1TWAK

Rna polymerase ii complexed with atp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twaK00
4YFXA 5FLMC 5IP9K 3S1RC 4Y52C 5IP7K 3GTPK 2R7ZK 3CQZK 2E2IK 3S14C 4YFNA 1K83K 3HOVK 3S17K 4C3IK 4A3GC 4Y7NC 3GTMK 3CQZC 2Y0SL 3K7AC 2E2IC 2JA6K 4A3LK 4MEXA 4G7HA 3RZOK 4AYBL 2E2HK 1HQMA 2YU9K 2JA7C 3S17C 5C3EC 1Y1VK 5C44C 5IYDC 4Y7NK 3GTMC 4A3JK 3H0GK 2NVTC 3S2DK 4A3KK 2B63K 3GTLC 3EQLA 4KN4A 3HOUK 4Q5SA 1I50C 3HOXC 3M3YK 2JA8K 2JA5K 4OIRA 3S1NK 4A3BC 1I6HC 2R93K 4QIWD 5IYCC 5TMFA 4A3EK 1WCMK 1R9TK 4OINA 5FLMK 3S15C 3RZOC 4OIOA 4NOIA 3I4NC 1YNNA 4A3MK 1SMYA 1TWGK 2WB1L 4LLGA 3HOZK 4G7OA 3GTLK 3HOUC 4BXXC 1SFOC 3HOYC 4A3DC 3RZDK 2A6EA 4Q4ZA 4BY1C 1TWAK 5IYCK 2E2HC 2YU9C 2JA7K 1IW7A 1I6VA 3K7AK 2JA6C 2VUMC 4XLPA 4A3IC 4JK1A 2R92K 3S2HC 4KN7A 5IP9C 3GTPC 3H3VL 4GZYA 5M5YK 3S15K 2NVYC 1TWAC 5M5XK 4A3FK 2JA8C 3HKZL 4C2MK 4C3JK 3PO2K 3HOWK 3M4OK 4A3CK 1TWHC 4YG2A 4QJVA 3GTKC 2Y0SD 4MQ9A 3S14K 1I3QK 4OIPA 4XSZA 3GTGC 5D4DA 3GTJK 1SFOK 4A3GK 4BBSK 5TMCA 3HOXK 3I4MK 3M3YC 4A93K 4XLNA 4AYBD 3FKIC 4ZH4A 2A6HA 2NVQC 4C3HK 4LK1A 5C3EK 4X6AC 4QIWL 1Y1WC 3GTQC 4MEYA 3GTOC 2PMZD 2PA8D 3FKIK 4A3BK 2A68A 4BXXK 5C4XK 5M3FK 5M5WK 1Y1WK 3I4MC 3DXJA 3H0GC 4LK0A 4LJZA 2NVTK 1YNJA 5FJ8K 5IP7C 4Y52K 2WB1D 2BE5A 3GTQK 1WCMC 2NVYK 1TWFK 4A3IK 3GTOK 4BBRK 5IYBK 4A3JC 5M3MK 3H3VD 3RZDC 4OIQA 3PO2C 2CW0A 2WAQL 4A3EC 1R9TC 3S2HK 3HKZD 1TWFC 3S1QC 1I50K 4YFKA 2VUMK 3WODA 1I3QC 4A93C 2O5JA 1K83C 5C4JK 3S1MC 5IYBC 1TWGC 4G7ZA 4A3FC 2NVQK 3S1RK 1ZYRA 2O5IA 3HOWC 4XSXA 4BY7C 1TWHK 2WAQD 3GTKK 3HOZC 1TWCK 2JA5C 3S1NC 1I6HK 5IYDK 2PPBA 3HOYK 4A3DK 3PO3C 3S2DC 5C4JC 4A3CC 4KMUA 4BBSC 2NVXK 4BBRC 1TWCC 3S16C 1XPPA 3GTGK 2PMZL 4BY7K 4A3LC 3GTJC 2B63C 2R92C 4X6AK 2E2JC 2NVXC 3S16K 4QJVB 4A3MC 1Y1VC 5C44K 3S1MK 3HOVC 3M4OC 2PA8L 3PO3K 4A3KC 3S1QK 5C4XC 2R7ZC 2E2JK 1BDFA 4BY1K 3I4NK 2R93C 2A69A
chains in the Genus database with same CATH superfamily
5HL8A 3FOEA 4PABA 3OEPA 4P9SA 3GTPK 1Y1WA 1WOPA 1VH2A 2E2IK 4YFNA 1JQWA 2R93A 3S17K 1DD5A 3TTGA 3CQZC 3N3YA 3BUEA 3S0XA 4G7HA 3S17C 5C3EC 1G51A 4Q5SA 1IS1A 1JOEA 5IOTA 3GTLC 3HOUK 1B4BA 1I50C 2P8TA 5FLMK 4FZBA 3NUHA 4OIOA 3GTPA 3FOFA 1SMYA 2RH6A 1WIHA 1O2FB 1SFOC 1XXBA 2A6EA 4GTEA 4KDDA 2GAGC 2YU9C 2JA7K 1IW7A 1I6VA 3CAGA 4KB4A 1F93A 2R92K 1GE9A 3A8IA 3S15K 3BP3A 2JA8C 3HKZL 1TWHC 2Y0SD 3GEHA 4OIPA 4XSZA 3GTGC 4C3IC 3HOXK 3I4MK 4XLNA 4AYBD 2GSUA 5JFEA 4LK1A 3GTQC 2PHCB 1XZQB 2KWAA 4A3BK 1O27A 5C4XK 5M3FK 4BXXK 1Y1WK 3I4MC 4LK0A 1DCPA 1YNJA 5EGHA 3TFHA 1ZQ1C 5FJ8K 4Y52K 3AQPA 2BE5A 4PAAA 1WCMC 1TWFK 4C45A 1V5VA 1WOSA 3AD9C 1EQRA 4A3JC 3JSTA 5M3MK 4RMFA 5L46A 4C3HC 1L0WA 1I50K 2O5JA 3WODA 4A93C 5C4JK 5IYBC 2FQTA 1I3QA 3S1RK 2XCOA 4GTFA 4BY7C 2WAQD 1TWCK 1I6HK 5IYDK 1PJ7A 4A3DK 3MMLB 1O2AA 4KMAA 3PO3C 3S2DC 4KMUA 4GTLA 3N0BA 3GTGK 2PMZL 4AH6A 4A3LC 1USMA 3S1MK 2PA8L 3PO3K 3V4GA 3S1QK 1WSRA 2JA5A 4BY1K 2R93C 3PO2K 4KMDA 5FLMC 1WQFA 5IP7K 3S1RC 3S14C 2R7ZK 3ERED 3GEEA 3GDZA 2ZFZA 4C2MC 4A3GC 4KARA 3K7AC 4AYBL 4WILA 5IYDC 4A3JK 3H0GK 1KQ4A 4KM8A 2W7VA 3M3YK 2JA5K 4OIRA 5IYCC 5TMFA 1WCMK 1B4AA 1YNNA 1TWGK 3A8JA 4BXXC 4A3DC 1TWAK 2E2HC 4LQYA 2JA6C 4XLPA 4JK1A 3S2HC 3GTPC 3H3VL 1J6VA 1TWAC 1VLOA 5IOSA 1I50A 1ZXOA 1TWHA 4C3JK 3SZYA 3GTKC 5D4DA 3GTJK 3N0CA 5TMCA 3M3YC 3GEIA 4X6AC 1Y1WC 4O2DA 4MEYA 1K83A 2PMZD 2PA8D 1WSVA 3FKIK 2A68A 3H0GC 1WORA 3TFIA 5IP7C 2NVYK 3GTOK 4GTDA 5CJ9A 3PO2C 2WAQL 1IE0A 2E2IA 1F7UA 3S1QC 2VUMK 2EBBA 3S1MC 4P5BA 4A3FC 2NVQK 3HOWC 3OREA 4XSXA 3G4CA 3GTKK 3HOZC 4P5AA 3S1NC 4ILDA 5C4JC 2ZUFA 4A3CC 2CFAA 1TWCC 1XPPA 1XZPB 4BY7K 3GTJC 1EI6A 2E2JC 3L4JA 4A3MC 4BKWA 3HOVC 2NVYA 4KM9A 1F9NA 2V6UA 2A69A 3LAPA 5IP9K 4Y52C 3Q3QA 3CQZK 4G0WA 3FKIA 2YU9A 3HOVK 4GTBA 2V6SA 1O25A 4Y7NC 3GTMK 2E2IC 2JA6K 4BLBA 4MEXA 1Y1VA 3RZOK 2E2HK 1HQMA 1Y1VK 5C44C 1AB4A 4A3KK 3GSIA 2B63K 3EQLA 5EGEA 3HOXC 4A3BC 3S1NK 5IORA 3BP8C 4QIWD 3T01A 4A3EK 1R9TK 4OINA 3RZOC 4NOIA 3QX3A 3I4NC 4A3MK 2WB1L 4G7OA 5E68A 1BS2A 4BY1C 1PJ6A 1EK8A 3K7AK 2GSNA 4WJ3M 4A3IC 4KN7A 3TFJA 1C0AA 2NVYC 3T00A 4A3FK 3GTKA 3M4OK 1WCMA 1J98A 4A3CK 1VJEA 4MQ9A 1I3QK 4XCHA 3LPXA 1SFOK 4A3GK 4BBSK 3GIRA 4A93K 4ZH4A 2NVQC 3GTQA 4C3HK 2JA6A 3A8KA 3ADAC 3HXAA 5C3EK 5IOQA 2R7ZA 3DXJA 2V6TA 4C3JC 2B63A 2GSOA 5TJ3A 2D6FC 5JVOA 4KATA 3GTMA 3H3VD 3RZDC 2P5MA 2CW0A 4A3EC 1R9TC 1TWFC 2XCRB 4GTCA 4YFKA 1I3QC 1K83C 4FM9A 1TWGC 1BGWA 1VRQC 1ZYRA 3T02A 2O5IA 1DCHA 1TWHK 2JA5C 2PPBA 3HOYK 1JVIA 1XXCA 4J3NA 3FHZA 2XCQA 4BBSC 1YX2A 2NVXK 3S16C 2NVXA 2FQOA 3AH5A 2R92A 3GTLA 4BLAA 2B63C 2R92C 4X6AK 1UV7A 4DDQA 4QJVB 2NVXC 3S16K 1Y1VC 5CHPA 1TWAA 5C44K 3M4OC 1J6WA 5C4XC 2R7ZC 1RU0A 2E2JK 1BDFA 3I4NK 4YFXA 4LR2A 2VUMA 1O26A 2E2HA 1K83K 1WQGA 2JH3A 4C3IK 2Y3PA 4KB2A 2Y0SL 3AQOA 4A3LK 2YU9K 1IL2A 2JA7C 1IQ0A 3SZZA 3GTJA 4Y7NK 3GTMC 2NVTC 3S2DK 1PJ5A 4KN4A 2JA8K 1I6HC 2R93K 3S15C 1O24A 3VA7A 4LLGA 3HOZK 3OPFA 3GTLK 3HOUC 1YCLA 4GTAA 3HOYC 3RZDK 4Q4ZA 3AD7C 5IYCK 1INNA 1WQHA 1SFOA 1DCOA 2VUMC 4LOWA 1ZBSA 5IP9C 4GZYA 5M5YK 5M5XK 1USOA 4C2MK 1J6XA 3LAJA 3HOWK 1IBAA 4G0UA 4KASA 4QJVA 4YG2A 3S14K 3H0GA 1XZPA 4GFQA 1ISEA 3GTOA 3FKIC 4GT9A 2A6HA 1O29A 4QIWL 1BJTA 1TWGA 1F7VA 3GTOC 2RGRA 1TWFA 1HI9A 5M5WK 2NVTK 4LJZA 1R9TA 1XZQA 1VGXA 1ZVUA 2WB1D 3GTQK 3AD8C 4M1XA 4A3IK 1WOOA 4BBRK 5IYBK 4OIQA 2ZUEA 4WJ4A 3S2HK 3CQZA 3HKZD 4KC6A 4G0VA 4G7ZA 1EFWA 2GAHC 4KAWX 1X31C 3GTGA 2CFAB 3IPJA 4BBRC 3G4AA 3L4KA 1O2BA 1EH1A 1TWCA 2JA7A 4KMHA 1O28A 4A3KC 1XXAA
chains in the Genus database with same CATH topology
4YFXA 5FLMC 5IP9K 3S1RC 4Y52C 5IP7K 3GTPK 2R7ZK 3CQZK 2E2IK 3S14C 4YFNA 1K83K 3HOVK 3S17K 4C3IK 4A3GC 4Y7NC 3GTMK 3CQZC 2Y0SL 3K7AC 2E2IC 2JA6K 4A3LK 4MEXA 4G7HA 3RZOK 4AYBL 2E2HK 1HQMA 2YU9K 2JA7C 3S17C 5C3EC 1Y1VK 5C44C 5IYDC 4Y7NK 3GTMC 4A3JK 3H0GK 2NVTC 3S2DK 4A3KK 2B63K 3GTLC 3EQLA 4KN4A 3HOUK 4Q5SA 1I50C 3HOXC 3M3YK 2JA8K 2JA5K 4OIRA 3S1NK 4A3BC 1I6HC 2R93K 4QIWD 5IYCC 5TMFA 4A3EK 1WCMK 1R9TK 4OINA 5FLMK 3S15C 3RZOC 4OIOA 4NOIA 3I4NC 1YNNA 4A3MK 1SMYA 1TWGK 2WB1L 4LLGA 3HOZK 4G7OA 3GTLK 3HOUC 4BXXC 1SFOC 3HOYC 4A3DC 3RZDK 2A6EA 4Q4ZA 4BY1C 1TWAK 5IYCK 2E2HC 2YU9C 2JA7K 1IW7A 1I6VA 3K7AK 2JA6C 2VUMC 4XLPA 4A3IC 4JK1A 2R92K 3S2HC 4KN7A 5IP9C 3GTPC 3H3VL 4GZYA 5M5YK 3S15K 2NVYC 1TWAC 5M5XK 4A3FK 2JA8C 3HKZL 4C2MK 4C3JK 3PO2K 3HOWK 3M4OK 4A3CK 1TWHC 4YG2A 4QJVA 3GTKC 2Y0SD 4MQ9A 3S14K 1I3QK 4OIPA 4XSZA 3GTGC 5D4DA 3GTJK 1SFOK 4A3GK 4BBSK 5TMCA 3HOXK 3I4MK 3M3YC 4A93K 4XLNA 4AYBD 3FKIC 4ZH4A 2A6HA 2NVQC 4C3HK 4LK1A 5C3EK 4X6AC 4QIWL 1Y1WC 3GTQC 4MEYA 3GTOC 2PMZD 2PA8D 3FKIK 4A3BK 2A68A 4BXXK 5C4XK 5M3FK 5M5WK 1Y1WK 3I4MC 3DXJA 3H0GC 4LK0A 4LJZA 2NVTK 1YNJA 5FJ8K 5IP7C 4Y52K 2WB1D 2BE5A 3GTQK 1WCMC 2NVYK 1TWFK 4A3IK 3GTOK 4BBRK 5IYBK 4A3JC 5M3MK 3H3VD 3RZDC 4OIQA 3PO2C 2CW0A 2WAQL 4A3EC 1R9TC 3S2HK 3HKZD 1TWFC 3S1QC 1I50K 4YFKA 2VUMK 3WODA 1I3QC 4A93C 2O5JA 1K83C 5C4JK 3S1MC 5IYBC 1TWGC 4G7ZA 4A3FC 2NVQK 3S1RK 1ZYRA 2O5IA 3HOWC 4XSXA 4BY7C 1TWHK 2WAQD 3GTKK 3HOZC 1TWCK 2JA5C 3S1NC 1I6HK 5IYDK 2PPBA 3HOYK 4A3DK 3PO3C 3S2DC 5C4JC 4A3CC 4KMUA 4BBSC 2NVXK 4BBRC 1TWCC 3S16C 1XPPA 3GTGK 2PMZL 4BY7K 4A3LC 3GTJC 2B63C 2R92C 4X6AK 2E2JC 2NVXC 3S16K 4QJVB 4A3MC 1Y1VC 5C44K 3S1MK 3HOVC 3M4OC 2PA8L 3PO3K 4A3KC 3S1QK 5C4XC 2R7ZC 2E2JK 1BDFA 4BY1K 3I4NK 2R93C 2A69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFX A;  5FLM C;  5IP9 K;  3S1R C;  4Y52 C;  5IP7 K;  3GTP K;  2R7Z K;  3CQZ K;  2E2I K;  3S14 C;  4YFN A;  1K83 K;  3HOV K;  3S17 K;  4C3I K;  4A3G C;  4Y7N C;  3GTM K;  3CQZ C;  2Y0S L;  3K7A C;  2E2I C;  2JA6 K;  4A3L K;  4MEX A;  4G7H A;  3RZO K;  4AYB L;  2E2H K;  1HQM A;  2YU9 K;  2JA7 C;  3S17 C;  5C3E C;  1Y1V K;  5C44 C;  5IYD C;  4Y7N K;  3GTM C;  4A3J K;  3H0G K;  2NVT C;  3S2D K;  4A3K K;  2B63 K;  3GTL C;  3EQL A;  4KN4 A;  3HOU K;  4Q5S A;  1I50 C;  3HOX C;  3M3Y K;  2JA8 K;  2JA5 K;  4OIR A;  3S1N K;  4A3B C;  1I6H C;  2R93 K;  4QIW D;  5IYC C;  5TMF A;  4A3E K;  1WCM K;  1R9T K;  4OIN A;  5FLM K;  3S15 C;  3RZO C;  4OIO A;  4NOI A;  3I4N C;  1YNN A;  4A3M K;  1SMY A;  1TWG K;  2WB1 L;  4LLG A;  3HOZ K;  4G7O A;  3GTL K;  3HOU C;  4BXX C;  1SFO C;  3HOY C;  4A3D C;  3RZD K;  2A6E A;  4Q4Z A;  4BY1 C;  1TWA K;  5IYC K;  2E2H C;  2YU9 C;  2JA7 K;  1IW7 A;  1I6V A;  3K7A K;  2JA6 C;  2VUM C;  4XLP A;  4A3I C;  4JK1 A;  2R92 K;  3S2H C;  4KN7 A;  5IP9 C;  3GTP C;  3H3V L;  4GZY A;  5M5Y K;  3S15 K;  2NVY C;  1TWA C;  5M5X K;  4A3F K;  2JA8 C;  3HKZ L;  4C2M K;  4C3J K;  3PO2 K;  3HOW K;  3M4O K;  4A3C K;  1TWH C;  4YG2 A;  4QJV A;  3GTK C;  2Y0S D;  4MQ9 A;  3S14 K;  1I3Q K;  4OIP A;  4XSZ A;  3GTG C;  5D4D A;  3GTJ K;  1SFO K;  4A3G K;  4BBS K;  5TMC A;  3HOX K;  3I4M K;  3M3Y C;  4A93 K;  4XLN A;  4AYB D;  3FKI C;  4ZH4 A;  2A6H A;  2NVQ C;  4C3H K;  4LK1 A;  5C3E K;  4X6A C;  4QIW L;  1Y1W C;  3GTQ C;  4MEY A;  3GTO C;  2PMZ D;  2PA8 D;  3FKI K;  4A3B K;  2A68 A;  4BXX K;  5C4X K;  5M3F K;  5M5W K;  1Y1W K;  3I4M C;  3DXJ A;  3H0G C;  4LK0 A;  4LJZ A;  2NVT K;  1YNJ A;  5FJ8 K;  5IP7 C;  4Y52 K;  2WB1 D;  2BE5 A;  3GTQ K;  1WCM C;  2NVY K;  1TWF K;  4A3I K;  3GTO K;  4BBR K;  5IYB K;  4A3J C;  5M3M K;  3H3V D;  3RZD C;  4OIQ A;  3PO2 C;  2CW0 A;  2WAQ L;  4A3E C;  1R9T C;  3S2H K;  3HKZ D;  1TWF C;  3S1Q C;  1I50 K;  4YFK A;  2VUM K;  3WOD A;  1I3Q C;  4A93 C;  2O5J A;  1K83 C;  5C4J K;  3S1M C;  5IYB C;  1TWG C;  4G7Z A;  4A3F C;  2NVQ K;  3S1R K;  1ZYR A;  2O5I A;  3HOW C;  4XSX A;  4BY7 C;  1TWH K;  2WAQ D;  3GTK K;  3HOZ C;  1TWC K;  2JA5 C;  3S1N C;  1I6H K;  5IYD K;  2PPB A;  3HOY K;  4A3D K;  3PO3 C;  3S2D C;  5C4J C;  4A3C C;  4KMU A;  4BBS C;  2NVX K;  4BBR C;  1TWC C;  3S16 C;  1XPP A;  3GTG K;  2PMZ L;  4BY7 K;  4A3L C;  3GTJ C;  2B63 C;  2R92 C;  4X6A K;  2E2J C;  2NVX C;  3S16 K;  4QJV B;  4A3M C;  1Y1V C;  5C44 K;  3S1M K;  3HOV C;  3M4O C;  2PA8 L;  3PO3 K;  4A3K C;  3S1Q K;  5C4X C;  2R7Z C;  2E2J K;  1BDF A;  4BY1 K;  3I4N K;  2R93 C;  2A69 A; 
#chains in the Genus database with same CATH topology
 5HL8 A;  3FOE A;  4PAB A;  3OEP A;  4P9S A;  3GTP K;  1Y1W A;  1WOP A;  1VH2 A;  2E2I K;  4YFN A;  1JQW A;  2R93 A;  3S17 K;  1DD5 A;  3TTG A;  3CQZ C;  3N3Y A;  3BUE A;  3S0X A;  4G7H A;  3S17 C;  5C3E C;  1G51 A;  4Q5S A;  1IS1 A;  1JOE A;  5IOT A;  3GTL C;  3HOU K;  1B4B A;  1I50 C;  2P8T A;  5FLM K;  4FZB A;  3NUH A;  4OIO A;  3GTP A;  3FOF A;  1SMY A;  2RH6 A;  1WIH A;  1O2F B;  1SFO C;  1XXB A;  2A6E A;  4GTE A;  4KDD A;  2GAG C;  2YU9 C;  2JA7 K;  1IW7 A;  1I6V A;  3CAG A;  4KB4 A;  1F93 A;  2R92 K;  1GE9 A;  3A8I A;  3S15 K;  3BP3 A;  2JA8 C;  3HKZ L;  1TWH C;  2Y0S D;  3GEH A;  4OIP A;  4XSZ A;  3GTG C;  4C3I C;  3HOX K;  3I4M K;  4XLN A;  4AYB D;  2GSU A;  5JFE A;  4LK1 A;  3GTQ C;  2PHC B;  1XZQ B;  2KWA A;  4A3B K;  1O27 A;  5C4X K;  5M3F K;  4BXX K;  1Y1W K;  3I4M C;  4LK0 A;  1DCP A;  1YNJ A;  5EGH A;  3TFH A;  1ZQ1 C;  5FJ8 K;  4Y52 K;  3AQP A;  2BE5 A;  4PAA A;  1WCM C;  1TWF K;  4C45 A;  1V5V A;  1WOS A;  3AD9 C;  1EQR A;  4A3J C;  3JST A;  5M3M K;  4RMF A;  5L46 A;  4C3H C;  1L0W A;  1I50 K;  2O5J A;  3WOD A;  4A93 C;  5C4J K;  5IYB C;  2FQT A;  1I3Q A;  3S1R K;  2XCO A;  4GTF A;  4BY7 C;  2WAQ D;  1TWC K;  1I6H K;  5IYD K;  1PJ7 A;  4A3D K;  3MML B;  1O2A A;  4KMA A;  3PO3 C;  3S2D C;  4KMU A;  4GTL A;  3N0B A;  3GTG K;  2PMZ L;  4AH6 A;  4A3L C;  1USM A;  3S1M K;  2PA8 L;  3PO3 K;  3V4G A;  3S1Q K;  1WSR A;  2JA5 A;  4BY1 K;  2R93 C;  3PO2 K;  4KMD A;  5FLM C;  1WQF A;  5IP7 K;  3S1R C;  3S14 C;  2R7Z K;  3ERE D;  3GEE A;  3GDZ A;  2ZFZ A;  4C2M C;  4A3G C;  4KAR A;  3K7A C;  4AYB L;  4WIL A;  5IYD C;  4A3J K;  3H0G K;  1KQ4 A;  4KM8 A;  2W7V A;  3M3Y K;  2JA5 K;  4OIR A;  5IYC C;  5TMF A;  1WCM K;  1B4A A;  1YNN A;  1TWG K;  3A8J A;  4BXX C;  4A3D C;  1TWA K;  2E2H C;  4LQY A;  2JA6 C;  4XLP A;  4JK1 A;  3S2H C;  3GTP C;  3H3V L;  1J6V A;  1TWA C;  1VLO A;  5IOS A;  1I50 A;  1ZXO A;  1TWH A;  4C3J K;  3SZY A;  3GTK C;  5D4D A;  3GTJ K;  3N0C A;  5TMC A;  3M3Y C;  3GEI A;  4X6A C;  1Y1W C;  4O2D A;  4MEY A;  1K83 A;  2PMZ D;  2PA8 D;  1WSV A;  3FKI K;  2A68 A;  3H0G C;  1WOR A;  3TFI A;  5IP7 C;  2NVY K;  3GTO K;  4GTD A;  5CJ9 A;  3PO2 C;  2WAQ L;  1IE0 A;  2E2I A;  1F7U A;  3S1Q C;  2VUM K;  2EBB A;  3S1M C;  4P5B A;  4A3F C;  2NVQ K;  3HOW C;  3ORE A;  4XSX A;  3G4C A;  3GTK K;  3HOZ C;  4P5A A;  3S1N C;  4ILD A;  5C4J C;  2ZUF A;  4A3C C;  2CFA A;  1TWC C;  1XPP A;  1XZP B;  4BY7 K;  3GTJ C;  1EI6 A;  2E2J C;  3L4J A;  4A3M C;  4BKW A;  3HOV C;  2NVY A;  4KM9 A;  1F9N A;  2V6U A;  2A69 A;  3LAP A;  5IP9 K;  4Y52 C;  3Q3Q A;  3CQZ K;  4G0W A;  3FKI A;  2YU9 A;  3HOV K;  4GTB A;  2V6S A;  1O25 A;  4Y7N C;  3GTM K;  2E2I C;  2JA6 K;  4BLB A;  4MEX A;  1Y1V A;  3RZO K;  2E2H K;  1HQM A;  1Y1V K;  5C44 C;  1AB4 A;  4A3K K;  3GSI A;  2B63 K;  3EQL A;  5EGE A;  3HOX C;  4A3B C;  3S1N K;  5IOR A;  3BP8 C;  4QIW D;  3T01 A;  4A3E K;  1R9T K;  4OIN A;  3RZO C;  4NOI A;  3QX3 A;  3I4N C;  4A3M K;  2WB1 L;  4G7O A;  5E68 A;  1BS2 A;  4BY1 C;  1PJ6 A;  1EK8 A;  3K7A K;  2GSN A;  4WJ3 M;  4A3I C;  4KN7 A;  3TFJ A;  1C0A A;  2NVY C;  3T00 A;  4A3F K;  3GTK A;  3M4O K;  1WCM A;  1J98 A;  4A3C K;  1VJE A;  4MQ9 A;  1I3Q K;  4XCH A;  3LPX A;  1SFO K;  4A3G K;  4BBS K;  3GIR A;  4A93 K;  4ZH4 A;  2NVQ C;  3GTQ A;  4C3H K;  2JA6 A;  3A8K A;  3ADA C;  3HXA A;  5C3E K;  5IOQ A;  2R7Z A;  3DXJ A;  2V6T A;  4C3J C;  2B63 A;  2GSO A;  5TJ3 A;  2D6F C;  5JVO A;  4KAT A;  3GTM A;  3H3V D;  3RZD C;  2P5M A;  2CW0 A;  4A3E C;  1R9T C;  1TWF C;  2XCR B;  4GTC A;  4YFK A;  1I3Q C;  1K83 C;  4FM9 A;  1TWG C;  1BGW A;  1VRQ C;  1ZYR A;  3T02 A;  2O5I A;  1DCH A;  1TWH K;  2JA5 C;  2PPB A;  3HOY K;  1JVI A;  1XXC A;  4J3N A;  3FHZ A;  2XCQ A;  4BBS C;  1YX2 A;  2NVX K;  3S16 C;  2NVX A;  2FQO A;  3AH5 A;  2R92 A;  3GTL A;  4BLA A;  2B63 C;  2R92 C;  4X6A K;  1UV7 A;  4DDQ A;  4QJV B;  2NVX C;  3S16 K;  1Y1V C;  5CHP A;  1TWA A;  5C44 K;  3M4O C;  1J6W A;  5C4X C;  2R7Z C;  1RU0 A;  2E2J K;  1BDF A;  3I4N K;  4YFX A;  4LR2 A;  2VUM A;  1O26 A;  2E2H A;  1K83 K;  1WQG A;  2JH3 A;  4C3I K;  2Y3P A;  4KB2 A;  2Y0S L;  3AQO A;  4A3L K;  2YU9 K;  1IL2 A;  2JA7 C;  1IQ0 A;  3SZZ A;  3GTJ A;  4Y7N K;  3GTM C;  2NVT C;  3S2D K;  1PJ5 A;  4KN4 A;  2JA8 K;  1I6H C;  2R93 K;  3S15 C;  1O24 A;  3VA7 A;  4LLG A;  3HOZ K;  3OPF A;  3GTL K;  3HOU C;  1YCL A;  4GTA A;  3HOY C;  3RZD K;  4Q4Z A;  3AD7 C;  5IYC K;  1INN A;  1WQH A;  1SFO A;  1DCO A;  2VUM C;  4LOW A;  1ZBS A;  5IP9 C;  4GZY A;  5M5Y K;  5M5X K;  1USO A;  4C2M K;  1J6X A;  3LAJ A;  3HOW K;  1IBA A;  4G0U A;  4KAS A;  4QJV A;  4YG2 A;  3S14 K;  3H0G A;  1XZP A;  4GFQ A;  1ISE A;  3GTO A;  3FKI C;  4GT9 A;  2A6H A;  1O29 A;  4QIW L;  1BJT A;  1TWG A;  1F7V A;  3GTO C;  2RGR A;  1TWF A;  1HI9 A;  5M5W K;  2NVT K;  4LJZ A;  1R9T A;  1XZQ A;  1VGX A;  1ZVU A;  2WB1 D;  3GTQ K;  3AD8 C;  4M1X A;  4A3I K;  1WOO A;  4BBR K;  5IYB K;  4OIQ A;  2ZUE A;  4WJ4 A;  3S2H K;  3CQZ A;  3HKZ D;  4KC6 A;  4G0V A;  4G7Z A;  1EFW A;  2GAH C;  4KAW X;  1X31 C;  3GTG A;  2CFA B;  3IPJ A;  4BBR C;  3G4A A;  3L4K A;  1O2B A;  1EH1 A;  1TWC A;  2JA7 A;  4KMH A;  1O28 A;  4A3K C;  1XXA A; 
#chains in the Genus database with same CATH homology
 4YFX A;  5FLM C;  5IP9 K;  3S1R C;  4Y52 C;  5IP7 K;  3GTP K;  2R7Z K;  3CQZ K;  2E2I K;  3S14 C;  4YFN A;  1K83 K;  3HOV K;  3S17 K;  4C3I K;  4A3G C;  4Y7N C;  3GTM K;  3CQZ C;  2Y0S L;  3K7A C;  2E2I C;  2JA6 K;  4A3L K;  4MEX A;  4G7H A;  3RZO K;  4AYB L;  2E2H K;  1HQM A;  2YU9 K;  2JA7 C;  3S17 C;  5C3E C;  1Y1V K;  5C44 C;  5IYD C;  4Y7N K;  3GTM C;  4A3J K;  3H0G K;  2NVT C;  3S2D K;  4A3K K;  2B63 K;  3GTL C;  3EQL A;  4KN4 A;  3HOU K;  4Q5S A;  1I50 C;  3HOX C;  3M3Y K;  2JA8 K;  2JA5 K;  4OIR A;  3S1N K;  4A3B C;  1I6H C;  2R93 K;  4QIW D;  5IYC C;  5TMF A;  4A3E K;  1WCM K;  1R9T K;  4OIN A;  5FLM K;  3S15 C;  3RZO C;  4OIO A;  4NOI A;  3I4N C;  1YNN A;  4A3M K;  1SMY A;  1TWG K;  2WB1 L;  4LLG A;  3HOZ K;  4G7O A;  3GTL K;  3HOU C;  4BXX C;  1SFO C;  3HOY C;  4A3D C;  3RZD K;  2A6E A;  4Q4Z A;  4BY1 C;  1TWA K;  5IYC K;  2E2H C;  2YU9 C;  2JA7 K;  1IW7 A;  1I6V A;  3K7A K;  2JA6 C;  2VUM C;  4XLP A;  4A3I C;  4JK1 A;  2R92 K;  3S2H C;  4KN7 A;  5IP9 C;  3GTP C;  3H3V L;  4GZY A;  5M5Y K;  3S15 K;  2NVY C;  1TWA C;  5M5X K;  4A3F K;  2JA8 C;  3HKZ L;  4C2M K;  4C3J K;  3PO2 K;  3HOW K;  3M4O K;  4A3C K;  1TWH C;  4YG2 A;  4QJV A;  3GTK C;  2Y0S D;  4MQ9 A;  3S14 K;  1I3Q K;  4OIP A;  4XSZ A;  3GTG C;  5D4D A;  3GTJ K;  1SFO K;  4A3G K;  4BBS K;  5TMC A;  3HOX K;  3I4M K;  3M3Y C;  4A93 K;  4XLN A;  4AYB D;  3FKI C;  4ZH4 A;  2A6H A;  2NVQ C;  4C3H K;  4LK1 A;  5C3E K;  4X6A C;  4QIW L;  1Y1W C;  3GTQ C;  4MEY A;  3GTO C;  2PMZ D;  2PA8 D;  3FKI K;  4A3B K;  2A68 A;  4BXX K;  5C4X K;  5M3F K;  5M5W K;  1Y1W K;  3I4M C;  3DXJ A;  3H0G C;  4LK0 A;  4LJZ A;  2NVT K;  1YNJ A;  5FJ8 K;  5IP7 C;  4Y52 K;  2WB1 D;  2BE5 A;  3GTQ K;  1WCM C;  2NVY K;  1TWF K;  4A3I K;  3GTO K;  4BBR K;  5IYB K;  4A3J C;  5M3M K;  3H3V D;  3RZD C;  4OIQ A;  3PO2 C;  2CW0 A;  2WAQ L;  4A3E C;  1R9T C;  3S2H K;  3HKZ D;  1TWF C;  3S1Q C;  1I50 K;  4YFK A;  2VUM K;  3WOD A;  1I3Q C;  4A93 C;  2O5J A;  1K83 C;  5C4J K;  3S1M C;  5IYB C;  1TWG C;  4G7Z A;  4A3F C;  2NVQ K;  3S1R K;  1ZYR A;  2O5I A;  3HOW C;  4XSX A;  4BY7 C;  1TWH K;  2WAQ D;  3GTK K;  3HOZ C;  1TWC K;  2JA5 C;  3S1N C;  1I6H K;  5IYD K;  2PPB A;  3HOY K;  4A3D K;  3PO3 C;  3S2D C;  5C4J C;  4A3C C;  4KMU A;  4BBS C;  2NVX K;  4BBR C;  1TWC C;  3S16 C;  1XPP A;  3GTG K;  2PMZ L;  4BY7 K;  4A3L C;  3GTJ C;  2B63 C;  2R92 C;  4X6A K;  2E2J C;  2NVX C;  3S16 K;  4QJV B;  4A3M C;  1Y1V C;  5C44 K;  3S1M K;  3HOV C;  3M4O C;  2PA8 L;  3PO3 K;  4A3K C;  3S1Q K;  5C4X C;  2R7Z C;  2E2J K;  1BDF A;  4BY1 K;  3I4N K;  2R93 C;  2A69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...