1TWAK

Rna polymerase ii complexed with atp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twaK00
4YFKA 4BBSC 2NVXC 4A3EK 4KN7A 4C3IK 5C4XK 1ZYRA 2WAQD 5C4JC 4XSZA 2JA5C 3GTPC 3M4OC 2R92K 2VUMC 2B63K 3S2HK 1XPPA 4XLPA 4A3FK 4MQ9A 3HKZL 3S1NC 2NVQK 1I3QK 4BBRC 3RZDK 2A6HA 4JK1A 4Y52K 4KMUA 4QIWL 4YFXA 5IYDC 4A3LC 3I4NK 3H0GC 4OIOA 2E2JK 4KN4A 2JA8K 2WAQL 3CQZK 5M5XK 4MEYA 5IYBC 2E2IK 4A3BC 3GTJK 4GZYA 2BE5A 1TWGK 5IP9K 5IYBK 3HOWK 4A3EC 3S1QC 5M3FK 4BXXC 5IYCC 4A3IK 4C2MK 1I6VA 2R92C 5M3MK 3FKIC 3S15K 3HOZC 3S2DK 5IP7C 5TMFA 3RZOK 3S1MC 2NVQC 4Y52C 3PO3C 1SMYA 4OINA 2WB1D 3DXJA 4QJVB 4A3DK 3I4NC 3GTGK 4A3KK 2E2JC 4G7ZA 2JA8C 3S1QK 4YFNA 2E2IC 1TWAC 2JA7C 1YNJA 1TWGC 3H3VD 4A3MK 3HOWC 5M5WK 2R93K 1K83K 4G7OA 1I6HK 2WB1L 3I4MK 3S15C 1WCMC 3GTMK 4OIQA 3HOYK 4A3CK 4G7HA 3RZOC 4X6AK 3GTOK 4C3JK 2O5IA 3H3VL 4A3JK 2JA6K 3GTGC 1TWCK 2A68A 4A3KC 3S2DC 5C4XC 2R7ZK 3GTLK 4BY7K 4AYBD 4C3HK 2E2HK 2B63C 3S2HC 1SFOK 4A3FC 4A3MC 5FJ8K 2A6EA 4NOIA 1K83C 2R93C 1I3QC 3RZDC 2NVTK 1I6HC 3I4MC 3HOUK 2YU9K 4A3GK 3S16K 3M3YK 4A3CC 3HOVK 4ZH4A 1HQMA 3CQZC 4LK1A 4AYBL 4Q5SA 3GTJC 4Q4ZA 5IP9C 2JA6C 1TWCC 4BBSK 3K7AK 1TWFK 2NVXK 4LK0A 2R7ZC 3GTLC 4A3IC 1TWHK 2E2HC 3HOXK 3S1NK 1SFOC 3PO2K 4LLGA 3WODA 5FLMK 1Y1VK 2YU9C 4A3GC 4Y7NK 4A3DC 5IYDK 3S16C 4A3LK 5D4DA 3H0GK 1BDFA 5TMCA 3HOVC 3S1RK 4OIRA 4QJVA 1R9TK 3K7AC 1I50K 2NVYK 1TWFC 3GTKK 4BY1K 4XLNA 5IYCK 3S14K 4A93K 1TWHC 3GTQK 4BXXK 2Y0SD 3FKIK 3HOXC 3HOZK 3GTMC 5IP7K 1Y1WK 2PMZD 3HOYC 3PO2C 3S17K 3S1MK 5C44K 4X6AC 4MEXA 1IW7A 3EQLA 5FLMC 3GTOC 3PO3K 1Y1VC 5C3EK 4Y7NC 4A3JC 1YNNA 2PA8D 2JA5K 4XSXA 3GTPK 5C4JK 3S1RC 4YG2A 3M4OK 4BY7C 2Y0SL 2VUMK 1TWAK 4LJZA 2JA7K 2PMZL 1R9TC 1I50C 2A69A 2NVYC 3GTKC 4BY1C 2NVTC 3S14C 4BBRK 4A93C 2PPBA 3GTQC 4OIPA 3HOUC 5M5YK 1WCMK 1Y1WC 3M3YC 3S17C 2O5JA 3HKZD 2PA8L 5C44C 2CW0A 5C3EC 4QIWD 4A3BK
chains in the Genus database with same CATH superfamily
5C4JC 2WAQD 2R92K 1XPPA 4BBRC 3RZDK 4JK1A 4KMAA 4LR2A 4QIWL 5IYDC 1EK8A 4J3NA 3I4NK 3H0GC 5JVOA 2WAQL 4P5BA 5IYBC 3GTOA 3GTJK 3HOWK 3GDZA 2JA6A 1BS2A 5IYCC 4A3IK 4C2MK 2R92C 2R7ZA 5IOQA 3FKIC 3S15K 1RU0A 3I4NC 1KQ4A 1PJ6A 3AD7C 4A3KK 1WOSA 3A8KA 3JSTA 1B4BA 3H3VD 4A3MK 3HOWC 3AQPA 5M5WK 3TTGA 4C2MC 1I6HK 2ZUEA 3HXAA 3S15C 1F7VA 4G7HA 2GSNA 3GTOK 5TJ3A 3TFIA 3H3VL 1Y1VA 2JA6K 1VH2A 2A68A 4A3KC 2R7ZK 1WOPA 5E68A 2XCOA 3A8JA 1ZXOA 3BP3A 4A3MC 1L0WA 4NOIA 3OPFA 1I3QC 1I6HC 3HOUK 3AD9C 4GTAA 3M3YK 5CJ9A 3HOVK 4QIWD 4LK1A 4Q5SA 4LQYA 2JA6C 5IP9C 1X31C 4LK0A 1WORA 2R7ZC 1O29A 2JA5A 2V6UA 4LLGA 2VUMA 1O26A 4M1XA 1Y1VK 3T01A 4A3LK 1BDFA 3HOVC 4OIRA 2V6SA 1DCPA 3HOZK 3HOYC 2KWAA 3S17K 4X6AC 5C44K 4RMFA 1O2AA 1Y1VC 1WSVA 1YNNA 2JA5K 4XSXA 3TFHA 5IOSA 4P9SA 4G0UA 3V4GA 1O28A 2VUMK 3AH5A 2E2IA 1TWAA 1TWGA 3GSIA 2PPBA 1WQFA 5M5YK 2XCQA 3S17C 4GT9A 4C45A 5C44C 3VA7A 2FQOA 1BJTA 1O27A 3N3YA 3S2DK 2JA5C 4C3IK 2P5MA 4GTLA 1ZYRA 3GTGA 1F9NA 1IE0A 2VUMC 4A3FK 1XZQB 3A8IA 2V6TA 2R93A 1K83A 2GSUA 4YFXA 2E2JK 1DCHA 1INNA 2JA8K 4BLAA 5M5XK 2E2IK 4GZYA 1TWGK 5IYBK 5M3FK 4BXXC 1I6VA 3GTLA 5IP7C 2E2HA 1SFOA 3FOEA 3PO3C 1SMYA 4KM8A 2WB1D 4KAWX 4QJVB 4A3DK 1XXAA 3GTGK 2GAGC 2E2JC 4G7ZA 2JA8C 2JH3A 4BLBA 3OREA 2E2IC 1TWAC 2JA7C 3OEPA 1TWGC 3IPJA 2R93K 1K83K 1TWFA 2NVXA 2W7VA 2WB1L 1WCMC 1TWHA 3GTMK 4OIQA 5L46A 1JOEA 4C3JK 2O5IA 4BKWA 4A3JK 3T00A 2EBBA 3GTGC 5IOTA 3GTLK 3AQOA 2E2HK 3LAPA 1SFOK 1XXCA 5FJ8K 2R93C 1K83C 3RZDC 2NVYA 1C0AA 4A3GK 1Y1WA 2ZUFA 3GEHA 3GTJC 4BBSK 1TWFK 2NVXK 3GTLC 4A3IC 3GTPA 1TWHK 2E2HC 3HOXK 4KB4A 1SFOC 1GE9A 3WODA 1B4AA 5EGEA 3GEIA 4A3GC 4Y7NK 2FQTA 3GIRA 4KMDA 1O2BA 1EI6A 1TWFC 2NVYK 3QX3A 1TWHC 1USOA 1O2FB 2Y0SD 3HOXC 1Y1WK 2B63A 3S1MK 3TFJA 1VGXA 1WSRA 2RGRA 3GTOC 4Y7NC 3GTPK 1YX2A 5EGHA 3G4CA 2Y0SL 3CQZA 1IS1A 4LJZA 4WJ3M 2NVYC 4WJ4A 1V5VA 3N0CA 3HOUC 1Y1WC 3M3YC 4FZBA 3HKZD 1XZPB 1O24A 4A3BK 4KMHA 4YFKA 3S0XA 4KN7A 5C4XK 4A3EK 3GTPC 1J6XA 4XSZA 4FM9A 2B63K 3S2HK 4XLPA 1JVIA 4MQ9A 3HKZL 4KMUA 4A3LC 1WQHA 4KN4A 3CQZK 4MEYA 4A3BC 4A3EC 5M3MK 1USMA 3HOZC 2PHCB 1EFWA 2D6FC 3DXJA 4KDDA 1IBAA 1XZQA 3N0BA 4YFNA 1ZVUA 4PABA 3SZYA 4G7OA 3FHZA 3I4MK 5CHPA 1EQRA 3GTMA 4KM9A 1DD5A 2GSOA 2CFAA 1DCOA 3Q3QA 3S2DC 3H0GA 1AB4A 2P8TA 4C3IC 1EH1A 4BY7K 4C3HK 1F93A 4A3FC 2NVTK 3GTKA 3I4MC 3GEEA 3GTQA 3FKIA 1HI9A 1F7UA 4GTFA 4KATA 4KASA 3SZZA 4C3HC 1WOOA 1XXBA 5IORA 3PO2K 1ZQ1C 1PJ5A 4XCHA 1IL2A 4A3DC 5IYDK 4G0VA 3H0GK 3BP8C 3ADAC 2ZFZA 3GTKK 3S14K 5IYCK 2Y3PA 4A93K 3GTQK 3FKIK 3GTMC 3PO2C 1IW7A 3EQLA 4P5AA 4C3JC 5C3EK 4ILDA 1I3QA 4A3JC 2RH6A 1BGWA 3LAJA 3M4OK 3NUHA 3GTKC 4GTCA 3S14C 1G51A 4A93C 3GTQC 3AD8C 3MMLB 1YCLA 3G4AA 3L4JA 5C3EC 3T02A 3BUEA 4BBSC 1ISEA 1J6VA 1VLOA 2NVXC 3M4OC 3S1QK 3LPXA 1J6WA 1O25A 2NVQK 1I3QK 3CAGA 4Y52K 2A6HA 4WILA 4OIOA 2BE5A 5IP9K 4GTEA 3S1QC 1TWCA 1XZPA 1PJ7A 5TMFA 3RZOK 3S1MC 2NVQC 4Y52C 4OINA 4KC6A 1WQGA 2YU9A 1UV7A 2XCRB 3ERED 5JFEA 1YNJA 2GAHC 4AH6A 3HOYK 4A3CK 3RZOC 4X6AK 1TWCK 1JQWA 5C4XC 4AYBD 4KARA 2B63C 4GFQA 3S2HC 2A6EA 1R9TA 1I50A 2YU9K 3S16K 4A3CC 4ZH4A 1HQMA 1WIHA 3CQZC 4AYBL 4Q4ZA 1TWCC 3K7AK 1ZBSA 3S1NK 1VJEA 2JA7A 4GTBA 5FLMK 2YU9C 3S16C 5D4DA 1WCMA 5TMCA 4GTDA 4LOWA 3S1RK 4QJVA 4PAAA 1R9TK 1I50K 3K7AC 4BY1K 4XLNA 4BXXK 1VRQC 3S1NC 5IP7K 2R92A 5HL8A 2PMZD 4MEXA 3PO3K 5FLMC 2PA8D 5C4JK 3S1RC 4YG2A 4BY7C 3L4KA 4G0WA 1TWAK 2JA7K 2PMZL 1R9TC 1I50C 4O2DA 2A69A 3FOFA 3GTJA 1IQ0A 2CFAB 4BY1C 2NVTC 4BBRK 4OIPA 1J98A 1WCMK 2O5JA 2PA8L 2CW0A 4DDQA 4KB2A
chains in the Genus database with same CATH topology
4YFKA 4BBSC 2NVXC 4A3EK 4KN7A 4C3IK 5C4XK 1ZYRA 2WAQD 5C4JC 4XSZA 2JA5C 3GTPC 3M4OC 2R92K 2VUMC 2B63K 3S2HK 1XPPA 4XLPA 4A3FK 4MQ9A 3HKZL 3S1NC 2NVQK 1I3QK 4BBRC 3RZDK 2A6HA 4JK1A 4Y52K 4KMUA 4QIWL 4YFXA 5IYDC 4A3LC 3I4NK 3H0GC 4OIOA 2E2JK 4KN4A 2JA8K 2WAQL 3CQZK 5M5XK 4MEYA 5IYBC 2E2IK 4A3BC 3GTJK 4GZYA 2BE5A 1TWGK 5IP9K 5IYBK 3HOWK 4A3EC 3S1QC 5M3FK 4BXXC 5IYCC 4A3IK 4C2MK 1I6VA 2R92C 5M3MK 3FKIC 3S15K 3HOZC 3S2DK 5IP7C 5TMFA 3RZOK 3S1MC 2NVQC 4Y52C 3PO3C 1SMYA 4OINA 2WB1D 3DXJA 4QJVB 4A3DK 3I4NC 3GTGK 4A3KK 2E2JC 4G7ZA 2JA8C 3S1QK 4YFNA 2E2IC 1TWAC 2JA7C 1YNJA 1TWGC 3H3VD 4A3MK 3HOWC 5M5WK 2R93K 1K83K 4G7OA 1I6HK 2WB1L 3I4MK 3S15C 1WCMC 3GTMK 4OIQA 3HOYK 4A3CK 4G7HA 3RZOC 4X6AK 3GTOK 4C3JK 2O5IA 3H3VL 4A3JK 2JA6K 3GTGC 1TWCK 2A68A 4A3KC 3S2DC 5C4XC 2R7ZK 3GTLK 4BY7K 4AYBD 4C3HK 2E2HK 2B63C 3S2HC 1SFOK 4A3FC 4A3MC 5FJ8K 2A6EA 4NOIA 1K83C 2R93C 1I3QC 3RZDC 2NVTK 1I6HC 3I4MC 3HOUK 2YU9K 4A3GK 3S16K 3M3YK 4A3CC 3HOVK 4ZH4A 1HQMA 3CQZC 4LK1A 4AYBL 4Q5SA 3GTJC 4Q4ZA 5IP9C 2JA6C 1TWCC 4BBSK 3K7AK 1TWFK 2NVXK 4LK0A 2R7ZC 3GTLC 4A3IC 1TWHK 2E2HC 3HOXK 3S1NK 1SFOC 3PO2K 4LLGA 3WODA 5FLMK 1Y1VK 2YU9C 4A3GC 4Y7NK 4A3DC 5IYDK 3S16C 4A3LK 5D4DA 3H0GK 1BDFA 5TMCA 3HOVC 3S1RK 4OIRA 4QJVA 1R9TK 3K7AC 1I50K 2NVYK 1TWFC 3GTKK 4BY1K 4XLNA 5IYCK 3S14K 4A93K 1TWHC 3GTQK 4BXXK 2Y0SD 3FKIK 3HOXC 3HOZK 3GTMC 5IP7K 1Y1WK 2PMZD 3HOYC 3PO2C 3S17K 3S1MK 5C44K 4X6AC 4MEXA 1IW7A 3EQLA 5FLMC 3GTOC 3PO3K 1Y1VC 5C3EK 4Y7NC 4A3JC 1YNNA 2PA8D 2JA5K 4XSXA 3GTPK 5C4JK 3S1RC 4YG2A 3M4OK 4BY7C 2Y0SL 2VUMK 1TWAK 4LJZA 2JA7K 2PMZL 1R9TC 1I50C 2A69A 2NVYC 3GTKC 4BY1C 2NVTC 3S14C 4BBRK 4A93C 2PPBA 3GTQC 4OIPA 3HOUC 5M5YK 1WCMK 1Y1WC 3M3YC 3S17C 2O5JA 3HKZD 2PA8L 5C44C 2CW0A 5C3EC 4QIWD 4A3BK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFK A;  4BBS C;  2NVX C;  4A3E K;  4KN7 A;  4C3I K;  5C4X K;  1ZYR A;  2WAQ D;  5C4J C;  4XSZ A;  2JA5 C;  3GTP C;  3M4O C;  2R92 K;  2VUM C;  2B63 K;  3S2H K;  1XPP A;  4XLP A;  4A3F K;  4MQ9 A;  3HKZ L;  3S1N C;  2NVQ K;  1I3Q K;  4BBR C;  3RZD K;  2A6H A;  4JK1 A;  4Y52 K;  4KMU A;  4QIW L;  4YFX A;  5IYD C;  4A3L C;  3I4N K;  3H0G C;  4OIO A;  2E2J K;  4KN4 A;  2JA8 K;  2WAQ L;  3CQZ K;  5M5X K;  4MEY A;  5IYB C;  2E2I K;  4A3B C;  3GTJ K;  4GZY A;  2BE5 A;  1TWG K;  5IP9 K;  5IYB K;  3HOW K;  4A3E C;  3S1Q C;  5M3F K;  4BXX C;  5IYC C;  4A3I K;  4C2M K;  1I6V A;  2R92 C;  5M3M K;  3FKI C;  3S15 K;  3HOZ C;  3S2D K;  5IP7 C;  5TMF A;  3RZO K;  3S1M C;  2NVQ C;  4Y52 C;  3PO3 C;  1SMY A;  4OIN A;  2WB1 D;  3DXJ A;  4QJV B;  4A3D K;  3I4N C;  3GTG K;  4A3K K;  2E2J C;  4G7Z A;  2JA8 C;  3S1Q K;  4YFN A;  2E2I C;  1TWA C;  2JA7 C;  1YNJ A;  1TWG C;  3H3V D;  4A3M K;  3HOW C;  5M5W K;  2R93 K;  1K83 K;  4G7O A;  1I6H K;  2WB1 L;  3I4M K;  3S15 C;  1WCM C;  3GTM K;  4OIQ A;  3HOY K;  4A3C K;  4G7H A;  3RZO C;  4X6A K;  3GTO K;  4C3J K;  2O5I A;  3H3V L;  4A3J K;  2JA6 K;  3GTG C;  1TWC K;  2A68 A;  4A3K C;  3S2D C;  5C4X C;  2R7Z K;  3GTL K;  4BY7 K;  4AYB D;  4C3H K;  2E2H K;  2B63 C;  3S2H C;  1SFO K;  4A3F C;  4A3M C;  5FJ8 K;  2A6E A;  4NOI A;  1K83 C;  2R93 C;  1I3Q C;  3RZD C;  2NVT K;  1I6H C;  3I4M C;  3HOU K;  2YU9 K;  4A3G K;  3S16 K;  3M3Y K;  4A3C C;  3HOV K;  4ZH4 A;  1HQM A;  3CQZ C;  4LK1 A;  4AYB L;  4Q5S A;  3GTJ C;  4Q4Z A;  5IP9 C;  2JA6 C;  1TWC C;  4BBS K;  3K7A K;  1TWF K;  2NVX K;  4LK0 A;  2R7Z C;  3GTL C;  4A3I C;  1TWH K;  2E2H C;  3HOX K;  3S1N K;  1SFO C;  3PO2 K;  4LLG A;  3WOD A;  5FLM K;  1Y1V K;  2YU9 C;  4A3G C;  4Y7N K;  4A3D C;  5IYD K;  3S16 C;  4A3L K;  5D4D A;  3H0G K;  1BDF A;  5TMC A;  3HOV C;  3S1R K;  4OIR A;  4QJV A;  1R9T K;  3K7A C;  1I50 K;  2NVY K;  1TWF C;  3GTK K;  4BY1 K;  4XLN A;  5IYC K;  3S14 K;  4A93 K;  1TWH C;  3GTQ K;  4BXX K;  2Y0S D;  3FKI K;  3HOX C;  3HOZ K;  3GTM C;  5IP7 K;  1Y1W K;  2PMZ D;  3HOY C;  3PO2 C;  3S17 K;  3S1M K;  5C44 K;  4X6A C;  4MEX A;  1IW7 A;  3EQL A;  5FLM C;  3GTO C;  3PO3 K;  1Y1V C;  5C3E K;  4Y7N C;  4A3J C;  1YNN A;  2PA8 D;  2JA5 K;  4XSX A;  3GTP K;  5C4J K;  3S1R C;  4YG2 A;  3M4O K;  4BY7 C;  2Y0S L;  2VUM K;  1TWA K;  4LJZ A;  2JA7 K;  2PMZ L;  1R9T C;  1I50 C;  2A69 A;  2NVY C;  3GTK C;  4BY1 C;  2NVT C;  3S14 C;  4BBR K;  4A93 C;  2PPB A;  3GTQ C;  4OIP A;  3HOU C;  5M5Y K;  1WCM K;  1Y1W C;  3M3Y C;  3S17 C;  2O5J A;  3HKZ D;  2PA8 L;  5C44 C;  2CW0 A;  5C3E C;  4QIW D;  4A3B K; 
#chains in the Genus database with same CATH topology
 5C4J C;  2WAQ D;  2R92 K;  1XPP A;  4BBR C;  3RZD K;  4JK1 A;  4KMA A;  4LR2 A;  4QIW L;  5IYD C;  1EK8 A;  4J3N A;  3I4N K;  3H0G C;  5JVO A;  2WAQ L;  4P5B A;  5IYB C;  3GTO A;  3GTJ K;  3HOW K;  3GDZ A;  2JA6 A;  1BS2 A;  5IYC C;  4A3I K;  4C2M K;  2R92 C;  2R7Z A;  5IOQ A;  3FKI C;  3S15 K;  1RU0 A;  3I4N C;  1KQ4 A;  1PJ6 A;  3AD7 C;  4A3K K;  1WOS A;  3A8K A;  3JST A;  1B4B A;  3H3V D;  4A3M K;  3HOW C;  3AQP A;  5M5W K;  3TTG A;  4C2M C;  1I6H K;  2ZUE A;  3HXA A;  3S15 C;  1F7V A;  4G7H A;  2GSN A;  3GTO K;  5TJ3 A;  3TFI A;  3H3V L;  1Y1V A;  2JA6 K;  1VH2 A;  2A68 A;  4A3K C;  2R7Z K;  1WOP A;  5E68 A;  2XCO A;  3A8J A;  1ZXO A;  3BP3 A;  4A3M C;  1L0W A;  4NOI A;  3OPF A;  1I3Q C;  1I6H C;  3HOU K;  3AD9 C;  4GTA A;  3M3Y K;  5CJ9 A;  3HOV K;  4QIW D;  4LK1 A;  4Q5S A;  4LQY A;  2JA6 C;  5IP9 C;  1X31 C;  4LK0 A;  1WOR A;  2R7Z C;  1O29 A;  2JA5 A;  2V6U A;  4LLG A;  2VUM A;  1O26 A;  4M1X A;  1Y1V K;  3T01 A;  4A3L K;  1BDF A;  3HOV C;  4OIR A;  2V6S A;  1DCP A;  3HOZ K;  3HOY C;  2KWA A;  3S17 K;  4X6A C;  5C44 K;  4RMF A;  1O2A A;  1Y1V C;  1WSV A;  1YNN A;  2JA5 K;  4XSX A;  3TFH A;  5IOS A;  4P9S A;  4G0U A;  3V4G A;  1O28 A;  2VUM K;  3AH5 A;  2E2I A;  1TWA A;  1TWG A;  3GSI A;  2PPB A;  1WQF A;  5M5Y K;  2XCQ A;  3S17 C;  4GT9 A;  4C45 A;  5C44 C;  3VA7 A;  2FQO A;  1BJT A;  1O27 A;  3N3Y A;  3S2D K;  2JA5 C;  4C3I K;  2P5M A;  4GTL A;  1ZYR A;  3GTG A;  1F9N A;  1IE0 A;  2VUM C;  4A3F K;  1XZQ B;  3A8I A;  2V6T A;  2R93 A;  1K83 A;  2GSU A;  4YFX A;  2E2J K;  1DCH A;  1INN A;  2JA8 K;  4BLA A;  5M5X K;  2E2I K;  4GZY A;  1TWG K;  5IYB K;  5M3F K;  4BXX C;  1I6V A;  3GTL A;  5IP7 C;  2E2H A;  1SFO A;  3FOE A;  3PO3 C;  1SMY A;  4KM8 A;  2WB1 D;  4KAW X;  4QJV B;  4A3D K;  1XXA A;  3GTG K;  2GAG C;  2E2J C;  4G7Z A;  2JA8 C;  2JH3 A;  4BLB A;  3ORE A;  2E2I C;  1TWA C;  2JA7 C;  3OEP A;  1TWG C;  3IPJ A;  2R93 K;  1K83 K;  1TWF A;  2NVX A;  2W7V A;  2WB1 L;  1WCM C;  1TWH A;  3GTM K;  4OIQ A;  5L46 A;  1JOE A;  4C3J K;  2O5I A;  4BKW A;  4A3J K;  3T00 A;  2EBB A;  3GTG C;  5IOT A;  3GTL K;  3AQO A;  2E2H K;  3LAP A;  1SFO K;  1XXC A;  5FJ8 K;  2R93 C;  1K83 C;  3RZD C;  2NVY A;  1C0A A;  4A3G K;  1Y1W A;  2ZUF A;  3GEH A;  3GTJ C;  4BBS K;  1TWF K;  2NVX K;  3GTL C;  4A3I C;  3GTP A;  1TWH K;  2E2H C;  3HOX K;  4KB4 A;  1SFO C;  1GE9 A;  3WOD A;  1B4A A;  5EGE A;  3GEI A;  4A3G C;  4Y7N K;  2FQT A;  3GIR A;  4KMD A;  1O2B A;  1EI6 A;  1TWF C;  2NVY K;  3QX3 A;  1TWH C;  1USO A;  1O2F B;  2Y0S D;  3HOX C;  1Y1W K;  2B63 A;  3S1M K;  3TFJ A;  1VGX A;  1WSR A;  2RGR A;  3GTO C;  4Y7N C;  3GTP K;  1YX2 A;  5EGH A;  3G4C A;  2Y0S L;  3CQZ A;  1IS1 A;  4LJZ A;  4WJ3 M;  2NVY C;  4WJ4 A;  1V5V A;  3N0C A;  3HOU C;  1Y1W C;  3M3Y C;  4FZB A;  3HKZ D;  1XZP B;  1O24 A;  4A3B K;  4KMH A;  4YFK A;  3S0X A;  4KN7 A;  5C4X K;  4A3E K;  3GTP C;  1J6X A;  4XSZ A;  4FM9 A;  2B63 K;  3S2H K;  4XLP A;  1JVI A;  4MQ9 A;  3HKZ L;  4KMU A;  4A3L C;  1WQH A;  4KN4 A;  3CQZ K;  4MEY A;  4A3B C;  4A3E C;  5M3M K;  1USM A;  3HOZ C;  2PHC B;  1EFW A;  2D6F C;  3DXJ A;  4KDD A;  1IBA A;  1XZQ A;  3N0B A;  4YFN A;  1ZVU A;  4PAB A;  3SZY A;  4G7O A;  3FHZ A;  3I4M K;  5CHP A;  1EQR A;  3GTM A;  4KM9 A;  1DD5 A;  2GSO A;  2CFA A;  1DCO A;  3Q3Q A;  3S2D C;  3H0G A;  1AB4 A;  2P8T A;  4C3I C;  1EH1 A;  4BY7 K;  4C3H K;  1F93 A;  4A3F C;  2NVT K;  3GTK A;  3I4M C;  3GEE A;  3GTQ A;  3FKI A;  1HI9 A;  1F7U A;  4GTF A;  4KAT A;  4KAS A;  3SZZ A;  4C3H C;  1WOO A;  1XXB A;  5IOR A;  3PO2 K;  1ZQ1 C;  1PJ5 A;  4XCH A;  1IL2 A;  4A3D C;  5IYD K;  4G0V A;  3H0G K;  3BP8 C;  3ADA C;  2ZFZ A;  3GTK K;  3S14 K;  5IYC K;  2Y3P A;  4A93 K;  3GTQ K;  3FKI K;  3GTM C;  3PO2 C;  1IW7 A;  3EQL A;  4P5A A;  4C3J C;  5C3E K;  4ILD A;  1I3Q A;  4A3J C;  2RH6 A;  1BGW A;  3LAJ A;  3M4O K;  3NUH A;  3GTK C;  4GTC A;  3S14 C;  1G51 A;  4A93 C;  3GTQ C;  3AD8 C;  3MML B;  1YCL A;  3G4A A;  3L4J A;  5C3E C;  3T02 A;  3BUE A;  4BBS C;  1ISE A;  1J6V A;  1VLO A;  2NVX C;  3M4O C;  3S1Q K;  3LPX A;  1J6W A;  1O25 A;  2NVQ K;  1I3Q K;  3CAG A;  4Y52 K;  2A6H A;  4WIL A;  4OIO A;  2BE5 A;  5IP9 K;  4GTE A;  3S1Q C;  1TWC A;  1XZP A;  1PJ7 A;  5TMF A;  3RZO K;  3S1M C;  2NVQ C;  4Y52 C;  4OIN A;  4KC6 A;  1WQG A;  2YU9 A;  1UV7 A;  2XCR B;  3ERE D;  5JFE A;  1YNJ A;  2GAH C;  4AH6 A;  3HOY K;  4A3C K;  3RZO C;  4X6A K;  1TWC K;  1JQW A;  5C4X C;  4AYB D;  4KAR A;  2B63 C;  4GFQ A;  3S2H C;  2A6E A;  1R9T A;  1I50 A;  2YU9 K;  3S16 K;  4A3C C;  4ZH4 A;  1HQM A;  1WIH A;  3CQZ C;  4AYB L;  4Q4Z A;  1TWC C;  3K7A K;  1ZBS A;  3S1N K;  1VJE A;  2JA7 A;  4GTB A;  5FLM K;  2YU9 C;  3S16 C;  5D4D A;  1WCM A;  5TMC A;  4GTD A;  4LOW A;  3S1R K;  4QJV A;  4PAA A;  1R9T K;  1I50 K;  3K7A C;  4BY1 K;  4XLN A;  4BXX K;  1VRQ C;  3S1N C;  5IP7 K;  2R92 A;  5HL8 A;  2PMZ D;  4MEX A;  3PO3 K;  5FLM C;  2PA8 D;  5C4J K;  3S1R C;  4YG2 A;  4BY7 C;  3L4K A;  4G0W A;  1TWA K;  2JA7 K;  2PMZ L;  1R9T C;  1I50 C;  4O2D A;  2A69 A;  3FOF A;  3GTJ A;  1IQ0 A;  2CFA B;  4BY1 C;  2NVT C;  4BBR K;  4OIP A;  1J98 A;  1WCM K;  2O5J A;  2PA8 L;  2CW0 A;  4DDQ A;  4KB2 A; 
#chains in the Genus database with same CATH homology
 4YFK A;  4BBS C;  2NVX C;  4A3E K;  4KN7 A;  4C3I K;  5C4X K;  1ZYR A;  2WAQ D;  5C4J C;  4XSZ A;  2JA5 C;  3GTP C;  3M4O C;  2R92 K;  2VUM C;  2B63 K;  3S2H K;  1XPP A;  4XLP A;  4A3F K;  4MQ9 A;  3HKZ L;  3S1N C;  2NVQ K;  1I3Q K;  4BBR C;  3RZD K;  2A6H A;  4JK1 A;  4Y52 K;  4KMU A;  4QIW L;  4YFX A;  5IYD C;  4A3L C;  3I4N K;  3H0G C;  4OIO A;  2E2J K;  4KN4 A;  2JA8 K;  2WAQ L;  3CQZ K;  5M5X K;  4MEY A;  5IYB C;  2E2I K;  4A3B C;  3GTJ K;  4GZY A;  2BE5 A;  1TWG K;  5IP9 K;  5IYB K;  3HOW K;  4A3E C;  3S1Q C;  5M3F K;  4BXX C;  5IYC C;  4A3I K;  4C2M K;  1I6V A;  2R92 C;  5M3M K;  3FKI C;  3S15 K;  3HOZ C;  3S2D K;  5IP7 C;  5TMF A;  3RZO K;  3S1M C;  2NVQ C;  4Y52 C;  3PO3 C;  1SMY A;  4OIN A;  2WB1 D;  3DXJ A;  4QJV B;  4A3D K;  3I4N C;  3GTG K;  4A3K K;  2E2J C;  4G7Z A;  2JA8 C;  3S1Q K;  4YFN A;  2E2I C;  1TWA C;  2JA7 C;  1YNJ A;  1TWG C;  3H3V D;  4A3M K;  3HOW C;  5M5W K;  2R93 K;  1K83 K;  4G7O A;  1I6H K;  2WB1 L;  3I4M K;  3S15 C;  1WCM C;  3GTM K;  4OIQ A;  3HOY K;  4A3C K;  4G7H A;  3RZO C;  4X6A K;  3GTO K;  4C3J K;  2O5I A;  3H3V L;  4A3J K;  2JA6 K;  3GTG C;  1TWC K;  2A68 A;  4A3K C;  3S2D C;  5C4X C;  2R7Z K;  3GTL K;  4BY7 K;  4AYB D;  4C3H K;  2E2H K;  2B63 C;  3S2H C;  1SFO K;  4A3F C;  4A3M C;  5FJ8 K;  2A6E A;  4NOI A;  1K83 C;  2R93 C;  1I3Q C;  3RZD C;  2NVT K;  1I6H C;  3I4M C;  3HOU K;  2YU9 K;  4A3G K;  3S16 K;  3M3Y K;  4A3C C;  3HOV K;  4ZH4 A;  1HQM A;  3CQZ C;  4LK1 A;  4AYB L;  4Q5S A;  3GTJ C;  4Q4Z A;  5IP9 C;  2JA6 C;  1TWC C;  4BBS K;  3K7A K;  1TWF K;  2NVX K;  4LK0 A;  2R7Z C;  3GTL C;  4A3I C;  1TWH K;  2E2H C;  3HOX K;  3S1N K;  1SFO C;  3PO2 K;  4LLG A;  3WOD A;  5FLM K;  1Y1V K;  2YU9 C;  4A3G C;  4Y7N K;  4A3D C;  5IYD K;  3S16 C;  4A3L K;  5D4D A;  3H0G K;  1BDF A;  5TMC A;  3HOV C;  3S1R K;  4OIR A;  4QJV A;  1R9T K;  3K7A C;  1I50 K;  2NVY K;  1TWF C;  3GTK K;  4BY1 K;  4XLN A;  5IYC K;  3S14 K;  4A93 K;  1TWH C;  3GTQ K;  4BXX K;  2Y0S D;  3FKI K;  3HOX C;  3HOZ K;  3GTM C;  5IP7 K;  1Y1W K;  2PMZ D;  3HOY C;  3PO2 C;  3S17 K;  3S1M K;  5C44 K;  4X6A C;  4MEX A;  1IW7 A;  3EQL A;  5FLM C;  3GTO C;  3PO3 K;  1Y1V C;  5C3E K;  4Y7N C;  4A3J C;  1YNN A;  2PA8 D;  2JA5 K;  4XSX A;  3GTP K;  5C4J K;  3S1R C;  4YG2 A;  3M4O K;  4BY7 C;  2Y0S L;  2VUM K;  1TWA K;  4LJZ A;  2JA7 K;  2PMZ L;  1R9T C;  1I50 C;  2A69 A;  2NVY C;  3GTK C;  4BY1 C;  2NVT C;  3S14 C;  4BBR K;  4A93 C;  2PPB A;  3GTQ C;  4OIP A;  3HOU C;  5M5Y K;  1WCM K;  1Y1W C;  3M3Y C;  3S17 C;  2O5J A;  3HKZ D;  2PA8 L;  5C44 C;  2CW0 A;  5C3E C;  4QIW D;  4A3B K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...