1TV6A

Hiv-1 reverse transcriptase complexed with cp-94,707
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
539
structure length
535
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 reverse transcriptase bound to an inhibitor active against mutant RTs resistant to other non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords reverse transcriptase p66 subunit
total genus 139
structure length 535
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tv6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tv6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tv6A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tv6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tv6A05
3MEGB 2AJQA 1JLCB 4B9SA 1T3NA 5FDLB 1WLJA 1Z26A 1CXQA 1RTJB 4YP3A 5JUMA 4K4SA 4DLGA 3MXIA 3M9MB 3RR7A 5J2MA 1WSGA 2NUBA 2KFZA 5KFMA 3HVTB 3H4DA 2V4QA 1NK7A 1LWEB 3OYLA 2JEGA 3UIQA 1FK9A 3KLGA 1JLEB 1X9SA 1LAWA 4KB1A 4ED2A 3KK3B 3V81B 3KD5E 4FS2A 3RWUA 2A1RA 4TYAA 4KBIA 3HSTB 3OYMA 3UR0A 4ECZA 2BRLA 1LWCA 3FSIA 1JLAA 4ECUA 3QEVA 5KT4A 2DFFA 2XO7A 3L2QA 3OJSA 2QK9A 3C6UB 2YNGA 1GOAA 3RB6A 2G8UA 2ZD1A 4DTNA 4JV1A 3KLIB 3GV8B 1LW2A 4O0JA 2C2RA 1C0UA 3AVGA 2WTFA 3V1OA 1IKVA 4GC7A 1HQUA 4TY8B 4W5NA 4Q45A 4M3RA 2OZMA 4KHSA 2WHOA 4WFXA 3HVAA 4DTOA 2FBXA 1GOCA 4CGFA 1RBSA 3K2PA 5KG5A 4ID1A 3PR5B 4B9UA 4ID5B 3RMAA 4MQ3A 3HJFA 4HYKA 5F8NA 4IFVB 1Q9YA 4EP5A 3ULDA 2W8LA 4KI4A 3DLGA 4CF2A 3ZT4A 2R8HA 3K59A 5EWFA 2WB4A 3D28A 4KREA 4Y1CA 3DI6A 1WSFA 5F8GA 3AO5A 5I3UB 5KFHA 4ECWA 3OL9A 3M8QB 3LP3A 3OYFA 2HW3A 1I3AA 1CXUA 4DQSA 4E0DA 2HVHA 4HVJA 1JLCA 2FBYA 4NLOA 2OYQA 3V9UA 4EEYA 4NCGA 5JS2A 2R2TA 4DL5A 1KVBA 4F4YA 1VSJA 5T14A 1R0AA 2WOMA 2IMWP 3NH1A 2FLLA 4LD0A 3BR9A 5J1EB 2AGPA 3H2LA 3TAFA 4URSA 5F9NA 1J5OB 4ZHRA 3NGDA 3SV3A 4ID5A 2RN2A 4RW4B 3PR4A 3QNOA 4F4XA 3CJ4A 4EYHB 3NHGA 3KK1A 2IJNA 4ZPDA 4W5TA 4K4YA 3K57A 2W7PA 3T19A 5CYQA 1S9GB 4IG0B 3QEPA 1TV6B 5KG2A 4B9VA 1HQUB 1MMLA 3IGVA 1NOZA 4K8ZA 2ASLA 4JUZA 5F8LA 5EDWA 3IN5A 4NYFA 4HUFA 4DSJA 4FJ9A 3AVHA 3AV9A 1NNDA 2G8IA 5KFTA 4J9RA 1JIHA 3QZ7A 4URGA 3SUPA 4J9KA 2HWHA 4K4VA 4KHNA 4FZZA 3V6HA 3NAIA 2IM2A 1RBRA 1RT5B 3VQPA 2F8EX 3PV8A 3SZ2A 1JXLA 4O3OA 3OHAA 2RKIA 2KZZA 5J2QB 2FBTA 3SUNA 1X1PA 1RT4A 4NZ0A 4M95A 1VRUA 1LAVA 3IRXB 4CJEA 5F9LA 1VK0A 2P1JA 5KFWA 4ZHRB 3OYEA 4FZXC 3QIPB 4K50A 1TL3B 5CZ1A 2WOMB 3GV7B 3NF9A 1C1BA 1TKXA 3E01B 1HYSA 4JLHA 3HYFA 3NAEA 3T5LA 4DSEA 1SL2A 1BL3A 2W7OA 4CEOA 3H5UA 3AA2A 1VRTB 4HKQA 1C2PA 2C28A 3GIIA 4FJJA 3M8PA 2IJFA 1RTDB 3RB0A 3UPFA 1A5WA 1RCHA 2XGQA 2FBVA 4CIEA 2R2SA 3AVBA 1RT6B 1HARA 3L2RA 2EHGA 5L1KA 4KE5A 4QWBA 3OL7A 3RB4A 4CFAA 1RA6A 4ECVA 3OYCA 3KK2B 4ICLB 1W0HA 2OZSA 4CJKA 1HQEB 4HUEA 4E7JA 3CJ5A 1XR7A 4YR3A 3BQ0A 4WZMA 4CECA 5HP1B 4ZVFA 4CK2A 4IR9A 1QS4A 2XHBA 2QV6A 3I0RB 4FJMA 5KFJA 1RT2B 4H4OA 3PJWA 2E6LA 4FM0A 3I5BA 1RT1B 2YKMB 3EZUA 1IKVB 4CJ5A 4CJFA 1I6JA 4DU1A 4DS4A 2KQ2A 2IM1A 2VWJA 3KKRA 1NKEA 3DRSA 1SUQB 4IOBA 1RT6A 1FKPA 3MXJA 4K4TA 2OPRB 4O5BA 4CEFA 1NKCA 1C6VA 1RA7A 4CJLA 2E9ZA 2X6SA 4O3QA 4CF9A 3CJ2A 1ZBUA 3MR6A 2X78A 2CJQA 1O1WA 3AO2A 4ZVGA 5KFGA 4QWCA 3OS1A 5I42B 3TAEA 2FJXA 2FJVA 2EC0A 1RT3A 3S3NA 4DF4A 4NCGB 4ECYA 1QE1A 1ASVA 5KG0A 3NGIA 1K1QA 4CJPA 4GC6A 2E4LA 4MK9A 4TSXA 4AHUA 1KLNA 1RTJA 3ISND 4K4XA 1HPZB 3C95A 1LWCB 3DM2B 4IH7A 3DRSB 4Z4CA 4BE2A 4O44B 3PHEA 2QE5A 4O3PA 5F8MA 3HPGA 2DFEA 4WXWA 4H54A 3VQBA 1HJRA 5L1JA 4ED3A 5J2PA 1RT7B 3T1AA 4QAGA 1K6YA 4OL8A 1T03A 4J9PA 5T7BA 1UA0A 3HVTA 4FJLA 4AHTA 4FJXA 4OKJA 4TXSA 4B9NA 2HHUA 4IG3A 4YQWA 4J9QA 2BQUA 1F21A 1N48A 4CCHA 5JS1A 4WZQA 4JS4A 3PW0A 4O55A 4B9TA 3OYGA 3V6KA 5KRSA 2BRKA 2XRIA 2BDPA 1KFDA 4WFYA 1LWFB 4EBCA 2Z1GA 1S9GA 4B9LA 5E41A 2O4IA 3QIOA 1SV5A 4O44A 1T94A 4Q0BB 2UVWA 4MIBA 1J54A 1TKTA 4F3TA 3LP1B 1SKWA 4FM2A 1Z4UA 5F8HA 4DMNA 4M94A 3SQ0A 4FCYA 3P5JA 2O5DA 2WCXA 4F4WA 5KFBA 2I1RA 2IOCA 1S6PB 4KHWA 4RW6A 5KFVA 5HRPA 3OJUA 4N5SA 3KK3A 1TK0A 3HM9A 4DQRA 4R8UB 1EETA 4J2DA 3TAQA 4NLTA 3Q8PB 4CEQA 2P51A 5KFCA 1SKSA 3VQCA 3AVKA 4ECRA 3NE6A 5HBMA 4KFBA 4ZPCA 4LSLA 1EXQA 1LV5A 1SL0A 3KHLA 1RDCA 4DLEA 4AHCA 4IG0A 3QO9B 3PZPA 3PO5A 3DMJB 3RAXA 4TQSA 4I9QA 3SFUA 1LWEA 4N41A 1YTAA 4CGJA 1L3UA 4ED0A 3LP0B 1RTIA 1S5JA 4RW4A 3EY1A 4M3XA 3VQ5A 4J2EA 3BGRB 3V6DA 3L3UA 4FW2A 2FLPA 2WONB 3PX6A 4R8UA 2YNFA 5DG8A 3NAHA 4FBTA 3KIOA 3PX0A 4PWDB 4KAIA 5F8JA 1LW2B 3GIKA 4O3RA 3K58A 3VQAA 4QWDA 1TGOA 5CZ2A 1XHXA 1G15A 4IRKA 4WE1B 1C1AA 1NHUA 4DS5A 4KHQA 3TWHA 3LAKA 1J9AA 3U3YA 5CY4A 2OPRA 3N6NA 3CWJA 4HCBA 4TYBA 2JGUA 4CGGA 1WSJA 4ZTFA 4NLQA 3V4IA 3ZSZA 1TL1B 3LANA 2A1SA 3LP2A 3SFGA 3TAMB 2Y1IA 4LQ3A 4IFVA 4ZVEA 4O4RA 1W9HA 1HNVB 2BE2A 2W9BA 2JEIA 1JLBA 4NLVA 3VQ7A 4K4WA 4RW8B 4H4MA 3JYTB 3HPHA 1XC9A 5DG7A 4QWAA 2W42A 1EKEA 4FLZA 4TY8A 5FRNA 4DTXA 1QAJA 1S48A 5DK5A 1U48A 4ZVHA 5CYMA 1LWFA 3T5KA 2XI3A 3KLIA 2HHWA 1RDDA 1SKRA 4Z0UA 3MXMA 4H8KA 1BQMB 1X9WA 3DDKA 3QIDA 3LPUA 5KFEA 4FZYA 1QSLA 3JYTA 1RDBA 4CK1A 3PW7A 3V6JA 3DOKB 1UAXA 3QEIA 4OKKA 1JLBB 4CJTA 4C8LA 1N56A 5KGWA 3H59A 3DRPB 4E7IA 3VQ6A 5KFXA 4MKBA 2BGGA 3H5SA 3DYAA 3OHBA 1JLFA 1ZETA 2QKKA 3VQQA 2AX1A 4JV0A 2D5RA 1S6QB 1NHVA 1CZBA 3IRXA 3P83D 1D9FA 3THVA 3IS9A 4CF1A 4OJRA 4G1QA 4B08A 4IH6A 1IKXA 3IGNA 1UWBA 2VG7B 3B6PA 3RRHA 1IKWB 3HVRA 1LW0A 3IG1B 3PVXA 1CSJA 1S1UA 5KG1A 2BQRA 3NMAA 1Z25A 4PY5A 2V9WA 5KG3A 4KAZA 4NCBA 4CE9A 5HROA 4B3OB 4AHRA 3ZT3A 2XGPA 5KT7A 1XR6A 5KFFA 3GYNA 2UVRA 3G6YA 2G8KA 3ZSWA 3TAPA 3H08A 3DI6B 4CHZA 2VG5B 2GC8A 5KFLA 4CIFA 3C6TA 4Q5VA 5KFRA 1HNIA 4RU9A 4CJSA 4M45A 2ILYA 3B6OA 4DSIA 5HRNA 2IAJB 3OYDA 4ECQA 3LP1A 3D5MA 3V9ZA 2FJWA 2YV0X 1RNHA 1VRTA 1GX5A 2AU0A 4FLUA 4DFJA 5KFOA 2XY8A 3BDPA 1KHWA 1JLGA 1TVRA 4NLSA 3NF7A 3CM5A 3IAYA 2P5GA 3TAMA 2HNYA 3LZIA 4FLXA 1VSHA 1S1VB 2HMIA 4CEAA 4NLDA 3BSNA 5KFZA 1YVUA 3BJYA 3HO1A 1ZTTA 3KJVA 2DPJA 4RW7B 3BSAA 3VA0A 3Q8RB 3HPOA 1BQNA 1D1UA 3LWLA 2RKIB 4NLWA 2O4GA 1HYSB 1WSHA 4KSEB 3SQ4A 2ASJA 2AWZA 3SI6A 4EZ9A 2GIQA 1QQCA 4F4KA 4M3UA 4BE1A 4EYIB 3I5AA 5KG6A 2CKWA 1S10A 3K5LA 4J2BA 2B6AB 4Y1DA 1I39A 1CZ9A 1T03B 4QOZB 4DL7A 4XO0A 3OYBA 4X2BA 4UQGA 3TANA 1FKOA 4FXDA 3UQSA 3OVNA 5KFSA 1IKXB 4DFPA 1KFSA 3SUQA 2FVPA 3KHGA 2GV9A 2GBZA 4GW6A 5DQIA 4NCAA 3DM2A 1NKBA 2PY5A 1S1TA 2B5JA 4BWMA 3QINA 3OYKA 1SH0A 1XI1A 1U45A 5L9XA 3GIMA 3VQDA 3VQ8A 5C5JA 4LY7A 3S3OA 1VSDA 2UVUA 1NK9A 4Z4IA 4CJQA 4RNNA 1JLQB 1N5YB 4EP4A 3LZJA 3ZSOA 1KRPA 4LSNB 4E1NA 1S0NA 1RBVA 3I8DA 4PQUB 4KKOA 4RNFA 1NJWA 1WSEA 3DOKA 2B4JA 4ZMMA 5KT6A 1WSIA 1ITGA 4CFDA 1VSIA 3D0PA 1BQMA 3SV4A 2OPQA 1MU2A 3SPZA 2FC0A 4FS1A 3L3VA 3OYNA 3BSOA 1RTHB 4MK7A 2D0AA 3NF6A 4ED6A 1U47A 4FK4A 3VQSA 4N47A 2XC9A 1ZBHA 4E7HA 2IC3A 4ZP7A 1DTQA 1C0TA 3L2WA 1EP4B 4DSFA 2V4RA 5KT5A 3OS2A 3KOAA 4I7FA 3LALA 4DFKA 4FW1A 4RW8A 3SNNA 4Y34A 2JC0A 4Y2CA 2YHBA 4QCLA 3UDLA 1NOYA 1CLQA 2OPSB 2XI2A 3H5YA 4DF8A 1JKHB 3QGGA 4WFZA 3LP2B 3L2UA 2AX0A 3V9WA 4ZP8A 1YTUA 1VSEA 2KZMA 4ECSA 2FVQA 3G10A 3S9HA 1TK8A 3OSPA 4FK0A 3LP0A 3GILA 4DU4A 4N56A 1TKDA 1NK6A 2C2EA 4ZP6A 1GOBA 3WNHA 4E7LA 3C6TB 1Q8IA 3QGIA 1TKZA 4F50A 1JXEA 5KFAA 2JEFA 2PYJA 4J9MA 1JLEA 3KD1E 3CJ3A 2RF2A 2GIRA 3KLFA 4I2PB 1B9FA 1VSLA 1HMVA 2B6AA 1YVFA 1K1SA 1BI4A 2X6NA 4BDPA 3HL8A 4E1MA 2OPPA 1DTQB 1ZBIA 1QAIA 5KG7A 3LWMA 3CYMA 1SUQA 1KVAA 4DSKA 3QO9A 3AA5X 4CJRA 3SYZA 3WNFA 3ALYA 1S4FA 1JL2A 3BSCA 2Z1IA 3RMCA 3RMDA 1X9MA 4NLUA 4XIUA 3F9KA 1BGXT 4RW7A 4BACA 1B92A 1JL1A 5L1LA 1RTDA 1N4LA 4CJVA 1SH3A 4CGIA 4O3NA 3G6XA 1KHVA 4FJIA 1S97A 1U49A 2ZE2B 4RZRA 2W9CA 1S1XA 4CHQA 2HNYB 3EPGA 5KTQA 4PUOB 5CYQB 3V9SA 3O3GA 4XPEA 5KFKA 5J2NA 4NYNA 4HCCA 4OVLA 3OLBA 3MEDB 5C24A 3DLEA 2R8GA 2J6TA 4FJGA 2R2UA 2IAJA 2UUWA 3VN5A 3QLHA 1HYVA 5J2NB 4LQ9A 1D0EA 3CDEA 2W8KA 4CHYA 2ZKUA 4CJWA 2IM0A 4NRUA 3RBEA 3N6LA 3N6MA 3HVWA 2WONA 1WNEA 3ZSXA 2E9RX 1HPZA 1IM4A 4I7FB 4ED7A 4BE0A 4F2RA 1JX4A 4HHTA 2KFNA 4J2AA 4M41A 4J9SA 1LW0B 4IFYB 4RW9A 3ZSQA 4MH8A 2YNIB 3KLEB 4Q8FA 1RBUA 3KLHA 5KT3A 5J2QA 4U6PA 4R5PA 4I9LA 2HWIA 4DL4A 4OPKA 1BCOA 4FJKA 1WAJA 3O4NA 4G3IA 1BCMA 4ELVA 4CFCA 2I5JB 2B5JB 4FJ8A 4EBEA 3O3FA 1D5AA 3AO1A 4KHRA 4KKOB 4BDYA 3SCXA 3U6FA 1EETB 2XY5A 2LSNA 4F4ZA 2YKNB 3CVKA 1QE1B 5HLFB 3KMSA 1U04A 4CF8A 4JS5A 1C0UB 1RT1A 3MR2A 2OPSA 1IKYA 1BIUA 3OSNA 3ZT1A 2YKNA 3ZSVA 4CJ3A 1RT2A 5KFQA 3NH2A 3M8RA 3C6UA 5C25B 5F8IA 3E51A 2I5JA 3PUFA 3AO3A 4O4GA 2DY4A 2ZQBA 3H98A 5D3GB 3KHHA 2QXFA 3NGYA 3AVLA 4JRQA 3FQLA 3KK2A 1JXBA 2OH2A 2D3UA 3T5JA 1KVCA 3F73A 1FKOB 5KFNA 1C1CB 3ZT0A 4MK8A 3QYYA 4RNMA 3JSMB 3OS0A 3CJ0A 2OPQB 2E6MA 5J2MB 2DFHA 3I0RA 4IG3B 4IBNA 1NJZA 4AHVA 1T7PA 2R7YA 3V1QA 3ZSRA 3PY8A 4E89A 2VA3A 4AILC 4TLRA 4Q8EA 1ZYQA 3M9NB 4ED8A 3IG1A 3DLRA 1IKYB 1KLMB 4MFBA 3MEEA 4CESA 1C1BB 2ITGA 5KI6A 4CGDA 1JLGB 1TVRB 4CHNA 3RMBA 1IG9A 1NK5A 3NBPB 4KTWA 3S3MA 1UA1A 3ISNC 5DQHA 2YNGB 2ILZA 3GV5B 3ASMA 2D41A 2G8VA 2D7SA 1XR5A 3G0ZA 1WN7A 1ZBLA 4BDZA 1SV5B 4NLPA 2XY6A 3MR5A 4LSNA 1W25A 4FJ7A 4NLRA 3T3FA 5FROA 4F3OA 2XY7A 3AA3A 4CGHA 4KHYA 2XCAA 1TL1A 2ZE2A 2W9AA 1RDAA 3OYIA 4ZP9A 1FXXA 2YNHA 2R8KA 4BWJA 1S0OA 3EZ5A 4C8NA 5SZTA 1BIZA 4YR2A 4RG8A 1RBTA 1RTIB 1L3SA 2HNZA 4XPCA 4DTSA 2HHTA 5KGXA 2VG7A 3MR3A 3LAMA 3EPIA 2VA2A 3K5NA 1U4BA 5CYMB 3BREA 1DTTB 4Z4FA 1S1WB 5HBMB 2BQ3A 2G8WA 2RDJA 1FK9B 2Z1JA 4LSLB 4RW9B 3PX4A 4C8OA 1XWLA 2HHQA 4CEBA 5C24B 1TK5A 5C25A 4DQQA 3LDSA 1HMVB 5JXSA 3OYHA 2Z1HA 3G86A 2HHXA 3CDWA 2BR0A 3RAQA 4FM1A 4Z4EA 3KMQA 2IBKA 3MECB 5FRMA 2IDOA 4J9LA 4YR0A 4KV8B 1S6PA 2JC1A 4G1QB 2R8IA 4OGCA 2ATLA 4OLBA 3DLKA 3NKYA 3HP9A 3HHKA 4QW8A 4KO0B 1U09A 2JEJA 3TI0A 4ELTA 3MAQA 4CHOA 2UUTA 3AVNA 1L3VA 3KNAA 4OKEA 1J5OA 3CFRA 2KW4A 3I0SB 5J1EA 3CIZA 3DYAB 4LH4A 3M9OB 4KB7A 4QW9A 2IA6A 2G8FA 2ATQA 4MFBB 2YNFB 1KLMA 1MU2B 1NJXA 4TY9A 4HTUA 5KFUA 3KTQA 2OPPB 4KRFA 4M42A 3TAGA 3AVCA 3L8BA 1L3TA 4FK2A 4MKAA 4TQRA 5HROB 4B3OA 4EBDA 1VRUB 5SWMA 3RTVA 5I3UA 4FLVA 1TKTB 1RDRA 5EWGA 1C1CA 4IQXA 3P1GA 4AH9A 3A2FA 4DTUA 1UWBB 5EU7A 4LH5A 1DTTA 1B9DA 3K5MA 2C2DA 3DOLA 1XHZA 3DLGB 4O3SA 3OYJA 4JRPA 2P5OA 1BHLA 1REVA 2FVRA 4HUGA 3D45A 4WXOA 4EO6A 4C8KA 3DLHA 5KFYA 4F2SA 5D3GA 3O3HA 1JLAB 3FRZA 1HRHA 3AVMA 4H4MB 4DL3A 4IDKB 4CEZA 2RF2B 2PYLA 3M8SA 1N5YA 3PW4A 1TAUA 4RUAA 2GUIA 2FVSA 3ZSYA 4U7CA 4IFYA 1ASWA 4QWEA 4DL6A 1VSMA 2EX3A 3G6VA 2VWKA 4Y3CA 1WAFA 2G8HA 3SI8A 3VQ4A 5HRRA 3NH0A 4WYLA 1J53A 2C22A 1REVB 3MEGA 1TP7A 2F96A 4K4ZA 2F8TA 5DG9A 3Q8SB 3KLHB 4CIGA 2YKMA 2F8SA 4DG1A 3TABA 3BQ2A 2HNZB 1GX6A 3HKWA 3MF5A 2HB5A 4IDKA 3ITHA 1QTMA 1RAJA 4E3SA 3M8QA 4OPJA 4PUOA 3FQKA 4DTMA 5DGBA 4DWIA 2PZSA 3QETA 3GQCA 3HK2A 1BISA 3DMJA 3NL0A 4AHSA 3QESA 5J2PB 1JLQA 4CERA 4ICLA 4YMEA 1RYRA 3CDUA 4Y2AA 4FJHA 4N76A 3FDSA 3TQ1A 4KI6A 1ASUA 1N6QA 4NYZA 3FFIB 5C42A 1DLOB 5DLGA 4B8AB 3QLHB 4E7KA 1C0MA 4IKAA 4DTJA 4WE1A 3PO4A 1TAQA 1S1TB 2J6SA 3M8PB 1HNIB 4ZTJA 5HRSA 1T05B 1SL1A 3NGZA 2AGQA 5KRTA 2W9CB 2D3ZA 1TKXB 4ZPAA 1A5XA 4JV2A 4IRCA 4RW6B 3HT3A 4ZPBA 4FLWA 3QERA 4OGEA 3QNNA 1HYZA 4CEDA 3BGRA 3I0SA 3V6DB 4RNOA 1L5UA 1BI4B 2Q3SA 3RB3A 3SQ2A 1KSPA 2J6UA 4IR1A 1S0MA 3OY9A 3DRRB 2D0BA 1IKWA 1S1WA 1RT4B 4DFMA 2X74A 4W5QA 1TQLA 3CFOA 4ECXA 1RT7A 4ECTA 2WK4A 4KV8A 5KG4A 1QHTA 4CF0A 3ICLA 3KLGB 3VQ9A 4CFBA 4C8MA 2YNIA 2KTQA 1RT5A 4FLYA 2HHSA 4FYDA 4M3ZA 3MFIA 1RILA 4CJUA 3K5OA 4L8RB 3CO9A 2DPIA 3VQEA 2V0NA 1Y97A 1NJYA 3DLBA 3QZ8A 3KLFB 4M3TA 4W5RA 4PQUA 3NFAA 5FDLA 4KTZA 4DG1B 3AVFA 4KHUA 1S1VA 4GMJB 1HQEA 4MIAA 2JLEA 1JKHA 1TKZB 3DRPA 1OS5A 3RR8A 3KLVA 3WNEA 5I42A 3T5HA 4M3WA 4CJ4A 4CEEA 4TN2A 3PW2A 4Z4HA 3DRRA 4W5OA 4B9MA 3DLEB 3KHRA 4URQU 1D9DA 4DTRA 4I2QB 4Q0BA 1IH7A 4K4UA 1N6QB 3AVIA 4YNQA 4FVMA 2VG6A 1JLFB 3DOLB 3V81A 1S9FA 3NDKA 4Q44A 2VG5A 4KHMA 2E9TA 3QIPA 1RYSA 3OL8A 3OYAA 1T05A 5KFIA 4CHPA 3H4BA 4QPXA 4GVMA 3EYZA 3SQ1A 5KFDA 4B8CA 4O0IA 2R8JA 3KK1B 1C0TB 4WYWA 1ZTWA 1KTQA 1EP4A 4Z4GA 1S1UB 4PA1A 1VSFA 3NBPA 1NK0A 3OLAA 1S9EB 4IH5A 1WNSA 2IGIA 2VG6B 4DU3A 3AO4A 3TVKA 5EWEA 2R2RA 4R0EA 2HVIA 4DSLA 2IS3A 2Y1JA 3QEXA 5DQGA 4I2QA 1S9EA 2XWYA 3HXMA 2HNDA 4IKFA 2FLNA 1EX4A 3ITHB 3OL6A 1IO2A 4I2PA 1HNVA 3VA3A 3JSMA 1NK8A 5DGAA 4PWDA 3MECA 4DTPA 5HLFA 4M3YA 3V1RA 2AQ4A 5EUHA 1D8YA 1RT3B 1A5VA 1TL3A 3GIJA 2D0CA 3H40A 1T8EA 3KKSA 3MTKA 3QEWA 3H5XA 3QGHA 2BANA 4ELUA 4J9OA 4FLTA 4RUCA 3L2VA 4FJ5A 3I5CA 4O4GB 1VSKA 1S6QA 3CG7A 2B43A 1FKPB 3O4QA 1QSSA 1YT3A 3WNGA 3TR8A 5K14A 4K8XA 2ETJA 3MFHA 3RRGA 2FVCA 4R5PB 3CFPA 3SPYA 3SJJA 4KFBB 2ALZA 4H4OB 3KLEA 2WRMA 2YHAA 4CK3A 4KPYA 1QSYA 4EO8A 4F8RA 1ZBFA 5HP1A 2HNDB 5DLFA 3PW5A 5KFPA 3CQ8A 3AVJA 3RBDA 3U3GA 5K14B 3HP6A 1RTHA 2ASDA 1TV6A 1Q9XA 2OA8A 4Q43A 1QUVA 3NCIA 3V9XA 2RPIA 1BQNB 1SH2A 3IS9B 5L1IA 4ED1A 3CM6A 3KJVB 2UVVA 2IM3A 2RDIA 4KTQA 3MEDA 1S49A 3FFIA 5C42B 3AA4A 2YNHB 4DEZA 4KO0A 2BANB 2HMIB 2HAIA 3DLKB 4DQPA 4J9NA 4DL2A 3SUOA 2BE2B 2W9BB 4DQIA 4KB0A 1S1XB 4FJNA 4NLXA 3E01A 2QKBA 1UOCA 2AGOA 4YFUA 4RNHA 4NRTA 3V4IB 5KT2A 2XCPA 3ZT2A 3C94A 4OLAA 2ZD1B 4E19A 2DTUA 2HHVA 4IRDA 4FBUA 3AVAA 3PJXA 3BQ1A 1NK4A 3ZCMA 5DMRA 4NLYA 4NLGA 1DLOA 2IC3B 3TARA 4EZ6A 1R0AB 3Q8QB 3MEEB 1KCFA 3NF8A 3LPTA
chains in the Genus database with same CATH superfamily
2OEJA 4YHHF 1JLCB 2AJQA 5FDLB 2PEBA 3Q0AA 3FZFA 4RTFD 1RTJB 4YP3A 3FZKA 4FF3A 4OI3A 1IR2A 2IDEA 1RISA 1HX1A 2ZM6J 1WTFA 3RVCA 1Q8LA 3HVTB 4CYUB 4A5AA 5AT1B 2V4QA 4OZ5A 2O8CB 2FQQB 1JLEB 1X9SA 5HK4A 3V81B 3P39A 4X4QA 1GFWB 2OFHX 3CHWA 2M52A 3VZIA 2XG8A 3H6EA 2KKHA 1YK9A 3UR0A 5AZIA 1NDPA 3NS5A 4ECZA 1DARA 2BRLA 3WXKA 3FSIA 2A0FB 2L9WA 4DV6J 4UUXA 3OJSA 2BJ8A 2JJ4D 3OR1B 1R8PA 4DTNA 2UXDK 4JV1A 3GV8B 1S6OA 1NSKL 1CJUA 3PRVA 2HRYA 2C2RA 3AVGA 4JI3J 2WTFA 3V1OA 2OSRA 1IKVA 2XEXA 4LF6F 4W5NA 3ENVA 4A8OA 4GKJK 3QJLA 3I8BA 3OA9A 3G87A 4GMKA 1GXUA 4ID5B 2E88A 3RMAA 1GAOA 3FUYA 5F8NA 1Q9YA 3R8YA 2W8LA 1NBWA 3DLGA 3SQGB 2VFTA 4DCPB 3ZT4A 2R8HA 2ZBIA 2ROEA 3DI6A 2AP1A 4F4AA 4IJNA 2V50A 3LDNA 1MSWD 3AO5A 5KFHA 1YUWA 3M8QB 3GMGA 1CPZA 3C15B 3MM9B 3CXCM 1VC0A 4HVJA 1S7IA 1WKLA 4XH5A 2PMWA 1HBMB 2NRTA 2OYQA 4EEYA 5F1XA 5JS2A 2E1YA 2UXBF 3BF1A 1VSJA 4RWTA 4BREA 3BR9A 5J1EB 1RAEB 5THWA 1J5OB 2ABYA 2HKEA 3CCJN 2ZBQA 4PQAA 3PR4A 5KQDA 3U8XA 2IJNA 4E2FB 3MM6B 4DR2F 2XMAA 3TA1A 1LXJA 5KG2A 1HQUB 3R97A 4K8ZA 1H72C 4JK8A 3G82A 5F8LA 5EDWA 3IN5A 4DSJA 5GINA 3ZNJ1 4XAKA 2LEBA 1ZS6A 5KFTA 4J9RA 4UT4A 3QZ7A 4URGA 1HNXJ 4J9KA 4QYZJ 2HFSA 3ONQA 4KHNA 3CD0A 2IM2A 3DRXA 3HKZD 1RT5B 3BGUA 5KQ8A 2F8EX 3SZ2A 5E7OB 1FRJA 1A6LA 3LQVA 3OHAA 3ZZOA 2RKIA 1C0GA 4B3RK 5LJ3Y 4FO0A 4DPWA 1YXQA 1RT4A 2VICA 2V68A 2U1AA 5CA5A 4CJEA 1AZSB 2COLA 1VK0A 5BR8K 4X64K 2P1JA 2XMTA 3EWGA 1RFQA 3EE3A 2QLJB 3MD1A 3R5JB 5B0AA 4GV9A 5CZ1A 1RAGB 4EHUA 1U1PA 1HYSA 4JLHA 1EJ7L 1TUYA 4DSEA 3OFGA 2GVZA 4P71A 4QOTA 1SL2A 4IOAL 4CEOA 2W7OA 3GWCA 3RRKA 1C2PA 3GIIA 4OHXA 2IJFA 4YOEA 5ETTA 4O8KA 4OYZA 4OI6A 3AVBA 2GQCA 1HKGA 3IBCB 1WKJA 3VEYA 5E84A 1NMNA 2IHR1 3UN5A 3OYCA 4USTA 3KK2B 2L08A 4C0HA 2VGMA 2OZSA 4M5HA 3T6BA 1HD1A 3O9UA 3CJ5A 2MGZB 2FUG9 2A3JA 1QS4A 3CCQN 2IMOA 2IBOA 3G25A 4DV4K 4FJMA 5M2PA 1YJUA 5GADU 3KUGA 2GEMA 4WK1A 4FM0A 3I5BA 4JI1J 2DB1A 2YKMB 1IKVB 4CJ5A 4JI0F 4U7UK 4QR0A 4JK7A 1RABB 4WJBA 4DV5F 4FF2A 1TR0A 4ZVQB 3KKRA 1YITN 3DRSA 1X9JA 4X62F 3CI5A 4K4TA 4CH0S 1N52B 1RUSA 4CEFA 1J2VA 3NGRA 2P9NA 2E9ZA 4O3QA 2JFKA 2PFDA 3MR6A 2CJQA 2N7CA 5KFGA 3OS1A 2N82B 4ISFA 2ZZTA 2V6AA 3S3NA 4DCOB 5H9EJ 2IVPA 3NGIA 5KG0A 4BHQA 3Q23A 5I3QA 1S77D 2E4LA 1WHXA 4MK9A 1KLNA 4CZKA 3ISND 2P9CA 1X4FA 4ATNA 1QZ5A 5B09A 3KG0A 3L09A 1VQMS 4V19J 4O44B 3IXQA 2LCWA 4J90A 3MM5B 5F8MA 2DFEA 3AD7C 4CTAB 4H54A 3VQBA 1S72S 1ZC6A 3CTRA 2DKOB 1T03A 5T7BA 2K7JA 3IBWA 2JNJA 4CLKA 4FJXA 4KRWA 4TXSA 4DR2K 2KI2A 3TRGA 4IG3A 2VGNA 3FSYA 3C8YA 4YQWA 3KK7A 3L0QA 4J9QA 1N48A 3GTYX 3THYA 4C23A 1MWQA 4O55A 3OYGA 1F0XA 2YQ3A 1RB0A 3V6KA 5KRSA 2VQEJ 1O6XA 5ETKA 2N4CA 1KFDA 3PRBA 1FRLA 1EWQA 1YHQN 4CH7A 4JOUA 4DUZK 2O4IA 5LSRA 2UVWA 4MIBA 1J54A 3ZTPA 1VRQC 4S0MA 4FM2A 3LM2A 3IR6B 5F8HA 3PHTA 4M94A 1CC7A 3SCKE 2O5DA 2RUSA 4ZLNA 1S6PB 1UEUA 5A8RB 5KFVA 3H45C 4LFBF 4N5SA 3ILJA 5RUBA 5MLCQ 4JI8F 1FTRA 4MMOA 4OYBA 5ETMA 4O0NA 3CUNA 4C3MA 4U8YA 3NNHA 1V4TA 2EFPA 4CEQA 5KFCA 3CB4A 2V51B 5AQKA 1EXQA 5C2CA 2UUAK 1F3FA 3AOBA 1LV5A 3CERA 2JDJA 2CQ3A 3QAEA 4OFZA 2MB0B 2YX6A 1GK8A 2NZ4A 2D69A 2R7VA 3BH6B 3LP0B 5HO4A 4B3MJ 4H0TB 3VQ5A 3Q83A 4J2EA 3CC4N 4OLPA 1TZ0A 4Y65A 1IXKA 3BV8A 1HBNA 3DXMB 1DZ5A 3PEHA 4USVA 2HHPA 1JJHA 3GIKA 3K58A 1V5VA 2KRRA 2Z2LA 1TGOA 1YJNN 4LF9J 1XHXA 5ETNA 1WDDA 4DS5A 4KHQA 2IRXA 2XZDB 1DQ8A 4KGKA 1RHMB 2W01A 2ZH1A 3WQUA 3R1HA 3ZSZA 4GNIA 3LP2A 3SFGA 4LQ3A 4IFVA 3CO0P 3M2VB 5M1FA 3I82A 2W9BA 1UAWA 1JLBA 3OVSA 2DNGA 4H4MA 3QATA 3R5GA 2L3MA 4DCJB 1FESA 5DG7A 4QWAA 2XULA 5AZJA 1EKEA 3CCTA 4FXWA 3MM7A 3VF4A 1KN6A 4TY8A 4DTXA 2XWXA 5A2QY 5DK5A 1IJJA 2GVDA 5JJBA 1U6FA 1LWFA 3A0IX 2XI3A 1KQFB 1RGVA 1GLAG 3KLIA 1SKRA 4Z0UA 1N32K 3ETMA 1UVIA 4H8KA 4DR4F 1WSRA 3W2WB 5KFEA 4B3SJ 2P9LB 1QSLA 3EX7B 4I68A 4OKKA 2BZ2A 5HAOA 5J1NA 4C8LA 3DRPB 1HW9A 4E7IA 4DPYA 5F41A 3P4UB 3N9UC 4DJBA 1A7GE 3E66A 3IUCA 1JLFA 3BKUA 3TEHB 2A42A 2IVOA 3O8WA 3FFKB 1VHXA 1HWJA 2QKKA 2XYPB 1VQ7N 3J7YP 1S6QB 4USHA 3IRXA 2XNQA 1OQ3A 1F60B 1D9FA 1RWUA 4ED5A 4OJRA 3K8VA 3MWPA 4RBTA 2BX6A 1I5OB 3E9OA 5C0YA 3RRHA 4YORA 3CCLN 2GX8A 1CSJA 2BQRA 4ZLJA 4GVBA 4LFCF 1Z25A 2V9WA 5KG3A 4CJ7A 3TOQA 2CZ4A 4AHRA 3AB4B 3W5XA 2DO4A 1IBMJ 1XR6A 5KFFA 2BEFA 3G6YA 2G8KA 2H5JB 1WI8A 1AYEA 1BC6A 4JKGA 3BO4A 1UETA 3C6TA 4LFCJ 2BJ1A 2ILYA 4DSIA 3MUMP 2IAJB 3GLJA 2BJ7A 1V4SA 3CDAA 4DV5J 2FJWA 3CEDA 4KY3A 2YV0X 1SZ2A 1C0FA 8AT1B 4DFJA 3NEKA 2XY8A 3BDPA 1KHWA 2VBXA 2NXNA 2OELA 3DXKA 3CM5A 3DAWA 3IAYA 2P5GA 3TAMA 4C48A 4A5BA 4A2BA 2HMIA 5AQIA 3ZFVA 2ZWPA 3QFHA 5KFZA 4UY8T 3MURP 1YVUA 1VQ6S 1EO1A 3FVYA 4AL7A 3FR0A 4ZCMA 3AT1B 2FB0A 3J81j 1Y00A 4RW7B 4ANCA 1FXDA 2CZVC 1Q82O 2VBWA 1BQNA 3QJPA 2AWZA 2GIQA 1QQCA 2JH3A 4M3UA 3I5AA 2CKWA 4DR6F 3P4IA 1NGHA 2DGUA 5DM7L 4OYXA 2ACYA 4ILRA 1YHQS 5CABA 4J9UE 4AT1B 3NLCA 4RKUC 3UQSA 2Q66A 4FXDA 2EWSA 3OVNA 2LA4A 5KFSA 2JHEA 1KFSA 4JAXA 3LDOA 4JI5J 2FVPA 1VC5A 3T7ZA 2GBZA 1VQ5N 4GW6A 5DQIA 2GX9A 4O8UA 1S1TA 3TO8A 1HKBA 3ZX2A 4BWMA 2BKNA 3HJVA 3ZNUA 3CJ8A 2HVZA 1PSDA 2FXUA 4Z94A 2AJ0A 5HANA 1B3TA 4Z4IA 4KH6A 4RNNA 3IM8A 4OV1A 1NZ8A 1X3NA 3DOMA 3P31A 1W26A 1WHVA 1YQHA 2GO8A 4KKOA 1WTBA 2NXJA 2CQBA 1WSEA 1K8AO 1WSIA 3C15A 2NRWA 4OJGA 4Q2MA 1BQMA 2DK2A 4MKYA 2VODA 1MU2A 2FC0A 4FS1A 1YJVA 3L3VA 4USKA 4MK7A 2D0AA 4KPCA 4LR9A 1Y5LB 3VQSA 4PYDA 3J7AN 3KJFB 2XC9A 1XQSC 1GMWA 4B9QA 4ZP7A 2V34A 3THXA 3LL3A 1EP4B 4BC5A 3EICA 4YB6A 4JHDB 4I7FA 3LALA 2AIRB 5JVGQ 1HJOA 4Y34A 5AXNA 2JC0A 2YWFA 2XI2A 2XZWA 1KC8T 3D3BJ 4FPIA 3LP2B 2JVRA 3SDEA 5L46A 1VSEA 3OUYA 2XYGB 4MO4A 3S9HA 1YKWA 1TK8A 1RWMB 5DJBA 3OSPA 5DS7A 5GMEA 3N79A 1NK6A 2ERRA 2LDIA 3R6GB 4DR3K 1GOBA 3WNHA 1VCTA 4E7LA 3C6TB 1N34K 1WC1A 1Z2ZA 2DR5A 2JWLA 1JLEA 3FZMA 3CJ3A 3H3OB 3FZHA 4QS9A 5ADXH 2B6AA 1KAYA 2W2NP 2DNYA 2P9LA 4LC9B 3WDOA 1VR6A 4ZN3A 2MZRA 4E1MA 4P2MA 1ZPVA 4I69A 2VIHA 1DTQB 2YCHA 1HL6A 2K3IA 1QAIA 1M5OC 4P10A 1PJ5A 2P6TA 4KHPJ 1O0PA 2U2FA 1LOUA 5HJXA 3FJ2A 3ALYA 1D8ZA 2VQEF 5IM0B 2QYGA 4H0YB 1KQSM 3RMDA 2QLWA 1XC3A 5E33A 2XS5A 4RW7A 1FF2A 1PAUB 1N4LA 4CJVA 2JZ5A 3QRQA 4JKCA 1M5SA 1ACMB 1HI1A 1WACA 5LSLA 4FL9A 4CGIA 1W2BM 2ZBRA 3G6XA 4FJIA 1M5HA 2MJUA 2XMMA 4ID8A 3M30B 1S1XA 3NG8A 2HRUA 5IT4A 1E4FT 1S5ZA 3POTA 4FN5A 5AJ3J 2CWKA 4OVLA 3OLBA 5C24A 2YKQA 3DLEA 3THXB 1MWYA 2QLXA 1D0EA 1UJ6A 2SXLA 2R7XA 5AQQA 4YEAA 3HHLD 2VU5A 2ZKUA 2HZAA 4NRUA 4ZCIA 3RBEA 1FFSB 4LF4F 1W7WA 4CQ1A 2RS2A 2A18A 3U9DA 3J7ZO 3CPWM 4UQTA 3KJQB 5E2QA 4F2RA 3EE8A 1X4GA 4M41A 3AHPA 1HWIA 3ZSQA 2MHEA 4Q8FA 2EK1A 2CNNB 4F0MA 4ILGB 1AFIA 2RIJA 1BCOA 1YZ7A 1K0TA 4FJKA 4HDHA 1TTHB 2M70A 2PMHA 3DFEA 2VYPA 4FJ8A 4DV2F 3K7RA 4NZ7A 1D5AA 3AO1A 2QA2A 4OYMA 5FPMA 1HR0F 4CI6A 1NU0A 3SDEB 2YH1A 3CJTA 2NS1B 3U6FA 2ZM6F 4F4ZA 3CVKA 4DV0K 1X4AA 2HGLA 1E6YB 5C2FA 1U04A 1M0SA 1RAFB 4LF1A 1YWXA 2O67A 3ZT1A 3SAGA 3OBWA 3ZSVA 4G9ZA 4CJ3A 3T1HF 3FC9A 4U9RA 3C6UA 4ZJOA 1ZM4A 4LFAF 4B1XB 3M6VA 3AO3A 2Z57B 4RBVA 1OH5A 3H98A 1GXTA 2GTDA 1TL7A 3NWRA 4A8QA 1KP6A 4Y2MA 1SQFA 3NGYA 4JRQA 2Z30B 2P9UB 3KK2A 2OH2A 4UOHA 3G8TA 3T5JA 1KVCA 1NEEA 5FJ4A 1EARA 1T95A 2HYIB 4F9OA 2H3EB 3ZZTA 4X4NA 1VISA 3PY8A 1BU6O 2VA3A 4ED4A 5C2DA 3DLRA 1U8SA 3U1LA 1HHTP 4LRFA 4QU7A 2GUPA 4FWLA 1KLMB 4MFBA 3O9QA 3MEEA 2LEAA 4FKXA 4CGDA 1JLGB 1TVRB 4CTAA 2RDDA 1F2HA 1JJ2M 2RVJA 3RMBA 2ILZA 3BS9A 3ASMA 1H2TZ 3IO1A 2QWOA 1WN7A 1DGKN 4BDZA 4NLPA 1X8DA 2XY6A 4BR7A 3POTB 3TA0A 4ZITA 1W25A 3D66A 3GL1A 5F0XA 2X1AA 1RDUA 4B1UB 2NLXA 2XCAA 1TL1A 2ZE2A 2W9AA 3VMFB 1IM6A 3OYIA 2FHJA 1NSPA 3FGUA 4BWJA 2CDQA 3W63A 2GAGC 1S0OA 4U67L 4OYWA 4ZA1A 3U02A 4FWSA 1NPRA 3HSZA 5LMNJ 3C16B 1RBTA 1N33K 4XPCA 4DR7K 2N3LA 4LF4J 2LQJA 2VG7A 2EI5A 2MQNA 3MR3A 2UUAJ 3PYDA 3EPIA 2VA2A 1GLJO 3KXDA 3I56N 3ULHA 1U1KA 1GMVA 1Y4ZB 2M8HA 2O66A 1S1WB 3SSSA 2BQ3A 1CJVA 2RDJA 1FK9B 3EO3A 1SXLA 3D0IE 4LBHA 4U8VA 5HI7A 4YY3F 2C2OB 5C24B 1TK5A 3S7RA 3ILLA 3AD8C 3VTIA 4GKJF 5A8KB 2HHXA 3CDWA 3QSYB 2BR0A 5E3PA 1CEZA 5BXIA 3MECB 2IDOA 3K17A 3V2UC 3CCES 4KV8B 5HL7Q 2R8IA 2ATLA 4OGCA 4OLBA 4LF9K 1VQLS 4FYXB 3THPA 1U09A 2VC1A 4ELTA 3MX5A 4CHOA 1DJ0A 1WEYA 1M1KT 1VLYA 2RNEA 1F6TA 3KNAA 2VL1A 3MMCA 3CMQA 4JI3F 4OKEA 4IDHA 4XDCA 3CFRA 4X65F 1NRKA 2HIYA 3BN4A 3NXZA 4LH4A 2GGPA 4KB7A 1WORA 2IA6A 2G8FA 4OZJA 4MFBB 3DGPB 4HTUA 2DHAA 3KTQA 1L3TA 3L8BA 4IXCA 4MKAA 3B4DA 4TQRA 4B3OA 3VTHA 3MOJB 3PJ9A 1GNKA 3MAHA 5I3UA 2HF4A 4IQXA 2Q43A 4LVOP 1VQOS 2LXUA 1B9DA 1XBWA 4CIOA 5CR4A 4KBOA 3DLGB 4JRPA 2FVRA 3D45A 4ZPTR 3P5BP 2V8DA 4HVZA 1U6BA 5IWAF 4LF7K 1JLAB 4H4MB 2HBQB 3D3CJ 3W5ZA 5BRHA 2R7RA 5LOQA 2VBYA 5LJ5Y 4JI0J 4YB1P 5B0CA 2WB1D 4LJMA 3M8SA 1E6YA 4HI1A 3ZSYA 4B3TK 3H90A 1VQNN 4U7CA 4FWPA 4U7BA 4C97A 1ASWA 3LGMA 4F7VA 2A41A 3I6PA 2QO3A 4ZCLA 3TX8A 3OR1A 1OQ6A 3V4MA 3SQOP 2ZBPA 2QA4S 1VSMA 1TU0B 2VWKA 2CRLA 3ET6A 2DGVA 2X3GA 4YOUA 2UXDF 3NH0A 1J53A 3UD5A 1VDHA 1WB9A 3A8YA 2VHGA 2KJVA 5DG9A 1RWKB 3KLHB 2RH3A 4DR6J 2BOAA 2CQ0A 2HAFA 3RUBL 4OYAA 1BA1A 3HKWA 1K47A 2H5IB 4IDKA 4I6WA 1HUXA 3K8WA 1RAJA 4E3SA 4AQYK 1X60A 1UFWA 3S6EA 3D68A 4OPJA 3A3OB 2VJUA 3FQKA 5DGBA 2AV5A 1SS6A 4WCEQ 3NL0A 4XK8C 3DXKB 4ICLA 4YMEA 1QJHA 1RYRA 1I1GA 3GFXA 3ZZZA 4CO3A 3CDUA 4FJHA 4N76A 4KI6A 5C42A 1DLOB 2X1GA 1PO6A 3VENA 1C0MA 4IKAA 3R6LB 2HG4A 4WE1A 2NRXA 5K20B 2J6SA 2OGUA 4LF8K 5HRSA 5AQMA 4FOEA 4RO0A 1SL1A 3GCWP 2C2NA 4ZPAA 4EUVA 1A5XA 4IRCA 3JSYA 4RW6B 3HT3A 2AJFE 1T02A 3H25A 4ZPBA 4FLWA 3WUHA 2BKOA 2V7ZA 3BGRA 4RNOA 4I0WA 4M7XA 3RB3A 4BQZA 4QYZK 3SQ2A 4DQ8A 2AJ1A 2EG2A 3UKUA 4IR1A 1S0MA 1P9QC 3CJCA 3P8BB 4PHTX 1RT4B 5H9FK 1RADB 4ECXA 1RT7A 1IBMF 4KV8A 2V8GA 4DOZA 4B3RJ 5M2UA 2WFBA 1H73A 4ZN1A 1X5SA 3VQ9A 2YNIA 2FGOA 2HHSA 1JB0C 3CJBA 4FYDA 4CJUA 1ZA1B 1YJ7A 4M3TA 3NFAA 5FDLA 3NMRA 4KTZA 2P9KB 3AVFA 1HQEA 1NDLA 1ZZNA 2JLEA 2PFUA 2FJBB 2JVOA 1FWLA 3JTPA 3D1OA 4WFBQ 5I42A 2PT0A 4A8MP 3GFHA 1Q18A 2CAJA 3R3TA 4PWUA 1K8KA 2HS0A 2EFQA 1PCAA 2C1EB 1D9AA 4F67A 1RKJA 3PYGA 1RU2A 4BR2A 4I2QB 1IH7A 4BLGA 5GIPA 4WKRA 4ISEA 4CRJA 3D6FB 2RRAA 1RLCL 3NDKA 2E5HA 2XNRA 5DO2A 5IWAK 3FSXA 2E9TA 4H5VA 2H65B 4CHPA 2KXFA 4GVMA 3AAQA 3OFFA 4B8CA 4ZVSB 4O0IA 4DV4J 1BXNA 2R7OA 2HBLA 1ZTWA 3OBIA 2HBRB 2K2PA 3GPAA 5GAGU 4Z4GA 4PCQA 4JI1K 1VSFA 2WC9A 3CCRN 2F7VA 3BF3A 1LFWA 2IGIA 3AO4A 5LMUF 4R0EA 1U1NA 3VAHA 1QAYA 1S9EA 2ZZNA 2XWYA 1D09B 4BRCA 2WSCC 3M7VA 5A8WB 1UJ5A 5D8HB 1X4HA 3P3DA 3ITHB 3MPYA 4I2PA 3M2UB 1NK8A 4PWDA 3MECA 2MKYA 1NLKL 4DTPA 2IVYA 3IR7B 4WP8A 1HW8A 1D8YA 1X4DA 1RT3B 2P9EA 4YOWA 3QEWA 3RW6A 4CZCA 1CJTB 5CHCB 4FLTA 4C11A 3T1YF 1OSDA 2YWKA 3ET6B 4WBFA 2B43A 4MT1A 1FKPB 1DQ9A 1QSSA 4Y28C 2ETJA 3NWGA 4R5PB 2KL8A 5JICA 2L9NA 1ATNA 3MMBB 3QFPA 3PYFA 1K9MT 2A5XA 4EO8A 4USUA 3HFVA 3TVYA 3FEZA 1FX4A 2YPYA 4U96A 4WK3A 1Y7PA 2JRSA 2WVCA 2EFOA 5HVHA 4KH0B 1VC6A 2BA9A 2BJDA 2VQEK 5KFPA 3ZYYX 3AVJA 5GAHP 3U3GA 3G71N 2ASDA 1Q9XA 1QUVA 1K73O 4DUZJ 3D6RA 3PTWA 3IS9B 5EXWA 4ED1A 1IBKF 3VAKA 3KJVB 2IM3A 1RCXB 1S49A 5C42B 2YNHB 4KO0A 2BANB 1DFDA 3DLKB 4J9NA 1WUAA 5LT5A 2BW2A 2BE2B 4NLXA 4NWBA 3J81Y 5AQHA 2EFVA 3H3NO 4RNHA 3V4IB 2KHCA 3ZT2A 4AL6A 2W6LA 5KOWA 3I9ZA 2UXCF 2B8PA 2IVFB 2ZD1B 3WBZA 1VQYA 4CLWA 4IRDA 3PJXA 4ILHA 3ZCMA 5DMRA 2GA7A 3TARA 4UF4A 4UOGA 4USJC 3CJKB 1APSA 3Q8QB 2KB2A 1B70B 3TJ8A 5D0HA 1KCFA 3CF5Q 3NF8A 4LF5K 3MX2A 3MEGB 3WQTA 1ZAVA 1OVYA 1U7LA 2FC9A 2R9LA 2K3KA 4B3MK 5JUMA 4DLGA 4ERDA 3MXIA 2OJ3A 3M9MB 3RR7A 2R7WA 5J2MA 5AQTA 3LH2S 2CNOB 4ZKAA 1FDAA 3MAAA 1LWEB 1YJ9S 3OYLA 5E0OA 4JYAF 3ILOA 3KD5E 3HULA 2YVSA 1ATSA 2XSJB 3D6MB 2ZVSA 5L38A 3BYRA 2DNKA 2HVEA 2CPDA 4FNHA 2QK9A 2YNGA 1GOAA 2G8UA 1FD2A 3OUYB 3C3LA 2HFZA 2M5YA 1G7CB 3T1HK 1WG5A 4TY8B 4Q45A 4KHPF 1HNZJ 4KHSA 4DTOA 5A8WA 3K2PA 2QYCA 1WC0A 4FPRA 2F3JA 2PBDA 4MQ3A 3P45B 4IFVB 4AFFA 1NM2A 3JS9A 5JVGL 4KI4A 3NCRA 2J9DE 5EWFA 2LQ5A 2WB4A 3D28A 3HF5A 3I4HX 5ETSA 4Y1CA 4BRIA 1TFWA 2NUHA 5AZJB 3WEEB 3OL9A 1FJGJ 3OYFA 2HW3A 1I3AA 1CXUA 4DQSA 4GKKF 3VESA 1JLCA 5DM6Q 2FBYA 4NLOA 4NCGA 4ER8A 2J9CA 1U2VA 4USWA 4LD0A 2AGPA 3TAFA 4JEPA 1CJUB 4K59A 4ZHRA 4NI2A 1D4XA 1JNZB 4OHVA 1TL7B 2E5GA 4ID5A 2FHMA 2LXIA 1YTYA 2RN2A 3U4LA 3QNOA 1GT8A 4J9VA 3ZETB 5CCLA 3KK1A 4M5KA 4ZPDA 4K4YA 4C11B 2ASPA 1UVNA 2DEIA 1P9YA 1S9GB 3A3NB 4YDUC 3QEPA 4C3KA 2JOQA 3FBFA 1WF1A 2ASLA 2RD5C 4DHVA 1N5QA 1R3NA 3Q2SC 4FJ9A 5AQFA 3ZZUA 4GV6A 1T9VA 5HQLA 2G8IA 3C16A 1MWZA 1FVSA 3R1LA 3AY0A 2HBJA 4FZZA 3V6HA 5AQJA 1ZAXA 4BR0A 3Q2TC 3NAIA 5F2RA 1RBRA 4DR7J 1RHRB 3GONA 3PV8A 1Q5YA 2B51A 3CF5L 1HIYA 3SJHA 1VIOA 3PFOA 3JAMY 4F3QA 4WFAQ 4M95A 4DV7K 5D0EA 5ETOA 2ZHBA 3BGFA 3IRXB 2PMZD 4I67A 5F9LA 4DV5K 2XO6A 2Y8WA 3J7YI 4EHTA 5BYQA 4RX6A 2R7SA 3OYEA 1ZPWX 1OY9A 4K50A 2D0PA 2FGCA 1RAOA 2J9EA 3NOCA 2WOMB 3GV7B 2VV5A 2ZOGA 3T41A 1E4GT 5GMKa 2CPJA 2ZWHA 3NAEA 2KHDA 2UU9J 1GH8A 2JL9A 4A57A 2BJEA 2G0IA 1BL3A 4HKQA 4B1VA 3D2FB 2CPYA 1XK8A 2O1PA 1A5WA 1RCHA 2RQKA 1QVFM 1S99A 3U27A 2RHKA 4DMZA 1RT6B 3S01A 2IVNA 2NZTA 2V2ZA 3L2RA 1EKRA 5B0EA 3W66A 3MMAA 3RB4A 4CFAA 1RA6A 2EPIA 4I56A 3G6ES 1W0HA 4NX9A 1K0VA 1R8BA 3DDIA 4CJKA 1BLUA 3H7HB 4ZVFA 4IR9A 5AQWA 3CCUS 3WT0A 2QV6A 3HHLA 3R7BB 1RT2B 5CQGA 3R2CJ 3DGPA 4PEOA 2HLTA 1H7WA 3WC2A 1H6KX 3MHYA 1I6JA 2ZOMA 2KQ2A 3IRWP 2IM1A 4JI5K 2QZ8A 4IOBA 1BQXA 2V8VA 1FKPA 1C6VA 2BW7A 3UE5A 1AUSL 1N8RT 1J27A 1MROA 2MZ1A 3TUJC 4DV3J 1FWKA 1ZBUA 2X78A 2VFUA 2XLKA 3FNNA 3J81U 4K7QA 1CQMA 5FPDA 4B1ZA 2J76E 4XEIA 4ECYA 1QE1A 2MQLA 3E9PA 3CCVN 4CJPA 3GSDA 2E2QA 2HQCA 4Y0FA 2C2KB 2ZHOA 3UFCX 1HPZB 2QMWA 1FNXH 3N4PA 1LWCB 1XMOJ 1J5EJ 3DM2B 2WBRA 1W2IA 1EQMA 4Z4CA 4BE2A 5J1PA 6FD1A 2HFVA 4WXWA 2O8DA 2GWJA 1HJRA 3OBYA 3GE1A 1U2VB 5IT0A 4FSVA 2ZEJA 1T9XA 2YX1A 3SCLE 1KAXA 3K0SA 4DR3F 3WX4A 1F21A 1N0VC 3LPYA 4CCHA 2DNHA 5C15A 4GKKK 2BRKA 2XRIA 1MNEA 4EBCA 4OX9J 1RHJB 3UB5A 3QIOA 1SV5A 5EVZA 2FZCB 5BPMA 4Q0BB 3A8EA 4ES3A 4P74A 1Q81O 3Q8YA 1PYSB 1S12A 1YBAA 2DNPA 3SQ0A 4NMLA 4F4WA 2WCXA 4DR3J 3TP2A 5BYRA 5BJRA 2J0WA 2MTLA 2E5LK 1U26A 5B7WA 4RW6A 2NNWA 2BACA 5JLHA 4DR5K 3M30A 1NMEB 3LO3A 3OXGA 3DN9A 3SEOA 1GLEG 3BF4A 4DQRA 3LDQA 1EETA 5HMZA 3VALA 4FWNA 3W9HA 3Q8PB 4UW2A 1F9EB 4DN0A 4D3GA 3AVKA 3J80O 4NO7A 5A0YA 1BHNA 1V3SA 5AFUA 2VF3A 3LGHA 5IS2A 5DDPC 3HSDA 1P8ZA 3TSUA 3KHLA 4DLEA 3QMLA 4A47A 4IG0A 3QO9B 1JMTA 3PO5A 3DMJB 3W61A 4TQSA 3LA0A 1YTAA 4DUYJ 2VZ9A 3K5PA 1K73T 1RTIA 1S3XA 1H38A 1XMBA 3EY1A 4M3XA 5LMUK 3W7BA 3BGRB 3T6JA 1XNQF 1H98A 3D4JA 2POKA 4PXBA 1VQPS 4ZJQA 3L3UA 2KN4A 2VQFF 2WONB 3PX6A 2E1ZA 3PEJA 2RQCA 3ULEB 3GR0A 3VR1A 3KIOA 2UV8G 2WVDA 3W64A 4I6AA 1LW2B 2KH9A 3CJAA 3VGUA 4QWDA 2N7YA 5CZ2A 1PJ6A 1G15A 4WE1B 4C1NI 3GJRB 4DUYF 1FXRA 1VHFA 3UD4P 3N6NA 3CWJA 2JGUA 2MZTA 4HR2A 2DTJA 4IEEA 1Q0NA 4NLQA 2OEMA 4NASA 3HSCA 2XZTB 3QQCD 4O4RA 4WCEL 2OO4A 2XQCA 4NPOA 2O8FB 4NA1A 4NLVA 3VQ7A 3JYTB 3RBXA 1WWHA 2YKOA 4R79A 2DNLA 3ENQA 1S48A 4ZVHA 5JVHQ 5CYMA 2MHNA 1UPPA 3T5KA 2A6MA 4JB8B 4L3NA 3O1LA 1RDDA 4KH4A 3MXMA 4K42A 4AXJA 4LFAK 3DDKA 3IFRA 1UJ4A 1TMJA 2DH8A 1RDBA 1QQOA 5GIOA 5D4OA 3BR8A 5DETA 3QEIA 2VDIA 1FDDA 2GQ2A 4PG8A 3C7NB 1SCJB 2MY7A 1G6BA 1N56A 1FJCA 3KVGA 4MKBA 2HS4A 2Z4PA 3M2UA 1ZETA 3VQQA 3CJRA 2WTUA 2BMBA 1AB8A 2PA8D 4JV0A 3SIPB 3LGNA 1CZBA 4CP5A 2V67A 4KYZA 3BKFA 3THVA 1T3VA 4OX7A 2ZH8A 4G1QA 1S6UA 2VFSA 3GG1A 4DN9A 3NMUA 1XMQJ 1CULB 3LDPA 1N0UA 1UEVA 2ZZMA 2LVWA 3GP9A 3PVXA 3NMAA 1G99A 2HZVA 4NXNF 2CJ9A 4NCBA 2Q79A 2DNNA 3ZT3A 3LUYA 2XGPA 3BBFA 2Y1LB 2GJIA 1KDNA 4JBCA 3VAIA 1OIAA 3TAPA 2MEWA 4CHZA 2VG5B 5KFLA 1IJEB 3OW2R 5IT9Y 4Q5VA 5AQNA 4NXMJ 4RU9A 4CJSA 3MCNA 5DDOC 2K7KA 2HHHF 2DH9A 3OYDA 4A46A 1Y3KA 3D5MA 5F3ZA 4JKEA 1VRTA 1GX5A 1LQ9A 1AT1B 2AU0A 2ZGZA 4JKDA 1JLGA 1TVRA 4ZPWR 4WIQA 1TL5A 3R9PA 3PIOL 3O9RA 4TU8A 3NF7A 2HNYA 3IAS9 1M1HA 4AL5A 3KG1A 1RBOB 1BMQB 1NLVA 1VSHA 2BTFA 4FLXA 3BSNA 4LFBK 1TUGB 3BJYA 1MA9B 2BABA 1WEXA 3KJVA 1V9OA 2XLJA 3VA0A 6AT1B 3VVUA 1QDUB 1YRXA 2YHWA 2BE7D 4NLWA 2HBZB 1WSHA 1U2CA 3SI6A 1SC1B 4EZ9A 4IOCL 1MLAA 4EYIB 1S10A 3F5TA 3EEQA 4NLBA 5EX5A 2ZHAA 4DV4F 4J2BA 2ROPA 4XO0A 4OZLA 4X2BA 2CUYA 1OVQA 1VAZA 4NLCA 1FKOA 2RRBA 3I55S 3VERA 1VIXA 1IKXB 1VQ4N 2UYTA 1QQNA 3KHGA 3AXKA 4FZVA 1NKBA 2PY5A 1JXVA 4JI2F 2B5JA 2K06A 3JB9k 5D6GA 1XI1A 2MY8A 3VQDA 4LY7A 1RWNB 1VSDA 3HDSA 1X4EA 2KO1A 1ZOTA 1IN0A 4A61A 1WSVA 3CD5A 3K89A 3LZJA 4DPOA 1KRPA 3UVJB 2DGOA 4PQUB 1N34F 1NJWA 4IOAQ 4PWWA 1HKAA 5KT6A 5GVQA 4CFDA 4DUZF 4DU7A 2UUBF 1VSIA 2R3VA 3W2WA 3SPZA 1A9NB 3MEKA 5KPRA 3BSOA 1RTHB 3NF6A 4ED6A 2OD4A 1U47A 2Y0SD 2I0XA 2HRTA 2GO9A 5AQUA 3CIPA 2EKNA 1ZBHA 4E7HA 2IC3A 3D2WA 3CT9A 2G2ZA 3CJ1A 4DSFA 7FDRA 2V4RA 3OS2A 3CJSA 4DR2J 2NQPA 3HLUA 1YBTA 1TUVA 3FEXB 3DOMB 2OEKA 4Y2CA 1CLQA 2OPSB 4DF8A 1JKHB 5ETRA 4B3TJ 1CULA 3QGGA 2FPHX 3L2UA 1BDGA 1YTUA 2KZMA 3B4MA 3CC2S 2Y9HA 3GILA 4DU4A 3OTOJ 4ZP6A 4JI8J 1RK8A 5C7PA 1HBOA 1BWVA 2E1RA 3R7SB 1JXEA 5KFAA 2JEFA 3KD1E 2CYYA 3R5AA 5GAEI 1N36F 1B9FA 4KH1B 2C3PA 2I38A 2PI4A 5C2GA 3QRRA 4LF8F 2WVEA 1BI4A 2CGJA 2QRRA 3CC7N 3HL8A 1NDKA 5KG7A 4BY9C 3L7PA 3J7YU 3K0JA 4DSKA 3AA5X 1EQYA 3WNFA 1S4FA 4L3QA 2Z1IA 1K9MO 4W92B 1X9MA 4NLUA 4CD1A 5AR0A 1BGXT 2KT2A 2E7XA 4BACA 1JL1A 1FRMA 5M1PA 4HHHA 3GE9A 4LF8J 5BREA 2MGZA 4O3NA 3TZXA 8RUCA 1KVKA 1S97A 1U49A 2CQGA 3SK3A 4DX7A 2FDNA 2HNYB 1F5CA 4X4UA 5KTQA 2GMHA 5CYQB 3V9SA 3TR5A 4P9SA 1NHKL 1SQKA 2E1AA 2VJVA 2M0GB 2J6TA 4FJGA 4YY3J 3QLHA 1KQSR 5J2NB 3Q89A 3MTJA 1SB6A 3CDEA 1Y3JA 2OAUA 4CJWA 3KWMA 1XUPO 3N6LA 2E1PA 3HVWA 4JI2K 2CWXA 2ZNYA 5M1NA 1KC8O 3FBBA 4I7FB 4ED7A 1JJCB 4BE0A 3OTEA 1Q7LB 3UDEA 1S57A 2KFNA 3M6GA 4J2AA 3L3CA 4IFYB 4HTIA 2PO4A 4CT8A 4FKYA 3KLHA 1OPIA 5KT3A 3BM7A 1Q82T 4WFNL 2E2PA 5IV4A 1WAJA 1RE1B 1U1LA 1SJRA 1BCMA 3TUZC 4CFCA 2I5JB 2DHHA 3ZZPA 5DDQC 3ENAA 2B5JB 4EBEA 2FF6A 2CQ4A 4KKOB 2UXDJ 4BDYA 2DBBA 1F2GA 1CQNA 4WF9Q 4Z2XA 2YKNB 1LXNA 3R6MA 1QE1B 3KMSA 2PAVA 4CF8A 4EI2A 4BGAA 1C0UB 3MR2A 3J7A1 3MN6A 3QJJA 1QTNB 2UZAA 1RT2A 5KFQA 4GKJJ 1DAXA 3WX8A 4HLBA 2GWKA 3PIPQ 2DY4A 1XMOK 1J5EK 4Y00A 1UW4A 4YOXA 1S76D 1Q79A 4RWXA 1KVIA 3FQLA 4ILLA 2D3UA 3F73A 1FKOB 3BEXA 2CJYB 2VPZB 1V5IB 1C1CB 3FK4A 2A2CA 4NXNJ 1MMNA 2OTLS 3QYYA 2MKCA 3OS0A 2BUNA 3CJ0A 1BY9A 5AXKA 4OJ1A 4IG3B 5EHHA 1NJZA 4IBNA 4AHVA 4CLUA 4OX8A 3ZSRA 1YDLA 1XEZA 1SI9A 3CE8A 1BOTO 4E89A 4TLRA 4Q8EA 4ZVOB 4ED8A 3IG1A 2KLAA 3LTOA 1IKYB 3BPDA 1C1BB 3M8YA 1N32F 5KI6A 2IYIA 3A5LC 1F3VA 3PFEA 3E8OA 3NBPB 3S3MA 3ISNC 2FHJD 5DQHA 3FMBA 1OH6A 2D41A 5M1KA 2G8VA 3LPEA 2D7SA 3VVTA 3GFZA 2MQMA 1SV5B 3ELHA 4QIEA 4JI7J 4QR1A 4LSNA 3UR3C 1XMOF 1J5EF 2OI2A 2UXCJ 3RYLA 3AA3A 4AM7A 3EL2A 2BBEA 4WP3A 4ZP9A 3AGRA 4PKDB 5DM7Q 4EMDA 4LREA 5SZTA 1WOSA 4YR2A 2DXFA 4N77A 2HHTA 2F9WA 2XS7A 5KGXA 2YWHA 3GJTB 5AQOA 2RHQB 1OJ4A 2P6SA 2B4VA 5F3TA 2H54B 1DTTB 1OY8A 3EDQB 2Z1JA 4NOHA 4CWBA 2HHQA 5CAAA 3OR2A 4Z7CA 2VASA 3M32A 2GJFA 1KTVA 2HBMA 1HMVB 3G86A 3AJ2A 4FM1A 1HWUA 1NZAA 2V4JA 4Z4EA 3KMQA 2AEFA 4MYUA 3TUIC 1K44A 3PSFA 5FRMA 4PPDA 4J9LA 1S6PA 2EBGA 2JC1A 3CQXA 2MJNA 5GAGI 4KO0B 2Y3YA 1QVFR 1ZBSA 3MAQA 3FGVA 2UUTA 2F5GA 1PGZA 4DV2J 5T7LB 4P2FA 1HNWF 2QL9B 2KW4A 4BR5A 3I0SB 5J1EA 3O5BA 4PXEA 1X0PA 1G1XA 2LMIA 3M9OB 4LUBA 3IWNC 5IV3A 1NB7A 2G4BA 4OI1A 3ZTSA 5IXUA 1NJXA 1LWXA 4YDDB 1KNZA 4KRFA 2QA1A 1ESVA 1E3MA 1VRUB 4NA2A 3M1VA 3RTVA 2WBMA 5EWGA 1C1CA 4AH9A 2YBVA 4BRPA 3FRYA 4DTUA 4C9DA 4LH5A 4YS2A 2APOA 1IWAA 2YQ0A 1XHZA 4O3SA 5B0BA 3BH7B 4RWWA 4JI6F 4HUGA 4WXOA 4LFAJ 3MMCB 3O9SA 1UP1A 4DPXA 3CC7S 4OYIA 4G65A 1I3OB 3D1HA 1RDWX 2ZJRQ 4CEZA 3QFWA 4WTYA 2V9KA 2NPFA 4MDAA 3UNGC 5B8HA 3ULEA 4RUAA 2GUIA 2O8CA 3BB5A 4IFYA 1NGCA 1NJIO 2ZUGA 1RZMA 3CCSS 3M6UA 3ZETA 1X4CA 3FCHA 1ZAWA 2CPHA 3L4QA 3K9KA 4JV5J 1V3RA 1REVB 3HI0A 3MEGA 2DRDA 1CJTA 2ITMA 2F96A 3O6QA 3HZ6A 3MPWA 5M1OA 3LM9A 3TABA 2LECA 2OKQA 3KJNB 1GX6A 2KXNB 1FJGK 2I2YA 4JHDA 1QTMA 3M8QA 1RACB 4IO9L 2O8BA 3A5NC 2AYBA 3EGZA 2RU9A 3QWPA 3DMJA 2R42A 5G4DA 4DV6F 1JLQA 1YF5L 3C0BA 4CERA 1IBKJ 2F9DA 2UUCJ 3FDSA 1RU1A 3DHWC 3F2KA 4DTJA 1HWKA 2G0CA 2CA9A 3MXHP 4ZTJA 2CDRB 5HJYA 1ZM3A 1T05B 2EBEA 2DGSA 3TNVA 2AGQA 5KRTA 2W9CB 5EOYA 2DJWA 2D3ZA 1TKXB 3K2YA 3HM8A 4JV2A 2ZH3A 2KM8B 4OGEA 1HYZA 5B0GA 4CBXA 3I0SA 3L7UA 1YSJA 2Q3SA 1KSPA 3M32B 1NGIA 3OY9A 3UDCA 3DRRB 2D0BA 5B0FA 1IKWA 5LXYA 4A62A 4JKAA 2X74A 2ZJRL 3WHIA 2DR6A 2WK4A 2E20A 1BG3A 2B9XA 5KG4A 2GVZB 1RHQB 4LR7A 4P2SA 3ADAC 2MMYA 3KLGB 1X5TA 4CFBA 1RT5A 1HBUA 4CT9A 3MCOA 3CJQA 1NAQA 2E29A 1JCEA 2Z8QA 2BJ3A 5HMWA 1WKKA 4KHUA 4MIAA 3B54A 3S1TA 1KQKA 1TKZB 2C3YA 1OS5A 3RR8A 1SBRA 4BRFA 2OTJN 4CJ4A 2QT7A 4QS8A 3NGUA 4X4SA 1SAZA 4PXCA 4W5OA 4K2JA 4B9MA 1H3DA 2DNMA 2M7SA 1CS4A 1VBKA 4DTRA 4I64A 2PIIA 5AE2A 4K4UA 3D67A 3AVIA 4BG9A 4ITSA 4FVMA 3KDNA 2VG6A 3R3LA 4DV0F 2DRBA 4ILJA 1TYQB 1NBEB 2VD3A 3THYB 4Q44A 2VG5A 1XQIA 4M1KA 3TU5A 3MCAB 1RYSA 3SMSA 2RAQA 1H7XA 4QPXA 3EYZA 4OPHA 5KFDA 3BZKA 1HFEL 3KK1B 1EP4A 4JI4J 4PA1A 3CC4S 2ROGA 3NBPA 2E7WA 1BD6A 1UMJA 4WFAL 2PI5A 1PAEX 3E3XA 1R31A 4DU3A 1XMQF 2IS3A 5DQGA 4LBPA 2VPXB 3WZ0A 2HS3A 3M1VB 2ZUAA 2HNDA 2WSEC 2FLNA 4BRAA 3OL6A 3CJ9A 1HNVA 3JSMA 4K43A 1AXQA 1F9HA 1N33F 1A5VA 3IFEA 2D0CA 3EVWA 3H40A 1T8EA 3GJQB 3KKSA 1R27B 2RHSB 3H5XA 1MROB 3QGHA 4BRDA 4ELUA 4J9OA 4A48A 5AQZA 5HL7L 4FVCA 3L2VA 4BR4A 4FJ5A 3S41A 3I5CA 4O4GB 1VSKA 8ATCB 5KAKA 3HCXA 3OTOK 1QVGM 2FYXA 1YT3A 1OH8A 3WNGA 2J4RA 4K8XA 4HL9A 4A4JA 3MFHA 3RRGA 2VPYB 2EEYA 4BC3A 4K8RA 3SJJA 1VQKN 2ALZA 3D0HE 3KLEA 2WRMA 4PYAA 4C4WA 1QSYA 1G4CA 3UCUP 2D3O1 4IQMA 2XHCA 2IA0A 1FJGF 2MQ8A 4OLOA 1UVLA 1H74A 1AA1B 3CQ8A 3RBDA 5K14B 3HP6A 1RTHA 1TV6A 3H46O 2B9YA 4TKTA 4U67Q 1SH2A 2NRHA 3O44A 3W9JA 4X4TA 3CM6A 3MDFA 1MW7A 3QPIA 3SBGA 4ZLPA 2DH7A 3VWSA 2YX4A 3AA4A 3FMWA 3D6HB 4RCHA 4LRAA 2VONA 2DRAA 4DQPA 4N8OA 4DL2A 4PPZA 2LFVA 1S1XB 4FYYB 2DR9A 3E01A 4BRNA 2QKBA 5A8RA 2UUBJ 4BVPA 3DKDA 4HEA9 3IWXA 1WG1A 4NEZA 1CLFA 1UCNA 3C94A 5BN9A 1E6VA 2DCLA 2KT5A 4OLAA 2DTUA 2HHVA 5A2QU 1WJ9A 4NLGA 4KJIA 2IC3B 4NB4A 1SVDA 2N4DA 4EZ6A 4R0JA 5AFUH 3EDRB 1HHQA 2BVZA 3LPTA 3N5FA 2WVFA 4JI2J 1U25A 2A10A 1T3NA 5ETVA 1S72N 3QNWB 5A0YB 1WLJA 1Z26A 3MN9A 4K4SA 4AM6A 1WSGA 2ACMA 2YQ1A 4MLHA 5IOLA 5BR8F 3MMBA 3H4DA 2HQIA 1NK7A 2JEGA 4F26A 3M2VA 3KLGA 4KB1A 1LAWA 4ED2A 2FJEB 4FS2A 1EKSA 1H1VA 2CPIA 2M2BA 2A1RA 4DV1F 4KBIA 3IWLA 1JQGA 3HSTB 3OYMA 1F1BB 4BC2A 1NSAA 2E2NA 1RSCA 1LWCA 2RQMA 1QQMA 3QEVA 3D0GE 5KT4A 2DFFA 2HF3A 2XO7A 3L2QA 2YXLA 3C6UB 3RB6A 2RS8A 1ITPA 2ZD1A 2BXJA 3R5DA 2B8QA 3KLIB 1VK8A 4LT6A 1LW2A 4O0JA 3W9IA 3TYTA 3BP8A 5D4LA 1JCGA 1HBMA 4GC7A 1HQUA 3UI3A 3G71S 4IUFA 1WG4A 3CCMN 4M3RA 2OZMA 2E1CA 2LXFA 2YWWA 3HVAA 4JV5F 1GOCA 2P9SA 1RBSA 3ZZ0A 5KG5A 4P73A 4B9UA 1XN9A 2A2DA 5AQSA 3HJFA 1U1OA 3IP0A 2W2PP 1S22A 1YIJN 3TZZA 2IPOB 2A1BA 5MAOA 4KREA 1KXPA 1GLLO 3UE2A 4QIWD 1WOPA 3LP3A 2J8SA 4E0DA 5HVFA 4HHJA 4RR5A 1SPBP 3V9UA 2MQQA 2R2TA 3U1MA 2HSEB 4F4YA 4OHZA 3B78A 4ZVPB 3NH1A 3H2LA 3NNCA 3CCEN 4URSA 2XB2D 3IC1A 3MWBA 2ZH5A 2XMJA 3CJ4A 4DPTA 3NHGA 3HFZB 5BR9A 2FTRA 3SBTA 4B17A 2JLFA 3K57A 2W7PA 4ENOA 3C66A 5CYQA 2R7TA 2MQOA 1SQGA 2XSJA 4IG0B 4JI7K 1QAXA 1TV6B 1UTAA 4OZ0A 4B9VA 3JS6A 3IGVA 3ENOA 4EIAA 2RRNA 4JUZA 3JAMU 3I96A 2GMLA 1CG2A 3ETOA 3MDQA 3AV9A 1NNDA 2EW9A 5E26A 4P75A 1JIHA 1SC3B 4HH1A 3SUPA 3NGKA 4K4VA 2QM1A 1T6CA 2D74B 3VQPA 5U47A 1HLWA 1JXLA 2N3OA 4M5JA 2G1DA 2KZZA 1VQ6N 3WIVA 2FBTA 3SUNA 1P1LA 2CQHA 1X1PA 2R7UA 4ANDA 3OHRA 4H5RA 2GQQA 4NYPA 5KFWA 4ZHRB 4AE5A 2BE9B 3MMVA 4FZXC 2V94A 2X7IA 2QFIA 1C1BA 1QD1A 3E01B 5BRDA 3L4BC 3J7ZT 3T5LA 3EM1A 3VCDA 4ZDNA 3R5CA 4O23A 2HHHK 3H5UA 3AA2A 1VRTB 1UVMA 4LFBJ 2KKZA 5CHIA 4FJJA 3M8PA 3HFKA 5HOOA 1RKIA 4H0VB 1SIZA 2Y8YA 5IT9O 2RJZA 2FBVA 4CIEA 1LOTB 1IQTA 2R2SA 2KDOA 4JKBA 2O8EA 1HARA 2EHGA 4KE5A 3OL7A 4FP9A 4ECVA 2CFXA 2G9OA 2DGQA 4HACA 1R6YA 4GRSA 4HUEA 4E7JA 1XR7A 1URNA 3BQ0A 4CECA 1ULRA 1U2RA 2QWPA 2IRUA 1HNZF 5E5NA 3PKMA 3I0RB 3DU6A 3N5BA 1B7FA 3MN7A 2WBNA 2GIFA 5KFJA 4H4OA 3PJWA 3O8MA 2E6LA 4UOCA 1YGYA 4CLTA 1BE4A 2AF6A 4IO1A 1NXIA 1C4AA 4WU2A 5FD1A 2CPZA 2J8AA 1SUQB 2MLYA 5L39A 3W2VB 4JKHA 4N8NA 4DV1K 2OPRB 4O5BA 1NKCA 2KT3A 2IVMA 1GLFO 4CJLA 1H0HB 1DRZA 4A8KA 3VEOA 3CJ2A 1NWKA 1O1WA 3AO2A 2LU1A 4QWCA 7AT1B 2FJXA 4DV0J 2EC0A 1S7HA 4DF4A 4NCGB 4HDGA 2W7AA 1ASVA 4LIRA 5H1SV 4A8XA 2C2MB 4CO2A 1NB2A 2DXEA 3R2DJ 3TZYA 3I4PA 4JV5K 4IH7A 3PIOQ 2HQFA 3I9V9 2MKJA 4X4PA 3DRSB 1B0TA 2BKPA 4FPBA 3EUNA 3HPGA 4F36A 4LF2A 5L1JA 3BPSP 2F1FA 3RJMB 1K6YA 1FWPA 3CMAN 2AJ4A 3OQ2A 3DXBA 4FJLA 4AHTA 1BWFO 3I31A 5AQXA 4KIAA 4DR7F 1O5JA 4WQ4C 4UY85 5JS1A 3THWA 2EVZA 3QWUA 2ZH2A 1NUEA 3PW0A 4LIWA 4B9TA 1VQON 2BDPA 3GU0A 3CDBA 4A2AA 1RHUB 1Q8KA 1S9GA 2UUCK 5D0GA 4O44A 4FYWB 2NRRA 1T94A 3G4SS 3LOUA 1SKWA 1Z4UA 1IG8A 4PG5A 2IIHA 4FCYA 2MLZA 1Q86T 2XLIA 1DT9A 1B0PA 2I1RA 1YRUA 2IOCA 3MM8A 4F02A 4H0XB 4KHWA 2H4WB 3BN7A 1WBDA 1WF2A 3KK3A 2AEJA 2VPWB 1GTHA 3OPKA 4R8UB 4J2DA 5FLXY 3SLCA 3F41A 2F4VK 3TAQA 4NLTA 4GO5X 1Q7YT 2P51A 2K8GA 4CVNE 3VQCA 3OFEA 3M5RA 1N33J 3NE6A 4KFBA 1VS3A 2QW9A 2LLZA 4MYTA 1SL0A 1RDCA 2QSWA 5C12A 3AAPA 3PZPA 4P52A 1W2BR 4I9QA 3UN3A 2MXYA 3SFUA 3WIUA 4N41A 1L3UA 4ED0A 2YHXA 3C6HA 1S5JA 4RW4A 2F63A 3W62A 2KVIA 1X0FA 2FLPA 2ZOFA 1YJRA 5D4NA 2DR8A 2YNFA 1JCFA 4HACB 1SJQA 3PX0A 3RZAA 4KAIA 5F8JA 2FY8A 4O3RA 4B3RF 3ZO7A 1NHUA 1BUXA 1TELA 3U3YA 2V2VA 5CY4A 2ADBA 3MI7X 4YY3K 4HCBA 4TYBA 4A8SA 4CGGA 1L3KA 4ZTFA 2NXUA 3VAFA 1WC3A 1TL1B 4X4RA 3LANA 2A1SA 1SC4B 2Y1IA 1R8AA 2DNQA 1W9HA 4ZOSA 2BE2A 5AXLA 2JEIA 4NE9C 3JQJA 1VQKS 4RW8B 1PILA 1UZDA 2OIHA 3HPHA 5G0RA 1XC9A 1MWKA 2W42A 3S8SA 2V52B 4X66K 2B56A 3UVJA 4IYQA 5FRNA 2XMWA 5A6PA 4WPAA 4D3HA 3JQKA 5CD4H 4B3TF 2HHWA 2O8DB 3CJKA 1FX2A 2MKSA 3T1YJ 1UWAA 1X9WA 2UUAF 3HD1A 1WOOA 1OYEA 4FZYA 4U7UD 4CK1A 3PW7A 3CD6S 1JLBB 4LRBA 4FXVA 4CJTA 1Y11A 4NEYA 5KGWA 1HPMA 2MZQA 3H59A 3DGVA 1EAYC 3C46A 4OHYA 3TZWA 5KFXA 2ASOA 2IFXA 2BGGA 3H5SA 3TPQA 3DYAA 4JI1F 3OHBA 2CQPA 5IQ6A 3ZEUA 2VQFK 2D5RA 1NHVA 5TKYA 5EX0A 3P83D 4IJAA 4KGZB 1O51A 4FWKA 1Q78A 4F0KA 5CZXA 4LF5F 5DRKA 3IS9A 1EB0A 4B08A 1VQPN 4IH6A 3VOVA 2DO0A 1G2EA 3MUTP 4OJ3A 4DR6K 3ID8A 3IGNA 3MGJA 1UWBA 3H20A 1SJ4P 1N36J 3CCQS 4IEIA 2VG7B 4OI4A 1NDCA 3VF0B 5I3PA 3TTFA 1FNMA 1IKWB 3IG1B 1S1UA 3NY0A 3M1FA 1NO8A 4K0KJ 2ZC3A 1M5PC 4PY5A 4KAZA 2D9OA 1VQ9S 5HROA 4AQYJ 4CZLA 5KT7A 2NZCA 2KYZA 1NM1A 2A6OA 4M5IA 3ZSWA 2Z58B 3PG9A 4CO4A 3DI6B 2FSJA 2NRZA 2GC8A 3QRPA 1N54B 2QXLA 4E98A 3CULA 1DEJA 3GR1A 1HNIA 4CLSA 4DX6A 2CADA 4DUTA 1NGFA 4YHHK 1KQGB 5DZ7A 5HRNA 1KVJA 4HTLA 3V9ZA 2K1RA 6FDRA 3M05A 2H4YB 2VWBA 1UFKA 5GAEU 1UVKA 5KFOA 4P7TA 4OI2A 1YI2N 2MKIA 4C98A 4NLSA 4CM2A 1KD1T 2LU2A 2HPUA 1MDUB 2MLXA 1S1VB 3TUPA 3IMQJ 1VQ8S 3EE9A 2Q1NA 3HO1A 5CE3A 1ZTTA 1NGEA 1AZSA 2DPJA 1B0VA 2J0SD 3BSAA 5GAHU 5LJWA 4J37A 1T3OA 5H9FJ 4PG7A 3Q8RB 3HPOA 4MDBA 1TMMA 3TSQA 1FD8A 3HBTA 2CIMA 4I6MA 4OZ1A 1R43A 1UKUA 2O4GA 1HYSB 2Q1LA 2LQBA 3SQ4A 5FLXO 4BE1A 3TTCA 3D54A 1B64A 3SMZA 1FJ7A 4ILMA 2E66A 4LBIA 2NXEA 1W97L 1I39A 2ZM6K 1CZ9A 3W5YA 3NVMA 3OYBA 1F5BA 4UQGA 5H1SQ 3G82B 3PDNA 1FXLA 4DFPA 1ZA2B 2M9KA 4NZ6A 3CCWA 1T9YA 5D4PA 3A8IA 4A8FA 4PG4A 2CQDA 1SH0A 5HMYA 1U45A 1T9UA 3GIMA 3VQ8A 3CCUN 3JSRA 3S3OA 5IT9U 2Q3PA 3I56S 1NK9A 4C8ZA 4JI3K 1N5YB 2P9PA 2FHOB 3TA2A 4EP4A 1OH7A 3ZSOA 3VZHA 4LSNB 1S0NA 4PXDA 2OUGA 4JYAK 4RNFA 2CG8A 3W8GA 2BJ9A 4MKVA 3HHLB 4PZVA 4ZMMA 4Y6IA 3C14A 2Y0BB 1ITGA 3D0PA 2OPQA 1VJWA 1Q8BA 4G6VB 1XNRF 4CZFA 2Q97A 3HHEA 2XMUA 2DGXA 1EWRA 1LNQA 2HQGA 3BZCA 3MWTA 3FE1A 3DJCA 1C0TA 1OY6A 4NL5A 5M2RA 4DR1J 4V1Ak 5KT5A 5K8OA 3PIPL 3KOAA 3R27A 2IDLA 4IOXA 1VQ5S 5GMDA 5I4MA 4DFKA 4FW1A 4RW8A 3SNNA 2YHBA 4QCLA 3NS6A 2PDAA 5LJVA 2B4PA 1WF0A 2CQIA 2ALYB 4OX9K 5LMNF 1UW9A 4ECSA 3G10A 4LF6K 1NCLA 2VFVA 4H0OA 2RUGA 1ZM9A 2W25A 5MLCV 3J7AP 1TKDA 2E2OA 2C2EA 3W65A 1NH8A 2RQ4A 4H5TA 4X64F 4Y0WA 1T0TV 1Q8IA 2E5LJ 4DXLA 2UXBK 1RGIA 2ZH7A 3FZLA 4UUWA 4DR5J 4C0BA 2YHYA 2CVIA 4M8LA 2CJXB 3OVBA 5CH7B 1UVJA 2RF2A 3KLFA 4DU8A 2HBYB 3DXSX 5CXTA 3R9LA 1HMVA 1YVFA 1K1SA 3TWZA 2ZBCA