1TW0A

Native crystal structure of spe16
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
157
Chain Sequence
GVFVFRDETSSSVAPAKLYKALTKDSDTIAQKIDGPIQSIELVEGNGGVGTIKKITANEGDKTSFVLQKVDAIDEANLGYDYSIVGGTGLPESLEKLSFETKVVAGSGGGSISKVTLKFHTKGDAPLSDAVRDDALAKGAGFFKAIEGYVLANPAEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pathogenesis-related class 10 protein SPE-16
publication title Native crystal structure of SPE16
rcsb
molecule tags Plant protein
total genus 42
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 1tw0A00
2FLHA 4A85A 4MA6A 1EM2A 3KB3A 3KB0A 3NS2A 2FFSA 2PCSA 2NN5A 2QPVA 2L65A 2RESA 3GGNA 3KAZA 3R6PA 4LG5A 4A84A 4R7KA 2NS9A 4A87A 2D4RA 4JHGA 3KL1A 3ZVUA 3RD6A 4LGAA 2WQLA 4PSBA 2E3MA 3TVRA 4MAPA 5I9JA 1XFSA 4REHA 2QIMA 1XUVA 2E3RA 2M47A 3NJOA 3PU2A 4C9IA 2E3QA 3NEFA 2E3SA 3NMTA 3IJTA 4A8GA 4C9CA 5E4BA 3NR4A 3K90A 4IGVA 4DSBA 1LN3A 2M89A 3KDIA 1T17A 3NMVA 2K7HA 3PUTA 4A86A 4A81A 5BRLA 4JHIA 3CNWA 4REJA 2LAKA 2Z9ZA 1TW0A 2I9YA 1ICXA 4IGXA 2VNEA 2VQ5A 3H3SA 2BK0A 2N4AA 1H2OA 3P9VA 2KEWA 2GKDA 4MNSA 1X53A 4GY9A 3W9KA 4M9BA 2A1LA 4LGBA 2KTEA 4BKCA 3OQUA 3UQHA 1LN2A 2KF2A 1FSKA 5E4MA 4B9RA 4BK6A 1TXCA 3FO5A 4A80A 2LCGA 4REIA 4IH0A 1FM4A 2LF2A 1B6FA 3H3QA 3NEGA 3NJ0A 3P51A 4LA7A 1IFVA 4QIPA 3RT0C 1UW5A 3KAYA 4N0GC 3TFZA 2LUZA 5I8FA 3Q6AA 4A83A 2EJXA 2LIOA 1JSSA 4JDLA 3K3KA 2PSOA 2L8OA 3KLXA 2LDKA 2E3OA 3P0LA 5JNNA 5JO2A 3UJLA 1Z94A 2E3NA 5AMWA 3RT2A 3JRSA 3TVQA 3OJIA 2LEQA 3F08A 4BTZA 2N4BA 3H3RA 4Y31A 3QN1A 1KCMA 1BTVA 4Q0KA 5E4DA 4IHRA 3QSZA 4JHHA 4XRWA 4DSCA 4RYVA 2REZA 4WVOA 4Z3LA 3Q63A 2LE1A 1ZXFA 4IGWA 2RERA 2R55A 4A8UA 4A8VA 1XN6A 4OICA 3E85A 4IH2A 3H3TA 3Q64A 2L9PA 3OH8A 4IGYA 4BKDA 5JO1A 1XDFA 3JRQB 4XRTA 4C94A 1E09A 3NI8A 2Q3QA 4M9WA 2LPXA 5C9YA 1BV1A 1VJHA 1LLTA 4BK7A 3KDJA 3W9RA 3C0VA 3NJ1A 3TL1A 1T27A 1QMRA 2LGHA 4DS8A 1LN1A 3UIDA 3OTLA 3ELIA 2KCZA 2K5GA 2E3PA 2MOUA 4JDAA 5E46A 3NMPA 3NMHA 4A88A 2Z9YA 3KDHA 3NMNA 4N3EA 3IE5A 3WG8A 1XN5A 4FPWA 2IL5A
chains in the Genus database with same CATH superfamily
2FLHA 4A85A 4MA6A 1EM2A 3KB3A 3KB0A 3NS2A 2FFSA 2PCSA 2NN5A 2QPVA 2L65A 2RESA 3GGNA 3KAZA 3R6PA 4LG5A 4A84A 2LAFA 4R7KA 2NS9A 4A87A 3HJFA 2D4RA 4JHGA 3KL1A 3ZVUA 3RD6A 4LGAA 2WQLA 4PSBA 2E3MA 3TVRA 4MAPA 5I9JA 1XFSA 4REHA 2QIMA 1XUVA 2E3RA 2M47A 3NJOA 3PU2A 4C9IA 2E3QA 3NEFA 2E3SA 3NMTA 3IJTA 4A8GA 4C9CA 5E4BA 3NR4A 3K90A 4QDCA 4IGVA 4DSBA 3GKEA 4E6FA 3DLBA 1LN3A 2M89A 3KDIA 1T17A 3NMVA 2K7HA 3PUTA 4A86A 4A81A 5BRLA 4JHIA 3CNWA 4REJA 2LAKA 2Z9ZA 1TW0A 2I9YA 1ICXA 4IGXA 2VNEA 2VQ5A 3GOBA 3H3SA 2BK0A 2N4AA 4N47A 5EKQC 3HK2A 3GL2A 1H2OA 3P9VA 2KEWA 2GKDA 4MNSA 1X53A 3HVRA 4GY9A 3W9KA 4M9BA 2A1LA 3HXMA 3DLHA 4LGBA 2KTEA 4BKCA 4N41A 3OQUA 3UQHA 1LN2A 2KF2A 1FSKA 5E4MA 4B9RA 4BK6A 4N76A 1TXCA 3FO5A 4A80A 2LCGA 4REIA 4NCBA 4IH0A 1FM4A 2LF2A 1B6FA 3H3QA 3NEGA 3NJ0A 3P51A 4LA7A 1IFVA 4QIPA 4NCAA 3RT0C 1UW5A 4JHYA 3KAYA 4N0GC 3TFZA 2LUZA 3GTEA 5I8FA 2YH6A 3Q6AA 4A83A 2EJXA 2LIOA 1JSSA 4JDLA 3K3KA 2PSOA 2L8OA 3KLXA 2LDKA 2E3OA 3HM9A 3P0LA 5JNNA 5JO2A 3UJLA 1Z94A 3F73A 2E3NA 5AMWA 3NQNA 3JRSA 3RT2A 3TVQA 3OJIA 2LEQA 3F08A 4BTZA 2N4BA 3H3RA 4Y31A 3QN1A 1KCMA 1BTVA 4Q0KA 4QCKA 5E4DA 4IHRA 3GL0A 3GB4A 3QSZA 4JHHA 4XRWA 4DSCA 4RYVA 2REZA 4WVOA 4Z3LA 3Q63A 2LE1A 1ZXFA 4IGWA 2RERA 2R55A 4A8UA 4A8VA 1XN6A 4OICA 3E85A 4IH2A 3H3TA 3Q64A 2L9PA 3OH8A 3TGOC 4IGYA 4BKDA 5JO1A 1XDFA 3JRQB 4XRTA 4C94A 1E09A 3NI8A 4QDFA 2Q3QA 4M9WA 2LPXA 5C9YA 1BV1A 1VJHA 1LLTA 4BK7A 3KDJA 3HO1A 3W9RA 3C0VA 3NJ1A 3TL1A 1T27A 1QMRA 2LGHA 4DS8A 1LN1A 3UIDA 4KPYA 3OTLA 3GTSA 3ELIA 2KCZA 2K5GA 2E3PA 2MOUA 4JDAA 5E46A 2ZYLA 4QDDA 3NMPA 3NMHA 4A88A 2Z9YA 3KDHA 3NMNA 4N3EA 3IE5A 3WG8A 1XN5A 4FPWA 2IL5A 4QDFB
chains in the Genus database with same CATH topology
2FLHA 4A85A 4MA6A 1EM2A 3KB3A 3KB0A 3NS2A 2FFSA 2PCSA 2NN5A 2QPVA 2L65A 2RESA 3GGNA 3KAZA 3R6PA 4LG5A 4A84A 2LAFA 4R7KA 2NS9A 4A87A 3HJFA 2D4RA 4JHGA 3KL1A 3ZVUA 3RD6A 4LGAA 2WQLA 4PSBA 2E3MA 3TVRA 4MAPA 5I9JA 1XFSA 4REHA 2QIMA 1XUVA 2E3RA 2M47A 3NJOA 3PU2A 4C9IA 2E3QA 3NEFA 2E3SA 3NMTA 3IJTA 4A8GA 4C9CA 5E4BA 3NR4A 3K90A 4QDCA 4IGVA 4DSBA 3GKEA 4E6FA 3DLBA 1LN3A 2M89A 3KDIA 1T17A 3NMVA 2K7HA 3PUTA 4A86A 4A81A 5BRLA 4JHIA 3CNWA 4REJA 2LAKA 2Z9ZA 1TW0A 2I9YA 1ICXA 4IGXA 2VNEA 2VQ5A 3GOBA 3H3SA 2BK0A 2N4AA 4N47A 5EKQC 3HK2A 3GL2A 1H2OA 3P9VA 2KEWA 2GKDA 4MNSA 1X53A 3HVRA 4GY9A 3W9KA 4M9BA 2A1LA 3HXMA 3DLHA 4LGBA 2KTEA 4BKCA 4N41A 3OQUA 3UQHA 1LN2A 2KF2A 1FSKA 5E4MA 4B9RA 4BK6A 4N76A 1TXCA 3FO5A 4A80A 2LCGA 4REIA 4NCBA 4IH0A 1FM4A 2LF2A 1B6FA 3H3QA 3NEGA 3NJ0A 3P51A 4LA7A 1IFVA 4QIPA 4NCAA 3RT0C 1UW5A 4JHYA 3KAYA 4N0GC 3TFZA 2LUZA 3GTEA 5I8FA 2YH6A 3Q6AA 4A83A 2EJXA 2LIOA 1JSSA 4JDLA 3K3KA 2PSOA 2L8OA 3KLXA 2LDKA 2E3OA 3HM9A 3P0LA 5JNNA 5JO2A 3UJLA 1Z94A 3F73A 2E3NA 5AMWA 3NQNA 3JRSA 3RT2A 3TVQA 3OJIA 2LEQA 3F08A 4BTZA 2N4BA 3H3RA 4Y31A 3QN1A 1KCMA 1BTVA 4Q0KA 4QCKA 5E4DA 4IHRA 3GL0A 3GB4A 3QSZA 4JHHA 4XRWA 4DSCA 4RYVA 2REZA 4WVOA 4Z3LA 3Q63A 2LE1A 1ZXFA 4IGWA 2RERA 2R55A 4A8UA 4A8VA 1XN6A 4OICA 3E85A 4IH2A 3H3TA 3Q64A 2L9PA 3OH8A 3TGOC 4IGYA 4BKDA 5JO1A 1XDFA 3JRQB 4XRTA 4C94A 1E09A 3NI8A 4QDFA 2Q3QA 4M9WA 2LPXA 5C9YA 1BV1A 1VJHA 1LLTA 4BK7A 3KDJA 3HO1A 3W9RA 3C0VA 3NJ1A 3TL1A 1T27A 1QMRA 2LGHA 4DS8A 1LN1A 3UIDA 4KPYA 3OTLA 3GTSA 3ELIA 2KCZA 2K5GA 2E3PA 2MOUA 4JDAA 5E46A 2ZYLA 4QDDA 3NMPA 3NMHA 4A88A 2Z9YA 3KDHA 3NMNA 4N3EA 3IE5A 3WG8A 1XN5A 4FPWA 2IL5A 4QDFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FLH A;  4A85 A;  4MA6 A;  1EM2 A;  3KB3 A;  3KB0 A;  3NS2 A;  2FFS A;  2PCS A;  2NN5 A;  2QPV A;  2L65 A;  2RES A;  3GGN A;  3KAZ A;  3R6P A;  4LG5 A;  4A84 A;  4R7K A;  2NS9 A;  4A87 A;  2D4R A;  4JHG A;  3KL1 A;  3ZVU A;  3RD6 A;  4LGA A;  2WQL A;  4PSB A;  2E3M A;  3TVR A;  4MAP A;  5I9J A;  1XFS A;  4REH A;  2QIM A;  1XUV A;  2E3R A;  2M47 A;  3NJO A;  3PU2 A;  4C9I A;  2E3Q A;  3NEF A;  2E3S A;  3NMT A;  3IJT A;  4A8G A;  4C9C A;  5E4B A;  3NR4 A;  3K90 A;  4IGV A;  4DSB A;  1LN3 A;  2M89 A;  3KDI A;  1T17 A;  3NMV A;  2K7H A;  3PUT A;  4A86 A;  4A81 A;  5BRL A;  4JHI A;  3CNW A;  4REJ A;  2LAK A;  2Z9Z A;  1TW0 A;  2I9Y A;  1ICX A;  4IGX A;  2VNE A;  2VQ5 A;  3H3S A;  2BK0 A;  2N4A A;  1H2O A;  3P9V A;  2KEW A;  2GKD A;  4MNS A;  1X53 A;  4GY9 A;  3W9K A;  4M9B A;  2A1L A;  4LGB A;  2KTE A;  4BKC A;  3OQU A;  3UQH A;  1LN2 A;  2KF2 A;  1FSK A;  5E4M A;  4B9R A;  4BK6 A;  1TXC A;  3FO5 A;  4A80 A;  2LCG A;  4REI A;  4IH0 A;  1FM4 A;  2LF2 A;  1B6F A;  3H3Q A;  3NEG A;  3NJ0 A;  3P51 A;  4LA7 A;  1IFV A;  4QIP A;  3RT0 C;  1UW5 A;  3KAY A;  4N0G C;  3TFZ A;  2LUZ A;  5I8F A;  3Q6A A;  4A83 A;  2EJX A;  2LIO A;  1JSS A;  4JDL A;  3K3K A;  2PSO A;  2L8O A;  3KLX A;  2LDK A;  2E3O A;  3P0L A;  5JNN A;  5JO2 A;  3UJL A;  1Z94 A;  2E3N A;  5AMW A;  3RT2 A;  3JRS A;  3TVQ A;  3OJI A;  2LEQ A;  3F08 A;  4BTZ A;  2N4B A;  3H3R A;  4Y31 A;  3QN1 A;  1KCM A;  1BTV A;  4Q0K A;  5E4D A;  4IHR A;  3QSZ A;  4JHH A;  4XRW A;  4DSC A;  4RYV A;  2REZ A;  4WVO A;  4Z3L A;  3Q63 A;  2LE1 A;  1ZXF A;  4IGW A;  2RER A;  2R55 A;  4A8U A;  4A8V A;  1XN6 A;  4OIC A;  3E85 A;  4IH2 A;  3H3T A;  3Q64 A;  2L9P A;  3OH8 A;  4IGY A;  4BKD A;  5JO1 A;  1XDF A;  3JRQ B;  4XRT A;  4C94 A;  1E09 A;  3NI8 A;  2Q3Q A;  4M9W A;  2LPX A;  5C9Y A;  1BV1 A;  1VJH A;  1LLT A;  4BK7 A;  3KDJ A;  3W9R A;  3C0V A;  3NJ1 A;  3TL1 A;  1T27 A;  1QMR A;  2LGH A;  4DS8 A;  1LN1 A;  3UID A;  3OTL A;  3ELI A;  2KCZ A;  2K5G A;  2E3P A;  2MOU A;  4JDA A;  5E46 A;  3NMP A;  3NMH A;  4A88 A;  2Z9Y A;  3KDH A;  3NMN A;  4N3E A;  3IE5 A;  3WG8 A;  1XN5 A;  4FPW A;  2IL5 A; 
#chains in the Genus database with same CATH topology
 2FLH A;  4A85 A;  4MA6 A;  1EM2 A;  3KB3 A;  3KB0 A;  3NS2 A;  2FFS A;  2PCS A;  2NN5 A;  2QPV A;  2L65 A;  2RES A;  3GGN A;  3KAZ A;  3R6P A;  4LG5 A;  4A84 A;  2LAF A;  4R7K A;  2NS9 A;  4A87 A;  3HJF A;  2D4R A;  4JHG A;  3KL1 A;  3ZVU A;  3RD6 A;  4LGA A;  2WQL A;  4PSB A;  2E3M A;  3TVR A;  4MAP A;  5I9J A;  1XFS A;  4REH A;  2QIM A;  1XUV A;  2E3R A;  2M47 A;  3NJO A;  3PU2 A;  4C9I A;  2E3Q A;  3NEF A;  2E3S A;  3NMT A;  3IJT A;  4A8G A;  4C9C A;  5E4B A;  3NR4 A;  3K90 A;  4QDC A;  4IGV A;  4DSB A;  3GKE A;  4E6F A;  3DLB A;  1LN3 A;  2M89 A;  3KDI A;  1T17 A;  3NMV A;  2K7H A;  3PUT A;  4A86 A;  4A81 A;  5BRL A;  4JHI A;  3CNW A;  4REJ A;  2LAK A;  2Z9Z A;  1TW0 A;  2I9Y A;  1ICX A;  4IGX A;  2VNE A;  2VQ5 A;  3GOB A;  3H3S A;  2BK0 A;  2N4A A;  4N47 A;  5EKQ C;  3HK2 A;  3GL2 A;  1H2O A;  3P9V A;  2KEW A;  2GKD A;  4MNS A;  1X53 A;  3HVR A;  4GY9 A;  3W9K A;  4M9B A;  2A1L A;  3HXM A;  3DLH A;  4LGB A;  2KTE A;  4BKC A;  4N41 A;  3OQU A;  3UQH A;  1LN2 A;  2KF2 A;  1FSK A;  5E4M A;  4B9R A;  4BK6 A;  4N76 A;  1TXC A;  3FO5 A;  4A80 A;  2LCG A;  4REI A;  4NCB A;  4IH0 A;  1FM4 A;  2LF2 A;  1B6F A;  3H3Q A;  3NEG A;  3NJ0 A;  3P51 A;  4LA7 A;  1IFV A;  4QIP A;  4NCA A;  3RT0 C;  1UW5 A;  4JHY A;  3KAY A;  4N0G C;  3TFZ A;  2LUZ A;  3GTE A;  5I8F A;  2YH6 A;  3Q6A A;  4A83 A;  2EJX A;  2LIO A;  1JSS A;  4JDL A;  3K3K A;  2PSO A;  2L8O A;  3KLX A;  2LDK A;  2E3O A;  3HM9 A;  3P0L A;  5JNN A;  5JO2 A;  3UJL A;  1Z94 A;  3F73 A;  2E3N A;  5AMW A;  3NQN A;  3JRS A;  3RT2 A;  3TVQ A;  3OJI A;  2LEQ A;  3F08 A;  4BTZ A;  2N4B A;  3H3R A;  4Y31 A;  3QN1 A;  1KCM A;  1BTV A;  4Q0K A;  4QCK A;  5E4D A;  4IHR A;  3GL0 A;  3GB4 A;  3QSZ A;  4JHH A;  4XRW A;  4DSC A;  4RYV A;  2REZ A;  4WVO A;  4Z3L A;  3Q63 A;  2LE1 A;  1ZXF A;  4IGW A;  2RER A;  2R55 A;  4A8U A;  4A8V A;  1XN6 A;  4OIC A;  3E85 A;  4IH2 A;  3H3T A;  3Q64 A;  2L9P A;  3OH8 A;  3TGO C;  4IGY A;  4BKD A;  5JO1 A;  1XDF A;  3JRQ B;  4XRT A;  4C94 A;  1E09 A;  3NI8 A;  4QDF A;  2Q3Q A;  4M9W A;  2LPX A;  5C9Y A;  1BV1 A;  1VJH A;  1LLT A;  4BK7 A;  3KDJ A;  3HO1 A;  3W9R A;  3C0V A;  3NJ1 A;  3TL1 A;  1T27 A;  1QMR A;  2LGH A;  4DS8 A;  1LN1 A;  3UID A;  4KPY A;  3OTL A;  3GTS A;  3ELI A;  2KCZ A;  2K5G A;  2E3P A;  2MOU A;  4JDA A;  5E46 A;  2ZYL A;  4QDD A;  3NMP A;  3NMH A;  4A88 A;  2Z9Y A;  3KDH A;  3NMN A;  4N3E A;  3IE5 A;  3WG8 A;  1XN5 A;  4FPW A;  2IL5 A;  4QDF B; 
#chains in the Genus database with same CATH homology
 2FLH A;  4A85 A;  4MA6 A;  1EM2 A;  3KB3 A;  3KB0 A;  3NS2 A;  2FFS A;  2PCS A;  2NN5 A;  2QPV A;  2L65 A;  2RES A;  3GGN A;  3KAZ A;  3R6P A;  4LG5 A;  4A84 A;  2LAF A;  4R7K A;  2NS9 A;  4A87 A;  3HJF A;  2D4R A;  4JHG A;  3KL1 A;  3ZVU A;  3RD6 A;  4LGA A;  2WQL A;  4PSB A;  2E3M A;  3TVR A;  4MAP A;  5I9J A;  1XFS A;  4REH A;  2QIM A;  1XUV A;  2E3R A;  2M47 A;  3NJO A;  3PU2 A;  4C9I A;  2E3Q A;  3NEF A;  2E3S A;  3NMT A;  3IJT A;  4A8G A;  4C9C A;  5E4B A;  3NR4 A;  3K90 A;  4QDC A;  4IGV A;  4DSB A;  3GKE A;  4E6F A;  3DLB A;  1LN3 A;  2M89 A;  3KDI A;  1T17 A;  3NMV A;  2K7H A;  3PUT A;  4A86 A;  4A81 A;  5BRL A;  4JHI A;  3CNW A;  4REJ A;  2LAK A;  2Z9Z A;  1TW0 A;  2I9Y A;  1ICX A;  4IGX A;  2VNE A;  2VQ5 A;  3GOB A;  3H3S A;  2BK0 A;  2N4A A;  4N47 A;  5EKQ C;  3HK2 A;  3GL2 A;  1H2O A;  3P9V A;  2KEW A;  2GKD A;  4MNS A;  1X53 A;  3HVR A;  4GY9 A;  3W9K A;  4M9B A;  2A1L A;  3HXM A;  3DLH A;  4LGB A;  2KTE A;  4BKC A;  4N41 A;  3OQU A;  3UQH A;  1LN2 A;  2KF2 A;  1FSK A;  5E4M A;  4B9R A;  4BK6 A;  4N76 A;  1TXC A;  3FO5 A;  4A80 A;  2LCG A;  4REI A;  4NCB A;  4IH0 A;  1FM4 A;  2LF2 A;  1B6F A;  3H3Q A;  3NEG A;  3NJ0 A;  3P51 A;  4LA7 A;  1IFV A;  4QIP A;  4NCA A;  3RT0 C;  1UW5 A;  4JHY A;  3KAY A;  4N0G C;  3TFZ A;  2LUZ A;  3GTE A;  5I8F A;  2YH6 A;  3Q6A A;  4A83 A;  2EJX A;  2LIO A;  1JSS A;  4JDL A;  3K3K A;  2PSO A;  2L8O A;  3KLX A;  2LDK A;  2E3O A;  3HM9 A;  3P0L A;  5JNN A;  5JO2 A;  3UJL A;  1Z94 A;  3F73 A;  2E3N A;  5AMW A;  3NQN A;  3JRS A;  3RT2 A;  3TVQ A;  3OJI A;  2LEQ A;  3F08 A;  4BTZ A;  2N4B A;  3H3R A;  4Y31 A;  3QN1 A;  1KCM A;  1BTV A;  4Q0K A;  4QCK A;  5E4D A;  4IHR A;  3GL0 A;  3GB4 A;  3QSZ A;  4JHH A;  4XRW A;  4DSC A;  4RYV A;  2REZ A;  4WVO A;  4Z3L A;  3Q63 A;  2LE1 A;  1ZXF A;  4IGW A;  2RER A;  2R55 A;  4A8U A;  4A8V A;  1XN6 A;  4OIC A;  3E85 A;  4IH2 A;  3H3T A;  3Q64 A;  2L9P A;  3OH8 A;  3TGO C;  4IGY A;  4BKD A;  5JO1 A;  1XDF A;  3JRQ B;  4XRT A;  4C94 A;  1E09 A;  3NI8 A;  4QDF A;  2Q3Q A;  4M9W A;  2LPX A;  5C9Y A;  1BV1 A;  1VJH A;  1LLT A;  4BK7 A;  3KDJ A;  3HO1 A;  3W9R A;  3C0V A;  3NJ1 A;  3TL1 A;  1T27 A;  1QMR A;  2LGH A;  4DS8 A;  1LN1 A;  3UID A;  4KPY A;  3OTL A;  3GTS A;  3ELI A;  2KCZ A;  2K5G A;  2E3P A;  2MOU A;  4JDA A;  5E46 A;  2ZYL A;  4QDD A;  3NMP A;  3NMH A;  4A88 A;  2Z9Y A;  3KDH A;  3NMN A;  4N3E A;  3IE5 A;  3WG8 A;  1XN5 A;  4FPW A;  2IL5 A;  4QDF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...