The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
75
|
sequence length |
247
|
structure length |
234
|
Chain Sequence |
ALLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQRVTIPVHPIIRPRGGDFCYSDGEFAAILEDVRTVRELGFPGLVTGVLDVDGNVDMPRMEKIMAAAGPLAVTFHRAFDMCANPLYTLNNLAELGIARVLTSGQKSDALQGLSKIMELIAHRDAPIIMAGAGVRAENLHHFLDAGVLEVHSSAGAWQASPMRYRNYSRYIVDGAAVAEMKGIIERHQAK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of the Putative Copper Homeostasis Protein (CutC) from Shigella flexneri, Northeast Structural Genomics Target SfR33
rcsb |
| molecule tags |
Metal binding protein
|
| source organism |
Shigella flexneri
|
| molecule keywords |
Copper homeostasis protein cutC
|
| total genus |
75
|
| structure length |
234
|
| sequence length |
247
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2004-06-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03932 | CutC | CutC family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Copper homeostasis (CutC) domain |
