1TWDA

Crystal structure of the putative copper homeostasis protein (cutc) from shigella flexneri, northeast structural genomics target sfr33
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
247
structure length
234
Chain Sequence
ALLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQRVTIPVHPIIRPRGGDFCYSDGEFAAILEDVRTVRELGFPGLVTGVLDVDGNVDMPRMEKIMAAAGPLAVTFHRAFDMCANPLYTLNNLAELGIARVLTSGQKSDALQGLSKIMELIAHRDAPIIMAGAGVRAENLHHFLDAGVLEVHSSAGAWQASPMRYRNYSRYIVDGAAVAEMKGIIERHQAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Putative Copper Homeostasis Protein (CutC) from Shigella flexneri, Northeast Structural Genomics Target SfR33
rcsb
source organism Shigella flexneri
molecule tags Metal binding protein
molecule keywords Copper homeostasis protein cutC
total genus 75
structure length 234
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03932 CutC CutC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.380 Alpha Beta Alpha-Beta Barrel TIM Barrel Copper homeostasis (CutC) domain 1twdA00
3IWPA 4R9XA 1X8CA 2BDQA 1TWDA 1X7IA
chains in the Genus database with same CATH superfamily
3VD3A 1VR6A 4PE8A 4GVFA 1CEOA 1E71M 4O0KA 3THUA 2YYUA 4M29A 3AMLA 3WN6A 2JQXA 4P8XA 4M1BA 4UB9A 1JCMP 3URBA 3NZRA 1PX4A 4UQAA 4WLCA 4QAIA 5CSUA 3L5LA 3CMFA 4H9YA 4LPCA 3SRDA 3V1PA 3O63A 2EQDA 3KTCA 3LS9A 4UNLA 4AF0A 5CQ1A 1AJ0A 3HZ3A 2EG6A 4A3YA 4XTIA 4L4PA 3IIOA 1JCYA 2WQDA 2J74A 4KIEA 1GVSA 1IXQA 4D1IA 3QKZA 3VIFA 1PZ3A 1MW0A 4JKMA 1ISYA 3WQOA 2QUTA 1VFLA 4DF2A 2E1WA 3PY2A 1QATA 1KD0A 3TONA 2DT2A 3GM8A 4K7VA 4YTUA 2DT3A 2DVUA 3BQ5A 1XS2A 1C3FA 3BGAA 2XIOA 3UWEA 3VDHA 4FX8A 4M24A 4NXKA 2PE4A 2X2YA 2HPMA 1JRBA 1PXGA 1J2WA 3VIPA 3LXBA 5JXQA 2XINA 4X2PA 1PCWA 1FXQA 4PMUA 5LGXA 2YW3A 1Q7QA 1MW1A 1VH7A 3CK5A 2UBPC 3N73A 3LCLA 3CWNA 3E49A 1W1ZA 3T7VA 4UUIA 1CYGA 4JIHA 2X41A 5EFFA 2JIWA 5EL1A 3LI1A 3WNKA 5E9XA 3EX4A 5LKYA 2YBTA 1P43A 4B2DA 2E6FA 1FFRA 1FWBC 1J12A 4XO6A 3U4FA 1NWTA 3T42A 4WKAA 1I4NA 1Q6CA 1EL3A 4BQ4A 1KR0A 3E2RA 2J13A 2BX7A 2CLLA 3N9SA 4RNJA 4X0NA 1IT8A 4RZ6A 4DBSA 5HNTA 1MVYA 3QTPA 3FIGA 1FWRA 1LWHA 5T9BG 5A6MA 3HOJA 3GTHA 3AHTA 2TYSA 1EBHA 2WJZA 4FXFA 1HKKA 3BG3A 2BY3A 1FVPA 4BI5A 3UWQA 2X7WA 2CZFA 3S9ZA 3H7UA 4XKYA 1K7EA 1LF1A 4XZ9A 4Q4PA 2VX6A 1X6UA 1MDLA 1UJQA 1XIHA 3KRZA 4UFMA 1R30A 4PCSA 1XIGA 2QDHA 1XBZA 2J9ZA 3OGVA 4BK9A 2VR4A 1GVOA 3LERA 3MBDA 3C0SA 4GINA 2CWNA 2Y5SA 4H2CA 4EP8C 1FCBA 3EWBX 3G0UA 2QMKA 1Y0EA 4IOTA 3LN3A 1XLJA 4D6IA 2YL6A 4QDWA 1R8LA 1XYZA 1K77A 3CUIA 1E9ZB 2FHCA 1Z7AA 2Y70A 4DUOA 3FOKA 3ARXA 3EPMA 2BBFA 4I9MA 2VX5A 1PS9A 2HE8A 3L2MA 3VOJA 1KCLA 1HN1A 1PZ0A 4AU0A 2DORA 1PO9A 4CD7A 3MUZ1 2P0IA 5HMDA 1W9DM 3QW3A 5DXXA 2ACSA 1F3EA 3MI6A 3B40A 3ZLGA 5C5YA 4XIAA 1I2RA 3EMCA 3II1A 3TMLA 2AQOA 2P5NA 2QIIA 5LNWA 1ZAJA 4YMZA 3HQOA 2LLEA 4GPNA 4RDVA 2DY3A 1ZB5A 3DC0A 4WDXA 1WKEA 2XN2A 5F4WA 4GYKA 4AIOA 5D33A 2PTWA 4ERIA 1UWIA 2ZZ2A 1UD4A 3WZ0E 3DYMA 4DF0A 3G0SA 4I5UA 1C29A 3KRSA 4B91A 1QK2A 4H4IA 3R25A 2RUSA 1JI2A 1HL9A 3F4DA 2UY3A 1UB3A 4M7SA 2DZTA 3TX9A 1G7UA 3VUPA 1LBFA 3K13A 4LC8A 3W85A 4AZ6A 3EYPA 4Q3MA 4AZGA 3ATYA 3TYBA 1E9YB 3O1NA 3MKVA 3QHMA 1XDLA 2V3GA 1K9FA 3PTMA 1Q7MA 1R6WA 2WM1A 4HT3A 3NYDA 1TJ0A 3VUSA 4W7WA 1VGAA 4YWSA 4CQ9A 3N04A 4DN1A 1WAUA 1XHGA 2NQ9A 3A13A 5LZLA 5JIWA 5C55A 2V2DA 4GZ7A 3UA3A 3CV6A 1DWIM 2DP3A 2XZ9A 4KFOA 3VIKA 4RXFA 3VXGA 1W56A 2QCHA 4LVDA 3CMGA 4I5XA 4YHGA 1B57A 4D6JA 5IFPA 1HTIA 1UIPA 3VCCA 3A3XA 4U3CA 5H8UA 3G3MA 1CB7B 3BGGA 1J2BA 6TIMA 1GWJA 4OTKA 1EUNA 1IWPA 1RBLA 3ARVA 3C2VA 2F2KA 1D7FA 3CZ8A 5HJLA 3OHIA 3KOYA 1K9DA 3BH4A 1JCTA 4ATWA 3NTYA 3M0YA 1LOSA 2I5QA 2FHBA 3WL0A 2PC8A 3C2EA 3WNOA 4F0LA 3FJLA 5GQBA 1R3WA 3O7UA 3OQEA 5LA0A 2X16A 1A4MA 4MUPA 3S1WA 2WZIA 4PTVA 3UP8A 1XCFA 4EOUA 4DF1A 5CZSA 3NVTA 3SQLA 4MYXA 5FCZA 2VYOA 3RO8A 3GH7A 3C0LA 3N14A 1WDRA 3PZOA 4MPQA 3W86A 2XFWA 3GWQA 3NEVA 3UXLA 3MVTA 2P88A 5XIMA 3TCEA 3MUAA 4I90A 4PFMA 1KV8A 3ERPA 1WP6A 3CZLA 5F4XA 2VFIA 1Y5XA 3W7RA 5HUOA 2E5DA 2HBXA 2ALDA 1V6YA 2QW5A 3O6YX 1HIZA 4CD6A 2BMBA 3CAWA 4JX5A 1X7FA 1DJNA 4Y9NA 2GWGA 1ZJBA 5I7GA 4Z2JA 2C7FA 1EX1A 4EACA 2Z28A 4P8WA 4TXEA 4FF5A 1GOXA 3GG1A 1QI5A 1LUCA 4GO9A 4XAGA 2V5DA 3UBPC 1B2YA 3U57A 1N55A 3C3NA 1WE5A 2E4TA 2ZUTA 3HB9A 2ZQ0A 1A50A 3Q4DA 3ZLFA 4W8BA 1JIBA 2J7EA 3V0UA 3MP4A 3H70A 6REQA 1VHCA 1ENUA 4TU1A 2EPOA 2AGKA 2GSEA 4FOJA 4PMRA 3SSJA 1N8FA 3UCDA 5C6MA 3CS2A 1XH2A 1S2TA 5E6ZA 1PKLA 3AWNA 3EGJA 3LSCA 2OO0A 3W1MA 1WOAA 2AL2A 4C6DA 1TR1A 3RPTA 1T96A 1MUWA 3R0UA 2Q8LA 2GDQA 4OV9A 4EAMA 4W84A 1SFSA 5FSDC 1SMAA 4WSJA 4HNVA 2GSJA 3PZNA 4LH8A 2AQWA 3LLDA 5EBUA 1UQZA 5A6KA 1QO2A 3GDMA 4NNCA 3O06A 4GQRA 4RNIA 4Q6XA 1MEWA 2YJQA 1SJCA 2QZRA 3H12A 5DY2A 3VCRA 4PMOA 3NDOA 3PK7A 3FFSA 3AO0A 4NAEB 3TJ4A 2CZEA 5GNXA 1M5WA 2E28A 1O6IA 2PB1A 2YA2A 1BG4A 3LI0A 5BNKA 4MNJA 4K2SA 2HISA 1W37A 2ZCGA 1TRIA 1BSLA 5BMWA 4I6KA 2FMOA 3JZUA 2NWSA 2YLLA 3CWHA 1ISXA 3OLEA 4ZQRA 3ZJ8A 4QR6A 1ADOA 3PB2A 3GNNA 4GQGA 1V03A 3GTNA 3GYEA 4IFOA 1MNZA 4JIPA 2QJNA 4AZBA 4H9XA 1UZ4A 3EB2A 4WOQA 4UTUA 4XBJA 1W9BM 2CU0A 4Q8NA 1X1OA 4XVEA 2PLMA 4BKNA 3RX2A 5MF5A 2E9LA 3MA8A 3CAKA 5E09A 4DJED 3ARYA 6REQB 1FH7A 3W7EA 1BWKA 2JALA 3T2QA 4PUJA 3EA1A 3M0ZA 4NZ1A 3GNRA 5E0FA 3RLGA 4M3PA 2FPTA 4GD0A 2ZC1A 1E1FA 1GOOA 4WY0F 3C2FA 4KCTA 2NV2A 4YN5A 1WXZA 5DMMA 4JHOA 4HNCA 3HU7A 1T6MA 1XLDA 2GL5A 4JDBA 5AOUA 2OLAA 4DB7A 1TV5A 2GVGA 3GAYA 1TG7A 3QPEA 4KS0A 4NAFB 1S38A 4UBPC 4L4MA 1UBPC 3CL8A 2WMJA 5K4XA 1QI3A 1CW2A 5D9OA 2OELA 3SM0A 2F6KA 4Z42C 4OVXA 4EPDC 4CD8A 3OVRA 3BGJA 1E15A 2Z6JA 5IBXC 2YYTA 3WKZA 2VWSA 1TTQA 3W7LA 4L1GA 3QY6A 1R2RA 1R2SA 2AKMA 3TNOA 3P81A 4S2CA 4GKTA 3LA4A 1J18A 3NSNA 3OJGA 1X96A 4PRWA 4F3HA 1RK5A 1O5XA 4J27A 2E0PA 2WSPA 2WM0A 3G1HA 4PSPA 3U7BA 1XCWA 5EBAA 3POHA 4K39A 2DSVA 2EBNA 3SURA 1TA3B 1ZFJA 3LTPA 3SJ3A 2VKZG 3ZSTA 5LIXX 1E3XA 2G97A 1HKIA 2V3EA 1G4SA 4Y8EA 3NR0A 2X7VA 1MRQA 1ISZA 3HGSA 1S5MA 1XXXA 4FNUA 5BOFA 3P80A 1L2UA 4G8TA 1GHSA 1A3XA 4C6NA 1Q65A 3IRSA 3KDOA 3H23A 2PZ0A 1IEVA 1XGEA 1PEZA 2GJNA 4O50A 4RPQA 1WBHA 2G3IA 3VOFA 3KE0A 3KM8A 5FJPA 2QCLA 3MDUA 2NT1A 3SCSA 4HHPA 4XG1A 2PTXA 2KX9A 4JYFA 2V0TA 4PR4A 4DEFA 1X1NA 1S5TA 2GOUA 4Q4RA 1J5SA 3B9DA 2ZWZA 4IWWA 4ADUA 3U6WA 1EDGA 4CU6A 5DQPA 1BPLB 3L0NA 4JXCA 3PZUA 2V3DA 5BYWA 1KBKA 2ZRZA 4M6VA 5KEZA 5KSWA 3TWBA 1KFWA 1NOUA 1QNSA 4S3GA 2DSWA 1ZZMA 3HGJA 4W93A 2ISVA 1XDMA 4KFPA 2PRLA 3DOPA 1CLXA 2R1PA 3ZIZA 1GOMA 3QR3A 5G1TA 1ONWA 5FOOA 3RX4A 3M46A 1PIFA 2VC7A 1A47A 4REQA 1QPRA 4ZVJA 5JBFA 3HFYA 4QIUA 1TV2A 4DBUA 4CCDA 2ZZ1A 2DU2A 2FGBA 4AWTA 3GXFA 5DRIA 1V6XA 3EOUA 3THCA 3D3FA 3EB3A 1BWVA 3KVLA 5DO8A 3CPGA 3TA6A 5CBBA 4XB3A 1XIEA 1IR2A 1K8ZA 1RD5A 1WZKA 4W87A 1VENA 5CPLA 3N17A 1EEXA 2AAAA 1HL2A 3W76A 9CGTA 3VO0A 4AEFA 4DZAA 4AY7A 2BASA 1FFQA 6PTDA 2PS2A 3RUBL 2WLYA 3WLOA 1W1PA 4FSAA 3ZMRA 2YCIX 2YBVA 4F0KA 3QQWA 3O6CA 5CC5A 2ZZ5A 3M64A 1JGIA 3SY5A 1BYAA 2PDLA 3FLUA 3BOLA 1KRAC 3I7RA 4MFEA 1H49A 1DOSA 1U83A 1YXCA 3S5OA 3VDCA 1KM4A 1OF8A 3RMEA 5J04A 4LBUA 1V8EA 5C9ZA 3C3UA 1I75A 1LWIA 4OE7A 3F2BA 1GUVA 1BXBA 3FNDA 5C2CA 1JCNA 3MUCA 4B9YA 3KOXA 4QLJA 3IJLA 3UG4A 4D2JA 5HR7A 1XKYA 1QO5A 4PB4A 4TO8A 3EA3A 1H7OA 1UBSA 3ITTA 1TJPA 3NL2A 4UOJA 4XIMA 3CNYA 4UFKA 1CZ1A 2QJJA 4XZNX 4JX6A 5DELA 3UCCA 3QV9A 2I57A 1GYLA 1GOQA 4QS6A 1S46A 3O05A 4M6QA 3NQCA 3WD3A 3CIWA 3GSMA 3VILA 4IHCA 4CLMA 4GIEA 3IUIA 4H41A 2UY5A 3B4YA 4CVUA 5K7JA 1OZMA 2DSKA 1TX0A 4JTAA 1PX8A 2XVGA 2YL8A 1P0EA 4AIEA 3GDLA 1EP1A 3AU2A 4KQNA 4D6CA 4JTHA 4AW7A 1FWGC 1I2PA 3QYQA 4WD0A 1W8SA 4NJKA 1EPXA 2P8BA 2WMIA 1LRTA 3DKLA 3T9PA 1J0ZA 2NQHA 1K8XA 2UWFA 2WVUA 4Y6GA 3DI0A 3D47A 3TN3A 1E0WA 4FNSA 5AHIA 3ARUA 1HW6A 3HMJG 4GH3A 2DT1A 3RILA 3BTNA 4HU3A 5CZTA 3SRKA 4LY4A 4JL1A 2EPLX 3UVIA 4AX7A 1H1ZA 2ISDA 4L5ZA 2GQ3A 4GACA 1JUBA 2WJDA 4UR8A 1C9DA 2Z25A 2VFDA 3MVIA 4XISA 3G77A 5AHFA 1F2JA 2RFGA 1E6PA 2XFRA 3RPDA 4O1EA 3HPSA 1IE7C 3ZVHA 1VYSX 3WNMA 4ZXLA 3NNTA 1VPYA 2OMAA 4IP5A 4N0RA 2ZX7A 4LALA 3UPWA 1F74A 4MKVA 5BOOA 4NYUA 4LT9A 3LEPA 1UUMA 1LL4A 3AIEA 1SZNA 3H2MA 5D2VA 4JFWA 1QPOA 3E2VA 5HINA 1I45A 2VQUA 4AF0B 5AHLA 2RDWA 1XRVA 3PBYA 5CBIA 2R9RA 5REQB 4R7JA 1IGWA 3MV01 3DECA 3H4XA 1ADSA 2C1IA 1T7LA 1OJXA 3QR1A 3UF9A 1G0CA 4NT0A 2TMDA 4B5VA 3VX1A 2GUYA 3ARQA 4DBWA 2A79A 1TE6A 4CU7A 1A5OC 4NZFA 3WFZA 3WSUA 1OEPA 2W9MA 3UVAA 1JXJA 1A5SA 3N2MA 4C5ZA 1CLKA 4B4FA 8A3HA 4HNUA 5D2WA 1J10A 4IX0A 3MPGA 2OGJA 2VX7A 1BEUA 4UWMA 4DO5A 1VJZA 1OY0A 4X60A 3ORWA 1NFBA 3NZGA 1QHPA 2HPIA 3AIWA 4ZR8A 1TWZA 3QH2A 4C6JA 4KGLA 2WV8A 4J9JA 3W38A 4DBEA 2GVJA 3U2OA 5AY7A 2ZXDA 3UR8A 1TQJA 2H8XA 4PUDA 2XWEA 3W37A 4HTBA 2Y8VA 4PC8A 1DWFM 2ZRYA 3AYTA 1MUMA 3L5MA 5H2ZA 3A23A 4S2BA 1YXDA 5FJOA 2YW4A 3MJMA 4HVXA 4XAZA 2VZTA 1RJRA 4V1YA 3WLIA 3QFWA 4QX4A 2QIWA 1XI3A 2XDFA 3NQ8A 1VB9A 2ON3A 3K2GA 1YLVA 3NL3A 4NX0A 4G1NA 4D6EA 1HKJA 3VM7A 3G1RA 4CEUC 2C79A 1IIHA 3EDKA 3S9YA 4DNMA 3NYZA 4HU0A 1OCNA 1X1ZA 3IV8A 2W92A 5I3HA 3L67A 2DW6A 5CKSA 1ONRA 2IKIA 1W3TA 3TYAA 2PGRA 1Q45A 1JGMA 1ZENA 4GLEA 3RU6A 1AK5A 4IL2A 4K8GA 3ZO9A 2RDXA 3VNIA 2IKHA 2VO5A 4B5SA 4HP5A 1T40A 3CQ0A 2GWNA 3SCOA 4F0SA 3KWSA 3PHAA 3CIVA 1FOBA 2XN1A 4FLQA 4POCA 2YSWA 3F4WA 2Y2WA 3QRHA 3R1ZA 1CI1A 1JD9A 3VM5A 5EMMA 3K8MA 4LCRA 2DJXA 2DZBA 3AU6A 2FVLA 3H8AA 4AZCA 4K3ZA 2Y88A 5HANA 1CDGA 3GKAA 5KMYA 3T4CA 2JEQA 2ZX8A 4HCLA 3ZWTA 1E6NA 4X22A 3LMZA 2D2HA 3WH6A 4E4FA 3ID7A 2V38A 4AD3A 4IXXA 3PG8A 5TBOA 2J9XA 3A64A 1RLCL 1JYVA 1TKKA 3ECQA 2AGTA 3QV7A 3DFSA 3VKDA 1SW0A 1UR1A 4QTGA 3RLHA 4GIRA 4EE9A 1SW3A 1FKXA 2CHNA 1S2VA 5D4YA 3S1VA 2HTMA 4CN1A 3VMNA 2EJAA 4KMQA 3O07A 1IR1A 1K7FA 2YB1A 2CXGA 3UJRA 2CETA 4PYSA 1XFBA 2R14A 3H4GA 2PPGA 3AXHA 1J0YA 4PGLA 2Y5JA 3E1F1 4KW2A 5JUVA 3UESA 3V5OA 2YCKX 3MI3A 2CNCA 1FY6A 4F9DA 3QVQA 3LXCA 1GG1A 4XK2A 1RQBA 1REQA 5DMLA 2PWEA 4ZZ9A 3GTIA 3SCTA 3E38A 1OSEA 4K37A 3W6YA 3LRLA 3PVFA 3OA3A 3TUUA 2Y0FA 1XKJA 4GYPA 1WQ5A 3VDAA 2WNQA 2TAAA 3LG3A 3LU2A 4CNNA 4HNOA 1K7XA 2CEQA 2D0HA 2V81A 1F4HA 3LRKA 3M16A 3MMDA 4ZQMA 3BLPX 4P7NA 1L6SA 1LYXA 1BYBA 4RKAA 4JTCA 3QLLA 4Z1YA 4LYPA 4HSHA 1V7AA 4LAZA 3GHRA 2V5BA 3GU2A 3JRKA 4FAMA 5AYIA 1PIGA 3L0GA 1EJTC 5C9UA 1YRRA 2GDUA 3DDMA 4OV4A 4U5IA 1SO3A 2ATSA 3EWDA 4LWWA 4UNIA 4V15A 4X9YA 2QUNA 4DELA 1W91A 4GGHA 1FUYA 4ZENA 2PDNA 3VGFA 5FAJA 4MDPA 3M5YA 2VR2A 4A2SA 1WA3A 2Z2BA 4RX0A 2GUBA 1RCXB 3H7VA 3LBOA 2IMRA 1SPQA 1VS1A 2F6XA 2O9TA 4AVNA 1Q6RA 4UCGA 3V5FA 1FDJA 2DPEA 1M3UA 3PAOA 3QOKA 4NASA 3W2JA 1WUFA 2WSRA 4LS1A 2QDEA 3R58A 1JUEA 1IZKA 4GABA 3I68A 4JS3A 3HM7A 2DDXA 3O9NA 2OWCA 4WK9A 2DIKA 2OT0A 1TVNA 4Q4MA 1JYXA 3W7MA 1SZEA 3LHZA 3EPOA 1PZ1A 1ZAIA 1PDZA 2D3NA 1GQIA 3WMLA 1PTGA 3CHVA 1BKHA 4QS5A 4RL3A 3WELA 4H8UA 4L9ZA 1KM2A 3AUOA 2CZVA 2PGEA 2QMJA 3L66A 1RLDA 1JPMA 2WVTA 1FWAC 2BY1A 1GG0A 3TQVA 3E0VA 4HTYA 2BOEX 1XF0A 1V02E 4QG6A 4AWEA 5C71A 3VOHA 1GGOA 2I16A 2EF9A 3NCOA 3UWZA 3RITA 1SW7A 4LYQA 4XZLX 3DESA 3BAXA 4I7VA 4M7TA 1SO6A 4Q4SA 4AH7A 2D24A 3FJ6A 4C7DA 4YU1A 5D38A 1KGXA 1EOMA 1K8YA 3WL1A 3EB4A 3SGGA 2GQ8A 3CV7A 2J6XA 4WSHA 3SUWA 1UP0A 1L6GA 3TWAA 4QCFA 2WC7A 1UP3A 1HZYA 3T05A 3BW2A 3CYJA 3WH7A 3W9ZA 1W3JA 4KEUA 2NVCA 4A3HA 4M8UA 1ZP4A 3A22A 1A5UA 5LIKX 2PWHA 4XSLA 3W00A 1KKOA 4UFIA 4HB7A 1F8IA 2TRSA 4PODA 3M4HA 4MDOA 4S3JA 2Y89A 4LUJA 5IOBA 1EDTA 5AHMA 4ZQOA 1BXCA 3TA9A 2Y63A 1P4CA 4KEVA 4WSKA 2B7PA 3WEOA 1J5TA 3TLQA 4CGTA 4D6GA 5DBTA 2FH6A 1AMYA 3WLMA 3GXTA 3KS5A 3ES8A 3UZZA 4PUMA 3W1LA 3OZMA 4CN4A 3AISA 4NRSA 3WMCA 5B7YA 3R4IA 1W9UA 1FKWA 4A2RA 3CO8A 4ZTXA 1GYNA 4ZE5A 1RUSA 1C9WA 1QJWA 2FB2A 5CJNA 5G2WA 2D22A 1NAL1 3N11A 3NPUA 4XD6A 3WLJA 2F9RA 4E2BA 2HS6A 3WF4A 2CITA 3TJXA 3VGHA 4Q8TA 5HATA 3PULA 2CWXA 2GK1A 3GU9A 1TE1A 3I3DA 3VD4A 2PLKA 1D3CA 3ZM8A 2VZUA 2FMNA 2IUZA 3CU2A 3WUGA 5FESA 5REQA 5C2XA 1PDYA 1J9YA 3I65A 2HBVA 3VKAA 1TPWA 1B54A 1JG9A 4LUTB 3B05A 3N4AA 3VX0A 3LCXA 3KCLA 5BZAA 4ACZA 3N3MA 5LIUX 4H6EA 4E8CA 3UZWA 4AUBA 5HR6A 3EDDA 1W1B1 4O52A 1L8NA 1G7VA 4OFCA 3LGGA 3RO6A 5AECA 2PMQA 3BSMA 4DZ5A 4JFTA 1YBQB 3RNDA 5DANA 2CBVA 4EAYA 2CIPA 2WQPA 1GOKA 1DQXA 3NVDA 1OYAA 3PSVA 3E0IA 1H1YA 3G1AA 1ZP3A 3L4TA 2NSXA 2PDGA 1ZU8A 2PDQA 2YZRA 3GKFA 4EF9A 4ZO7A 1S2UA 3CEPA 3RU8X 1FTXA 4A3QA 4HPHA 3TYZA 3CZGA 3BQ6A 3TTSA 3M5VA 3KCOA 2H3DA 1H51A 3ICJA 4FX7A 3THDA 3E0LA 3R8HA 4IPIA 4LUSA 4MAVA 4LQ1A 1U1UA 1H60A 3TOPA 1KA9F 2JIEA 3U2ZA 3VA8A 4V28A 4P7OA 3ALFA 4ICNA 2ACQA 2OEKA 2Y4SA 2PAJA 4J3SA 3CAQA 4YTQA 1EJWC 1UKOA 4W4QA 3BW3A 4J5NA 3DIPA 5JU6A 3TZNA 2NWRA 3H2OA 1MMFA 4J28A 3LHYA 4JFSA 2Z00A 1YDVA 3WNNA 1UWUA 4DPQA 1K9TA 1OC5A 4QITA 1A5BA 4WJ8A 4F40A 4XBSA 3DG6A 2NT0A 1UMYA 1SR0A 2OVLA 2PP0A 2I1OA 3W84A 1KCKA 2ZBTA 5G1MA 4FK9A 3PNUA 1SFJA 1IWAA 4C6CA 3IRDA 2ISSA 3WD4A 1LQ2A 3LV5A 1WBJA 1XG3A 3CB8A 4IIGA 3DFQA 1ITCA 1GZ1A 2WMIB 1RZMA 1PHWA 1RCOB 3PSWA 1UIOA 2PDHA 1EA0A 4NNBA 3A4AA 3AROA 1Q6OA 1XH0A 5LIWX 1XW8A 3ATZA 3S4TA 3B04A 1ME9A 2V5JA 3NQ7A 5D8WA 3MP3A 3PP7A 4QJ5B 3V1HA 2HVOA 1IYXA 4Z08A 4Z2KA 3GIPA 2VHLA 2A3AA 4P61A 1GVEA 1QNQA 3GZ3A 1XLLA 4XZMX 2VURA 3VIIA 2JKAA 3NAVA 1SSDA 1HKWA 1UKPA 5I3KA 4ZQPA 5CJ5A 1OX6A 3UGRA 3BLIA 4RCXA 2QS8A 1JI1A 3RG6A 1RY8A 1WX0A 2QCGA 1CIUA 2OG9A 1FHLA 3A9IA 3GAKA 3ZR4A 4RE2A 1TMQA 3B8VA 3IANA 1MFUA 1E0UA 4U28A 5EFDA 3GE7A 2R24A 4AQLA 2YA1A 5G2IA 1PPIA 2MANA 2W63A 2YCEA 4WJXA 3OHMB 2P3EA 5DRCA 4IMEA 1UD5A 7REQB 1W3IA 2RGMA 4E2VA 3CHCA 5HDRA 4IP4A 3B0UX 2FFCA 2JE8A 3G8EA 3UETA 3RN6A 3K1DA 3TQPA 1XCXA 3LLXA 3QSTA 3W1TA 5DMYA 5I0DA 1PKNA 3B8TA 2GJPA 2ZFAA 5U4NA 1O1HA 2NUYA 2PC4A 4GFIA 4OIFA 4P5UA 4WXYA 3W7HA 3A4JA 3W7QA 1LQ0A 1BLIA 4JIRA 4GI4A 3OBAA 2ZX6A 4C6IA 1XP3A 2CBJA 1OCJA 4GK8A 3UY7A 3PFRA 1H7WA 2UV8G 4TTUA 6ENLA 4PEEA 2G5WA 2GK1B 4NI3A 5A8PA 3WF3A 4A3UA 3ZJ7A 3S1UA 1JAKA 1TMLA 1XJBA 2CHOA 5AYXA 4CN6A 3UXIA 3WMBA 2F6UA 1IT7A 4JY8A 1W5QA 1L0PA 3ITLA 4J3UA 4JFVA 3M7WA 4DIAA 5I24A 1LG2A 3Q65A 2NZLA 4ZBCA 2DV0A 2QYGA 2HNHA 3NWRA 2DH2A 2FTYA 4UTWC 4I8DA 4YCPA 2ZUVA 4HPJA 1RALA 2DZSA 2Z27A 2ZDRA 3VZZA 1OIFA 1CPUA 1NWUA 1K70A 3BOXA 4DAIA 4JD4A 2J8TA 4WOZA 3FEMA 2C19A 3W75A 1H7NA 4G7EB 1SJDA 1OX5A 4DYKA 3BZGA 5FEWA 4W86A 5AYYA 5F2GA 1GVQA 4DX3A 3T2PA 1LLWA 3WK3A 5C70A 3DG3A 4C6PA 4Z1AA 1E5JA 4R3UA 4W5UA 3BOFA 1I1XA 3GFXA 4GG9A 4LVAA 2POZA 4TOQA 4ZFMA 1D2KA 3BJTA 3AOFA 3SUSA 1K6WA 1RBOB 2J7DA 1VFHA 2VT0A 2IS7A 4U5KA 2Y24A 4V27A 1A49A 4HK7A 4O53A 1UH4A 1GOWA 2EG7A 3PJXA 4GNVA 1QBAA 4KFNA 1XPGA 3LSBA 3EKGA 4TMCA 1M04A 2X1RA 3OZOA 1QOXA 1AFSA 3I10A 3UG8A 3M6DA 5DCBA 4XQ6A 1IQ8A 1GCYA 3IWPA 1QUMA 1DJHA 3OIXA 4QJ3B 3GUWA 2A4AA 3QKEA 2WHMA 4Q33A 1QR7A 1UCWA 3CEUA 1M7OA 4BR1A 1X6LA 1ZGDA 3PWAA 1M41A 2QCMA 2R1MA 3SCNA 4ORMA 3IACA 3FEQA 1UR8A 3U3HA 4LAKA 1OINA 3W2LA 3XISA 4I7UA 3STCA 2WPBA 5GNZA 1RXOB 3SN0A 3SN1A 3VGDA 3MMWA 1HP5A 1EHNA 2E68A 1DQUA 4XX6A 4E8DA 4FEZA 1XC6A 4GUGA 2XN0A 2V82A 2YA0A 1VFOA 3UG5A 1L2QA 1QDSA 4N02A 4CNSA 3EOOA 2BP1A 2X1UA 4CQAA 3H54A 5CLWA 1KBJA 2D2OA 4AHOA 1RR2A 1TB3A 3UXKA 1E1EA 3WF0A 2V69A 3KRUA 4IQDA 1TPH1 4UTJA 3BMWA 1VBUA 2VZSA 3N4FA 3ARPA 2CPUA 1Q4NX 3K4AA 1SZGA 3GR7A 2J27A 3B9NA 2D2GA 1OGSA 2YCLB 1SUXA 2VWTA 4GC4A 1L6FA 3PBUA 2O9RA 3S5ZA 1IEQA 4RR4A 3PPFA 3I6RA 4HA4A 3EKZA 1W1YA 3ZLHA 5K9XA 1AG1O 3CH0A 1E4NA 3ARSA 5IDZA 2GVYA 2JK2A 5HWMA 2PRMA 3QXBA 4PMYA 3UNDA 2WNNA 4JNMA 2R1KA 4GQBA 3D6NA 1RAKA 2O7QA 4ZODA 3GBEA 4C5YA 4LNCA 1GTEA 1JVNA 2BS9A 3UD6A 5M03A 2YFOA 4H9UA 1ADDA 3PB0A 3NL6A 1NOFA 2ZE0A 2YLAA 1TVLA 3TV8A 1YTEA 1ESWA 1VYPX 1H62A 2O9OA 3KEHA 4K7YA 3MV11 3T0AA 3B3DA 1Y7VA 4U2YA 5MHBA 3L2LA 1V3MA 2DT0A 3EMQA 2CBIA 3DKJA 4GOAA 4H6RA 2J75A 4UFJA 1CXEA 1NEYA 2HXTA 4HHMA 3H4WA 2QUVA 2E6YA 2EHHA 3MYPA 2F7FA 1MXSA 4V2XA 4US6A 4RV8A 3MJYA 2OQHA 3UJSA 1NP2A 3Q2DA 5B80A 1OT2A 5IDIA 1SM9A 3URAA 4A29A 4M0XA 1PUDA 1VF8A 5CGQA 3ZXWA 2QEZA 2CZ5A 4W5ZA 3GH4A 3MB9A 4MWAB 3BV4A 3AYVA 1TQXA 1A0DA 3VC6A 4PMJA 4JQ1A 3APGA 3QGVA 3THAA 4BS0A 1UKQA 5FF2A 1W1IE 4AB4A 2DSZA 1LJYA 3BPWA 2INFA 4DY1A 3W71A 1WKFA 1XX1A 5CGMA 1KXQA 4AZCB 1RP8A 3K4WA 3UZYA 2FKPA 1KWGA 3CLWA 3LBCA 2VCBA 4RK8A 4S38A 1TTJA 4FXJA 2XM1A 1NDWA 4YVPA 3H2FA 3EMZA 4R85A 3FKKA 2VZOA 2AMGA 3EWWA 4Q6JA 1AH0A 4NL1A 1K03A 3HIJA 4O17A 3KOFA 3IJ8A 3WK0A 1OHLA 2ASHA 1YE6A 1HGWA 1G69A 3WQ8A 1GVYA 3WLSA 3W7OA 3RMJA 3Q67A 4O1CA 4GYFA 2OX4A 1C92A 4CEXC 4UZUA 1VBJA 4HJWA 2J8GA 1R3VA 2OX1A 3R8GA 4F9JA 1DJYA 1GNXA 2BOFX 2XSAA 3W83A 1XLMA 4NZ5A 2E40A 2NXIA 3LENA 4US5D 2OEMA 4D72A 1J6OA 1Y5VA 2WWCA 2OJPA 1V08A 3IS4A 4O15A 2Q8ZA 2CKSA 1NM9A 4E38A 1CB2A 3DFPA 5A94A 3LQGA 3MHGA 3VD5A 3ME3A 5BOEA 1D8CA 4RDWA 3VNZA 2Q71A 3ARRA 2ODOA 2R1LA 1LT8A 2HDJA 3BCFA 3N13A 1NIUA 1Q2SA 3M1ZA 3B9EA 3EX3A 1GVRA 1X97A 3TYUA 3KBJA 1JAEA 2VMFA 1W1TA 2OB3A 4JTRA 4IQJA 1XIJA 4L6OA 1H09A 3WLPA 2E25A 2JBMA 2CERA 2Q3OA 1TFVA 2BG5A 3P61A 4WR3A 4YS1A 5ABHA 1KC7A 3TYDA 1VRXA 5EU9A 4NHVA 4YYFA 3S8HA 2OSXA 3V4BA 1BYCA 5LA2A 3HMCA 1NFGA 4YNGA 3OODA 2VOTA 5AZ1A 4UNKA 2VDIA 2ZUMA 1YE4A 3WNLA 2HZGA 1I2NA 2Y7GA 3RLUA 5IHSA 1D8WA 1DXEA 3P62A 2OYMA 4WUIA 4AWUA 1NF7A 3DBPA 4O14A 1AA1B 3GVWA 1UOZA 5CZ0A 5ABFB 3M47A 1GONA 1P6CA 1U1JA 1W9VA 3V3WA 5L6UA 1XSIA 1TUFA 3S2JA 2QUMA 3M0KA 3OW1A 3QMRA 3L4UA 4G5DA 3NQEA 1ISWA 1US0A 1BWLA 1EIBA 1E9LA 3ABRA 2ABBA 4RZ5A 2VOMA 3W01A 2EPNA 4PL1A 4LY8A 4J35A 4GIYA 1AZ1A 1AJ2A 5HMSA 3WQVA 1L6YA 2OODA 3WEZA 1CWYA 4IJRA 3ABOA 3NZPA 3KZPA 4MKNA 3CQHA 2BHYA 4PMQA 6TAAA 2ZUWA 3MP5A 1ZY9A 3ITGA 8CGTA 4QROA 1CXKA 3P60A 4WZHA 2IQ0A 4X63A 1B3ZA 2YB4A 3HG2A 2Z24A 1TPB1 1F07A 5BXTA 1NVMA 3UXAA 1UWAA 1QNRA 4H8VA 2C6QA 4PBFA 3OIHA 2QVNA 3GG0A 4RDZA 3R10A 3C86A 2A85A 8XIMA 5HWNA 2OYKA 3LQLA 4KKXA 3IVSA 2PDUA 4D71A 3QYSA 1U5HA 4TQTA 1S5WA 3NGJA 1OYBA 1E3ZA 1FBAA 3BLDA 1F3WA 3S5NA 1WZMA 1AQHA 1OK6A 1SQ7A 1M7PA 1BTMA 2UY4A 4GVIA 1UD6A 4QSHA 5AC8A 5KZ6A 4HOXA 1S5VA 1VAHA 1UUOA 1FWSA 3E5BA 4IH3A 3HPFA 4OHQA 1HVXA 2DVTA 3GQYA 2EJ1A 4Z1CA 1GKRA 2RJHA 4QQUA 1VFMA 5CJMA 4Z0SA 1CGYA 4GISA 2X1SA 3TH6A 2PWUA 5HMFA 5FEZA 2QV5A 3RFAA 3K46A 3PZIA 1TJ2A 4FF7A 1J6PA 4X0VA 1L6WA 3Q37A 3A12A 3VTRA 2BGSA 4PL2A 3WENA 3CQIA 3HG3A 3K1GA 1ZBCA 1GKPA 2BGQA 1E6QM 2PA6A 3ANVA 4FOKA 3RXZA 1K4GA 4R5EA 4W8AA 2OSWA 3HQPA 4CNUA 3G1XA 3HG5A 3AHVA 3VNYA 3KW3A 1I8JA 5D05A 4ILSA 4DWSD 1P1MA 4CNPA 3LDVA 2YFNA 4KESA 4JEJA 8XIAA 4ZMGA 1IV8A 3WFAA 4N42A 4Q8OA 3SQMA 1XYFA 1VFSA 2OZ3A 4JTJA 1CXIA 3MC5A 3HPZA 4M19A 1XG4A 1V6UA 1SMDA 1M68A 3R13A 3A24A 4N7QA 4NIRA 3SUVA 5M3WA 4AHPA 2H3BA 2PWGA 1VPXA 2XH7A 3HG4A 1IZCA 4UTHA 3MHUA 3W7IA 4L64A 3R6IA 2VFEA 1JJKA 3PZVA 3EZ4A 2Y8UA 4YL2A 1VCVA 3QV8A 3EXRA 3P7YA 5JQ9A 2QDDA 1R2TA 2NW0A 3DAQA 1UZDA 3V0SA 1YADA 3ZWSA 1BHGA 3P14A 1AVAA 2WWDA 5EKYA 3UA4A 3IJ7A 1KBBA 2PRHA 3NDZA 3T40A 4W7VA 1I9CB 2Y5EA 4WVXA 2GSHA 3I4KA 3LHUA 1O66A 2V8ZA 2QGHA 1XDJA 4GZJA 2E8ZA 2F61A 4IMAA 2A0NA 1BVNP 2E6AA 1R86A 1N7KA 1NELA 1U2YA 2X2GA 3CZKA 3JS3A 1S3HA 3G6MA 1W3LA 4FOUA 2ADAA 1RP9A 1P7TA 3B8UA 5H6HA 4RPPA 1YPIA 3NO3A 3B0XA 1AODA 3UXDA 4HPXA 4US5A 4LUTA 3BURA 2J47A 3FHAA 1TWIA 1HJVA 3CT2A 4MTVA 1FQ0A 2GDVA 1XLKA 2R6OA 5HPOA 2W27A 2WVSA 2ZRWA 3WNPA 1OABA 4QEEA 4H2HA 4ZOCA 4MJZA 2VD9A 2BZNA 3FDGA 4HNNA 3P84A 1PAMA 3E9AA 4LEQA 3COTA 2Y62A 3SECA 3T44A 2A7RA 1AUSL 4CD5A 1HG3A 2WNZA 3AXMA 1M6JA 1DE5A 1V77A 2BWGA 3P3BA 3NQAA 3H22A 1EZ2A 3B8WA 4WDTA 3EPNA 3EA2A 1OG6A 1DEDA 3KOZA 1EJXC 2DIJA 3QOMA 1ZQ5A 2W6RA 5F4SA 4EKJA 1T5AA 1TJ1A 2FJUB 1WAWA 3GXDA 1DE6A 1SU5A 3GC2A 3RJYA 1H5YA 5CC3A 1JZ2A 3IUDA 1PB0A 1SGJA 4IXHA 3RR1A 3GR8A 4UMBA 4KRTA 1R7OA 2I9UA 3LZ3A 1H7PA 1IZJA 2DZXA 2WXDM 2DEPA 2HK1A 2BY2A 4BQ3A 4RE3A 3BANA 5JIPA 3FA4A 1EGVA 1ICQA 1D3GA 4HCHA 2D1ZA 1XV8A 3KXQA 1XLHA 4AD1A 3ARZA 3LPPA 4QLKA 4M6PA 3VIHA 5DFAA 3CMJA 3LX9A 4OGZA 1J0KA 1VKFA 1UA7A 4FIRA 1GORA 3GG7A 4AVOA 4AISA 1QHZA 1N82A 3PWGA 1JZ5A 2GGHA 1K1DA 2RDUA 3B06A 1PCKA 4ROPA 2Q09A 3M0VA 2XSXA 4HJFA 3AXIA 1QPKA 4DJEC 3WH9A 1E40A 1JZ4A 4LOCA 3KS6A 3DFHA 4EF8A 4KGJA 2ISFA 3PBVA 1FWCC 3FSUA 4H01A 4J1OA 3UU0A 5ENLA 2ZX9A 1XUUA 3MWCA 1ZLPA 3NQVA 1RD6A 1G1YA 2OZTA 1GK8A 3TROA 3TLLA 4DI8A 2Z1SA 5LXEA 2HEJA 1US2A 1TA3A 4LVBA 4CU8A 1V3LA 4LB4A 3GHTA 1EDQA 3WLNA 3ZOAA 5IFTA 2DH3A 2PP1A 1JZ3A 3FYYA 1KXVA 3WDQA 1H50A 3EXTA 4JEQA 3L68A 3L4ZA 4PUWA 3UWWA 3M07A 3CJPA 4ZSUA 5A3HA 1R9ZA 4NX5A 4LVFA 3T0BA 1OD8A 3DXIA 3W53A 4GE8A 1JDDA 3ONCA 2DZUA 1R3QA 2FDMA 5EA9A 3WJYA 3C0JA 3KL0A 4ZO8A 4K1GA 2J78A 4O1BA 2BVWA 4O4VA 4R27A 4L1XA 4HPGA 2EO7A 4HN4A 3O6AA 3VI2A 4MUZA 1Q6DA 3SO7A 1HJXA 1ZHAA 3B8IA 4IFKB 1KWKA 2WPGA 5MKGB 3TYEA 1O4UA 1HJQA 1YTKA 4S39A 4XZWA 4Y2WA 1MQQA 3S9IA 3IIVA 3SRHA 3W70A 3CWOX 5BWFA 4QISA 3F1QA 1T8QA 4GO8A 4PTXA 3O16A 3XINA 3N3TA 4M6UA 1WV2A 3BSGA 1PBGA 1ME7A 1Q6GA 4LUIA 2OFJA 3S2MA 4B4HA 4JKLA 2CC0A 1C7SA 3UCQA 2ZRUA 1K02A 1V6VA 3FGCB 3W3OA 4PTDA 2YX0A 3LPGA 1JCLA 5IXEA 3T0CA 3AMDA 2NLYA 2C3ZA 4QJ1A 1NWSA 4BQ2A 4E3TA 1Q6FA 3G8RA 4RUBA 1MQPA 5HUPA 2J66A 4UMCA 2ZVRA 2VFGA 2ZA2A 2WSKA 1R3RA 4BQ5A 4AY1A 2OZ8A 1W0MA 2G4JA 1AL7A 7TIMA 4OZOA 1VZWA 3WCZA 4H00A 5EMLA 3C61A 4QSFA 4NZ3A 5DCDA 1GT8A 3S6DA 4PZVA 1XICA 2SFPA 3HV8A 4U4MA 5CSSA 2YL9A 3F2DA 4GZEA 5DN1A 4AG0A 2ZWYA 3RM9A 4FA3A 4JYEA 4BEUA 1A3HA 4KWWA 2CLHA 2E7FA 3PBWA 4QG9A 1HX0A 2XGBA 3VK5A 3T0TA 4IIBA 3W29A 3JVAA 3DHFA 7ODCA 3SBFA 5E70A 4NJIA 3N2TA 4YVXA 1KXTA 4L4OA 3H26A 3I6TA 1Z42A 1FP9A 2X0HA 2A2IA 2PBGA 1TPEA 5JVLA 1T41A 3RDKA 2GOKA 3USBA 3KFTA 4AFYA 4R7WA 2QNEA 3DC8A 3WY1A 2WHJA 1YBQA 3CIXA 2F38A 3W81A 3CUXA 4H9ZA 1EWDA 3IJIA 4QNEA 3U9IA 1S1PA 1FCQA 3E02A 3WDPP 2E77A 2AL2B 2D69A 4PTWA 3OO2A 1E55A 5DCEA 4Q8VA 3LHVA 2XFYA 3F03K 3KL5A 5HNRA 3P74A 3R0KA 1XRFA 3EX6A 2REQB 4O13A 3DFNA 4N9EA 3BE7A 4PB3A 2GQ9A 1XBYA 1DIDA 3VC5A 4OJYA 1QNPA 5BRQA 3ABXA 2CW6A 1A3WA 3L23A 4RJEA 4DBDA 4Q4KA 5TAOA 4O8RA 3CV1A 2W79A 5F1UA 4AZHA 4GXPA 1ZJAA 5E5CA 5A6TC 4ZO9A 1UP2A 1HO4A 3P6LA 2VZVA 4E2DA 2VNCA 3GDRA 4NUWA 3NM1A 5DXYA 3B8DA 3IJ9A 4RZBA 2O92A 4F0MA 2VCCA 4Q22A 1YHTA 4RDYA 1EFZA 2ZE3A 3U0HA 4ML9A 4DPPA 3R79A 3TCSA 2PTDA 3FAXA 1V93A 3MY9A 3IJDA 3VAVA 4LEFA 3ZJ6A 1M9HA 1MQRA 5M1TA 2PP3A 3VZYA 1KTBA 4YVVA 1J4EA 3KVJA 2UY2A 4GNJA 1TELA 3F5JA 1LM1A 4TX9A 1R9YA 2RKXA 2QXWA 4PTMA 1MYRA 1S1RA 3TU9A 2PU1A 3AFBA 3KBVA 2GQAA 3IIPA 5CGTA 2Z1WA 4AC1X 1EA9C 5HPCA 1XISA 1Z8AA 5I02A 1PHQA 5K9DA 4XAYA 3DCPA 3WJXA 4R9XA 5D32A 2W3ZA 3WQFA 4TV5A 1G67A 2WNWA 3S1XA 2P10A 1KM1A 4OU1A 1B3OA 2CKRA 1OK4A 4YYCA 1GJUA 4JIEA 3EDFA 4FB7A 3SSZA 5A8NA 3AXXA 4KT2A 2ZRVA 2TODA 1NTHA 4DQWA 1EQCA 2NV1A 4LV4A 4MF4A 4H8HA 2V5KA 2GYIA 3MMTA 2Z1XA 1LL7A 4AY8A 2E5BA 5HBFA 4LAUA 1TJRA 1VCGA 4ZEPA 1GW1A 2AKZA 4ZCWA 1XM3A 2YIHA 5LHFA 4LYKA 1VC4A 2VEMA 4NAEA 4GXWA 1JF6A 1OFPA 3BC9A 1EUAA 8TIMA 1P48A 4L9YA 1YDOA 1F6YA 1TTPA 1JDFA 1OIMA 4HCDA 2F2HA 4H7ZA 4TVUA 1F05A 2WAGA 3W6LA 2OO6A 4JIIX 4UQ9A 5U7SA 5FIPA 3VD9A 1IXNA 3KUMA 4AMAA 4EXQA 3C5QA 4MM1A 5A6BA 1EZWA 3VNLA 1ZJIA 3G18A 1KO0A 1RV8A 1FWTA 1H5VA 1OWQA 4MYAA 5K4ZA 4PMDA 4GY1A 3AMCA 4JTIA 1MNSA 1W5MA 3RCMA 2QF8A 3KWXA 1B3VA 3LGDA 3SI9A 1DYSA 2VD8A 1VPQA 4O0ZA 1MUCA 1VFTA 2XIMA 4PCPA 3AIRA 3NA8A 3NQGA 1U1HA 4YXGA 4F2BA 2FLIA 2CLFA 5AVHA 3FK4A 1MRAA 1E0TA 2JGQA 4QE1A 2PD9A 4XWUA 4CCCA 4ONVA 5AYZA 3B0YA 1W5OA 3A5VA 5LYRA 1LBMA 4X2RA 3W7JA 3QV6A 3UR7A 3UJEA 4Y9OA 1XLBA 3FGCA 2GGIA 4HYRA 2P0OA 3DERA 1Q5MA 1CLVA 1A5KC 2VVNA 1EJ7L 1YPXA 2PGWA 4C6LA 4DWDA 1XC4A 5I06A 3CH9A 3TN4A 2YDAA 1VIWA 1D7KA 1EXBA 4C6OA 4LNYA 1DJQA 4B3LA 4LBSA 3SY8A 1B9ZA 3C2YA 4U2ZA 3S46A 5KITA 3AYSA 2EGZA 2X8RA 1DJWA 3E2SA 3ELFA 1W9XA 3SZ8A 4IISA 2BHZA 2VC9A 1AW1A 3MSRA 2QDGA 1YNYA 3L2IA 4UTIA 4N9DA 5E93A 1GPWA 1HNYA 1AQFA 2WZTA 4CCEA 2CCRA 2B7OA 3C6CA 3NIYA 3BJFA 4GZIA 4L9XA 1IXPA 4JX4A 4ZL1A 4L65A 1QI0A 3P67A 4EPKA 4E4PA 3P8JA 3V0TA 4O0QA 1NU5A 3I7QA 3B8SA 4L4LA 1OGGA 1UC5A 1VEMA 5LNSA 3VIJA 3NJ3A 5CCZA 1DWGM 4TIMA 1JFXA 2Y61A 4AIUA 4Y7EA 3UR5A 4QEHA 4HU8A 4DJFD 3DEQA 2VVSA 4W9TA 2GPTA 4DJDA 5CBJA 1LROA 1ML1A 3BMXA 1R3TA 3ITOA 4A4AA 3UQNA 4UQBA 1BFNA 4CKQA 3WF2A 4ADTA 3L21A 2Z2AA 3MO4A 1DTUA 2PLCA 4H04A 5LHEA 2OXNA 2JGYA 3NOYA 3UWVA 4KWUA 2OOGA 4GVHA 2OZ0A 4O18A 1B3WA 1I1WA 4J4KA 3TK7A 3QMSA 4NKCA 7CGTA 3GNDA 4RXGA 2C0AA 2B7NA 2A3BA 1E4LA 4PEKA 1U30A 4JHMA 2OGYA 2WCSA 3PBGA 2NQJA 1UD8A 1SJBA 1KR1A 2VEKA 1VBRA 4QM1A 4IPPA 4JTKA 4F79A 5TQLA 4HMDA 3NQ6A 1UD2A 4PH6A 1P0DA 1FHUA 5EYWA 1J0JA 5BXRA 3MU7A 1C93A 3IIXA 1SO4A 4TVDA 3SB0A 3WYZA 5KZDA 2A3LA 2PF0A 4H3DA 1HL8A 3WQEA 1TZZA 1M65A 4P7RA 2Z29A 3VNJA 1ODZA 4ERGA 2H9AA 5D09A 3PJUA 4YJ5A 4GBDA 5I23A 2BFGA 4QJ4B 2VI0A 1DXIA 3WUFA 3CV2A 3WQWA 3GZAA 4I3GA 2YXGA 2ANUA 2PSNA 4EPBC 1FDYA 1HFBA 1MXDA 3O0FA 5BWAA 3WLTA 1HF6A 1TPC1 3CHFA 2WBGA 3AHXA 5CG7A 1VJIA 3GH5A 1E9IA 2A6NA 1AQMA 1WOBA 1CENA 2J79A 3IARA 3VABA 1OBAA 3WBEA 3PUDA 1GPFA 4YPJA 4LCSA 4JPGA 3GUGA 2HCVA 2BGNE 4A35A 4E4UA 4INFA 4HHHA 4HGXA 1TVPA 2WZMA 2W4XA 5A2BA 4Q4QA 1DORA 3VOCA 1O94A 3QW4B 2E09A 4MWAE 3W1UA 1F73A 4CD4A 2GVLA 3VFLA 3TN5A 4BF9A 1BF2A 1O5RA 2QCDA 5C2GA 2A3CA 1UJPA 3LB0A 4PA8A 1NFPA 4DYEA 2ZXQA 3AS1A 3AIVA 1TREA 1V3KA 3LCIA 5FF4A 2D0GA 1TCMA 1FXPA 2WMFA 3TSBA 3W87A 3R5EA 3NUKA 4GCXA 3VFCA 3B97A 3VGBA 1E4IA 5CC6A 2QHAA 2NXGA 2XG9A 1TRDA 1DJIA 1P1XA 2OU4A 3PUGA 1HGYA 3QZ6A 4Q7BA 2XIBA 4BI6A 1XQKA 2FVKA 1ZCOA 3DENA 4JKKA 2PDCA 2VGIA 1EWEA 4YTTA 4FR6A 4O28A 2XH2A 1RQEA 5DX7A 2C16A 3LPFA 2H8ZA 3GNOA 4O54A 5C54A 3V5CA 1O7AA 3D46A 4PFHA 4H9TA 3QMTA 1UR9A 5L9FA 2EAWA 4ZTYA 4DRSA 3LTSA 4K1WA 4RW3A 1MO0A 3TC7A 1W1VA 4CQ8A 4I9TA 4JQAA 3O2LA 4LFYA 4UQCA 3KHJA 3O15A 2WSYA 4L80A 3A3HA 1A5NC 2P3ZA 2QULA 1H3GA 1KFEA 4MG4A 1XIFA 4XV0A 3CAVA 2R82A 4ADSA 1UC4A 3HJEA 2CLOA 1WPCA 4DLFA 5I79A 4A3RA 4GMEA 5LIYX 1VRDA 2AQVA 3FY1A 1AW5A 4IICA 5AZ0A 1D3HA 3EOLA 5CZKA 4MKSA 4F2UA 1G4EA 1H0IA 1AL8A 3K30A 4FLOA 3N4EA 1F6PA 4JGDA 1EJRC 3LBMA 2ALRA 3AHZA 4AHQA 4OUIA 2ZZ4A 2WVVB 4RNFA 3JU2A 1QBBA 2D3LA 2WLZA 1BGAA 2FZNA 3LZ5A 4MNMA 4XD5A 4QGCA 1JPDX 4FNQA 4IFRA 4NZJA 4EXAA 3OOQA 2Q3RA 3S5YA 1DIEA 3VGGA 3KDNA 1US3A 5A2CA 1DIOA 4GI6A 4MPKA 1NH6A 2ZXBA 1B30A 3DI1A 3PTKA 4P7QA 4G1KA 4DJEA 5FSEC 1IWBA 1WXJA 1EP2A 2X0SA 3LXAA 4RV3A 2VEIA 3ZS4A 2H9AB 5HMEA 2IQTA 2E67A 3OZPA 1P0BA 4CNOA 3WF1A 1JCXA 4AAJA 1A0EA 1M03A 1YDYA 4TTGA 4Y9PA 3AIUA 2NV9A 1VD6A 3T78A 4Q8QA 3N9KA 2J7FA 3VVGA 3UNTA 4U3AA 5EMUA 3ZT6A 3TN6A 3HQNA 4HZMA 3WEMA 1JPKA 4L6DA 1EO7A 4HYVA 4OQVA 3LOTA 3H2EA 2F8QA 3WBXA 2QT3A 2REQA 3GHSA 2XU2A 4ZO6A 4NF7A 4H9VA 5IHRA 2WZHA 4L1WA 1ZS2A 3GTXA 4ERAA 1KFKA 5CSRA 4HK6A 2Z4GA 2TPSA 2C14A 1IHIA 2PDFA 1HVQA 4GY7A 4LUYA 4C6BA 2H90A 2ZXAA 5G5IA 1S5NA 2PZNA 1JL8A 4JL2A 3MKKA 3N2OA 4GUHA 3MWAA 3M43A 2VP8A 1KKRA 3WQ5A 3IVUA 1PE1A 5BU9A 4N6EA 4U10A 2YL5A 1Q13A 3QY7A 2A7NA 1AMKA 3SUUA 3TNBA 1EC9A 3W0KA 2VC5A 2WKJA 1QMLA 3TFCA 3PJTA 3BJSA 1UR2A 3W82A 4YTRA 3GO2A 4ZOAA 2G0WA 3A5FA 4XTDA 2CLKA 4F4RA 4KERA 4MFDA 1HKVA 1XL9A 4I9AA 3NQBA 1UZ1A 3QN3A 3DUGA 1POKA 1BRLB 4S23A 2X40A 3IEBA 2Q02A 5SWUA 3OP2A 4G56A 3G2GA 4RW5A 1ICPA 2Z1BA 3GXIA 2NQLA 1BAGA 4S3EA 2Y7EA 3GY1A 2KZHA 4JNYA 4KRUA 4NZ4A 1QXLA 1QOPA 4MNLA 3TC6A 1RSCA 1XGZA 4KRZA 2IW0A 3GVQA 1QVBA 3OZYA 4Z17A 3SGUA 3FAWA 4HMNA 4IFKA 1UWSA 3R94A 4HK5A 3L4WA 5JMUA 4PRTA 4K36A 1NOWA 1V51A 2F84A 4EXBA 3WMSA 1MSSA 4NJJA 4ZE4A 4C6FA 1MEIA 3PANA 1OFOA 8RUCA 3UZJA 1QASA 4B5UA 3T81A 1S2CA 2HV5A 3UPBA 1IEWA 3KVKA 5D2XA 3S2CA 3OTRA 4N9BA 4U33A 3WD0A 2XZ7A 4ATDA 4J40A 2O4QA 3H21A 1CGTA 4LU0A 2I14A 1TV3A 5FL1A 3F5KA 4WCJA 1OX4B 3E5PA 1R46A 3MO7A 2YR1A 3IV3A 3KAOA 1DHPA 1WKDA 3M0HA 2FZDA 4Z2GA 1O1ZA 4FXRA 4OOUA 1J01A 3BZJA 4PUNA 4PCTA 4QP0A 3OPSA 4I7WA 3ZYZA 4IF2A 3GRIA 5A6BD 1HJSA 3VNMA 4HOZA 5BU6A 4LYRA 5ABGA 3IGSA 3CL7A 2XJ7A 3LHWA 1H41A 3MZ2A 1EC8A 3HJZA 3NSMA 1WB0A 3QJAA 4LX4A 4Y9AA 1FH8A 3KZSA 5AKQA 3W6MA 4WX2A 1GKQA 3AWOA 3PBMA 4WKFA 2CBUA 3PR2A 4HBKA 1TMHA 3ALGA 5CLTA 4LAOA 5A69A 4WDWA 3MSGA 1TUXA 3KP1A 3DFYA 2CESA 1EYEA 2QJHA 3BAYA 3IJQA 3HPAA 1WDPA 3TZFA 1GQNA 1QPNA 2DIEA 1Q85A 2DGAA 4HKPA 4A8RA 1BD0A 2QCCA 1H11A 3AUJA 4GJIA 4OBSA 2EG8A 1GEHA 4N9CA 3Q94A 3V75A 2FB3A 4O8AA 4GJJA 1LOQA 1TO3A 3BL3A 3QPYA 1GQLA 4B3KA 4G6CA 3N2XA 3MCNA 2HS8A 4QAWA 3USZA 5PTDA 2PDWA 3CHEA 5JH1A 4ZQCA 4QLLA 3SQSA 4A8LA 3O3RA 1B1YA 3AJ7A 3WIJA 4UR7A 3K4DA 3ZFHA 5HOSA 3A21A 5LNVA 4J3VA 1Y8BA 1FWWA 2PDBA 1UA3A 4S1FA 4TUFA 3U8GA 3GR4A 1Q7ZA 1KRCC 4OECA 3VE7A 4OBRA 1YEYA 3WFLA 1CBGA 4PCFA 3HA1A 1KB3A 1RPXA 2XIQA 4FPSA 1TSIA 3ZZ1A 4MZYA 4TVCA 5DT7A 3LGEA 4IX2A 1PJ9A 3AS3A 1PIIA 4KCUA 1SZFA 1QT1A 1X38A 2FJKA 3VNKA 2OT1A 4JIQA 4AWSA 4UTWA 3GYCA 5HAOA 2VC6A 1O5KA 3VYLA 2DSUA 4KEMA 1KRMA 2W91A 4BY3A 1TWDA 3CUFA 2PBOA 3BW4A 3QLDA 3WK2A 5DBUA 4F66A 3T8QA 5GJMA 4IMCA 2WVVA 4JTUA 3U5YA 1W5NA 4C90A 4E8GA 5CPOA 4A8IA 4FLRA 3NDYA 2YGYA 2DZVA 6ALDA 3RLVA 1W3KA 3RM4A 4UOQA 4TV6A 5AC6A 1W3NA 3TOYA 3H24A 1VCFA 2VRQA 3EWUA 4MJ2A 4WDUA 1GVIA 3H2CA 3LNMA 1G5AA 2C71A 1OFRA 4GI9A 3R89A 3F2CA 3IGXA 4K68A 3O0KA 2ICSA 1XYAA 5LXXA 4HHLA 5E9AA 4PB5A 1NDZA 3DHUA 4H1ZA 1IF2A 1VBGA 2DVXA 4JQ3A 1K3UA 2OKOA 2XHYA 3VMOA 2EPHA 3VKKA 2JF6A 5CPTA 3W7PA 3WDHA 2FZMA 1QPQA 1TX2A 5G4HC 1NDVA 4B16A 2ZRXA 3U48A 4WRHA 5A6SA 2QLYA 2FIQA 5HQLA 1PYFA 4J2PA 4D8ZA 1NY1A 4XVDA 2Y8KA 5D2YA 2E9BA 1UG6A 1S39A 2HJPA 3BAIA 3R8RA 5RUBA 1O95A 4JTLA 5AFDA 4JTGA 3MUY1 2V9DA 2C18A 3CBWA 1YMYA 2PD5A 3H53A 3S6OA 7A3HA 5AN7A 4ML4A 4HSNA 2J7BA 1PVNA 4QE4A 4MB4A 2J8FA 3FX4A 2CLPA 4P2VA 1FRBA 1CGXA 4R34A 4O12A 1P0NA 3U7VA 2JEPA 1AD1A 2D73A 4MOZA 2W67A 4EX4A 4HMEA 4NU7A 2RAGA 1LUCB 2PFHA 2A6LA 3M5ZA 4NJGA 1J11A 2P1FA 4GFSA 2Q6ZA 4G7FA 1H7XA 4PUKA 2GVEA 3R11A 1QTWA 4GUIA 7TAAA 4D9PA 3A4XA 3N34A 5CPMA 3FV9A 3WJSA 1X98A 1G4PA 1MWOA 1RK6A 4UCFA 1OFEA 1B5TA 5HJYA 4AXNA 3PWIA 2QAFA 2WBKA 2NSOA 1DJZA 2ZADA 3G1SA 3EOSA 1UPPA 2QUUA 4PULA 2FGLA 4XUYA 1R0MA 2PODA 3PFMA 1Z32X 4N4PA 1NQ6A 4AD2A 1DP0A 3KLKA 3M7SA 3P0WA 1F6KA 1I0BA 4GGBA 4IMGA 4IQLA 2VGFA 1AH4A 5H91A 2OTDA 4UIOA 2NX1A 1EJVC 4I8YA 2VENA 4DUXA 2IXVA 4BA0A 3HV9A 5E1QA 4PSRA 4B2DD 4GUJA 1PL9A 4L6HA 7ENLA 1F5ZA 1JZ6A 2CXEA 5K2ZA 2D23A 3ITYA 3OG3A 7PTDA 3URNA 1B90A 1ZJHA 5AHEA 4UQDA 4NZCA 1EPVA 3AJXA 3ZR5A 1RVGA 2PCQA 5LNUA 3PZ9A 3CQJA 1Z41A 2B7QA 3LK6A 2HMCA 3NM3A 1JULA 2IKJA 5AC5A 4EVZA 1ZL1A 3WH8A 4MNKA 5EY5A 4ZSTA 3H6OA 3SN4A 2BXVA 3L5AA 3VU2A 3GS6A 4KWOA 2WHKA 1C90A 5AYBA 5HULA 3VGEA 3WLKX 2IQDA 3WO8A 4GYJA 2B81A 4WGXA 4LRSA 3G3DA 2IXUA 4YWIA 4GCAA 4H7VA 1RQHA 2QCEA 3GNXA 1MW3A 2G41A 4R33A 1W9PA 1VFFA 1FCVA 4O16A 1QWGA 3E6EA 4QDMA 1P7TB 4WJEA 2EPMX 2DQXA 2FDSA 1XYCA 2G3JA 1JF5A 4GQ0A 1T0OA 2O7SA 1XD0A 1DHKA 4F0HA 1TYGA 3VIOA 1ODUA 2A1YA 2ZUNA 3BV7A 3ITCA 1JYWA 1FWNA 1KTCA 1XIMA 1NP0A 4H6QA 3TC3A 2FHFA 2YDSA 3F4VA 5ABFA 5BCAA 5KINA 2FGZA 3BICA 2YOCA 2BTMA 4MB1A 3FA3A 3FYOA 1L9WA 4HIBA 1PWLA 1LL6A 2X05A 3G0XA 1DIKA 4A21A 3V7PA 2WJEA 2V6AA 2WMGA 1WUEA 4XAFA 2E3ZA 3LHTA 3W2NA 3ONBA 4CVWA 2ZOXA 4MZ8A 4LSBA 1M01A 2VDGA 4YCOA 2HSAA 4LB3A 3AZSA 1F4AA 1VJSA 2VCAA 4EK7A 1LLZA 3M41A 2PU0A 1FH9A 1EIXA 1L8PA 4QRNA 5CH9A 4B9ZA 1GHRA 4DUWA 1OCQA 4W89A 3D3AA 5A6LA 4DUVA 4E2OA 2BDQA 3N6QA 3STEA 1R3SA 4NSBA 3LM3A 1YTDA 1WYIA 2ZX5A 3AALA 4KWVA 1W32A 4KWSA 3WDJA 3LV6A 3AMGA 1GJWA 3I4EA 3STGA 3WBYA 4AD5A 1SVDA 3VD7A 5BXPA 3HBLA 2I17A 4LCQA 1K6AA 4PRRA 2XIIA 4IGNA 4M82A 3GNPA 2OSYA 1JRCA 5XINA 3UT0A 3IGUA 1XSJA 3MMUA 1Z89A 5G4WA 3UG3A 3FDKA 1AQ0A 1W3HA 1EC7A 4MB5A 3WJZA 1RBAA 2OWXA 3MCMA 4IZGA 2G3MA 3B9OA 3NQDA 1JD7A 4EPEC 1Q6LA 4BF7A 3AICA 4AD0A 1R38A 1X6NA 1OFDA 1OG0A 5ABTA 2GLKA 4LVGA 2W0UA 4IT1A 4B5NA 3RHGA 1J96A 1MFVA 1XLIA 3NSXA 1V79A 1ITXA 4JQ4A 1QW9A 2ESCA 3GK0A 3TXZA 1Z9AA 4N2YA 2HXUA 3WQDA 3GVRA 1B3XA 3OVGA 3W7GA 1V3IA 3P8IA 4V33A 1NJJA 2MUCA 4D1JA 1JPHA 1N8WA 3SGZA 5TIMA 3RR4A 2HK0A 3BAWA 3KOWA 3WD2A 3ITVA 2GGJA 1AD4A 2IPFA 2WW5A 1HXJA 3CL6A 4JDYA 5HWJA 3EDEA 1XSKA 1XIDA 2ABAA 1EXPA 2ZA3A 4IGMA 1R87A 4ZB5A 4CNTA 4GBUA 3WBAA 3OLIA 3YPIA 1CT5A 4HNTA 2IKGA 3TW7A 5GNYA 5T91A 5TF0A 3MDWA 4XZIA 3TR9A 4LW7A 3S0CA 5LA1A 4LS2A 3SCWA 1IXOA 2PWDA 3IPWA 4DO7A 3GG8A 1XBVA 2PTZA 3TTOA 1XIBA 3GW3A 1YPFA 1REQB 4PUUA 2V5LA 3KL3A 1E72M 5A8MA 1B9BA 3ZSSA 5GJNA 3WG6A 4D6FA 1J8VA 1E0XA 2PDIA 4G7EA 2IPWA 2BB0A 3L65A 4LJ3A 4L56A 4QDPA 3QY8A 2JF7A 2VXNA 3S3GA 4Z2HA 1TTIA 2ZA1A 4UTLA 2O55A 4E3VA 4BWLC 5D9PA 2QGYA 4AMCA 4RZ4A 1ECEA 2ISWA 2WB5A 1FWDC 4AZ5A 1SFTA 2QPSA 3BLEA 3GXNA 4DO6A 1JPIA 3CTTA 4XZHA 4DM1A 1F61A 4I9JA 1YX1A 2V3FA 3VZXA 5HXMA 3WLRA 3T08A 5A8OA 3T1GA 2D0FA 3A47A 1ALDA 3SIZA 3HFTA 1W6TA 4AD4A 2OYLA 1W8GA 3N19B 1E51A 3W25A 4ROQA 4XBKA 3FSTA 3P93A 4JR5A 3CUGA 4D8LA 4ASTA 3V18A 4DWSB 3IGHX 4GKLA 1H7RA 1Q2RA 2A3HA 1F8MA 4ACZB 2V68A 4AYSA 2G4FA 3M6YA 3V36A 5XIAA 1KXHA 2W5FA 2XTKA 3O8AA 6A3HA 3MQTA 1FWEC 4K6AA 4W8LA 1TWWA 3VIGA 4U31A 3CLMA 3F4CA 1DL3A 3OYZA 4Q32A 1YYAA 1UHVA 4AEEA 3ZVHB 3BDKA 5JBEA 1PYMA 5D9NA 2O56A 4IJCA 5A6AA 3RX3A 1IIGA 4H7CA 3M44A 3OGSA 3W73A 1THFD 3STPA 3V35A 1GYMA 4FI4A 4DNHA 3T55A 1AH3A 2VDHA 3GD6A 4C6MA 4IPLA 2V2CA 4DXXA 4MY8A 4IMDA 1XYLA 3QGAC 4QBXA 1JEZA 1KQYA 4N6FA 2FH8A 1OADA 3HN3A 1X39A 3QQ0A 1ONXA 2HVMA 1I2OA 4B90A 4ACYA 3S47A 1W5PA 4KF1A 1KM6A 3GX9A 4GYPC 3P5YA 1QK0A 2QR6A 2A3EA 5D30A 2R94A 4XUGA 1BG9A 3ITXA 1ZBWA 4S3KA 4MWAD 2XM2A 3MHFA 3MT1A 4AZIA 2G3NA 1R5YA 3E0FA 3NQMA 3RRXA 3AYRA 4KIRA 5C7VA 5FACA 3L9CA 2VGBA 4Y8FA 3W74A 5C9WA 2FPYA 2NX9A 5TNVA 4UMAA 2YPIA 4QE5A 3CUJA 5H8MA 3RK8A 4LV9A 4PBGA 4YIWA 1J79A 1Z48A 3W1NA 1UKSA 3CPUA 4UTFA 1AW2A 5M5DA 3OU8A 2ZKMX 3ZVIA 3IUHA 2FQIA 1RA5A 5A8QA 1N2VA 5GPRA 3JW7A 3UZXA 1KFCA 6CGTA 1H0GA 2D2JA 3TIMA 4UXDA 2C1HA 1FHVA 4LXFA 3SDOA 2NQ5A 4PMNA 1MXGA 1Q4WA 4Y90A 1QAPA 1FA2A 1EEPA 4H19A 2DFAA 4HOWA 4IUOA 2NUXA 4DI9A 3UY8A 1FWIC 1LDCA 3GDTA 5C0QA 2ZVIA 1V5XA 2NVAA 3W72A 1TPUA 4URIA 1W2PA 1A4LA 4JTSA 3LYEA 4XD4A 3FVDA 4YLWA 2NQZA 4NNAA 2NLIA 3BG5A 1X8FA 1JXKA 4Z1BA 1E6ZA 4QHRA 2WJFA 3DHPA 2Z1KA 1OGBA 1RY0A 1GEQA 3EEZA 2EXOA 3MUXA 3BMVA 1KRBC 4JICA 1R9XA 3L4XA 1ZALA 3M9YA 3UFYA 5FAGA 4S3BA 4ICMA 3WLHA 5D02A 4PTNA 1KLZA 1LT7A 4GHRA 1LOLA 4Q7IA 3H2AA 1MDRA 2XVPA 3FVMA 4V1XA 3ARTA 2I9EA 4W88A 1BYDA 1X8CA 1P5BA 4C1NB 3WX7A 4BI7A 4XKYB 1UH2A 1BSIA 3VKBA 4IGHA 1WDDA 2HNEA 3MSYA 1OCBA 3TJIA 4DJDC 4Z2LA 1M7JA 3G1VA 3NFUA 1ZNNA 5DLCA 1BXNA 4KBXA 1EJSC 3JUGA 3KBWA 4GX8A 4XO7A 1RCQA 3L4YA 4FMVA 4LGXA 1JUKA 1PWMA 2PDYA 3TEVA 2R91A 4IP7A 1ZTVA 1BQGA 4KETA 2FTWA 5FF0A 3KX6A 4RLIA 3PS7A 5CC7A 4HN8A 5C7HA 1JNEA 1I0DA 1TCDA 3JZEA 2E8YA 1ITUA 3TQKA 1P0KA 3B4UA 2WMKA 3ANYA 1CGUA 1A5CA 3BLOA 1EOKA 5FJRA 1F9CA 1J93A 3PF3A 2Z1VA 2XUCA 4LRTA 2ZTKA 1VQTA 1VLIA 2HRWA 5JBDA 4UTMA 3W2KA 1DV7A 4JCMA 3R2GA 2YZ5A 5FF7A 3BLKA 2BV9A 2AOSA 3TP4A 4MAZA 2J24A 2QJGA 3SEPA 4S3FA 2PDJA 2G50A 3IIZA 2RGLA 1G4TA 3W27A 3QHOA 2D20A 3CHDA 3VE9A 4XKMA 2OWWA 1O60A 3IVTA 3UYCA 3FN9A 1OZQA 4ZOBA 1UOKA 3LMYA 1EF2A 1UUQA 3DGRA 4HD5A 1UROA 3GIYA 3TAKA 4JZ5A 2B4GA 4J3WA 1DTNA 2DZPA 4NG3A 1GQJA 3O6DA 1TIWA 5CSYA 1UMLA 2PDXA 3TR2A 3S5SA 4J2MA 5GVJA 5DY3A 4C1LA 3EXSA 3QSRA 3RAOA 1SSGA 3D0CA 1DJGA 3SFKA 4LC6A 2NUWA 3L0KA 1ZRQA 1JDAA 2Y7FA 3P0XA 2NVDA 1T99A 4HU4A 2G96A 3XIMA 2DUXA 4G9PA 3ABSA 3TXVA 1VHNA 3S2LA 4MSSA 4WY0A 3VMPA 2ACRA 1QI4A 5CAHA 2DJLA 3TTEA 2XYLA 3STFA 3G1YA 1IGSA 3PG9A 2MNRA 4QCEA 5I2UA 4ZXOA 4FO4A 2EPKX 5CZJA 2RHGA 2JKPA 2A5HA 4W7UA 1XLGA 3BAKA 1DJXA 2IPGA 3DBNA 4MIMA 4FR1A 1F3TA 3C2RA 3S42A 3UR2A 4MADA 2R1NA 3WQ6A 4ES4A 4B15A 3VKJA 3TYCA 2DUAA 5A1AA 3DFTA 2DW7A 5I3JA 4KCWA 4GY0A 2X09A 5I3DA 2FZBA 4O1DA 4ZFCA 2YBUA 5LGZA 5D9MA 2J88A 1WDWA 2PGFA 3S83A 3KBNA 4GC3A 4JQ2A 1CTNA 3SCVA 1JDCA 3FYPA 5KETA 4GRSA 1WZAA 1XIIA 4YTSA 1KV5A 3NXFA 3WLQA 4C7FA 3CZJA 1H63A 4LANA 3HURA 2A21A 2QVHA 4H6KA 1M1BA 3OBKA 3ZT5A 4AYGA 5I3FA 4BJHA 2WC3A 5H8PA 3UZ5A 1Z44A 1WXYA 3GB6A 2X0YA 1OC6A 4O1AA 3BK0A 4ALDA 3S6TA 3BSHA 2HWGA 3KBSA 3TJLA 3CYVA 5K9CA 5JH2A 1VBHA 3RJXA 4HPNA 2J25A 3AC0A 5I3IA 2TSYA 4DYJA 3N2BA 5EPDA 3N9RA 2R8WA 1HT6A 4C1KA 3W2UA 1W2VA 2ZZ6A 2ZUSA 1GZJA 3CASA 1O5QA 4CUCA 1DWHM 3M0XA 2V30A 4OOZA 3NO5A 4ECLA 3N6JA 3EBVA 3MTWA 3A9BA 2PTYA 4DVOA 3HTWA 5TD4A 1FCUA 4O4WA 1TPFA 3AS0A 4FNPA 4R7OA 1JNDA 1F7BA 1UW9A 1CGWA 4IIEA 4OBTA 4JBRA 3PC0A 1V6TA 4WIWA 2GGEA 1QW7A 1VP5A 4WXZA 1AJZA 2QCFA 3AS2A 1EB3A 2XVNA 4Q8WA 4C91A 1YDNA 1QHOA 2EKGA 1P6BA 3PAJA 3PZGA 4HA0A 1CXHA 3CO4A 3T8LA 3PPCA 1QRQA 3GC4A 5FJTA 1BKSA 3CXOA 3RCYA 4ZGYA 5A6JA 5E0CA 1MW2A 3NG3A 3E2QA 1RJPA 3QZAA 3PPGA 1VLWA 3DFOA 5BROA 4JTEA 4WHBA 3N6HA 2HE5A 3NPWA 1KTNA 4X9SA 5AHNA 4B5XA 5CEWA 4X3ZA 4MZ1A 1KGWA 4MHBA 4BEQA 3EWZA 1NWRA 5J5RA 1TZ9A 5DT5A 3F4NA 3MKCA 3OYXA 3TW9A 3W2MA 5BW6A 3PN8A 1HJWA 3BLLA 1EF3A 2Y6ZA 1XYMA 1J0HA 3W28A 1XRTA 3KLLA 2GJRA 3GLCA 3QFEA 3VOGA 5J5DA 3MBFA 4C60A 3QHNA 2VGGA 4F48A 3GVGA 1JR1A 3UPMA 2FFIA 4BCEA 1LG1A 3PTDA 2BOGX 2GJXB 1HUVA 1FWHC 5G2HA 1OF6A 1XPYA 3U4AA 3MW7A 2AL1A 4S3AA 1SYTA 3A6OA 4Y9MA 4BZYA 3T4WA 5BMXA 4ATLA 9XIAA 2W62A 3GU1A 3RPMA 1XLCA 4GVGA 4C6EA 9RUBA 4UFLA 2YXOA 2VEGA 1RHCA 1UD3A 2IPJA 3W1XA 5IBXA 3URQA 1DWAM 3W88A 1GZGA 3H55A 4UFHA 2QPUA 5EGRA 1J0IA 2NXHA 1BQCA 2A7PA 1HKMA 6XIMA 4LTSA 2QJIA 1POJA 4JNZA 1ICSA 2Z7GA 3CT7A 1PTAA 3PJWA 1JZ8A 3GFYA 1GQKA 4JAWA 4QG8A 2BXYA 1GW9A 5ECUA 2WOQA 1HQTA 3BWWA 5HNUA 3W7DA 3DX5A 5KTLA 1PZ2A 3KTSA 1KNWA 3SCUA 4K38A 1UYQA 3MUIA 3HGRA 1G9HA 3CC1A 2VEPA 3R12A 2QCNA 3S1GA 3R43A 1XGDA 1EHAA 2Y7DA 1O12A 4JN7A 4OUEA 4A8NA 1SJAA 2JFEX 4C6QA 1NDYA 3W26A 3RM8A 5HA7A 2DZWA 3T6CA 4NY2A 3CB3A 3EX1A 3C56A 3M0JA 5LNRA 2J7HA 2C91A 2FZ8A 1E6XM 3G22A 3NURA 2OLSA 2I5GA 1OFBA 2XIJA 1LBLA 2P8CA 3IK4A 1A5LC 4IL0A 4DLMA 5I03A 4EIVA 3SR7A 4JYDA 4AVFA 2ZIDA 3PM6A 4E5TA 4BWLA 5MKGA 3RRAA 4NQ1A 1Y65A 2H6RA 3EWXA 3EAUA 1KFLA 3DG7A 1YIXA 1C8YA 3PPHA 5I07A 1RA0A 3C4UA 2PEVA 2W66A 3TE9A 4M80A 2WMHA 1XBXA 3VKCA 4J3TA 3UWUA 3UWYA 3F7JA 3AZTA 3NQFA 5F2MA 4D6DA 3POCA 2V2HA 1KBIA 4UZSA 1QNVA 2B0MA 3E12A 1EJUC 1PX3A 4UTTC 3QTGA 3ES7A 3P82A 2Z2UA 1ISVA 2OEJA 4ZB2A 1ZAHA 1V7YA 3AHYA 2WSQA 1Z69A 3ZR6A 2BVTA 1E0VA 4EWJA 1XD1A 3G1DA 3BG9A 3CUHA 3QM3A 3RYSA 3BVJA 3G6LA 4MVAA 5KZMA 4J3ZA 3FW6A 1YW1A 1JDEA 4KPLA 3EKLA 3FXGA 2C0HA 4O19A 3DH7A 3K8KA 5T26A 3BLFA 4IG2B 2Z6IA 2WCAA 5A8GA 3OG2A 4FS9A 1W54A 3PZTA 3APTA 1UR3M 2L5HA 3FHQA 4ZQNA 4A22A 3OVPA 1ZUAX 3GXMA 3WDIA 3MYOA 5T9CE 4TX6A 3SRFA 3QPZA 3ANUA 3W23A 2XGZA 4DAFA 1TZ7A 3MI2A 5G1YA 5M17A 3DHDA 4EWND 3BCJA 4F8XA 9XIMA 2PURA 1UH3A 3BUVA 4E0CA 4C6KA 2Q01A 3UGVA 1S2AA 4A05A 2QV4A 3SUTA 1DQWA 2C15A 1WKYA 1UASA 1F76A 1MI3A 2INEA 2XSBA 1Q63A 4XZBA 4B5TA 2VUNA 3N29A 2ATMA 1NQKA 3R7MA 1ZCCA 2J6VA 3LLFA 3EDJA 3RF9A 1T8XA 3WJWA 3INPA 1S3TC 4GX9A 2XWDA 4LS0A 2OPJA 5IM51 4DHGA 4NJHA 3UJ2A 4IIHA 4KCVA 3ENLA 1MEHA 4Y96A 3KCJA 1SFLA 2GZXA 2Z7KA 3CUZA 1W31A 2ZDSA 3OA5A 2RH9A 1A5AA 4OKDA 3GDKA 1U22A 3AAMA 2POTA 4G2DA 2XH4A 3NEHA 3REQA 4P8VA 3QEZA 3WK1A 2BSLA 4FP1A 4LAMA 2PUZA 3LPOA 1LLOA 2AAMA 3I6EA 2XVLA 4TR9A 3W1QA 4MLRA 4ZB0A 4Q8UA 3AI0A 3SADA 4P8UA 4UC5A 1E70M 1GOIA 4OWGA 3VPLA 4O11A 1WNOA 1LORA 3LUTA 1M7XA 3GDBA 3VDGA 1XH1A 5D37A 3VOIA 1XWYA 4MB3A 5H1WA 3MANA 1E5NA 3LY0A 3RGTA 4LF1A 3LCHA 5I00A 2ZYFA 4F0RA 4MWAA 3SCQA 3FKRA 1KW1A 3REQB 3RIKA 5FJUA 3E3HA 3CQKA 3GVVA 5FEXA 3K8LA 1CXLA 1EP3A 1PTDA 1KCZA 4E6MA 2KAUC 2I5IA 1B4EA 5CPQA 4XSMA 3SIMA 2O9PA 2QAPA 1M53A 2DQWA 1DVJA 5DF0A 1FWFC 3LCGA 2PWFA 5FJIA 1OFQA 5HNNA 4UOZA 2OCZA 2VTFA 4HA1A 3UEQA 3VINA 2PDKA 1B3YA 1E56A 1PV8A 1QFEA 2GFTA 3NL5A 2OR2A 3E96A 2YXXA 4CQCA 3FCPA 4MMWA 1LRQA 2J62A 4ZA0A 1D9EA 1GTHA 4WY0B 3V16A 1RJQA 3AIBA 4FNRA 5G4EA 4JOMA 3QF0A 5D04C 5A2AA 1UWQA 1NF0A 3W1PA 2QKFA 2C13A 3CM4A 3AIQA 4H83A 5D2TA 4S3DA 1W1A1 3N15A 4PBEA 1JFHA 1XLAA 5EMKA 4B5WA 2X42A 4PMZA 1XINA 7XIMA 1S2WA 2O4MA 1UWTA 2XH0A 5HJXA 7REQA 4P7LA 4LF2A 4I5RA 1QI2A 4IJBA 4DXVA 1UPMB 2WZEA 3KRBA 1DPMA 3PZMA 4PCNA 1SR9A 2OQLA 2WANA 3TTYA 3ISIX 2QPXA 2FPVA 3W07A 2P53A 2CLEA 5D8ZA 3TAOA 1A5MC 1VEPA 3FA5A 3F5LA 1FHDA 1B0IA 3TSMA 1WDSA 2YKKA 1CNVA 5I77A 5E0KA 1TV4A 1VFUA 3HF3A 3G1FA 3G5EA 5I3GA 3PTQA 1GVFA 2C1GA 1QOQA 1FWJC 4JCLA 5CPSA 2YDRA 4K8HA 2X30A 3QR0A 3GTFA 4W85A 2HQAA 4AXKA 4UR9A 2WKGA 3LTYA 3WDRA 1OVDA 1KFJA 3SAZA 3TMQA 2EKCA 1MZRA 1C91A 4MGGA 2CLMA 1KQZA 3W1AA 3QZEA 2RJGA 2PF8A 4A6GA 4FHAA 3OQ8A 2P76A 2Z0IA 1E4MM 4ZOEA 3B0PA 3AQUA 3M0IA 4JFUA 2I7GA 1C8XA 4WEVX 3WQ4A 3UW6A 4NI8A 3W24A 5I6SA 2G8ZA 5ABEA 3NZ1A 3UJFA 3SCRA 3ZJKA 3MCOA 5FF3A 2WHLA 3BO9A 4GH1A 2O0TA 3SY1A 1JCJA 5DEZA 2RDTA 4EANA 3SW6A 4LUSB 3THQA 5BXSA 1YKWA 3D5HA 3QBUA 4HA3A 2VFHA 2VEFA 3OLGA 4MY9A 3IJ6A 1LRNA 1R47A 4PUEA 4IPNB 5AC4A 1EBGA 4Z2IA 4PMXA 4NXSA 1ZBKA 5E6YA 2NX3A 3QQ1A 1DKWA 1U5JA 1Z6KA 2HVNA 3FS2A 4H9MA 4D8AA 2PDMA 3LRMA 1A53A 1WZLA 1Q8AA 3EOEA 4JN6A 1HO1A 1NSJA 5CPNA 2BVYA 1JYNA 2QCDB 2ZTJA 4FIQA 3TDFA 4OT7A 4D6HA 4DWSC 2OLHA 2VRKA 4IPJA 1CXFA 2XFFA 4GXMA 5F2IA 2E5CA 4HNLA 4L61A 2OQYA 4C7GA 3W7KA 4GIAA 1VIZA 2VL4A 1HP4A 2CLIA 3OEXA 5EMYA 1KFBA 1LTDA 5F7UA 1F3XA 3A3WA 3K5XA 2WK2A 1LQAA 3J7HA 3L4VA 3MS8A 4R88A 1TPVA 4IM4A 3I3BA 1UKTA 4FZIA 2E9MA 2G95A 4ENLA 1V3HA 3NO1A 3TSDA 2QJMA 4Z1DA 2X1IA 3L7RA 4CQBA 4BHYA 4C1NA 2FTPA 2GJLA 2W61A 5A95A 5I09A 4PMVA 3T07A 4GWEA 3N18A 3WUBA 2V67A 1E1CB 4L7ZA 2FYMA 5AB3A 5FD0A 3U5UA 4GQQA 4RE0A 4R53A 1UR0A 1YXYA 1HJUA 4AEOA 1Q6EA 4AZ7A 2BNJA 2VELA 2E1DA 4YHEA 4C65A 4GUFA 1V0MA 3NXLA 1X7IA 3ZQ9A 1FX6A 1KM3A 5HQEA 1QNOA 4M56A 3UYIA 3PZQA 1R85A 1JZ7A 4GA8A 4WQ6A 5GJPA 1ME8A 5BRBA 4IGSA 3S2NA 4NVTA 1KGUA 3T2OA 3C8NA 1N8IA 4Q8MA 1XR2A 1OYCA 4Q7NA 1FDZA 3N25A 1KBLA 3W7CA 1CCWB 1OB0A 2CHRA 4M51A 1MZHA 4NP7A 3GXPA 4DM2A 3EX2A 3LNPA 3TFXA 2VM8A 5D03A 1UWRA 5DMNA 3UERA 1DXFA 1CX9A 4MJMA 1LZOA 5K3VA