1TWDA

Crystal structure of the putative copper homeostasis protein (cutc) from shigella flexneri, northeast structural genomics target sfr33
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
247
structure length
234
Chain Sequence
ALLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQRVTIPVHPIIRPRGGDFCYSDGEFAAILEDVRTVRELGFPGLVTGVLDVDGNVDMPRMEKIMAAAGPLAVTFHRAFDMCANPLYTLNNLAELGIARVLTSGQKSDALQGLSKIMELIAHRDAPIIMAGAGVRAENLHHFLDAGVLEVHSSAGAWQASPMRYRNYSRYIVDGAAVAEMKGIIERHQAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper homeostasis protein cutC
publication title Crystal Structure of the Putative Copper Homeostasis Protein (CutC) from Shigella flexneri, Northeast Structural Genomics Target SfR33
rcsb
source organism Shigella flexneri
molecule tags Metal binding protein
total genus 75
structure length 234
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03932 CutC CutC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.380 Alpha Beta Alpha-Beta Barrel TIM Barrel Copper homeostasis (CutC) domain 1twdA00
1X7IA 2BDQA 1TWDA 4R9XA 3IWPA 1X8CA
chains in the Genus database with same CATH superfamily
1QBBA 1YDVA 4JKKA 3RU6A 1IZKA 3CGTA 2QGHA 3NQ2A 1XIEA 3EEGA 2YYTA 4F0LA 1C7SA 4X22A 3UF9A 4I9TA 4GI4A 1U1HA 3KUMA 2OX1A 2ZC8A 4PMVA 1YTKA 3B05A 1I8JA 4NAEB 1W1IE 4Y9MA 2FZNA 1G6CA 1TJ0A 2QUUA 3IJ6A 4FOKA 4WK9A 2WCSA 4GO9A 3LM7A 3NGJA 3WBYA 2PC8A 3PNZA 1E9YB 4JQ3A 3IVUA 1LF1A 1T41A 4WDWA 5I7GA 1V3KA 2H6RA 3R25A 2NQLA 5AZ1A 3EOEA 2HXTA 4XD4A 1J5TA 2ZRZA 5DEZA 4GIYA 3N6JA 1BRLB 2EBNA 3MCNA 3I68A 3P62A 3UJFA 1H61A 3HPSA 4AHQA 3NNTA 3MI6A 1LOLA 4Z1AA 4Z2HA 3PC0A 1TR9A 4O4VA 2V2CA 3VNMA 3NZRA 7TAAA 2PTYA 3LI0A 3OBEA 5A2CA 1P48A 3G24A 1T99A 3UXAA 1GYNA 4GUJA 4XSLA 3TJXA 4G7EA 2WSKA 2F6KA 3AAMA 4MJ4A 4ERAA 1VIWA 3K8MA 1LLWA 4YVPA 4WGHA 4GI9A 2OEJA 1J2WA 3V0SA 2QCEA 5DRCA 1O95A 2BY0A 3L4TA 5FACA 2XSBA 3DEQA 5E0FA 2WVSA 1ZRQA 1OGBA 1H50A 4RV3A 1H7XA 1GZJA 4QP0A 3KX6A 3VKCA 1YQ2A 1VLWA 5AC6A 4XZIA 3TJLA 3BSMA 2PURA 2VFFA 3KRBA 3T44A 4G56A 4AIBA 5BMXA 3OO2A 2ISFA 3VD5A 1J0YA 3IJIA 1H60A 5D05A 5F2IA 1FWAC 1VENA 2HPIA 2DJLA 1CPUA 3BAIA 1H1NA 4DPQA 4PMZA 3NG3A 3OBKA 3VD4A 2E25A 1SO3A 2UZ9A 3BV4A 4IQDA 2I14A 5JU6A 2GWNA 2TAAA 4WF7A 1S2CA 4O8AA 3E3HA 4JTTA 2ZXBA 2OZ8A 1WKYA 2ZC1A 1MSSA 4N4QA 3R11A 3UZJA 1ZBKA 3W7LA 1K7XA 4ZOCA 3EPNA 3UGRA 4RPPA 1UZHA 2VQUA 1OZMA 1DWJM 2H9AA 3TMLA 5DRIA 2CKSA 3IIXA 3TYZA 4M82A 4I5RA 1IEQA 3TZNA 3M46A 2OWXA 4LAKA 1FH9A 1VQTA 4F0RA 2NX1A 1KTCA 4W7UA 4HU0A 2GK1A 2PU0A 4WZHA 1LT7A 2XFFA 5EB8A 4BQ4A 4DX3A 4OWGA 1AMYA 2D2JA 5DBUA 1RCOB 3K4DA 1DJYA 2EKCA 3AS0A 1E6RA 3F4DA 4GNKB 2Z28A 1BLIA 4JIPA 3XISA 3HPXA 3OA3A 3P7YA 4UMAA 1VEMA 3QM3A 1W0MA 2Q8LA 4WSKA 3GZAA 4EAMA 3UR5A 1JRBA 4JN8A 1V51A 1VCVA 4YN5A 2R1LA 2PWEA 1J6PA 1P1MA 4ZENA 1XHGA 3MZ2A 2DSWA 5A6BA 2X16A 4L9YA 3EX1A 5JH2A 2J8TA 1R87A 1SW0A 1YLVA 1QAPA 3OODA 4L5ZA 1GYMA 2FYMA 2WAGA 4GC3A 2E6DA 3PZ9A 5REQB 2CXEA 3ELFA 2G3NA 4GYPC 3KRZA 4B3KA 2PAJA 2ZQ0A 3NQAA 8XIAA 1E73M 3IJLA 1L6GA 4HCDA 3KP1A 3GQYA 4GQ0A 3AHXA 2WHLA 2DSVA 1EYWA 1NH6A 2Q02A 4J2MA 4ALDA 1RP8A 3GNPA 4FXRA 4W5UA 4L9XA 2JGYA 3LBCA 4JQ4A 2Z1WA 1VFUA 1MVYA 4F8XA 1CGXA 2VQTA 5CPNA 3W84A 2YX0A 4DF1A 3NGFA 1KM6A 1KCXA 1DHKA 2OSWA 5LSMA 4OFCA 2ADAA 4S2BA 3PZQA 1SR0A 3AQUA 2HE5A 2ASHA 1XRFA 3ZIZA 1TV2A 2G5WA 2XVNA 4A3QA 3MV11 3R10A 6REQB 4V15A 2DZSA 1TJRA 1NY1A 2EAWA 1CB2A 4M1BA 1V3JA 1ZU8A 2PE4A 3HOJA 3M5XA 1MW2A 2O7QA 1HQTA 4LAZA 1DORA 1AQFA 2X40A 4W88A 3TVAA 5MKGA 5EFDA 1EF2A 3NSXA 2ABBA 3B8VA 1X98A 4FNRA 3TC7A 2VGFA 1UWAA 2Z29A 4L56A 2X2YA 4UB9A 3V75A 1EXPA 1U33A 2JKPA 4M7TA 2AKMA 1BQCA 3DH7A 5E5CA 2PWFA 1QPRA 4DM2A 1OC5A 7A3HA 3P74A 4N6FA 1WBJA 4RZ4A 4NI3A 4MPQA 3T55A 4IG2B 2WB5A 3S5ZA 4WD0A 1GVEA 1KKRA 1E9ZB 3CT7A 4D6HA 1WUFA 4US5D 2BX7A 2NUXA 1ZY9A 2YL9A 4DWDA 5T8GA 1VF8A 5ABGA 3VM5A 4HA0A 2J25A 2YZ5A 3C2YA 3UWYA 1M68A 1H7WA 1FFRA 3B8DA 1TVPA 4JFVA 4Y8FA 2YA1A 4D6EA 4YL2A 3HA1A 4TX6A 2X7VA 4LCQA 3Q37A 3UETA 3WLOA 1QI2A 3LHUA 3VKAA 4ORMA 3TFXA 1H09A 1EPXA 2EKGA 1FY6A 1V93A 1PAMA 1UUMA 2J9YA 3EA1A 2AMXA 3IANA 4F2BA 5AY7A 3IK2A 4X2PA 3SCOA 3O06A 3CT2A 3VIHA 1B3WA 2GJXB 5I78A 5BWFA 4W87A 3RIKA 2D2GA 3TTQA 3GXPA 1DIEA 4ZFMA 1L6SA 3VKKA 1T8XA 3IRDA 1CT5A 3II1A 4GA8A 3K30A 3DKLA 5HR6A 4UOJA 1FWJC 4QISA 2Y6ZA 3N6QA 3WD4A 3SUTA 4CN6A 4ZZ9A 3O6YX 4J2PA 3SUSA 4XTDA 3W2NA 4Z08A 1SW7A 3E1F1 3P93A 2YGYA 5IBXC 4GVIA 4MAZA 3N2OA 3A3XA 3GDKA 3CUXA 3S6OA 4NZ3A 3M6YA 2P5NA 5IXEA 2ZZ2A 1H49A 5J8LA 2QZRA 3QW3A 2VR4A 1IXOA 2NWRA 3RRAA 4DJDD 4JTUA 4IQJA 1B2YA 1M7OA 4PYSA 4LC8A 1Z48A 3BO9A 1XKJA 3SCTA 2NQZA 3MP4A 1AL7A 3MSGA 4FSAA 4JZ5A 3E74A 1W1YA 1S2AA 3GHSA 3L66A 3NQBA 1KFJA 2ANUA 2DPEA 3G8EA 1PZ3A 2QMKA 4Y96A 3ZLFA 2XIMA 2P3ZA 1LLOA 3BW2A 4TOQA 1DPMA 4L61A 3SN1A 4H83A 1Q63A 3QKEA 1FH7A 2D20A 4PMDA 4O1FA 1SO6A 1Z9AA 2B7NA 1JYNA 3BAYA 1S5NA 3SY8A 2VX6A 5LIYX 2RHGA 3HV9A 3LN3A 5C9UA 1NARA 1ADSA 2W91A 1JCXA 1E0TA 1PTGA 4LTSA 3IGXA 1SSGA 4UTHA 4F66A 2V5KA 3GR4A 1UOKA 1UKPA 4RW5A 3THCA 3KZPA 3B04A 3SBFA 5LNVA 3UXDA 1IR1A 3MUZ1 2OX4A 3AJ7A 4N6EA 3W88A 4NQ1A 1RHCA 3FIGA 3ONBA 3ZOAA 4LC6A 1PZ1A 4IXXA 3PJTA 4H9YA 2FB2A 3NQMA 3W1UA 1PEZA 3NUKA 3AIWA 3QV8A 5EMLA 2F84A 4KEMA 3S46A 4N4PA 2RGLA 1TYGA 5MF5A 4AEFA 2PEVA 4WDXA 3M4HA 3PS7A 2GOKA 1TREA 3NQGA 2XZ9A 3AWOA 3TXZA 3SGZA 4WXZA 1OCBA 2DT0A 4FMVA 5TNVA 3GY1A 3VNDA 1PBGA 5BU9A 5M5DA 2XWDA 4RR4A 5CJ5A 2MNRA 4PSPA 3QTPA 1KFCA 5FF3A 4KRTA 2PBGA 4PUDA 4DO4A 1QPOA 3MP5A 3B9OA 3BDKA 3G1VA 4IPPA 1AL8A 4AXKA 4HJFA 3COTA 2X30A 2XIOA 4GGHA 4U33A 3EMCA 2F61A 1G69A 3FYOA 5H91A 1ZAIA 5MHBA 1LG2A 2XGZA 5AYXA 1WXJA 3GDBA 1TZ7A 4E38A 1DQXA 3W6YA 4UBPC 3RX2A 1TX0A 4DF0A 2OU4A 3OQ8A 4ZO9A 3N6HA 1SMAA 2IQTA 2QVHA 1HVQA 2E5DA 3OLDA 1J0JA 1UWSA 2DZBA 4LYRA 3WQPA 3ENLA 3URAA 4RNJA 2C3ZA 3K2GA 1XDMA 5E0CA 4ICCX 4NAFA 2J88A 3M16A 1UUQA 3EA3A 3SECA 3W00A 1P5BA 1EWEA 3W28A 3U57A 3RM9A 4F48A 5IFPA 1UWTA 1V7YA 4CCZA 3TW9A 3NYZA 4J3SA 3SN0A 4U2YA 4GK8A 3LD5A 2NQJA 1M3UA 4HZMA 4R9OA 4ACYA 2IPWA 5F4WA 4AX6A 4X0NA 4U2ZA 3QMTA 4PUWA 3LGEA 3NXFA 5A8OA 3LBOA 1AMKA 2FDMA 3R8GA 4ZE4A 3F5KA 1KV8A 1RK5A 4TVUA 4Q8UA 2NVDA 1NOUA 3KBJA 1ESWA 4XZWA 1EP1A 1XCFA 3TA6A 4N02A 3W7OA 4YYFA 3WQFA 1YRRA 4WY0B 1HGWA 3VIGA 2NV1A 2FFIA 3UZXA 3VKJA 1XIHA 2ZRUA 3AUJA 5F2GA 3IUHA 4ADTA 2OZ0A 3L2IA 3TSMA 3N17A 5FD0A 4FX6M 1HGYA 3S9ZA 4GY0A 2YIHA 3SGUA 4H6QA 1JAEA 4MNLA 3VILA 1EC7A 4CQCA 1JQXA 3O6CA 3EWZA 4ML9A 1BYCA 1RH9A 3M43A 3BLDA 1UP3A 2OT0A 3FK4A 4DJEC 2NSXA 1W2PA 2O9PA 1F8IA 3SCWA 4GUGA 1JYWA 1IEWA 4FR6A 4YPJA 4ROPA 4FXSA 1TWSA 1GVQA 1JNDA 3VUSA 3JS3A 2JBMA 5K9CA 4M8UA 3W0KA 5KSWA 3W72A 2BHUA 1NTHA 4CCDA 2CLKA 3VVGA 4CVWA 4S39A 4CD5A 2OWWA 4GLEA 1YBQB 1G0CA 4PUKA 4CGTA 1JI1A 4BI7A 2WMJA 3DC8A 2VR2A 3TP4A 3A6OA 4PMYA 2DY3A 3LTYA 1KM4A 3G6LA 4M3PA 3WQVA 4TO8A 4ZSTA 4HT3A 1NJJA 4CD7A 3PY2A 4QCEA 4KRZA 4JCMA 4F0HA 9CGTA 1CENA 1AD1A 3P81A 3LTPA 3NPVA 1PE1A 3VD7A 2V5DA 2XTKA 1FWNA 3WLHA 2V38A 1SZFA 3LLFA 2DZXA 1DL3A 2XFYA 3W75A 2Y5EA 3NQ7A 1O1ZA 2VZOA 1G9HA 3GX9A 3IRSA 1QI5A 2NX9A 3T8QA 4JFWA 4S23A 4I6VA 1GQKA 3S6DA 1LRTA 3LUTA 2EPOA 1WKEA 4TMBA 3DXIA 1F07A 3W26A 1G4TA 4YVVA 2P10A 3W7JA 2ZDSA 2ZX7A 1A4MA 1F5ZA 3PUEA 3MQTA 3LCFA 5CSYA 3CS2A 1HKJA 3UCDA 3NDYA 1CXHA 1CZ1A 3CQJA 3QR0A 1QNRA 4LANA 4OECA 4AD1A 4WOZA 1LZOA 2XVKA 1QDSA 4A8RA 3BSGA 3QEZA 3W7PA 3ABSA 2MANA 1KM2A 4J40A 4ZVJA 3TEVA 1H4PA 3ARSA 5I3GA 3CV6A 3AI0A 3LV6A 3VNYA 5AYZA 3K8KA 1F3WA 1ZBCA 4C7DA 5CC5A 3W70A 2QCFA 4O15A 3WUEA 3AS1A 5C2GA 4LX4A 1LRNA 5FIPA 2Z27A 1PKYA 1J0IA 3VDBA 1VHNA 3WMSA 1EGZA 2WMIA 2E3ZA 3PTQA 1W9DM 4CD4A 1O5RA 1TTPA 3CLMA 3M0JA 2FH8A 1IIGA 4F2TA 2J6VA 2B7PA 4QCFA 2Z2UA 4KCUA 2XJ7A 2MUCA 2CLPA 5HMEA 1E4NA 3W2MA 4DO7A 1ITXA 3SCSA 1GVOA 3UWUA 2WKGA 3KVJA 3VD9A 2VX4A 3TONA 1YDYA 3MJYA 3YPIA 1JUEA 4E8DA 1PO9A 3HG3A 4A21A 2VDIA 2V67A 3TKFA 2BVYA 4E0CA 5CJNA 1I2OA 4XKYA 2IKIA 1EEXA 4FOUA 2WMKA 1W5MA 2RDTA 2CZEA 1A53A 4LBRA 1AQMA 4ATLA 2BFGA 1AG1O 5SWUA 3OQEA 1G4EA 1B54A 1TRIA 4AD5A 3RO8A 5J5DA 2DFAA 3ZJ8A 4TTGA 1BWLA 3I6EA 3EX6A 3CHVA 2XGIA 2O7SA 4MADA 2E8ZA 4RK8A 4HYWA 4XAFA 4O12A 4IFKA 1QW7A 4IIGA 3ABZA 4MB5A 1JF6A 1Z32X 3AS2A 3TNOA 3P5YA 1V6XA 4YJ5A 1HP5A 1ODZA 1QPNA 3AS3A 1QHOA 1V03A 2H8ZA 5DMYA 3QGAC 3EDKA 4OHQA 3RCYA 6ALDA 5LA0A 5FJPA 3MW7A 3GNNA 4A35A 3MMTA 5BRQA 3GNOA 3UYIA 3DBNA 3USBA 3R4IA 5HUOA 1TRDA 3SY5A 4EPKA 4M0XA 4D8LA 2CLOA 1ZP4A 2FZ9A 2OYLA 3ZT7A 1U2YA 4P61A 3UPBA 1YDOA 2AL1A 4HSNA 5D9NA 4JTIA 1GORA 2IS7A 5FEWA 4FNPA 3DFPA 1RPXA 2DDXA 2WM1A 1YW1A 1WOBA 2DW7A 4HA3A 2Q71A 3U5YA 5IOBA 1WUEA 4O1DA 5HXMA 3QOMA 3T0CA 3W1LA 2HK0A 2VOTA 1XLCA 1MZHA 3GHRA 1VS1A 1XUZA 1TPDA 3URNA 1UASA 2A0NA 2PDLA 2WJZA 3T0TA 2JEQA 1BTCA 1AVAA 4D6JA 2DT1A 4RLIA 3U2EA 3ORWA 1TX2A 1SJAA 1E4MM 2OQHA 3W7CA 1L2QA 4S3CA 4LVBA 2E09A 3UXKA 8RUCA 4DUOA 3D47A 3UT0A 4MFEA 3ALFA 2BV9A 1CGUA 2DGAA 1V0LA 4ACZB 1SMDA 4B16A 3M0XA 1E0UA 3OG2A 3JU2A 2WLYA 1I9CB 4IUOA 3S0CA 4LVGA 2PGRA 3VIOA 2DT3A 3E2QA 3BL3A 4L6HA 2GWGA 1YE6A 1SO5A 2J47A 3GXFA 2VC7A 3NZ1A 1OIFA 2RDUA 4HPXA 1AK5A 3WH8A 3B9DA 4JL1A 4REQB 2ZUWA 4JYDA 1A5OC 4E6MA 2INEA 2IKJA 2Z7GA 1XUUA 2W62A 1UZ1A 2EXOA 3QGKC 2B4GA 2PMQA 1QUMA 1GQLA 3VNKA 2D24A 3KOFA 4AYSA 4MDPA 1W1TA 3MB9A 2ZXQA 2EPHA 4F9DA 4DO6A 2HS8A 1K02A 3CAKA 4RE0A 1EJVC 1XQLA 3C3NA 2DP3A 2FJUB 4A29A 1NDWA 5D30A 3O16A 4ICMA 1TJ2A 4C6QA 3PZTA 4XZBA 3TZFA 1XLMA 5E70A 1DE5A 5C2CA 3CXOA 4HA1A 4RDVA 1GOXA 1MW3A 2EF9A 1P0NA 5TIMA 1S5VA 3KP0A 1PDZA 4NVTA 4CN1A 2YBTA 3CASA 4AZGA 4DNMA 5A3HA 3DI1A 1FDZA 1A4LA 1UCWA 4LAMA 2PPGA 3GFYA 1QJWA 1GOIA 4DXKA 5DELA 3VYLA 1M5WA 5BZAA 1E9IA 4NRSA 1EJ7L 2AAMA 2C0AA 2GGHA 3H2NA 4B91A 3HGJA 2C13A 5IRPA 3QV7A 3C6CA 4PCFA 1XJBA 1P43A 2IPJA 2V3DA 1M53A 4K2SA 4U4MA 1D9EA 2R8WA 4LVDA 4RE2A 5XIAA 1DIDA 4JTSA 4DZHA 4YHGA 4A2RA 1HZYA 3NM3A 1EBGA 4HU3A 1HVXA 5EGRA 4BEQA 1K1DA 4QFUA 4K68A 4Z1CA 3BOFA 2WNZA 4U3CA 1FKXA 4QE1A 3WYZA 1UROA 2HTMA 3EPOA 4IF2A 8XIMA 4GQGA 3O6DA 4ZTXA 1FWBC 2GVJA 3QKZA 3PBWA 3WF0A 3KOXA 1JUBA 3GR8A 5H2ZA 1SQ7A 1JJKA 1JPMA 2OSXA 1EA0A 3WKZA 1E5NA 4JTQA 3FOKA 1OYBA 2R9RA 3GVQA 2X41A 3BGJA 4ZOAA 4BEUA 1A5MC 4ADUA 1S3HA 4PUMA 2WO5A 3TTOA 1DWAM 1I4NA 3W71A 1ONXA 5TD4A 2QUVA 5I06A 2CLEA 2NLYA 5HNTA 1BD0A 4ATDA 3T4CA 1FWHC 1FBAA 3LM3A 5HANA 4IUGA 4JAWA 1NAL1 2BBFA 5E93A 1B4KA 5HA7A 3NZPA 3L9CA 2QPUA 2F9RA 5BRBA 3T6CA 2X1IA 1LL6A 4G2DA 4PBFA 1A80A 4IP4A 4K36A 2H9AB 2ZUVA 5DCDA 3CAWA 4I9AA 1J0KA 1GG1A 2P88A 2A3EA 4HA4A 3GXDA 1BRLA 4ONVA 1HG3A 3THAA 5K4ZA 1H41A 4QG8A 4H7ZA 3TC6A 1S2UA 3S2JA 2WM0A 4GRSA 4TVCA 1TJ1A 4JHZA 4RW3A 1F2JA 2BZNA 1B5TA 4NX0A 5K9XA 2J24A 4O4WA 3RILA 4N9DA 2ACQA 2OODA 5ECUA 2XISA 1EDTA 2BVWA 2YA2A 3TN5A 3QV9A 4FI4A 3W53A 4E2DA 1NFPA 4J3XA 4QS6A 2G3JA 1U30A 2FZBA 1JUKA 1DJHA 4C6NA 5L9FA 3I6RA 1HL8A 2QJMA 4B4HA 3GUGA 5DFAA 4IPIA 2PWVA 4O52A 4W4QA 2D0GA 4CQBA 3PZVA 4MF4A 2NT1A 3WD2A 4H4IA 4Q33A 1M7XA 2Y89A 4WDUA 4AX7A 4AD4A 3DECA 1XG3A 1DQUA 1RLDA 4EWJA 2ESCA 1WV2A 3APYA 3KCJA 4BQ3A 2C71A 4GISA 4ATWA 1JFHA 2PDPA 2VEPA 1MNZA 1M41A 5CZJA 2GGGA 3BICA 1M03A 3TAKA 2QF8A 1UBPC 4JYFA 1UKSA 2YDRA 4HKPA 3W3OA 1JZ6A 2X1TA 2QJHA 2WZIA 3JR2A 2GQ9A 2OELA 1S38A 2Q8XA 5LNUA 2ZX5A 5HNRA 4MUZA 2V0TA 1TWZA 2NXIA 4DYEA 2B31A 2Z25A 3MO4A 4NT0A 3B0UX 1VJSA 2GDVA 4NY2A 4Z2JA 3QZAA 3W9ZA 4K3ZA 4CNOA 5HULA 3R12A 3I3BA 2G37A 4Q7BA 2Y24A 2RAGA 2VUNA 1AQ0A 1EHAA 3FYPA 3WLNA 5A6BD 3SR7A 4D8ZA 5B7YA 3DU0A 4PODA 3AFBA 2VKZG 5CAKA 3E5BA 4EOUA 4Q8NA 2W9MA 4U31A 4DRSA 3V35A 1JXJA 1V6VA 1RAKA 1RCQA 5LNSA 3DFQA 5MKGB 1N8FA 1BVNP 2D2OA 3P8JA 1H11A 1VEOA 3POHA 1TV8A 3PZOA 5CSRA 4PRRA 4HIBA 3VGFA 4C65A 2ZZ7A 4TV6A 1XIDA 3RLHA 1US3A 4FLSA 2HISA 4S38A 3G1FA 2IMRA 3CK5A 1YNPA 3RF9A 1OFRA 4MMWA 1XF0A 4LT9A 4PMUA 3KHDA 4LQ1A 1JD9A 3WH5A 1OQFA 2ZBTA 4UTIA 2WANA 2QV4A 3AMKA 4FA3A 1U22A 2GGJA 5DBTA 3UVIA 2D23A 1JZ5A 4XAYA 2X05A 3H53A 3N15A 4UQEA 4LAOA 4C1KA 4UIOA 4EANA 3ATZA 2CETA 1ZHAA 4UNKA 4M80A 2OLAA 2HCVA 3O6AA 4P7RA 2ZX9A 4NNAA 3U6WA 3UZ5A 4O17A 1ME9A 2ZA2A 3F2BA 3AMCA 2PDGA 3LA4A 1ZLPA 4W8AA 4AXNA 1F8MA 1PIGA 1F05A 4KERA 1EIBA 4HU8A 2O0TA 2B81A 4KETA 3ITYA 3JZUA 4XD5A 3TN4A 3M0YA 5T91A 3W1RA 2Y62A 4DJFA 3R94A 3AO0A 3E6EA 1LWHA 3WD1A 1E4LA 6REQA 4LVAA 7ENLA 1MWOA 2PUZA 2PDNA 2ZXDA 3ZMRA 1LWIA 4CN4A 3A12A 3NZGA 2XWEA 2PS2A 4GX8A 3AYSA 2J75A 1FWIC 2XYLA 4E2BA 2XH7A 4AZIA 2DQWA 5FEPA 5BXPA 2OR2A 1VRDA 2GPTA 1P0KA 1NIUA 5DY2A 3RM8A 3LRMA 1K9TA 4D72A 3T81A 1UR3M 1XCXA 3P14A 1NSJA 3RFAA 2BB0A 4PL1A 3CB3A 4FXJA 4R88A 1OEPA 2ZCGA 1US2A 4XVEA 3W83A 5AFDA 5LHEA 1W1B1 4MY8A 8CGTA 1WAUA 3E0VA 4X61A 3E49A 2BG5A 2Z4GA 3GUWA 4NX5A 4IG2A 4DNHA 5CCZA 3IJ8A 1MO0A 5A5WA 1XXXA 4S3GA 5GVJA 1L8NA 1OD0A 4Z2KA 1BSLA 4NZ1A 4QE5A 1QK2A 3KDNA 1DIOA 4NRRA 1BEUA 1BVZA 3MMUA 3IV3A 5CQ1A 4M29A 4UNLA 4JNYA 1TQJA 1HJXA 2WWDA 1OC6A 1Y8BA 5ECVA 2GFTA 1OG0A 4XBJA 1Q6EA 1H7PA 4WQ6A 4QEHA 4DPPA 1XIIA 2FGLA 3HF3A 4ZQNA 3R5EA 1L9WA 1W5OA 3OZYA 5F1UA 2DU2A 3EBVA 3T40A 1EXBA 1JXKA 5D8WA 2C16A 1UR8A 1EX5A 3VM7A 3LSCA 3WH6A 3G0SA 4JY9A 4R7JA 5LNWA 1R3TA 1TMHA 4FIRA 4Q8PA 3RO6A 2J9ZA 4JTCA 1QHPA 3KOYA 4C6OA 3ZWSA 2VD8A 1TTJA 2XZ7A 5AVHA 1OBAA 3UW6A 3GIYA 3B40A 1GTHA 3DC0A 3W1TA 4HPGA 5G2IA 5FL1A 1M6JA 3URBA 4BCEA 4PZVA 3ITTA 4OVXA 1CEOA 3GC2A 1K7EA 5AC4A 3LPFA 1QWKA 3L5LA 1EEPA 3RU8X 1W31A 3FHQA 4D1JA 1UH4A 1OX4B 3ZVIA 1YKWA 2IKHA 4TUFA 4MOZA 1N7KA 4QDWA 2CNCA 1JPHA 4XIMA 1UWRA 4YWIA 3LLDA 3NQFA 3VZYA 3W85A 4UTLA 4CEUC 3TQVA 1BGAA 1CGTA 5FF2A 1B3YA 2QHAA 1AJ2A 2IXVA 1KXQA 4OGZA 5F1VA 3QXBA 4IH3A 5CG7A 1T40A 3N9RA 6TAAA 1G94A 3PZGA 4JTFA 5DO8A 3GK0A 1GT8A 5HMFA 3OGVA 2PP3A 1B9ZA 3DAQA 4HNOA 3QRHA 3HG2A 3UU0A 3WELA 2F8QA 4HZ7A 2GQ3A 4ZOBA 4FNSA 3QHMA 4BF7A 3BCJA 3JRKA 5A1AA 1HUVA 5CZKA 2NV2A 1XYAA 4XV0A 3RYSA 1WNOA 3AIBA 3T0AA 2OQYA 3TTYA 1C8QA 3WN6A 3NQCA 2INZA 2FTYA 2GJRA 3UJSA 2QCMA 3U48A 3O9NA 2X42A 4J4KA 2RUSA 4IPJA 4GZ7A 4YNGA 3P0WA 3PPGA 1OHLA 3K8LA 3WBAA 4FAMA 3LCXA 4V28A 1SZGA 4C6IA 3EX3A 3GTIA 1CW2A 3H4WA 1A47A 2VTFA 1CCWB 1DOSA 2Q01A 5DXYA 3W6LA 4LU0A 3TQKA 1A5LC 3QN3A 4B5SA 3F7JA 3TYBA 3H4GA 4C6CA 5I6SA 4B92A 3I7QA 5CPQA 5HK4A 1D7KA 3NL5A 4YVXA 3D6NA 2QIWA 2YDQA 3SI9A 5I3IA 1GJWA 4NAFB 3N04A 4AQLA 1A3XA 4FALA 4JFUA 2G4FA 2VI0A 4AVOA 1LCOA 2NX3A 3H2CA 2BNJA 1WOAA 3DKJA 4C6MA 5BU6A 2X0SA 1PCWA 1HJQA 2O9OA 5KMYA 3WDHA 1OFDA 3MY9A 3OYXA 4E3TA 4PMXA 5I00A 4UQCA 4GZEA 4D1IA 1EP2A 3ABRA 2YL5A 2PDQA 1LL7A 5RUBA 4GGBA 4AWSA 3U4FA 3UD6A 4LCRA 3M1ZA 4K37A 1OCQA 2VFHA 3CZGA 2C14A 5FCZA 4EX4A 1E6NA 3ANYA 5CKSA 2P3EA 3AC0A 4L6OA 5BXRA 3QHOA 4UTWA 3BVJA 4ZODA 3OGRA 4PSRA 4ZGYA 4S3JA 1MW1A 4D6CA 5G4WA 4ZTYA 3RPDA 3F4CA 3OZOA 3PFMA 2YXOA 4Q8MA 3M0IA 2J77A 3CHFA 3SW6A 2OLHA 3SCUA 1W5NA 5CEWA 4MFDA 4POCA 1X7FA 3GIQA 5HUPA 1TJPA 1ITQA 2RJGA 3D0CA 4AY8A 3FS2A 4A3YA 4ILSA 1ZENA 1CGWA 3GNRA 5CLWA 1K7FA 1AFSA 1PX4A 4O8RA 2WMHA 2VENA 4NJHA 5XINA 3QOKA 1ICQA 3VMPA 2ZRVA 1R47A 4EWND 4K7YA 1AD4A 1FWGC 1UJQA 3VK5A 3UJ2A 3N34A 2E77A 2QCDB 1A0CA 4Z17A 4Z42C 5JH1A 3TTSA 3GS6A 3CM4A 4IQEA 4JD4A 2C18A 3A3HA 4O19A 3QQ0A 4YHEA 4YTSA 3LHZA 2NQ5A 2V63A 5CSSA 2R1NA 4UZSA 3NSMA 4B3ZA 4A2SA 4H9ZA 5A2AA 1Z41A 3KBVA 2VEMA 3PTMA 1XIJA 3G22A 4KIEA 3FDGA 5HJLA 3MYPA 4CQ8A 4EPEC 3O05A 2ZTJA 2PDCA 1LJYA 2ACSA 1JPKA 1KQZA 3KTCA 4HP5A 3AHVA 3ANUA 3IV8A 5HWNA 2PDKA 1BAGA 8A3HA 4AZ6A 1J6OA 1L6FA 2CFFA 2TYSA 5E6ZA 2O4MA 4PN2A 5M2FX 4UWMA 4X9YA 3FSUA 4XIAA 2AMGA 4M81A 4EXBA 1KBJA 5I3FA 1GOOA 2Z26A 4KWSA 4A3HA 3SFWA 3L65A 1JYXA 4LGXA 3CEUA 3IWPA 1IYXA 2D69A 2FPTA 4I7UA 5CC3A 4FLOA 3SURA 1JDFA 4JN7A 1ADDA 1H7OA 2ODOA 1AJZA 4MZ1A 3ITOA 1CXFA 2GVEA 3C5QA 1LP6A 2YB4A 3WMBA 1A5NC 1GZGA 2XPKA 4HVXA 4H9UA 2Q6ZA 4AHPA 4MLRA 1LBMA 4JIQA 3QF0A 3HBLA 2V3GA 4C6BA 1AZ1A 2OYKA 4IICA 5A8PA 4QTGA 3C2RA 4YXGA 5AN7A 2F2KA 1RQHA 1K3UA 1EQPA 3PPCA 3UA3A 1EJXC 2QKFA 2WKLA 4CCEA 3W7EA 3U2ZA 3TROA 1PL9A 3TOYA 3DFNA 1YBQA 1VR6A 2P8CA 4JBRA 5A6MA 4PUJA 4HOZA 3OBAA 2GLKA 1Q2SA 2DZWA 2WMIB 4F9JA 4G9PA 4PMQA 2CW6A 4GY7A 5G2HA 1XH1A 3P2VA 5A2BA 1MNSA 1VD6A 3LMYA 2WWCA 1CXEA 1SZNA 3DFYA 1W9VA 1OFQA 1TV7A 3VDCA 3KAOA 2D2HA 1TWIA 1KXHA 3WQ4A 4Y9PA 1FWDC 1ZJIA 4GOAA 1R3VA 5A94A 3W2LA 2YXXA 4CQAA 3EYPA 3L23A 2IPFA 4GUIA 4ECLA 4QBXA 2PLKA 1PCKA 4MUPA 3P82A 3M07A 3EB2A 1QBAA 3A4JA 2WBGA 4XZMX 3WQGA 4AY1A 4D6GA 5EMMA 1RJRA 1W56A 1CLKA 1HW6A 4X9SA 4WJXA 2UWFA 4A6GA 1BWVA 5D9PA 3GTHA 3W02A 4IMCA 4Q4SA 3CZ8A 4UR7A 2QVNA 4GQRA 2ZX8A 5EFFA 3SO7A 1XLFA 4IFKB 1KQYA 1AH4A 5IFTA 3WFAA 3GG7A 1FCBA 1HIZA 3UZZA 3SN4A 5BROA 2O55A 2EQDA 5EPDA 5FJTA 1EH9A 4IFOA 3MU7A 2O92A 1JZ2A 3N19B 1OGSA 3EB3A 4WIWA 3QPZA 3EX2A 3TW6A 4NNCA 4KESA 2IKGA 4DIAA 1RJPA 3AXKA 4DUVA 3WNOA 2GJNA 5HWJA 2OO6A 3TJ4A 1PIFA 5DN1A 3GU2A 4LEFA 1XRVA 1XBYA 4QROA 1V0NA 4HNTA 4PTDA 3VFLA 3N25A 3TN3A 2VGIA 4HN4A 4S3FA 3N2BA 1LT8A 4ES4A 3E0WA 3RUBL 3EOOA 1CX9A 4ZL1A 3G6MA 2QJNA 4ZB5A 1HO1A 2V5CA 2ZYFA 2W63A 2G0WA 4PEKA 4AVFA 3FJLA 1BG9A 3VFCA 4W7VA 1NFGA 4I8DA 2Z2AA 3UP8A 3HPAA 2DW6A 2NSOA 3UCCA 4C1NB 3QMRA 5A8MA 1FVPA 4H8VA 3Q4DA 2EJAA 2XHYA 3BV7A 2C1GA 1T7LA 2X1UA 3W81A 1EUNA 2CCRA 2E5BA 4RZ6A 3G3DA 3GWQA 4LEQA 3UZYA 4L1XA 5ABTA 1UD2A 2F7FA 3RM4A 4AEEA 3NL3A 2JFEX 4WRHA 1ECEA 5JVLA 2VDHA 4CCCA 1TFVA 1SJCA 3PP7A 3GXMA 4W86A 2J7CA 3FNDA 1KFKA 4AH7A 4DWSD 3DN5A 1XBXA 1PJ9A 2BY2A 4BZYA 1OSEA 3H2MA 1QR7A 2WJFA 3EOUA 1XSKA 4HOXA 1NWUA 2VM8A 1FWRA 5LKYA 1I2RA 4M56A 4ZR8A 1XW8A 1VYPX 3C2EA 4NYUA 1G4SA 1A49A 1MDLA 4GIRA 4QM1A 1ZQ5A 2PDWA 4M19A 3R89A 4WX2A 3AOFA 2A7NA 3H7UA 3PWAA 3VI2A 1Z6KA 3PF3A 4GIEA 1VCFA 3NVDA 4KEVA 3H2AA 3NPUA 3V5OA 5D37A 3E2VA 5AECA 3C2OA 3O3RA 1NQKA 1XICA 2V3FA 2VJXA 4IL2A 4HOWA 3UERA 1GJPA 4JPGA 4GVHA 3CYJA 3DBPA 1GVRA 3WQ6A 4JQ1A 1EJWC 1UH2A 5HQMA 3SADA 3QY6A 1F73A 3P8IA 5C71A 2GJPA 1PSCA 2FH6A 3MSRA 3R6IA 4H01A 4IGHA 4JFTA 1DJWA 3KFTA 1MQPA 4K39A 2DZPA 3R43A 3NO1A 1JCLA 5I79A 1MUWA 1QCWA 4Y2WA 2ABAA 3B8IA 5AHLA 3C56A 1XD1A 1XS2A 2WHMA 1OFEA 4YYCA 4UR9A 3AMDA 3S1GA 3BH4A 1EJTC 5FF4A 3IIPA 3UXIA 2F6XA 3NWRA 4GC4A 1GVIA 3MCOA 2WZTA 4YTQA 2KAUC 3C86A 3WQOA 2INFA 3DESA 2A3HA 5C9WA 1WPCA 1ME8A 1PZ2A 1RBAA 2WYSA 2OG9A 1FHDA 1FXQA 3OVQA 4C60A 4QJ1A 3LTSA 3C2VA 5HJXA 3GTNA 2PBOA 3DYPA 3WQCA 4CVUA 3IACA 3VC6A 3CQ0A 3CB8A 3OHIA 2DIJA 4REQA 3LOTA 1ZJHA 4IISA 3NO3A 2Z1VA 4JTDA 1D3HA 3DI0A 2JIWA 1F6YA 3TUUA 2PGFA 1EKOA 2Z1BA 1X39A 3NYDA 5LHFA 4MSSA 1B30A 1C91A 5DLCA 3AUOA 3E0FA 1W3LA 4TIMA 2WMFA 2XIBA 4MIMA 3RPTA 3QYSA 3ICJA 1KRAC 4BQ2A 5F2LA 4IM4A 3R8HA 4E4FA 3T09A 3OPSA 1IWAA 4QDPA 4KMQA 1UR1A 3WQEA 4DLMA 1VFMA 1H51A 1SYTA 3FV9A 5AHEA 2Y8VA 1XD0A 4JICA 4W8LA 1UP0A 3PB2A 1XPYA 2ISVA 1V3MA 4LSBA 1OFPA 3B4UA 3CH9A 1YTDA 5KZ6A 1DWFM 4I9MA 7REQA 2BXYA 4DJFC 1O5KA 3VNLA 1Q6GA 1W1PA 2YA0A 3VXGA 3K13A 1XLIA 1RQBA 2Y88A 1PHQA 4P7OA 4OT7A 3CU2A 3HG4A 5HNNA 3WDRA 2DUAA 2YL8A 1AJ0A 2VT0A 1OFBA 3AXXA 3W86A 3FY1A 5F4XA 2ZE0A 4H6EA 1EZWA 1DV7A 1SVDA 1KM5A 4PE8A 1TUFA 3CIVA 4O14A 4M6PA 3NQDA 5E6YA 1QK0A 4C6DA 2Q3OA 3HQPA 2W66A 5EKYA 3T0BA 1RUSA 3WQWA 1PKMA 1DKWA 2VRQA 1PXGA 3SDOA 3L12A 2VO5A 1A0DA 3MUY1 2ZADA 3MUXA 1KCLA 5H8UA 3MKVA 1ZJAA 3W23A 1DJQA 1I75A 1IXPA 3ARPA 3OVRA 4BFAA 2OT1A 4M1RA 1TV5A 3DIPA 1WDRA 1XGEA 3C3UA 4IX0A 4OE7A 4US5A 5AC5A 1VKFA 1LWJA 1Q6LA 1V5XA 4UFHA 1TB3A 3BG9A 4UQAA 1R3SA 1Q3NA 2VRKA 2Y85A 4KFNA 2GL5A 2PLCA 3MDUA 3N4EA 1UC4A 5I24A 1PKNA 2BVDA 2F6UA 3KZSA 1IIHA 1AUSL 3EGJA 3MMWA 2QYGA 2Z00A 1FWFC 1A5CA 4ZQCA 3KEHA 3OJGA 4L4OA 1VRXA 1Z44A 4PUUA 3SY1A 1PWLA 5D2TA 4NXKA 3KS6A 4H9VA 4BWLA 4GH1A 3QZ6A 3ABOA 1TTIA 1NWSA 3G0XA 4W85A 2ZUTA 2E1WA 4ZQOA 2BGSA 4LVFA 3VIKA 1UMLA 3UG3A 3W7MA 2WSYA 3WO8A 3NQEA 4QAWA 3INPA 3N12A 2A3AA 3ES8A 1EDQA 3A5FA 1RD5A 3LZ5A 3UPMA 2VFEA 2W6RA 4JIRA 1B3VA 3ABQA 4W84A 3UG4A 1HJUA 2C8NA 4MYAA 3LHVA 4OJYA 3VIMA 4XWUA 1CGVA 3PK7A 1AA1B 3CAVA 4BY3A 3WD0A 5GJPA 3VE9A 2A3BA 4DEFA 5E0KA 3QGVA 4MDOA 2HDJA 2A7PA 4PFHA 3BC9A 4DJDA 3VOIA 1N55A 1OK4A 3RR1A 3ZT5A 4IMGA 3PTKA 3CIXA 1B0IA 1HKMA 1AW5A 1XL9A 3EX4A 3BCFA 4Y6GA 3RNDA 2P0OA 3G77A 4H7CA 3TOPA 3P67A 1N8IA 1YADA 1QI3A 2G50A 4AMAA 4UTUA 2VZSA 1KV5A 3GVVA 4IQLA 2A79A 4KFOA 3WQ8A 5DT7A 2CBUA 2VOMA 5EY5A 2B7QA 5CLTA 5BRPA 2O4QA 4TX8A 1AW2A 2J4GA 2GVYA 4JHMA 2XVLA 1JNEA 4Q4RA 3VGEA 1MI3A 4PB3A 2VUYA 2E7FA 4BJHA 3NXLA 4DLFA 1R2SA 3NO5A 2XH4A 1IWBA 3WEMA 3BE7A 2HS6A 1MDRA 4OOZA 1Q13A 1PKLA 4Z1YA 4Z0JA 3IEBA 2RGMA 1EC8A 1XYMA 3SCPA 4HNCA 5A6AA 5FAGA 3RJXA 2YOCA 4BF9A 2DVUA 3W82A 3LPPA 4FIQA 4Z2LA 1XLKA 2D22A 3NOYA 4Q8WA 1CLVA 2V68A 4B90A 2HVOA 2QJGA 3PSWA 1H7RA 2Z1XA 2J62A 3L67A 1LRQA 2E9BA 5BMWA 1GQIA 1TCMA 2PZ0A 2YSWA 1S5TA 4X60A 3MUIA 4H41A 4NZFA 3CUGA 3DGRA 1WDDA 3HM7A 2PF0A 2PDXA 3V1HA 3I10A 1XFBA 3BZGA 4ZB2A 4WHBA 2D0HA 3DGBA 1P6CA 3CMFA 2QJJA 4U10A 4AC7C 4UTWC 4O11A 4LY8A 2Y4SA 1MXSA 2CU0A 1BWKA 4OBRA 1ZAJA 3ZR4A 2VC5A 5C5YA 3TU9A 2G8ZA 2ZTKA 1VHCA 1HXJA 2YBUA 3SCNA 4GJ1A 3UJRA 2HMCA 1VBRA 5B80A 4R3UA 2A21A 2BVTA 3N9SA 2OOGA 2VNCA 4J27A 2DJXA 4S2CA 3KL3A 4UFJA 4P2VA 1E0VA 4J3WA 2W67A 1S2VA 2JQXA 3ZO9A 5HMSA 3AYTA 3QZEA 3PBYA 3HN3A 4HMNA 4G6CA 3RLVA 4WKAA 3DX5A 3TK7A 3QQ1A 3WLIA 4R34A 2J66A 2PCQA 3STEA 4AZ7A 4S1FA 3MA8A 3OZMA 1WXZA 2RJHA 3ISIX 1Z3NA 3DENA 1W5PA 3FDKA 1UWQA 1RBOB 4FS9A 1E3XA 1WB0A 4DJFD 1QOXA 4MJ2A 4GG9A 5D09A 2A6LA 1XBZA 1B90A 1FX6A 2VFDA 1JQVA 2D1ZA 1JF5A 1KBKA 4DBSA 3VX1A 3PJUA 1QATA 4ZQPA 3T08A 2EEXA 1MEWA 4PUEA 4JDBA 3SM0A 2YYUA 2E1DA 1UR4A 1TE1A 4CNPA 4IMEA 2VP8A 4IGNA 1W8SA 4GMEA 3L0NA 4O1EA 1QI4A 3WLTA 3TMQA 5I07A 1UD5A 1F4HA 2GDQA 2POTA 4GXMA 4PC8A 3CQKA 1MMFA 3E5PA 5I3JA 1ADOA 1ZSXA 2EG6A 3H2EA 4IPNB 1M01A 2CC0A 2JIEA 1E51A 5D9OA 2XIQA 5AKQA 2EPMX 2E28A 2DSKA 1E3ZA 2QXWA 3MBFA 4RNIA 4XAGA 1TV3A 1TKKA 1C7TA 8TIMA 2XU2A 3TXVA 4JR5A 2FKPA 3TNBA 4ZFCA 1X97A 2ZZ3A 4WKFA 1WQ5A 3OVGA 1V02A 5HQLA 1MQQA 4IPLA 1XRTA 5HDRA 3PG9A 1JR1A 5C7HA 3MUCA 3ZZ1A 4IJCA 4DF2A 1BXBA 4O50A 4XX6A 2YDSA 4RNFA 4L1GA 4KQNA 1WKDA 2PWGA 3WH9A 2H3DA 4LUTB 2BASA 2QR6A 4XKMA 5EBAA 1DHPA 3FFSA 1NVMA 4TTUA 4RCXA 3C0LA 3LGDA 4EAYA 4R53A 2QQ6A 2ON3A 5FSEC 1DIKA 3BQ5A 4ERIA 1R6WA 1FCQA 1R30A 1BHGA 5I3KA 2ZKMX 2QPXA 4WOQA 3CUFA 4Q4KA 1LBLA 2YB1A 4MNKA 3HIJA 3P60A 2YFNA 5PTDA 4XVDA 3D3AA 1VLIA 3VGBA 4RL3A 3WNKA 1W3JA 3MANA 5D2WA 1YTEA 2PDMA 2WVUA 1E1CA 1R2TA 2PD5A 3V4BA 2QCGA 3ECQA 2VXNA 3DOPA 3HGSA 3W76A 2FIQA 3H24A 3CWOX 4IIBA 5CPMA 1LQ0A 4FNTA 4LYPA 1AH0A 2XM1A 4H9XA 1UG6A 2CESA 3NQVA 2B0MA 2UY5A 3VIIA 2AQOA 3H8AA 1OX4A 3U5UA 4GY1A 3HMJG 1ME7A 2E6AA 3M47A 5FI8A 1Y5XA 4PCSA 3OIXA 2WPBA 3O07A 1KXVA 1J01A 4I7VA 4P8UA 4LH8A 3UEQA 2HEJA 1XYCA 2IPGA 3AXIA 2QMJA 3AICA 1GG0A 3TAOA 1KNWA 3EXSA 3WG6A 3LXBA 3VPLA 3B06A 2WJDA 3GB6A 1K4HA 1EO5A 2FDSA 3M5ZA 4PTMA 5BW6A 3JW7A 1OB0A 2WVVB 5FJIA 2CEQA 2WJEA 1ZFJA 3M0HA 3B8TA 3J7HA 1UZDA 3DG3A 1EFZA 1LOQA 3N18A 4BHYA 1YE4A 4D8AA 1E40A 4Z2GA 2DZVA 1J96A 2JF7A 1UPPA 4ZSUA 1GYLA 3T2OA 3BJSA 4NZCA 1AQHA 3W87A 2FJKA 4GBUA 1LQAA 1X1ZA 1TCDA 1FHLA 1YPIA 4QJ4B 3N29A 3MMDA 4XQ6A 1FFQA 3BCDA 4JKMA 1KFBA 2PFHA 1IT7A 3WLLA 1SFJA 3N11A 3UPWA 1O60A 4LPCA 2PDFA 3IJQA 4JXCA 4J3VA 4OKDA 4W89A 4QJ3B 2HQAA 4QNEA 1ZCOA 3IGUA 1EYEA 2CLMA 4TU1A 2BODX 2G4JA 3I3DA 3C8NA 5LA2A 1MRQA 4UUIA 3BOLA 3NCOA 1Z42A 3W1XA 3S5NA 4AF0B 4XK2A 4YU1A 3SRHA 4LS1A 1EB3A 1ML1A 3FGCA 1V3IA 1XR2A 3WBXA 4X2RA 1C8VA 1X96A 3BPWA 4G1KA 2BWGA 4PTVA 1FDYA 3WCZA 5IDZA 2ONEA 3OLEA 3S83A 3BG3A 3L7RA 1MFUA 3GH7A 5JIPA 1S5WA 3CO8A 4FHAA 4Q3MA 4BKNA 5H6HA 3NVTA 1KO0A 3LI1A 3PUGA 4V1YA 2WQDA 4UTTA 2X09A 4NILA 4UXDA 3SUUA 1CWYA 4I9JA 1R3RA 2OKOA 3W27A 2QDHA 5FJOA 2AQVA 5D2XA 1I2NA 1FRBA 3CH0A 4LJ3A 2HROA 4Y9OA 4CUCA 3CQHA 4JS3A 4FB7A 1DQWA 3G1AA 2PU1A 1R9YA 1JGMA 3NPXA 1O6IA 3UBPC 4Q7IA 3CQIA 2BHYA 2CHNA 4V33A 4V27A 1JEZA 4WUIA 1XLEA 3QSTA 1QO2A 2BHZA 3GH4A 3EKZA 4PUNA 2JE8A 1RLCL 3OIHA 3H7VA 2D0FA 3BJFA 3NM1A 3GDTA 1TPWA 3HMCA 2QULA 1DJNA 3VABA 1J79A 3GU1A 1I60A 3V0UA 5I02A 4OOUA 1O94A 1S46A 2ZVIA 3WMLA 2XH2A 1Q7MA 2HBXA 4E5TA 3E38A 1DJGA 3S2NA 1RV8A 3CV1A 1Q65A 3RCNA 3VTRA 2A85A 4GVFA 3BAJA 4C91A 2YZRA 1DTUA 2QCDA 1Q6QA 2C79A 2PDYA 3ARZA 1G7VA 5C9ZA 1P4CA 1BTMA 2R14A 2OPJA 1EGVA 1LUCA 3G3MA 2EHHA 5CPTA 1D3GA 1Q6DA 3W24A 3BMXA 4QG6A 3UG8A 1Q6CA 3LHWA 1EHNA 3BXWA 4LY4A 2G95A 4H7VA 2WV8A 2F38A 4J35A 4IX2A 1V3LA 2I5IA 1W54A 2QNEA 1CNVA 3OVPA 1P7TB 2ACRA 3EDJA 4MWAB 2EG7A 3CYVA 1L8PA 2YBVA 2BS9A 3KTXA 4K38A 1OCJA 4XZ9A 3QBUA 1OT2A 5FA5A 3GBEA 4WEVX 2GOUA 6TIMA 1B57A 3VDAA 1POJA 4ZQMA 3PBMA 3EB4A 1FKWA 3K4WA 3BWWA 2ZZ1A 2BSLA 3RN6A 1RQEA 3C4UA 5GJNA 3S47A 3W73A 1CGYA 2O9RA 3OLGA 1ICSA 2R6OA 2W79A 3PJWA 4I7WA 3TCEA 4GZJA 3MWCA 5G4EA 3LCWA 2P53A 4QQUA 5FEXA 4F2UA 2FQIA 3RRXA 2GVGA 3TN6A 2QV5A 1KFWA 4H6RA 4BF5A 3R1ZA 2J7EA 4JTKA 1A5KC 4O0ZA 2W3ZA 2IQ0A 3ES7A 4GQQA 3H26A 5ABFB 4PMNA 3GU9A 3TYUA 3TDFA 4CD6A 1H0GA 3BARA 3GC4A 3CC1A 2FVMA 4UFLA 1K4GA 1C9WA 2FB3A 3T05A 3F4VA 4GHRA 3W2KA 1E15A 5LIKX 3TYAA 1XGZA 3T07A 2Y0FA 2J7GA 1J9YA 2CWXA 2W5FA 3TQ0A 3GHTA 3D5HA 5A69A 1ZCCA 3KRSA 4HZ6A 2XVGA 1UA3A 1L2UA 3W7IA 2DIKA 4LF1A 1GQNA 2FVKA 1WKFA 3L2MA 1FP8A 4ZXLA 3UWZA 4QG9A 1R5YA 3ANVA 4IJBA 3N3MA 1VBJA 3F5LA 3BG5A 5AC8A 1RY0A 2CLHA 1V0MA 2PB1A 4LNYA 1QTWA 2V5BA 1JCYA 3PPHA 1B31A 4JTRA 2VC9A 4HHHA 1A5BA 1TPH1 4OBSA 1QNQA 1ZGDA 4N9BA 1E6SM 2CZFA 2PDHA 1WZLA 3LHYA 1VB9A 3BQ6A 3LRLA 4QNWA 1OCNA 1TE6A 4O1BA 3CPRA 4IMDA 2GUBA 4N9EA 4ORIA 3WJWA 4PGLA 5C0QA 5M3WA 2NVCA 4IIFA 5GJMA 1PUDA 3LZ3A 4H2CA 1IEXA 1XKYA 2QAFA 4LRTA 2E4TA 1A5SA 1FCVA 1YNYA 2E6FA 2CITA 4RZ5A 3UWEA 3U3HA 1OZQA 1JVNA 2C91A 3W2JA 2GVLA 1GZ1A 4BI5A 2ZUMA 5KZDA 1BF2A 3R2GA 3MT1A 3KHJA 1DBTA 1UOZA 1WE5A 2C7FA 4Q4QA 3W1PA 4W9TA 3FA3A 2QLYA 1TPC1 1GQJA 2Z1KA 2GUUA 4QS5A 1FA2A 1PVNA 1X7IA 5GPRA 2QCHA 2XN2A 4DZ5A 5CSUA 3QR3A 3M9YA 3RITA 4MKVA 1TTQA 1IR2A 1PYFA 1J12A 2YDAA 3FJ4A 5D38A 3WSUA 1PYMA 2A3CA 2PGWA 1RSCA 5DF0A 3ID7A 3MJMA 4PMJA 3WJZA 1ZB5A 3IAPA 3LK6A 1WDWA 4GE8A 4MWAE 3E2RA 1Q7ZA 1Z7AA 2BMBA 3S6TA 1K77A 4NZJA 4OV4A 2A6NA 4MNMA 2WC7A 3IUDA 1JCNA 1WDPA 4L65A 2NLIA 4K1WA 2NQHA 1A5UA 1Q4NX 3AISA 3DG7A 3EWCA 4JX5A 2NXGA 1TWDA 2CBVA 4BWLC 2VWTA 5LZLA 3AXHA 4FP1A 3ITCA 1RVKA 3K1DA 2NT0A 4WLCA 1UBSA 4B5VA 1S2WA 4UC5A 3ZM8A 2FHBA 2RDXA 3Q65A 1N2VA 4RDZA 2R1KA 1GJUA 1EOKA 1TPVA 3BANA 1KRBC 2AL2A 2VCCA 3DFOA 4PCTA 1KBBA 4LALA 3WLQA 2ZIDA 1JD7A 3HO8A 3EMQA 3CHDA 3M5VA 2I9UA 4QLLA 2WHJA 3IS4A 1XH2A 1SGJA 4QLJA 5BNKA 3EKGA 3F1QA 3KVLA 3UZWA 1XIBA 3CL7A 4IP5A 2XVPA 1XSJA 3VNIA 1T6MA 4U5IA 1NOFA 1NU5A 2Y7EA 3TW7A 4DJDC 4C1NA 1V6UA 3P0XA 3SIMA 1HL9A 2Z6IA 4UQ9A 1Z69A 3BGAA 1A3WA 4CNTA 1VPXA 1W3NA 3MKCA 1W5QA 3WLMA 1R7AA 3GG1A 5KZMA 1GCYA 4FOJA 1UC5A 3WZ0E 1TMLA 4XBSA 1HJSA 1TELA 2V9DA 1HN1A 4XAPA 4D6FA 7PTDA 1RD6A 1W3HA 2G3FA 4AMCA 1VFHA 1ALDA 2A5HA 3LPOA 2VGGA 2PCEA 3VE7A 5TBOA 4DYKA 4GH3A 1UIPA 3HQ1A 4QIUA 3G2GA 4AZHA 2ZFAA 4O0KA 2CHOA 3QC0A 5D03A 4JTGA 2VEGA 4XISA 3W1AA 3LYEA 4TV5A 5LXXA 1J8VA 2OMAA 1B3OA 4NYYA 1DEDA 4PL2A 4J7RA 5FF7A 3U0HA 1XH0A 1XLAA 3AMLA 1AZ2A 2ALDA 3EZ4A 2NUYA 3GVWA 3MWAA 3HPFA 4NHVA 4DJED 5E1QA 3CTTA 4RDYA 4JN6A 3STPA 3I65A 3KWSA 3KWXA 4K8EA 1GNXA 3VZZA 9XIMA 3IVTA 1WO2A 1XLBA 4PRWA 5M17A 3W2UA 3MHFA 5LGZA 1Y5VA 1Q2RA 4GWEA 4H2HA 3SQSA 6PTDA 2I17A 2ZICA 3QR1A 4B5UA 1TVLA 3EWDA 2DZAA 3Q2DA 3Q67A 3IIZA 4BK9A 2JF6A 4LBSA 5K9DA 5K7JA 5HJYA 1RALA 3ZFHA 4RE4A 4DHGA 4HK7A 1FWWA 2DUZA 3TIMA 1WXYA 3UWWA 3VNZA 3DUGA 7REQB 3EWXA 5AOUA 3AMGA 4AIEA 1CXIA 3R7MA 2E5CA 3LDVA 3W01A 1JCTA 1OFOA 1XSIA 3O63A 5D8ZA 3WLSA 1J0ZA 1TVNA 2E68A 4H3DA 4AZ5A 5I77A 4EXQA 1SFLA 2D3NA 4C5YA 1P0EA 2R1PA 3CZKA 4Z2IA 2FLIA 1FWCC 2I57A 5F2MA 4AD3A 1GKQA 4H6KA 1NDZA 1ZALA 3OOQA 1JZ3A 2DH3A 3K46A 3LSBA 2TODA 2YCEA 4I6KA 4FR1A 3W7RA 5BWAA 1UWUA 4A8IA 1KM3A 2WK2A 5T26A 1G7UA 3TJIA 3GKFA 4EKJA 4EF9A 4AYGA 3SRKA 3B03A 3PZUA 4G5DA 3QSRA 4PTXA 3LENA 2UV8G 4WSJA 2G3MA 4C6EA 1K8CA 2WQPA 3U7BA 3TTEA 4Z1BA 4NJIA 2JGQA 1XWYA 3EPMA 2ZUSA 4B2DA 2I16A 2J7BA 4UFMA 3KE0A 1JULA 5A6LA 4E4UA 3RK8A 3ITVA 4GABA 1CB7B 1BYDA 2WMGA 1ZJBA 1K9DA 4LV4A 4D71A 1HNYA 4P8WA 1M7PA 4X0VA 3ZLGA 4B4FA 4PB4A 5C54A 3BJTA 3CL8A 5I23A 3NPWA 2HWGA 4KF1A 1GOMA 4OBTA 1TPUA 1FH8A 3SB0A 2OEKA 3DHFA 1EDGA 4B3LA 2F2HA 3LERA 2Y7GA 3WNLA 1K03A 1YX1A 1F7BA 3L0GA 1IEIA 5IHRA 4O16A 1KXTA 4MNJA 5A6TC 3M44A 4JNMA 2E8YA 2VR5A 2HVMA 4EF8A 3FVMA 4KWVA 2X1RA 4HJWA 1J18A 3HJEA 5A8NA 4QR6A 4GVGA 4URIA 3B4YA 4EK7A 3ZLHA 2J78A 3LPGA 4TMCA 4P7LA 2V3EA 1AODA 2QUMA 3CEPA 1CXKA 3WDJA 3IJ9A 2Q3RA 4NNBA 1E1FA 1EUAA 4DBUA 5FF0A 2PDIA 3VU2A 1N82A 1WBHA 2SFPA 4HNVA 3LRKA 1UQZA 3AIQA 4C90A 4JIHA 3IVSA 3PANA 1WAWA 2OYMA 1W9XA 2CZDA 3VMNA 2PA6A 3ZSSA 3CZJA 4ZOEA 3UXLA 4JL2A 1QNPA 4JQAA 3WFLA 3NQ6A 4QHRA 3EXTA 2VEKA 3UNDA 3KLKA 1J11A 4X63A 3F2DA 1JIBA 2Y2WA 3MUAA 3A13A 4P5UA 1C93A 1I0DA 5DXXA 3H4XA 4FNQA 4HHPA 5CBIA 1OYAA 3OZPA 3ZVHB 3CIWA 5A95A 3R0DA 2DVXA 4J3ZA 1D3CA 1IXNA 4MB4A 2WVTA 1V08A 4GNVA 2RFGA 1RXOB 3UCQA 3MZNA 1I6NA 1ISWA 3FEMA 4HHMA 4B5XA 3BLKA 4LYKA 3ARWA 1R3YA 2OSYA 3VCCA 1A3HA 4C6LA 3GRIA 4UMBA 3VA8A 1REQB 4TQTA 1RVGA 4L64A 5EA9A 3CMGA 1JDDA 2NVAA 4L9ZA 2ZZ4A 3C8FA 4NF7A 1VPYA 1U83A 4LF2A 3TYDA 2R24A 3MYOA 1P6WA 3WLRA 2OOFA 3S42A 1GPWA 1JZ8A 4D2JA 1WP6A 1Q85A 1H5YA 1Q66A 1WX0A 3SCRA 1WA3A 3XINA 1GVYA 1DXFA 2H8XA 5I2UA 4RXFA 3CZEA 2XFWA 1C3FA 1E5JA 1YIXA 2WBKA 3AIRA 4NASA 2QIIA 3ATYA 3DHPA 3CZLA 4QLKA 1B3XA 2PRMA 3PM6A 3WF4A 3PWIA 3DFTA 3U8GA 1F3TA 3TV8A 1GPFA 3SCQA 3KS5A 1V0KA 4I5UA 5A8QA 1QNVA 4CQ9A 4LCSA 1VIZA 3DZ1A 4FEZA 1HJVA 3MTWA 3I4EA 2R91A 2HZGA 2EG8A 5G2WA 4CU8A 4EVZA 2YXGA 3N73A 3BZJA 2FPYA 3ZXWA 1H7NA 4HNNA 4JTAA 4N2YA 3SQMA 3OU8A 5CGQA 2NXHA 4R7WA 1XQKA 4F0SA 3GHUA 1EPVA 4ZO8A 3SAZA 4KKXA 3UJEA 4QGCA 1XYLA 3PHAA 4UNIA 4HD5A 3THDA 3QW4B 5D04C 2ZRYA 3GLCA 2W4XA 3HB9A 2YW3A 4I8YA 1F3EA 1GUVA 2VELA 3SFKA 3TE9A 4G8TA 3WLPA 1OK6A 1YPFA 2A7RA 2FZMA 5EMYA 2VVNA 2PWUA 2WPGA 3O0KA 5CZTA 1NEYA 4H04A 1IE7C 1RA5A 1D2KA 5FJRA 4RX0A 3NTYA 1Y65A 4DBWA 1IT0A 3PN8A 3GVGA 3WF2A 1HX0A 4CNUA 4DI9A 3WEOA 2Q09A 3QQWA 3KBNA 3QJAA 3L4WA 4KGLA 3AXMA 4WR3A 4DY1A 3XIMA 3T9PA 3VGDA 4OUIA 5F4SA 5E9XA 3G1RA 1K70A 2C6QA 5DQPA 5C9RA 4HU4A 1W1A1 3CUJA 3TLQA 3LMZA 5LXEA 3GO2A 1BKHA 3LU2A 4ZEPA 4RJEA 1O12A 3W74A 4DBEA 3B3DA 3CLWA 1QNSA 4GJJA 2POZA 2C0HA 1S2TA 4I3GA 4UTTC 4AD0A 4WJEA 4JTJA 1V6WA 4TR9A 2OJPA 4AZBA 3FEQA 4GO8A 4CU6A 2VCAA 3HV8A 1PDYA 3P80A 3HQOA 3IGHX 5HATA 1E6XM 1ODUA 1ZNNA 3CWHA 4YS1A 4MY1A 3AHTA 3TC3A 1P1XA 2VL4A 3L4XA 3B9AA 1EP3A 1J0HA 1EC9A 1A5AA 2Y5JA 3G1SA 1O7AA 4ZO6A 3ARRA 3REQA 1UW9A 4LRSA 5AYIA 3K5XA 2P8BA 3G1HA 3B0YA 2VWSA 1XINA 1GHRA 4AU0A 4NJGA 3WJXA 1EZ2A 3VOGA 5KTLA 1Q45A 5G1MA 4AB4A 1E4IA 1FHVA 4W8BA 3OB8A 3KXQA 4LXFA 3BLIA 1UZ4A 1I1XA 5H8MA 3THQA 5AVNA 4GNJA 4OUEA 1E55A 4ZQRA 3PNUA 5BXSA 4Y90A 3W1MA 4YCOA 1S3TC 1G67A 4AEOA 3TCSA 1ECQA 3POCA 3WDQA 1C90A 5J5RA 4JHOA 1F6KA 2QCLA 1Y5WA 3CPGA 3QPEA 3ZS4A 1QMLA 4WDTA 1QO5A 2OXNA 4LUSB 5HWMA 3WF1A 2OB3A 3WBEA 3VUPA 1J10A 1S39A 4LB4A 4JYEA 1KTBA 5TF0A 5CC7A 1VGAA 3JUGA 2QUTA 4QITA 3A21A 2ISWA 4JX4A 5ENLA 3QMSA 3A4WA 1DXIA 4P7NA 5JIWA 3BLPX 2GYIA 2CLFA 2HRWA 2QJIA 1RA0A 2YLAA 4JTHA 4L4LA 2C1IA 1W3TA 2WZHA 1JZ4A 2GGEA 3CJPA 1D7FA 2DQXA 3FYYA 3V7PA 3WDPP 4YTTA 1E1CB 1W6TA 3Q58A 1E6ZA 1GHSA 5G4HC 1LOSA 3IJ7A 3VO0A 4A3UA 2PWDA 4JEJA 3R13A 5E09A 1LBFA 3RCMA 2PDUA 2ZWYA 1IWPA 1T96A 1OVDA 3GNDA 4ZB0A 3LHTA 5GNXA 2JK2A 3OTRA 2UY3A 1QPKA 1GEHA 1BPLB 3H55A 4PFMA 4PMRA 5BCAA 2XFRA 3AIVA 1QW9A 4BQ5A 4GFSA 3G1YA 3H54A 1HFBA 5JBEA 2QCCA 2BDQA 1TPEA 4HPJA 1HL2A 3AALA 2NV9A 2J7DA 2CYGA 3PR2A 4U5KA 3GM8A 1G4PA 1UYQA 4QAIA 2FTWA 1FWTA 5H1WA 1KLYA 5KETA 2EPNA 2PF8A 5K2ZA 1YHTA 3KVMA 2VFGA 1XIFA 4HN8A 1WZAA 1OFAA 1V4YA 3LXAA 3EOLA 1VFTA 4GYJA 5DCBA 2QUNA 1OM0A 1M9HA 3C0JA 4LUTA 1KR0A 1F9CA 2VFIA 1XFCA 3ARUA 1B1YA 4E8GA 3AROA 3W37A 3W7NA 3M41A 3STFA 5I09A 3VIJA 4NL1A 5G5IA 5LA1A 1ELSA 2WZMA 4KIRA 1R46A 3I7RA 2YW4A 3LV5A 3LCIA 3M64A 1VBUA 4NXSA 3GTXA 4GPNA 5BYWA 1J4EA 3A4AA 1JDAA 4Q8OA 4QX4A 1TV4A 3IGSA 1K9EA 5CJMA 4NI8A 3SGGA 1VZWA 1ZP3A 2V82A 3TFCA 3UNTA 3UWVA 2RKXA 4MAVA 4M7SA 1TIMA 5LNRA 1XP3A 2GGIA 3L2LA 3N4FA 4IT1A 3W1QA 3EAUA 3VDGA 4UFKA 3STCA 1RZMA 4ASTA 4DELA 1KA9F 1VFFA 3WUBA 4F4RA 5M03A 3IARA 1VJZA 3S8HA 1JRCA 1DJIA 4GI6A 2PWHA 3ME3A 4X3ZA 3GH5A 4XBKA 1B3ZA 1FWSA 3FGCB 1JGIA 4O28A 2CLIA 1UWIA 1EOMA 4DZIA 1Z8AA 1PPIA 1T5AA 1HF6A 3DYMA 4L6DA 4XZLX 3W22A 1XV8A 1PIIA 4GZIA 4O57A 3AJXA 3GSMA 1XG4A 3IAQA 2CBIA 1FXPA 1TUXA 3MSDA 5C70A 2YCLB 1QNOA 1IZJA 5M1TA 1TA3A 2UY2A 2YL6A 1DWHM 3QYQA 1XBVA 2WVVA 2V81A 1XGDA 2OO0A 1MFVA 2VZVA 2VDGA 2Q8ZA 4NP7A 3EWWA 1TSIA 1W37A 3EWYA 4FLQA 3U4AA 4MVAA 3KBWA 3RLUA 2HBVA 2G96A 2XM2A 4FNUA 2PTXA 3C0QA 4PTWA 3GXNA 4EIVA 3NURA 5CGMA 2I1OA 4G7FA 4YMZA 4HK5A 1ZAHA 4Z0SA 4JKLA 2E9LA 4UQDA 5DT5A 4PTNA 3I4KA 3QY7A 1UJPA 1D8CA 5HPCA 1R3WA 4MKNA 4AG0A 2R1MA 1GONA 3GDRA 4YLWA 1YPXA 3MP3A 4WY0F 4E2VA 4OV9A 4KS0A 3BMVA 2WCAA 1XIGA 2OZ3A 3BLFA 3ALGA 5GNZA 4CQDA 4GKLA 1R2RA 3UQNA 2X8RA 1KGXA 4E3VA 4MM1A 3DHUA 4PMOA 4US6A 4IGSA 4DZAA 1Y7VA 2VC6A 4HYVA 4W5ZA 1MEHA 1K8XA 3AU2A 3N13A 3E02A 2J13A 3LQLA 3RHGA 3BUVA 1JDEA 4AF0A 2OCZA 1R86A 2W0UA 1LUCB 4CU7A 3NL2A 5A6JA 2Z7KA 3S1VA 4GINA 1KLZA 3VNJA 2PP0A 4YTUA 3O7UA 1ONEA 4K7VA 3N1AA 3BAKA 3IJDA 2B7OA 3MHUA 3AYRA 3AZSA 4WJ8A 3HZ3A 1FHUA 1W1VA 4MLJA 3CWNA 1BYBA 3SJNA 5XIMA 4RNHA 2X0YA 3DFHA 4JIEA 4B5WA 3L4ZA 3AU6A 1XRSA 3PBUA 4UCFA 3W29A 4D9PA 3SUVA 5HR7A 3NDOA 3V16A 4HBKA 5C6MA 2HSAA 1GW9A 4HZ8A 1H62A 1KD0A 2Z2BA 3I3EA 3DFSA 3VD3A 1UR9A 4DWSA 2OLSA 2PI6A 4Q8TA 1JI2A 6CGTA 1XLDA 4B5TA 1X6NA 3ITLA 4JNZA 2O9TA 3W07A 5HPOA 1U1JA 1OABA 2WNNA 3GW0A 4OZOA 1VAHA 3LNMA 3GFXA 4P7QA 3NJ3A 7CGTA 1MUCA 2VYOA 4A8NA 1M65A 2OFJA 1S1PA 2DIEA 4AZCA 3QTGA 4LUIA 2CZ5A 3FX4A 3BAXA 3PJXA 4S3KA 2UY4A 3IIOA 3LQGA 1JG9A 1VP5A 3RMEA 2JKAA 2CKRA 1HO4A 4M6VA 4QXIA 2G41A 3ZQ9A 3ZYZA 2GQ8A 4UMCA 3WEZA 3CUIA 2WW5A 2A3LA 2IQDA 2FTPA 2WCGA 5EMUA 5I03A 3O0FA 4FK9A 3W7DA 4A8LA 1O66A 2BXZA 2ZA1A 1DVJA 5C2XA 3UWQA 3NDZA 1OGGA 3W6MA 3DCPA 2OWCA 5CZ0A 5ABEA 4JX6A 2RH9A 4K1GA 2DH2A 4FX7A 1BF6A 4ZBCA 3S1XA 3RGTA 1CTNA 3FXYA 3H2FA 2WOQA 1KR1A 2VX7A 3LXCA 3GDLA 3ARQA 2E40A 1SZEA 4NKCA 4BA0A 2HPMA 3WMCA 1FP9A 3SUWA 1DWIM 1UPMB 2JKEA 4HK6A 3OG3A 3CL6A 4NZ5A 3GVRA 2DSUA 3TR9A 1P7TA 2XSAA 3Q45A 1IZCA 3F2CA 3V3WA 4MWAA 2HJPA 1PTDA 4EP8C 1KWKA 2PTZA 3GE7A 1NF7A 2ZDRA 4ERGA 2I7GA 1IQ8A 3SEPA 3SRFA 1R9XA 5AB3A 1PX3A 2C19A 1CECA 3TX9A 4AWUA 4DO5A 5KEZA 3H21A 1LG1A 3BW3A 1R7OA 4H8NA 2VMFA 2Y1HA 1DP0A 1VFLA 3MVTA 2REQB 3TH6A 1IEVA 4HHLA 4UTMA 1SSDA 2YFOA 1KTNA 4J28A 4IFRA 1UA7A 3ZT6A 5ABFA 2J79A 2BY3A 4O1AA 3PUOA 3NEVA 3I6TA 2V2HA 2XIJA 2FMOA 2XH0A 2OZTA 3PZIA 4QQ3A 1ISXA 1F4AA 4GYFA 4W93A 1I1WA 3LCLA 1QWGA 4S3AA 2E67A 5A6SA 9RUBA 3S2LA 1MYRA 1QOQA 3NA8A 1BXCA 3LS9A 4R5EA 4B15A 5I0DA 3ZJ6A 3T2PA 4V1XA 1M7JA 4BS0A 1XLLA 1G5AA 1BQGA 1GOKA 2OGJA 4DQWA 2FHFA 4L7ZA 2QDDA 3G18A 3GR7A 3NSNA 2E0PA 4FF5A 5C7VA 1RR2A 2DV0A 3DG6A 3ZR6A 4MYXA 3NZQA 4QE4A 3FKRA 3RLGA 1EJSC 4J3UA 1KCKA 1T8QA 4L80A 3WBWA 4FF7A 1SZRA 1QXLA 2DVTA 4NJKA 1SJBA 3N14A 2P1FA 1H5VA 3PWGA 4PR4A 4JTEA 1OWQA 1RCXB 4DVOA 4PA8A 4Q4OA 2CIPA 5JUVA 4PCPA 2PRLA 4JOMA 1UP2A 3SSZA 3QY8A 4K8HA 2GZXA 2L5HA 4QDMA 3UR8A 5HAOA 3WENA 4BR1A 3O2LA 5I3HA 2AL2B 5FL0A 1UKTA 4LNCA 1FDJA 1VFSA 3VAVA 4MTVA 4Q6XA 4FLRA 3BLOA 1NOWA 3G0UA 2PDJA 4G7EB 3F4NA 3RDKA 3A9IA 1UKOA 4H19A 3T0DA 3BK0A 1QPQA 2DZTA 3R8RA 4DBDA 2QCNA 4CKQA 4CEXC 4YTRA 3CPUA 2J8FA 4AWEA 1W91A 3TYCA 2FZDA 1XIMA 3N4AA 1GKRA 3OHMB 1L6WA 1M04A 2V6AA 3LCGA 3S5SA 1I0BA 2GJLA 1NDVA 3GAYA 1YMYA 4LAUA 1E9LA 1PTAA 1XC6A 1KW1A 1E0WA 4XB3A 3R79A 4H00A 4TVDA 3WFZA 3NFUA 5DMMA 2VCBA 4KPLA 3UR2A 3S1WA 1KBLA 2XINA 5C9XA 5D4YA 5L6UA 3MCMA 3OEXA 4GFIA 7ODCA 3TSDA 1KKOA 3WIJA 4LOCA 5K3VA 4G1NA 4C6KA 1S1RA 2FPVA 2YR1A 4GYKA 4NAEA 5LGXA 2VZTA 4XZHA 3E0IA 2QW5A 3WY1A 1W32A 4GUHA 1E43A 2QS8A 4N9CA 3M0ZA 4IIEA 1R38A 4NIRA 1F3XA 4IMAA 2C15A 1NWRA 4HNUA 4S3BA 2XGBA 4KWUA 4N7QA 5CZSA 1GKPA 3EWUA 1OJXA 1XYBA 4TX9A 1DJZA 2FZ8A 3H2OA 1H1ZA 4GIAA 2J7HA 3B9EA 3G1DA 1R85A 1ZL1A 2YCKX 2WC4A 1ITCA 3WF3A 1TR1A 2FMNA 3AIEA 3MVIA 4C5ZA 4ML4A 4UR8A 2ZUNA 3S2CA 1CYGA 5I5RA 3P3BA 3UG5A 4HCHA 1KRCC 2V5LA 1EO7A 3L4VA 1ZBWA 1XDJA 3S9YA 2GK1B 1GWJA 5U4NA 2ZE3A 4AIOA 5JBFA 4I5XA 4P8XA 4XUYA 1FCUA 3ITXA 4PCNA 5FESA 3L5MA 1GTEA 3RX3A 5HBFA 1ZBVA 1AH3A 4OIFA 3ZR5A 3QPYA 1BKSA 2WSPA 5FKYA 2I5GA 1YEYA 1UD3A 2VURA 1NELA 1X8CA 2GDUA 2PD9A 4AIUA 1L6YA 4AHOA 2ZXAA 6A3HA 3TYEA 4FXFA 1TPFA 2BGNE 3WUGA 2OGYA 4B9ZA 3M5YA 3BGGA 2WC3A 1TIWA 3C61A 3EKLA 4LS2A 4LBUA 3V18A 2BXVA 2YCIX 2AKZA 3ARYA 5JQ9A 4IOTA 5CG0A 1E56A 3UVAA 1MEIA 4MJZA 1XDLA 3G5EA 1C8XA 3MC5A 3NAVA 3L5AA 1BXNA 5IDIA 5EYWA 4E4PA 1YXDA 4NSBA 1C92A 3BMWA 3WK2A 3OA5A 3N2CA 4Y7EA 5EL1A 3IK4A 3HTWA 2ISSA 1XM3A 1HP4A 4I90A 1O4UA 5A8GA 3HJZA 2G97A 3F4WA 3GIPA 2TRSA 1OX6A 4IJRA 2PLMA 2WZEA 3QHNA 1VBGA 3VX0A 3A5VA 3PPFA 2PZNA 3VCNA 1O5XA 2WSRA 4LWWA 3ZJ7A 3PSVA 1SFTA 2WXDM 4KFPA 4DXVA 1UR0A 3R0UA 1VBHA 3W7KA 3N9KA 3VZXA 3KW3A 4Q4MA 5DMNA 3CV7A 4DUWA 3KTSA 5I3DA 1E72M 1J93A 2R94A 3ONCA 1O68A 2JEPA 4MB1A 4WGXA 1QOPA 2W27A 5GNYA 2FGBA 2X1SA 3FLUA 4RPQA 2P0IA 1JPIA 3E12A 4O54A 3O1NA 3AIUA 4U3AA 3A22A 1ONRA 1P0DA 1E0XA 1JDCA 1SO4A 5BOFA 2PTWA 4HSHA 2V2DA 5FOOA 2J9XA 2AAAA 3CTLA 4WKHA 3M0VA 3FN9A 3CUZA 3PFRA 4QRNA 3MO7A 4KRUA 3E2SA 1B4EA 1CI1A 5CBJA 1CBGA 2DZUA 1KM1A 3VKBA 3KL0A 3T2QA 2BY1A 1ICPA 3APTA 4JEQA 2KZHA 1RBLA 4FX8A 3EXRA 1NP2A 3IPWA 5T9BG 4UOZA 1Q6OA 1QFEA 4M6UA 3EEZA 2ZRWA 3Q94A 5REQA 4IL0A 1PS9A 2WLZA 1U1UA 4DI8A 3WL1A 2TSYA 4F79A 2GSJA 3CHEA 3W7GA 5AHFA 4B2DD 1V79A 4XO6A 1EL3A 4RDWA 4DM1A 4L4MA 2NZLA 3MS8A 2CXGA 2QPSA 4XZNX 4HTYA 1QT1A 4HQVA 3E9AA 2DUXA 3JVAA 1W9PA 1K6AA 1W8GA 4Q22A 2DORA 1WZMA 4J9JA 3CUHA 1MXDA 3LY0A 4W7WA 1B9BA 1V8EA 4MB3A 1ZZMA 1KWGA 1KC7A 1PB0A 3VOCA 5DCEA 1C9DA 2G3IA 4LW7A 3MV01 3NL6A 2TPSA 2W92A 3A64A 3NQ8A 1UHVA 5JXQA 1OYCA 4HPNA 3ZWTA 2OQLA 3A9BA 1CLXA 4IWWA 1H0IA 3GNXA 4UTFA 2VEFA 2GSEA 5FJJA 4O10A 4WSHA 1TO3A 1EWDA 3OP2A 3KL5A 4LUJA 4FO4A 4F0KA 3SCVA 4CNNA 2E6YA 1PWMA 3BAWA 3QC3A 1NWTA 4GJIA 1R8LA 1KCZA 2YJQA 2DEPA 1ISVA 1GOQA 3UYCA 1G01A 2V8ZA 2NUWA 5TQLA 4DXXA 1KFEA 3M0LA 4EXAA 3VIFA 4A05A 1NFBA 3QV6A 1QASA 4KW2A 4LV9A 3TWAA 5C8BB 3S2MA 1LROA 4E2OA 3R0KA 4Q7NA 5BXTA 1PZ0A 3HPZA 4MGGA 2VX5A 4GI8A 4A22A 4UOQA 4EPBC 4R27A 4RUBA 1LLZA 4Y8EA 3QFEA 2J27A 3H70A 1AW1A 3PAOA 3BLLA 4NZ4A 4FPSA 1P6BA 1XYFA 1MQRA 1IV8A 4JFSA 5DY3A 5IHSA 1F61A 4RKAA 3UY7A 1SW3A 5F7UA 4XAZA 1F6PA 2VRJA 4F40A 2H90A 2PTDA 1HKKA 1XI3A 3M6DA 1VYSX 3WJSA 1LTDA 3WNMA 3A23A 2QF7A 1J5SA 3A4XA 4AISA 3C2FA 2GJXA 4MHBA 3ZVHA 3FAXA 1IGWA 4ROQA 3L4UA 1GEQA 3M7SA 3TWBA 3BW4A 1W1ZA 2HE8A 3HU7A 2PDBA 1EGMA 3N3TA 4JIIX 3SQLA 5T9CE 1C8YA 1P0BA 5D32A 1EJUC 6XIMA 3UESA 4AVNA 3B97A 2ATSA 1YYAA 4K8GA 3L0KA 3PB0A 3LBMA 1VEPA 1H63A 4D6IA 2H3BA 3HG5A 3LB0A 4Q8VA 2PC4A 3FXGA 4XSMA 1S5MA 2IW0A 5CBBA 2VD9A 2PSNA 1X8FA 1REQA 1W17A 3KM8A 2QEZA 3EDFA 5EBUA 1SJDA 3PG8A 1NF0A 1LM1A 4IHCA 3JZEA 1E71M 1GK8A 3MSYA 1UR2A 1T0OA 1PV8A 3S3GA 5J04A 2Z24A 1V7AA 4JDYA 3EMZA 3OYZA 4KEUA 4HNLA 5AHNA 4ADSA 3V5FA 1OD8A 1ZUAX 3UFYA 3U2OA 1JYVA 3P61A 2W61A 3HQNA 3TR2A 3MKKA 1UB3A 5HNUA 3WK3A 1H1YA 4C1LA 2I9EA 3GZ3A 2BOEX 1FWEC 3OW1A 2FHCA 3FKKA 3ARVA 3S5YA 4PRTA 3WK0A 4DUXA 7XIMA 3NIYA 2YCJA 4UFIA 2DT2A 1EQCA 5AHIA 1XYZA 2KX9A 2P76A 3E0LA 5CPOA 4JY8A 4HMEA 2UBPC 3PAJA 4GKTA 2ISDA 4TXEA 3FAWA 1XLJA 2V69A 3GKAA 2VEIA 1XLGA 1TPB1 4HMCA 3T42A 5HOSA 4WXYA 5HINA 3V0TA 3CNYA 3H22A 1HKVA 1GOWA 3AHZA 3V36A 2WNWA 3ITGA 4L1WA 1XLHA 2PLJA 2XDFA 2YLLA 4LYQA 1IT8A 1Q8AA 6ENLA 1J2BA 1MZRA 2OKTA 4IP7A 1RY8A 2PGEA 4EACA 3KOZA 3REQB 1Q7QA 3DERA 4QSFA 2E9MA 4GYPA 1H3GA 3CMJA 1V02E 4AY7A 2EPKX 4UZUA 3THUA 3W4RA 5CAHA 4IMFA 3WJYA 2HNEA 3GYEA 2PRHA 5FEZA 3KBMA 2OTDA 3LNPA 4MPKA 2ZWZA 4LB3A 1ZTVA 5FJUA 5KZEA 2ZRXA 3LEPA 4OQVA 1ISZA 1SM9A 1KB3A 1JFXA 2BGQA 3B0PA 3VOHA 1DXEA 1GGOA 2CERA 2ICSA 2BOFX 4QSHA 1OADA 4RV8A 4ZCWA 1IXQA 2VHLA 1UIOA 2J6XA 1PX8A 3IUIA 3GC5A 2X0HA 2FVLA 4J5NA 3MI3A 3LLXA 3RMJA 3WLJA 4C6JA 3QFWA 3A47A 1UD6A 2VZUA 3PBGA 2ALRA 1F74A 3GYCA 1OINA 3UY8A 3QLDA 1EBHA 3L4YA 5AYBA 4C7GA 3FA5A 3H7RA 3MPGA 1MXGA 3PUDA 4CNSA 1A0EA 5C55A 4P8VA 2Y7DA 4IZGA 3VOFA 4LS0A 1OF6A 2V30A 1K9FA 2WSQA 4MJMA 1YDNA 3WNNA 1KM0A 1WZKA 1U5JA 4GX9A 3V1PA 3DYOA 4Q8QA 3TSBA 3P5ZA 2CBJA 1BG4A 5JBDA 1EA9C 2BLEA 2VGBA 3WD3A 5CXPA 4DWSC 2GQAA 3GAKA 2ATMA 4QEEA 3R58A 3RG6A 3MDWA 4HPHA 1MUMA 2A1YA 2BP1A 4XTIA 3A3WA 1C29A 3CAQA 4HSOA 3KVKA 4KCWA 3C0SA 3K4AA 1LDCA 3FJ6A 2BTMA 5DX7A 4KWWA 3BLEA 1Q5MA 4EE9A 3L21A 1EX1A 4UTKA 4GQBA 3GFZA 5H8PA 3BOXA 4J1OA 3U9IA 2RDWA 1HKWA 4QJ5B 1VH7A 1NDYA 3S5OA 3EDDA 3QH2A 1FUYA 5HQEA 4HYRA 4ZA0A 3F5JA 3SIZA 2GUYA 4ZMGA 5AZ0A 1W9UA 3VDHA 1D8WA 4NG3A 1XX1A 2I56A 1LYXA 1X1NA 4NU7A 1Q6RA 1K8ZA 1K8YA 2FGZA 3S4TA 2J7FA 1SUXA 5D2VA 1OF8A 4C6FA 9XIAA 1K6WA 2XIIA 4GCXA 3T1GA 3WH7A 3RJYA 5FSDC 3HGRA 4ZO7A 4IIDA 5DANA 1WCGA 1E70M 1I45A 4LUSA 2NW0A 1XCWA 4UTJA 1X6UA 3T8LA 4UQBA 2XUCA 4Z1DA 4AC1X 1R0MA 3GXTA 4JCLA 4YWSA 1IGSA 2AGKA 1FQ0A 2P50A 4INFA 5KINA 2EJ1A 4XUGA 1SU5A 4M51A 5E9AA 3FJNA 2PODA 4MWAC 4WY0A 2GSHA 2AQWA 3LG3A 3UR7A 3M0KA 3OLIA 2QAPA 3PTDA 4GCAA 3W7HA 1ONWA 3ERPA 1NM9A 2QGYA 3W25A 2FFCA 5EMJA 3RAOA 2XSXA 2HV5A 3UGVA 5IBXA 1JZ7A 4R7OA 5U7SA 1LORA 3K1GA 2CLLA 3ARTA 4UCGA 4H1ZA 1US0A 2Z0IA 2A2IA 5CPSA 5EMKA 4H9MA 1R3QA 3W7QA 4PULA 4R85A 1GVSA 3KOWA 4HGXA 4H8HA 4FZIA 2CZVA 1VC4A 1XISA 4Y9NA 3WL0A 1Z89A 4S3DA 4DAFA 4MG4A 4A3RA 3RPMA 3SZ8A 3U2CA 3VGHA 4D6DA 2YKKA 5LYRA 1W3IA 1THFD 1HJWA 2Z1SA