1TV6A

Hiv-1 reverse transcriptase complexed with cp-94,707
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
539
structure length
535
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords reverse transcriptase p66 subunit
publication title Structure of HIV-1 reverse transcriptase bound to an inhibitor active against mutant RTs resistant to other non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 139
structure length 535
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tv6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tv6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tv6A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tv6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tv6A05
4DSKA 3C6UB 4AILC 4CJPA 3SFGA 5L9XA 1NK8A 2OH2A 2F96A 4FM1A 1S1XA 3SI8A 3RR8A 4BE1A 2QV6A 1UA0A 4DQPA 1TL1B 3K5OA 3NBPA 2X6NA 3NH0A 4DFMA 2HHTA 2UVRA 3OS2A 1DTTB 1S0MA 3AVNA 3H5SA 3BSNA 2ATQA 3O3FA 5K14A 4FLZA 5J1EA 1JKHB 4ELUA 3VQ7A 1WAJA 3NF8A 4AH9A 2XHBA 2B4JA 2FVSA 3LAMA 4WFZA 2V4QA 1J5OB 1S5JA 1RDCA 4TSXA 1SL2A 1XWLA 5CYQA 3PY8A 2FBTA 4YFUA 3UDLA 3QEIA 4IFVA 4IFYB 5JS2A 3PZPA 1DTTA 4LSNB 4O3QA 4DFPA 5KFHA 4IKAA 2QXFA 1JL2A 1HMVB 1BQMB 1N5YB 4L8RB 1SV5B 3MEEB 4RZRA 1RT1B 1RT4B 3KK2B 1K1SA 4Y3CA 4ZPCA 2J6SA 4QCLA 5DLFA 1LWCB 4QWEA 5KFXA 4B9VA 3QNOA 3B6PA 1TK8A 4K4YA 2IA6A 3SUPA 2R8GA 3ZSZA 5DG7A 1FK9B 3SNNA 3ZT3A 3QNNA 4IFYA 4LSNA 4NLSA 1TGOA 2BANA 4KV8B 4FBUA 3CFOA 3TI0A 4EYHB 3LAKA 1N5YA 1SV5A 3K57A 2WRMA 1RT4A 4WYWA 1LWCA 2HHUA 1S97A 3IRXA 5KT7A 4FJIA 4FS1A 1RT3A 1ZTTA 3LWLA 1IM4A 1TKTB 4K4XA 1N56A 3ZT4A 3H08A 4NLTA 3VQAA 4QW8A 1ZBIA 4HKQA 4IDKB 4FM2A 3H40A 4F2SA 2BGGA 1VSMA 3IN5A 1FK9A 3CQ8A 2R2RA 4BE0A 1KRPA 5KG6A 3PUFA 2HHVA 4LH5A 1NK0A 4KV8A 5SZTA 4K50A 4B9UA 4B9MA 3QINA 4JV2A 2AJQA 4HCCA 1D9FA 2RDJA 5JUMA 5F8NA 3F9KA 4XIUA 4FK4A 3AVKA 3AVFA 3PW0A 3QEVA 2BQ3A 2J6UA 1TKTA 2AQ4A 3RAXA 5KFRA 1T3NA 3AVCA 5KFIA 3MXJA 3V6JA 4CF0A 2F8TA 3JYTB 2OZSA 4MK8A 2YNFB 2AWZA 3DDKA 2XWYA 3L2VA 4W5RA 1RYRA 4CK3A 1NHUA 4RW9B 1QHTA 4F3OA 4B3OB 3H5UA 4B8AB 4WXOA 3ITHA 4GC7A 4NLXA 3VQBA 2GUIA 3M8PB 2FVQA 3NCIA 1TKDA 2D41A 1JX4A 1L3SA 3VN5A 2G8WA 3NH1A 1RYSA 4Z4IA 3OYJA 1RT6B 4DFJA 4NRTA 1CSJA 2E9RX 4J2DA 4C8MA 1B9FA 2IAJB 4ZVEA 5KFDA 3P83D 2R7YA 2EC0A 4Q0BB 2C2RA 4LQ9A 1NK7A 2YNFA 3RB3A 1GOCA 4FZZA 5KT5A 1C6VA 1XR5A 2D0BA 1KSPA 4ECWA 1CXUA 3QESA 2XGQA 2QKKA 4J9NA 3V81B 3MF5A 4KB7A 1K1QA 2HNYA 1JLQA 3ZSXA 3N6LA 5FROA 4N47A 3V9ZA 4IRCA 3M8PA 3TWHA 4K4UA 4DF4A 2Z1JA 2HMIB 3LP1B 1WLJA 4B9LA 4I9LA 3VQDA 2E9ZA 4E7KA 2IAJA 3OYFA 4ZPAA 3RMBA 2HVHA 4KHUA 3IS9A 4Q0BA 5DGBA 2I5JA 1X9MA 4KAZA 1TKZB 3DLKB 2WOMB 4FZXC 3UIQA 3V81A 2XY6A 3KJVB 4RNMA 3U3YA 3DLBA 4RNOA 5KI6A 3ZSQA 1L5UA 4FJJA 4DS4A 1EETB 4ZVHA 1S1TB 4UQGA 4NCGB 1QSSA 1RT2B 5DG9A 4CGIA 1RA6A 2HMIA 3KLEB 1BQNA 4K4VA 3PX6A 4ICLA 1NJWA 4DF8A 3TAQA 3PR5B 4BWJA 4BWMA 4ED3A 1YTUA 3VQ9A 3VA3A 4IRDA 3DRPA 1R0AB 3THVA 3DLKA 1NNDA 2WOMA 2W7OA 4CJSA 3VQSA 4ECXA 1NJXA 1Z4UA 4KE5A 3KJVA 4J2AA 2VA3A 4J9RA 4ED2A 2ZD1B 1EETA 4E19A 1S1TA 4NCGA 4Y1CA 4KHRA 3CFRA 4DSLA 5KFTA 3KLEA 1IKYB 5EWGA 4QWCA 1QSLA 3N6NA 1Y97A 4CF1A 2X78A 3PV8A 4QPXA 1NJZA 3QZ8A 4YQWA 2YKNA 4HUFA 2X74A 5F9NA 4G3IA 1LW2B 3OJUA 3O3HA 2RF2B 3K2PA 3PW2A 3OL7A 2FJXA 3GV5B 1LAWA 5CY4A 5KG3A 1HNVA 3VQPA 4J9MA 1VSIA 4FLWA 3D5MA 3K5MA 1L3VA 3SI6A 4W5TA 1KLNA 1IKYA 3V6KA 2PYLA 3TVKA 4ECQA 3MEGB 2ILZA 3TAGA 3Q8QB 1ZBFA 4M3XA 3ZSWA 3NL0A 1A5XA 2RF2A 4ZP7A 4PY5A 1WSFA 3QLHB 1ZTWA 3DM2B 3RRHA 5JS1A 3G6XA 4E1NA 1ZBLA 3NKYA 3MECB 3H4BA 3BQ1A 1J53A 1NK9A 3C6TA 3V6DB 2HW3A 4KI4A 4NYFA 4C8KA 4CJVA 4NLDA 4QWDA 3MEGA 1EX4A 4ZMMA 2YKMB 3HM9A 5KFUA 1QE1B 5KFOA 4DSJA 1EP4A 5CYMB 4G1QA 1WN7A 3UQSA 1D8YA 3QLHA 3M9OB 1JXEA 3DM2A 4EP5A 3ASMA 1WNEA 4HTUA 1WSEA 3MECA 4QAGA 1I39A 4J9QA 4AHVA 3ZCMA 2BR0A 3OYLA 1S1UB 2O4GA 4GMJB 3AA4A 2IM0A 3V6DA 1W0HA 2YNIB 1EKEA 4OLBA 4CFCA 1FKOB 4RW6B 4HHTA 3WNGA 3DOLB 2YKMA 2V4RA 4O4GB 3MTKA 5F8HA 4IR1A 4KB1A 4FK0A 1N6QB 1TKXB 3KMSA 4EBCA 1WAFA 4KAIA 3SV3A 3G86A 2O4IA 2D0CA 2G8HA 3WNHA 1S1UA 3T5JA 1S1WB 2YNIA 5FDLB 3NAHA 2OPSB 4EP4A 1BCOA 1TP7A 4JUZA 3B6OA 3AVMA 1LWFB 4RW6A 2WONA 5JXSA 1BCMA 3MFHA 1IG9A 1S0OA 2OPPB 1C1CB 2BDPA 1T94A 1BIZA 4ZP6A 2KTQA 4LSLB 1N6QA 1RBRA 1TKXA 4TN2A 1W25A 4FLXA 3HP9A 4ID1A 2VG6A 5C24B 1U45A 1ITGA 1YTAA 3AVGA 3V9XA 3HHKA 2VG7A 1DLOB 1LWEB 2WTFA 2AGOA 4ECYA 4OPKA 4RW4B 4FJNA 4XO0A 1GX6A 1S10A 4F2RA 1S1WA 3SZ2A 2KZMA 5FDLA 2KW4A 5HRPA 2OPSA 2C2EA 5C25B 3T1AA 1BISA 5L1IA 1RT5B 3VQEA 4JV0A 3VQ8A 1LWFA 3HVWA 4GVMA 3QETA 5CZ1A 4J2EA 2O5DA 3MXMA 4DTNA 3OJSA 3ZSVA 2B5JB 4TYBA 2E6LA 3SV4A 2FVRA 3I0RA 5KTQA 2W9BA 3SYZA 1WNSA 1DLOA 1LWEA 2IGIA 5KFZA 1GX5A 1C1BB 2UUWA 5DLGA 1SKSA 1JLFB 1J9AA 2B6AA 3SQ1A 3G10A 1RTIB 4TLRA 3H4DA 4NLRA 2UUTA 1IKWB 1VSFA 3V9SA 2B5JA 3KLHB 3H5YA 4F4WA 3EZUA 3DI6A 5KFQA 5DQHA 1RILA 3AO2A 3KHLA 2Q3SA 5KGWA 2IOCA 3PX0A 3FFIB 1UWBB 4FLVA 3KLIB 3OYDA 1HQEA 4OLAA 3MR2A 5C42B 4RNHA 1BIUA 4ID5B 4Y2AA 3RB4A 2DFHA 5FRMA 1JLFA 4NYZA 3C6UA 4IG0B 3C95A 4CIFA 3KK1B 2VA2A 4W5NA 1U04A 5F8LA 3E01B 5EU7A 3PHEA 4M3YA 1MMLA 4FZYA 1IKWA 3ZT0A 5KG4A 2IM2A 1TL1A 4EBDA 4KB0A 4WFYA 4KFBB 4KHNA 5KGXA 2BRLA 3KIOA 4TY8B 2HHXA 4WXWA 3KHHA 4H54A 2AGQA 2YHBA 1VRTB 1UWBA 3KLIA 1NHVA 1L3UA 3QEXA 1JKHA 5HBMB 2YNHB 3CG7A 4CE9A 2ASDA 1NK5A 4FCYA 3SQ0A 4O3PA 4KBIA 1I6JA 3KK1A 1J5OA 1ZYQA 2W9CB 5F8MA 3E01A 4DS5A 3S3OA 4GW6A 5DK5A 4DLGA 1VSLA 5EUHA 4J9PA 3AVHA 4H8KA 3ISNC 3EZ5A 4QWBA 1KLMB 3CM5A 5DQIA 3TAMB 3ISND 4OGCA 4OL8A 3PJXA 1HMVA 3DYAB 1BQMA 2YNHA 3MEEA 1VSKA 3OS1A 1RT1A 3KK2A 3RWUA 4MH8A 1WSJA 4NLUA 4Y1DA 2W9CA 4DQIA 2XY8A 4EEYA 3OHBA 4CJTA 4DL5A 1F21A 3FQLA 3BQ0A 4M3ZA 2BQRA 4GC6A 4I2PB 4JV1A 4EO8A 3VQ5A 3IAYA 1RBTA 3TAMA 1JIHA 3PR4A 4IH6A 3LWMA 5KFAA 3HK2A 2IDOA 2OPQB 4H4OB 4Y2CA 2R8HA 3DLRA 3LP2B 1QUVA 4B9TA 4BACA 4U6PA 4MK7A 4ZVFA 2X6SA 1SH3A 2W9AA 3BJYA 4RW8B 4CCHA 1HYVA 4DG1B 4ELTA 1I3AA 4EZ6A 3TR8A 4B08A 4NZ0A 4CHOA 3OYKA 3F73A 2D0AA 3QIPB 4NLYA 4IDKA 2GIQA 2BRKA 1SL1A 3RBEA 1T7PA 2GBZA 2AGPA 2W8LA 3QERA 2UVVA 3AO1A 4NCBA 3MR3A 4OGEA 4DTRA 2OPQA 4H4OA 3EPGA 5L1LA 4AHUA 4F4ZA 4DEZA 4KTQA 4CK1A 1TV6B 2R2UA 3DMJB 4HVJA 3HT3A 3HVTB 3VQ4A 3CWJA 3SUQA 1N4LA 2JEJA 3RMDA 3QIPA 2Z1IA 4KI6A 3ALYA 4O5BA 2FVCA 1KFSA 3JYTA 1X9SA 3WNFA 1Z25A 4IOBA 4R0EA 3H5XA 1Q8IA 4NLQA 4CEFA 4RW9A 3HXMA 2A1RA 4K4SA 4DTPA 4B3OA 4K8ZA 5DG8A 3TAEA 4ED0A 1TV6A 4F4KA 1UAXA 3T5KA 2FLNA 5J2QB 3SQ4A 1RA7A 3I5BA 2G8UA 1N48A 4I7FB 1RT6A 3BREA 4CGGA 3DMJA 3NF9A 4CEZA 4E7IA 3HVTA 1S1VB 4Z4FA 3LZIA 2HWHA 4BDYA 4CEAA 1RTJB 1RTHB 3IGNA 2YV0X 4FJ8A 4KO0B 3DRRB 1Z26A 2JGUA 1UOCA 3QO9B 3I0SB 3L3UA 5KG0A 2ZKUA 4N41A 3ICLA 2W42A 4DSIA 1RBVA 4CFDA 4XPEA 3DLHA 4O0JA 5I3UB 3KKSA 3NGYA 2LSNA 3LP1A 1NKBA 2JC0A 2Z1GA 1S1VA 3KTQA 1TK5A 4RUCA 3U3GA 2P1JA 3CYMA 4J2BA 2XY7A 1RTJA 1RTHA 5J2NB 1TKZA 4KO0A 2DFEA 1VSEA 4M3TA 3QO9A 1GOAA 5EWEA 1RT7B 1BHLA 4CJRA 1X9WA 2WB4A 4E3SA 2Y1JA 3QGGA 4H4MB 3H98A 1JLEB 3K5NA 4RG8A 1RT2A 3DOKB 4DL7A 3PO4A 2FVPA 3HPGA 2JEFA 3HKWA 2ASLA 5F8JA 3PO5A 4EO6A 1ZBHA 1D0EA 4NCAA 4O44B 2DY4A 3KD5E 2PYJA 4DQQA 2W8KA 4ZPDA 3M8QB 1WSHA 3AO4A 2OZMA 3D45A 4KREA 1SH2A 1X1PA 2FBYA 1R0AA 3NAIA 4NYNA 3KKRA 4PQUB 1RT7A 3QEPA 1TAQA 4FJ7A 4WYLA 4EBEA 1BL3A 4HUEA 4H4MA 4DTSA 4BDPA 4KHQA 1NOZA 2ZD1A 1TL3B 2YNGB 4PWDB 3OLBA 4OKKA 3DOKA 4KSEB 4CJLA 5HROB 4N5SA 3BSAA 4NLPA 3A2FA 4CERA 1Q9YA 3JSMB 3FQKA 3VA0A 5HRNA 4AHRA 3M8QA 2R8JA 4Q5VA 4M42A 1LW2A 4F4YA 2ZQBA 5HRRA 1UA1A 4TQRA 3PX4A 4KRFA 2DPJA 4FLYA 2ETJA 5EWFA 4IG3B 1S9EB 4CK2A 3CVKA 4LY7A 1TL3A 4O55A 4ZVGA 2DPIA 3NAEA 2YNGA 5KFFA 5F8GA 4FS2A 1ASWA 1GOBA 4M3UA 5HROA 1HNIB 1S6PB 4CJFA 4YNQA 1SUQB 4E7LA 2R8IA 2XY5A 4RNFA 2FC0A 4MQ3A 3KOAA 1KHVA 1RNHA 4IG3A 3SUOA 4YMEA 4B9SA 3S3NA 3LP0B 5KFNA 3AO5A 1S9GB 3AV9A 2A1SA 1B92A 4ZP8A 1NJYA 4FLUA 1HNIA 5KFMA 1S6PA 1U09A 2UVUA 1A5WA 1TAUA 2HB5A 2HAIA 2RPIA 4CHQA 5F9LA 1YVFA 3RTVA 5SWMA 3AO3A 5DMRA 4RU9A 1L3TA 2JLEA 4K4ZA 4K8XA 1QE1A 3CDWA 4E1MA 3CJ3A 5CYMA 3MEDB 4CFBA 3GIJA 3KK3B 1KTQA 1J54A 1VSHA 1S9GA 4ZTFA 4LQ3A 5D3GB 5L1JA 4CFAA 1IKVB 2J6TA 4W5QA 3HO1A 4FW1A 4CHPA 5KFBA 5KFKA 4Z4GA 1FKOA 4X2BA 1REVB 1MU2B 2P51A 3GYNA 2F8EX 3RB0A 4IQXA 3DOLA 3NMAA 3KD1E 3K58A 1JLCB 4O4GA 4F4XA 4O3RA 2OPRB 3OL9A 3BQ2A 3OYHA 3HL8A 3MEDA 3HP6A 4Z4EA 3Q8SB 4DQRA 2R2SA 5KG7A 4ECRA 4CECA 4NLWA 4DL2A 4CF8A 4RNNA 1RDBA 1U48A 3TQ1A 1S6QB 2FJVA 1C0MA 4JS4A 1MU2A 5KG1A 3CJ4A 3AA2A 1JLCA 3CO9A 4CGDA 2OPPA 3BDPA 1C1CA 2IJNA 1RDDA 4NLGA 4CHZA 4R8UB 4LSLA 2WK4A 3OVNA 4QOZB 5C24A 1ASUA 2G8FA 1K6YA 3S3MA 1ZBUA 3C94A 2RKIB 2BE2B 2VG5B 2XCPA 3ZT1A 2WHOA 4RW4A 4Q43A 2V9WA 1LW0B 1RDAA 4I2QB 4FJKA 4YR3A 3HVAA 1D9DA 3IG1B 1S6QA 5C25A 4XPCA 4DTOA 4DU1A 2IJFA 1RT5A 3Q8RB 2GV9A 4CGFA 2CJQA 2IBKA 2OA8A 3U6FA 4FBTA 2Y1IA 3M9MB 4MIBA 3NGZA 3QGHA 3AVLA 5C5JA 2GC8A 5J1EB 4R8UA 2C2DA 1U49A 4ZHRB 4I9QA 5DGAA 4IH5A 4CIGA 2RKIA 4FVMA 4YR0A 2BE2A 2VG5A 4HCBA 4ECSA 1WSGA 4ZTJA 1SH0A 1LW0A 1A5VA 4I2QA 3EPIA 3AA5X 5CYQB 3IG1A 3MR5A 1RAJA 1C1BA 4KTZA 2D5RA 3QZ7A 3OL6A 1RTDB 4FM0A 4IFVB 1RTIA 3LDSA 4M95A 4Z4CA 3SCXA 4DTMA 3G6YA 3KLHA 2IM1A 4DL6A 4ZHRA 2ITGA 4CJ4A 4CF9A 4CJUA 2VWKA 4FYDA 3OS0A 4J9OA 3HVRA 3V9WA 4M45A 3OL8A 3CFPA 4KHSA 1XHZA 3FFIA 5KFEA 4CJWA 3MFIA 5C42A 3E51A 2G8VA 3QIOA 4ID5A 3RMAA 4Q44A 1U4BA 1HPZB 4EYIB 1RTDA 3TANA 4IG0A 4CJ3A 1O1WA 1KVAA 1VSDA 4DU3A 4DWIA 2NUBA 1S49A 2BANB 2XCAA 3SJJA 4FJ9A 2C22A 1Q9XA 1NKCA 2JEGA 3RRGA 4C8NA 4WZMA 3H59A 4URSA 4AHCA 4KFBA 4HUGA 3GV7B 4C8OA 1LV5A 3D28A 3K5LA 5T14A 2UVWA 2IC3B 2PY5A 3IRXB 4TY8A 1T05B 4DLEA 2ILYA 3V1QA 1RT3B 3BGRB 2P5OA 1VRTA 4CEQA 3MR6A 4CGJA 3L3VA 2KZZA 1FXXA 4Y34A 5HBMA 2D3UA 3V1RA 3GQCA 5F8IA 2G8KA 1HPZA 3BSOA 5KT6A 1XR6A 3TAPA 2XRIA 3VQCA 4E0DA 5KG2A 4ED1A 3UPFA 2AU0A 1S4FA 3AVJA 2KFZA 3TARA 4URQU 4M3RA 2YHAA 1JLAB 1KLMA 1S9FA 2IC3A 5HP1B 1T05A 2QKBA 1ASVA 1KVBA 3NFAA 5KFCA 3BGRA 2FBVA 4PA1A 3MAQA 4ED8A 3DYAA 3RAQA 2ASJA 3TABA 3PW4A 1IKXB 3HPHA 1NKEA 2HHWA 4FK2A 2Z1HA 3IGVA 4CHNA 2V0NA 3LP3A 1KHWA 3LPUA 4I2PA 3CM6A 5I42B 3ITHB 1JLAA 3EYZA 3OYNA 3L2WA 5HP1A 3V1OA 2G8IA 3VQ6A 2ALZA 3I5AA 2E4LA 1HYSB 3LP2A 4DSEA 1EXQA 3DRSB 1BGXT 4CEEA 3QGIA 4FLTA 1IKXA 1JLBB 2IS3A 4RW8A 4Q8EA 4DG1A 1QTMA 4E7JA 4OPJA 1XR7A 2XC9A 2IMWP 3NDKA 2QE5A 2HNYB 1JLQB 3DLGB 1RBUA 4KKOB 1TK0A 3HJFA 4AHTA 5I42A 2HNDB 3BR9A 2BQUA 3BSCA 3VQQA 3V6HA 4CJEA 5KFJA 1XI1A 1C0TB 4M94A 1RCHA 1TVRB 1HYSA 4MIAA 3KHGA 2XO7A 3MXIA 3DRSA 3PW7A 4B8CA 1JLBA 1HARA 4KHYA 3SPZA 5KT2A 3IS9B 3G6VA 3KNAA 4MKBA 1YVUA 2P5GA 4F50A 2I5JB 4J9SA 4JS5A 3QYYA 2QK9A 1HJRA 2FBXA 1IH7A 4YR2A 3DLGA 4N76A 4KKOA 4IKFA 1NK6A 1JLGB 2HNDA 1QS4A 5HLFB 4FJGA 1QAJA 1WSIA 2EHGA 4DU4A 3SFUA 1C0TA 1B9DA 1BQNB 3CJ0A 5KFYA 1TVRA 4ICLB 3NGDA 1YT3A 5E41A 4URGA 3PW5A 2XI2A 4PUOB 2FLLA 2DFFA 3SQ2A 4WE1B 5J2QA 1NK4A 2AX0A 3AVBA 3DRPB 4I7FA 4Q8FA 4DTUA 2HVIA 5CZ2A 4FW2A 4DTXA 2R2TA 1FKPB 3NHGA 4OVLA 3TAFA 4FJLA 3CIZA 5L1KA 3P1GA 1HQUB 4R5PB 1JLGA 4Z4HA 3QIDA 2ZE2B 5HLFA 4E89A 2W7PA 3DRRA 3GIMA 4WZQA 3O4QA 3I0SA 4J9KA 1HRHA 3KHRA 4O3NA 3ZSOA 1C1AA 1RBSA 4RUAA 4M41A 2D7SA 3M8SA 4PUOA 1C2PA 4WE1A 5KFSA 4K4TA 2YKNB 5I3UA 3S9HA 3OYIA 3GIIA 3QEWA 1DTQB 4B9NA 1FKPA 3HPOA 2AX1A 1HQUA 4EZ9A 3P5JA 4R5PA 1HNVB 4BDZA 2E9TA 2ZE2A 2HWIA 4IH7A 5J2NA 3L2RA 1CLQA 4CGHA 5DQGA 3ZSYA 3GIKA 1VSJA 1S48A 4C8LA 5HRSA 4TY9A 4OJRA 1JLEA 3DLEB 4ECVA 3PJWA 1DTQA 2ATLA 4E7HA 4IBNA 3M9NB 4ELVA 1IO2A 3RBDA 1BI4B 2HHSA 1LAVA 4O44A 1XC9A 3KLFB 4ED7A 4O3OA 1C0UB 4NLOA 3KLVA 3NH2A 4MFBB 4FJHA 4ECUA 3C6TB 4PQUA 3OYBA 3FDSA 5J2PB 4CHYA 4ECZA 2IM3A 1T03B 1CZBA 2D3ZA 2XI3A 3FSIA 2JEIA 1SL0A 3FRZA 4IRKA 4CESA 2GIRA 3M8RA 3DLEA 4PWDA 3RB6A 1D5AA 4CJ5A 5KFVA 3JSMA 1EP4B 4G1QB 1BI4A 3KLFA 2VWJA 3AVIA 3HYFA 3L2QA 1KVCA 4CJQA 1C0UA 1JXLA 4KHMA 4CEDA 3ZT2A 4MFBA 4Q45A 1SKRA 4BE2A 1SKWA 5J2PA 4DL4A 4O4RA 4IR9A 4TQSA 1T03A 2E6MA 5J2MB 2DTUA 2XGPA 1S9EA 2HNZB 3ZSRA 1RDRA 1T8EA 2B43A 4CEBA 1G15A 4CIEA 4DTJA 3V4IB 4FJMA 4OKJA 5KFGA 3GILA 4LD0A 1SUQA 4KPYA 4WFXA 5KRSA 5KT4A 3RMCA 3CJ2A 1OS5A 4YP3A 2OYQA 3O3GA 1NOYA 4QWAA 4NLVA 4KHWA 4HYKA 4QW9A 4LH4A 4FJ5A 3WNEA 2RDIA 3L8BA 3GV8B 3SUNA 5J2MA 3L2UA 4N56A 4ZP9A 1S0NA 2KFNA 2HNZA 5KFPA 3LP0A 4JRQA 5T7BA 4DSFA 2EX3A 2WONB 5KFWA 2R8KA 3V4IA 4MKAA 3OLAA 2WCXA 1KFDA 3SPYA 3OY9A 2RN2A 2FJWA 2C28A 3K59A 2VG6B 5KG5A 1ZETA 3NE6A 2VG7B 3NF6A 4CF2A 3OYMA 4JLHA 3I5CA 4FXDA 2CKWA 1XHXA 1CXQA 5KT3A 3Q8PB 4W5OA 3KK3A 1VK0A 3N6MA 2FLPA 1QQCA 3O4NA 5D3GA 5KFLA 4U7CA 1HYZA 1IKVA 3T3FA 1JXBA 4Z0UA 3OYGA 4FJXA 5KRTA 4KTWA 3OYAA 1VRUB 4AHSA 4DQSA 3KLGB 2I1RA 3OYCA 3KMQA 4OKEA 3OSPA 3I0RB 3RR7A 1REVA 2W9BB 4M3WA 3LPTA 2PZSA 4JRPA 3CJ5A 4TYAA 3HSTB 4K4WA 3OHAA 3V9UA 1U47A 2OPRA 2KQ2A 1JL1A 3D0PA 4MK9A 4NRUA 4ZPBA 1W9HA 4DFKA 3NGIA 1D1UA 4RW7B 4J9LA 3LANA 2JC1A 5EDWA 2B6AB 3I8DA 5FRNA 3EY1A 3LZJA 3T5LA 3NF7A 3ULDA 3T19A 3AA3A 1S1XB 3CDEA 1VRUA 3KLGA 1TQLA 4ECTA 3DI6B 4CJKA 3NBPB 3G0ZA 3LALA 3CDUA 3AVAA 4DL3A 2HHQA 1CZ9A 4F3TA 1QAIA 4F8RA 2F8SA 1HQEB 5K14B 3PVXA 3UR0A 4CEOA 3OYEA 4ED6A 1QSYA 3T5HA 4DMNA 1KCFA 4TXSA 4RW7A 3H2LA 3OSNA 4O3SA 4O0IA
chains in the Genus database with same CATH superfamily
4AILC 3BBFA 1NJIO 3SFGA 4TNOA 1IN0A 2YWKA 6FD1A 1TL1B 4Q2MA 3NH0A 3BH6B 2VBYA 3O5TB 4PPZA 1VK8A 3CCMS 3VGSA 3OS2A 4KGZB 3AVNA 3C46A 3W64A 2CAJA 5J1EA 3TSUA 2AA4A 1WAJA 4AH9A 2G0CA 3U7JA 1Q0NA 4OJ1A 1D3WA 1M5VC 1H38A 1M1KO 3K8WA 1EQMA 1S5JA 1RDCA 1ZXOA 4WKYA 1B7FA 2DRBA 2FBTA 3I82A 4WFBQ 3NG8A 4IFVA 5JS2A 5MAOA 2IVOA 4DFPA 1VQ8N 1KQSR 1BQMB 4NI2A 3KK2B 1K1SA 4Q2LA 4QCLA 5DLFA 4QWEA 4OX8A 3J7Z5 3QNOA 2DNLA 4YB6A 2F7VA 1T6CA 4M63C 2IRUA 1IBLJ 2X3DA 2R8GA 4IEIA 4KPCA 1FFSB 2F4FA 1A0OB 3MN6A 4RWXA 3O9TA 3QNNA 4IFYA 1PJ5A 4JHDA 4LSNA 4HHJA 4NLSA 4ZPWR 1WG1A 1RT4A 4X62K 2JZ5A 1WTFA 2CGKA 3BZKA 4X62F 4DR3K 1TKTB 4K4XA 3P4UB 1N56A 5AQJA 1QHAA 4DR3F 4MDAA 3PFOA 3RBZA 3BF1A 2VFSA 4ZVRB 1FK9A 2CA9A 1NPKA 3QT7A 3TJ8A 2HHVA 3PUFA 4LH5A 4KV8A 1NGHA 4NASA 1UMJA 5SZTA 4DHVA 4WPAA 3BY5A 3PSIA 1WF1A 4JV2A 2AJQA 3MGJA 2V63A 5HOOA 5JUMA 4FK4A 2BJDA 3QEVA 3ATVA 3MD1A 4FYWB 4NA2A 1XK8A 3BEGB 3OR1A 1OH5A 4OI0A 4LMZA 4FOIA 1LOUA 1O5JA 1HD0A 4W5RA 4RW9B 1H2TZ 2P2CB 1ZS6A 2DR8A 2KVQE 1TKDA 2D41A 1U1PA 2FYXA 3NH1A 1RYSA 1FRIA 3CIMA 4CD3A 2ZHAA 1SB6A 4NRTA 3CJ8A 4QYZJ 1FWKA 2IAJB 2J5AA 1XMQK 5KFDA 4ZVUB 2HFSA 1XMQF 2C2RA 4BRAA 1OY9A 1XR5A 1B0TA 1CXUA 3AJ1A 1ATNA 3H1QA 2EC2A 1K1QA 2QN6B 1JLQA 4F26A 3V4MA 3CMAS 3LDQA 2ZDOA 4BG8A 1X4BA 3V9ZA 3ET6B 4I4BA 1AA1B 2IFXA 3N4QA 3C19A 3J81Y 1MWMA 4HR2A 2KDOA 4LJMA 3OYFA 3K7RA 4ZPAA 4PWWA 3RMBA 2IYGA 4A8MP 4H5VA 4Q0BA 5AQGA 3EGNA 4NXMJ 3O4WA 5DRKA 1X9MA 4C11B 1GLDG 4KAZA 4FZXC 4QJVA 5GAEU 3V81A 3KJVB 1NJIT 1AUSL 3ENQA 3U3YA 4RNOA 3UW1A 4WJBA 4LFAK 1D4XA 5KI6A 1RABB 1UJ4A 2FJDB 3FZBA 4LFAF 1WF0A 2GGPA 2ZBIA 1BU6O 1VQON 3ZNJ1 1HBUA 1NJWA 3TAQA 3PR5B 1SVDA 2O8EA 4BWJA 4ED3A 3VA3A 1M5HA 2NXJA 1V4TA 2W7OA 1WEZA 2E1PA 1VQ6S 3VQSA 4ECXA 1CQNA 2C2OB 1M1KT 1Z4UA 4KE5A 4GV9A 3OHRA 2CQ2A 4NCGA 4ZPVR 2V9KA 2RRBA 5KFTA 3KLEA 2KVIA 4QWCA 4XDCA 1Y97A 3H3OB 1W2BR 3TU5A 1FD2A 1NJZA 3QZ8A 4YQWA 1U1KA 4DX8H 3KXDA 4HUFA 2X74A 5K5MA 1VQMN 3QAUA 5CD4H 3K2PA 2E2OA 3HOTA 3JTOA 3TUJC 4P2XA 1UL3A 2CQDA 5KG3A 1FJEB 3VF2A 2GVZA 3MM5B 2LA4A 2KJVA 3D5MA 4WCEL 1L3VA 2G4BA 3SI6A 1U24A 3QWUA 4RKUC 3D66A 2FLOA 3IP0A 3T7ZA 2DGUA 4FPAA 1UP1A 3ULEA 2PMHA 1NG9A 1PO6A 1KKHA 4ECQA 1TFWA 3WX4A 4M7YA 3TAGA 4E98A 4PAAA 3CDBA 1SKUB 1RQ0A 2MSSA 3W9HA 3Q89A 2F1FA 3G8QA 1A5XA 3ZXWA 4PY5A 2R42A 4EAHD 2M4MA 4IEEA 1ZTWA 1A6LA 3RRHA 1QD1A 1N32J 4W92B 4C1NK 4AYBD 4MMOA 5E84A 4YDUA 1KQSM 4PKDB 2NRVA 2RE2A 3MEGA 3SBTA 4ZMMA 1LFPA 4CLPA 2O8DA 1GAOA 5KFUA 1P6TA 3L9ZA 3IA0A 4DSJA 3CB4A 1F2GA 3L0QA 1WN7A 1D8YA 3QLHA 4CZHA 2C2KB 2A42A 1CJTB 2MHEA 1U02A 4JK9A 1WSEA 1EWRA 4QAGA 3IRWP 3ZCMA 1P9YA 1KP6A 3OTCA 3AA4A 3V6DA 1W0HA 3KUGA 2EBGA 4OLBA 2MQQA 3P8BB 1Q8KA 5AZIB 4HHTA 1WJ9A 3DDNA 3WNGA 2YKMA 2V4RA 3U27A 1T9VA 4KB1A 1RE1B 2EPIA 3W7BA 3LPYA 2BUNA 2CQCA 2GMJA 4KAIA 2CFXA 2V34A 4JV5K 3G86A 2O4IA 2G8HA 3EKSA 1YRTA 4DU7A 2VPWB 1R31A 3JAMY 2F9JA 2GAGC 2Z56B 4EP4A 2EK1A 3CW2C 1TP7A 3LH2S 5E33A 4F02A 1UVNA 4P10A 2DCUB 4ES3A 2W4PA 3MFHA 2XYGB 3PTWA 1S0OA 2OPPB 5L9NA 2RHKA 3LM9A 5EX5A 2KTQA 3B4MA 3HP9A 2HZVA 1ITGA 3V9XA 1D09B 4PXEA 3NP5A 2P9PA 4YOXA 2AGOA 4CLZA 5M2UA 5C12A 4RW4B 4FJNA 1GX6A 5AQWA 5FDLA 1KAYA 3SAGA 3T1AA 4IJAA 1JWWA 2FSJA 3VQEA 5IWAK 2IA0A 2GS8A 1LWFA 3HVWA 5IWAF 1NEEA 3R7SB 2R7TA 5ITHA 3OJSA 2B5JB 2HGMA 3FLCO 3THPA 2FVRA 5ADZA 5KTQA 2LQBA 3CSKA 1PYOB 4OYZA 3HHLC 3W2WB 2CH6A 4GMKA 3CT9A 2ZZTA 5KFZA 1GX5A 5L39A 1VQ4N 1SKSA 1JLFB 3SQ1A 3WIUA 4TLRA 2MQMA 3V9SA 4MLEA 4CLLA 3TZXA 3DI6A 4BRQA 2VOOA 2J9CA 3M2UA 3KHLA 3VEYA 2VOPA 3PX0A 3FFIB 1T95A 3D1HA 3MR2A 2XMAA 4CYUA 1BIUA 1U8SA 3RB4A 5H1SV 1LK7A 1NMNA 4CIFA 1PCAA 3KK1B 4X64K 2VA2A 3OVSA 4W5NA 2FHOB 5F8LA 5D4PA 4X64F 3PHEA 3K9JA 4WTYA 1MMLA 4L3NA 4FZYA 1WDDA 2IM2A 1TL1A 5E7OB 3LDNA 1FTRA 4DX7A 3KIOA 4JI0K 2HHXA 3CJBA 3GSDA 4PG5A 1VRTB 4JI0F 1WKJA 5K8MA 2BOPA 3QEXA 3PYEA 2KT5A 4CE9A 2ASDA 4FCYA 3SQ0A 4O3PA 2HRUA 2BJ8A 2CWKA 4YY3K 5F8MA 2JSXA 4JI8J 4DS5A 3S3OA 3FZFA 4YY3F 1VSLA 3GP9A 2LXFA 4AD6A 1W2BM 3AVHA 4QWBA 3CJCA 3I55N 3BM7A 2JVOA 2A3ZA 4BREA 4CNZA 3MPWA 1LWXA 2I9SA 4OYMA 1BQMA 2YNHA 1VSKA 1NU0A 3KK2A 3OR2B 4MH8A 2I7NA 2LDIA 2EFQA 3M6GA 4A8KA 2VBXA 1Q18A 2P9NA 2OGUA 3J7YP 3GDQA 4UY8O 4U95A 4GC6A 1NZ8A 1XTZA 3CCSN 4IH6A 3LWMA 2B7BB 1NGAA 3HK2A 5EGYA 2OPQB 3POTB 4H4OB 2MZTA 3I32A 4Y2CA 3DLRA 1QUVA 4GVBB 3GE9A 4ZVFA 2X6SA 2W2PP 2OD6A 1SH3A 2W9AA 3LGNA 2RHSB 3DOMB 4CCHA 5ETNA 1S72N 5ETOA 2WVFA 5ETRA 5GINA 4CHOA 2LKZA 3UKRB 3D4JA 2HKEA 4A2AA 3BEXA 1IXKA 3SJHA 1U0SA 2UVVA 2PFFB 4FKYA 4BRKA 3N9UC 4BRDA 4OV6A 2HFOA 4F4ZA 3GFZA 2W40A 1W7AA 4CK1A 4NZ6A 1WORA 3HMJG 4ANCA 2IPOB 3PYDA 5LSRA 2ZDPA 3EE8A 3HT3A 1WSRA 3VQ4A 3CWJA 3UB5A 3EX7B 3QIPA 2HGNA 2MZ1A 3FK4A 5ETVA 1OIAA 1NHKL 2MQNA 3TSPA 2ZH8A 2O66A 4NLQA 4CEFA 4B3SF 4GKKJ 1FW6A 4ZCMA 4RW9A 3C2PA 1QVFR 1FDBA 4Y28C 2AYGA 4DTPA 1TV6A 4F4KA 5AQZA 4WK3A 4EUVA 1S7IA 4CO0A 2NQPA 3C14A 3RG6A 1RA7A 3BREA 4CIOA 4CGGA 4CEZA 4YHHJ 4O5FA 3HZEA 4HDGA 3UNGC 3RGIA 2HWHA 2YWFA 1U2CA 1RTJB 2HS3A 3IGNA 2NSBA 3BR8A 2J9EA 2YV0X 5JVGQ 4FJ8A 5EVZA 1Z26A 2JGUA 4O8UA 1UOCA 4WQ4A 3CD6S 2PFUA 4X4VA 2QO3A 1FJGJ 5KG0A 1P8GA 1RU2A 2PA3A 5T7LA 2ZKUA 3QMLA 4N41A 4CFDA 4XPEA 4O0JA 3NGYA 2GNKA 3N5BA 2B9WA 1T9TA 2PI5A 1J5EJ 3IWNC 2YY3A 5B0CA 3KTQA 2B8PA 3U3GA 3CYMA 4J2BA 1IUJA 3TUPA 1RTHA 3BO2A 3CCLS 3QFHA 3CCRS 5C7PA 2CG4A 4KO0A 2CPIA 1RWKB 2CH5A 2KT2A 1X9WA 2ZEJA 1F3FA 1PJ6A 2Y1JA 3CJKB 3QGGA 4OYXA 2KI2A 3H98A 4RG8A 2LVWA 3DOKB 2FXUA 4DL7A 3J7ZO 1I1GA 3HKWA 4TU7A 2ASLA 2OIHA 3GG4A 2ABYA 5HVHA 1D0EA 1RDUA 3LDPA 2W8KA 1F5BA 2DIUA 2F4VK 4ZPDA 3AO4A 1X1PA 1J27A 5EXWA 1KXPA 2F4VF 4P75A 4M5IA 4NYNA 2E5LK 3QEPA 4FJ7A 3EGVA 1GT8A 5IQQA 4WYLA 3QPIA 4CWBA 2E5LF 4HUEA 4H4MA 1X4AA 4BDPA 4KHQA 1TL3B 2W01A 2XBPA 4C97A 1ZAVA 3PDNA 3BSAA 4PG6A 4NLPA 1NU4A 3JSMB 5DDOC 3FQKA 4DR2K 5JJBA 3UDVA 1X60A 2R7XA 5B0BA 4DR2F 3M8QA 4DX5A 4NO7A 2ZOGA 3WXIA 3PX4A 1AW0A 3MM8A 1FCAA 4OYIA 2BM1A 4PKGA 1S9EB 2KHOA 3NAEA 4UY8T 2POKA 5F8GA 4M3UA 2G1HA 1HNIB 1S6PB 2HWTA 4CJFA 3CGIA 4IOCQ 1NGBA 4FL9A 2Y1LB 4JOUA 2KFYA 3CC7S 4C1NI 3SMPA 2XLJA 4MQ3A 1RKJA 3KOAA 3BGUA 2AJ4A 2RQCA 1YX2A 4PXBA 4IG3A 4DV4K 3R5GA 4DUZK 2OEJA 2P9LB 5KFNA 3TTFA 3AO5A 3NY0A 4DV4F 5HL7L 1ZZNA 5LMUK 1ZA1B 4JI6K 4X66J 4A8SA 1U09A 4JI6F 2UVUA 1YITS 1TAUA 1WKLA 2BYCA 5F9LA 5DM6Q 2FHJA 4EK2A 5SWMA 1XNQK 3GCWP 1N0VC 4K4ZA 3CDWA 2RIJA 1OQ3A 2HBLA 4CFBA 4IYQA 1KTQA 1CJTA 5B8HA 1J54A 4P6QA 3CD0A 2CIMA 4PL7A 4U8YA 1WOPA 4DU8A 2QEXN 4CFAA 2HEKA 2B8QA 5KFBA 3RAMA 2G1DA 3CJ9A 1REVB 5AZIA 5EY4A 3RB0A 1U26A 3FCVA 4KRWA 1S5ZA 3A13A 3ZZRA 3BQ2A 4Z7YA 4EU0A 3HL8A 3MEDA 3HP6A 2LEBA 4DQRA 3PJ9A 4ECRA 3ZTPA 2KXHA 4DL2A 4RNNA 3JXUA 3M6VA 3BYRA 3HSDA 3GL1A 3J8AA 3TQ1A 3S1TA 1BG3A 3M8YA 2KT3A 4FO0A 2PC6A 1MU2A 1N33J 3CJ4A 4EIAA 3NGTA 3PM9A 3CO9A 2OPPA 4PG8A 2H9ZA 4E2FB 2IJNA 4NLGA 4TLQA 1QQOA 1XC3A 2WK4A 3OVNA 2JRSA 4QOZB 2CRLA 1ASUA 3BPSP 2G8FA 1K6YA 5LJ3Y 3C94A 2I6WA 1QM9A 1CJUB 3VAJA 2XCPA 3GWCA 4RW4A 4WP8A 3IG1B 1UJ5A 3O1WA 1QVFM 4DTOA 1B64A 2QWNA 2J0SD 1Z05A 3R1LA 2XS5A 4DV6K 3U6FA 3T1HJ 3M9MB 4P7VA 3AVLA 4DV6F 2NPIA 5K8OA 4YDDB 4WQ5A 5HO4A 3J7ZT 1WC0A 4QU7A 4IH5A 4CIGA 2D0OA 2BE2A 4A2BA 3M3ZA 4CZEA 1UPMB 1DBDA 3R7BB 1A5VA 3AA5X 5CYQB 2BJ7A 4KTZA 3QZ7A 1RTDB 4JNEA 4EGLA 3MM9A 4DPYA 2DNPA 2XZWA 4M95A 4ZK7M 2HHHK 3MCMA 4DTMA 5IV3A 3G6YA 2CXEA 2HHHF 2VWKA 4IWVA 3HD2A 3OS0A 2HRYA 2YXLA 1FA0A 3OL8A 2XG8A 3IM8A 4KHSA 1XHZA 3FFIA 5KFEA 3QIOA 2OLWA 1IWAA 1TU0B 2YWGA 4F3QA 1VMBA 4YOVA 4DU3A 2R9LA 1Z2ZA 2CPZA 2XCAA 1BY9A 4OZ0A 3SJJA 3F5TA 3TUIC 2MKKA 1Q9XA 2JEGA 2A5XA 4HHUA 1FWPA 1F5CA 3H59A 2KRRA 2QSWA 1IQZA 2JDJA 5L46A 2YBVA 1LXJA 4N8OA 3U02A 3PRVA 3K5LA 4BRIA 2LQ8A 1A9NB 3JS6A 4OZJA 1RT3B 1VRTA 3CF5Q 4CGJA 4USWA 2I8EA 1FXXA 2WW8A 4QBUA 1JNZB 3D0GE 1VBYA 5AQRA 5KT6A 5AQTA 3TAPA 1RFQA 2H5IB 1RHRB 3GOIA 1WBDA 4ED1A 3OXFA 2GA7A 2BW7A 3L09A 5HQMA 4UF4A 3AVJA 4ZVQB 2M5YA 2YHAA 1JLAB 1Q8BA 2IC3A 5AXNA 1HIYA 2V6AA 4F36A 2OEKA 3RAQA 2DGSA 1OQ6A 3PW4A 3DXMB 3OR2A 2K1RB 4GVEA 3OXLA 4KQZA 4FK2A 4JYAK 2WFBA 3LP3A 1KHWA 4JYAF 2HURA 3CM6A 5I42B 1VQ9N 4KGMA 1U2RA 2Q43A 5GMDA 2MQ8A 1R8PA 5BPNA 4IO9Q 3POTA 3I5AA 1NDPA 2V7YA 1WG4A 3OXGA 4X4SA 3DHXA 3DRSB 2ZITA 1BGXT 1YIJS 4GVBA 4CEEA 3QGIA 1IKXA 1JLBB 2OFGX 2IS3A 3G96A 3JSRA 2J7WA 3FBBA 1UWAA 3DOMA 1WC1A 2PN6A 4L3KA 1QTMA 3QICA 2N7YA 4E7JA 1XR7A 2XC9A 2VFTA 4OYPA 2KXNB 1B99A 1TK0A 3HJFA 1E6YB 1S22A 2BQUA 3DGPB 2YJEA 3V6HA 1XI1A 4UOFA 1GTEA 1GTHA 4MTPA 4Y2KA 2AJ0A 1FHTA 1HYSA 2I38A 2R7RA 3MXIA 3GR1A 1MROB 3VGLA 2KYXA 4CZGA 2MQPA 2MGZB 1CLFA 4JI3J 3U1MA 5KT2A 3G6VA 3KNAA 2UXBJ 4KH4A 4JI5K 2P5GA 4F50A 4NLCA 5FPMA 4J9SA 4JI5F 1YJNS 1HJRA 3UR3C 1IH7A 3ILJA 3GZ7A 2O8CB 2O8FB 3OD2A 1X5SA 1WSIA 1R0CB 4DU4A 3N28A 1NGIA 1C0TA 3CJ0A 1TVRA 3QMQA 4OZLA 3AXKA 4DV7J 4RBUA 3BGLA 2PA8D 4PUOB 4FF1A 3SQ2A 2GCFA 2OFHX 2DH9A 5GADU 3FZMA 4ZCIA 3ENBA 5B0AA 2XHWA 3NHGA 1U1NA 3TAFA 5EN1A 1RISA 2NXCA 3CCES 4DV2J 1JLGA 4E89A 2WVCA 2AHOB 2ZJQQ 3KHRA 1EKSA 1C1AA 2W24A 4M41A 1SPBP 1OKJA 4ETXA 4WE1A 3MMVA 5L8RC 4KHPK 1NPRA 3CC4S 4KHPF 1S79A 2V67A 1DTQB 1RBOB 3EM1A 3MURP 2AX1A 4LR8A 1HQUA 1D8ZA 2ZE2A 3ULHA 5GAEP 3F56A 1TELA 2JNJA 3G25A 4PR6A 3QFPA 4AM6A 1M90O 4J37A 2OP5A 4OJRA 2KG0A 1Q1KA 2APOA 3O44A 3TWZA 4IBNA 3SSSA 4B9QA 4CZFA 5AZJA 3BGFA 3IR5B 3GJTB 1DQ9A 1BI4B 2WBMA 1XC9A 3KLFB 2PDAA 3B4DA 3VETA 4O3OA 4NLOA 2D74B 1RWMB 4ECUA 4PRFA 4FPBA 5J2PB 3WDOA 1T03B 2ITMA 2FY8A 1SL0A 2Q0UA 1AZSA 4XAKA 1HL6A 4IRKA 2ZFHA 3DLEA 3A1YG 1D5AA 3DLJA 3JSMA 1JCFA 1EP4B 2BXJA 2QMWA 4HH0A 5A8WB 2XYHB 2VWJA 3AVIA 4OPAA 3MMJA 1LKZA 4CJQA 4CEDA 1BLUA 5IT4A 3ZT2A 4KH6A 2MY7A 5CE3A 1KC8O 4BE2A 1SKWA 4OJGA 3BDEA 4DL4A 4IR9A 4J91A 1R0BG 2E6MA 3C15B 1S9EA 2HNZB 2VF3A 4LF2A 1T8EA 1N34F 4CEBA 4CIEA 3ETMA 3CMQA 4EFHA 1F6TA 3OQ2A 2YHYA 4OX9F 4OKJA 5KFGA 4PG4A 4JI4K 1ZM2A 3FGUA 4KPYA 4WFXA 4JI4F 4ALZA 3CJ2A 1OS5A 2YKQA 4QWAA 4KHWA 1E3MA 4MKYA 4H5RA 2E1CA 2B4PA 3CNQP 3L2UA 4ZP9A 1S0NA 4DSFA 1UZHA 1JJ2R 1M1GA 2M70A 1GH8A 2XLIA 5ELZA 3LGMA 5KG5A 1ZETA 2VG7B 1SJ4P 4CF2A 1R6VA 1VQYA 4JLHA 3A8KA 2CKWA 1HWJA 1GXTA 2EBEA 3D6MB 1EQYA 1CXQA 1K9MO 3Q8PB 1S0VA 5F0UA 1QQCA 3O4NA 3T6JA 2KHCA 4JD2B 4Z0UA 3OYGA 3QGPA 3QT5A 2CQ3A 2RAQA 2UUCJ 4L73A 2DTJA 4OKEA 2W4DA 2NZ4A 3I0RB 1YAGA 1REVA 2W9BB 5AQUA 3U1NA 3PYFA 3AAPA 1UFKA 2HQGA 1Q16B 1VBXA 2Q79A 4A4JA 1D1UA 4J9LA 1ELOA 5EDWA 2B6AB 3I8DA 4BVPA 1UJ6A 3EY1A 3AGRA 2EWHA 3CMAN 2MMYA 1U7LA 3HFZB 3LALA 4B1ZA 3CDUA 1VQLN 2WB1D 2H48B 1CZ9A 4F3TA 4B3RK 1QAIA 4F8RA 2CVIA 5K14B 3HHLD 3PVXA 4B3RF 4ILGB 1C0FA 3Q7CA 1BC6A 3T5HA 2FTRA 4TXSA 3OSNA 2DGQA 5HJYA 4DPTA 4O3SA 1CJUA 1B3TA 5HAOA 2OH2A 5AJ3K 3VEOA 5AJ3F 1UA0A 2X6NA 3LDOA 3EL2A 3OBWA 3BZQA 3SBGA 3EMTA 4XDDA 1S0MA 4NEZA 1M90T 4P7TA 5LXRA 4ELUA 4DX6A 3LAMA 4LF4K 3W5YA 3WXKA 3ZNUA 1QAYA 3SCLE 3D54A 2W1BA 4TSXA 1SL2A 5LM7E 5CYQA 2CJAA 3FVYA 1O8BA 4TU9A 5BPMA 1U0HB 3SIPB 1DTTA 3ENHA 4A48A 3TUZC 4DPUA 4CTAB 1CS4B 2V8HA 4RZRA 1SXLA 1RT1B 2NCKL 1HFEL 1MMNA 3RBXA 3WBZA 3BF3A 3MMCA 4B9VA 4X62J 3DHWC 1RWOB 3PYGA 1YJWS 1EKRA 3ILOA 5GMEA 3M05A 2DIVA 4DR3J 1BHNA 3ZSZA 1KC8T 1FKAF 2YQ1A 3EEQA 5BRFA 3SNNA 1LEOA 1RGVA 5HVGA 1FNMA 3H90A 3BV8A 3TI0A 3LAKA 1N5YA 4ZLNA 1SV5A 2WRMA 3GTYX 4BRMA 4G1PA 1LWCA 4CZMA 1Y00A 2Y9HA 4IJNA 1BQXA 1RT3A 3HI9A 1IM4A 3AA9A 2WSEC 3AD9C 5F2RA 3CJSA 3ZT4A 3AOCA 4NLTA 4DV0K 3VQAA 5GAHU 4DV5J 3AAWB 4IDKB 4DV0F 2EFNA 4F2SA 1VSMA 5A8KB 3CQ8A 5KG6A 5CABA 1NK0A 2ZBCA 4B9UA 4DJBA 3W2VA 4HCCA 2CQHA 1SIWB 5F0WA 2DGVA 4PYAA 1JXVA 3S6EA 2E66A 1DJ0A 5JLHA 3FC9A 2AQ4A 1NSQA 1YBAA 5KFRA 3MXJA 3DXMA 3Q0AA 1AFJA 4CLYA 3E66A 2OZSA 1XMQJ 4MK8A 2YNFB 3D2FB 2AWZA 3DDKA 4A5BA 4CK3A 2PBDA 5IQ6A 1N5SA 3F9MA 3H5UA 4UOGA 2N7CA 4GC7A 2VCPA 3NCIA 1N36K 1JX4A 3W62A 3D2EB 3ID8A 1N36F 1CSJA 2E9RX 4J2DA 1PIEA 4C8MA 2J4RA 4DPWA 3P83D 2QWPA 4B17A 1NK7A 1GOCA 3CCZA 1HHSA 5KT5A 1C6VA 3CMEN 3QESA 4W90B 3OTOK 1SIZA 3ZSXA 4DUYK 3OTOF 3BN7A 4N47A 1E6YA 2VZ9A 4DUYF 3M8PA 1EJ7L 3TWHA 4K4UA 3OBYA 4DF4A 4LFAJ 3VQDA 3T6BA 4E7KA 3GR0A 3R5BA 1ESVA 2HBQB 2MGZA 2HVHA 4IO1A 4WBFA 1LOTB 1VQ4S 1VBZA 1TKZB 2VC1A 2W2QP 2XY6A 4RNMA 4CH1A 3AY0A 3L4BC 2ZHBA 3DLBA 4B1WB 2YX4A 4AE5A 2HQCA 2V8VA 3HM8A 4FJJA 1EETB 4H5NA 3OFEA 2AF6A 2YQ0A 1XQIA 2HMIA 3PX6A 4K4VA 2HFZA 1T9YA 1H2UX 1S57A 2FDNA 5HATA 3WC0A 5L38A 1RU1A 3VQ9A 4C7QA 3O8MA 2X1GA 4IFEA 1R0AB 2R7OA 3EVWA 3DLKA 1X5TA 1NNDA 2WOMA 4V1Ak 3IMQJ 2VICA 2JJ4D 2QTWA 4DR7J 1ULRA 2ZJPL 2AZ3A 2V8GA 1A7GE 4XK8C 2BE9B 3N79A 4ED2A 4E19A 1S1TA 4DSLA 2RQKA 1IKYB 3DRXA 2PD1A 3HCXA 2H54B 2FIUA 3ILLA 4CBUA 3AOAA 2RF2B 2R7SA 3OL7A 4DCOB 5E3QA 3OUYB 4J9MA 1X4HA 3M6UA 2AW0A 2OD4A 2EXUA 5HK4A 2E2PA 3I55S 2Z58B 1MN7A 3N01A 4DCJB 1GLFO 1FRLA 1HJOA 1LQ9A 1G3OA 3TVKA 4DZDA 4FWNA 3SCIE 5U47A 2ILZA 3NXZA 4ANEA 4ZLPA 3ZSWA 1MW7A 5HN0A 1XJWB 1SQFA 3DM2B 4E1NA 3QDKA 3FJ2A 1FFGB 2NPFA 3E9PA 3H4BA 5AQLA 3SBMA 1X4EA 1J53A 3HFKA 1K8KB 1NK9A 1X31C 3T41A 1HNWK 1FVSA 4ES2A 2X7IA 3LTOA 4CVNE 2BEFA 1HNWF 4CLKA 1WACA 3IWXA 3IAS9 3HM9A 4DV1J 4DR6K 4DR6F 5KFOA 1S72S 3GFXA 1EP4A 2DNHA 4DMZA 5A8WA 3UQSA 1VQNS 4P2FA 1OPIA 4OZ1A 4HTUA 3MECA 5T41A 4J9QA 3G6EN 2P6SA 3OYLA 4TU8A 1S1UB 3W5XA 4J8FA 2V2QA 4JV5J 3P38A 5DDRC 4P9SA 4CFCA 4LF9K 4R0JA 3DOLB 1RAFB 3J7AN 3M30A 4K2JA 2E7VA 1S99A 2Q1NA 1SJQA 5CHCB 2YPZA 4IR1A 1O0PA 4NX9A 2CPFA 3UCUP 3PACA 3M4XA 1HBNB 3ENWA 3KMSA 2CZVC 2R3VA 3SV3A 2JWLA 2V50A 1JJCB 1URNA 2D0CA 3WNHA 1HNXK 5H9EK 4O8KA 2JVRA 3T5JA 1S1WB 3GFHA 2YNIA 1FXRA 3NAHA 3SQGA 3ONQA 2MZQA 1HNXF 3ZC4A 3P5TL 1UEKA 3K5PA 4M5DB 4RW6A 5JXSA 1UETA 3X3UA 3QWPA 3Q23A 5IWAJ 1F9HA 1Q78A 3ZO7A 1C1CB 1NM2A 2BDPA 1T94A 1YXQA 3U1LA 5HJXA 4ZP6A 2VPYB 1N6QA 1RBRA 1TKXA 4FLXA 1W25A 2HBKA 5C24B 4DCPB 2N3OA 3AVGA 1YTAA 4C0HA 1MWQA 4NYPA 2VG7A 1CULA 3AXMA 2WTFA 1SQGA 4ECYA 4OPKA 1RAIB 4OYBA 3SZ2A 2KZMA 2KW4A 2OPSA 2C2EA 3DC2A 5C25B 4YOUA 5L1IA 1CEZA 2KKZA 4H5WA 4JV0A 3THYA 3TA0A 4IOAL 1S12A 4GVMA 2OEMA 2AP1A 5AE3A 3FSXA 4J2EA 2O5DA 3MXMA 3N5FA 1ICEB 2P6TA 2CJKA 3ZSVA 3I0RA 2W2NP 2W9BA 4J7CA 3FE1A 2ASPA 2ZH9A 3GJRB 1WNSA 1DLOA 1LWEA 1CJVB 2Q6BA 5ETSA 3HHLA 1V5IB 3EGWB 2GV1A 2B6AA 3G10A 3TEGA 1QVGR 3M1FA 3CD6N 5ADXH 3FBFA 3H4DA 4WQ5C 2HIQA 3AJ2A 1BXNA 1VSFA 3KLHB 4K0KK 4X4PA 2W6KA 4K0KF 2VODA 3M2RA 2IOCA 2GW8A 1UWBB 1H7WA 5CAAA 3KLIB 4FLVA 4JI0J 4RNHA 3CQYA 4Y2AA 2GELA 3T69A 2DFHA 5FRMA 3CCLN 2O8BB 5BXIA 3CCRN 1Q8LA 4NYZA 1O51A 1X0PA 1YTYA 4L75A 1U04A 4OQJA 3E01B 3FCHA 2DR9A 3O9RA 1WHYA 1U1OA 3GG0A 1IKWA 4YY3J 2QLXA 3KKFA 5DM7L 3IAM9 2KL8A 2A41A 3PIOL 2RILA 4D3GA 2KRBA 1NLKL 2HLUA 2ZBRA 1NHVA 1OMSA 1L3UA 4ES1A 5KPZA 1WTBA 3FZKA 1GLCG 4G65A 3CG7A 5IS2A 2XS2A 1NK5A 2BA9A 2RS2A 5FLXO 1I6JA 2PE8A 1H0HB 2MDAA 3NLCA 2W9CB 4PKHA 4P74A 1SBRA 2RU9A 1VK3A 4DLGA 2Q2RA 3R9LA 5EUHA 1MWKA 4HH1A 5ADXA 4H8KA 1U0HA 3QBXA 3EZ5A 1KLMB 1SJ1A 3TAMB 5M1PA 3ISND 4OMFG 4ZOSA 2XB2D 3BZCA 4OGCA 3DXBA 4OL8A 2CG8A 3PJXA 5FIIA 4DZ6A 1M5PC 4OJHA 1RT1A 1FDNA 3RWUA 3R1HA 1NRKA 4X84A 2XSJB 1EB0A 3T9NA 4NLUA 1PAUB 4DQIA 3JSBA 2XY8A 4CJTA 5K8NA 3BQ0A 4AQYK 4I2PB 4BRCA 2FZCB 4UOCA 4EO8A 2A40A 2KJWA 1JIHA 4K42A 3PR4A 4BRLA 3LP2B 4EMDA 4RBTA 3CC7N 2CPJA 4LRCA 4U6PA 1FE0A 2VWBA 4MK7A 2XTJP 1DY3A 3R3TA 5B09A 1ACMB 4DR4K 3CXCM 4EZ6A 3OYKA 4DR4F 2EG2A 3H42A 1H98A 4NLYA 4IDKA 4TKTA 3IR7B 1BWEA 4KGVB 3KVGA 1FI4A 3IMXA 1UKUA 5AQVA 3QERA 3MR3A 4OGEA 4AHUA 1YITN 4ZCKA 1EQ0A 2HZCA 4DEZA 3J81j 3MPVA 3C16B 1NWKA 1R8HA 4ZVTB 3P31A 4ITSA 5ETTA 1IBKK 3A3PB 3FCWA 4CZJA 2R2UA 1IBKF 3DMJB 3IBCB 1JK9B 4I64A 1N4LA 5BRHA 3RMDA 4KI6A 3ALYA 4ZLJA 2CJ9A 1FRJA 5I3QA 4IOBA 3AOBA 1HX1A 1KQKA 3UI3A 1CJKB 1QDUB 3TAEA 3SQOP 5IT9U 2FLNA 4QYZK 2NRRA 1RDWX 3VF0B 1J6ZA 4DI6A 3CI5A 1KOOA 3D2EA 4JKHA 2AV5A 3HVTA 4X4QA 3A0IX 3LZIA 2VONA 2ZH6A 4BDYA 4CEAA 1B0PA 2J9DA 5HANA 1VQ5S 2Y8WA 3W3SA 2DHXA 3NGUA 3I0SB 5LOQA 3TZYA 4LF7K 3IDHA 2KH9A 2W2MP 3ICLA 4DSIA 1XBWA 4DKWA 4ZN3A 3KKSA 4AL6A 1SC3B 1NKBA 2JC0A 1S1VA 4WP9A 4UOHA 2C42A 4H4KC 1TK5A 4RUCA 3G82A 2P1JA 5JICA 2VJVA 1TKZA 3L6QA 2DFEA 3SCJE 2F4VJ 3THXA 3QO9A 1APSA 1AT1B 1RT7B 4OIXA 2GHWA 2WB4A 1TYQB 3MCSA 2E5LJ 2P8IA 2AIRB 1JLEB 2B0GA 4JI1K 3PO4A 2JEFA 4JI1F 4FSVA 3TZWA 5F8JA 1JQGA 3PO5A 7AT1B 5E3AA 3KD5E 2HHPA 2PYJA 2F8HA 3MAAB 1WSHA 3MUTP 4WK1A 2FBYA 1R0AA 3CCWA 2EWSA 4PABA 5GADP 1V3SA 2UV8A 4OO1J 3NWGA 2MYFA 1VJQA 1KONA 4EBEA 2DNOA 4DTSA 2C3OA 1TL7B 4PWDB 2KB2A 4QR2A 4USMA 3OLBA 4OKKA 1UEVA 3NMRA 4N5SA 3A2FA 1Q9YA 3C7NA 1UZDA 5CQGA 5AQMA 1X3NA 1FE4A 2PMWA 4CLFA 2DR6A 2ZQBA 3WX8A 1UA1A 4TQRA 3TJ9A 4KRFA 1M5OC 1HR0K 4N77A 5EWFA 1WI8A 2DNYA 4ZVOB 1HR0F 2ROGA 3CVKA 4U96A 4O55A 2DPIA 2A2CA 2YNGA 1XN9A 4DUZJ 5KFFA 4DV4J 4A8QA 3D3CJ 5HROA 3H7HB 4RTFD 3S7RA 5LMUJ 2YWEA 2BJ1A 1SUQB 4YOTA 3CPEA 2XY5A 4RNFA 3RSEB 1N54B 5GAGI 3WQTA 2XS7A 3PCOB 1Q95G 1YJTA 5EOYA 2RMLA 1XNQJ 2L41A 3Q2SC 1IR1A 3BYPA 4HEA9 3S3NA 3LP0B 1S9GB 2H1YA 4CLSA 1X0FA 4LFBJ 3CEDA 4V19J 4FNHA 2HAIA 3PRBA 3RTVA 3AO3A 1LNQA 3VVUA 1L3TA 2JLEA 4K8XA 3JB9k 3B54A 1KQGB 3RRKA 3WEEB 4L72B 2HK3A 3A8JA 3CJ3A 5M1QA 4LUBA 1EARA 3GIJA 3KK3B 4QIWD 1VSHA 2COLA 2MXYA 3EZWA 5L1JA 1IKVB 3SAFA 4RLEA 4ZIWA 3HO1A 4PYDA 3O8WA 4FW1A 2HFNA 4CHPA 3QJJA 4NEYA 3H8YA 2KM8B 3ZLJA 2A6MA 2HAFA 5IV4A 1UFLA 2P51A 1QJHA 4IQXA 3DOLA 3HHNB 3K58A 2Z2ZA 3EDRB 4K8RA 1VDHA 5ETKA 1SZ2A 3OL9A 1YIJN 1S6OA 2IIHA 3FEYB 2HS0A 1YHQS 5CCLA 5D0GA 4JEPA 3Q8SB 2DNQA 2W2OP 5LXYA 3HX9A 1WEXA 3HLUA 4ZCLA 5BYQA 1GK8A 1RDBA 1Q86O 5ETPA 1YJRA 4AXJA 4JS4A 2HVEA 3SSQA 4CJ7A 3WXJA 4LT6A 1EIYB 3A5OC 3LO3A 1OWXA 2QA4G 1JLCA 4CGDA 4DV6J 4J90A 1C1CA 1TUGB 3MCNA 4R8UB 2WBNA 2WBRA 3M1VB 1HNZK 5C24A 4DHYA 1HNZF 4A8FA 1ZBUA 3D2WA 1YJNN 5BREA 2RKIB 2ZJRQ 4K41A 2VG5B 3ZT1A 4Q43A 1LW0B 2G9OA 3FMBA 4I2QB 3O9UA 4BY9C 3HULA 1S6QA 5C25A 2F3JA 4GY2B 1YUWA 2IJFA 2GV9A 4CGFA 3PEHA 1NGEA 4FBTA 1WHWA 3QGHA 5C5JA 1HKCA 2A1BA 1VCTA 1BUXA 4ZHRB 4I9QA 5DGAA 2YPYA 4FVMA 2XZTB 2RH3A 4ECSA 1WSGA 3CCEN 1SH0A 2Q66A 3MR5A 3ZZZA 1PYSB 3GSIA 2NRZA 5SUHA 2CPDA 5IC6B 1AYEA 3KLHA 1PGZA 3IC1A 4DL6A 1N52B 4WTOB 4BRHA 2AJ2A 4CJUA 4FYDA 2DNMA 4J9OA 3CC4N 3V9WA 4J9VA 4M45A 1U25A 4ISFA 2DNZA 1GLLO 2H51B 3NOGA 3M32B 2R7QA 3MFIA 3AB4B 2QJ3A 4Q44A 2Y0BB 1HPZB 5FLXU 4EYIB 2NREA 3DU5A 5D4OA 1O1WA 3Q86A 1NMDA 3W9IA 4K25A 4DWIA 3ID6A 2IVNA 2BANB 2UXDK 3DRYA 2C22A 4QOTA 4C8NA 3UFCX 2UXDF 4C0OC 4WZMA 2MQLA 4URSA 4YORA 3LPEA 3GV7B 5E0OA 4C8OA 2AMCB 1LV5A 1I51B 2LEAA 2UVWA 2PY5A 3IRXB 1T05B 3TR5A 1Y5NB 2ILYA 3V1QA 2MJUA 2P5OA 4BC3A 3L3VA 1RBLA 3TSQA 2VQFJ 1NXIA 4CBXA 3BO4A 1UPPA 2MKIA 3WUHA 2P9IA 1WKKA 2ZJPQ 4ERDA 2K7KA 1R7IA 3QBCA 5KG2A 4JYAJ 5TKYA 2AU0A 2ROEA 3JS9A 5JMVA 3BH7B 2YHXA 3TARA 4M3RA 3WZ0A 4O23A 5CCMA 4AT1B 1KLMA 5KFCA 3BGRA 4JK7A 1E6VB 4PA1A 2WSFC 2H5EA 3NMUA 3IBWA 3TABA 1MWYA 3HPHA 1OVYA 4ILHA 3TEHB 3O1BA 4RR5A 3R6GB 3D1QA 2B51A 4WFNQ 2E5JA 3LPUA 3TZZA 4I2PA 3ITHB 3IWLA 4DUTA 5BN9A 5HP1A 4WFAL 2ALZA 2QG9B 5AQIA 3LP2A 3MDQA 3MMAB 2QM1A 4FLTA 2M3DA 5G0RA 2W7AA 3R8EA 2EKNA 3VAFA 3GB0A 5GAHP 2DNKA 2IMWP 3EE9A 2QE5A 4BRGA 1Q4RA 3MN9A 1RBUA 1YBTA 4KKOB 4H0XB 4AHTA 4I0WA 4BRFA 2JL9A 3BR9A 2HBZB 1Q86T 2R4FA 1CVJA 2K8GA 2WVBA 2E2QA 2CGLA 3VQQA 4CJEA 5KFJA 3U9DA 3N4WA 3NNAA 3L95X 4M94A 2AP6A 3I8BA 1VQKS 1JCEA 3PW7A 4B8CA 3WT0A 1HARA 4KHYA 3SPZA 4MKBA 1YVUA 2R7WA 3UVJB 5H1SQ 2H3GX 2V4JA 2QK9A 2F65A 3AY9A 2L3MA 4Z7CA 3UKUB 5AXKA 2HQ3A 3DLGA 4WIQA 1NK6A 1WHXA 4P52A 2HNDA 3MOJB 1QS4A 2QMXA 4FJGA 1QAJA 3DDIA 2CJXB 4OFZA 2EHGA 3W65A 2V69A 4WFBL 1VQLS 2H3EB 4A59A 1B9DA 1BQNB 4LBIA 2ZH2A 1YT3A 5E41A 4URGA 3CJRA 2DFFA 3A12A 3ETOA 1TFYA 3IFEA 4AFFA 3DRPB 2G2ZA 5HVFA 3FKBA 2V51B 4KHPJ 2A18A 4DTXA 2QFJA 4OHWA 4OVLA 4FJLA 5L1KA 1OPZA 2D9PA 4R5PB 1XMOK 1YK9A 5HLFA 3UD5A 1YZ6A 1XMOF 3K89A 4PPDA 3GIMA 1KVIA 3I0SA 3CCQN 1RHJB 4RUAA 1RZMA 1HLWA 3M8SA 3O9SA 5KFSA 2YKNB 2DHGA 2GQCA 1HKAA 3IBFB 3GIIA 2HLTA 4PG7A 4B9NA 1RWXB 3J81U 1FKPA 1ZPVA 3HPOA 3G71S 5A0YA 2QXLA 2HWIA 2N82B 4E1JA 2ACYA 3FSYA 5BJRA 3GIKA 2C3MA 4M5NA 1S48A 4USTA 4F0HA 3NNCA 4TY9A 1N8RO 1JLEA 3NRBA 4ECVA 3G4SS 5IM0A 2ZH5A 1HBMB 4E7HA 5RUBA 3M9NB 4ELVA 3WHIA 3RBDA 2HHSA 4X65K 3MAAA 4ED7A 2JWNA 4X65F 1C0UB 2XMJA 3KLVA 1MMDA 3NH2A 2FB0A 1JMTA 3OYBA 1VGYA 4K5SA 2CPEA 1NBWA 3W9JA 2XI3A 4ZKAA 3FSIA 1TL7A 2P9KB 4MYUA 4CESA 1IBMJ 3OFFA 3M8RA 4PWDA 3WQUA 5D77A 3RB6A 3SDEA 2VPXB 4FZVA 4OI2A 5FD1A 2JHEA 1NGJA 2JWKA 3R5DA 4G1QB 2LCWA 3UN2A 1X4DA 4OYOA 1KVCA 4BR0A 1YJWN 4KHMA 2YCHA 2WZ1A 4MFBA 4KC5A 1G1XA 1SKRA 2FQQB 3I33A 5J2MB 2ZNYA 2F8MA 3ZSRA 4IQMA 3TQEA 1H7XA 2EK6A 3WIVA 2DBBA 4DTJA 3EICA 3M2VA 4FJMA 2QZ8A 3GILA 4LD0A 3F44A 1SUQA 3BPDA 4XTTA 2CJBA 5IFMA 5CD4A 4LRBA 3RSEA 5KRSA 2F9TA 4BLGA 4YP3A 2OYQA 3MPYA 1NOYA 2XHCA 1ZH5A 4U7BA 4HYKA 3DAWA 5E3PA 2I7PA 2RDIA 2OO4A 3GV8B 5MLCV 3SUNA 2Q36A 5M1KA 4LF6J 3LP0A 5B0DA 5T7BA 3M8WA 2WONB 3OFGA 1FJCA 2VDIA 2HG4A 3V4IA 2XM3A 4MKAA 3OLAA 2WCXA 2O3DA 1KEKA 5A8RB 2MJNA 3OY9A 2RN2A 2VG6B 3TP2A 4BVOA 3NE6A 4Y2MA 3MM7B 3D6RA 1DQ8A 4B1XB 4FXDA 3CMES 2XMKA 2YTCA 2QLJB 3KK3A 2DGXA 1VK0A 4CNYA 2QT7A 2MPUA 2FLPA 1K0VA 3BF4A 1IKVA 4F3MA 2RJZA 1VRUB 4AHSA 5CYJA 2I1RA 3WXLA 3SCKE 1Q81O 3LOUA 3KWGA 4M3WA 3QAEA 1L3KA 2PZSA 3CJ5A 4CT8A 3OHAA 5B08A 1JL1A 4USHA 3D0PA 2FUG9 4B3RJ 1EZZB 2P9SB 3K2YA 3LANA 1KOHA 5FRNA 2H5JB 3NF7A 3ULDA 3ZETB 2RD5C 1AFIA 3PRDA 1SAZA 3QRPA 1N33K 3KLGA 5AJ3J 1TQLA 2NUUG 1N33F 3AVAA 5KOXA 4B1YB 4BQLA 2F8SA 2RB7A 1AB8A 1TTHB 1HQEB 4PKIA 1RHQB 3M1VA 4JKGB 2DHHA 5FJ4A 4ED6A 1KCFA 1RK8A 2LECA 3VZIA 1M5KC 4RW7A 3H2LA 4JI2K 2VH7A 4ISGA 4O0IA 3N0VA 4DSKA 3C6UB 1T11A 3FEZA 4CJPA 4JI2F 3MM6A 4KR0B 5L9XA 2EFOA 1NK8A 1RCXB 4LF4J 2F96A 4FM1A 1FNXH 1S1XA 3SI8A 3ENAA 3RR8A 2QV6A 3T1HK 2RRNA 9RUBA 4ZITA 3NBPA 2HHTA 2UVRA 3DN9A 1LXNA 3T1HF 1V9OA 2G0IA 4QPTA 2DPNA 4JKCA 3H5SA 3O3FA 2EG1A 1N8RT 2QWOA 2V2VA 4NI2B 2B4JA 3CHWA 3O08A 2FJAB 2L9DA 2Y8YA 3NS7B 2V4QA 2MKHA 1VC0A 4LF1A 2WTUA 2VBZA 3T9ZA 1XWLA 3DXSX 3PY8A 3IO1A 2CQ4A 5CXTA 2P9GA 3QEIA 3D6HB 3TO8A 3VAMA 4IFYB 2YX6A 3PZPA 4MLHA 4LSNB 2DHSA 5KFHA 2QI2A 4OI6A 1VR6A 2YWHA 1JL2A 1HMVB 3VGVA 4L8RB 3MEEB 1N5VA 2BZ2A 2ZOFA 1RT4B 1HPMA 4ZPCA 1K47A 2KYZA 2O67A 2GVDB 3M32A 3P96A 2NUHA 4OZNA 1QLNA 3ZZOA 3VF6A 3SUPA 1FRMA 4MKVA 3KJNB 4OZ3A 4G1IA 1FK9B 1SI9A 3ZT3A 5A76A 3R5CA 2BANA 1FESA 4KV8B 3VENA 2HS4A 5LMNJ 4FBUA 3CFOA 2ZM6K 3CO0P 1IJEB 1Q53A 3FZ2A 3D7SB 2ZM6F 3DWLA 4YOEA 1ZPWX 3I87A 1WOSA 1S97A 3IRXA 1GLEG 4FJIA 1RADB 4DCHA 3MMBB 1ZTTA 3LWLA 2D3OR 3TOQA 5LSLA 3VTHA 3EJMA 3H08A 3IUCA 1H74A 3G6ES 3QBWA 2XZDB 4K2XA 4QW8A 1ZBIA 2PIIA 4FM2A 4YB5A 3IN5A 2R2RA 1KRPA 5DZ6A 2BKOA 1U8WA 1NO8A 4B9MA 1Y5LB 1RGIA 1D9FA 2RDJA 5F8NA 4LIRA 4UUWA 4ATNA 2GFFA 3AVFA 3VAKA 3PW0A 3PIPL 2V5HG 3K0JA 3TJAA 2E88A 1N36J 1TKTA 2HF4A 3M8ZA 3VAHA 1VQNN 3VV2B 3AVCA 5KFIA 5AQSA 5I9EB 1Q82O 3V6JA 5DZ7A 3EKUA 2F8TA 3JYTB 1REGX 3QB0A 3L2VA 1RYRA 1NHUA 4F3OA 3OTOJ 3PKYA 4B3OB 1P1TA 3ITHA 4HACB 3VQBA 3IXQA 5C2FA 4DUYJ 2FVQA 2RQ4A 4H5TA 1L3SA 3M7VA 3W8PA 1RT6B 4DFJA 1Q81T 2AEJA 2KXFA 1FT8A 2V8PA 4CI0B 4ZVEA 1P90A 1KVKA 2R7YA 2EC0A 2K3IA 4Q0BB 2QC3A 1QTNB 4LQ9A 2IYIA 2J7KA 3RB3A 4B3SK 1KSPA 4JBCA 5KPTA 4ZVSB 2XGQA 4J9NA 3LUYA 3V81B 4KB7A 3DXKB 3N6LA 3L7OA 4J5OA 5FROA 1H73A 4A62A 1F0XA 2LFVA 4USKA 2UUBK 3BKFA 2H65B 1NSAA 2CDRB 2UUBF 2E1ZA 4FXVA 1WLJA 4B9LA 4I9LA 2KKHA 4EWTA 1HBUB 4FF4A 2F9DA 2IAJA 3UN5A 4KHUA 2ZH4A 1VRQC 2CQ1A 2ZBPA 2Q1LA 3R27A 3UIQA 3UKUA 4NB4A 2B9EA 3JQJA 5FPNA 3ET6A 1AUDA 1L5UA 4HTIA 4DS4A 4ZVHA 4DV7K 4NCGB 4PZVA 5DG9A 3P49B 3ELHA 1NGGA 4CGIA 1RA6A 3KLEB 1BQNA 4DV7F 3BO3A 4DF8A 4ZLLA 3CPWR 4CZKA 1FWLA 4BWMA 3LM2A 4JKBA 3ILIA 2DHAA 4PWUA 1YTUA 4MYTA 3DRPA 3THVA 4C11A 2RS8A 3EVMA 1RB0A 3RW6A 3KJVA 5AQQA 4CO1A 4DV2F 1SJ3P 2GVZB 4J9RA 2ZD1B 2OSQA 4C8YA 1H1VA 4KHRA 3CFRA 2ZZMA 1M5SA 1FJ7A 1QSLA 3S8SA 3N6NA 4CF1A 4NOHA 1C0GA 5AFUH 3ULEB 2X78A 7FDRA 3PV8A 4QPXA 2YKNA 1WSVA 2E1MC 5F9NA 3OJUA 3C65A 2BJ9A 3LGHA 3AD7C 2VD3A 4OI4A 3QJLA 2RUSA 1QZ6A 3VESA 3PW2A 2FJXA 3GV5B 5CY4A 3CETA 3VQPA 3VEVA 1VSIA 1I5OB 3W66A 3D6TB 4BGAA 3HD1A 4CI6A 3F0NA 4W5TA 4EHUA 3ENVA 3V6KA 2F7TA 2Z2LA 1SC1B 2EEYA 2PYLA 1DURA 1Y3JA 1HNWJ 4FWQA 3MEGB 1K44A 1HBMA 3AJDA 2ZZNA 4ZP7A 2NLXA 4DR6J 1QQMA 1PBAA 1WSFA 3QLHB 1WB9A 3MM5A 2X3GA 1EHWA 1ZBLA 3NKYA 3I6PA 4DPXA 3SXLA 1RWUA 2HQFA 3V6DB 2HW3A 4P2MA 4K7QA 4KI4A 4NYFA 4C8KA 3FGVA 4C0BA 4CJVA 4NYOA 2CWXA 4F0KA 1EX4A 2YKMB 3MPUB 5AFUA 3P39A 4LF9J 4OX6A 1QE1B 1VHFA 2HPUA 4DV3K 2ZKTA 5CYMB 4G1QA 4DV3F 1KVJA 4DDFA 3M9OB 2D9OA 3H6EA 3A5LC 1WNEA 1Q5VA 4GNIA 1Q82T 4AHVA 2BR0A 1PC5A 2BVZA 4GMJB 2ZUGA 1DT9A 2BMBA 2OTLS 1HNXJ 2M7SA 3G8SA 4ZJOA 1Q7LB 4U67L 4O4GB 5GIOA 4C6AA 3THWB 2XULA 4QIFA 3MTKA 1N88A 4ER8A 1BWFO 4FK0A 4EBCA 1WAFA 2EFVA 1P27B 1U1RA 2P9PB 2VJUA 2DY9A 3O9QA 2NXEA 4HDHA 5FDLB 3ZTRA 4IXCA 3HZGA 4JN4A 3JSYA 3B6OA 1EO1A 3H45C 1LWFB 2WONA 1GLAG 1IG9A 4H0YB 2ZF5O 5J1NA 1BIZA 2VQEK 4LSLB 4MT1A 2JOQA 3RYLA 2VQEF 2VG6A 5CZVA 2ZC3A 1BE4A 1SCJB 5AQYA 1J2VA 4XO0A 3CD7A 1S10A 4FWPA 2DGTA 5HRPA 4Z37A 1RT5B 4F4AA 1ZBSA 3EXYA 1WELA 3VQ8A 1ZAWA 4YN3B 2OJ3A 1IVZA 1YGYA 5CZ1A 3OTBA 3KG1A 4WFAQ 5AXLA 1DQAA 4K0KJ 5JVHL 3CJQA 2HQIA 3P5BP 4L3QA 3AARA 1DKGD 4HHHA 3QFWA 2ZGZA 3W61A 2ROPA 5FLXY 3I56S 1C1BB 5DLGA 1Q7YO 2P9SA 2X1FA 1J9AA 1VC6A 1VQ5N 2KHDA 4A5AA 3ZETA 2OMLA 2J7UA 3VCDA 3CCVS 4NLRA 2UUTA 4UTGA 2B5JA 3H5YA 4F4WA 3VVTA 3MK6A 2XSFA 5DQHA 1NLVA 1RILA 3AO2A 2EKYA 3MPDA 3PEJA 3W2WA 5KGWA 4IOCL 1HQEA 4OLAA 1FEEA 5C42B 4JKGA 4ID5B 3C3LA 3GLJA 1T3OA 1FVQA 2BTFA 3TX8A 3JQMA 1JLFA 3GU0A 1OY6A 3C6UA 5AT1B 2EFPA 3JQKA 5EU7A 4M3YA 3CPWM 4WFYA 4KFBB 2CYYA 4M5KA 4LF5J 1F9EB 2IJRA 3ZX3A 5KGXA 2W6LA 4F25A 4H54A 3MOZA 2AGQA 2YHBA 2PEBA 5HBMB 2YNHB 5DM6L 2Q31A 2RE1A 2HK2A 5KAKA 3KK1A 5FPDA 4NMLA 1NH8A 1YJUA 2P9NB 5DK5A 1KN6A 3AA8A 3SMZA 5A6PA 5H9FK 4J9PA 5A2QO 3ISNC 2HF3A 3KWMA 1RKIA 4AQYJ 4M7XA 3CM5A 4RUBA 4IDHA 1OH8A 4UZBA 3MTJA 2HVZA 1HMVA 4ILRA 4ZN1A 3MEEA 4IZ9A 5AQPA 1KNZA 1IJJA 4U7UK 3VEZA 2V2KA 2GVDA 1RBAA 2DEIA 1NGFA 3W1YC 4JKAA 3OHBA 4DL5A 2NXNA 4DR4J 2IVPA 3DU6A 4M3ZA 4RUHA 1TR0A 5EX0A 9ATCB 4JV1A 2OAUA 3IAYA 3GIRA 3VALA 2RSQA 4BROA 3UCGA 3KDOA 3A8YA 4AL5A 4B9TA 4LF8K 1CC8A 5M1OA 3TTCA 1WUAA 4LF8F 3O2IA 3C6HA 2DRDA 3MMBA 1HYVA 1SQEA 4DG1B 4DV5K 1RWPB 4CLWA 3TR8A 1IBKJ 1AROP 3F73A 5IXUA 4LBHA 4WCEQ 3QIPB 4DV5F 2DY1A 4BC4A 2GIQA 2BRKA 2QSFA 4XEIA 3RBEA 1GMWD 1T7PA 2QYGA 2GBZA 1Y7PA 2AGPA 2HSTA 4NCBA 1I94K 3UD4P 4FDFA 4DTRA 2OTJN 2OPQA 4H4OA 1I94F 1RAOA 4PXCA 1TV6B 4ZIVA 2LXIA 3NNHA 2CPYA 2DISA 3C14B 1KAXA 3OA9A 4HVJA 1IBCB 4RWWA 1YKWA 2JEJA 3UKRA 2HBRB 2Z1IA 5LJWA 1SS6A 1T44A 5E5NA 5C2DA 1OH6A 4KH1B 5D6GA 3EUNA 3JYTA 5EHHA 1X9SA 3WNFA 1Z25A 2SXLA 2VFUA 2YX7A 3R6LB 3H5XA 3HJVA 2VUGA 2B3TB 3T1YK 2NNWA 3VWSA 3R5JB 4Z2XA 3T1YF 3GBTA 5T7LB 4K4SA 2A1RA 4F0MA 4B3OA 5K9FA 5DG8A 4ED0A 2QWQA 2NLWA 4HACA 4CM0A 3T5KA 5J2QB 4A57A 4LF7J 4GKJK 3SQ4A 2G8UA 1FO1A 4ZVPB 4GKJF 1RT6A 1YHQN 5ETLA 3NF9A 4E7IA 1O13A 1UVLA 4H0OA 2RT3A 3DCAA 1RI7A 2ATCB 3B8HA 1RTHB 5AQKA 4UUXA 1Q7YT 4KO0B 3DRRB 1RWVB 3DXKA 2BKNA 2ASMA 2W25A 2DT9A 4OZ5A 1FFWB 4U7UD 2HSEB 4M5MA 2DGOA 3R9PA 2K3KA 3DLHA 1S3XA 2LSNA 2VBWA 4JI1J 2H4YB 4P72A 2Z1GA 4QR1A 3VOVA 3CF5L 2XY7A 1RTJA 3HBTA 5J2NB 2PGCA 4H4KA 4I6MB 3G9CA 1VSEA 4M3TA 1UEUA 1H72C 2BBEA 3LA0A 5EWEA 2YH1A 2J9DE 1FRHA 4U9RA 4E3SA 4Y65A 3FZHA 4H4MB 3QT6A 2A6AA 3MHYA 3K5NA 1H2VZ 2FVPA 3HPGA 2IRXA 4RWTA 5LL6d 3FMWA 2DY4A 1ZBHA 4NCAA 4O44B 4DQQA 2QLFB 1IWGA 3M8QB 4YB1P 3D45A 1SH2A 4ED4A 1VHXA 4DR7K 4WIIA 1Y0HA 2HFVA 3NAIA 3VGTA 3KKRA 4DR7F 3MM8B 3FFKB 1KAZA 1BL3A 3CJKA 3OBIA 1HR0J 4LREA 2ZD1A 3DOKA 4KSEB 3TX0A 4CERA 2AYEA 2HVDA 2XO6A 2UXCK 4IO9L 3L3CA 1I3OB 5HRNA 2C3YA 4AHRA 2UXCF 2R8JA 4PQAA 4Q5VA 4QQBA 4F4YA 3O5BA 2Y3YA 4FLYA 4U8VA 4IG3B 2GO8A 2QA4S 2DO0A 3CE8A 3B8AX 3MR7A 1TL3A 4V19X 2M8HA 3GJQB 2E1YA 4QS8A 2MZJA 4FS2A 1ASWA 1GOBA 1PILA 4YNQA 2R8IA 1RWNB 2FC0A 5HMZA 2ZGYA 2ZVIA 4F9OA 3I4PA 1KHVA 3A3OB 3MAHA 3VEXA 4L6V3 4RX6A 1N34K