA 2E88A 5CH7B 1S0OA 2DFHA 1QM9A 2EPIA 1ATRA 2ZZMA 4GMKA 2MSTA 1C2PA 1FJCA 3S01A 4LF9J 4J2DA 3MR5A 4NMXA 4C3KA 2ZEJA 2AYEA 1PSDA 1FERA 1YXQA 5A2QO 2ZJPQ 3AVAA 3C14B 2YX6A 4PHTX 3OTOK 1J5OA 3I56N 2I38A 4MJKA 1VSLA 4CH1A 5JUMA 4QWAA 3RBZA 4DTMA 3Q86A 2PMZD 2W1BA 2NUHA 1KDNA 2CAJA 4B9SA 2E5IA 1HBMB 1L5UA 3AQPA 4I2PA 2V8GA 3AARA 5F3ZA 2KYZA 4KKOB 4FLVA 2CPYA 3PLAA 3F56A 1VQ7N 4DSJA 4CHYA 3MM8B 4CJKA 4BR4A 4CO1A 3UCZP 5HLFA 1U48A 1RAHB 3T7ZA 3HHEA 4DU1A 5HQ8A 4J9MA 4DB3A 4BDYA 2DNNA 4IDKB 3IM9A 5F3TA 1NZ8A 4HHJA 1L3UA 4WFNL 2DY4A 3ZSWA 3V81B 5A8KA 2IFXA 1FA0A 3CPWR 4O44B 2HQFA 3OT9A 3VAKA 1YJ9N 2NREA 1S9GB 2I9SA 2OEKA 1IKYA 4DFPA 4Y3CA 3TUPA 2CQ2A 2LQJA 4C4WA 1WG5A 1CSJA 4NLVA 3RMBA 1HQEB 2K7KA 3E1YA 4LD0A 3HHKA 1WORA 4K42A 5CAAA 5EWEA 2XYGB 3OV7A 3KLFB 4CZHA 5ETQA 5GAHU 1HNIA 4OYPA 4WTYA 2KJVA 4X64F 5MLCQ 3JAMO 3SIPB 4CLTA 4ZKAA 2BQ3A 2IRUA 3I5BA 1FCAA 2QO3A 2B9EA 5KFZA 1I1GA 1K9MO 4JAXA 1X8DA 4RG8A 4YB6A 2IVOA 1RHMB 3PUFA 3UD5A 1FX4A 5DM6Q 2XMJA 4IOCQ 4DLEA 3EE3A 2VBWA 3MUVP 1GX6A 3O3FA 1SIWB 2O8EB 4HVJA 3VQ9A 1F9FA 2ZITA 4LQ9A 4JI3J 2CJXB 1Q82T 1WF2A 2JH3A 4G1PA 2CUYA 2QL5B 3HKWA 3SQOP 3C94A 4CLKA 2XY5A 3MCSA 2R7OA 1QAJA 2N3OA 3BKTA 5B0AA 3K2PA 3SAHA 3CQXA 4CLLA 2QIFA 1DLOB 1IJEB 2CGJA 3TUJC 4I6YA 4E19A 4OL8A 3FK4A 3L3VA 4FSVA 1DZ5A 4DPWA 3TP2A 1SC4B 2C22A 3TAGA 3DM2A 1GTEA 1ASWA 3DOKB 1FKPB 3IGVA 5KG0A 3SQGB 3J80U 3FRYA 3S6EA 5HMXA 3C6TA 4IG0B 2CVEA 3QRPA 4N77A 3D0IE 3BV8A 1FTCA 3SSRA 3OUYA 1UVKA 4R8UB 3D2FB 1B9FA 1NK6A 4CBWA 3SMPA 4DUYF 1EB0A 5DQGA 4AQYJ 4B3TF 4KHSA 5GAHP 5AZJB 4K4WA 2HRTA 2F8SA 2G8WA 4YN3B 2MLZA 5AQQA 1ZAXA 2YNFA 4R5PA 1IN0A 1UAXA 1RBRA 4L6V3 2R7YA 2JZ5A 3ZSVA 2W25A 5L1KA 3OTOF 3D0GE 3QESA 4TLQA 1KRPA 2V7ZA 4DV1J 5IWAJ 5DDQC 2GMLA 4CZMA 3PVXA 4NOHA 2XWYA 1HNVB 5L8RC 2EFQA 5GAHI 4NYNA 2OZSA 5C42B 1CEZA 1LW2B 5KFQA 3KKSA 4E8UA 5AQLA 2GVDA 9RUBA 2GGPA 1NB7A 4BS2A 2K7JA 4BE2A 2ILZA 3G4SS 4BHQA 5E84A 2HBRB 1Q9YA 2QN6B 4DR3J 5LL6d 5BR8J 3KYLA 2UVUA 3AB2B 2I0XA 3C65A 5GAGU 4B3RK 2Q2RA 1K8AO 4QU7A 1R31A 2IY5B 2D3O1 2QA4S 1S5JA 3TWZA 2CQHA 3ZTRA 1VQ4S 3OSNA 1HMVA 4FK4A 2D4WA 2OP5A 1VIOA 4CJFA 3OL6A 1RAJA 1LW0B 3BF1A 2R7VA 3UPFA 3OYNA 2WVBA 4JI5K 4LF6K 2GJIA 1Y5NB 2CPEA 4RW6B 3G6VA 2RE1A 3PZPA 1JCFA 1JLCB 4QR1A 5KAKA 2QXLA 3SPYA 4JI6F 1WSGA 4I7FB 1S97A 4AXIA 4CNYA 3UDVA 3MTKA 4BRIA 4ILLA 1EWRA 4J2EA 3VWSA 3ZEUB 2H9ZA 1S12A 5F8NA 2ERRA 3DXMB 5AQTA 4PAAA 1F5CA 1SH0A 2YQ3A 4P74A 2ZVIA 4Z94A 3OD2A 3Q83A 1D8YA 3MX5A 3M7VA 3W65A 1S6QB 2GO8A 2F96A 1T03B 3EKSA 3UI3A 2CJYB 2MJUA 3DDNA 1NLVA 5EVZA 3UKUB 3D0PA 1PBUA 1WTFA 4GMJB 5AQVA 5ETSA 4PYDA 4YOTA 1D4XA 2RT3A 1KVIA 1IH7A 1O51A 1HWKA 3R3TA 4CD3A 3C16B 4DV4J 3G6YA 3GMGA 4GVEA 1RBTA 1MWQA 4JI7J 3P96A 2VF3A 4DV7J 2QWQA 3O4WA 2HK3A 3F44A 3T1HF 3HHLD 3G8TA 4BRLA 1FFGB 1W2BM 4JHDB 2UUBF 1FK9B 4WP9A 3NMRA 2A6AA 1TL1A 3WQTA 2ZE2A 3EMTA 1AFJA 3FGVA 2APOA 4QJVA 2RHSB 2CGKA 2V6AA 1M5KC 2P9KA 3T1YJ 5HL7Q 5GAGI 4TVAB 1YI2S 3JS6A 1T02A 2KT2A 2HOEA 4M63C 3KLHA 2XMUA 4JV5J 2E6MA 3ZSQA 2FSKA 4IWVA 1OVQA 1S7IA 1NNEA 3HTVA 2YHYA 4BRPA 2DR5A 2H4WB 3D2EB 3GYXB 4NYPA 1K0TA 3UCUP 2GHVC 3O4QA 4CHZA 3PYDA 5AT1B 1WC3A 1HJOA 4ZHRA 4ZP7A 5D6GA 2OYQA 4K8XA 4DR4F 3E8OA 1IJFB 4NEZA 4KPCA 3H8YA 2N7YA 4G65A 3QZ8A 5F0WA 4G1IA 1C0UB 3Q2SC 4OPJA 4ENOA 1H2TZ 2Y8YA 4OI0A 3CNQP 2CWXA 2QWMA 2O3DA 3RRHA 1E6VB 3DFEA 1QSLA 4NI2A 1GEHA 3LP1B 1TMMA 3MUTP 2LQBA 1N34J 1M5PC 2IJRA 3CYMA 4IOXA 3H46O 5GADU 4JN4A 2CQ1A 5IT4A 1FDAA 3IAM9 4CO4A 5RUBA 3R1LA 1U02A 1R8PA 3WIUA 4CCHA 1ACMB 4WWSA 1OYEA 2F1FA 2OTLS 1REVA 3NS6A 3W9HA 2DCLA 3CGIA 4J90A 3PW5A 3O3GA 2UXDK 2YHXA 3IBCB 1KTVA 5A76A 5HATA 3W62A 2HHHK 2P9CA 3SQ1A 1XMQF 3OS1A 2EFVA 3VF0B 2ASOA 4H4MA 4NX9A 3RRKA 2PYJA 4JRPA 3PX0A 3MGJA 1YLXA 2HSEB 4LUBA 4JI8F 4IH5A 3PSIA 5E41A 4LR9A 3SFUA 3QIPB 3M8SA 1M90O 3C6AA 4B9UA 2M9KA 1GMVA 3DMJB 2RQMA 5T14A 4CEFA 2A3JA 4WFXA 1N33F 4JKGA 3D9BA 4FBUA 4H54A 3D54A 4QIGA 2BJDA 2E7WA 4F0MA 2AYMA 1W7AA 4HI1A 1NZAA 5A8WB 3CCJS 5AQHA 3MOZA 1RHKB 1N5SA 3ILLA 4DMNA 2BE9B 3T5KA 1CC7A 5AQJA 2P8IA 1VJQA 4CO3A 3V4IB 2O8BB 2B7BB 2PSZA 1SAZA 1S6UA 4B9NA 2VZ9A 3J8AA 4QQBA 4Q0BB 2F4VF 2HB5A 3ET6B 2JLFA 3VENA 3B8AX 4PR6A 2QLJB 4FZVA 2ZM6F 1NG9A 4BDZA 2M4MA 3GTYX 4RW9B 4IOCL 1O6XA 3MM6A 2KT3A 2MXYA 2VOPA 3CC4S 4K8ZA 5D4NA 3VESA 5GADI 4FJ8A 4GKJF 4DV6J 1H38A 4L72B 3TR8A 1JJCB 2OD4A 2RD5C 2LFVA 3OXGA 1BOTO 3AVFA 1VSMA 1NUEA 1Y0HA 4YDXA 5AXLA 1YJNS 3SDEB 4NLGA 1BCOA 1KN6A 2R7SA 4FW1A 3R1XA 4H0OA 1LOTB 2MQLA 3SCLE 1MWMA 4O5FA 3R5JB 4CI0B 5KQ8A 2Z56B 5J2NA 3FEXB 4IUFA 3BZKA 2CFXA 1KVCA 1VSJA 4DV2J 1JL2A 4OQJA 2XCPA 4KRFA 3VVTA 1W2BR 2KRBA 3JQMA 3WXKA 2ZZTA 5F8JA 3IMXA 4ID8A 1BE4A 2HLTA 4JI1K 3DRXA 3MXJA 3AB4B 3DLBA 5J1PA 4LF4J 2CPDA 2M88A 2WONA 3DXSX 3VMFB 1FNMA 2GIRA 4AHTA 3KK1A 5KGXA 2GO9A 5HSPA 3VGTA 8ATCB 4ED8A 1D3WA 3T1AA 5A8RA 3AA3A 2G13A 4GO5X 1HNXK 5IQQA 2K2PA 5KFCA 1U8WA 5GAEP 1NM2A 4O0NA 2UXCF 2OCEA 4BRNA 1WBBA 4IR1A 1YDLA 4LBPA 4FF3A 2DH8A 3CI5A 1DT9A 1DQ8A 4M41A 4RWXA 3HD1A 1T9TA 3AVBA 4JBCA 1VQ8N 4LJMA 5E2QA 3ULEB 1FKAF 3WC2A 4ISEA 4BE0A 1UFLA 3MEDA 3KZBA 5CABA 1K0VA 2R7WA 3SJJA 4I0WA 1NGJA 3L2VA 1GNKA 4ZPDA 5M1OA 5CYMB 4ECQA 3CCUN 3N6NA 1NGBA 1UJ5A 3OFHA 3J7AN 2ZNZA 4IRKA 1N8RO 5I3UB 3KHHA 3GG1A 3FFIB 2XLJA 4DOZA 2MKJA 2M7SA 4PZVA 1ZBLA 2XLIA 2J0XA 4MTPA 3O5TB 3T3FA 1XNRF 1YRTA 1RTHB 3T9ZA 2ITMA 2L9DA 1C1BB 4H0XB 3TU5A 3U4LA 2D69A 4CGIA 1ITGA 4ILGB 4A47A 4NA2A 2WSEC 1U04A 1CULA 2FHMA 2R2TA 2A18A 4PPDA 3QWPA 3RR7A 3IAYA 2IDOA 3MCOA 4PA1A 1U45A 3RUBL 2J0WA 2YHBA 3VCDA 3NNCA 5C24A 2HYIB 4OHVA 3DYAB 1SJ4P 1VQ5N 4KT0C 2IIHA 1UEVA 1W9HA 4LR7A 4R25A 3ZZ0A 3FFKB 1FRHA 4P52A 2BZ2A 1R8AA 3NP5A 3DHXA 4ZVHA 4O55A 1ICEB 4F0HA 4FCYA 1KVAA 2Z8QA 5J1EB 2L9NA 3CIMA 4KI6A 2MHNA 4DZ6A 5KFHA 1IBKJ 2P6SA 5G0RB 4Q7AA 1V5VA 2NRTA 1KBRA 1S6PA 3BKUA 4C3MA 1HW8A 3SFGA 4NXNF 5EHHA 1ZTWA 4DF4A 1VBXA 3NF6A 1FKOB 3AVLA 4A61A 4FJLA 3WX4A 2IMWP 3LZIA 4K0KF 1CXQA 1NK8A 4M95A 3OBWA 1G15A 2Q1LA 2HVEA 1RI7A 4QR0A 3TAEA 4EUVA 1SB6A 4KH6A 2D1KA 4CLPA 3D6RA 1IBMF 2OPPA 1IBLJ 3ZT0A 1HBUA 3V1OA 3PFOA 3DRRA 4NPOA 5C15A 3ZYYX 1N6QB 2EK6A 3DGPA 2KN4A 5D3GB 3ICLA 4DZDA 4I56A 5HJYA 2VV5A 2IM3A 4YOXA 2CDRB 5H9FK 1NWKA 2VH7A 3QLHA 4BGBA 4CEEA 4NLYA 3P83D 1HI1A 4NYZA 2G2YA 4DL0C 1NJWA 3SJHA 1VQ9S 3DDIA 4OYBA 1ZM2A 4Y65A 1X60A 3LL3A 1RFQA 4MYUA 2AX1A 3HK2A 4WFBL 4M3TA 2KXHA 1E6YA 1VLYA 3O9RA 2IC3A 2DIVA 1E4GT 5J2QB 1S1XB 3PW0A 1RDDA 3DJCA 4DR1F 1GLAG 1WG1A 5IV4A 2P9UB 2RJZA 4JI0J 4FS1A 7FD1A 4KC5A 3PW4A 2YKMB 1VFJA 2BQUA 1G4CA 2BW2A 3WXLA 2RQCA 5DO2A 3AH6A 4DR5F 5LJ3Y 3HX9A 1LAVA 3H3OB 2HS3A 1REGX 5KFVA 4KFBA 2BUNA 2HKEA 3Q8YA 3KUHA 3OFFA 1S79A 3OYKA 1OVYA 3K0SA 3A0IX 4P73A 4FZXC 1HFEL 3A5NC 3HHLA 2YCHA 2HZAA 4X4UA 3MN7A 4K41A 4F2RA 1CBKA 4DL2A 1YVFA 2WUSA 3Q24A 1NK9A 1CQMA 3OL9A 4KO0B 3DXBA 3CJ3A 4B1UB 4WU2A 4OLBA 3M32B 4QBUA 4ES3A 4B3SJ 4B9LA 4WZQA 1OJ4A 5HI7A 4FOIA 3LGMA 2JEJA 3TAMB 4DDFA 4FPIA 5A8KB 1V3SA 4QPTA 5FPEA 3WEEA 2B4VA 4M3YA 1AZSA 1IKXB 2WBRA 5CHCB 5KT3A 4UT4A 5C2DA 4WTOB 4NCGB 2ZHAA 3ETOA 1EETA 2E1PA 4M5HA 3H5SA 3IUCA 3QINA 2BMBA 3QJJA 1U1NA 4A8WA 4DTXA 1RGIA 1RP5A 2CQPA 3KWMA 2W41A 1HNIB 3I5AA 1FEEA 4PQAA 5KFTA 4CTAB 3GJSB 3I55N 2AJQA 3CJ7A 3CJQA 4HKQA 4PKIA 4XH5A 2V51B 1JLAB 3OYBA 2WRMA 2UU9F 2KL8A 2HBKA 3WQPA 5ELZA 2O8DA 4PABA 1EP4A 3OYLA 3DLKA 1RT3A 4U95A 3TA0A 2LU2A 2ADBA 4CP5A 1YBUA 4NXMF 4RKUC 2E20A 1U47A 4OKEA 4QR2A 2FF3B 3I56S 3UIQA 2DVIA 1B92A 2V9KA 2KM8C 2HRUA 3B6OA 4Y6IA 4FLZA 1Q4RA 3N5BA 3TRGA 3CJCA 4HHTA 1XC3A 1J6ZA 3DHWC 2L41A 2IVMA 4OLPA 1RBAA 2DO4A 2W6KA 3KLGA 3MR7A 1IUJA 3V9UA 1GMUA 2CH5A 1VQ7S 1RWOB 3C2PA 4ANDA 3G87A 1WI6A 2KTQA 3D2WA 4PG7A 1JIHA 1JLGA 3L2WA 3S3OA 3PIOQ 4GKKJ 2X1AA 3IR5B 5KG7A 3UDLA 2VC1A 2B51A 3EVWA 3AODA 4NLCA 2RF2A 3JXUA 3I31A 3BPSP 3SXLA 2FY1A 1BGXT 1H0HB 2F7VA 2E7XA 5E7OB 3VQPA 4DU8A 4ZMMA 3A3PB 5KG5A 4RR5A 5DK5A 2W2PP 1YJ9S 1RT5A 4CZFA 4IFYA 2ZDPA 2IHR1 4CHOA 4FK2A 4IO1A 2P9LB 3A8YA 3BQ1A 2FQQB 2B5JA 3A1YG 2X3DA 1JCGA 2M70A 3O1WA 4DFJA 1LWEB 3TJ9A 4DQPA 3A8KA 4USJC 2WTUA 1BWEA 5LOQA 3WXJA 4HDGA 4YOUA 2F8HA 1X9JA 2X1FA 1FFSB 2HHUA 3IFEA 4IEIA 2GHPA 3EXYA 4WFAQ 3QSIA 3QYYA 1Z2LA 2EEYA 5KFBA 3AAQA 4NLWA 4PPZA 4M5DA 4RPFA 1ZA1B 4J9QA 2P9IA 1RDUA 2QG9B 3BZCA 4JD2A 1TFWA 3MPVA 4NLQA 4PG5A 2R7RA 4JI2F 2EX3A 5LSOA 2UVWA 2XWXA 4DMZA 1I94J 3JQJA 2C2RA 3FUYA 5IT9O 3HXMA 4CESA 4X4VA 3CFRA 1X9MA 2YJFA 3QT8A 4A8YA 1SJRA 4TU7A 3CCRN 4BLGA 2V4QA 3B4DA 3GYNA 1LV5A 4CJLA 4E98A 2KFNA 1HWUA 1BL3A 2VFUA 3ENHA 1N48A 5C25B 2QKBA 4LRFA 2YI1A 1KXPA 3C15B 5F8LA 2MZQA 1X5SA 1YJUA 3THPA 4B3RJ 1IV0A 2RSQA 4YB7A 2NSBA 1VK0A 5LJ5Y 5SZTA 3V6HA 1CJVB 3E01B 2XRIA 3JXOA 1K9MT 4DL3A 3G10A 4DR2K 3C6HA 4Y0FA 1K44A 2H5IB 2DNLA 4FXVA 4QWDA 1YQHA 3W0LA 1KQSM 2LQ5A 3OJSA 1NOYA 4Q8FA 3K9JA 3L4IA 4GVBA 2BDPA 4I9QA 3KJVA 4YB1P 1MU2A 1UKUA 3ENVA 1NH7A 2O8FB 3LWMA 4HACB 3F73A 2CPFA 1RU2A 2V8HA 3NGRA 3Q0AA 2E66A 5KFYA 1IWAA 4ED3A 1OPIA 1F5BA 2P51A 3N6LA 5E0OA 1NAQA 2OMOA 5ETNA 1UCNA 3KLEA 2HBZB 3NF8A 3CJTA 1QJHA 2ZZNA 4RBTA 2HQGA 2E2OA 1WSHA 4LF7F 5A2QU 4HCCA 2CNNB 1GTHA 4JK9A 4CO2A 5HROB 5MLCV 1KVJA 5LMNF 1HNZK 2ATQA 3VHQA 5F8GA 2FJDB 1V6HA 1RAAB 4USMA 1YWXA 3TARA 1NDLA 2D41A 4KHPF 4L74A 4XAKA 4DPXA 1K8KA 1T9WA 2IM2A 1VRTA 4JKBA 4BCAA 1YJ7A 2HVZA 4CLZA 4DX8H 3SUPA 3I8BA 3IWXA 4CHPA 2HMIA 4C98A 3SUOA 2PMWA 4DV3F 1QQOA 2DK2A 3D6FB 3MEGA 2YHWA 2DTUA 5IZHA 4USTA 3NS7B 3MCPA 2B4UA 4AM7A 1ZYQA 1E4FT 1Q7LB 1BHNA 3O4NA 4OMFG 4CW7B 3OYGA 2VDHA 1TKTA 3LDNA 3QBWA 3SCKE 5KFOA 1DTTA 2OO4A 1NJIO 5TKWA 4ECWA 1SQEA 9ATCB 2AEJA 3MF5A 4B1VA 1T6CA 4OX9F 3RMCA 1S0MA 2HURA 5FJ4A 4KHYA 2D74B 4PG6A 3L6QA 1GT8A 3M8QA 3W8PA 1BHLA 5KT2A 2CJBA 4WK1A 5J2MA 4JUZA 3SMZA 3QATA 5KFDA 4FKXA 3AA8A 3H1QA 1FTRA 2E9TA 2HEKA 1X4DA 2W4DA 2YNGA 1ILYA 4FYXB 3CCTA 2O67A 2DHXA 1PC4A 3JAMU 3MOJB 3D6MB 4F7VA 3H2VE 4RW7B 3MEEB 3JYTA 1CJUB 5BN9A 4ZVUB 1P1LA 3J80O 2G8FA 2GX8A 1RHRB 1TVRA 4YDDB 5EX5A 4CBUA 3HM8A 4TQSA 2I8EA 5EUHA 1FRJA 4YY3J 3O5BA 4ID5B 1OQ6A 1SV5A 2HFVA 4RBUA 3LA0A 1GOBA 3DLEA 1F3FA 5J1NA 5AXKA 1JKHB 2BANA 3DNCA 4HTUA 2QL9B 1JLQA 4Y34A 3CMAN 4IDHA 1CQNA 3ADAC 2FC0A 2O5DA 2KYXA 2H51B 3R2CJ 3FR0A 3KHRA 5K14A 2EBEA 3UVJA 1BQMA 3GG0A 1QHTA 3OTCA 2NXNA 4I68A 1VBYA 4PWWA 3NGIA 4LF5F 2BACA 1P27B 1DQ9A 2UXDJ 3FSIA 5B0EA 2FJXA 2H5EA 2P1JA 1S5ZA 2A6MA 2JOQA 3KNAA 4M42A 3VETA 4Z37A 3L4BC 4ZCIA 2BABA 5KFIA 4X4PA 2F40A 3D5MA 3ZZZA 4AF1A 3RB4A 2WVDA 4J7CA 4WP3A 4QS9A 3W2WA 3QGGA 4WK3A 4BGAA 1SBRA 3QERA 3R7SB 2QT7A 4G3IA 1LEOA 1Y5IB 2E2NA 2ZH6A 4YOEA 3LANA 2BM1A 1JJ2M 3MMAB 4BVPA 4J9NA 4PCQA 3ZX3A 2LVWA 2BJEA 2YNIB 3TSQA 2W9AA 4OPAA 3N6MA 1J5EF 2YH0A 2GVZA 3W3SA 3MAQA 3IP0A 2Z2ZA 3D45A 2HHVA 2POKA 3VQDA 4OV1A 5DS7A 4OPKA 4ZTFA 1MWZA 3EJMA 2Q97A 1T3VA 1UMJA 3VZHA 4UY8O 1VHXA 1KQSR 4ANCA 3CJ4A 2U2FA 1N54B 5KFGA 2MSSA 1YJTA 2ZD1B 2GWJA 4BR0A 1X0PA 4B8AB 3ATUA 1RKJA 2OLWA 2CJAA 3OVSA 3TNVA 4FVCA 4FF2A 4X66J 3K5MA 2V9WA 1HR0J 3CULA 1RTZA 5DZ6A 2PFDA 3H59A 3T41A 2EI5A 3E3XA 3AT1B 3QRRA 1KQKA 1OH6A 1TKDA 4LC9B 1N5TA 3CDBA 1N36F 2OMLA 4LFCJ 3TI0A 2OANA 3R6MA 4F0KA 4GVLA 3H4BA 3MWTA 4NLXA 3HI9A 3IBFB 4PY5A 3LF0A 3FVYA 4LMZA 1YRXA 3M8PB 2OTJN 2DNOA 4RBVA 1BXNA 2RHQB 2O4IA 3AOBA 3QETA 3SAFA 2KO1A 2UP1A 1TUGB 4ZJOA 5DLFA 1X4FA 4FXWA 1X5PA 4KBOA 2XHBA 1CS4B 1FWKA 3C14A 2VB6A 2GTDA 5IS2A 4LBHA 1VR6A 2ETJA 3UO0A 3GIKA 2HLUA 1WUUA 2MQ8A 2VQEF 4AH9A 4IG3B 2RRNA 4MKAA 2Q0RA 3BO2A 4HDHA 1U2VB 2MKYA 1HBMA 1RCOB 1U7LA 3T5HA 1TYQB 3OFGA 3HYFA 3NGKA 1S48A 2BJ3A 4BQZA 3QT5A 5L1JA 4KKOA 5M1NA 3K58A 1OKJA 3OY9A 1U4BA 5ETPA 3MM8A 4W90B 5AZIB 2LSNA 3LGHA 1EIYB 4CFBA 1FI4A 4DL6A 5CZ1A 4FJHA 2YWEA 4X65J 3UWTA 3UKRB 1CZBA 4QS7A 5BXIA 4IDKA 1RDRA 1M90T 3BR8A 3CT9A 4RLEA 3OSPA 4KTQA 1CLQA 2FVSA 4CJ5A 4O44A 2BJ1A 3S7RA 5B0BA 1S9GA 4NASA 1QTMA 5AE2A 1RILA 4DTSA 3PTWA 5C0YA 1XMOJ 3RB6A 2QC3A 3QNOA 1HQEA 4ISFA 2LA6A 1NO8A 1SQGA 4OVLA 4XH1A 1PG5B 2DRBA 3KLFA 2GX9A 4FLWA 4TYBA 1EZZB 2NZTA 5BRDA 2XEXA 2JL9A 5AE1A 1KSPA 3M2RB 5CZVA 2ZH9A 3CEDA 3RG6A 4KGZB 4DN0A 2WAQD 4DX5A 2C2ZB 2W2MP 1VSKA 2Z2YB 3MCNA 2NZ4A 4MO4A 5JVHQ 2QLXA 5A6WA 3CSKA 2QV6A 3DRYA 1GXTA 1YK9A 3RW6A 3TUZC 3VA0A 4JI3K 4O8UA 4JI4K 4I64A 2O8EA 1CPZA 2XG8A 3R9LA 3AV9A 2AJ2A 4I6AA 4F4AA 2VBXA 3I9ZA 2RN2A 4DSIA 4IFVB 2J6UA 4GV6A 4HWIA 1D0EA 3H2UB 2ZGZA 3EE8A 2ACYA 1DLOA 2QA4N 1VQ8S 2AF6A 1QUVA 4A8SA 1TR0A 1VCTA 2C3PA 4A4JA 3M5RA 4U67L 3DOKA 1FKPA 1JJ2R 3SQGA 4CO5A 4IG0A 1S99A 3P1GA 5I42B 3CCUS 1XNQK 4AQYK 2Y1JA 1W2IA 2WB4A 4LF9F 4R8UA 5KT6A 4CT9A 5SUHA 3ZXWA 5LMUF 3F9KA 3PCOB 1VDHA 3I96A 3MCMA 5AZJA 2NUBA 3DRRB 1W25A 3D7EO 1VSDA 3TAPA 3IG1B 4NCBA 2AP6A 4RNFA 3RJMB 3GIMA 5IWAK 3IWLA 1UEKA 2BOAA 3U27A 1RWXB 2V2KA 4H4KC 3OYCA 4WXOA 5FLXY 2AJ4A 2ALZA 2YKNB 1HJRA 2KKZA 3W9JA 1VQSA 2VG6B 1OY8A 3TZWA 2C2MB 1HNVA 3D7SB 1WN7A 5C42A 4RNOA 4I4BA 2KDOA 1LW2A 4CM2A 5HBMB 4OJRA 2E1MC 5GINA 3BDEA 1VQ5S 4PG4A 3FE1A 3LZJA 3OYFA 3A5MC 3QT6A 4X64J 3M9OB 1N8RT 3TVZA 1SI9A 3MPUB 4PL8A 3N4QA 3M9MB 2Z0GA 4FW2A 5DG7A 1X5OA 3TABA 1S1WB 3M30B 1WF0A 3MZIA 3HFKA 1U0HB 3MAAB 3TEHB 4P75A 1CZAN 5CR4A 1R6VA 5KI6A 2DGTA 5DDRC 1S0VA 5KG4A 1UW4A 2DCUB 2VONA 2JEGA 1GOCA 1KLNA 2WB1D 3NGYA 1CLFA 2VA2A 2QYCA 1LW0A 2FSNA 3VQ6A 3GLJA 3MD3A 4ZPBA 1NEEA 4JS4A 3HVRA 4I9LA 1SPBP 2NRXA 4YQWA 3JSMB 2FLPA 4MIAA 4BR5A 1M1KO 3I6PA 3EICA 2HNYB 1VOMA 4KFBB 4KHNA 2OUGA 3DLLQ 3NBPB 2WZ1A 1RTJB 5CD4H 1TAUA 3D3CJ 4I7FA 4FYWB 4DPYA 4OJGA 1SQKA 3PDNA 5DM7L 4C0OC 1CC8A 1ZAVA 2V2QA 2ZJRQ 3MN6A 1LFWA 1WJ9A 2EBGA 3DXMA 2HFSA 4OYMA 2NYIA 4QZVB 2HGNA 3LOUA 3H5UA 2FJVA 3GONA 3OS2A 1GX5A 1S6QA 4DUYJ 1RSCA 4JOUA 3WEEB 2J8SA 3MMJA 3LAMA 2CYYA 1T03A 2WSFC 4ETXA 3VN5A 4FJNA 3UKUA 5B08A 3SAGA 4BR9A 4I2QB 2XB2D 3NNHA 2X78A 1HUXA 4DXLA 1H73A 1Z25A 4DV4K 2UUAK 3PJXA 5CA5A 4JI7K 2NS1B 4DV7K 4WKYA 3M2UB 1T11A 4GC7A 3C16A 1SKWA 3G0ZA 3CCZA 3GV7B 4UY85 1TZ0A 2KHOA 2E1RA 4ZTJA 3ZSYA 4BY9C 4ZITA 4X84A 2YKAA 3HL8A 3R3LA 4CJQA 4LSLB 4CYUB 3MMCB 1O1WA 2DISA 5HJXA 4JHDA 4AQYF 2WBNA 5HVGA 1FK9A 3M2VB 3QMLA 4Z4GA 4O3NA 3T1YK 2XMTA 4LFAK 3R6GB 3M8YA 2RDJA 4DS5A 2VFVA 1LWCB 1QTNB 2DHGA 5L46A 4QIFA 5KRSA 3KG0A 4MLEA 1LNQA 1W0HA 4DTPA 4JV5K 1FXLA 3UW1A 4DV1F 2RE2A 3QEIA 3RSEB 5F2RA 1X9SA 3UN5A 2G8IA 3NVMA 3MFIA 5ETLA 3P5JA 4A5AA 3M1FA 2XSJB 5E3CA 1UA1A 1C0FA 4JK7A 4FWOA 2G8KA 5ITHA 4IJAA 2H3EB 3D2EA 1LOUA 2HVIA 1DEJA 3O08A 4X62F 5HQLA 5F0UA 2V4JB 2B4PA 4DQ8A 3KG1A 1FESA 1UFWA 4NO7A 2HW3A 1V3RA 1WF1A 3VQEA 1RWVB 4MIBA 1S57A 3M8RA 4OLOA 2ZBRA 4DR3F 3FC9A 5BR8F 1TK0A 4O3QA 3BGUA 5THWA 3VR1A 1ZOTA 2O1PA 2PC6A 2YBVA 3RU0A 2DHHA 1C0UA 3C8YA 5LSRA 4GV3A 8AT1B 1MW7A 4JYAF 1NGAA 4WQ4C 4H5NA 1RTIB 3PO5A 2EG2A 1N34K 1OSCA 1FRMA 2PGCA 4QYRA 2QWRA 3GG4A 3LP1A 4CGFA 2B5JB 4WF9Q 4AHUA 2YJEA 1KWMA 1UAWA 3BM7A 4ZLJA 1QD1A 3H0PA 4DUTA 4ECXA 1UFKA 3HSZA 2R7TA 4JV0A 4OGCA 1FDDA 2QLWA 2A1SA 1S3XA 5I3PA 4KY3A 3AO3A 4JKEA 3EUNA 3VEXA 3CC4N 4BQLA 2QWNA 3M05A 2B43A 4YUDA 2FJAB 4M5DB 2R8IA 4HI2A 3C3LA 4USKA 1BQNB 1H3DA 2CKWA 2DY1A 3T1HJ 3EGWB 3LDSA 3CJ5A 1TV6B 3GJQB 2DPNA 3MAHA 4A8KA 1NCLA 5KG2A 2V34A 1Q81T 4F8RA 4TSXA 2UUBJ 4IYQA 2GA7A 1N32K 3QIPA 3K5NA 2R8JA 2IPOB 3BP8A 1PO6A 2BQRA 3DMJA 1ESVA 2E9ZA 2HQDA 2KB2A 1X1PA 4Y28C 2YQ1A 4KB7A 3C95A 4CH7A 4PYAA 2ROEA 1NOZA 1NK5A 4UOHA 5CQGA 4IJNA 1HBNB 4KH0B 5A8WA 1NPKA 1I5OB 4CFDA 2QSWA 2PE8A 2XNQA 2ZC3A 1HHSA 1VSEA 3T19A 2XBPA 1L3TA 4OI2A 2D9PA 3RAQA 2D0PA 2ZHBA 3O3HA 1HI8A 2G8HA 3V4IA 2O8BA 3S1TA 1QVGR 1BIZA 4DTUA 2Q79A 3NH1A 2CPIA 4DR4J 3LP3A 1T6DA 4DR2J 4Q0BA 3KG4A 5AQGA 1B99A 1ZA2B 3ET6A 3E9PA 4H0TB 3WXMB 3MWBA 1F6TA 1S72S 4FWPA 2AHOB 3BEGB 2DH7A 4DFMA 3OTDA 3H25A 2O66A 2B3TB 4DV6K 4RW9A 1X3MA 1RWUA 3DDKA 3H90A 3I0SB 1XR6A 3OQ2A 3QGPA 3O6WA 1BMQB 3ZO7A 1TP7A 2F65A 5AQWA 4P2FA 4U8VA 3POTA 5A2QY 1ZM4A 4DV5F 5HP1B 4O8KA 1WEZA 2IBKA 1NMDA 1UOCA 2FZGB 2XZWA 1NHKL 4CBXA 2JNJA 3KLEB 2VICA 3HP6A 2ZFHA 2R2RA 1FT8A 3SDEA 4RW4B 2I2YA 1NHVA 4DV2K 1Q79A 3CJ9A 4MK9A 3HDSA 2Q6CA 2LXFA 2RRAA 2ASDA 3CCRS 4J9RA 1LWXA 1RCHA 1FNOA 1M1GA 4LF4K 1RT1B 4NLRA 1HNWJ 3TX8A 4FXDA 3ISND 1XMQJ 2R3VA 4DCPB 1XTZA 4TKTA 2BJ8A 3BSNA 3IKMA 1EJ7L 2FHKA 3C0BA 3AVHA 2ZF5O 5IC6B 5M1QA 1TKZA 4FJJA 4X4QA 2EW9A 3BR9A 2HFNA 1G2EA 3WDOA 2IIRA 1NGCA 2QTWA 3PRBA 2YQ0A 1URNA 1YX2A 2X1GA 1N33J 3EZ5A 2NQPA 2DRDA 1R8HA 1H1VA 5EDWA 4A8OA 2KLAA 4FLTA 2E7VA 3OYJA 3NAHA 4DR7F 1ZBSA 5KT5A 3EKUA 3ULEA 3GIIA 1VQYA 3HJFA 1XEZA 3EZUA 1RHUB 4ZJLA 3LALA 3S3MA 3HMJG 3JAMY 3J7ZO 3CPWM 3FCHA 1HRHA 4BVOA 5CYMA 2PA3A 1TU0B 3CF5Q 3HSDA 4HT7A 4WQ4A 5I3UA 3FSYA 1HQUB 3CJ1A 1U6BA 1D5AA 3I33A 2F4VJ 3RRGA 1W26A 1VQON 2PY5A 2J4RA 2LDIA 3GCXP 2IAJB 2H4YB 4NZ7A 3V6DB 4WYLA 2Z2LA 3QRQA 1C1BA 2ZM6J 1LXJA 2IA0A 3Q8PB 2XY8A 2QX0A 2QW9A 3MWPA 2NRRA 1HPZB 3WQUA 4V19X 3H7HB 2XO6A 2QWLA 2EKYA 1VQNS 3LGNA 5L9XA 2BW7A 3PO4A 2A1BA 4HUFA 4H4OA 3SBTA 2YX4A 3BH7B 4DTOA 1QQMA 1Z1ZA 2QGFB 1VQ9N 3RBXA 1R27B 3EY1A 3DLLL 3EX7B 5K14B 1YJWN 5HVHA 2KZMA 4Q43A 1X3NA 3K5OA 3B6PA 1FXDA 2MZJA 3FBCA 2DYAA 4DUZF 3S41A 5G4DA 2AKWB 4WE1B 2YWFA 2DKOB 1QS4A 3D67A 2ZJRL 3QFHA 5BYSA 5J1EA 4DV6F 3I8DA 1R0BG 3JQKA 3UCGA 3TTFA 4KHUA 1B70B 4ZP6A 4CFAA 3ZTPA 2DRAA 2G0IA 5G0RA 4ECSA 1U8SA 1SUQB 2LU1A 4CHQA 3ZT2A 3HO1A 3DI6A 3P3DA 1IVZA 3VEVA 2JEFA 1FKOA 4V19S 1IQTA 4FJMA 1S7HA 1W7WA 2UXCJ 1S22A 5B0CA 3VAMA 2W8KA 5BYRA 2RQ4A 3D28A 1C4CA 1OH5A 2ZBCA 3VPZA 3U3YA 2BE7D 4R79A 4C8NA 3EL2A 4C1NK 3TOQA 3TSUA 4UW2A 4XO0A 5D3GA 3GP9A 4ELTA 1KONA 3ZSRA 4RNNA 5DETA 3EXCX 1IKWB 3MD1A 3EZOA 3HVWA 2C42A 1NJIT 2DGSA 3ONQA 3FDSA 3W5ZA 1AUDA 5KPZA 4YHHF 4A2AA 3CMAS 4IOAQ 2OPQA 3MX2A 2XMMA 5FPDA 2DHSA 2H48B 3HI0A 4CEZA 1NJZA 2EK1A 3VGLA 1KEKA 1HPMA 4J37A 3AO4A 3TA2A 3M9NB 4NLUA 2NRZA 2JWLA 1FJGF 1O8BA 2I5JB 2K3KA 4NYFA 3SSSA 3B78A 1SJFA 3QDKA 2FTRA 1DY3A 3BSAA 5J2QA 1S1XA 4JI0K 3PRDA 2OHDA 1P6TA 3FQKA 4LF8F 4FYDA 1HYSB 3ZNJ1 3F2KA 4DL4A 2P9UA 2FHJD 2UUCJ 5LM7E 4ED6A 4C8LA 1WOSA 5LJVA 1BIUA 4ICLB 4PUOB 3CD7A 2YKMA 3KHYA 4J9UE 5LY3A 1T94A 4LF2A 2AQ4A 1HL6A 4CZJA 3OHAA 2BKNA 1TGOA 2KT5A 4ITSA 4DTJA 2V8DA 3DLHA 1EQMA 1RBOB 1BUPA 3J7YU 3KOAA 4W5RA 1WHXA 2W2QP 2RS2A 1FF2A 1B4SA 4A59A 3NGSA 5F9NA 2GS8A 1AT1B 4NE9C 3SSQA 4Z4FA 4WCEL 3DOMB 4B3SK 1EKEA 1KAYA 3W2VB 4UQGA 2QA4G 4K50A 2Q0UA 4KO0A 1DJ0A 3S9HA 2LMIA 3R27A 3M32A 4DBQA 4U7UK 1WOPA 3TTDA 4YR0A 3UD4P 4N56A 3QBXA 3J81j 1JLBB 3TAMA 1SJQA 2JWNA 4OIXA 2B6AB 4Q5VA 4M94A 1WI8A 2G8UA 1IKXA 1IBKF 1FWPA 2XCAA 3A8IA 4DEZA 2J0SD 4MFBB 4WBFA 3R2DJ 2KI2A 4NCGA 3MM5B 2AX0A 5LL6Z 3AHPA 2J0QD 1V5IB 1R8BA 2UXBF 1K6YA 4PWDB 4K4XA 3AY0A 4F3QA 4AHCA 4FZYA 3HZ6A 2WK4A 4K7QA 3G96A 3TANA 3J7AP 2O8CB 3W3DA 3O6QA 1QZ6A 2VPZB 4CTAA 2CQ0A 2PDAA 5AQSA 5IM0A 1VS3A 2OTJS 3OFEA 1R0AA 4LFBF 1JLAA 4UY8T 2OPRB 4FDFA 1IBLF 5FIIA 4NLDA 4ZN1A 3KDOA 4OI3A 3CIPA 2XGQA 2VJUA 2BTFA 2BA9A 3G8SA 3D0HE 5K8PA 2GEMA 4PG8A 2ZJQQ 2WC9A 1KP6A 5CHIA 1K73T 3M6GA 1OSDA 2B8QA 5CYQB 4DR1J 4FPBA 3R8EA 2HQIA 2PEHA 4JI4J 3U3GA 3PKMA 2HZVA 3N28A 1D8ZA 4Y2IA 2W40A 2VFRA 4GKKK 4FWKA 1C0TB 2A10A 3J7YI 4E7JA 1GQEA 3PR4A 1GLLO 1ZBFA 4DR5J 2AJFE 2HAIA 4M3WA 1FW6A 3OYDA 1QUPA 3ZT4A 4RTFD 1ELOA 5CY4A 5AQNA 3G2XA 1T9UA 3VGSA 3CPEA 1KC8T 1M0SA 2QYGA 3CCEN 4M3XA 3KWGA 1X4BA 3CC7N 1IBCB 4Y2MA 2FLOA 4MLHA 2VOOA 3BB5A 2HVHA 5E33A 1MN9A 5ETKA 1XNQJ 4CQ1A 4CF0A 2P9LA 1RA7A 1QHAA 2IM0A 3RYLA 1B0PA 4BWJA 2HFUA 4DQSA 2XLKA 1LWEA 1T9YA 3AFGA 3PEHA 3G71S 2PN6A 2UVVA 2VG7B 1B7FA 3EGVA 4N8NA 4DN9A 3U9DA 3NKYA 5HK4A 5FRMA 4ED1A 4U96A 4UTGA 3J7Z5 2DXDA 2V67A 1J53A 1RAGB 3PACA 2FJEB 1NBWA 4RW8A 4ER8A 2HZCA 1MSWD 2IMOA 1IO2A 2AW0A 1I94K 1Q9XA 1DKGD 2R42A 4HYKA 1EKRA 2IYGA 3M8WA 3NFAA 1QVFM 3PNIA 4AHVA 3HRGA 1GFWB 3P49B 4AL5A 3GFYA 1Y5LB 1N56A 2UU9J 3VA3A 4LH4A 2ROGA 1V4SA 3O9UA 2HNZB 1ZZFA 3L09A 3K8VA 2OSQA 2IOCA 2E8AA 4NXMJ 1RTDB 2RILA 5C25A 1Y97A 3TQEA 5AQYA 1NNDA 5AQKA 4OYXA 2J9CA 3C15A 3CG7A 1W97L 4KH1B 1TQLA 3THWB 1WG4A 5L38A 2VWBA 4Y2CA 1CJVA 3E01A 2XGPA 1UPMB 1U6ZA 5K8OA 4TLRA 2RQKA 1K1QA 3KMQA 5M1KA 2P9SB 1SJ3P 1YBAA 2Q43A 3FGUA 2A42A 3GZ7A 2JWKA 2PBDA 2W9CB 4BC4A 2KG0A 2WCXA 3HD2A 1OO0B 1H74A 3VQCA 1KTQA 4FVMA 1XMBA 4F50A 4ZCKA 2GQCA 2X51A 2VC0A 1SJ1A 3QAEA 2DGXA 3K17A 2EC0A 1DBDA 5KFLA 1FRLA 1ZXOA 4AFFA 1X4GA 4FNIA 3SV4A 1NU4A 3TVYA 2VCPA 4DSEA 2VPXB 3B54A 1HKCA 2CPHA 3QZ7A 4B3MK 3KD5E 4CEAA 3B82A 4KIAA 2O8FA 2UUTA 5JLHA 2F9JA 4HACA 3GV8B 2JC1A 2LEBA 4USVA 1BO5O 2H5JB 5AR0A 3ILOA 2ZGYA 4H5VA 3GB0A 3E9LA 4HCBA 5F41A 5M2RA 4C2MA 3OW2R 1EX8A 1Q1KA 4DHVA 1UJ4A 1L3SA 4F2SA 2RH3A 2UUAJ 3AAWB 8RUCA 1UJ6A 1G7CB 5GAGP 4OHYA 2W01A 2HBLA 5HROA 2V2ZA 4HVZA 2IM1A 3NEKA 5C10A 4P72A 3OR1B 5C2FA 3S8SA 4TY8B 2MTLA 4G6VB 5IOLA 2ZKTA 2F8MA 2Z1IA 2IVPA 4JI2J 4ZOSA 5DQHA 4C7QA 4JEPA 4OZ2A 4ZLLA 4FNHA 4ZIVA 2OIHA 3BSCA 1TKXB 3ASMA 3NCIA 3R5CA 2K06A 4USHA 3RBDA 4LFAJ 4V19J 1Z4UA 3AJ2A 2RNEA 2CZVC 4B08A 3HT3A 4C8KA 5AJ3K 5FDLB 1I6JA 4U7BA 2OPSB 3R5DA 3L7OA 2CXEA 2GIQA 4H5WA 2X6NA 4IRDA 2Z1JA 3OL7A 1P90A 2GAGC 1ASVA 3J81O 2E5LJ 4OHWA 3SBGA 4FN5A 2FVPA 4JKDA 3NDKA 3TTCA 5M1PA 1NSKL 3SPZA 3DC2A 4J91A 1KAZA 3CMQA 2QLBB 3IFRA 4O4GB 4URQU 3HOTA 3ILIA 3D1HA 1YTYA 2GUIA 4RCHA 4O3PA 2E4LA 4BRMA 2JLGA 2A3ZA 5F9LA 1Y7PA 5EXWA 2P9NB 4RW7A 3MEEA 1CJUA 4DSLA 3AVKA 1RUSA 4B3RF 1R0CB 1YUWA 4Z4EA 1ZBTA 4YY3K 1M1KT 4MKVA 4UUXA 4ZK7M 3KLIB 2L9WA 3FZKA 4C0HA 4YP3A 3N79A 1Q5VA 4ID5A 4WKRA 1JK9B 2W4CA 2C3MA 1JWWA 4KREA 4JI5F 2ZJPL 3N0VA 3NVKA 3VGKA 4LF6F 4J9OA 3Q2TC 3K89A 4B9MA 4BDPA 1JKHA 3PHTA 1F2HA 3MUMP 3MECB 1B7YB 2ZBPA 5E5NA 1GLEG 3MPYA 2EWHA 1WHWA 5T7LB 5C2CA 3WUHA 1A9NB 2V69A 4CK1A 1Z2ZA 2CNLB 4FLUA 4QWCA 1RBUA 3GSDA 3KK7A 1Y10A 4ATNA 4ID1A 2G2OA 4LF7J 4CVNE 4DPTA 5AQOA 1G1XA 2V50A 5KFSA 1QVFR 5LMNJ 1YF5L 4CDIA 3NXZA 3GL1A 3G86A 5DLGA 3HP9A 3I5CA 3M6UA 1ATSA 4BRQA 4KHPJ 1S4FA 3SEOA 2PI4A 3G9CA 1S0NA 3DRPA 2ZH5A 3R6LB 1YRUA 3H2LA 2X1BA 2PI5A 4IQMA 3HSCA 3G8QA 3VQ5A 3ZCMA 3R1HA 1N32J 2R7QA 2RHKA 4FWMA 1AXQA 2HQCA 1VQLS 3MMAA 3MMBB 2F9TA 2YNIA 2F8EX 1QAIA 4WQ5A 2D1CA 3M1VB 4HTJA 4C8YA 2VQFK 1Y3JA 1AFIA 4CLSA 3GBTA 5I4MA 2ZH4A 1U2FA 2YX1A 3OYMA 1H6KX 3NGZA 1EQ0A 2MZSA 4OX9J 5IXUA 5GADP 3ALYA 2FHJA 4K5SA 2X6SA 5H9EJ 5FLXO 4DV0K 2ZD1A 2XZTB 3BQ2A 1EX4A 1MROB 3FCWA 4X66K 5AQFA 2MZ1A 1RT2B 3LM2A 4HL9A 3OHBA 1HR0K 4B1ZA 1JXVA 2DH9A 5DM6L 4CJWA 4ZPTR 3ELHA 4P9SA 3BY5A 2J9EA 4F25A 2MMYA 4PXCA 3POTB 4LFCK 5KOXA 2VASA 1NJXA 4Z0UA 5B8HA 3CD0A 3VAJA 1S59A 3VQ7A 3ZX0A 3AO2A 2PD1A 4HT5A 2HF3A 3R7BB 5EOYA 3LUYA 3DU5A 2V2VA 1VMBA 2J7WA 1VSHA 4ZPVR 3ETMA 5D0HA 3M8PA 1RYRA 3L3UA 1S1UA 3AVCA 3LDLA 1C1CB 2QTDA 2QZ8A 3BN4A 4NA3A 5J2PB 2R2UA 2ZH8A 2YVSA 1PCAA 4FOEA 4RUAA 3BSOA 1CS4A 2LKZA 3JSYA 4LF5J 1FDNA 1NGEA 1RLDA 2MLXA 2RIJA 4NYOA 3GE9A 3X1LB 2AU0A 2RU3A 4NLOA 2Y8WA 1S10A 1TKZB 4IG3A 1RA6A 1RKIA 1U2VA 5KT4A 2X7IA 1TYQA 4MIWA 5HRNA 1TUYA 1LXNA 4HLBA 1BI4A 4M3ZA 3SZ2A 4XH4A 4ED7A 3MURP 4QWBA 4E1NA 3BF4A 2D7SA 4ECRA 4X65K 2CPZA 5IV3A 3KKRA 4FWRA 3W64A 2DR9A 5AZIA 5D4LA 5DDPC 3HHLC 3R7NB 3BQ0A 4FJKA 1TL7B 3HM9A 1I39A 3CCQN 3GYGA 3OTBA 4LVOP 3ZFVA 4JS5A 3THXA 2UXDF 3GFHA 4CJ7A 3FKBA 3UKRA 1H98A 2V68A 1PILA 1J5EJ 2HHHF 2FBYA 2XMVA 2D0CA 4K43A 3VQSA 3QWUA 4F4KA 1XMOK 2VKRA 2GQQA 3O1BA 3LP0B 3L95X 2HMPA 4P7VA 4RNMA 1EKSA 3FBFA 3T9NA 5GMKa 2GNKA 1NPPA 1YAGA 4MAKA 2FD2A 1MDUB 3HHNB 1WHYA 2NR0A 2NPFA 3IXQA 5D4OA 3EDQB 5TKYA 4CJSA 2CWKA 3GJRB 3HPGA 2UV8G 2Z1GA 4O3OA 1HBOB 3AA5X 3D1OA 3M2RA 5BPMA 4AM6A 5BR9A 1YITN 3IAS9 2Q3SA 1VBKA 2HWTA 2HHSA 4H4OB 4CLFA 1APSA 1JNRB 3Q8UA 3V6JA 1HYZA 1NGHA 2QJ3A 1HQ2A 2B9WA 4JB8B 3SMSA 3O2IA 4HUEA 1SS6A 3RBEA 3HZEA 3JB9k 4K2JA 1WC0A 4FJXA 1F0XA 1VQPN 4IH6A 1RT7B 1VQMN 5IC4B 2W9BB 4URSA 5EX3A 4IFVA 3W1YC 4W5NA 5GVQA 1HKAA 3ZSZA 1YZ6A 1NXIA 3RMDA 3PRVA 3G82A 2PFFB 2ADCA 1WBDA 2IBOA 2VQEJ 3CQ8A 1B0TA 3RAXA 2Z58B 3RTVA 1PAUB 2MPUA 2F9DA 1YVNA 3DI6B 3K9KA 1FVQA 4OZJA 1WD6A 4F3MA 2GQ2A 2BGGA 5I42A 5B0DA 2ZWOA 1Z6RA 1RAEB 3ENOA 3G6EN 4N47A 2IA6A 4CJVA 4QIEA 3GIRA 5ADZA 3O3LA 1UPPA 3SI8A 3Q8QB 2WFBA 2D5RA 1Q5YA 2CQBA 1VQOS 4NZ6A 4NRTA 3CM6A 4CIOA 5KPTA 1MG7A 3IG1A 1KNZA 3O8MA 5ETMA 3IDHA 4NZ0A 4JI1F 3JS9A 5IT9Y 2R7UA 3R5AA 3FBEA 2K1RB 1WAJA 4LF1A 3T5LA 1C4AA 2YKNA 3PX4A 5JMVA 4MK7A 2J9DA 1FX2A 1DHMA 2VG6A 1D9DA 4ZN3A 1UEUA 4TXSA 3IMQJ 4IKAA 1TL3B 5B7WA 2AJ0A 5HL7L 2FVRA 4FJ5A 4CZGA 1HNXF 3MDQA 2XS2A 3L7PA 4CZEA 3IN5A 4X64K 5HBMA 2OPQB 2A5XA 4DSKA 2HSTA 1G6BA 3QT7A 3CB4A 3AOCA 3I4PA 3J7ZT 1RHJB 1YJWS 2V7YA 3THYA 3CO9A 2FXUA 2AEFA 1YTAA 1U0SA 3GV5B 3V2UC 4OX6A 1QLNA 4TY9A 1OIAA 1S1WA 3M30A 4CZKA 2DGUA 2Q1NA 1U0HA 3TX0A 3W66A 1U24A 3MAAA 4ZVTB 2HAFA 3PSFA 2W42A 1RT4B 4MT1A 3L8BA 3JTNA 3VF6A 5JMNA 3CUNA 5ETRA 4DPOA 4W5QA 1L3VA 3SQ4A 2XNRA 3VF2A 3VEYA 2EC2A 5DGBA 2VG5B 4DSFA 4BRDA 4ZVRB 3O80A 4L3KA 2HNDB 3QNNA 1PJ6A 3JSMA 7AT1B 1VGYA 2HNYA 3A8EA 3K2YA 4CM0A 1BISA 1VQ6N 2Z1HA 1F9HA 4KAIA 1N5QA 3NBPA 3UN3A 2VD3A 4IRCA 2DEIA 1RTJA 4EYIB 4EBCA 2NXCA 5JXSA 2YH1A 3NWRA 3A4TA 6FD1A 3EVMA 3KJQB 1SIZA 2KRRA 1S9EA 2QFJA 3AVNA 4UF4A 3TA1A 5I9EB 4DUYK 1F1BB 3FZ2A 4ZS6A 1Y4ZB 1WNEA 4BRGA 4B3TK 3A3NB 2I7NA 1U09A 2RRBA 3Q7BA 2VDIA 5LMUJ 2Z4PA 4YNQA 4N5SA 3U8XA 2XTJP 5JVGQ 4I2QA 2H3GX 1T9XA 1UZHA 5DJBA 1Q81O 4Y2KA 3OHRA 2OGUA 5HOOA 2HBMA 1NGGA 4RWTA 2QWOA 1VSFA 5FPNA 4QIVA 4ZVQB 5E3RA 3M2UA 3P31A 1XR5A 3SQ0A 3WXIA 2BXJA 3E66A 3DXKB 2XSFA 2LEAA 4USWA 1SH2A 3TUIC 1FWLA 1ULRA 1U25A 4LSZB 3QEWA 2Y9HA 2CA9A 4YOYA 4LSLA 1WSFA 3KWIA 4CYUA 3MM7B 3MMCA 2XC9A 5IM0B 2O4GA 3LM9A 1R0AB 3UQSA 1R8CA 5E3AA 1KQGB 3M2VA 1OPZA 5CZ2A 1VHFA 2AD9A 2XQCA 3NRBA 3LDOA 3BBFA 3EYZA 2Z2MA 1O5JA 3N4PA 4PRFA 1LWCA 3E2EA 3RR8A 2DNKA 4A62A 4RU2A 3QAUA 2QK9A 1P8ZA 1U1LA 1VC5A 3RSEA 4QOTA 1NK0A 4DHYA 4MK8A 3MK6A 2N4CA 5LT5A 2OEJA 1HI0P 3G25A 1VC6A 2WW8A 2XSJA 3K57A 2ALYB 3T6BA 1CG2A 4PQUB 2J7KA 1GMWD 3TO8A 1WDTA 1S76D 1XHXA 2E9RX 4BRFA 3J80Y 3QFWA 4E1JA 2XS7A