1TWAK

Rna polymerase ii complexed with atp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 25
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twaK00
2A6HA 4KN4A 3HOXK 1TWHC 5M5WK 4C3HK 2WAQL 1BDFA 2A6EA 2NVTC 2JA5C 3S17K 2JA8C 4OIRA 5C4XC 3S1NK 5M5XK 4OINA 3K7AC 5C4JK 3S1RC 3GTLC 1WCMC 4A3DC 5M3MK 2WB1L 1HQMA 5M5YK 4OIOA 5IYBK 5FJ8K 3GTJK 3HOYK 4X6AK 4A3MC 4Y7NK 3S2HC 3S2DK 1TWCK 1I6HC 1Y1VK 3S15K 1ZYRA 4BBRC 3RZDK 2R93C 4YFNA 5FLMK 3FKIC 4BY1K 3HOUK 4BBSK 3GTOC 3HOXC 4QIWD 4A3BC 5IYCC 3M3YC 3I4MK 3GTMC 3GTQK 4A3LC 2BE5A 5IYDK 2JA8K 4G7OA 4LK1A 3S1NC 2R92K 3H0GK 4BY7K 3S16C 2E2JC 3HOZK 2PPBA 1TWGK 2PA8L 3HOVC 3RZOC 1K83K 4LK0A 3EQLA 3PO3C 2WAQD 2PA8D 4Y7NC 3S2DC 3HKZD 4YFXA 3HOWC 1Y1VC 4A93C 5C44K 4A3KK 4BY7C 4A3CC 1YNNA 5M3FK 2E2IC 4AYBL 4G7ZA 3M4OK 3I4NK 2WB1D 4A3FK 3HOUC 1I6VA 4A3GK 5TMFA 3I4MC 4Q4ZA 3GTQC 3GTMK 4A3LK 3PO2K 2A68A 4MQ9A 2Y0SD 2JA5K 4MEYA 2E2JK 3HOZC 3S1MC 2NVYK 3HOVK 4GZYA 1R9TC 2JA7K 4Q5SA 4Y52K 3S1RK 5IP9C 5IP7K 1Y1WK 1SFOK 4A3DK 2VUMC 1I50K 1I3QC 3S1QC 3GTPC 1IW7A 4A93K 5C44C 3CQZK 4A3KC 2NVQK 2O5IA 3S2HK 4A3CK 4XSXA 1TWFC 1I6HK 3M4OC 2YU9K 2R7ZC 2O5JA 2A69A 2PMZD 3H3VL 3S14K 4BXXC 2NVXC 3FKIK 4BBSC 4LJZA 3GTOK 3S17C 4QIWL 4OIQA 4A3BK 4A3JK 3PO2C 3K7AK 3GTKK 3GTGC 1WCMK 5IYDC 4KMUA 3S1MK 2NVYC 2E2HK 4KN7A 3H0GC 4QJVA 4AYBD 5IYBC 3GTJC 2R92C 3HOYC 3S16K 4C3JK 4A3MK 2B63C 3RZOK 1SMYA 1TWCC 4ZH4A 4A3IC 2JA6K 4XSZA 4BBRK 4A3EK 3PO3K 3GTPK 2Y0SL 1TWAC 3WODA 3CQZC 2NVQC 4NOIA 4LLGA 1TWFK 5C3EC 4C3IK 2YU9C 2R7ZK 2E2IK 3S14C 5IYCK 3M3YK 4BXXK 2NVXK 1TWHK 3DXJA 4A3FC 4JK1A 4MEXA 2NVTK 4A3JC 4XLNA 4A3GC 3GTKC 3GTGK 5C4XK 4XLPA 1TWGC 1K83C 3HKZL 5C4JC 4C2MK 2E2HC 5D4DA 2PMZL 1XPPA 3GTLK 3H3VD 2B63K 2CW0A 4YFKA 4Y52C 4A3IK 1R9TK 2JA7C 4G7HA 2JA6C 4A3EC 3HOWK 5IP9K 5IP7C 1Y1WC 1SFOC 2VUMK 1TWAK 3S15C 3RZDC 3I4NC 4QJVB 1I3QK 1I50C 4YG2A 2R93K 4X6AC 3S1QK 5C3EK 4OIPA 5FLMC 1YNJA 4BY1C 5TMCA
chains in the Genus database with same CATH superfamily
4KN4A 3HOXK 1EQRA 1J6XA 2A6EA 1ZVUA 3H0GA 1C0AA 1WQFA 1WQHA 4OIRA 5C4XC 3S1NK 3AQOA 2VUMA 4LOWA 2WB1L 3BP8C 5IYBK 5FJ8K 4X6AK 1WSVA 4A3MC 3S2DK 1Y1VK 2R93C 1TWAA 5FLMK 4BBSK 3HOUK 1ISEA 4QIWD 1IE0A 3M3YC 3GTQK 4G7OA 4P5AA 3TTGA 2PPBA 1K83K 1O28A 4Y7NC 1Y1VC 4A93C 5C44K 4A3KK 2V6SA 2JA6A 1G51A 3HXAA 1I6VA 5TMFA 4Q4ZA 3GTQC 3VA7A 2YU9A 4J3NA 3AH5A 4MQ9A 1EFWA 3GTPA 5IOSA 2JA5K 1WOSA 1O26A 4MEYA 2GSNA 2NVYK 4Q5SA 1R9TC 4Y52K 4M1XA 1O27A 5IP9C 1SFOK 2VUMC 1WIHA 1JVIA 1TWFA 3V4GA 1WOPA 1IW7A 2XCOA 4A3CK 3CQZK 4A93K 2O5IA 3S2HK 4XSXA 4GTFA 4BXXC 1ZBSA 5TJ3A 4BKWA 3N0BA 3FKIK 1BGWA 2P8TA 4OIQA 4A3BK 1VJEA 1J6VA 3PO2C 5IYDC 2NVYC 2R92C 4AYBD 5IYBC 3HOYC 1EK8A 1WQGA 4KC6A 3RZOK 1TWCC 1V5VA 2JA6K 1TWAC 1O2BA 4LLGA 3AD9C 1O2AA 5C3EC 3GTMA 3GDZA 2E2IK 4BXXK 5IYCK 1K83A 5EGHA 4MEXA 2NVTK 4XLNA 4KM9A 5D4DA 2PMZL 1XPPA 3IPJA 3GTJA 2B63K 4A3IK 3Q3QA 4A3EC 2JA6C 1Y1WC 1TWAK 2Y3PA 3RZDC 1I50C 4GTEA 3S1QK 5CJ9A 2A6HA 3FOFA 4RMFA 1BJTA 2JA8C 3CAGA 4FZBA 5C4JK 3GTLC 1HQMA 4KB4A 3GTJK 2GAGC 3S2HC 1I6HC 1WOOA 3RZDK 4BBRC 1PJ6A 4YFNA 2KWAA 3OREA 3OEPA 3FHZA 3I4MK 3GTMC 2BE5A 1I3QA 2JA8K 4LK1A 2ZUFA 1TWGK 3HOVC 4LK0A 1DCHA 2NVXA 4KASA 3HKZD 3ERED 1YNNA 2E2IC 3A8KA 3G4AA 4O2DA 2R7ZA 4A3LK 2GSUA 3CQZA 3GEEA 2V6TA 2E2JK 3S1MC 4GZYA 1Y1WK 5IP7K 3N3YA 1I50K 3GTPC 3T02A 3L4KA 2YU9K 2P5MA 2A69A 2PMZD 4G0VA 3S14K 3GIRA 4LJZA 3S17C 4KM8A 2ZFZA 3AD7C 1IBAA 4C45A 2GAHC 3K7AK 3GTKK 1KQ4A 3S1MK 4C2MC 4KN7A 4WJ3M 3S16K 2JA7A 4XSZA 5EGEA 4BBRK 3PO3K 2XCRB 4C3IK 2YU9C 3S0XA 1XZQA 1TWHK 1WORA 3DXJA 4JK1A 1XZPA 4A3GC 2EBBA 2R92A 1TWGC 2GSOA 4GTBA 3FOEA 4G0UA 4PABA 3H3VD 4YFKA 4Y52C 1R9TK 2JA7C 1F93A 4G7HA 3HOWK 1JQWA 5IP9K 2VUMK 1EI6A 3S15C 3LAPA 4QJVB 4WJ4A 4C3IC 5FLMC 3HOUC 3OPFA 4LR2A 1TWHC 5M5WK 5JVOA 1TWGA 1XXAA 1INNA 1TWCA 5M5XK 2R93A 3TFIA 4OINA 4GTLA 3S1RC 5M5YK 3GEIA 4KMAA 4P9SA 4OIOA 3HOYK 4BLAA 4WILA 4Y7NK 1TWCK 5L46A 3S15K 1ZYRA 3QX3A 1O2FB 2FQOA 2PHCB 4BY1K 3HOXC 5IYCC 3S1NC 5IOTA 4BY7K 3S16C 3HOZK 4PAAA 3EQLA 3PO3C 2WAQD 3S2DC 4YFXA 4A3CC 5M3FK 1F9NA 3M4OK 3I4NK 4GT9A 3GSIA 4A3GK 1VLOA 2D6FC 2E2HA 4LQYA 4GTDA 4GTCA 4P5BA 3PO2K 3LPXA 3HOZC 2JA7K 3A8JA 4A3DK 5C44C 4A3KC 2NVQK 1IS1A 3GTKA 4GFQA 1TWFC 1I6HK 3M4OC 2R7ZC 2O5JA 1O29A 3H3VL 1ZXOA 3GTOK 1J6WA 1IL2A 1USMA 3AQPA 4A3JK 3JSTA 3TFJA 1I50A 2RH6A 2E2HK 5IOQA 3H0GC 1L0WA 4X6AC 2B63C 4A3MK 4XCHA 1SMYA 1DCOA 1USOA 1HI9A 4A3IC 4A3EK 4KARA 2Y0SL 3WODA 3CQZC 2NVQC 5HL8A 1TWFK 3BUEA 2R7ZK 1SFOA 1F7UA 3M3YK 5IORA 4A3FC 4ILDA 2JA5A 4A3JC 4XLPA 1ZQ1C 1K83C 1O25A 1YCLA 1RU0A 5C4JC 1AB4A 2E2HC 4AH6A 4FM9A 3GTLK 1XXBA 5IP7C 3I4NC 4YG2A 1I3QK 5C3EK 4OIPA 1BS2A 1YNJA 5TMCA 1UV7A 2JH3A 4C3HK 2WAQL 1BDFA 2NVTC 2JA5C 3S17K 3K7AC 1WCMC 4A3DC 5M3MK 3AD8C 4KMDA 2ZUEA 1GE9A 3ADAC 2RGRA 3GTLA 1YX2A 1Y1VA 4KB2A 3FKIC 3GTOC 1XZPB 5JFEA 1R9TA 3GEHA 4A3BC 1VRQC 4A3LC 1B4BA 1DD5A 2CFAB 2XCQA 5IYDK 2W7VA 3H0GK 2R92K 3BP3A 2E2JC 2PA8L 3RZOC 2V6UA 2B63A 1TWHA 5CHPA 1IQ0A 1PJ5A 2PA8D 3SZZA 4GTAA 3HOWC 4AYBL 5E68A 4G7ZA 1O24A 2WB1D 4A3FK 3GTOA 2E2IA 2CFAA 3SZYA 3I4MC 3GTMK 3GTGA 2A68A 4KATA 1WSRA 3N0CA 2Y0SD 4KAWX 1JOEA 1F7VA 3HOVK 3T01A 3S1RK 2FQTA 3A8IA 4KDDA 1I3QC 3MMLB 3S1QC 1VGXA 3LAJA 4BLBA 4C3HC 3FKIA 1Y1WA 1X31C 2NVXC 1EH1A 4BBSC 1PJ7A 4QIWL 1WCMA 3GTGC 1WCMK 4KMUA 3L4JA 4QJVA 3GTJC 4BY7C 4C3JK 4DDQA 4ZH4A 2NVYA 1B4AA 3GTPK 4NOIA 3G4CA 1J98A 3S14C 3T00A 2NVXK 3TFHA 3GTKC 3GTGK 5C4XK 3NUHA 1XZQB 3HKZL 1DCPA 1VH2A 1XXCA 4KMHA 4C2MK 4C3JC 2CW0A 4G0WA 1SFOC 2R93K 3GTQA 4BY1C
chains in the Genus database with same CATH topology
2A6HA 4KN4A 3HOXK 1TWHC 5M5WK 4C3HK 2WAQL 1BDFA 2A6EA 2NVTC 2JA5C 3S17K 2JA8C 4OIRA 5C4XC 3S1NK 5M5XK 4OINA 3K7AC 5C4JK 3S1RC 3GTLC 1WCMC 4A3DC 5M3MK 2WB1L 1HQMA 5M5YK 4OIOA 5IYBK 5FJ8K 3GTJK 3HOYK 4X6AK 4A3MC 4Y7NK 3S2HC 3S2DK 1TWCK 1I6HC 1Y1VK 3S15K 1ZYRA 4BBRC 3RZDK 2R93C 4YFNA 5FLMK 3FKIC 4BY1K 3HOUK 4BBSK 3GTOC 3HOXC 4QIWD 4A3BC 5IYCC 3M3YC 3I4MK 3GTMC 3GTQK 4A3LC 2BE5A 5IYDK 2JA8K 4G7OA 4LK1A 3S1NC 2R92K 3H0GK 4BY7K 3S16C 2E2JC 3HOZK 2PPBA 1TWGK 2PA8L 3HOVC 3RZOC 1K83K 4LK0A 3EQLA 3PO3C 2WAQD 2PA8D 4Y7NC 3S2DC 3HKZD 4YFXA 3HOWC 1Y1VC 4A93C 5C44K 4A3KK 4BY7C 4A3CC 1YNNA 5M3FK 2E2IC 4AYBL 4G7ZA 3M4OK 3I4NK 2WB1D 4A3FK 3HOUC 1I6VA 4A3GK 5TMFA 3I4MC 4Q4ZA 3GTQC 3GTMK 4A3LK 3PO2K 2A68A 4MQ9A 2Y0SD 2JA5K 4MEYA 2E2JK 3HOZC 3S1MC 2NVYK 3HOVK 4GZYA 1R9TC 2JA7K 4Q5SA 4Y52K 3S1RK 5IP9C 5IP7K 1Y1WK 1SFOK 4A3DK 2VUMC 1I50K 1I3QC 3S1QC 3GTPC 1IW7A 4A93K 5C44C 3CQZK 4A3KC 2NVQK 2O5IA 3S2HK 4A3CK 4XSXA 1TWFC 1I6HK 3M4OC 2YU9K 2R7ZC 2O5JA 2A69A 2PMZD 3H3VL 3S14K 4BXXC 2NVXC 3FKIK 4BBSC 4LJZA 3GTOK 3S17C 4QIWL 4OIQA 4A3BK 4A3JK 3PO2C 3K7AK 3GTKK 3GTGC 1WCMK 5IYDC 4KMUA 3S1MK 2NVYC 2E2HK 4KN7A 3H0GC 4QJVA 4AYBD 5IYBC 3GTJC 2R92C 3HOYC 3S16K 4C3JK 4A3MK 2B63C 3RZOK 1SMYA 1TWCC 4ZH4A 4A3IC 2JA6K 4XSZA 4BBRK 4A3EK 3PO3K 3GTPK 2Y0SL 1TWAC 3WODA 3CQZC 2NVQC 4NOIA 4LLGA 1TWFK 5C3EC 4C3IK 2YU9C 2R7ZK 2E2IK 3S14C 5IYCK 3M3YK 4BXXK 2NVXK 1TWHK 3DXJA 4A3FC 4JK1A 4MEXA 2NVTK 4A3JC 4XLNA 4A3GC 3GTKC 3GTGK 5C4XK 4XLPA 1TWGC 1K83C 3HKZL 5C4JC 4C2MK 2E2HC 5D4DA 2PMZL 1XPPA 3GTLK 3H3VD 2B63K 2CW0A 4YFKA 4Y52C 4A3IK 1R9TK 2JA7C 4G7HA 2JA6C 4A3EC 3HOWK 5IP9K 5IP7C 1Y1WC 1SFOC 2VUMK 1TWAK 3S15C 3RZDC 3I4NC 4QJVB 1I3QK 1I50C 4YG2A 2R93K 4X6AC 3S1QK 5C3EK 4OIPA 5FLMC 1YNJA 4BY1C 5TMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6H A;  4KN4 A;  3HOX K;  1TWH C;  5M5W K;  4C3H K;  2WAQ L;  1BDF A;  2A6E A;  2NVT C;  2JA5 C;  3S17 K;  2JA8 C;  4OIR A;  5C4X C;  3S1N K;  5M5X K;  4OIN A;  3K7A C;  5C4J K;  3S1R C;  3GTL C;  1WCM C;  4A3D C;  5M3M K;  2WB1 L;  1HQM A;  5M5Y K;  4OIO A;  5IYB K;  5FJ8 K;  3GTJ K;  3HOY K;  4X6A K;  4A3M C;  4Y7N K;  3S2H C;  3S2D K;  1TWC K;  1I6H C;  1Y1V K;  3S15 K;  1ZYR A;  4BBR C;  3RZD K;  2R93 C;  4YFN A;  5FLM K;  3FKI C;  4BY1 K;  3HOU K;  4BBS K;  3GTO C;  3HOX C;  4QIW D;  4A3B C;  5IYC C;  3M3Y C;  3I4M K;  3GTM C;  3GTQ K;  4A3L C;  2BE5 A;  5IYD K;  2JA8 K;  4G7O A;  4LK1 A;  3S1N C;  2R92 K;  3H0G K;  4BY7 K;  3S16 C;  2E2J C;  3HOZ K;  2PPB A;  1TWG K;  2PA8 L;  3HOV C;  3RZO C;  1K83 K;  4LK0 A;  3EQL A;  3PO3 C;  2WAQ D;  2PA8 D;  4Y7N C;  3S2D C;  3HKZ D;  4YFX A;  3HOW C;  1Y1V C;  4A93 C;  5C44 K;  4A3K K;  4BY7 C;  4A3C C;  1YNN A;  5M3F K;  2E2I C;  4AYB L;  4G7Z A;  3M4O K;  3I4N K;  2WB1 D;  4A3F K;  3HOU C;  1I6V A;  4A3G K;  5TMF A;  3I4M C;  4Q4Z A;  3GTQ C;  3GTM K;  4A3L K;  3PO2 K;  2A68 A;  4MQ9 A;  2Y0S D;  2JA5 K;  4MEY A;  2E2J K;  3HOZ C;  3S1M C;  2NVY K;  3HOV K;  4GZY A;  1R9T C;  2JA7 K;  4Q5S A;  4Y52 K;  3S1R K;  5IP9 C;  5IP7 K;  1Y1W K;  1SFO K;  4A3D K;  2VUM C;  1I50 K;  1I3Q C;  3S1Q C;  3GTP C;  1IW7 A;  4A93 K;  5C44 C;  3CQZ K;  4A3K C;  2NVQ K;  2O5I A;  3S2H K;  4A3C K;  4XSX A;  1TWF C;  1I6H K;  3M4O C;  2YU9 K;  2R7Z C;  2O5J A;  2A69 A;  2PMZ D;  3H3V L;  3S14 K;  4BXX C;  2NVX C;  3FKI K;  4BBS C;  4LJZ A;  3GTO K;  3S17 C;  4QIW L;  4OIQ A;  4A3B K;  4A3J K;  3PO2 C;  3K7A K;  3GTK K;  3GTG C;  1WCM K;  5IYD C;  4KMU A;  3S1M K;  2NVY C;  2E2H K;  4KN7 A;  3H0G C;  4QJV A;  4AYB D;  5IYB C;  3GTJ C;  2R92 C;  3HOY C;  3S16 K;  4C3J K;  4A3M K;  2B63 C;  3RZO K;  1SMY A;  1TWC C;  4ZH4 A;  4A3I C;  2JA6 K;  4XSZ A;  4BBR K;  4A3E K;  3PO3 K;  3GTP K;  2Y0S L;  1TWA C;  3WOD A;  3CQZ C;  2NVQ C;  4NOI A;  4LLG A;  1TWF K;  5C3E C;  4C3I K;  2YU9 C;  2R7Z K;  2E2I K;  3S14 C;  5IYC K;  3M3Y K;  4BXX K;  2NVX K;  1TWH K;  3DXJ A;  4A3F C;  4JK1 A;  4MEX A;  2NVT K;  4A3J C;  4XLN A;  4A3G C;  3GTK C;  3GTG K;  5C4X K;  4XLP A;  1TWG C;  1K83 C;  3HKZ L;  5C4J C;  4C2M K;  2E2H C;  5D4D A;  2PMZ L;  1XPP A;  3GTL K;  3H3V D;  2B63 K;  2CW0 A;  4YFK A;  4Y52 C;  4A3I K;  1R9T K;  2JA7 C;  4G7H A;  2JA6 C;  4A3E C;  3HOW K;  5IP9 K;  5IP7 C;  1Y1W C;  1SFO C;  2VUM K;  1TWA K;  3S15 C;  3RZD C;  3I4N C;  4QJV B;  1I3Q K;  1I50 C;  4YG2 A;  2R93 K;  4X6A C;  3S1Q K;  5C3E K;  4OIP A;  5FLM C;  1YNJ A;  4BY1 C;  5TMC A; 
#chains in the Genus database with same CATH topology
 4KN4 A;  3HOX K;  1EQR A;  1J6X A;  2A6E A;  1ZVU A;  3H0G A;  1C0A A;  1WQF A;  1WQH A;  4OIR A;  5C4X C;  3S1N K;  3AQO A;  2VUM A;  4LOW A;  2WB1 L;  3BP8 C;  5IYB K;  5FJ8 K;  4X6A K;  1WSV A;  4A3M C;  3S2D K;  1Y1V K;  2R93 C;  1TWA A;  5FLM K;  4BBS K;  3HOU K;  1ISE A;  4QIW D;  1IE0 A;  3M3Y C;  3GTQ K;  4G7O A;  4P5A A;  3TTG A;  2PPB A;  1K83 K;  1O28 A;  4Y7N C;  1Y1V C;  4A93 C;  5C44 K;  4A3K K;  2V6S A;  2JA6 A;  1G51 A;  3HXA A;  1I6V A;  5TMF A;  4Q4Z A;  3GTQ C;  3VA7 A;  2YU9 A;  4J3N A;  3AH5 A;  4MQ9 A;  1EFW A;  3GTP A;  5IOS A;  2JA5 K;  1WOS A;  1O26 A;  4MEY A;  2GSN A;  2NVY K;  4Q5S A;  1R9T C;  4Y52 K;  4M1X A;  1O27 A;  5IP9 C;  1SFO K;  2VUM C;  1WIH A;  1JVI A;  1TWF A;  3V4G A;  1WOP A;  1IW7 A;  2XCO A;  4A3C K;  3CQZ K;  4A93 K;  2O5I A;  3S2H K;  4XSX A;  4GTF A;  4BXX C;  1ZBS A;  5TJ3 A;  4BKW A;  3N0B A;  3FKI K;  1BGW A;  2P8T A;  4OIQ A;  4A3B K;  1VJE A;  1J6V A;  3PO2 C;  5IYD C;  2NVY C;  2R92 C;  4AYB D;  5IYB C;  3HOY C;  1EK8 A;  1WQG A;  4KC6 A;  3RZO K;  1TWC C;  1V5V A;  2JA6 K;  1TWA C;  1O2B A;  4LLG A;  3AD9 C;  1O2A A;  5C3E C;  3GTM A;  3GDZ A;  2E2I K;  4BXX K;  5IYC K;  1K83 A;  5EGH A;  4MEX A;  2NVT K;  4XLN A;  4KM9 A;  5D4D A;  2PMZ L;  1XPP A;  3IPJ A;  3GTJ A;  2B63 K;  4A3I K;  3Q3Q A;  4A3E C;  2JA6 C;  1Y1W C;  1TWA K;  2Y3P A;  3RZD C;  1I50 C;  4GTE A;  3S1Q K;  5CJ9 A;  2A6H A;  3FOF A;  4RMF A;  1BJT A;  2JA8 C;  3CAG A;  4FZB A;  5C4J K;  3GTL C;  1HQM A;  4KB4 A;  3GTJ K;  2GAG C;  3S2H C;  1I6H C;  1WOO A;  3RZD K;  4BBR C;  1PJ6 A;  4YFN A;  2KWA A;  3ORE A;  3OEP A;  3FHZ A;  3I4M K;  3GTM C;  2BE5 A;  1I3Q A;  2JA8 K;  4LK1 A;  2ZUF A;  1TWG K;  3HOV C;  4LK0 A;  1DCH A;  2NVX A;  4KAS A;  3HKZ D;  3ERE D;  1YNN A;  2E2I C;  3A8K A;  3G4A A;  4O2D A;  2R7Z A;  4A3L K;  2GSU A;  3CQZ A;  3GEE A;  2V6T A;  2E2J K;  3S1M C;  4GZY A;  1Y1W K;  5IP7 K;  3N3Y A;  1I50 K;  3GTP C;  3T02 A;  3L4K A;  2YU9 K;  2P5M A;  2A69 A;  2PMZ D;  4G0V A;  3S14 K;  3GIR A;  4LJZ A;  3S17 C;  4KM8 A;  2ZFZ A;  3AD7 C;  1IBA A;  4C45 A;  2GAH C;  3K7A K;  3GTK K;  1KQ4 A;  3S1M K;  4C2M C;  4KN7 A;  4WJ3 M;  3S16 K;  2JA7 A;  4XSZ A;  5EGE A;  4BBR K;  3PO3 K;  2XCR B;  4C3I K;  2YU9 C;  3S0X A;  1XZQ A;  1TWH K;  1WOR A;  3DXJ A;  4JK1 A;  1XZP A;  4A3G C;  2EBB A;  2R92 A;  1TWG C;  2GSO A;  4GTB A;  3FOE A;  4G0U A;  4PAB A;  3H3V D;  4YFK A;  4Y52 C;  1R9T K;  2JA7 C;  1F93 A;  4G7H A;  3HOW K;  1JQW A;  5IP9 K;  2VUM K;  1EI6 A;  3S15 C;  3LAP A;  4QJV B;  4WJ4 A;  4C3I C;  5FLM C;  3HOU C;  3OPF A;  4LR2 A;  1TWH C;  5M5W K;  5JVO A;  1TWG A;  1XXA A;  1INN A;  1TWC A;  5M5X K;  2R93 A;  3TFI A;  4OIN A;  4GTL A;  3S1R C;  5M5Y K;  3GEI A;  4KMA A;  4P9S A;  4OIO A;  3HOY K;  4BLA A;  4WIL A;  4Y7N K;  1TWC K;  5L46 A;  3S15 K;  1ZYR A;  3QX3 A;  1O2F B;  2FQO A;  2PHC B;  4BY1 K;  3HOX C;  5IYC C;  3S1N C;  5IOT A;  4BY7 K;  3S16 C;  3HOZ K;  4PAA A;  3EQL A;  3PO3 C;  2WAQ D;  3S2D C;  4YFX A;  4A3C C;  5M3F K;  1F9N A;  3M4O K;  3I4N K;  4GT9 A;  3GSI A;  4A3G K;  1VLO A;  2D6F C;  2E2H A;  4LQY A;  4GTD A;  4GTC A;  4P5B A;  3PO2 K;  3LPX A;  3HOZ C;  2JA7 K;  3A8J A;  4A3D K;  5C44 C;  4A3K C;  2NVQ K;  1IS1 A;  3GTK A;  4GFQ A;  1TWF C;  1I6H K;  3M4O C;  2R7Z C;  2O5J A;  1O29 A;  3H3V L;  1ZXO A;  3GTO K;  1J6W A;  1IL2 A;  1USM A;  3AQP A;  4A3J K;  3JST A;  3TFJ A;  1I50 A;  2RH6 A;  2E2H K;  5IOQ A;  3H0G C;  1L0W A;  4X6A C;  2B63 C;  4A3M K;  4XCH A;  1SMY A;  1DCO A;  1USO A;  1HI9 A;  4A3I C;  4A3E K;  4KAR A;  2Y0S L;  3WOD A;  3CQZ C;  2NVQ C;  5HL8 A;  1TWF K;  3BUE A;  2R7Z K;  1SFO A;  1F7U A;  3M3Y K;  5IOR A;  4A3F C;  4ILD A;  2JA5 A;  4A3J C;  4XLP A;  1ZQ1 C;  1K83 C;  1O25 A;  1YCL A;  1RU0 A;  5C4J C;  1AB4 A;  2E2H C;  4AH6 A;  4FM9 A;  3GTL K;  1XXB A;  5IP7 C;  3I4N C;  4YG2 A;  1I3Q K;  5C3E K;  4OIP A;  1BS2 A;  1YNJ A;  5TMC A;  1UV7 A;  2JH3 A;  4C3H K;  2WAQ L;  1BDF A;  2NVT C;  2JA5 C;  3S17 K;  3K7A C;  1WCM C;  4A3D C;  5M3M K;  3AD8 C;  4KMD A;  2ZUE A;  1GE9 A;  3ADA C;  2RGR A;  3GTL A;  1YX2 A;  1Y1V A;  4KB2 A;  3FKI C;  3GTO C;  1XZP B;  5JFE A;  1R9T A;  3GEH A;  4A3B C;  1VRQ C;  4A3L C;  1B4B A;  1DD5 A;  2CFA B;  2XCQ A;  5IYD K;  2W7V A;  3H0G K;  2R92 K;  3BP3 A;  2E2J C;  2PA8 L;  3RZO C;  2V6U A;  2B63 A;  1TWH A;  5CHP A;  1IQ0 A;  1PJ5 A;  2PA8 D;  3SZZ A;  4GTA A;  3HOW C;  4AYB L;  5E68 A;  4G7Z A;  1O24 A;  2WB1 D;  4A3F K;  3GTO A;  2E2I A;  2CFA A;  3SZY A;  3I4M C;  3GTM K;  3GTG A;  2A68 A;  4KAT A;  1WSR A;  3N0C A;  2Y0S D;  4KAW X;  1JOE A;  1F7V A;  3HOV K;  3T01 A;  3S1R K;  2FQT A;  3A8I A;  4KDD A;  1I3Q C;  3MML B;  3S1Q C;  1VGX A;  3LAJ A;  4BLB A;  4C3H C;  3FKI A;  1Y1W A;  1X31 C;  2NVX C;  1EH1 A;  4BBS C;  1PJ7 A;  4QIW L;  1WCM A;  3GTG C;  1WCM K;  4KMU A;  3L4J A;  4QJV A;  3GTJ C;  4BY7 C;  4C3J K;  4DDQ A;  4ZH4 A;  2NVY A;  1B4A A;  3GTP K;  4NOI A;  3G4C A;  1J98 A;  3S14 C;  3T00 A;  2NVX K;  3TFH A;  3GTK C;  3GTG K;  5C4X K;  3NUH A;  1XZQ B;  3HKZ L;  1DCP A;  1VH2 A;  1XXC A;  4KMH A;  4C2M K;  4C3J C;  2CW0 A;  4G0W A;  1SFO C;  2R93 K;  3GTQ A;  4BY1 C; 
#chains in the Genus database with same CATH homology
 2A6H A;  4KN4 A;  3HOX K;  1TWH C;  5M5W K;  4C3H K;  2WAQ L;  1BDF A;  2A6E A;  2NVT C;  2JA5 C;  3S17 K;  2JA8 C;  4OIR A;  5C4X C;  3S1N K;  5M5X K;  4OIN A;  3K7A C;  5C4J K;  3S1R C;  3GTL C;  1WCM C;  4A3D C;  5M3M K;  2WB1 L;  1HQM A;  5M5Y K;  4OIO A;  5IYB K;  5FJ8 K;  3GTJ K;  3HOY K;  4X6A K;  4A3M C;  4Y7N K;  3S2H C;  3S2D K;  1TWC K;  1I6H C;  1Y1V K;  3S15 K;  1ZYR A;  4BBR C;  3RZD K;  2R93 C;  4YFN A;  5FLM K;  3FKI C;  4BY1 K;  3HOU K;  4BBS K;  3GTO C;  3HOX C;  4QIW D;  4A3B C;  5IYC C;  3M3Y C;  3I4M K;  3GTM C;  3GTQ K;  4A3L C;  2BE5 A;  5IYD K;  2JA8 K;  4G7O A;  4LK1 A;  3S1N C;  2R92 K;  3H0G K;  4BY7 K;  3S16 C;  2E2J C;  3HOZ K;  2PPB A;  1TWG K;  2PA8 L;  3HOV C;  3RZO C;  1K83 K;  4LK0 A;  3EQL A;  3PO3 C;  2WAQ D;  2PA8 D;  4Y7N C;  3S2D C;  3HKZ D;  4YFX A;  3HOW C;  1Y1V C;  4A93 C;  5C44 K;  4A3K K;  4BY7 C;  4A3C C;  1YNN A;  5M3F K;  2E2I C;  4AYB L;  4G7Z A;  3M4O K;  3I4N K;  2WB1 D;  4A3F K;  3HOU C;  1I6V A;  4A3G K;  5TMF A;  3I4M C;  4Q4Z A;  3GTQ C;  3GTM K;  4A3L K;  3PO2 K;  2A68 A;  4MQ9 A;  2Y0S D;  2JA5 K;  4MEY A;  2E2J K;  3HOZ C;  3S1M C;  2NVY K;  3HOV K;  4GZY A;  1R9T C;  2JA7 K;  4Q5S A;  4Y52 K;  3S1R K;  5IP9 C;  5IP7 K;  1Y1W K;  1SFO K;  4A3D K;  2VUM C;  1I50 K;  1I3Q C;  3S1Q C;  3GTP C;  1IW7 A;  4A93 K;  5C44 C;  3CQZ K;  4A3K C;  2NVQ K;  2O5I A;  3S2H K;  4A3C K;  4XSX A;  1TWF C;  1I6H K;  3M4O C;  2YU9 K;  2R7Z C;  2O5J A;  2A69 A;  2PMZ D;  3H3V L;  3S14 K;  4BXX C;  2NVX C;  3FKI K;  4BBS C;  4LJZ A;  3GTO K;  3S17 C;  4QIW L;  4OIQ A;  4A3B K;  4A3J K;  3PO2 C;  3K7A K;  3GTK K;  3GTG C;  1WCM K;  5IYD C;  4KMU A;  3S1M K;  2NVY C;  2E2H K;  4KN7 A;  3H0G C;  4QJV A;  4AYB D;  5IYB C;  3GTJ C;  2R92 C;  3HOY C;  3S16 K;  4C3J K;  4A3M K;  2B63 C;  3RZO K;  1SMY A;  1TWC C;  4ZH4 A;  4A3I C;  2JA6 K;  4XSZ A;  4BBR K;  4A3E K;  3PO3 K;  3GTP K;  2Y0S L;  1TWA C;  3WOD A;  3CQZ C;  2NVQ C;  4NOI A;  4LLG A;  1TWF K;  5C3E C;  4C3I K;  2YU9 C;  2R7Z K;  2E2I K;  3S14 C;  5IYC K;  3M3Y K;  4BXX K;  2NVX K;  1TWH K;  3DXJ A;  4A3F C;  4JK1 A;  4MEX A;  2NVT K;  4A3J C;  4XLN A;  4A3G C;  3GTK C;  3GTG K;  5C4X K;  4XLP A;  1TWG C;  1K83 C;  3HKZ L;  5C4J C;  4C2M K;  2E2H C;  5D4D A;  2PMZ L;  1XPP A;  3GTL K;  3H3V D;  2B63 K;  2CW0 A;  4YFK A;  4Y52 C;  4A3I K;  1R9T K;  2JA7 C;  4G7H A;  2JA6 C;  4A3E C;  3HOW K;  5IP9 K;  5IP7 C;  1Y1W C;  1SFO C;  2VUM K;  1TWA K;  3S15 C;  3RZD C;  3I4N C;  4QJV B;  1I3Q K;  1I50 C;  4YG2 A;  2R93 K;  4X6A C;  3S1Q K;  5C3E K;  4OIP A;  5FLM C;  1YNJ A;  4BY1 C;  5TMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...