1TV6A

Hiv-1 reverse transcriptase complexed with cp-94,707
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
539
structure length
535
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 reverse transcriptase bound to an inhibitor active against mutant RTs resistant to other non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords reverse transcriptase p66 subunit
total genus 139
structure length 535
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tv6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tv6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tv6A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tv6A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1tv6A05
1VSEA 2V4QA 4ID5B 2F8SA 4I9QA 4ECRA 1NJXA 2VWKA 3Q8QB 1SKSA 2YV0X 3TI0A 4H54A 2D0BA 4DSIA 3NGZA 3CO9A 5DQIA 3B6PA 3ZT0A 3OYCA 3DLGA 2IS3A 4B8CA 3NAIA 3QLHA 4M95A 4DLGA 4QAGA 4IG0A 4DFPA 1SV5B 4ID5A 1YT3A 4W5RA 3VQ8A 1T94A 4W5NA 4EBEA 4FJKA 1WN7A 3O4NA 5KFDA 3F73A 4CEAA 4IBNA 1DLOB 4LQ9A 3C94A 4ELTA 3TAMA 5FDLA 4IH7A 4IFVB 4J9LA 3NAEA 4O3PA 5F8GA 1L3SA 1N5YA 3EZ5A 3KLFB 3OYKA 3EY1A 2YNGA 2XHBA 3KNAA 2ZD1B 3JYTB 3JSMA 4J9KA 3KLEB 3BSOA 4WXOA 3KLHB 2GUIA 5CZ2A 3PV8A 4YFUA 4F4KA 2B6AA 3AO4A 4N76A 5F8HA 4FLWA 5D3GB 3GIIA 4RUAA 1L5UA 4M42A 3CIZA 4QW8A 4C8KA 4DL3A 4CEEA 2P5OA 1KFDA 1S10A 4ZMMA 1RA6A 4CF9A 1D5AA 3ASMA 1TKTB 1B9FA 4K50A 3SV4A 2G8FA 4CEDA 4ED2A 4WYLA 3PW5A 5C24B 1T05A 3S3NA 3OLAA 3DLEA 4CIGA 4O44B 1TQLA 3D45A 4E7HA 4DTJA 2HHXA 4E7KA 2CKWA 2G8HA 1KLMA 3QIPB 1QQCA 5C24A 4Y3CA 2RKIA 5F8IA 1RT1A 5EWFA 4DF4A 4DU3A 4B08A 3RR8A 3K5OA 4RW9B 3MEEB 3OL9A 3OYLA 5KG1A 5CYQB 2BQUA 2YKNB 1KVAA 4BE0A 4QWDA 4EO6A 1GOAA 4DTRA 5KFOA 4PA1A 1KLNA 3GILA 3RB0A 4YR2A 1S4FA 1HYVA 3RRHA 3HSTB 1CLQA 1IKWB 3O3GA 4J2AA 5KFCA 2ATLA 2HWHA 1ZYQA 3CM6A 4XPEA 2RPIA 3KK2A 3VQ4A 3HKWA 3Q8RB 3L2WA 4JS4A 4HUGA 4XPCA 2ASLA 3EZUA 1DLOA 4OL8A 1ZBHA 4TSXA 4DF8A 2R8HA 4QCLA 2FVPA 3I8DA 3AV9A 2XGQA 4IG0B 4FJNA 2PYLA 3HVAA 3O3FA 3RMDA 3HJFA 4FVMA 3H5SA 4I2QB 4ZP7A 4WYWA 2BQRA 4EP4A 4YR3A 1JKHA 4AH9A 3NF9A 3DM2B 3N6LA 4CJPA 3T1AA 2IGIA 1D0EA 3ZCMA 3EPGA 3ULDA 4Q8EA 4ELUA 2R2SA 1F21A 4W5OA 4J2EA 4TQSA 1XR5A 5KFEA 3K2PA 3DM2A 2R8GA 2HHVA 3IS9A 1BIZA 2R7YA 2ZQBA 2GIRA 4CGIA 1S9EA 4EZ6A 3DI6A 4TXSA 3MR2A 1C1BB 4CK1A 4JS5A 4OLBA 4DSJA 4PWDB 2OZSA 1RILA 3QINA 1JL2A 3QYYA 4RW7B 4ICLB 4B9MA 4B8AB 1ZETA 5C42A 3HO1A 1MU2A 2P1JA 1ASVA 5EWEA 1SH2A 3I0RB 4URQU 1QHTA 3SPZA 3LP0B 1S1WB 1S1WA 1C2PA 4CHQA 4FJ5A 3F9KA 2KFZA 4HUEA 1EX4A 4Z0UA 3DLRA 4FW1A 1NK5A 1NK6A 2IA6A 2XY5A 3V1RA 4DU4A 2RF2B 1W25A 1TKXA 1TAQA 1JLCB 4CHOA 4ZPCA 2X6SA 1X1PA 4CFDA 2ILYA 1KTQA 1C1BA 4M3WA 1U47A 4JRPA 1KCFA 3VA0A 4FZZA 4IDKA 4IG3A 2OPQA 2WONB 4LH5A 1ITGA 4CFAA 4KAIA 2I5JB 3OS2A 1RT4B 2AGOA 3OYHA 1EKEA 4CJEA 4NLVA 1SH0A 3OYAA 4JRQA 1QE1B 4IFYA 1TKZB 2YNFA 2DFEA 4YMEA 4FZYA 3AO3A 5L1JA 1HMVB 3OSNA 3AO2A 2XY6A 1YVUA 4IRCA 3TAFA 1VSIA 2NUBA 2HNZB 2WHOA 4C8OA 3RWUA 5KI6A 4I7FA 1S9FA 2D3UA 3DOLB 4H4OA 4KTZA 4FW2A 1S6QA 4NCAA 3NF6A 1C0MA 3OYDA 2VG5A 1C1CA 2HNYA 1S6PB 2BGGA 3UQSA 3CFRA 3BGRB 4I2QA 3VQSA 1FKOB 3CFPA 1FKPA 2HWIA 3KLVA 4Z4EA 3OYNA 2A1RA 4GVMA 2W9AA 3OSPA 4QWCA 3O3HA 5KT6A 3VN5A 5DLGA 2F8EX 1REVB 2KFNA 3QZ8A 3QEWA 3MECA 2DPJA 4BDYA 4J2DA 1LWCB 1QSSA 4F2SA 1S9GB 3V4IA 4HKQA 4CHYA 1EXQA 4AHUA 3CDUA 3ISND 3DMJA 2VA2A 3CDEA 1RT5B 4ECQA 3VQEA 1VSKA 2IM3A 4CEOA 4E19A 1RTIB 1WSHA 3UR0A 3P1GA 3NH1A 3ZSWA 4OGEA 1IKWA 4FXDA 1JIHA 3PO5A 1GOBA 1JLGA 3DYAB 1U09A 4CJ5A 4ED7A 2R8KA 4BWMA 1LW0A 2KQ2A 5T7BA 3PW4A 4OLAA 1RBSA 2E9RX 2BE2B 4Q44A 2F8TA 4O5BA 2JEIA 1Y97A 2IDOA 4QW9A 5KFUA 4E0DA 3HPHA 4O3NA 1RT2A 1EETA 3V6KA 4N56A 1S97A 5HROB 5KG2A 3OYEA 4Q0BA 3KMQA 4KFBA 5HLFB 3HVTB 1BIUA 2B5JA 2UVUA 2W9BA 1RT6B 4DQPA 4AHVA 2OPRA 3LALA 5HLFA 3D5MA 1RT3B 3QERA 1QE1A 1C1AA 2G8VA 1FK9A 5KFSA 4DG1B 1RDRA 4Z4HA 3DLHA 2VG7B 5KFMA 1TV6A 2UVWA 1N4LA 2W9CB 4J9SA 1RT4A 2OA8A 3OL8A 3PZPA 3ZSYA 5L9XA 3TAMB 3ZSXA 5KG3A 2D5RA 4CF2A 2W42A 2WONA 1TV6B 3TQ1A 3MR5A 4GMJB 4KI6A 3I5BA 2BE2A 3AVNA 1N6QA 5KFJA 4KTQA 3OYMA 5D3GA 3PJWA 4WXWA 1JLAA 2OPRB 3CJ0A 3KLIA 4NLDA 1JXBA 2Z1GA 3S3MA 1Q8IA 4URSA 1U04A 3FDSA 1EP4A 2FBYA 2ASJA 5KT2A 3I0SA 1J53A 3QGGA 4J9NA 1RDAA 4AHCA 4ZPBA 5KT3A 5J2MB 3H59A 2YNGB 4CJKA 3IS9B 4FK4A 1SKRA 2FLNA 2W8LA 4O4GA 1JX4A 4JV2A 3E51A 1XWLA 4RU9A 4EYHB 2Z1HA 3K5MA 4FJJA 1BQMB 4W5QA 4DS5A 4DL4A 3HM9A 1TAUA 2QXFA 5KGWA 4DQSA 2Z1IA 4DL2A 3N6NA 4MKAA 4QWAA 1ZBFA 1U49A 4KHNA 3VQ7A 2R2RA 4CJQA 5I42B 2IM1A 2OPPA 3TABA 3DLGB 3BJYA 2E6MA 1HPZA 4LY7A 3MECB 5KT5A 3CJ3A 4CJSA 5KFNA 4CGDA 4HCCA 5F8MA 4FLUA 1LW0B 4DL6A 3K57A 5KGXA 4QWBA 2P51A 3HYFA 4O4GB 5KT4A 4KHQA 5JS1A 4Y2CA 5DLFA 4CF8A 1NHVA 1YVFA 4ELVA 4L8RB 3M9NB 3D0PA 5KFZA 1HNVB 4FS1A 3AA4A 1JLQB 3SI8A 1X9WA 1CSJA 4OPJA 2VA3A 3M8QB 3LP2A 3QO9B 4RNFA 4RNMA 2YHBA 1C1CB 1ZTWA 3SQ4A 2FJXA 2DFFA 3H4BA 4MIBA 4IR1A 3AVJA 3MXIA 3UPFA 4RNNA 1NHUA 1S6PA 1OS5A 2ZE2A 3ZSOA 4KO0B 4K4SA 5J2PA 1RYRA 3HPGA 4U6PA 4DTOA 1SUQA 3CDWA 3OY9A 2HNZA 4DTSA 3H08A 1ZBUA 1TK0A 4ZTFA 4O55A 2E9ZA 3VQPA 4CFBA 2D0AA 3RR7A 4ECXA 4C8MA 1FKPB 3V6DB 1DTQA 2FVSA 4J9OA 2V9WA 2HW3A 2FC0A 1FK9B 2HNYB 1S1UB 3HPOA 2W9BB 3QNNA 4DTNA 3KJVA 1N6QB 4Y34A 2V0NA 5J2QA 4CEFA 4E3SA 3HP6A 2P5GA 4MK8A 5EU7A 1NJZA 5HBMB 4BE2A 4HVJA 4CGFA 3RBDA 4ZP9A 2F96A 3DRRB 1RBTA 1RDDA 2O4GA 1QAIA 1S1XA 4NLGA 1D9DA 5DQHA 3A2FA 4DLEA 3S9HA 4PUOA 4Y1DA 3SPYA 3V9ZA 3OYFA 2BANA 2ASDA 1LWEB 3V1OA 4FYDA 2HNDB 4DL7A 5KFHA 1QUVA 3SQ0A 1S9EB 2WOMB 3WNHA 2G8IA 3ISNC 1NNDA 5K14A 4PWDA 3MFIA 4ECZA 3MR6A 3H40A 5KFQA 4E1MA 4DEZA 4M3XA 2WOMA 3UDLA 4BACA 4NLPA 3KK3B 4M3YA 4I2PB 1HQEB 3L2RA 4RW6B 4KHYA 4RW6A 3ZT2A 2J6UA 2JEJA 4I2PA 4BDZA 3LP2B 3QO9A 3RTVA 3GQCA 2VG6A 5SZTA 3G86A 4I7FB 1D9FA 4MH8A 3GV7B 3KK3A 5EWGA 3QEPA 4MFBA 1BL3A 1RBUA 4DTXA 3KOAA 3K58A 4CJFA 4RNHA 4ECWA 4NYNA 3H5XA 2D3ZA 4MFBB 4DWIA 3OYBA 3I5CA 3PVXA 4F4ZA 1FKOA 4NLUA 2HHUA 3L8BA 2G8KA 5KG7A 3SUNA 4JV0A 4EO8A 4WZMA 1HQUB 4LSNB 4TY9A 4I9LA 1U4BA 5KRTA 3DLBA 4KAZA 3NL0A 5KFTA 1D8YA 3FFIA 5HP1B 1SL0A 3V9WA 4WFYA 5KFXA 1CXUA 4H4OB 4DQRA 3G6YA 1RT1B 4DSFA 3OHBA 4JUZA 4WE1A 4FS2A 2WCXA 1XI1A 4K4YA 1RTHB 4N47A 4O3OA 3O4QA 2IJFA 1CXQA 3LP3A 1BQNA 4FJ8A 3DLEB 4YQWA 1KHVA 1LAWA 4EEYA 1WSGA 3BQ0A 2RF2A 2ATQA 3WNFA 3KHRA 4TYAA 3TAQA 4FK0A 4NCBA 2BANB 2WB4A 2HMIB 2HHWA 3HK2A 3NH0A 3OYGA 4FJGA 3QEXA 4XIUA 5DGBA 3I0RA 3QEIA 2D7SA 3OLBA 4TN2A 1ZTTA 5HRRA 1MU2B 4CK3A 3M8PA 1VSHA 3WNEA 2C22A 2EC0A 3KKSA 1C0TB 4DTUA 3LPUA 4B9NA 1NJYA 5KG0A 1C6VA 1RBVA 1BI4A 4KSEB 5HBMA 4DSKA 1Z4UA 4CF1A 4KV8B 3DDKA 1S0NA 4FM0A 4ED6A 2KW4A 4J9RA 3VQCA 1UOCA 4DFJA 4K8ZA 4NYZA 5F8JA 3HVRA 1NJWA 1HARA 2Y1IA 3MAQA 4DG1A 4R5PB 3MEGA 1VSJA 3GYNA 3QIPA 1UWBA 3IGNA 4J9PA 1TK8A 4KO0A 3T5LA 3KLEA 4ZP6A 1RT3A 2AGPA 3M8QA 2B43A 1SV5A 2R2TA 1RT2B 5KFKA 4Z4GA 3QLHB 4E7IA 4KHWA 4EZ9A 4ECUA 3KIOA 3B6OA 3GV8B 1HYSB 1C0UA 1S9GA 3SUPA 3MEDB 3RBEA 4K4ZA 2BRKA 2QV6A 4ZTJA 4F3TA 4ED1A 3OJUA 1J5OA 2XWYA 1O1WA 2RN2A 3KLHA 1LWFB 3AVLA 1NK0A 1IKVB 4ED8A 3DLKA 1GX6A 4JLHA 1LWFA 5EUHA 3SUOA 1DTTB 3BGRA 3OJSA 4LSLA 4YP3A 3NMAA 2I1RA 3AVMA 2KZMA 3SFUA 1UA1A 2XCPA 1REVA 3LWMA 2YKNA 4OKEA 3GIJA 3RMBA 1Q9XA 3LDSA 1L3TA 3PX4A 4ECTA 4AHSA 3MEEA 4RW8A 4CHPA 2JEFA 3NE6A 4X2BA 5F8NA 3AVCA 4OPKA 3KLGB 2FVRA 4CIEA 4URGA 1JXLA 1I6JA 2IM0A 3HVTA 3CVKA 1JXEA 4IFYB 4EP5A 1LV5A 2RDJA 3AVFA 4R5PA 4RW9A 2AWZA 3SZ2A 2FBTA 1BCMA 4K4UA 2HMIA 2VG7A 3LAKA 3FQLA 1T7PA 3P5JA 4F3OA 4B9UA 2C2EA 3L2UA 2YNFB 4HTUA 1HMVA 3M8PB 1TP7A 2FJVA 2HHSA 1LW2A 3KK1B 2B6AB 1UWBB 3IGVA 4CERA 4PQUA 3LZJA 1BCOA 1SL2A 5DGAA 2W7OA 1U45A 3SUQA 3CFOA 3JSMB 5FDLB 3ITHA 2QKBA 1GX5A 2AGQA 4MK9A 4LH4A 2Q3SA 2OYQA 1S1TB 1S1UA 1W0HA 4FCYA 3RMCA 4TYBA 4RG8A 4KHMA 1BISA 5J2PB 4WFZA 4K4VA 5CY4A 5KFFA 4FJMA 1HNIA 4Q5VA 3TWHA 4TY8B 4OKJA 2PY5A 3AVAA 2E9TA 3K5NA 3V6JA 4MIAA 3DRSB 1RDBA 3NBPA 2IAJA 4MKBA 4CJRA 4CJ4A 4DSEA 1SUQB 2PYJA 2IC3B 3GIKA 1RTIA 2ZE2B 1B92A 4J9MA 3HVWA 3L3UA 1RT5A 2J6SA 5KT7A 3FFIB 3L2QA 3MEDA 4FLZA 4TQRA 5L1KA 4NLRA 3G10A 3V4IB 1LWCA 4ICLA 4KB7A 2KTQA 1K6YA 4NCGA 1XHXA 2AJQA 2X6NA 4KB1A 3SQ1A 3IN5A 1IO2A 1HNVA 5I42A 1L3VA 3CG7A 2DPIA 4ZPAA 4B3OA 3S3OA 2YNIB 1IKVA 2OZMA 4ED3A 1TVRB 2C2RA 3ZT4A 3PW0A 1NK7A 1RT7B 2HNDA 3NCIA 5DG7A 1LWEA 5KFWA 3M9MB 4ZHRB 2V4RA 4FJXA 4M3ZA 5CYMB 1KVCA 3MXJA 1CZBA 3V9XA 4KHUA 4FJLA 3TVKA 4DQIA 1RTJA 3VQAA 1ZBLA 4CJTA 4IOBA 4R8UA 3OYIA 1JKHB 2BR0A 4R0EA 3MF5A 2YNIA 3AA3A 3BSAA 3L2VA 5DMRA 4GC6A 1S1XB 4K4XA 4FJ7A 3KMSA 2J6TA 1T03A 4ED0A 1B9DA 4IKFA 3QETA 4Z4IA 4QPXA 2D0CA 4CGGA 2GBZA 1T3NA 2FBVA 4FM2A 4CCHA 2XCAA 4CEQA 1FXXA 3V9UA 3HP9A 3NGIA 4IQXA 1KSPA 3IG1B 3ZSQA 5J2QB 1JLEA 1SL1A 3HHKA 1A5WA 3ZSZA 2XRIA 3RAXA 4KE5A 4WZQA 2HAIA 1RA7A 4KHSA 2HHTA 3KHHA 3HT3A 1U48A 2XO7A 1HNIB 5JUMA 2IJNA 1NKEA 2OPSA 4RW7A 4Q8FA 1I3AA 4ECYA 5KFYA 4QOZB 1S49A 1VRTA 1VRTB 3HL8A 2HVHA 1T03B 2E4LA 1TKZA 3OS1A 3KHGA 4RZRA 4Q43A 1IKYA 4CE9A 2RDIA 1K1QA 1TKTA 2FLPA 1UAXA 1S0MA 3VQBA 4HCBA 3NF7A 4F4YA 5KG5A 3ITHB 3QIDA 1HQUA 3BQ1A 1UA0A 4OJRA 1HYZA 4CK2A 5T14A 1J54A 2IOCA 4O44A 4BE1A 1TVRA 2W8KA 4ZVFA 3NHGA 2FVCA 2GIQA 1WSIA 3U3GA 3VQQA 1JLCA 3U3YA 2R8IA 4M94A 4CJWA 4KKOB 3IRXB 2EHGA 4O3QA 2AQ4A 3P83D 1JL1A 3PR5B 1TL1A 3G6XA 4C8LA 4NRTA 2WRMA 3Q8SB 4EBDA 4CGJA 4FM1A 4E7JA 4O3SA 3RMAA 1NOZA 3AA2A 1S48A 4H4MA 5KTQA 3BSCA 1WNSA 1HQEA 3PY8A 3T5JA 1S5JA 3TANA 3VQDA 3ZSRA 2HVIA 3N6MA 3AO1A 3IAYA 3V9SA 4Q45A 2QE5A 2D41A 4DFMA 4IFVA 4NLTA 1RTJB 2GC8A 3L3VA 3M8RA 1VRUB 1VRUA 5CYMA 1VSMA 1QTMA 3LP1A 4H8KA 4RUCA 3TARA 2IC3A 1S1TA 4NLYA 4Y1CA 2O5DA 2WTFA 1G15A 4IRKA 4IKAA 4ECVA 3AA5X 3DLKB 1SKWA 3NAHA 2UUWA 4O0JA 3BREA 4RW4B 4M3RA 1GOCA 5F9LA 4F2RA 2UVVA 3NBPB 3HXMA 3NF8A 1HRHA 3KTQA 1RTDB 2VG5B 1C0UB 3KLIB 4DL5A 4OGCA 4FJIA 4Z4FA 1T05B 1RAJA 1ASUA 3TAGA 3DOLA 4KBIA 3CYMA 1QAJA 4DSLA 1IM4A 4O4RA 1KHWA 1X9SA 5J2MA 1XR6A 4K4WA 3T19A 5HRNA 4PUOB 1TKDA 4ZVHA 1KLMB 4EYIB 3VQ6A 4DMNA 3H2LA 4NLSA 2OPQB 2YKMB 3DRPB 4DU1A 3I5AA 3KJVB 2G8UA 3DRSA 1RBRA 1TGOA 4IH6A 1TL3A 4M3TA 1EP4B 4ZPDA 1RCHA 4G3IA 3VQ9A 1JLFB 3OL6A 3C6TB 3PR4A 2YHAA 4ZVEA 2OPSB 5JXSA 3CJ4A 2JC0A 2XI3A 5CYQA 3MTKA 1TKXB 2XGPA 3DOKB 4IH5A 3NGDA 5HRPA 2Z1JA 3DOKA 4M3UA 3QZ7A 5KFRA 4J2BA 3U6FA 4TLRA 5C25B 4CJUA 1VSFA 4E89A 4DTPA 3H5UA 2B5JB 1WAFA 5FRNA 3NH2A 4F4WA 2LSNA 5J1EA 5DQGA 2DFHA 5L1IA 3JYTA 3FQKA 3LPTA 1EETB 4KRFA 5KFLA 3KLFA 1KFSA 1I39A 3ZSVA 2KZZA 5KG4A 4JV1A 4Q0BB 3KLGA 3SQ2A 1X9MA 2ZD1A 4NZ0A 1R0AA 3FRZA 1JLEB 3QNOA 4EBCA 4YR0A 5FRMA 4R8UB 1KVBA 2R2UA 1VK0A 4ID1A 4NYFA 3QESA 3AVIA 5J2NB 3LAMA 5CZ1A 2VWJA 1QSLA 2AU0A 4KB0A 1MMLA 1HYSA 3FSIA 5KFIA 1RT6A 3OHAA 3AO5A 4FZXC 1WNEA 3TAEA 1Q9YA 3SYZA 2XY8A 4NRUA 1RTHA 3PJXA 2XI2A 3RB3A 1DTTA 5F9NA 4M45A 4ECSA 3DMJB 3RAQA 2E6LA 2VG6B 3OVNA 3TAPA 2G8WA 4NLQA 4CHZA 1NK8A 5KFBA 5DK5A 1A5XA 3QGIA 1IH7A 3BDPA 4FJ9A 5SWMA 3LP1B 3MR3A 1XHZA 1K1SA 2JEGA 1NOYA 3K5LA 4C8NA 3PHEA 5F8LA 3CM5A 1TL1B 1QS4A 4CJLA 1LAVA 3THVA 1ASWA 2AX1A 4O0IA 3SJJA 4LD0A 1NK4A 3I0SB 2DY4A 2IAJB 3V6HA 3SI6A 3K59A 2FLLA 1NKCA 1BI4B 2BRLA 2Y1JA 3CQ8A 3GV5B 4HHTA 1J5OB 3QIOA 1KRPA 3PX0A 4DTMA 4H4MB 1BQMA 1S6QB 1A5VA 3AVBA 2ILZA 2W7PA 1J9AA 5C25A 4CECA 3ICLA 3KK2B 4FBTA 4B9TA 3MEGB 3EPIA 5K14B 3OYJA 2O4IA 1R0AB 4IRDA 2X74A 5HRSA 5KFPA 4CFCA 4TY8A 2W9CA 3TR8A 4RNOA 3SFGA 3Q8PB 3C95A 4CGHA 4PY5A 1C0TA 3SV3A 1JLAB 4IR9A 1WSFA 3E01A 4KREA 4KFBB 3KKRA 2I5JA 1VSDA 5HROA 3M8SA 4XO0A 2QKKA 3LP0A 5I3UB 3DRRA 2OH2A 2UUTA 4PQUB 2IBKA 1Z26A 2GV9A 2JC1A 4KPYA 4N41A 1RTDA 1S0OA 1QSYA 4MQ3A 3PUFA 4KTWA 3SCXA 2YKMA 3DRPA 1RNHA 1BGXT 2YNHA 2IMWP 3AVKA 3T3FA 1WAJA 4WFXA 5JS2A 3RB6A 3ZT3A 1IG9A 3KHLA 4LSNA 4KHRA 2BQ3A 2BDPA 5HP1A 3QGHA 4FJHA 4E1NA 5C42B 2EX3A 3ZT1A 4F50A 3H4DA 2ALZA 3D28A 1DTQB 2HB5A 2WK4A 1N5YB 4RW4A 3RRGA 5KFAA 2ITGA 3G0ZA 3UIQA 4HYKA 3AVHA 2PZSA 5DG8A 1JLBB 2FJWA 4CEZA 4FLVA 3LZIA 3OL7A 4K4TA 3AVGA 2DTUA 3T5HA 4ZHRA 3BR9A 4QWEA 3NKYA 4MK7A 3M9OB 5E41A 1ZBIA 4DQQA 4AILC 1TK5A 4LSLB 1HPZB 5KFGA 4FLXA 1N48A 4KKOA 4B3OB 3V81A 1WLJA 5EDWA 3G6VA 4AHRA 1JLBA 3NGYA 2IM2A 4FLTA 1JLQA 3PX6A 4J9QA 1NK9A 3V81B 4OKKA 2X78A 4CHNA 3BQ2A 2C2DA 3CWJA 1CZ9A 5KFVA 2R8JA 4NCGB 4Y2AA 4NLOA 4GC7A 4W5TA 1XR7A 3NDKA 2HHQA 1N56A 5DG9A 4ZP8A 4FBUA 1S1VB 4AHTA 4CIFA 4YNQA 5I3UA 3RB4A 5KRSA 4ZVGA 3H5YA 1L3UA 3NFAA 4CESA 2QK9A 1T8EA 3IRXA 4IG3B 1YTUA 3E01B 3H98A 2B4JA 1YTAA 3VQ5A 3LANA 5J1EB 1IKXA 2A1SA 2XY7A 4B9SA 4IDKB 3LWLA 2C28A 4Z4CA 3VA3A 4F8RA 4F4XA 4B9LA 3PW2A 3PO4A 5J2NA 2ZKUA 5L1LA 2FBXA 3ALYA 4BWJA 1XC9A 3KD5E 4CEBA 1W9HA 3C6UA 4CF0A 3QEVA 2AX0A 1WSEA 1WSJA 4KV8A 4U7CA 1LW2B 3KK1A 2YNHB 1IKYB 3IG1A 4CJVA 3GIMA 4G1QA 4G1QB 4GW6A 4FLYA 3DI6B 1BQNB 2CJQA 4NLWA 4OVLA 4HUFA 4O3RA 1IKXB 3OS0A 1SH3A 3V6DA 3CJ2A 3C6UB 1NKBA 4CJ3A 5KG6A 2UVRA 4WE1B 5C5JA 3KD1E 3EYZA 3CJ5A 2RKIB 1JLFA 3BSNA 3MFHA 3T5KA 1HJRA 4FK2A 4M41A 2JLEA 1RT7A 3C6TA 1D1UA 3SNNA 1JLGB 3DYAA 5FROA 3V1QA 4DFKA 4UQGA 2OPPB 1TL3B 4N5SA 1VSLA 4B9VA 2ETJA 1Z25A 4KI4A 2XC9A 2JGUA 4E7LA 1BHLA 1RDCA 3WNGA 4RW8B 4BDPA 1S1VA 2FVQA 1RYSA 3MXMA 4NLXA 4DS4A 4LQ3A 3PW7A 4K8XA
chains in the Genus database with same CATH superfamily
1VQMS 3CCSN 4CZJA 1G4CA 3M2RB 2VWKA 1SKSA 5IT4A 4FWPA 4DSIA 2QA2A 2A42A 3NGZA 1KEKA 3GONA 3EZOA 3OYCA 2IS3A 4B8CA 3NAIA 3B78A 5D15A 3NMRA 3R7SB 4DLGA 3D6RA 4IG0A 1RAOA 3N9UC 1YT3A 2ZF5O 1XNQF 3VQ8A 1NH8A 3ZTRA 4EBEA 3MMAA 1IJEB 3K2YA 1N33K 3CQXA 4IBNA 2J8SA 2V68A 3TAMA 1M5OC 5FDLA 1OYEA 2QYCA 1XMBA 1L3SA 1N5YA 3EZ5A 4AFFA 3EY1A 3JYTB 1R6VA 2D1CA 2GUIA 4YFUA 3AO4A 5F8HA 1XNRF 5D3GB 3NMUA 3BH6B 1CJUB 4DL3A 3SBGA 3CD0A 3UKUA 2P5OA 3M1FA 1FWKA 1RA6A 2WBRA 1T3VA 4CIOA 1S7HA 1J5EK 1D5AA 3ASMA 1TKTB 4CLUA 2EFGA 4B3SJ 4ED2A 5C24B 2FHJA 2V8PA 3BR8A 3ZNJ1 3DLJA 2ZH8A 2VFRA 1KLMA 5C24A 1HA1A 5F8IA 4ZS6A 2Q1LA 3AQOA 5EWFA 4JV5J 2KYZA 3GB0A 4P72A 1V6HA 1KAYA 3OL9A 4WTYA 3OR2A 3CCUN 4V19S 2FJAB 1GOAA 3PACA 3SBTA 4YR2A 1HYVA 4K43A 1IKWB 2JH3A 1S3XA 3O3GA 4JI3F 4J2AA 4Z2XA 2ATLA 2HWHA 3WBZA 1FNXH 3HKWA 1K8AT 2X51A 3L2WA 2V2VA 3CTRA 4JS4A 4XPCA 2ASLA 4OL8A 2XTJP 4U95A 4IEIA 3EWGA 1KQFB 1RACB 4H5NA 4GKJJ 4J9VA 4IG0B 4JKBA 3BO3A 4ZJQA 3O3FA 3HJFA 2UV8A 2IDEA 4PPZA 1N5QA 2BQRA 4YR3A 1JKHA 3NF9A 5BYQA 1IBKJ 4CJPA 2LEAA 2I2YA 3QICA 4ZLPA 1D0EA 4FYYB 3CCSS 4C8YA 3OPKA 4ELUA 3J7YP 4Y2MA 3VOVA 1Q78A 4X62J 3EGVA 3K2PA 2LLZA 4PG7A 2MEWA 1RBLA 3IS9A 2CVEA 1BIZA 2GIRA 4OI6A 2RIJA 4TXSA 3MR2A 1C1BB 4CK1A 2KI2A 2VBZA 3E9PA 4PWDB 2OZSA 1RILA 1U1OA 3QINA 1BD6A 2FB0A 4DV3F 4RW7B 4K42A 5LMUK 2Q3PA 1QDUB 4ICLB 1ZETA 3HO1A 5HL7L 1ASVA 4F25A 2HK2A 4NL5A 1SH2A 2WSCC 4E2FB 4P9SA 3W63A 2PFDA 3CB4A 1S1WA 1ZBTA 4DUYK 2FHMA 2VQEF 3V1RA 1EARA 2RF2B 1W25A 1S79A 2RS8A 4QIFA 3F0NA 2QN6B 2F7TA 4ETZA 1EKSA 1UTAA 4ZPCA 4DOZA 4CFDA 2ILYA 1KTQA 3A13A 1GLLO 4USIA 4IDKA 2B8QA 4B1UB 4LH5A 1HNXJ 3I6PA 3EL2A 1FFGB 3ZO7A 5KAKA 1EWQA 1SH0A 4IFYA 1FF2A 2YNFA 3GYXB 1WEZA 4J9UE 4G6VB 2XY6A 3TAFA 1VSIA 1RHRB 2WHOA 4C8OA 3L4IA 3MOJB 2EKNA 2FJDB 3J7ZO 5KI6A 4JK7A 1S9FA 3U02A 2XNQA 4DR4K 3PYFA 3NF6A 3IBWA 2AP1A 2VG5A 3LDOA 4UZBA 1C1CA 4GKJF 3JAMU 1EZZB 3L7OA 3UQSA 1CZAN 4OZ3A 5BPLA 1U0HB 4DL0C 1DARA 1ZZFA 3GPAA 3H45C 4A48A 4GVBB 3OSPA 2Q31A 5HMWA 3C8YA 1NLVA 1F60B 1LWCB 1QSSA 1OH6A 1S9GB 4CHYA 1YVNA 1TZ0A 4HH0A 4FWLA 3HZEA 1MWQA 1RT5B 4ECQA 1RTIB 1YLXA 1WSHA 4ILRA 2A40A 1GT8A 4CO5A 2MZQA 5I3QA 5AT1B 3E1YA 1P8GA 2A2DA 3DYAB 1WBBA 2ZWOA 2AYBA 2GVDB 5IQQA 3BF1A 3C0BA 4CZKA 3O1LA 1XC3A 4QS7A 1LW0A 2KQ2A 3THPA 5T7BA 2E9RX 5HATA 2W1BA 3VAKA 2F8TA 4O5BA 4JI4J 2GELA 2O8CB 4O3NA 4YDXA 1VQLN 2HF4A 3TJAA 2QJ3A 1S97A 5KG2A 3OYEA 3HVTB 2UVUA 2W9BA 1M1KO 1FEHA 2OPRA 3LALA 5HLFA 1RT3B 3AB4B 1RDRA 2KVQE 1N5VA 2UVWA 4CZIA 1IM6A 2W9CB 5M2UA 3PZPA 3NGKA 3ZSYA 3I33A 2D5RA 4CF2A 2WONA 3TQ1A 3KDNA 2MMYA 1N6QA 4BQLA 3PJWA 3ENAA 2OPRB 3KLIA 4C3LA 1PYOB 1JXBA 3D6FB 4YORA 3S3MA 3RAMA 3SBMA 3W1YC 1Q8IA 3E9OA 1YKWA 4IO9L 5KT2A 2O01C 2ZHBA 4RKUC 2WB1D 4KH0B 1YJ9S 1RDAA 4AHCA 1SKRA 5E2QA 3MPYA 3NG8A 4O4GA 5IT9U 3TRGA 4RU9A 3J81O 4BHQA 2Z1HA 3K5MA 4DS5A 4DL4A 1VJQA 1X5TA 1R3NA 1X4BA 3G6EN 1Q8KA 3ENHA 1QM9A 3QJLA 4MKAA 3B82A 1O13A 1N36K 3JXOA 4QWAA 5AZJB 3VQ7A 1YHQN 2V63A 5I42B 2IM1A 2E6MA 3BJYA 1HPZA 5L38A 3MXHP 4FKYA 4CJSA 4WKYA 3CT9A 3O9TA 2BE9B 4YHHJ 3CCQS 4FLUA 3W2VB 2O66A 2BJ7A 3G82B 3HYFA 5KT4A 2YWFA 3QWUA 5K8NA 2PMWA 4JI8J 3S8SA 4ELVA 2YX7A 4L8RB 4NZ6A 5KFZA 4LF9F 3K7RA 4AQYF 4NEYA 3SI8A 1X9WA 1CSJA 5E0OA 3M8QB 5IV4A 4B17A 3MCOA 2MDAA 4OIXA 2HOEA 4FOIA 4MIBA 2L9NA 3MXIA 3C16A 3UPFA 4FL9A 2YHYA 3SAFA 1X5OA 2F4VF 1APSA 4KO0B 3IC1A 4K4SA 2NQPA 1NSQA 2E5GA 3HPGA 1SUQA 3CDWA 4LF8F 5K8OA 4XEIA 2MKCA 1WC0A 3H08A 3IR5B 2V2ZA 4ZVQB 2PGCA 2XMVA 4CFBA 2VODA 4C8MA 1RHKB 1NHKL 4IOAQ 3B4DA 4Y2IA 4BC3A 1T02A 3EEQA 3MUMP 1OYDA 2FHOB 4A5BA 1O6XA 4DPYA 4Y34A 1C0FA 2ZC3A 4FXWA 2HVZA 2GWKA 5J2QA 1ZM4A 1RBAA 4E3SA 4IOCQ 3GE1A 4Y65A 1M5PC 4M5LA 3CQYA 2DNLA 4IYQA 5HBMB 4CWBA 4I6YA 3WDOA 1VBXA 2YHXA 3FBEA 2ZH3A 4AQYK 1UETA 4W4MA 3R5GA 1S1XA 4C2MA 2LQ5A 4Y1DA 3SPYA 4FWNA 4LMZA 1H3DA 3M1VB 5LSRA 1BLUA 4L74A 4QQBA 5AR0A 2DH7A 1P1LA 2ZJRQ 3OBWA 3QAUA 4KJIA 3ISZA 4DL7A 4DR5F 3H6EA 5KFHA 3HDSA 4ITSA 3OW2R 1S9EB 2PMHA 2VDIA 4LF4J 2G8IA 3IR6B 4BRHA 2B9EA 3ISNC 5K14A 2QEXN 2MQLA 5F2RA 2B9YA 1IR2A 1NNEA 4E1MA 2BMBA 3DXSX 3EO3A 3FZHA 3H8YA 9RUBA 1HQEB 4EU0A 3ZT2A 3VWSA 3LP2B 4JBCA 4PXEA 4DR3K 3VESA 2VG6A 2NSCA 3V4MA 3G86A 1TYQB 3KK3A 2HIYA 3QEPA 4MFBA 1RBUA 2PI5A 5LXRA 1S0VA 2QLJB 3H5XA 3TJ8A 1H7WA 1OIAA 5A8KB 1RJJA 3L8BA 2QLFB 3L4QA 1WTFA 3IWXA 4EO8A 1YJRA 4WZMA 4TY9A 5KRTA 3DLBA 2HS3A 1CXUA 1X9JA 1EB0A 4JUZA 4WE1A 1VK3A 3VGUA 4FPAA 1VQYA 1D9AA 5E3PA 3MMVA 5DDRC 2OTLS 1YJTA 1IBMF 2IJFA 3O4QA 3EKUA 3DLEB 4DV7J 1LAWA 4RBUA 2WSFC 1UL3A 3WNFA 2K3IA 3Q2TC 3KHRA 4TYAA 3IM9A 4WFNQ 4B3MJ 1FE0A 2GGPA 3M8WA 4DV6K 2ZJQL 4CBUA 3QEXA 2J7WA 2C3MA 5IZHA 3QEIA 1X4FA 2D7SA 3OLBA 4TN2A 1ZTTA 2DISA 3D9BA 1VSHA 1XMQK 2EC0A 2HGNA 3R5JB 3VTIA 1C0TB 1RWPB 2JLFA 5KG0A 5K9FA 1S6OA 4YHHF 4KSEB 1AROP 2KDOA 2L08A 2XEXA 1F3FA 3ZTOA 3KHYA 1N33F 4DV5F 4GKKJ 1VQ5S 4DFJA 3VR1A 3HSJA 4H0XB 2BW2A 2DO0A 3UKRA 3R7NB 1NJWA 1WF0A 3UE5A 2OFHX 3LGMA 2RT3A 2DCUB 2AEFA 1UWBA 1TK8A 2EWHA 3JS9A 1ATNA 1RT3A 1A6LA 1SV5A 2AMCB 1HLUA 4ISEA 1RT2B 2CQ2A 1EX8A 3QLHB 2ADBA 4EZ9A 4M5IA 2RDDA 2RAQA 1S9GA 3J81U 3SUPA 5DRKA 3OFHA 1YDLA 3TZXA 4JKDA 1AUSL 4JI7F 5ETMA 4BC2A 3OJUA 3AVLA 3P31A 1LWFA 3BGRA 3OJSA 2DNGA 1HNZJ 4ZVSB 1P9YA 3NMAA 5F1XA 3AVMA 3SFUA 1F2HA 1UA1A 2XCPA 1REVA 5BRDA 2YKNA 1SJRA 3EVMA 4NXNJ 1KN6A 3VEOA 4NA2A 4CZFA 2D9PA 1NRKA 3BB5A 3K8VA 4RW8A 3OT9A 5A8RB 4KGZB 1ZAVA 3NE6A 4OYIA 3AVCA 3KLGB 2OEJA 2F63A 4URGA 5LMNF 3THYB 3LQVA 2IM0A 3IWNC 4ZCMA 1JXEA 1Y5IB 1JCGA 4H0TB 1HQ2A 5DZ7A 1UKUA 2RDJA 1ZM2A 2B7CB 4QYZJ 4RW9A 1B7FA 2WTUA 3CJQA 1WOQA 4DJBA 3EGZA 2VG7A 1YZ6A 4USVA 4PKHA 4AE5A 5IOLA 3IAS9 1T7PA 2VFUA 2I6WA 3P5JA 4F3OA 3VEYA 1PC4A 2C2EA 4HTUA 5DO2A 3W8GA 1TP7A 2GHPA 1WSVA 3KK1B 2GHWA 1JNRB 1FDNA 2M2BA 3CFOA 3JSMB 1U2VB 1IJJA 1GX5A 1BHNA 3QMQA 3M4XA 5TKYA 5ETVA 2YWKA 4A5AA 3VQTA 2YWHA 3RMCA 3AOAA 4RG8A 1N34J 2F9TA 1K8KA 2O8FA 1FFSB 5CY4A 5KFFA 4HHHA 4QBUA 2CPDA 1HNIA 1GTHA 1W2IA 3UR3C 4TY8B 4IQMA 2E9TA 3K5NA 3V6JA 1RDBA 3NBPA 1K44A 1KKHA 2IAJA 4CJ4A 1VQ9S 4M7YA 1BA1A 2IC3B 3MR7A 2E2QA 3HBTA 4DR7F 4W98A 2ZE2B 3PG9A 3SMPA 3L3UA 5KT7A 3W9JA 3AXMA 2VQFJ 2BKPA 5L1KA 3P5BP 5DM6L 3L09A 3V4IB 4USUA 3GCXP 4ICLA 2C2KB 2CZ9A 1YAGA 1XHXA 3KUGA 1QZ5A 1IO2A 4OX9F 4DUZK 1X7VA 2YJEA 1SC6A 3D1OA 2VFVA 2UP1A 4U7BA 2BUPA 2XWXA 2CNOB 2OEMA 4W92B 1NK7A 3D67A 3PW0A 5HQMA 4DN0A 2UUAK 5DG7A 4BRIA 4B3TF 4FJXA 5F0UA 2H9ZA 3PKMA 2BM0A 4MLEA 1CZBA 3KG4A 4FJLA 2ACMA 3JAMY 3TTFA 5F41A 4IOBA 4CBWA 4R8UA 1KNZA 2BR0A 1S1XB 4FJ7A 1WDTA 3ATUA 1RU1A 3SLCA 3VVUA 4ED0A 2ZJPL 3RJMB 5H9EK 4Z4IA 4KH5A 3HF5A 3AAPA 1M1GA 3ULEB 3HHEA 1T3NA 1NSKL 1HHSA 2XCAA 1NZAA 1FXXA 2H51B 1KR4A 4GKJK 1KSPA 3ZSQA 5J2QB 3HHKA 3US5A 4LRFA 3ZZUA 4DPWA 2ZM6J 3RAXA 1ZM9A 4RX6A 4PWWA 1RA7A 2HZCA 2HHTA 1I94K 3FBCA 8AT1B 1UVJA 2E8AA 1HNIB 3F9MA 4LF6F 1TMJA 2HHHJ 5KPRA 1VRTA 3H42A 1T03B 2E4LA 4AM6A 1AZSA 3KHGA 2GA7A 2RJZA 2HKEA 1DRZA 1SC1B 2L48A 1RWXB 1FI4A 4F4YA 3GIRA 3UKUB 3QIDA 4N8NA 1HYZA 2R7SA 3EUNA 5A8WB 2G0IA 4CK2A 1UP1A 1VLOA 2DR6A 1J54A 3M6XA 2IOCA 4PG4A 1S72S 4O44A 3JXUA 2W8KA 1IWGA 3HHLB 2GIQA 2YWGA 4Q7AA 4UY85 5JJBA 4I1TA 2R8IA 3GFZA 1KD1O 1R6YA 4K59A 4CJWA 4OI2A 2KN4A 2AQ4A 3P83D 3D2FA 2FSKA 1TL1A 2GFFA 4NRTA 2BX6A 4FM1A 2R7VA 4O3SA 3RMAA 4JOUA 3MCMA 2VQEJ 3O9QA 4DV2K 3IFRA 1OWXA 3T5JA 2CJ9A 1S5JA 5D78A 4G1PA 2QE5A 1YRUA 3DGVA 4GV3A 3RVCA 1RTJB 1TU0B 1VRUA 2OD4A 1NGHA 4QIGA 1N0VC 2M52A 5KOWA 4UT4A 2QA4S 3AA5X 2BW7A 1REGX 2P9KB 1SKWA 2E2OA 4JN4A 2LVWA 3NAHA 1PKUA 1R59O 4O0JA 5F9LA 4F2RA 2UVVA 3NBPB 3HXMA 1HRHA 2JLGA 4OYXA 4F26A 1C0UB 3KLIB 4DL5A 2AW0A 3MM8B 4OGCA 4FJIA 3TVYA 3PYEA 3CYMA 1QAJA 2JSXA 1Q7YO 1OQ3A 3FZBA 5CH7B 3OVBA 1KLMB 4PWUA 1XNRJ 4X64J 3H2LA 3EZWA 2OPQB 2YKMB 3DRPB 3I5AA 4WU3A 2G8UA 3PJ9A 1AZSB 4IH6A 1TL3A 1YHQS 4ZPDA 3IBCB 3WQUA 4G3IA 3VQ9A 2O8EB 3PR4A 4ZVEA 3K89A 2OPSB 4KPCA 3CJ4A 1UVIA 4DN9A 4B3SF 3CJKA 2PO4A 4PPDA 1TKXB 1EWRA 2RVJA 4JD2B 4PR6A 2PT0A 2BEFA 4NOHA 2Y1LB 4XH5A 4HTJA 2ZVSA 3CJKB 2Z1JA 3QRRA 1U7LA 2AF6A 2QW9A 3DOKA 4J2BA 1WAFA 4Y6IA 4BRQA 4CTAB 1FDDA 1U1LA 1HNWK 5L1IA 3JYTA 3NWRA 3BDEA 4KRFA 3CJ1A 1X4GA 3KLFA 1SQGA 5B0BA 5KG4A 4LREA 3Q0AA 1R0AA 4EBCA 4QIEA 3MMBB 3R2CJ 1NUEA 1WEXA 4ID1A 3ONQA 1N88A 1HYSA 1YSJA 4WFNL 3FSIA 4O23A 2IYGA 1RT6A 3R5DA 3OHAA 4FZXC 1WNEA 3TAEA 2Z57B 4MYUA 4ZA1A 2OLWA 2DNOA 1RFQA 1PAEX 1U2CA 2V51B 2MHNA 2XMTA 1X60A 1DJ0A 2QWNA 3HKZD 3RAQA 4H5WA 4P71A 4LFAJ 3FC9A 1NK8A 5DK5A 1KAZA 5LXYA 1K1SA 2JEGA 3QNWB 4C8NA 3PHEA 3CM5A 4CJLA 1T0TV 3J7YI 1LAVA 3HHLC 2Z2YB 4O0IA 2R9LA 2F9WA 2GW8A 3PKYA 2ZHAA 3BO4A 1YJNN 1NU0A 1O51A 1HR0J 4FZVA 3LDLA 2BRLA 4HEA9 1RWNB 4GKKF 5C2CA 4OYZA 1BQMA 5IWAJ 3H3OB 2YQ0A 2O8FB 3PXGa 1J9AA 2VL1A 4CECA 3KK2B 5IT0A 4FBTA 4IWVA 2LCWA 3VCDA 1RWVB 1VAZA 3EPIA 1B0PA 2GGPB 5K14B 2D74B 5HRSA 2X74A 3C6HA 1VHXA 4F4AA 2V2KA 3TR8A 2F5GA 4RNOA 4KHPJ 3W62A 3FFKB 3MM6A 3M1VA 3C95A 3RW7A 4OZLA 1S7IA 1MA9B 1C0TA 2ZZNA 4KFBB 3VGTA 1VSDA 1U0SA 3X1LB 2QKKA 4ZPTR 1HBMB 4KGVB 3KKFA 2UUTA 4PQUB 1Z26A 1KVKA 1Z2LA 1BUXA 4N41A 3JTNA 3O44A 4MQ3A 3MWPA 4KTWA 2OJ3A 4K0KF 1RNHA 3CI5A 3D3CJ 2IMWP 3AVKA 2C2NA 3GMGA 1WAJA 4WFXA 3WC2A 3J7Z5 2DBBA 1HI1A 4E8UA 5HP1A 3HRGA 1HW8A 3ETMA 3QGHA 4UUXA 2JRSA 4E1NA 3GWCA 3TSUA 4PRFA 5A8KA 1SS6A 3D28A 4WQ5C 3HCXA 4RW4A 5KFAA 2CPXA 3UIQA 2X1FA 1H72C 4DB3A 1SQEA 2HQIA 3FZFA 5D0EA 1G7CB 4CEZA 1H7XA 3AVGA 4F7VA 4OHYA 1WHWA 2G2ZA 3NKYA 3TX8A 4MK7A 3R3LA 2NREA 1WKKA 1YBAA 3FNNA 3CMAN 3AJ2A 1N48A 2YX1A 2JWKA 5AJ3J 3OR1B 2DVIA 2WVFA 3A8IA 1WLJA 2O8DB 3I9ZA 1KDNA 2DHXA 4CRJA 3OFGA 1U2FA 1NK9A 3O9RA 3EN9A 1CVJA 4CHNA 1CZ9A 2R8JA 4K7QA 4YN3B 2GEMA 3DFEA 5DG9A 4ZP8A 4CIFA 2CZVC 3RB4A 5AZJA 1RE1B 5KRSA 5AQKA 4HT7A 5AQNA 1S77D 4CESA 3C65A 4LRCA 4JI1J 3E01B 4CLLA 3CNQP 4KHPF 1YTAA 3ID8A 3WXJA 1X4AA 5J1EB 2A1SA 2LQJA 1GH8A 2H5IB 5A2QU 3SK3A 4PKDB 3LO3A 1T9UA 1HFEL 5J2NA 5L1LA 2FBXA 3ALYA 5DETA 3KD5E 2P9UA 2VICA 1W9HA 1NAQA 3QEVA 1RGIA 4K25A 1IKYB 3IG1A 2L9WA 1SC4B 4BR9A 4DHVA 3GTYX 3AH6A 2CQ3A 4ZPVR 3VF4A 3ULEA 3SIPB 2CJQA 4JI4K 1LXJA 3AOBA 4HUFA 4ANEA 4K5SA 2AA4A 4OFZA 4MKYA 5C15A 2VCPA 3PIOL 4P7VA 1NKBA 2UVRA 2OFGX 1VC6A 3KD1E 1SBRA 3WIUA 2ZDPA 5AE2A 2CQHA 3CJ5A 1P90A 2Z4PA 2O8EA 4LFAF 2EG2A 1FJEB 3P4UB 3T5KA 4JI3K 1RT7A 4LIRA 2MZTA 2OTJN 2CDRB 3BKFA 4X4TA 4JI3J 1Y10A 1JJ2M 3CMEN 2XS7A 3VAGA 4QR1A 2DEIA 3CC7S 4GO5X 4RW8B 4BDPA 4H0OA 3WQPA 1RYSA 4HR2A 2XMUA 1XMOF 3SCKE 4GNIA 1MW7A 1VSEA 8ATCB 2K2PA 1UWAA 2JFKA 4MAKA 4ID5B 4LUBA 3TTDA 5FPMA 2WUSA 1FVSA 2CQDA 1G99A 4DBQA 1CJTA 3N4QA 3IXQA 3Q8QB 2YV0X 1YI2N 4U8VA 3CO9A 2FXUA 3B6PA 3J8AA 3PEJA 1GQEA 4Q2LA 2Q66A 2XB2D 4Y2KA 3VZIA 2J7UA 3AD8C 5GADI 4ID5A 4GY2B 3CJBA 4JI4F 2K1RA 4W5RA 4DV1J 4ZKAA 5M1FA 4FJKA 1WN7A 5JLHA 3BH7B 3F73A 4IO8A 5AQXA 4BQZA 3W64A 4N77A 5I3PA 1WC3A 3KLFB 3D2WA 2M70A 1Q7YT 3U4LA 2YNGA 4BCAA 5JICA 2XHBA 3KNAA 1CG2A 3KWIA 3JSMA 4J9KA 3BSOA 2MXYA 4F4KA 2B6AA 1J5EJ 4N76A 1FWLA 2BKNA 2FY1A 1F9EB 4RUAA 2B4UA 3MHYA 3I31A 1P8ZA 3CIZA 4C8KA 3O3LA 5GMKa 3BN7A 4C9DA 3M6WA 2XMJA 3ZZYA 4FWOA 1IBLJ 4A8MP 4K50A 1HWUA 3N0VA 4OX9K 2G8FA 4CEDA 5THWA 4X4RA 4B3RJ 4WPAA 5HOOA 3S3NA 3DDIA 2IYIA 4E7HA 3ID6A 2FF3B 5GINA 2UXDK 1QQCA 5T7LA 1Q5YA 4ZITA 1RT1A 3RR8A 1ULRA 2R7XA 3K5OA 4X4NA 5CYQB 4C0HA 4BGAA 1Q79A 1FX2A 2ZM6K 4PA1A 4DR6F 1VQ9N 3C19A 3RRHA 1CLQA 5FPDA 3CPWM 2ASMA 3CJ7A 5KFCA 1S59A 2WFBA 4UOHA 2N4CA 1MWKA 1UPPA 5CHIA 3KK2A 3VQ4A 1RISA 4LR9A 1CS4A 1LFPA 1VFJA 4HUGA 3NVKA 3MN5A 2LYVA 3O5BA 4XDDA 3QT7A 1FRKA 2V34A 5AQSA 1VHIA 3I8DA 1ILYA 2EC2A 4FJNA 3G8TA 4NE9C 5B0FA 4XH4A 2L41A 3SXLA 4AH9A 3DM2B 3I55N 3N6LA 4MO4A 4J37A 3QB0A 3EPGA 4Q8EA 2CNKB 2UXDF 2R2SA 6AT1B 4CLFA 4J2EA 1B70B 2E44A 2H4WB 4TQSA 3G8SA 3G96A 4C1NI 3DM2A 2XYGB 1T3OA 1S9EA 2XM3A 4ID8A 3DI6A 2ZM6F 3T1HJ 2V50A 2KG0A 1VBKA 2A0FB 4LJMA 2FSJA 4B8AB 4EHTA 3OA9A 3CJAA 1OVYA 5EWEA 3HHLD 3I0RB 1XUPO 4KR0B 3E3XA 4DX5A 4URQU 2UUCF 3SPZA 1S4EA 1S1WB 1NPRA 5LT5A 2KXFA 2AZ1A 5AXLA 3DLRA 4FW1A 1NK5A 1X4HA 2XY5A 4R25A 1TAQA 1NGJA 2RQKA 1JLCB 4FWRA 3D7EO 3CJ8A 4LF8J 1BU6O 2HBQB 1RGVA 3R5CA 1V3SA 2IA0A 2HQDA 2GV1A 1X1PA 4DUYJ 4L72B 2GWJA 1Y4ZB 1C1BA 4JRPA 1KCFA 3N01A 3VA0A 1WC5A 3POTA 1ITGA 4A8KA 4CFAA 2KM8B 3I55S 1RT4B 2AGOA 1FXDA 4ZVTB 4CJEA 3HSZA 1FE4A 3OYAA 3TQEA 1QE1B 3C7NA 1FJ7A 3MPVA 2XNRA 1TKZB 4UOGA 4FZYA 5L1JA 4WP3A 3GP9A 4AT1B 3AO2A 4IRCA 1RP5A 4DR5K 4JYAF 4ZVRB 1RLDA 3UWTA 4I7FA 3WX8A 1F9HA 1VLYA 2F40A 4NCAA 1WI6A 3P4IA 2KB2A 1VISA 3OYDA 1GMWA 2EBGA 4FWSA 2BGGA 1FRLA 5JVHQ 3VQSA 3TP2A 1FKOB 4FYWB 3CFPA 1JJHA 1FKPA 2HWIA 3L9ZA 3KLVA 4Z4EA 4FYVB 3UN3A 4GVLA 5AQFA 1AUDA 5KT6A 4JKGA 5DLGA 1NSAA 1NMEB 2IVNA 3QEWA 1OH5A 4UY8O 4DXLA 1EXQA 3HZ6A 2DR5A 5GIOA 1R7IA 2VA2A 4LF9K 3CDEA 2GMLA 3NRBA 3VQEA 3R8EA 3BZCA 4CEOA 2PI4A 1N52B 3J81j 3WUHA 4ZCKA 1LWXA 4MO5A 2KLAA 2OSQA 3ZSWA 1HWLA 1FRXA 2IJRA 3MPWA 4FXDA 3KXDA 3M05A 1JLGA 4CJ5A 4ED7A 3FCVA 4M63C 1CJTB 4H5RA 4YDUC 4M1KA 4CLSA 2EBEA 3PW4A 3J7AP 2BE2B 2CPJA 2P9EA 3C46A 5B0AA 2RILA 2JVOA 4E0DA 1HBNA 4LFCF 3GFXA 4DPOA 2N82B 1RT2A 4MKVA 2YKOA 3V6KA 4N56A 5GAEI 4Q0BA 3KMQA 1V9OA 2MQ8A 4JHDA 3AGKA 4JI0J 2PA8D 2G8VA 4DG1B 4JK9A 2M88A 4WKRA 2VG7B 2VD3A 3W0LA 2DRDA 2VPWB 1HBNB 3HHNB 3OUYB 3OL8A 3CCES 3CETA 5L9XA 3TAMB 2JHEA 5KG3A 2FZGB 1E4GT 1TV6B 1OH7A 4KI6A 4LC9B 2Z1GA 1FDBA 4B3MK 1YX2A 3FDSA 2XS2A 4J5OA 4H4KC 2HFZA 1YJ7A 3R9LA 3H59A 2OANA 4LR8A 2IIHA 1IJFB 3IS9B 2C3OA 2ZUAA 5HAOA 1JX4A 4WTOB 3THWA 3UVJA 3K8WA 5DM7L 4HHUA 2GVDA 2ZH5A 2G1DA 4RCHA 4FPIA 2QWRA 4W5QA 5LMNK 3HM9A 1TAUA 2QXFA 5CR4A 4DQSA 3NEKA 5I4MA 1QHAA 3D6MB 4B02A 3ZETB 4JI7K 2B51A 4KHNA 2R2RA 1EKRA 2OPPA 4C0BA 3CCEN 3ET6B 2ZBRA 3MECB 5KT5A 5KFNA 1JCFA 4CGDA 3KJQB 3DGPA 4NI2B 3K57A 2H5EA 4QWBA 2ASYA 3IM8A 3NP5A 5JS1A 2CGJA 1KVJA 3UNGC 4X62K 4OYOA 5G0RA 2HZAA 1HNVB 5JLFA 5AQRA 1RAEB 2DHAA 4DR1J 4OPJA 2HG4A 4NXMF 1F6TA 4YB1P 3MD1A 3LP2A 1C1CB 3SQ4A 3H4BA 2XMWA 1N8RO 4IR1A 2M5YA 2O67A 2NCKL 3PFOA 4RNNA 1HNZF 1JMTA 2ZE2A 1DHMA 3ZSOA 1SJ3P 1RYRA 2ZBIA 4U6PA 4DTOA 1LFWA 2M7SA 3SQGA 4FXVA 2J0XA 1HBUA 3M8YA 3OY9A 2Y9HA 4DTSA 3UKRB 1ZC6A 1ZBUA 4ZTFA 4A8OA 1KC8T 1NMDA 3RR7A 5D4LA 4ECXA 2HQ3A 2CGLA 3V6DB 1DTQA 1RAGB 2V9WA 4EI2A 3DXKB 1YBTA 3FEZA 2LEBA 2VU5A 5DDPC 1FK9B 1LKZA 1Z1ZA 1OQ6A 2CQ4A 2HNYB 3FCHA 4HDHA 1OY8A 1S1UB 2W9BB 4DTNA 2VONA 3RU0A 1W2BR 2E29A 1WUAA 4LF6J 4CEFA 1FERA 4M5NA 2P5GA 1Y7PA 3ZX2A 3K9JA 5EXWA 5H9FK 2ALYB 4HVJA 2PSZA 3CIPA 4BVOA 4M7XA 4P2XA 3RBDA 3CDBA 2F96A 1XK8A 2O4GA 4CLKA 4K8RA 4ZCLA 1QAIA 4NLGA 1TL7B 3N4PA 4KQZA 2QWPA 4EWTA 4NASA 3VPZA 3T69A 1FD2A 3R1XA 4DR4J 1RK8A 2KT5A 4CNYA 2GQ2A 5RUBA 3CULA 1LWEB 2BJ8A 2NRZA 4WQ4A 2HNDB 1QUVA 3SQ0A 4CZHA 2WOMB 4Y0WA 1V4TA 4PWDA 2I8EA 2KYXA 2PDAA 4DEZA 3BZKA 4M3XA 2DR7A 2WOMA 4EK2A 4RUBA 1Q82O 4M3YA 4WFBQ 3NOGA 5ETOA 1UW9A 2HPUA 4KHYA 5JVGQ 2J6UA 5B8HA 4OHWA 3F5TA 3RSEA 3TVZA 2NS1B 4DUZJ 3GQCA 2N3LA 4I7FB 4TU8A 4MH8A 4JKFA 4HVZA 4MT1A 5G0RB 5EWGA 3CF5L 4LF2A 2R7QA 2P9IB 4TKTA 1RB0A 2QFIA 3T1HF 4RNHA 2D3ZA 2RU3A 3IMXA 1HI0P 3PVXA 1FKOA 2HHUA 3CPEA 4JI6F 3SUNA 3PNIA 2N3OA 2KG1A 1NU4A 2EFOA 5KFTA 3FFIA 1JJ2R 4WFYA 1U1RA 4H4OB 5GADP 1YBUA 2ZUGA 3G6YA 1RT1B 4OI3A 1QY7A 1FJGJ 2CPZA 1YTYA 4X4QA 4MJKA 3TA1A 5AZIA 1XI1A 4ZOSA 4CLZA 4K4YA 1RTHB 4N47A 1VQ8S 4O3OA 2NPIA 3LP3A 1B7YB 2XHCA 2AV5A 3CW2C 4YQWA 3QJJA 3T1YK 3R6GB 4ENOA 1VRQC 3BBFA 2ATQA 3TWZA 2BANB 3R2DJ 5AJ3K 1VQ8N 5LL6Z 3C3LA 1GTEA 4ES3A 4FJGA 4CLTA 1OY9A 4F67A 3HFKA 1YJNS 5BXIA 1PJ5A 3AQPA 3D0IE 3HHDA 1MU2B 2CQ0A 6FD1A 4CK3A 2QL9B 3WNEA 5AQZA 3R97A 2J5AA 1RBVA 2V67A 4MTPA 1BI4A 1I51B 2B4PA 4CF1A 3ELHA 1Q18A 5BREA 2KRRA 2QL5B 5FPNA 2KH9A 1PSDA 5LMNJ 3VQCA 1UOCA 3TYTA 3D2EB 4NYZA 3HVRA 1Q0NA 4DG1A 3MEGA 2QX0A 2ZHOA 5CD4H 2MY8A 3IGNA 4J9PA 2ASPA 1E6YA 4UUWA 3RUBL 3M8QA 3TA2A 2RD5C 2F9JA 4RWWA 4E7IA 4DCOB 2ZNZA 3TNVA 4KHWA 4ECUA 4WK1A 3KIOA 3B6OA 4I6AA 2VIHA 3GV8B 3QFWA 2IIRA 2J9DA 1UVKA 2VBXA 2I7NA 2XO6A 1JXVA 1O8BA 2BRKA 2QV6A 4ZTJA 1T9XA 4F3TA 3D3BJ 2IHR1 3W61A 1O1WA 3GJSB 3KLHA 3M2VA 4PYDA 1LWFB 2O1PA 2EW9A 2ERRA 1IKVB 3OTOF 1EHWA 2OTLN 5EUHA 1KOOA 3SUOA 3SDEB 4LSLA 2X1AA 2J7KA 3DLLL 3ZETA 2MGZB 2KZMA 3AB2B 5D0GA 1HI8A 1HBOA 3LWMA 1Z2ZA 3ETOA 3GIJA 1NPKA 2DK2A 3D2FB 2RQ4A 1L3TA 3LDSA 4AHSA 1N32F 4CHPA 2JEFA 4X2BA 3C15B 1IV0A 4YB5A 4ISFA 2MLZA 1A7GE 9ATCB 3Q8VA 3J81Y 2HRUA 2HBMA 2CH5A 4V19J 4XTTA 1HKAA 2CFXA 2E2NA 4OQJA 1LV5A 1F2GA 1WWHA 3D2EA 3LDPA 2PE8A 2Q0UA 2AWZA 1BCMA 4Y00A 2LXUA 2HMIA 2PBDA 1K47A 3FQLA 3SCIE 5IM0B 4M5DB 1FEEA 3L2UA 1X0FA 4IOXA 4CTAA 2FJVA 2J9CA 3Q8UA 3IGVA 1UWBB 1JK9B 1BCOA 1TUUA 1SL2A 5DGAA 4BR7A 5GAGI 3OTOK 2W7OA 1YGYA 2ZZTA 2MZJA 3IKMA 1QTNB 3I9V9 3OTDA 2EXUA 2RS2A 3L4BC 2KL8A 1S1TB 2P9UB 2LXIA 1S1UA 1W0HA 4FCYA 1SC3B 2APOA 4TYBA 1BISA 5J2PB 1NZ8A 4RR5A 2WVBA 2YKAA 2Q2RA 3TWHA 2PY5A 3AVAA 4CNZA 1FRHA 4MIAA 5BJRA 1TUGB 2P9KA 1BO5O 4HTIA 5ADZA 4JI2F 4F0HA 2C2OB 2QXLA 4DV4J 4PZVA 3TO8A 1RTIA 1VDHA 1B92A 3N79A 1WUUA 4J9MA 3HVWA 1RT5A 1NG9A 3MEDA 4DV4K 4GRSA 3THXA 1N54B 3ENWA 2YPZA 2DB1A 3UFCX 2X6NA 4KB1A 3SQ1A 3WZ0A 3IN5A 5FLXY 5HQLA 1HNVA 1U0HA 1BOTO 2ZH1A 1WKLA 2CPIA 4M5MA 2YNIB 1NXIA 3R8YA 1TVRB 2GCFA 1RT7B 2Y0BB 2B7BB 3NCIA 2J0QD 3ZLJA 3A5MC 2VGNA 5CYMB 4DQIA 5KPTA 1PIEA 4CJTA 3DU5A 3LA0A 5IXUA 5ETKA 5C10A 3MF5A 3AA3A 5DMRA 4GC6A 1NM1A 5FJ4A 3QBCA 1Q95G 2NPFA 4DU7A 2BABA 3TA0A 1NDCA 3R3TA 2COLA 3C14A 1GLFO 1WHYA 4L76A 2GBZA 3I56N 1FJGF 4H5VA 5A6WA 4CCHA 4CEQA 1M90O 3RBXA 4BC9A 2MKSA 1S5ZA 1JLEA 1SL1A 1A5WA 4ERDA 5AE3A 3Q86A 2XRIA 4KE5A 4O0NA 1M5KC 4BRAA 2VDHA 4IDHA 3FGUA 2J9EA 3KHHA 4L6V3 5JUMA 3AFGA 2CQGA 1GMUA 4Q8FA 1S49A 4PL7A 3HL8A 3CUNA 4JKAA 1Y0HA 2Z2ZA 4Q43A 1IKYA 1LQ9A 1CJVB 4P2FA 1R0CB 2W41A 1VCTA 3EXCX 2HVDA 3CD7A 3VQBA 4ZVPB 1UA0A 3T1HK 4KRWA 4JI6J 1VQPN 1X4EA 3CCLN 2P2CB 2W24A 2V6AA 4BE1A 3T7ZA 4ZVFA 1RI7A 2IPOB 1FW6A 1WSIA 4LF4F 4ZLLA 3U3YA 4BG9A 3DCAA 2EHGA 1MWMA 1V3ZA 3PR5B 2UUAJ 2DNYA 2IVOA 3L95X 4WP8A 3IR7B 4OZ5A 3H0PA 4DV6F 3BSCA 3QT5A 1HQEA 3AXKA 3TANA 1KQGB 3VQDA 1UJ5A 2HVIA 2AYMA 3AO1A 3IAYA 3V9SA 4OLOA 4Q45A 3G71S 5F0WA 4DFMA 3W3SA 1S76D 2VPYB 3FR0A 3J7YU 2YKQA 5CYMA 1VSMA 3BBCA 2CG4A 1YJWS 4NLYA 4DV5K 2O5DA 5LJ3Y 2WTFA 4RU2A 4Y0FA 2K06A 1CULA 4CD1A 3DLKB 4DR2F 5HVHA 2MKKA 4WFAQ 1VBZA 2UUWA 2VFSA 3BREA 1Q4RA 4ED4A 4M3RA 1GOCA 5IWAF 4U67Q 1XERA 1N34K 3H20A 1CBKA 1E6YB 3KTQA 3TSPA 3LDQA 2VG5B 2AD9A 3UVJB 1ATSA 5BRHA 1RAJA 3EGNA 1IBLF 4BRFA 4DSLA 1IM4A 2POKA 1XR6A 4K4WA 3WXMB 4PUOB 1VQNS 1TKDA 3AHPA 3VQ6A 4DMNA 4P10A 4ZIVA 3CC2N 2XHWA 2AT1B 3JAMO 4OX6A 4CH1A 1RBRA 5BR8K 4NPOA 1RU2A 3W2WA 1EP4B 3EXYA 1OH8A 1JLFB 3OL6A 2ZOGA 4LF6K 5B0DA 3DHWC 5JXSA 2BZ2A 4JI7J 3DJCA 1CQMA 3CC2S 2KT2A 3GFHA 3MN6A 2B0GA 4CZLA 4UQTA 3DOKB 3Q23A 4IH5A 3TUPA 1FO1A 2K7KA 2A6AA 2WSEC 4UF4A 1U25A 1IQZA 3UCGA 4TLRA 3Q83A 3MUTP 1VSFA 3H5UA 4ILJA 1FKAF 3IFEA 2MTLA 3AAQA 2LSNA 3UN5A 3NS7B 3LPTA 5KFLA 3MX5A 3DHXA 3OXGA 4LF5F 1X9MA 4IUFA 2GJIA 3FRZA 2NUUG 1PILA 2CZ4A 1KVBA 1OKJA 3E8OA 1NLKL 4NYFA 1KC8O 1WD6A 4CQ1A 4KB0A 3CERA 4K2JA 3CE8A 5AFUH 1MMLA 3MMAB 3W2VA 3CD5A 1XMOK 4OJHA 4RPFA 5KFIA 2P9NA 2PC6A 3TZWA 1X31C 3SYZA 4AL7A 1FTRA 3IDHA 3EE8A 5F9NA 1TL4A 2VG6B 3IUCA 3F2KA 3KK7A 4NLQA 4CHZA 4IZ9A 5KFBA 2LU1A 1IH7A 2P9CA 1EQMA 2J0WA 3BDPA 4CM0A 4FJ9A 3KJFB 1XHZA 2F65A 3CD6N 2NXEA 4M5HA 5K20B 2LDIA 1I5OB 3D0HE 1ASWA 2IRYA 2EFQA 3SJJA 3MD3A 1T9YA 3I0SB 2UXBJ 3V6HA 2B4VA 4A61A 2FLLA 2Y1JA 3CQ8A 2UU9K 2HRYA 3Q7CA 1E6VB 3PX0A 5JMVA 2EVZA 3MK6A 1Y00A 3AVBA 2ILZA 4IFEA 5C25A 3QBWA 4B9TA 1XQIA 4A47A 3HOSA 1BQXA 4A8SA 1FD8A 3H25A 2O4IA 1R0AB 4IOAL 2CDQA 5KFPA 2DGQA 2DGVA 4JKHA 3CCWA 2W9CA 3ILIA 2XLIA 1ZPWX 1HKGA 3AARA 3LPEA 1Q8BA 3SFGA 1NCLA 3PRVA 1P6TA 3DOMB 2E5IA 4CO1A 2PEBA 1JLAB 2MQPA 3E01A 4KREA 1AXQA 4JHDB 4NWBA 1WSRA 2A6MA 1WOSA 2ABYA 3CJRA 2Q97A 3VGMA 2XLKA 3LP0A 1Y11A 5I3UB 3W66A 4A62A 4D3HA 2IBKA 2UUAF 3G87A 4ES1A 2JC1A 4M8LA 3S41A 2VOPA 4PKGA 3C14B 1A0OB 2KT3A 5B7WA 3BS9A 1HNWF 3SCXA 3K17A 3K5PA 1OMSA 2ZBPA 5AQOA 1SIWB 1U8SA 5JS2A 1IVZA 2YX6A 1IG9A 2QWQA 1ITPA 2RB7A 4KHRA 1WHVA 2UU9J 4FYXB 3Q7BA 3F44A 1KS2A 5C42B 2NRXA 1WF1A 3ZT1A 2ALZA 5CE3A 4PKIA 1R27B 1YRTA 1XBWA 2JZ5A 3AVHA 4GVBA 4YOVA 5AFUA 2PZSA 2I38A 1JLBB 2FJWA 5L39A 4FLVA 3OL7A 4K4TA 1WJ9A 2CQ1A 2DD8S 3QDKA 4ZHRA 5G4DA 5CD4A 4QWEA 3I56S 2NYHA 2YTCA 3M9OB 5E41A 1PBAA 3ZEUA 2RE2A 1TK5A 5AQMA 3A8KA 4A59A 3V81A 3U27A 2E2PA 2QI2A 5EDWA 3CGIA 2M8HA 2IM2A 3T9ZA 2RHKA 2OIHA 2NR0A 4J9QA 2W2OP 3VGSA 1DQ8A 3V81B 3U8XA 2GJFA 4C98A 3BQ2A 1NBWA 3VF2A 4LBPA 4NLOA 3MZIA 2HHPA 3G82A 3A8YA 1XR7A 3NDKA 5D6GA 1N8RT 5M1NA 4YNQA 3NCQA 5I3UA 5D77A 4DX7A 4ZVGA 3H5YA 3NFAA 1X0PA 2KFYA 3KYLA 2QK9A 3H98A 4RO0A 4JNEA 1VQSA 2HFUA 3ENVA 1URRA 3VQ5A 3LANA 2XY7A 3HHLA 4B9SA 3LWLA 4ATNA 4BS2A 4CLWA 3DNCA 3O2IA 3PW2A 2HGMA 3PO4A 1M5SA 3H7HB 4BWJA 5E5NA 2R7OA 1KP6A 4CEBA 1ACMB 3ZZRA 2AX0A 1WSEA 1WSJA 3EKSA 1LW2B 1UVMA 2YNHB 4FVUA 1NGGA 1M5VC 3GJTB 3JQJA 4P6QA 4YY3J 4QJVA 4NMXA 3HSCA 4CJVA 2LA6A 3HD2A 3M30A 2HVEA 3AAWB 4X4SA 4CI6A 4I67A 3TZZA 4FLYA 1U1MA 1BQNB 2MZSA 2LDYA 4C1NK 5CABA 2QLWA 3D68A 2U1AA 5KG6A 4X4PA 2FHJD 4OV6A 5C5JA 2ZJPQ 3EYZA 2E1CA 1CJKA 4B1XB 3ZZTA 3BYPA 1WG5A 1HBOB 5B09A 5AQQA 4DR1K 1BWFO 1D1UA 3SNNA 2DNQA 1JLGB 2JFDA 5FROA 2IRUA 3V1QA 5HI7A 2ZH2A 3CD6S 4DFKA 3O80A 4GV9A 4N5SA 3W8PA 4B9VA 1Z25A 4KI4A 2XC9A 2MYFA 4E7LA 4HACA 3W9HA 1RDCA 2E1ZA 4CO2A 1IBMK 3BGFA 3L0QA 1S1VA 3MOZA 4MLHA 4JB8B 2IVFB 4DS4A 3ATVA 3BF3A 4LQ3A 4K8XA 2HBRB 4BC5A 5AXNA 5IT9O 2F8SA 4AQYJ 4ECRA 1UEVA 1Y3JA 4H54A 2DXEA 3I4HX 5DQIA 3NNAA 1T9VA 3ZT0A 3DLGA 1W2BM 2M3DA 1DEJA 1PYSB 3M6UA 4M95A 3K9KA 3VAMA 4QAGA 4DFPA 1SV5B 3TOQA 3VMFB 1SQFA 1N32J 3LL3A 4RWTA 2HFVA 2W4PA 4X64K 1AA1B 2JDJA 2WZ1A 4W5NA 4CEAA 1DLOB 2DNZA 3C94A 2FUG9 4ELTA 2XMKA 3T1YJ 1QVGR 4IH7A 4IFVB 4J9LA 3NAEA 2VWBA 3OW2M 1GLAG 1XEZA 2ZD1B 3PRBA 3G4SS 4RL1A 3KLEB 4WXOA 3PV8A 5D0RA 2QL7B 1IQTA 3FGVA 2DR8A 4FPRA 4CBXA 4M42A 2GQQA 5JVHL 1DT9A 1FNOA 5M2RA 1Z05A 1OSDA 2V69A 2BJ9A 2QWMA 4CF9A 4YOUA 2V4JB 1B9FA 2JOQA 2VUGA 3M7VA 1DFDA 1CJUA 4WYLA 3PW5A 3A8EA 2VC0A 1H0HB 1SIZA 3OLAA 3DLEA 3ZZZA 5HL7Q 2HGLA 4ANDA 2NNWA 4DTJA 3UD5A 2HHXA 2CGKA 2FJEB 2G8HA 2HRTA 3QIPB 4UW2A 4Y3CA 4PG8A 2MQOA 1F0XA 3J80U 1NEEA 2P9SB 1R89A 4DU3A 2X7IA 4ZCIA 3O4WA 1EQ0A 4YOXA 3MEEB 2J9DE 3OYLA 2DKOB 4BR5A 2BQUA 2YKNB 1KVAA 4BE0A 5KQ8A 4DTRA 3ENBA 1VBYA 3GILA 1S4FA 5AQYA 2NZTA 2UXCJ 4KY3A 4OYBA 1ZYQA 3CM6A 2CAJA 3HOTA 1EJ7L 4X4OA 2RPIA 5M1QA 2HFOA 3QT6A 4MMOA 4Q2MA 2VOOA 3Q8RB 2RNEA 4AM7A 1N5TA 2AIRB 2DRAA 1ATRA 1L3KA 1DLOA 1ZBHA 1GLJO 3CJTA 5AQJA 4TSXA 3O1BA 2R8HA 4QCLA 2FVPA 3R5BA 4DV3J 2XGQA 3Q89A 2P8IA 2PYLA 3DU6A 2VKRA 3HVAA 1YJWN 2IMOA 2D9OA 4A46A 4YOTA 4ZP7A 3CCTA 1LEOA 4NYOA 2D3O1 3UD3P 4EP4A 3M2VB 4LR7A 2FGCA 2BJDA 5U47A 3ZCMA 3ULDA 4LVOP 2XLJA 1G2EA 1F21A 3NNCA 3CCRN 1Y5NB 4RUHA 4O5FA 4IO9Q 5CQGA 2QLXA 3CCLS 1RLCL 1SKUB 5C7PA 3H1VX 2R7UA 2R8GA 2HHVA 3X3UA 2YQ3A 3GE9A 2ZQBA 4IEEA 3KFWX 2QTWA 4EZ6A 1ELOA 4JS5A 4JI6K 1JL2A 2CNNB 3QYYA 1IBLK 5EVZA 1UPMB 1MN9A 5C42A 5F3ZA 1MU2A 2J8AA 5BRFA 3NLCA 2C1EB 1XIQA 3PYGA 1QHTA 4DZDA 3LP0B 3TJ9A 4CT8A 5GAEU 4FJ5A 2KFZA 2BYCA 2EFVA 3I32A 4HUEA 1EX4A 4Z0UA 3W5YA 1NK6A 2IA6A 3PHTA 3MGJA 2CJKA 4PG6A 4CHOA 1HNXK 1BE4A 2V52B 3O1WA 3L3CA 4QIVA 4PEOA 4M3WA 4WF9L 4IG3A 2P9SA 3OR2B 3SSSA 3I4PA 4UZCA 2I5JB 3OTBA 2E66A 3OS2A 5D4NA 1OJ4A 4XAKA 2DPNA 3DC2A 4DI6A 5HJXA 4FNHA 2JNJA 2DFEA 3AO3A 2QA4N 1NGBA 5E3RA 2RU9A 1M1HA 4QYRA 1YI2S 1HMVB 3OSNA 4DR6K 1YVUA 5HJYA 2NRTA 2NUBA 4A8QA 2WW8A 4HL9A 4LRBA 4GV6A 4LFAK 3VZHA 3U9ZA 2AHOB 2I9SA 2FYXA 1JWWA 4H4OA 4KTZA 1S6QA 5EX0A 4TLQA 1C0MA 4BRPA 4DR7K 2CA9A 2HNYA 1S6PB 3MDFA 2E20A 3CIMA 3UE2A 4OZ2A 1T11A 3CFRA 4KGKA 1H6KX 4K0KJ 5KQDA 3OQ2A 4JI5J 3OYNA 1O0PA 3GZ7A 2A1RA 1LCUA 2UUBK 1UVNA 4GVMA 1VQKN 3RZAA 3T6JA 4WBFA 5LOQA 1BMQB 2LP4A 3O3HA 1IBKF 3VN5A 3BYRA 1ESVA 4CW7B 1REVB 2KFNA 3QZ8A 4BR0A 2V9KA 2DPJA 1GLEG 5GAGP 4BDYA 5CXTA 3LH2S 3V4IA 4HKQA 4AHUA 2A6OA 3ISND 3DMJA 4ANCA 2IM3A 4E19A 1AFIA 1VHFA 5CZXA 3UR0A 4QR0A 1U6ZA 3NH1A 1OO0B 1IKWA 3CC7N 1U09A 5FD1A 4JV5F 2BJ3A 3CMES 2CRLA 4BWMA 2R8KA 3TZYA 3M2RA 3MPDA 3MDQA 1RTZA 5IM0A 2OEKA 1S6UA 4C97A 4OLAA 3W65A 3MMBA 4DR1F 4Q44A 3EGWB 2VHGA 2JEIA 1Y97A 2IDOA 4QW9A 5KFUA 3HPHA 5FPEA 3F56A 2Q0RA 5HROB 3P38A 2AYEA 2NRRA 1MN7A 4KFBA 3QFPA 1RT6B 3KJNB 3MM6B 1UAWA 3D5MA 3FEXB 1R8AA 3QERA 3ENQA 1QE1A 1C1AA 3VF0B 4Z4HA 3VV2B 2KHCA 1N4LA 1UCNA 3FSYA 4WWSA 1UEKA 4OYWA 2QGFB 3SMZA 2OA8A 4E98A 5EN1A 2XG8A 5BYSA 2W42A 3EVOA 2W01A 1Y9OA 3PIPQ 2BE2A 4FF1A 3AVNA 5KFJA 4BGBA 3OYMA 5D3GA 1JLAA 4NLDA 1IWAA 1NGEA 2EEYA 1MWZA 3D4JA 4CZEA 4RBTA 3W7BA 4URSA 1U04A 1K9MO 1EP4A 1HKCA 2ASJA 4LFBF 3QGGA 4IOCL 4J9NA 4ZPBA 3RBZA 1ROFA 4WK3A 4CJKA 2V7YA 3CPWR 4TU7A 4ILGB 2W8LA 3K0JA 3M8ZA 4JV2A 4XK8C 1AT1B 1XWLA 1HLWA 3U1MA 4EYHB 1TELA 3CMQA 1WBDA 2NYIA 1N36J 1WACA 1X5SA 5L8RC 5KGWA 1SI9A 3N6NA 3S01A 3GSIA 1QAYA 3O6WA 1LXNA 2IVMA 3WQTA 2C3PA 4CP5A 1U49A 2ZITA 1R0BG 2ROPA 4CJQA 3H1QA 3W5ZA 5BR8J 4USKA 4K41A 2HURA 3CJ3A 1N0UA 3AD7C 3G6ES 5KGXA 1VQOS 2K1RB 4QZVB 4KHQA 4Y2CA 4OO1J 2KJVA 3M9NB 1ICEB 1GNKA 2IRXA 4ED5A 2C2ZB 1NWKA 3AA4A 1JLQB 3JTOA 4WFBL 1FRIA 2PAVA 4OZ1A 5HMYA 5ETRA 2DIUA 5EGYA 1GMWD 3KVGA 4RNMA 1G3OA 1ZTWA 4FKXA 2FPHX 4D3GA 2DFFA 3AVJA 5LJWA 1OS5A 1VC5A 3M5RA 5J2PA 2AEJA 2OHDA 4OX7A 4JI8K 4DV5J 2HNZA 3FK4A 3E2EA 1TK0A 1UJ6A 4KH1B 4LVNP 4O55A 4DCHA 4BLGA 2E9ZA 4YOEA 2NRVA 3BBBA 4AXIA 2W7AA 4JYAJ 1IBMJ 3I87A 4J9OA 5AQIA 3D54A 5A8WA 1DQAA 2HW3A 3VGKA 2Y8YA 2EG1A 2AZ3A 2HQFA 4NLCA 3SSRA 5AJ3F 1XQSC 3MMCA 3HPOA 1OSCA 3BM7A 3JB9k 3QNNA 2ZGZA 4B1YB 3KJVA 1N6QB 2WC9A 2HHHF 5FLXU 4JI5F 1ZAXA 2CJYB 5T7LB 2V4JA 3CCJS 3CC4N 3OUYA 5H9EJ 4X66K 5BPNA 4FF2A 3NGSA 2D69A 5E3QA 5EU7A 1M0SA 1S12A 5M1KA 3LF0A 5LJVA 3LGNA 4CGFA 1GXUA 1W7WA 3CC4S 4ZP9A 3DRRB 2VZ9A 2DGTA 3O9SA 4QOTA 3NGUA 1D9DA 1V3RA 2CQBA 3TUIC 3FMBA 3WIVA 2HBJA 1VQ6N 3FZLA 4KT0C 4B1VA 3TPQA 3V9ZA 3OYFA 7FDRA 2ASDA 4X66J 2H5JB 4P2MA 3OBYA 1K8AO 1DKGD 3V1OA 1OVQA 4I6WA 1G1XA 3NWGA 5FIIA 2BACA 3PM9A 4ECZA 3MR6A 1TFWA 2WAQD 1SJQA 3BP8A 4RJVA 3UDLA 1CULB 4FF3A 4BACA 2Q1NA 3KK3B 3DLLQ 1R8BA 4I2PB 3A3PB 4CD3A 4RW6B 3MWTA 5H1SV 3G71N 3QO9A 4USHA 3RTVA 2A2CA 4N7TA 5SZTA 5C2DA 4YHHK 2J4RA 3GYGA 4DTXA 4WFAL 5GVQA 3TTCA 3KOAA 5BN8A 4CJFA 4DWIA 4ZJOA 6FDRA 1VQ5N 4F4ZA 4FSVA 3LTOA 4F04B 2GAGC 4R79A 3P5TL 1WOOA 4JV0A 5HK4A 1HQUB 4DV2J 4LSNB 3NL0A 1D8YA 3H3NO 3V9WA 2SXLA 5KFXA 4A57A 1RHQB 2AJ4A 1N34F 5IWAK 3GLJA 4FS2A 2WCXA 3JQKA 3DXMA 5IS2A 1CXQA 3MN7A 2CJBA 1CPZA 4FJ8A 4IXCA 4U8YA 3OFEA 1UVLA 1WSGA 3BQ0A 4RTFD 3QMLA 1J5EF 2WW4A 3TAQA 2ZC4A 5AQUA 2HMIB 4EFAC 2HHWA 3HK2A 3OYGA 1RWKB 5DGBA 3I0RA 1RWMB 5HRRA 3U1NA 1AW0A 1DGKN 3M8PA 2C22A 1EAYC 2ZJRL 4DSKA 1Z4UA 2RQCA 4WF9Q 1S0NA 4FM0A 4ED6A 4J9RA 4K8ZA 1PO6A 5F8JA 1F1BB 1ZXOA 3UD4P 2Y1IA 1HARA 2HK3A 3VAJA 3OXLA 2FC8A 4CT9A 4F0MA 4R5PB 5MAOA 3GFYA 1FWPA 1TL5A 3GYNA 1VSJA 3QIPA 2F3JA 4KO0A 4CJ7A 3T5LA 3KLEA 2NXNA 1K73T 1RKIA 2X3DA 3CJSA 2R2TA 1VK8A 3BEXA 1VIXA 1HWIA 1YRXA 4FF4A 1XMOJ 1P27B 2P6SA 1VIOA 3S1TA 2DTJA 1FCAA 4A2AA 5LY3A 2WVDA 3CCUS 2DH9A 4EGLA 4KGMA 3SQGB 5A2QO 2G13A 1V4SA 5DDOC 4H4KA 1J6ZA 3RBEA 1ZZNA 3MURP 2ZNYA 4K4ZA 4ED1A 4BG8A 1J5OA 2RN2A 3LDNA 1RUSA 1RWUA 2W2NP 4ED8A 2F4FA 4DV1K 3DLKA 1NGCA 1RHMB 4JLHA 1DTTB 5D4PA 3G25A 2MQMA 3UO0A 3HM8A 4OKEA 3OTEA 4PG5A 2NRWA 3ULHA 2Q36A 5H1SQ 1FX4A 3N5FA 4ECTA 2DNPA 1XNQJ 2CJAA 4LF5K 4JI0F 3ILOA 1X4CA 1H2VZ 3CO0P 2QEXS 4OPKA 2FVRA 3P3DA 3UNYA 1JXLA 4JP8A 5CCLA 1N5SA 1WC4A 5EHHA 4FO0A 3CVKA 3C7NB 2ZH7A 3KUEA 4EP5A 4UOFA 2E7XA 1M1KT 4DV7K 4HT5A 4R5PA 4YB6A 3CCQN 1R8PA 2G2YA 2QMUB 3LAKA 2E5JA 1ZOTA 4AL5A 2OELA 4B9UA 2CIMA 2YNFB 2FQQB 5DS7A 2FY8A 1HMVA 3CXCM 4NEZA 1WOPA 3R6MA 2CWXA 5HSPA 2HHSA 4M5DA 1LW2A 4F02A 5ADXH 2RUSA 3ADAC 3DXMB 4B3TK 5JMNA 5T41A 4G1IA 2VYPA 2DGWA 2QKBA 2AGQA 4MK9A 1MDUB 4OHVA 2FZCB 3FKBA 2Q3SA 2OO4A 3SCJE 3P8BB