1TVIA

Solution structure of tm1509 from thermotoga maritima: vt1, a nesgc target protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
150
structure length
150
Chain Sequence
MIRILGEGKGSKLLENLKEKLEEIVKKEIGDVHVNVILVSEDEIKELNQQFRGQDRPTDVLTFPLMEEDVYGEIYVCPLIVEENAREFNNTFEKELLEVVIHGILHLAGYDHEFEDKNSKEMFEKQKKYVEEVWGEWRSNPSEDSDPGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of Thermotoga maritima protein TM1509 reveals a Zn-metalloprotease-like tertiary structure.
pubmed doi rcsb
molecule keywords Hypothetical UPF0054 protein TM1509
molecule tags Structural genomics, unknown function
source organism Thermotoga maritima
total genus 27
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02130 UPF0054 Uncharacterized protein family UPF0054
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.30 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Metalloproteases ("zincins"), catalytic domain 1tviA00
1OZ9A 1XM5A 1XAXA 1TVIA
chains in the Genus database with same CATH superfamily
3HY7A 4AXQA 1XFWA 3P24A 3CKIA 2YIGA 1PWUA 3TT4A 2JNPA 1OZ9A 1EB6A 3HBVP 2AIGP 2JT6A 4I35A 1QJJA 2JSDA 4L6TA 3TSKA 3KEKA 2OW2A 3HDAP 3OHLA 4AYKA 2JIHA 2JT5A 3DNGA 1XFZA 3KECA 1S4BP 1J7NA 1XFUA 1IABA 3P1VA 3HYGA 4XCTA 1JIWP 1BKCI 1IAGA 3LEAA 2D1OA 4DV8A 1Q3AA 4GR8A 4HX3A 1OO9A 3KMCA 2O36A 4L7AA 5I0LA 1OMJA 1XUCA 4CTHA 2WOAA 1PWWA 3EHYA 1EUBA 2K9CA 1UMTA 1C8TA 2OI0A 4PKWA 2V4BA 3ELMA 3DL1A 1CXVA 1BKCA 2OW0A 3LJTA 4ON1A 2OW1A 1ATLA 3EHXA 3LJGA 4Q1LA 3RTSA 4H82A 1FLSA 4H3XA 2WO9A 2X3AA 2I47A 4FXQA 3HY9A 3LE9A 4PKUA 2D1NA 1G49A 2OXUA 1R1IA 1ASTA 3EWJA 4JQGA 1QIAA 3WV2A 3KMEA 1OS9A 1OM6A 3O2XA 1G05A 1XM5A 1GKDA 1XFVA 4XM7A 1Y0VA 3DPEA 2HU6A 1ZS0A 1YP1A 2OVZA 1SU3A 1EAKA 3VTGA 4IUWA 4ILWD 1R1JA 5I3MA 4WK7A 3AYUA 3HDBA 1KUHA 1I76A 1UMSA 4J4MA 1ROSA 1B8YA 3USNA 1R54A 4GR0A 2DDFA 4GF1A 1DTHA 2OZRA 3UVCA 3KHIA 1B3DA 4JP4A 4WKEA 1KUKA 3I7IA 4XBHA 1IACA 2J83A 3F18A 3U1RA 1CQRA 1XURA 4GWNA 1MMQA 1BQQM 4ZR5A 1O0QA 1K7IA 3F15A 2AYKA 1XAXA 3LGPA 3SHIA 1R1HA 3DTIA 2Y6DA 4PKTA 2L0RA 1CGFA 5H8XA 1CIZA 2QPJA 2W12A 1BIWA 2MZEA 1UTTA 3DWBA 2SRTA 3VI1A 1SLNA 5CXAA 2E3XA 2FV5A 1G12A 3LIRA 1GO7P 1HTDA 4GUYA 2WO8A 1BM6A 1K7GA 1FBLA 2W0DA 2YUFA 5L7FA 3K7NA 2OY2A 2E2DA 830CA 2ERQA 5CZMA 2EROA 5I12A 1OM8A 5D3CA 5I43A 4DD8A 5D1TA 1JK3A 3GBOA 5D2BA 3LQ0A 1KAPP 1XFYA 3EDGA 2MLRA 3LMCA 3LILA 1WNIA 3G5CA 4AIGA 1G4KA 2XS3A 2RJQA 1MMPA 4PKQA 5D1SA 1JANA 1A85A 3N2VA 1DMTA 5BOYA 3L0VA 3TVCA 5B5OA 1ZXVA 1OS2A 1D7XA 1BSWA 3ZVSA 1QUAA 2J0TA 3TS4A 2OXWA 1AYKA 1ZP5A 2ERPA 4WKIA 3OHOA 2DDYA 4FVLA 3EDZA 1FM1A 4H30A 2X3BA 1KUFA 1ZVXA 1YOUA 3V96B 2DW0A 4JPAA 3Q2GA 4G0DA 1CGLA 3EDHA 2K2GA 1Y8JA 2OXZA 1I1IP 2MZIA 3DPFA 1XFXA 3DTKA 3I7GA 1C3IA 4FU4A 3DTEA 4IJOA 4PKSA 1PWPA 3LIKA 4L19A 1AKLA 3LKAA 4AUOA 1JKYA 3AYKA 3K7LA 2W13A 1BUDA 2Y6CA 3BA0A 1I73A 2X3CA 4FXYP 1MMBA 2PJTA 1ZTQA 1SMPA 1PWQA 3B92A 4WF6A 3ZUKA 1MNCA 3KRYA 1O0TA 1QIBA 3MA2A 1KUIA 3DSLA 1L6JA 1MMRA 4GR3A 1Z3JA 2OY4A 1G9KA 2O3EA 4QKZA 3N2UA 1UTZA 1GXDA 1QICA 4G9LA 2OVXA 1SRPA 2N8RA 4EFSA 4DF9A 1JJ9A 2MLSA 1PWVA 1AF0A 1XUDA 5CUHA 4HMAA 5D1UA 1YCMA 2W14A 1IAEA 1H71P 1BZSA 1JH1A 2FV9A 4JIJA 1JAQA 4PKRA 1GE6A 3F1AA 1R55A 1RMZA 5D7WA 5LABA 1OM7A 3F17A 3WV3A 1KBCA 3F16A 3RTTA 1JAOA 2KRJA 1C7KA 1HFSA 1HOVA 1GE7A 1CK7A 1D8MA 1SATA 3AIGA 3HBUP 2DW2A 1HV5A 3LUNA 1BQOA 2DW1A 1K7QA 1TVIA 4GQLA 1YQYA 3HB2P 5B5PA 2W15A 5JMYA 2XS4A 3LJZA 1GE5A 4XM8A 1HFCA 2A8HA 3LK8A 4L63A 4XM6A 1HY7A 4H84A 966CA 2RJPA 3G42A 2Z2DA 4R3VA 3KWVC 1UEAA 2MZHA 2TCLA 3B2ZA 1CAQA 1GKCA 2OW9A 4DPEA 4H2EA 2USNA 5BPAA 3Q2HA 3KEJA 4GWMA 3O64A 4H1QA 4JA1A 4A3WA 1IADA 1USNA 3ZXHA 4I03A 3F19A 2YB9A 456CA 1ZXCA 4IN9A 1BUVM 1Y93A 5I2ZA 1D5JA 3B8ZA 1A86A 4H76A 1GO8P 3LUMA 1RM8A 3EDIA 4H49A 4WZVA 2CLTA 1JIZA 1ND1A 4A7BA 1CGEA 3NX7A 3LQBA 3L0TA 3WV1A 1QJIA 1JAPA 3E8RA 2POJA 2CKIA 4PKVA 2X7MA 1SLMA 1D8FA 5L79A 5BOTA 5I4OA 1KUGA 1BKCE 1IAAA
chains in the Genus database with same CATH topology
4QHFA 2YPTA 3CQBA 1XAXA 1OZ9A 4JIUA 4AW6A 4IL3A 1TVIA 1XM5A 4JIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZ9 A;  1XM5 A;  1XAX A;  1TVI A; 
#chains in the Genus database with same CATH topology
 3HY7 A;  4AXQ A;  1XFW A;  3P24 A;  3CKI A;  2YIG A;  1PWU A;  3TT4 A;  2JNP A;  1OZ9 A;  1EB6 A;  3HBV P;  2AIG P;  2JT6 A;  4I35 A;  1QJJ A;  2JSD A;  4L6T A;  3TSK A;  3KEK A;  2OW2 A;  3HDA P;  3OHL A;  4AYK A;  2JIH A;  2JT5 A;  3DNG A;  1XFZ A;  3KEC A;  1S4B P;  1J7N A;  1XFU A;  1IAB A;  3P1V A;  3HYG A;  4XCT A;  1JIW P;  1BKC I;  1IAG A;  3LEA A;  2D1O A;  4DV8 A;  1Q3A A;  4GR8 A;  4HX3 A;  1OO9 A;  3KMC A;  2O36 A;  4L7A A;  5I0L A;  1OMJ A;  1XUC A;  4CTH A;  2WOA A;  1PWW A;  3EHY A;  1EUB A;  2K9C A;  1UMT A;  1C8T A;  2OI0 A;  4PKW A;  2V4B A;  3ELM A;  3DL1 A;  1CXV A;  1BKC A;  2OW0 A;  3LJT A;  4ON1 A;  2OW1 A;  1ATL A;  3EHX A;  3LJG A;  4Q1L A;  3RTS A;  4H82 A;  1FLS A;  4H3X A;  2WO9 A;  2X3A A;  2I47 A;  4FXQ A;  3HY9 A;  3LE9 A;  4PKU A;  2D1N A;  1G49 A;  2OXU A;  1R1I A;  1AST A;  3EWJ A;  4JQG A;  1QIA A;  3WV2 A;  3KME A;  1OS9 A;  1OM6 A;  3O2X A;  1G05 A;  1XM5 A;  1GKD A;  1XFV A;  4XM7 A;  1Y0V A;  3DPE A;  2HU6 A;  1ZS0 A;  1YP1 A;  2OVZ A;  1SU3 A;  1EAK A;  3VTG A;  4IUW A;  4ILW D;  1R1J A;  5I3M A;  4WK7 A;  3AYU A;  3HDB A;  1KUH A;  1I76 A;  1UMS A;  4J4M A;  1ROS A;  1B8Y A;  3USN A;  1R54 A;  4GR0 A;  2DDF A;  4GF1 A;  1DTH A;  2OZR A;  3UVC A;  3KHI A;  1B3D A;  4JP4 A;  4WKE A;  1KUK A;  3I7I A;  4XBH A;  1IAC A;  2J83 A;  3F18 A;  3U1R A;  1CQR A;  1XUR A;  4GWN A;  1MMQ A;  1BQQ M;  4ZR5 A;  1O0Q A;  1K7I A;  3F15 A;  2AYK A;  1XAX A;  3LGP A;  3SHI A;  1R1H A;  3DTI A;  2Y6D A;  4PKT A;  2L0R A;  1CGF A;  5H8X A;  1CIZ A;  2QPJ A;  2W12 A;  1BIW A;  2MZE A;  1UTT A;  3DWB A;  2SRT A;  3VI1 A;  1SLN A;  5CXA A;  2E3X A;  2FV5 A;  1G12 A;  3LIR A;  1GO7 P;  1HTD A;  4GUY A;  2WO8 A;  1BM6 A;  1K7G A;  1FBL A;  2W0D A;  2YUF A;  5L7F A;  3K7N A;  2OY2 A;  2E2D A;  830C A;  2ERQ A;  5CZM A;  2ERO A;  5I12 A;  1OM8 A;  5D3C A;  5I43 A;  4DD8 A;  5D1T A;  1JK3 A;  3GBO A;  5D2B A;  3LQ0 A;  1KAP P;  1XFY A;  3EDG A;  2MLR A;  3LMC A;  3LIL A;  1WNI A;  3G5C A;  4AIG A;  1G4K A;  2XS3 A;  2RJQ A;  1MMP A;  4PKQ A;  5D1S A;  1JAN A;  1A85 A;  3N2V A;  1DMT A;  5BOY A;  3L0V A;  3TVC A;  5B5O A;  1ZXV A;  1OS2 A;  1D7X A;  1BSW A;  3ZVS A;  1QUA A;  2J0T A;  3TS4 A;  2OXW A;  1AYK A;  1ZP5 A;  2ERP A;  4WKI A;  3OHO A;  2DDY A;  4FVL A;  3EDZ A;  1FM1 A;  4H30 A;  2X3B A;  1KUF A;  1ZVX A;  1YOU A;  3V96 B;  2DW0 A;  4JPA A;  3Q2G A;  4G0D A;  1CGL A;  3EDH A;  2K2G A;  1Y8J A;  2OXZ A;  1I1I P;  2MZI A;  3DPF A;  1XFX A;  3DTK A;  3I7G A;  1C3I A;  4FU4 A;  3DTE A;  4IJO A;  4PKS A;  1PWP A;  3LIK A;  4L19 A;  1AKL A;  3LKA A;  4AUO A;  1JKY A;  3AYK A;  3K7L A;  2W13 A;  1BUD A;  2Y6C A;  3BA0 A;  1I73 A;  2X3C A;  4FXY P;  1MMB A;  2PJT A;  1ZTQ A;  1SMP A;  1PWQ A;  3B92 A;  4WF6 A;  3ZUK A;  1MNC A;  3KRY A;  1O0T A;  1QIB A;  3MA2 A;  1KUI A;  3DSL A;  1L6J A;  1MMR A;  4GR3 A;  1Z3J A;  2OY4 A;  1G9K A;  2O3E A;  4QKZ A;  3N2U A;  1UTZ A;  1GXD A;  1QIC A;  4G9L A;  2OVX A;  1SRP A;  2N8R A;  4EFS A;  4DF9 A;  1JJ9 A;  2MLS A;  1PWV A;  1AF0 A;  1XUD A;  5CUH A;  4HMA A;  5D1U A;  1YCM A;  2W14 A;  1IAE A;  1H71 P;  1BZS A;  1JH1 A;  2FV9 A;  4JIJ A;  1JAQ A;  4PKR A;  1GE6 A;  3F1A A;  1R55 A;  1RMZ A;  5D7W A;  5LAB A;  1OM7 A;  3F17 A;  3WV3 A;  1KBC A;  3F16 A;  3RTT A;  1JAO A;  2KRJ A;  1C7K A;  1HFS A;  1HOV A;  1GE7 A;  1CK7 A;  1D8M A;  1SAT A;  3AIG A;  3HBU P;  2DW2 A;  1HV5 A;  3LUN A;  1BQO A;  2DW1 A;  1K7Q A;  1TVI A;  4GQL A;  1YQY A;  3HB2 P;  5B5P A;  2W15 A;  5JMY A;  2XS4 A;  3LJZ A;  1GE5 A;  4XM8 A;  1HFC A;  2A8H A;  3LK8 A;  4L63 A;  4XM6 A;  1HY7 A;  4H84 A;  966C A;  2RJP A;  3G42 A;  2Z2D A;  4R3V A;  3KWV C;  1UEA A;  2MZH A;  2TCL A;  3B2Z A;  1CAQ A;  1GKC A;  2OW9 A;  4DPE A;  4H2E A;  2USN A;  5BPA A;  3Q2H A;  3KEJ A;  4GWM A;  3O64 A;  4H1Q A;  4JA1 A;  4A3W A;  1IAD A;  1USN A;  3ZXH A;  4I03 A;  3F19 A;  2YB9 A;  456C A;  1ZXC A;  4IN9 A;  1BUV M;  1Y93 A;  5I2Z A;  1D5J A;  3B8Z A;  1A86 A;  4H76 A;  1GO8 P;  3LUM A;  1RM8 A;  3EDI A;  4H49 A;  4WZV A;  2CLT A;  1JIZ A;  1ND1 A;  4A7B A;  1CGE A;  3NX7 A;  3LQB A;  3L0T A;  3WV1 A;  1QJI A;  1JAP A;  3E8R A;  2POJ A;  2CKI A;  4PKV A;  2X7M A;  1SLM A;  1D8F A;  5L79 A;  5BOT A;  5I4O A;  1KUG A;  1BKC E;  1IAA A; 
#chains in the Genus database with same CATH homology
 4QHF A;  2YPT A;  3CQB A;  1XAX A;  1OZ9 A;  4JIU A;  4AW6 A;  4IL3 A;  1TVI A;  1XM5 A;  4JIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...