1TVVA

Contributions of orientation and hydrogen bonding to catalysis in asn-229 mutants of thymidylate synthase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
316
structure length
316
Chain Sequence
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFCIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contributions of orientation and hydrogen bonding to catalysis in Asn229 mutants of thymidylate synthase.
pubmed doi rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Transferase
source organism Lactobacillus casei
total genus 97
structure length 316
sequence length 316
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 1997-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1tvvA00
4DPHA 4PSGA 4EZ8A 4TMSA 1BKOA 3BHLA 1F4CA 1VZDA 3EHIX 4DPDA 3C06A 1I00A 5H3AA 1RTSA 3DGAC 2G86A 4E28A 3JSUA 3IROA 1SYNA 1B5EA 1EV8A 3IJZA 1TSZA 5FCTA 1ZPRA 1TJSA 3BYXA 2FTQA 2G8XA 1JMFA 4KY8A 1KCEA 2A9WA 2OIPA 1TSYA 1TDUA 1HVYA 3QJ7A 2VETA 1TSMA 1JU6A 2RDAA 1NJDA 2G8AA 4O1UA 3NRRA 1JMIA 1BQ2A 1JUTA 2TDMA 1F4BA 3EF9A 3N5EA 1TVVA 1TSWA 3QGTA 3KJSA 3DG8C 4FOXA 4IQQA 1BSPA 3IRMA 1B02A 1EVFA 3BZ0A 1BO7A 1BDUA 3ED7A 4GYHA 4O1XD 3BFIA 1NJEA 4LRRA 5H38A 2TDDA 4EINA 1KZIA 1F4EA 1BP0A 1FWMA 4XSEA 3UWLB 4FQSA 4JEFA 4FGTA 1AIQA 1NCEA 3I3RA 2FTNA 1BJGA 2G8DA 3EAWX 1TSDA 3BNZA 4FOAA 3TMSA 4O7UA 4IQBA 2TSRA 1NJAA 3DL6A 2AAZA 1DDUA 4GEVA 1TSVA 2ONBA 1DNAA 1B5DA 2BBQA 4F2VA 1HZWA 1QZFA 1BO8A 3GH2X 4XSCA 1TRGA 3UM6A 4KNZA 1TDBA 3N5GA 1BP6A 3B9HA 3BGXA 4H0RA 1BKPA 3EDWX 1HW3A 1TLCA 4H0UA 4XSDA 3GH0A 4G2OX 4EB4A 3IK0A 1TISA 1B49A 1TDAA 2FTOX 1FFLA 3INVA 1TSLA 1VZEA 3HB8A 3IX6A 4ISKA 4DQ1A 4H1IA 2RD8B 1JTQA 1F4FA 4E5OA 2G89A 3H9KA 1VZBA 3BHRA 1AN5A 1KZJA 1JMGA 4UP1A 5BY6A 1LCAA 3B5BA 4ECKA 1TSXA 4FOGA 1THYA 3EJLA 1JMHA 1TVUA 4G6WX 4KYAA 1NJBA 1TVWA 1VZAA 4Q0DA 1BQ1A 2KCEA 3OB7A 3IRNA 1J3KC 3KJRA 4IRRA 1AOBA 1AXWA 1J3IC 1TLSA 1JG0A 3K2HA 1JUJA 4GD7A 5H39A 1AJMA 3V8HA 1YPVA 1LCEA 3HBBA 1F4DA 3C0AA 1F28A 4ISWA 1TSNA 3EBUA 3QG2A 2VF0A 1JTUA 1TDCA 3UWLA 3IHIA 2RD8A 1TYSA 3UM5A 1EV5A 1SEJA 3UM8A 3CLBA 1BIDA 1NJCA 1QQQA 1F4GA 4DP3A 4Q0EA 5HS3A 5J7WA 3N5EB 2H2QA 1J3JC 4KPWA 3KGBA 5WRNA 4KY4A 1BPJA 1BSFA 1HW4A 3IK1A 4O1XA 3CL9A 3EGYX 1CI7A 1EVGA 3GG5A 4EILA 3DL5A 2TSCA 1LCBA 3HJ3A 1VZCA
chains in the Genus database with same CATH superfamily
4DPHA 4PSGA 4EZ8A 4TMSA 1BKOA 3BHLA 1F4CA 1VZDA 3EHIX 4DPDA 3C06A 1I00A 5H3AA 1RTSA 3DGAC 2G86A 4E28A 3JSUA 3IROA 1SYNA 1B5EA 1EV8A 3IJZA 1TSZA 5FCTA 1ZPRA 1TJSA 3BYXA 2FTQA 2G8XA 1JMFA 4KY8A 1KCEA 2A9WA 2OIPA 1TSYA 1TDUA 1HVYA 3QJ7A 2VETA 1TSMA 1JU6A 2RDAA 1NJDA 2G8AA 4O1UA 3NRRA 1JMIA 1BQ2A 1JUTA 2TDMA 1F4BA 3EF9A 3N5EA 1TVVA 1TSWA 3QGTA 3KJSA 3DG8C 4FOXA 4IQQA 1BSPA 3IRMA 1B02A 1EVFA 3BZ0A 1BO7A 1BDUA 3ED7A 4GYHA 4O1XD 3BFIA 1NJEA 4LRRA 5H38A 2TDDA 4EINA 1KZIA 1F4EA 1BP0A 1FWMA 4XSEA 3UWLB 4FQSA 4JEFA 4FGTA 1AIQA 1NCEA 3I3RA 2FTNA 1BJGA 2G8DA 3EAWX 1TSDA 3BNZA 4FOAA 3TMSA 4O7UA 4IQBA 2TSRA 1NJAA 3DL6A 2AAZA 1DDUA 4GEVA 1TSVA 2ONBA 1DNAA 1B5DA 2BBQA 4F2VA 1HZWA 1QZFA 1BO8A 3GH2X 4XSCA 1TRGA 3UM6A 4KNZA 1TDBA 3N5GA 1BP6A 3B9HA 3BGXA 4H0RA 1BKPA 3EDWX 1HW3A 1TLCA 4H0UA 4XSDA 3GH0A 4G2OX 4EB4A 3IK0A 1TISA 1B49A 1TDAA 2FTOX 1FFLA 3INVA 1TSLA 1VZEA 3HB8A 3IX6A 4ISKA 4DQ1A 4H1IA 2RD8B 1JTQA 1F4FA 4E5OA 2G89A 3H9KA 1VZBA 3BHRA 1AN5A 1KZJA 1JMGA 4UP1A 5BY6A 1LCAA 3B5BA 4ECKA 1TSXA 4FOGA 1THYA 3EJLA 1JMHA 1TVUA 4G6WX 4KYAA 1NJBA 1TVWA 1VZAA 4Q0DA 1BQ1A 2KCEA 3OB7A 3IRNA 1J3KC 3KJRA 4IRRA 1AOBA 1AXWA 1J3IC 1TLSA 1JG0A 3K2HA 1JUJA 4GD7A 5H39A 1AJMA 3V8HA 1YPVA 1LCEA 3HBBA 1F4DA 3C0AA 1F28A 4ISWA 1TSNA 3EBUA 3QG2A 2VF0A 1JTUA 1TDCA 3UWLA 3IHIA 2RD8A 1TYSA 3UM5A 1EV5A 1SEJA 3UM8A 3CLBA 1BIDA 1NJCA 1QQQA 1F4GA 4DP3A 4Q0EA 5HS3A 5J7WA 3N5EB 2H2QA 1J3JC 4KPWA 3KGBA 5WRNA 4KY4A 1BPJA 1BSFA 1HW4A 3IK1A 4O1XA 3CL9A 3EGYX 1CI7A 1EVGA 3GG5A 4EILA 3DL5A 2TSCA 1LCBA 3HJ3A 1VZCA
chains in the Genus database with same CATH topology
4DPHA 4PSGA 4EZ8A 4TMSA 1BKOA 3BHLA 1F4CA 1VZDA 3EHIX 4DPDA 3C06A 1I00A 5H3AA 1RTSA 3DGAC 2G86A 4E28A 3JSUA 3IROA 1SYNA 1B5EA 1EV8A 3IJZA 1TSZA 5FCTA 1ZPRA 1TJSA 3BYXA 2FTQA 2G8XA 1JMFA 4KY8A 1KCEA 2A9WA 2OIPA 1TSYA 1TDUA 1HVYA 3QJ7A 2VETA 1TSMA 1JU6A 2RDAA 1NJDA 2G8AA 4O1UA 3NRRA 1JMIA 1BQ2A 1JUTA 2TDMA 1F4BA 3EF9A 3N5EA 1TVVA 1TSWA 3QGTA 3KJSA 3DG8C 4FOXA 4IQQA 1BSPA 3IRMA 1B02A 1EVFA 3BZ0A 1BO7A 1BDUA 3ED7A 4GYHA 4O1XD 3BFIA 1NJEA 4LRRA 5H38A 2TDDA 4EINA 1KZIA 1F4EA 1BP0A 1FWMA 4XSEA 3UWLB 4FQSA 4JEFA 4FGTA 1AIQA 1NCEA 3I3RA 2FTNA 1BJGA 2G8DA 3EAWX 1TSDA 3BNZA 4FOAA 3TMSA 4O7UA 4IQBA 2TSRA 1NJAA 3DL6A 2AAZA 1DDUA 4GEVA 1TSVA 2ONBA 1DNAA 1B5DA 2BBQA 4F2VA 1HZWA 1QZFA 1BO8A 3GH2X 4XSCA 1TRGA 3UM6A 4KNZA 1TDBA 3N5GA 1BP6A 3B9HA 3BGXA 4H0RA 1BKPA 3EDWX 1HW3A 1TLCA 4H0UA 4XSDA 3GH0A 4G2OX 4EB4A 3IK0A 1TISA 1B49A 1TDAA 2FTOX 1FFLA 3INVA 1TSLA 1VZEA 3HB8A 3IX6A 4ISKA 4DQ1A 4H1IA 2RD8B 1JTQA 1F4FA 4E5OA 2G89A 3H9KA 1VZBA 3BHRA 1AN5A 1KZJA 1JMGA 4UP1A 5BY6A 1LCAA 3B5BA 4ECKA 1TSXA 4FOGA 1THYA 3EJLA 1JMHA 1TVUA 4G6WX 4KYAA 1NJBA 1TVWA 1VZAA 4Q0DA 1BQ1A 2KCEA 3OB7A 3IRNA 1J3KC 3KJRA 4IRRA 1AOBA 1AXWA 1J3IC 1TLSA 1JG0A 3K2HA 1JUJA 4GD7A 5H39A 1AJMA 3V8HA 1YPVA 1LCEA 3HBBA 1F4DA 3C0AA 1F28A 4ISWA 1TSNA 3EBUA 3QG2A 2VF0A 1JTUA 1TDCA 3UWLA 3IHIA 2RD8A 1TYSA 3UM5A 1EV5A 1SEJA 3UM8A 3CLBA 1BIDA 1NJCA 1QQQA 1F4GA 4DP3A 4Q0EA 5HS3A 5J7WA 3N5EB 2H2QA 1J3JC 4KPWA 3KGBA 5WRNA 4KY4A 1BPJA 1BSFA 1HW4A 3IK1A 4O1XA 3CL9A 3EGYX 1CI7A 1EVGA 3GG5A 4EILA 3DL5A 2TSCA 1LCBA 3HJ3A 1VZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPH A;  4PSG A;  4EZ8 A;  4TMS A;  1BKO A;  3BHL A;  1F4C A;  1VZD A;  3EHI X;  4DPD A;  3C06 A;  1I00 A;  5H3A A;  1RTS A;  3DGA C;  2G86 A;  4E28 A;  3JSU A;  3IRO A;  1SYN A;  1B5E A;  1EV8 A;  3IJZ A;  1TSZ A;  5FCT A;  1ZPR A;  1TJS A;  3BYX A;  2FTQ A;  2G8X A;  1JMF A;  4KY8 A;  1KCE A;  2A9W A;  2OIP A;  1TSY A;  1TDU A;  1HVY A;  3QJ7 A;  2VET A;  1TSM A;  1JU6 A;  2RDA A;  1NJD A;  2G8A A;  4O1U A;  3NRR A;  1JMI A;  1BQ2 A;  1JUT A;  2TDM A;  1F4B A;  3EF9 A;  3N5E A;  1TVV A;  1TSW A;  3QGT A;  3KJS A;  3DG8 C;  4FOX A;  4IQQ A;  1BSP A;  3IRM A;  1B02 A;  1EVF A;  3BZ0 A;  1BO7 A;  1BDU A;  3ED7 A;  4GYH A;  4O1X D;  3BFI A;  1NJE A;  4LRR A;  5H38 A;  2TDD A;  4EIN A;  1KZI A;  1F4E A;  1BP0 A;  1FWM A;  4XSE A;  3UWL B;  4FQS A;  4JEF A;  4FGT A;  1AIQ A;  1NCE A;  3I3R A;  2FTN A;  1BJG A;  2G8D A;  3EAW X;  1TSD A;  3BNZ A;  4FOA A;  3TMS A;  4O7U A;  4IQB A;  2TSR A;  1NJA A;  3DL6 A;  2AAZ A;  1DDU A;  4GEV A;  1TSV A;  2ONB A;  1DNA A;  1B5D A;  2BBQ A;  4F2V A;  1HZW A;  1QZF A;  1BO8 A;  3GH2 X;  4XSC A;  1TRG A;  3UM6 A;  4KNZ A;  1TDB A;  3N5G A;  1BP6 A;  3B9H A;  3BGX A;  4H0R A;  1BKP A;  3EDW X;  1HW3 A;  1TLC A;  4H0U A;  4XSD A;  3GH0 A;  4G2O X;  4EB4 A;  3IK0 A;  1TIS A;  1B49 A;  1TDA A;  2FTO X;  1FFL A;  3INV A;  1TSL A;  1VZE A;  3HB8 A;  3IX6 A;  4ISK A;  4DQ1 A;  4H1I A;  2RD8 B;  1JTQ A;  1F4F A;  4E5O A;  2G89 A;  3H9K A;  1VZB A;  3BHR A;  1AN5 A;  1KZJ A;  1JMG A;  4UP1 A;  5BY6 A;  1LCA A;  3B5B A;  4ECK A;  1TSX A;  4FOG A;  1THY A;  3EJL A;  1JMH A;  1TVU A;  4G6W X;  4KYA A;  1NJB A;  1TVW A;  1VZA A;  4Q0D A;  1BQ1 A;  2KCE A;  3OB7 A;  3IRN A;  1J3K C;  3KJR A;  4IRR A;  1AOB A;  1AXW A;  1J3I C;  1TLS A;  1JG0 A;  3K2H A;  1JUJ A;  4GD7 A;  5H39 A;  1AJM A;  3V8H A;  1YPV A;  1LCE A;  3HBB A;  1F4D A;  3C0A A;  1F28 A;  4ISW A;  1TSN A;  3EBU A;  3QG2 A;  2VF0 A;  1JTU A;  1TDC A;  3UWL A;  3IHI A;  2RD8 A;  1TYS A;  3UM5 A;  1EV5 A;  1SEJ A;  3UM8 A;  3CLB A;  1BID A;  1NJC A;  1QQQ A;  1F4G A;  4DP3 A;  4Q0E A;  5HS3 A;  5J7W A;  3N5E B;  2H2Q A;  1J3J C;  4KPW A;  3KGB A;  5WRN A;  4KY4 A;  1BPJ A;  1BSF A;  1HW4 A;  3IK1 A;  4O1X A;  3CL9 A;  3EGY X;  1CI7 A;  1EVG A;  3GG5 A;  4EIL A;  3DL5 A;  2TSC A;  1LCB A;  3HJ3 A;  1VZC A; 
#chains in the Genus database with same CATH topology
 4DPH A;  4PSG A;  4EZ8 A;  4TMS A;  1BKO A;  3BHL A;  1F4C A;  1VZD A;  3EHI X;  4DPD A;  3C06 A;  1I00 A;  5H3A A;  1RTS A;  3DGA C;  2G86 A;  4E28 A;  3JSU A;  3IRO A;  1SYN A;  1B5E A;  1EV8 A;  3IJZ A;  1TSZ A;  5FCT A;  1ZPR A;  1TJS A;  3BYX A;  2FTQ A;  2G8X A;  1JMF A;  4KY8 A;  1KCE A;  2A9W A;  2OIP A;  1TSY A;  1TDU A;  1HVY A;  3QJ7 A;  2VET A;  1TSM A;  1JU6 A;  2RDA A;  1NJD A;  2G8A A;  4O1U A;  3NRR A;  1JMI A;  1BQ2 A;  1JUT A;  2TDM A;  1F4B A;  3EF9 A;  3N5E A;  1TVV A;  1TSW A;  3QGT A;  3KJS A;  3DG8 C;  4FOX A;  4IQQ A;  1BSP A;  3IRM A;  1B02 A;  1EVF A;  3BZ0 A;  1BO7 A;  1BDU A;  3ED7 A;  4GYH A;  4O1X D;  3BFI A;  1NJE A;  4LRR A;  5H38 A;  2TDD A;  4EIN A;  1KZI A;  1F4E A;  1BP0 A;  1FWM A;  4XSE A;  3UWL B;  4FQS A;  4JEF A;  4FGT A;  1AIQ A;  1NCE A;  3I3R A;  2FTN A;  1BJG A;  2G8D A;  3EAW X;  1TSD A;  3BNZ A;  4FOA A;  3TMS A;  4O7U A;  4IQB A;  2TSR A;  1NJA A;  3DL6 A;  2AAZ A;  1DDU A;  4GEV A;  1TSV A;  2ONB A;  1DNA A;  1B5D A;  2BBQ A;  4F2V A;  1HZW A;  1QZF A;  1BO8 A;  3GH2 X;  4XSC A;  1TRG A;  3UM6 A;  4KNZ A;  1TDB A;  3N5G A;  1BP6 A;  3B9H A;  3BGX A;  4H0R A;  1BKP A;  3EDW X;  1HW3 A;  1TLC A;  4H0U A;  4XSD A;  3GH0 A;  4G2O X;  4EB4 A;  3IK0 A;  1TIS A;  1B49 A;  1TDA A;  2FTO X;  1FFL A;  3INV A;  1TSL A;  1VZE A;  3HB8 A;  3IX6 A;  4ISK A;  4DQ1 A;  4H1I A;  2RD8 B;  1JTQ A;  1F4F A;  4E5O A;  2G89 A;  3H9K A;  1VZB A;  3BHR A;  1AN5 A;  1KZJ A;  1JMG A;  4UP1 A;  5BY6 A;  1LCA A;  3B5B A;  4ECK A;  1TSX A;  4FOG A;  1THY A;  3EJL A;  1JMH A;  1TVU A;  4G6W X;  4KYA A;  1NJB A;  1TVW A;  1VZA A;  4Q0D A;  1BQ1 A;  2KCE A;  3OB7 A;  3IRN A;  1J3K C;  3KJR A;  4IRR A;  1AOB A;  1AXW A;  1J3I C;  1TLS A;  1JG0 A;  3K2H A;  1JUJ A;  4GD7 A;  5H39 A;  1AJM A;  3V8H A;  1YPV A;  1LCE A;  3HBB A;  1F4D A;  3C0A A;  1F28 A;  4ISW A;  1TSN A;  3EBU A;  3QG2 A;  2VF0 A;  1JTU A;  1TDC A;  3UWL A;  3IHI A;  2RD8 A;  1TYS A;  3UM5 A;  1EV5 A;  1SEJ A;  3UM8 A;  3CLB A;  1BID A;  1NJC A;  1QQQ A;  1F4G A;  4DP3 A;  4Q0E A;  5HS3 A;  5J7W A;  3N5E B;  2H2Q A;  1J3J C;  4KPW A;  3KGB A;  5WRN A;  4KY4 A;  1BPJ A;  1BSF A;  1HW4 A;  3IK1 A;  4O1X A;  3CL9 A;  3EGY X;  1CI7 A;  1EVG A;  3GG5 A;  4EIL A;  3DL5 A;  2TSC A;  1LCB A;  3HJ3 A;  1VZC A; 
#chains in the Genus database with same CATH homology
 4DPH A;  4PSG A;  4EZ8 A;  4TMS A;  1BKO A;  3BHL A;  1F4C A;  1VZD A;  3EHI X;  4DPD A;  3C06 A;  1I00 A;  5H3A A;  1RTS A;  3DGA C;  2G86 A;  4E28 A;  3JSU A;  3IRO A;  1SYN A;  1B5E A;  1EV8 A;  3IJZ A;  1TSZ A;  5FCT A;  1ZPR A;  1TJS A;  3BYX A;  2FTQ A;  2G8X A;  1JMF A;  4KY8 A;  1KCE A;  2A9W A;  2OIP A;  1TSY A;  1TDU A;  1HVY A;  3QJ7 A;  2VET A;  1TSM A;  1JU6 A;  2RDA A;  1NJD A;  2G8A A;  4O1U A;  3NRR A;  1JMI A;  1BQ2 A;  1JUT A;  2TDM A;  1F4B A;  3EF9 A;  3N5E A;  1TVV A;  1TSW A;  3QGT A;  3KJS A;  3DG8 C;  4FOX A;  4IQQ A;  1BSP A;  3IRM A;  1B02 A;  1EVF A;  3BZ0 A;  1BO7 A;  1BDU A;  3ED7 A;  4GYH A;  4O1X D;  3BFI A;  1NJE A;  4LRR A;  5H38 A;  2TDD A;  4EIN A;  1KZI A;  1F4E A;  1BP0 A;  1FWM A;  4XSE A;  3UWL B;  4FQS A;  4JEF A;  4FGT A;  1AIQ A;  1NCE A;  3I3R A;  2FTN A;  1BJG A;  2G8D A;  3EAW X;  1TSD A;  3BNZ A;  4FOA A;  3TMS A;  4O7U A;  4IQB A;  2TSR A;  1NJA A;  3DL6 A;  2AAZ A;  1DDU A;  4GEV A;  1TSV A;  2ONB A;  1DNA A;  1B5D A;  2BBQ A;  4F2V A;  1HZW A;  1QZF A;  1BO8 A;  3GH2 X;  4XSC A;  1TRG A;  3UM6 A;  4KNZ A;  1TDB A;  3N5G A;  1BP6 A;  3B9H A;  3BGX A;  4H0R A;  1BKP A;  3EDW X;  1HW3 A;  1TLC A;  4H0U A;  4XSD A;  3GH0 A;  4G2O X;  4EB4 A;  3IK0 A;  1TIS A;  1B49 A;  1TDA A;  2FTO X;  1FFL A;  3INV A;  1TSL A;  1VZE A;  3HB8 A;  3IX6 A;  4ISK A;  4DQ1 A;  4H1I A;  2RD8 B;  1JTQ A;  1F4F A;  4E5O A;  2G89 A;  3H9K A;  1VZB A;  3BHR A;  1AN5 A;  1KZJ A;  1JMG A;  4UP1 A;  5BY6 A;  1LCA A;  3B5B A;  4ECK A;  1TSX A;  4FOG A;  1THY A;  3EJL A;  1JMH A;  1TVU A;  4G6W X;  4KYA A;  1NJB A;  1TVW A;  1VZA A;  4Q0D A;  1BQ1 A;  2KCE A;  3OB7 A;  3IRN A;  1J3K C;  3KJR A;  4IRR A;  1AOB A;  1AXW A;  1J3I C;  1TLS A;  1JG0 A;  3K2H A;  1JUJ A;  4GD7 A;  5H39 A;  1AJM A;  3V8H A;  1YPV A;  1LCE A;  3HBB A;  1F4D A;  3C0A A;  1F28 A;  4ISW A;  1TSN A;  3EBU A;  3QG2 A;  2VF0 A;  1JTU A;  1TDC A;  3UWL A;  3IHI A;  2RD8 A;  1TYS A;  3UM5 A;  1EV5 A;  1SEJ A;  3UM8 A;  3CLB A;  1BID A;  1NJC A;  1QQQ A;  1F4G A;  4DP3 A;  4Q0E A;  5HS3 A;  5J7W A;  3N5E B;  2H2Q A;  1J3J C;  4KPW A;  3KGB A;  5WRN A;  4KY4 A;  1BPJ A;  1BSF A;  1HW4 A;  3IK1 A;  4O1X A;  3CL9 A;  3EGY X;  1CI7 A;  1EVG A;  3GG5 A;  4EIL A;  3DL5 A;  2TSC A;  1LCB A;  3HJ3 A;  1VZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...