1TWAK

Rna polymerase ii complexed with atp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twaK00
1YNJA 5M3FK 4G7HA 2VUMK 3GTMK 3HOYC 4GZYA 4XSXA 2R93K 1R9TC 2NVTC 5IP7C 1K83K 5IP9K 5C3EK 5FLMK 5M5YK 2JA5C 3H3VL 4A3JK 3HOVK 2O5IA 5IYCK 2R92C 3I4MC 3DXJA 3K7AK 1Y1VK 4AYBD 2NVYK 1BDFA 3S14C 4BBSK 3S1MK 4A3BC 4A3FC 3I4NK 1TWHC 3S1NK 5C4JC 4G7ZA 2B63C 2R7ZK 1I3QK 4A93C 2Y0SD 3FKIC 3S16K 4Y52K 4KN7A 3WODA 3GTOK 4BXXC 4YG2A 1TWFC 3PO2C 2A68A 3H0GC 3GTJK 4BY1K 4LLGA 3RZDK 1TWCK 5M5XK 2E2JC 3GTGK 3HOZK 3S17C 4X6AK 4Y7NK 4QIWL 4A3DK 4LK0A 1TWGK 4KMUA 4ZH4A 3S2DC 1WCMC 4A3IK 3S1RC 3HKZL 4A3EK 4YFKA 4A3MC 4A3CK 4LJZA 5TMCA 1Y1WC 3HOUC 1I50C 4YFXA 5FJ8K 3HOWC 4A3GK 4OIOA 3S2HK 3GTKK 1SMYA 3M3YK 5C44K 1I6VA 4A3LC 3S15K 4XSZA 2A69A 3RZOC 3GTQK 3PO3C 2PMZL 2PA8L 5IYBC 4BXXK 3HOYK 2WAQL 3HOXC 4YFNA 1R9TK 2NVQC 5M5WK 5IP7K 2NVTK 3M4OC 2JA5K 1I6HC 4MEXA 4Q4ZA 1TWAC 2R92K 3I4MK 4QJVB 3S14K 3H3VD 4C3JK 5TMFA 1ZYRA 4A3BK 4A3FK 2JA7C 4A3KC 4BY7C 3GTLC 2WB1L 1TWHK 4G7OA 5C4JK 4OIRA 2B63K 4A93K 5C4XC 2JA8C 3FKIK 4C2MK 4OIQA 2E2HC 1SFOC 1TWFK 3PO2K 4C3HK 3CQZC 4XLNA 3H0GK 1YNNA 3S17K 2NVXC 1XPPA 2E2JK 2YU9C 4BBRC 3GTPC 3S1QC 4OIPA 2JA7K 4QJVA 2E2IC 5IYDC 3S2DK 1WCMK 2VUMC 3GTMC 3S1RK 4A3MK 4KN4A 2R93C 4AYBL 1Y1WK 3HOUK 4QIWD 1I50K 1K83C 4MEYA 5IP9C 5FLMC 5C3EC 3HOWK 4A3JC 2JA6C 3HOVC 1IW7A 3HKZD 3K7AC 4OINA 1Y1VC 2NVYC 4A3LK 4MQ9A 4NOIA 3RZOK 3PO3K 5IYBK 4BBSC 2Y0SL 3S1MC 3HOXK 4C3IK 4LK1A 2NVQK 3M4OK 4Q5SA 2CW0A 3I4NC 3S1NC 4JK1A 1I6HK 2PMZD 2PA8D 1I3QC 1TWAK 5D4DA 2JA6K 2R7ZC 2WAQD 3S16C 1HQMA 4Y52C 3GTOC 3GTJC 4BY1C 2PPBA 3HOZC 3RZDC 1TWCC 3GTGC 4XLPA 4X6AC 4Y7NC 4A3DC 4A3KK 4BY7K 1TWGC 5C4XK 3GTLK 4A3IC 2JA8K 5M3MK 2A6HA 4A3EC 4A3CC 2E2HK 1SFOK 4A3GC 2WB1D 2A6EA 3CQZK 3S2HC 3GTKC 5IYCC 2NVXK 2YU9K 3EQLA 3GTPK 4BBRK 5C44C 3M3YC 3S1QK 3S15C 2BE5A 2E2IK 3GTQC 2O5JA 5IYDK
chains in the Genus database with same CATH superfamily
4AH6A 5M3FK 2VUMK 1XZQB 2GSNA 5IP7C 5L46A 4G0VA 5M5YK 4A3JK 2O5IA 2R92C 3I4MC 1TWAA 3DXJA 1Y1VK 3S14C 4C3JC 4LR2A 4FM9A 1O2AA 1VGXA 1ISEA 1TWHC 1HI9A 3WODA 1WQFA 2E2HA 1TWFC 1SFOA 3GTJK 5TJ3A 3HOZK 1F93A 4ZH4A 2GAHC 4A3IK 3HKZL 4GTEA 4KATA 4LJZA 5TMCA 1Y1WC 3HOWC 5FJ8K 1INNA 3GTKA 1SMYA 1B4BA 2XCRB 3M3YK 3L4KA 1I6VA 3PO3C 2PA8L 3LAJA 4YFNA 5IOTA 4Q4ZA 2R7ZA 1I3QA 2R92A 4KAWX 1PJ7A 2CFAB 4LQYA 3H3VD 5TMFA 1ZYRA 1EK8A 1DD5A 3GTGA 3N0BA 2JA7C 3BP3A 3JSTA 3CAGA 5C4JK 2B63K 4C3HK 3CQZC 4KMAA 4P9SA 3S17K 2P8TA 5HL8A 1O27A 3GIRA 5IYDC 3GTQA 3GEHA 2ZFZA 2VUMC 4KN4A 3HOUK 3AD9C 3SZZA 1Y1WA 1I50K 4MEYA 1R9TA 1DCHA 4A3JC 2JA5A 3V4GA 3AQPA 3Q3QA 1Y1VC 1GE9A 3FOEA 4C3IK 4LK1A 4JK1A 1I6HK 2PMZD 2JA6K 4KDDA 3GTJC 3HOZC 4XLPA 4GTDA 3SZYA 2GSUA 2JA7A 3GTLK 4A3IC 3A8KA 1WCMA 1USOA 5M3MK 1EFWA 3FOFA 1O24A 2NVXK 3GTPK 3M3YC 3S1QK 1WSRA 1F7UA 4WJ4A 2ZUFA 4XSXA 1WSVA 5FLMK 3H3VL 3HOVK 5IYCK 2NVYK 1BDFA 1EI6A 1USMA 1XXCA 3ADAC 3T02A 3I4NK 3G4CA 5C4JC 2B63C 3GTOK 3A8JA 1XZQA 2A68A 4C3HC 4LLGA 4M1XA 3RZDK 3S17C 3AD7C 2YU9A 5CHPA 4Y7NK 4LK0A 1TWGK 2E2IA 4A3EK 3GTMA 3HOUC 2D6FC 2R93A 1I50C 4A3GK 1K83A 4OIOA 3S2HK 3HXAA 5C44K 4KASA 2PMZL 4GFQA 4C3IC 2NVTK 1WORA 1I6HC 5IORA 4KMDA 1WOPA 1TWCA 1XZPA 4KC6A 4A3FK 2PHCB 3GTLC 1J6WA 4OIRA 1DCPA 3FKIK 1G51A 4C2MK 3H0GK 1YNNA 2NVXC 1XPPA 2E2JK 3GTPC 3S1QC 4OIPA 1IQ0A 1X31C 3S1RK 4A3MK 4QIWD 5FLMC 3HOVC 1IW7A 2NVYC 3RZOK 1EH1A 5IYBK 3HOXK 1F9NA 3M4OK 4Q5SA 3I4NC 1TWHA 5D4DA 1TWAK 3T01A 2WAQD 4WJ3M 3GTOC 3BP8C 1TWFA 3AD8C 3RZDC 4C45A 1IE0A 4Y7NC 4A3KK 4BY7K 1TWGC 2V6SA 4A3EC 4KM9A 2JH3A 2E2HK 5E68A 1YCLA 1SFOK 4A3GC 4KARA 2WB1D 2A6EA 4J3NA 3S2HC 3GTPA 5C44C 5CJ9A 2BE5A 4G7HA 4GZYA 3OEPA 3AH5A 5IOQA 1PJ6A 2NVTC 5IP9K 5C3EK 4AYBD 2FQOA 3MMLB 4RMFA 3AQOA 3GDZA 1L0WA 4A3FC 4BKWA 4G7ZA 2R7ZK 1I3QK 2Y0SD 2XCQA 3FKIC 1JVIA 4C2MC 4Y52K 3GEIA 4YG2A 3H0GC 3CQZA 2Y3PA 5M5XK 2E2JC 1J6XA 3GTGK 5JFEA 4X6AK 4QIWL 1YX2A 4A3DK 1O2BA 3S1RC 2VUMA 4YFKA 4A3MC 1WOOA 3OREA 4YFXA 1WIHA 2W7VA 1Y1VA 3S15K 2RH6A 4XSZA 2A69A 3RZOC 2EBBA 4PABA 5IYBC 3GTQK 4BXXK 3HOYK 2WAQL 3HOXC 3ERED 1IL2A 4GTAA 1R9TK 1XXBA 5M5WK 3M4OC 2JA5K 4MEXA 1TWAC 4P5AA 3A8IA 1J6VA 4QJVB 1PJ5A 3OPFA 3GTJA 4A3BK 4A3KC 1ZQ1C 4BY7C 2WB1L 1VRQC 4A93K 2GAGC 4OIQA 2E2HC 2P5MA 1SFOC 3PO2K 1DCOA 1VLOA 4ILDA 2JA7K 3S2DK 1ZXOA 1WCMK 4KMHA 3TFIA 4AYBL 5IP9C 5C3EC 5EGEA 3L4JA 2JA6C 1WQGA 4A3LK 4WILA 4MQ9A 4NOIA 1O29A 1ZBSA 2Y0SL 4GTFA 3VA7A 2NVQK 2CW0A 2R7ZC 1I3QC 2B63A 1HQMA 3TFHA 4Y52C 1BGWA 1JQWA 4GTCA 2XCOA 2PPBA 3GTGC 4X6AC 4A3DC 2CFAA 5C4XK 4G0UA 2JA8K 2A6HA 4XCHA 4KB4A 1I50A 5EGHA 4GT9A 4O2DA 5IYCC 4PAAA 2YU9K 3EQLA 1B4AA 4BBRK 2ZUEA 3TTGA 3S0XA 3S15C 2E2IK 3GTQC 4BXXC 4KB2A 1YNJA 3GTMK 3HOYC 4BLBA 2R93K 1R9TC 1K83K 2JA5C 1XZPB 2JA6A 1C0AA 3K7AK 2V6TA 1WQHA 4BBSK 3S1MK 4A3BC 1O26A 2GSOA 3S1NK 3GTLA 4A93C 3S16K 4KN7A 1XXAA 3LAPA 3PO2C 4BY1K 1TWCK 2NVXA 3G4AA 4KMUA 3S2DC 1WCMC 3NUHA 1ZVUA 4A3CK 4G0WA 1F7VA 3GTKK 3T00A 3FHZA 3QX3A 4A3LC 1UV7A 2NVYA 1O2FB 1V5VA 2NVQC 1KQ4A 1JOEA 5IP7K 4GTLA 5JVOA 3I4MK 3IPJA 2R92K 1VJEA 3GTOA 3S14K 4C3JK 3GSIA 3LPXA 1BJTA 4LOWA 5C4XC 1TWHK 4G7OA 1TWGA 1EQRA 2V6UA 2JA8C 1TWFK 4XLNA 1AB4A 1O25A 4FZBA 2YU9C 4BBRC 3GEEA 1WOSA 2KWAA 4QJVA 1BS2A 2E2IC 3BUEA 3GTMC 2R93C 1Y1WK 1K83C 3HOWK 2FQTA 3TFJA 3HKZD 3K7AC 4KM8A 4OINA 1J98A 2RGRA 4DDQA 3PO3K 1O28A 4BBSC 3S1MC 3N3YA 4BLAA 3S1NC 2PA8D 3S16C 3FKIA 1VH2A 4BY1C 3H0GA 1TWCC 4A3CC 5IOSA 4P5BA 3CQZK 3GTKC 1IS1A 3N0CA 1RU0A 1IBAA 4GTBA 2O5JA 5IYDK
chains in the Genus database with same CATH topology
1YNJA 5M3FK 4G7HA 2VUMK 3GTMK 3HOYC 4GZYA 4XSXA 2R93K 1R9TC 2NVTC 5IP7C 1K83K 5IP9K 5C3EK 5FLMK 5M5YK 2JA5C 3H3VL 4A3JK 3HOVK 2O5IA 5IYCK 2R92C 3I4MC 3DXJA 3K7AK 1Y1VK 4AYBD 2NVYK 1BDFA 3S14C 4BBSK 3S1MK 4A3BC 4A3FC 3I4NK 1TWHC 3S1NK 5C4JC 4G7ZA 2B63C 2R7ZK 1I3QK 4A93C 2Y0SD 3FKIC 3S16K 4Y52K 4KN7A 3WODA 3GTOK 4BXXC 4YG2A 1TWFC 3PO2C 2A68A 3H0GC 3GTJK 4BY1K 4LLGA 3RZDK 1TWCK 5M5XK 2E2JC 3GTGK 3HOZK 3S17C 4X6AK 4Y7NK 4QIWL 4A3DK 4LK0A 1TWGK 4KMUA 4ZH4A 3S2DC 1WCMC 4A3IK 3S1RC 3HKZL 4A3EK 4YFKA 4A3MC 4A3CK 4LJZA 5TMCA 1Y1WC 3HOUC 1I50C 4YFXA 5FJ8K 3HOWC 4A3GK 4OIOA 3S2HK 3GTKK 1SMYA 3M3YK 5C44K 1I6VA 4A3LC 3S15K 4XSZA 2A69A 3RZOC 3GTQK 3PO3C 2PMZL 2PA8L 5IYBC 4BXXK 3HOYK 2WAQL 3HOXC 4YFNA 1R9TK 2NVQC 5M5WK 5IP7K 2NVTK 3M4OC 2JA5K 1I6HC 4MEXA 4Q4ZA 1TWAC 2R92K 3I4MK 4QJVB 3S14K 3H3VD 4C3JK 5TMFA 1ZYRA 4A3BK 4A3FK 2JA7C 4A3KC 4BY7C 3GTLC 2WB1L 1TWHK 4G7OA 5C4JK 4OIRA 2B63K 4A93K 5C4XC 2JA8C 3FKIK 4C2MK 4OIQA 2E2HC 1SFOC 1TWFK 3PO2K 4C3HK 3CQZC 4XLNA 3H0GK 1YNNA 3S17K 2NVXC 1XPPA 2E2JK 2YU9C 4BBRC 3GTPC 3S1QC 4OIPA 2JA7K 4QJVA 2E2IC 5IYDC 3S2DK 1WCMK 2VUMC 3GTMC 3S1RK 4A3MK 4KN4A 2R93C 4AYBL 1Y1WK 3HOUK 4QIWD 1I50K 1K83C 4MEYA 5IP9C 5FLMC 5C3EC 3HOWK 4A3JC 2JA6C 3HOVC 1IW7A 3HKZD 3K7AC 4OINA 1Y1VC 2NVYC 4A3LK 4MQ9A 4NOIA 3RZOK 3PO3K 5IYBK 4BBSC 2Y0SL 3S1MC 3HOXK 4C3IK 4LK1A 2NVQK 3M4OK 4Q5SA 2CW0A 3I4NC 3S1NC 4JK1A 1I6HK 2PMZD 2PA8D 1I3QC 1TWAK 5D4DA 2JA6K 2R7ZC 2WAQD 3S16C 1HQMA 4Y52C 3GTOC 3GTJC 4BY1C 2PPBA 3HOZC 3RZDC 1TWCC 3GTGC 4XLPA 4X6AC 4Y7NC 4A3DC 4A3KK 4BY7K 1TWGC 5C4XK 3GTLK 4A3IC 2JA8K 5M3MK 2A6HA 4A3EC 4A3CC 2E2HK 1SFOK 4A3GC 2WB1D 2A6EA 3CQZK 3S2HC 3GTKC 5IYCC 2NVXK 2YU9K 3EQLA 3GTPK 4BBRK 5C44C 3M3YC 3S1QK 3S15C 2BE5A 2E2IK 3GTQC 2O5JA 5IYDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNJ A;  5M3F K;  4G7H A;  2VUM K;  3GTM K;  3HOY C;  4GZY A;  4XSX A;  2R93 K;  1R9T C;  2NVT C;  5IP7 C;  1K83 K;  5IP9 K;  5C3E K;  5FLM K;  5M5Y K;  2JA5 C;  3H3V L;  4A3J K;  3HOV K;  2O5I A;  5IYC K;  2R92 C;  3I4M C;  3DXJ A;  3K7A K;  1Y1V K;  4AYB D;  2NVY K;  1BDF A;  3S14 C;  4BBS K;  3S1M K;  4A3B C;  4A3F C;  3I4N K;  1TWH C;  3S1N K;  5C4J C;  4G7Z A;  2B63 C;  2R7Z K;  1I3Q K;  4A93 C;  2Y0S D;  3FKI C;  3S16 K;  4Y52 K;  4KN7 A;  3WOD A;  3GTO K;  4BXX C;  4YG2 A;  1TWF C;  3PO2 C;  2A68 A;  3H0G C;  3GTJ K;  4BY1 K;  4LLG A;  3RZD K;  1TWC K;  5M5X K;  2E2J C;  3GTG K;  3HOZ K;  3S17 C;  4X6A K;  4Y7N K;  4QIW L;  4A3D K;  4LK0 A;  1TWG K;  4KMU A;  4ZH4 A;  3S2D C;  1WCM C;  4A3I K;  3S1R C;  3HKZ L;  4A3E K;  4YFK A;  4A3M C;  4A3C K;  4LJZ A;  5TMC A;  1Y1W C;  3HOU C;  1I50 C;  4YFX A;  5FJ8 K;  3HOW C;  4A3G K;  4OIO A;  3S2H K;  3GTK K;  1SMY A;  3M3Y K;  5C44 K;  1I6V A;  4A3L C;  3S15 K;  4XSZ A;  2A69 A;  3RZO C;  3GTQ K;  3PO3 C;  2PMZ L;  2PA8 L;  5IYB C;  4BXX K;  3HOY K;  2WAQ L;  3HOX C;  4YFN A;  1R9T K;  2NVQ C;  5M5W K;  5IP7 K;  2NVT K;  3M4O C;  2JA5 K;  1I6H C;  4MEX A;  4Q4Z A;  1TWA C;  2R92 K;  3I4M K;  4QJV B;  3S14 K;  3H3V D;  4C3J K;  5TMF A;  1ZYR A;  4A3B K;  4A3F K;  2JA7 C;  4A3K C;  4BY7 C;  3GTL C;  2WB1 L;  1TWH K;  4G7O A;  5C4J K;  4OIR A;  2B63 K;  4A93 K;  5C4X C;  2JA8 C;  3FKI K;  4C2M K;  4OIQ A;  2E2H C;  1SFO C;  1TWF K;  3PO2 K;  4C3H K;  3CQZ C;  4XLN A;  3H0G K;  1YNN A;  3S17 K;  2NVX C;  1XPP A;  2E2J K;  2YU9 C;  4BBR C;  3GTP C;  3S1Q C;  4OIP A;  2JA7 K;  4QJV A;  2E2I C;  5IYD C;  3S2D K;  1WCM K;  2VUM C;  3GTM C;  3S1R K;  4A3M K;  4KN4 A;  2R93 C;  4AYB L;  1Y1W K;  3HOU K;  4QIW D;  1I50 K;  1K83 C;  4MEY A;  5IP9 C;  5FLM C;  5C3E C;  3HOW K;  4A3J C;  2JA6 C;  3HOV C;  1IW7 A;  3HKZ D;  3K7A C;  4OIN A;  1Y1V C;  2NVY C;  4A3L K;  4MQ9 A;  4NOI A;  3RZO K;  3PO3 K;  5IYB K;  4BBS C;  2Y0S L;  3S1M C;  3HOX K;  4C3I K;  4LK1 A;  2NVQ K;  3M4O K;  4Q5S A;  2CW0 A;  3I4N C;  3S1N C;  4JK1 A;  1I6H K;  2PMZ D;  2PA8 D;  1I3Q C;  1TWA K;  5D4D A;  2JA6 K;  2R7Z C;  2WAQ D;  3S16 C;  1HQM A;  4Y52 C;  3GTO C;  3GTJ C;  4BY1 C;  2PPB A;  3HOZ C;  3RZD C;  1TWC C;  3GTG C;  4XLP A;  4X6A C;  4Y7N C;  4A3D C;  4A3K K;  4BY7 K;  1TWG C;  5C4X K;  3GTL K;  4A3I C;  2JA8 K;  5M3M K;  2A6H A;  4A3E C;  4A3C C;  2E2H K;  1SFO K;  4A3G C;  2WB1 D;  2A6E A;  3CQZ K;  3S2H C;  3GTK C;  5IYC C;  2NVX K;  2YU9 K;  3EQL A;  3GTP K;  4BBR K;  5C44 C;  3M3Y C;  3S1Q K;  3S15 C;  2BE5 A;  2E2I K;  3GTQ C;  2O5J A;  5IYD K; 
#chains in the Genus database with same CATH topology
 4AH6 A;  5M3F K;  2VUM K;  1XZQ B;  2GSN A;  5IP7 C;  5L46 A;  4G0V A;  5M5Y K;  4A3J K;  2O5I A;  2R92 C;  3I4M C;  1TWA A;  3DXJ A;  1Y1V K;  3S14 C;  4C3J C;  4LR2 A;  4FM9 A;  1O2A A;  1VGX A;  1ISE A;  1TWH C;  1HI9 A;  3WOD A;  1WQF A;  2E2H A;  1TWF C;  1SFO A;  3GTJ K;  5TJ3 A;  3HOZ K;  1F93 A;  4ZH4 A;  2GAH C;  4A3I K;  3HKZ L;  4GTE A;  4KAT A;  4LJZ A;  5TMC A;  1Y1W C;  3HOW C;  5FJ8 K;  1INN A;  3GTK A;  1SMY A;  1B4B A;  2XCR B;  3M3Y K;  3L4K A;  1I6V A;  3PO3 C;  2PA8 L;  3LAJ A;  4YFN A;  5IOT A;  4Q4Z A;  2R7Z A;  1I3Q A;  2R92 A;  4KAW X;  1PJ7 A;  2CFA B;  4LQY A;  3H3V D;  5TMF A;  1ZYR A;  1EK8 A;  1DD5 A;  3GTG A;  3N0B A;  2JA7 C;  3BP3 A;  3JST A;  3CAG A;  5C4J K;  2B63 K;  4C3H K;  3CQZ C;  4KMA A;  4P9S A;  3S17 K;  2P8T A;  5HL8 A;  1O27 A;  3GIR A;  5IYD C;  3GTQ A;  3GEH A;  2ZFZ A;  2VUM C;  4KN4 A;  3HOU K;  3AD9 C;  3SZZ A;  1Y1W A;  1I50 K;  4MEY A;  1R9T A;  1DCH A;  4A3J C;  2JA5 A;  3V4G A;  3AQP A;  3Q3Q A;  1Y1V C;  1GE9 A;  3FOE A;  4C3I K;  4LK1 A;  4JK1 A;  1I6H K;  2PMZ D;  2JA6 K;  4KDD A;  3GTJ C;  3HOZ C;  4XLP A;  4GTD A;  3SZY A;  2GSU A;  2JA7 A;  3GTL K;  4A3I C;  3A8K A;  1WCM A;  1USO A;  5M3M K;  1EFW A;  3FOF A;  1O24 A;  2NVX K;  3GTP K;  3M3Y C;  3S1Q K;  1WSR A;  1F7U A;  4WJ4 A;  2ZUF A;  4XSX A;  1WSV A;  5FLM K;  3H3V L;  3HOV K;  5IYC K;  2NVY K;  1BDF A;  1EI6 A;  1USM A;  1XXC A;  3ADA C;  3T02 A;  3I4N K;  3G4C A;  5C4J C;  2B63 C;  3GTO K;  3A8J A;  1XZQ A;  2A68 A;  4C3H C;  4LLG A;  4M1X A;  3RZD K;  3S17 C;  3AD7 C;  2YU9 A;  5CHP A;  4Y7N K;  4LK0 A;  1TWG K;  2E2I A;  4A3E K;  3GTM A;  3HOU C;  2D6F C;  2R93 A;  1I50 C;  4A3G K;  1K83 A;  4OIO A;  3S2H K;  3HXA A;  5C44 K;  4KAS A;  2PMZ L;  4GFQ A;  4C3I C;  2NVT K;  1WOR A;  1I6H C;  5IOR A;  4KMD A;  1WOP A;  1TWC A;  1XZP A;  4KC6 A;  4A3F K;  2PHC B;  3GTL C;  1J6W A;  4OIR A;  1DCP A;  3FKI K;  1G51 A;  4C2M K;  3H0G K;  1YNN A;  2NVX C;  1XPP A;  2E2J K;  3GTP C;  3S1Q C;  4OIP A;  1IQ0 A;  1X31 C;  3S1R K;  4A3M K;  4QIW D;  5FLM C;  3HOV C;  1IW7 A;  2NVY C;  3RZO K;  1EH1 A;  5IYB K;  3HOX K;  1F9N A;  3M4O K;  4Q5S A;  3I4N C;  1TWH A;  5D4D A;  1TWA K;  3T01 A;  2WAQ D;  4WJ3 M;  3GTO C;  3BP8 C;  1TWF A;  3AD8 C;  3RZD C;  4C45 A;  1IE0 A;  4Y7N C;  4A3K K;  4BY7 K;  1TWG C;  2V6S A;  4A3E C;  4KM9 A;  2JH3 A;  2E2H K;  5E68 A;  1YCL A;  1SFO K;  4A3G C;  4KAR A;  2WB1 D;  2A6E A;  4J3N A;  3S2H C;  3GTP A;  5C44 C;  5CJ9 A;  2BE5 A;  4G7H A;  4GZY A;  3OEP A;  3AH5 A;  5IOQ A;  1PJ6 A;  2NVT C;  5IP9 K;  5C3E K;  4AYB D;  2FQO A;  3MML B;  4RMF A;  3AQO A;  3GDZ A;  1L0W A;  4A3F C;  4BKW A;  4G7Z A;  2R7Z K;  1I3Q K;  2Y0S D;  2XCQ A;  3FKI C;  1JVI A;  4C2M C;  4Y52 K;  3GEI A;  4YG2 A;  3H0G C;  3CQZ A;  2Y3P A;  5M5X K;  2E2J C;  1J6X A;  3GTG K;  5JFE A;  4X6A K;  4QIW L;  1YX2 A;  4A3D K;  1O2B A;  3S1R C;  2VUM A;  4YFK A;  4A3M C;  1WOO A;  3ORE A;  4YFX A;  1WIH A;  2W7V A;  1Y1V A;  3S15 K;  2RH6 A;  4XSZ A;  2A69 A;  3RZO C;  2EBB A;  4PAB A;  5IYB C;  3GTQ K;  4BXX K;  3HOY K;  2WAQ L;  3HOX C;  3ERE D;  1IL2 A;  4GTA A;  1R9T K;  1XXB A;  5M5W K;  3M4O C;  2JA5 K;  4MEX A;  1TWA C;  4P5A A;  3A8I A;  1J6V A;  4QJV B;  1PJ5 A;  3OPF A;  3GTJ A;  4A3B K;  4A3K C;  1ZQ1 C;  4BY7 C;  2WB1 L;  1VRQ C;  4A93 K;  2GAG C;  4OIQ A;  2E2H C;  2P5M A;  1SFO C;  3PO2 K;  1DCO A;  1VLO A;  4ILD A;  2JA7 K;  3S2D K;  1ZXO A;  1WCM K;  4KMH A;  3TFI A;  4AYB L;  5IP9 C;  5C3E C;  5EGE A;  3L4J A;  2JA6 C;  1WQG A;  4A3L K;  4WIL A;  4MQ9 A;  4NOI A;  1O29 A;  1ZBS A;  2Y0S L;  4GTF A;  3VA7 A;  2NVQ K;  2CW0 A;  2R7Z C;  1I3Q C;  2B63 A;  1HQM A;  3TFH A;  4Y52 C;  1BGW A;  1JQW A;  4GTC A;  2XCO A;  2PPB A;  3GTG C;  4X6A C;  4A3D C;  2CFA A;  5C4X K;  4G0U A;  2JA8 K;  2A6H A;  4XCH A;  4KB4 A;  1I50 A;  5EGH A;  4GT9 A;  4O2D A;  5IYC C;  4PAA A;  2YU9 K;  3EQL A;  1B4A A;  4BBR K;  2ZUE A;  3TTG A;  3S0X A;  3S15 C;  2E2I K;  3GTQ C;  4BXX C;  4KB2 A;  1YNJ A;  3GTM K;  3HOY C;  4BLB A;  2R93 K;  1R9T C;  1K83 K;  2JA5 C;  1XZP B;  2JA6 A;  1C0A A;  3K7A K;  2V6T A;  1WQH A;  4BBS K;  3S1M K;  4A3B C;  1O26 A;  2GSO A;  3S1N K;  3GTL A;  4A93 C;  3S16 K;  4KN7 A;  1XXA A;  3LAP A;  3PO2 C;  4BY1 K;  1TWC K;  2NVX A;  3G4A A;  4KMU A;  3S2D C;  1WCM C;  3NUH A;  1ZVU A;  4A3C K;  4G0W A;  1F7V A;  3GTK K;  3T00 A;  3FHZ A;  3QX3 A;  4A3L C;  1UV7 A;  2NVY A;  1O2F B;  1V5V A;  2NVQ C;  1KQ4 A;  1JOE A;  5IP7 K;  4GTL A;  5JVO A;  3I4M K;  3IPJ A;  2R92 K;  1VJE A;  3GTO A;  3S14 K;  4C3J K;  3GSI A;  3LPX A;  1BJT A;  4LOW A;  5C4X C;  1TWH K;  4G7O A;  1TWG A;  1EQR A;  2V6U A;  2JA8 C;  1TWF K;  4XLN A;  1AB4 A;  1O25 A;  4FZB A;  2YU9 C;  4BBR C;  3GEE A;  1WOS A;  2KWA A;  4QJV A;  1BS2 A;  2E2I C;  3BUE A;  3GTM C;  2R93 C;  1Y1W K;  1K83 C;  3HOW K;  2FQT A;  3TFJ A;  3HKZ D;  3K7A C;  4KM8 A;  4OIN A;  1J98 A;  2RGR A;  4DDQ A;  3PO3 K;  1O28 A;  4BBS C;  3S1M C;  3N3Y A;  4BLA A;  3S1N C;  2PA8 D;  3S16 C;  3FKI A;  1VH2 A;  4BY1 C;  3H0G A;  1TWC C;  4A3C C;  5IOS A;  4P5B A;  3CQZ K;  3GTK C;  1IS1 A;  3N0C A;  1RU0 A;  1IBA A;  4GTB A;  2O5J A;  5IYD K; 
#chains in the Genus database with same CATH homology
 1YNJ A;  5M3F K;  4G7H A;  2VUM K;  3GTM K;  3HOY C;  4GZY A;  4XSX A;  2R93 K;  1R9T C;  2NVT C;  5IP7 C;  1K83 K;  5IP9 K;  5C3E K;  5FLM K;  5M5Y K;  2JA5 C;  3H3V L;  4A3J K;  3HOV K;  2O5I A;  5IYC K;  2R92 C;  3I4M C;  3DXJ A;  3K7A K;  1Y1V K;  4AYB D;  2NVY K;  1BDF A;  3S14 C;  4BBS K;  3S1M K;  4A3B C;  4A3F C;  3I4N K;  1TWH C;  3S1N K;  5C4J C;  4G7Z A;  2B63 C;  2R7Z K;  1I3Q K;  4A93 C;  2Y0S D;  3FKI C;  3S16 K;  4Y52 K;  4KN7 A;  3WOD A;  3GTO K;  4BXX C;  4YG2 A;  1TWF C;  3PO2 C;  2A68 A;  3H0G C;  3GTJ K;  4BY1 K;  4LLG A;  3RZD K;  1TWC K;  5M5X K;  2E2J C;  3GTG K;  3HOZ K;  3S17 C;  4X6A K;  4Y7N K;  4QIW L;  4A3D K;  4LK0 A;  1TWG K;  4KMU A;  4ZH4 A;  3S2D C;  1WCM C;  4A3I K;  3S1R C;  3HKZ L;  4A3E K;  4YFK A;  4A3M C;  4A3C K;  4LJZ A;  5TMC A;  1Y1W C;  3HOU C;  1I50 C;  4YFX A;  5FJ8 K;  3HOW C;  4A3G K;  4OIO A;  3S2H K;  3GTK K;  1SMY A;  3M3Y K;  5C44 K;  1I6V A;  4A3L C;  3S15 K;  4XSZ A;  2A69 A;  3RZO C;  3GTQ K;  3PO3 C;  2PMZ L;  2PA8 L;  5IYB C;  4BXX K;  3HOY K;  2WAQ L;  3HOX C;  4YFN A;  1R9T K;  2NVQ C;  5M5W K;  5IP7 K;  2NVT K;  3M4O C;  2JA5 K;  1I6H C;  4MEX A;  4Q4Z A;  1TWA C;  2R92 K;  3I4M K;  4QJV B;  3S14 K;  3H3V D;  4C3J K;  5TMF A;  1ZYR A;  4A3B K;  4A3F K;  2JA7 C;  4A3K C;  4BY7 C;  3GTL C;  2WB1 L;  1TWH K;  4G7O A;  5C4J K;  4OIR A;  2B63 K;  4A93 K;  5C4X C;  2JA8 C;  3FKI K;  4C2M K;  4OIQ A;  2E2H C;  1SFO C;  1TWF K;  3PO2 K;  4C3H K;  3CQZ C;  4XLN A;  3H0G K;  1YNN A;  3S17 K;  2NVX C;  1XPP A;  2E2J K;  2YU9 C;  4BBR C;  3GTP C;  3S1Q C;  4OIP A;  2JA7 K;  4QJV A;  2E2I C;  5IYD C;  3S2D K;  1WCM K;  2VUM C;  3GTM C;  3S1R K;  4A3M K;  4KN4 A;  2R93 C;  4AYB L;  1Y1W K;  3HOU K;  4QIW D;  1I50 K;  1K83 C;  4MEY A;  5IP9 C;  5FLM C;  5C3E C;  3HOW K;  4A3J C;  2JA6 C;  3HOV C;  1IW7 A;  3HKZ D;  3K7A C;  4OIN A;  1Y1V C;  2NVY C;  4A3L K;  4MQ9 A;  4NOI A;  3RZO K;  3PO3 K;  5IYB K;  4BBS C;  2Y0S L;  3S1M C;  3HOX K;  4C3I K;  4LK1 A;  2NVQ K;  3M4O K;  4Q5S A;  2CW0 A;  3I4N C;  3S1N C;  4JK1 A;  1I6H K;  2PMZ D;  2PA8 D;  1I3Q C;  1TWA K;  5D4D A;  2JA6 K;  2R7Z C;  2WAQ D;  3S16 C;  1HQM A;  4Y52 C;  3GTO C;  3GTJ C;  4BY1 C;  2PPB A;  3HOZ C;  3RZD C;  1TWC C;  3GTG C;  4XLP A;  4X6A C;  4Y7N C;  4A3D C;  4A3K K;  4BY7 K;  1TWG C;  5C4X K;  3GTL K;  4A3I C;  2JA8 K;  5M3M K;  2A6H A;  4A3E C;  4A3C C;  2E2H K;  1SFO K;  4A3G C;  2WB1 D;  2A6E A;  3CQZ K;  3S2H C;  3GTK C;  5IYC C;  2NVX K;  2YU9 K;  3EQL A;  3GTP K;  4BBR K;  5C44 C;  3M3Y C;  3S1Q K;  3S15 C;  2BE5 A;  2E2I K;  3GTQ C;  2O5J A;  5IYD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...