1TWDA

Crystal structure of the putative copper homeostasis protein (cutc) from shigella flexneri, northeast structural genomics target sfr33
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
247
structure length
234
Chain Sequence
ALLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQRVTIPVHPIIRPRGGDFCYSDGEFAAILEDVRTVRELGFPGLVTGVLDVDGNVDMPRMEKIMAAAGPLAVTFHRAFDMCANPLYTLNNLAELGIARVLTSGQKSDALQGLSKIMELIAHRDAPIIMAGAGVRAENLHHFLDAGVLEVHSSAGAWQASPMRYRNYSRYIVDGAAVAEMKGIIERHQAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper homeostasis protein cutC
publication title Crystal Structure of the Putative Copper Homeostasis Protein (CutC) from Shigella flexneri, Northeast Structural Genomics Target SfR33
rcsb
source organism Shigella flexneri
molecule tags Metal binding protein
total genus 75
structure length 234
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03932 CutC CutC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.380 Alpha Beta Alpha-Beta Barrel TIM Barrel Copper homeostasis (CutC) domain 1twdA00
1X7IA 1TWDA 1X8CA 3IWPA 4R9XA 2BDQA
chains in the Genus database with same CATH superfamily
4UOJA 4WD0A 4DO5A 1S39A 2CHNA 3GYCA 4FLQA 3QGVA 1R30A 1PKYA 2P8BA 2OQHA 1B2YA 2A5HA 3NIYA 4QX4A 2BG5A 4PCSA 3W81A 3L4WA 2DGAA 3DFPA 2C1HA 4OOZA 3CHCA 2YPIA 4RE0A 1JCLA 3GVRA 1PS9A 3BDKA 3CQIA 1W3NA 2GOUA 1TPVA 2PF8A 5BW6A 2CERA 4XUYA 4AWEA 1B3ZA 4ROQA 2WVTA 3HV8A 3C52A 2O0TA 2QDEA 5FF2A 2GSJA 3W6LA 2NV9A 4FX7A 2FFIA 2VJXA 4DJDD 2CW6A 1EJVC 1H09A 1W3HA 4WOZA 3A12A 1NWRA 2JEPA 1LLZA 2AOSA 1O95A 2X1SA 2FZMA 3LPOA 1E0XA 2WJZA 4JY8A 4Q8WA 2VFIA 5C54A 3HPZA 3VC5A 4CD5A 4WSJA 1MNSA 3W9ZA 4LTSA 1XGEA 1I1WA 1NOWA 1V5XA 3BCJA 1RBLA 2GDQA 1H63A 5FEPA 4YWSA 4JCMA 3DFOA 1K02A 5AYZA 1BLIA 3P6LA 1NIUA 2TSYA 1GJPA 1C7SA 1ITUA 1UZDA 2VL4A 1GUVA 1DIOA 1PIFA 3K4DA 2BGSA 2ASHA 4AD0A 2CIPA 3NYDA 2CZEA 1BKSA 3ZJ8A 3A9IA 4H1ZA 3NZRA 4A22A 2F6KA 1EZWA 5I07A 3UXKA 2D73A 2WOQA 5DQPA 6TAAA 4LT9A 1TA3A 3ARYA 2NQZA 4UB9A 3QH2A 3QY7A 4RXFA 2DT3A 4AVFA 1RVGA 1VEOA 4AC1X 2WVVA 4JN6A 1XJBA 4KGLA 4W89A 4XVDA 4REQA 1EOMA 3WBWA 2QULA 2VNCA 2R8WA 4UCGA 1BYCA 3ZT7A 2X40A 4ICMA 3DCPA 4KCTA 2G95A 3PZMA 1KCKA 4FS9A 2OZ3A 2QJJA 1S5NA 2XN0A 3MO7A 1KQYA 3IRDA 3W2UA 4QRNA 4GCAA 5AHMA 4H6KA 1PPIA 2GSHA 1E4NA 1T99A 5T9BG 1R3WA 1RHCA 1KXTA 4WY0B 1LROA 2PDKA 1WYIA 3BPWA 4H2CA 2DZAA 4X3ZA 4UMCA 2AAAA 3APTA 1TV7A 3MUAA 3FA3A 1QMLA 1K9DA 2G3NA 1LRQA 4QEEA 4NP7A 2GYIA 4DM2A 5IHSA 1DVJA 2PD9A 2J47A 4MAVA 2E1DA 2QJIA 1W3IA 7XIMA 1FTXA 1NTHA 1QT1A 4R34A 1TPDA 3MTWA 3AS0A 5A5WA 4JFSA 1LRNA 5M3WA 1KM3A 4EAYA 4O57A 4QEHA 3EB4A 4F0SA 2PDMA 2HROA 3G3DA 4N4PA 5B7ZA 1T96A 5FF7A 4L9ZA 3N13A 1PE1A 2ZUTA 1KBKA 1SO3A 1JXJA 1HP4A 4OJYA 2CLHA 1LOLA 3BOXA 3ONBA 4DF1A 3QZ6A 2XZ9A 4V27A 4JX6A 4W7VA 3VIHA 2NUWA 1A47A 3Q94A 2AAMA 3QFWA 2TAAA 3BAXA 1W9BM 3JZUA 1N8IA 3CTTA 3N18A 1ITCA 3T40A 2PBOA 3QHNA 1GPFA 1LL4A 1LP6A 3SRFA 1F3EA 4NL1A 3SB0A 2CBJA 2PTZA 2YXOA 2X1RA 4HU8A 1BQCA 1OVDA 4YWIA 3QTPA 1ZP4A 4W9TA 4UQAA 3O63A 4EACA 3IJLA 2QCGA 5DY3A 5G4EA 1QPRA 4D6CA 1Q63A 2F2HA 3DBPA 2ZA3A 5H8PA 3BLLA 3DFSA 1WDDA 4TUFA 3WBXA 1AQHA 4ZR8A 1XD0A 3M0VA 1XSJA 4XIAA 1TTJA 3EDEA 4NYYA 2WM0A 3DU0A 4H9VA 4JKMA 3R10A 4G7FA 3HOJA 2J27A 2X05A 4ZXLA 3SCOA 3WEZA 4HNOA 4LAOA 4GJIA 3S5OA 3BQ5A 1J6PA 3CPGA 3QM3A 4JNYA 1GCYA 4L5ZA 2YW3A 3M6DA 1DJYA 4Q8VA 3D3FA 1CIUA 3IAQA 5BXPA 1BGGA 1GEQA 2YXGA 4C1NB 2P53A 1A0EA 1LOQA 3EWBX 4ECLA 3ZO9A 5TD4A 3TCEA 4Q4PA 2CLPA 4MDOA 2R1MA 2DJLA 4EE9A 3F4WA 3ARXA 4JD4A 1LG1A 3KVLA 4J2MA 4DIAA 2XFYA 3N6QA 4DZHA 4AZ6A 4H8HA 1XYLA 1S2AA 3LGEA 1RP8A 3T2PA 1TWDA 2KX9A 1S2WA 1KRAC 4M56A 1PIIA 5AVHA 1HJQA 3P3BA 2YLLA 3B03A 1NP0A 3GAYA 4L6HA 3WH8A 2VR4A 1BXNA 4B3KA 3T09A 3G0XA 3N2XA 4GYKA 2VFDA 5MKGA 1XFCA 4GH1A 1KKOA 2C79A 4HBKA 2ACUA 2H3DA 5DELA 1UIOA 3MBDA 3N29A 3EB2A 1S1PA 3QC0A 5DEZA 3BMVA 4W7WA 2WPBA 1W5NA 4UMAA 1IHIA 3P0XA 4C91A 2FH6A 1P0BA 2YGYA 4BQ2A 4OIFA 1K6AA 4BI6A 4WDTA 1TA3B 1MUCA 1XLAA 3HQPA 1KM1A 2BTMA 2Q3RA 2C0AA 1FWIC 3A3XA 1AJ0A 5AHLA 1MQRA 1K03A 3VKJA 1P0EA 1ZNNA 2FPTA 1UASA 2GWGA 1H5YA 2EPMX 1K3UA 4JTAA 3WD2A 2HV5A 3CV6A 4IICA 1C7TA 3E0LA 4H3DA 3WFAA 4GABA 2ZRUA 1SW0A 2DUAA 2EKGA 2INZA 4MUPA 4JIQA 4UIOA 1JRBA 2DSVA 4GLEA 3IPWA 4IIDA 5C0QA 1WOAA 4HZ6A 3THDA 4CEXC 4PUNA 2Y4SA 3AXHA 4KWVA 1Q7MA 2F84A 1PX4A 1GW1A 3MU7A 4EXAA 1V51A 3FLUA 1EGZA 3CAQA 1XQLA 3WBEA 1KM6A 1MFVA 2C91A 4AMCA 1TKKA 4LQ1A 3CHFA 1E1CA 2JQXA 3W22A 5D2TA 4G1KA 5G4HC 3URAA 1IEWA 3THUA 1E55A 2PC4A 1RZMA 4PBEA 3VGGA 1FRBA 4G8TA 1D7FA 1F74A 4C6QA 3QSRA 3QF0A 3S6OA 5FOOA 4WGXA 1GVRA 2FPVA 5FJTA 3UT0A 3W84A 3GNPA 5FEXA 4UTTA 4UQCA 3HMCA 3M5XA 1Q3NA 2QCFA 1TWSA 2WM1A 1ZJHA 3HTWA 3TV8A 4RNHA 4UC5A 2CZ5A 1H7PA 3GR8A 2P5NA 3EA2A 2PDUA 2AL2A 4HYRA 4IIHA 1BSIA 3OGRA 4DAIA 3PBWA 1ZS2A 3RCNA 3LERA 1EH9A 3L0GA 5E0FA 3IJ6A 1OX5A 1O66A 1E6XM 4R3UA 4UTUA 1ZCCA 2CC0A 4J2PA 4Q8UA 5CXPA 1XH0A 1OZMA 1LCOA 3TC6A 2YZRA 3TC7A 4GGBA 2C6QA 1OABA 4LEQA 1JCJA 2VCCA 4OE7A 3WN6A 5LZLA 1H1ZA 2PDXA 1V3LA 3N73A 4N6FA 1UWAA 2GGJA 1B0IA 2DORA 3H8AA 2NVAA 4XKMA 2ZTKA 2V3FA 2XWDA 4DBUA 1KFLA 3OW1A 4I9JA 4GYJA 4MKVA 3OYXA 5I77A 1Y0EA 3Q2DA 1BVZA 5KZDA 1R7OA 1FWFC 4DXVA 4DBDA 1OWQA 1UA7A 4PEKA 3GW3A 1ISXA 3ARVA 4K7VA 3MA8A 1PZ0A 4AZ5A 1FH9A 1IIHA 2ISWA 1D8CA 2Z2BA 3C8FA 2IPGA 4AZHA 3GZ3A 3BANA 4UTKA 3SUTA 4Z2LA 1M9HA 4PTMA 5T26A 3UG4A 4AZ7A 2EAWA 3WK1A 4FNRA 1J18A 3KP0A 3AYRA 2R1PA 2VC7A 2XH2A 2HXUA 4PMRA 5IHRA 4Z2IA 3O06A 1JYWA 4EPBC 4DUWA 1FWNA 1Z3NA 5U4NA 4MY8A 3RR1A 1SW3A 3QJAA 3TC3A 1QNOA 5SWUA 5T8GA 4PUKA 4NJGA 1PSCA 1K4HA 2BBFA 3ZYZA 1C9WA 2YYUA 1RCXB 1W8GA 1FWEC 4Q7NA 2D23A 3PM6A 3DYOA 2Z2UA 2DZPA 2GFTA 1DJNA 1AL8A 3C6CA 3NNTA 3Q65A 4PFMA 5B80A 4DO4A 1VBHA 5BWFA 4WDXA 1TFVA 2GUYA 1BWKA 3LXBA 3RF9A 3KCJA 2HE8A 1CDGA 4NF7A 1EEXA 4N0RA 1TJ0A 2GJLA 3P5ZA 1Q65A 1KFJA 2PP3A 1W1A1 2IPWA 3MI2A 2HSAA 3K4AA 4ZTXA 2X42A 2XSBA 3NZPA 1G4EA 1H4PA 1XG3A 3ZMRA 1ZPTA 3OHMB 4D8AA 4V28A 4GY1A 4I90A 1POKA 4GWEA 2VC5A 3QW4B 3KX6A 3QLLA 4JHOA 4A4AA 4O19A 1MI3A 4DWDA 4B4FA 1VFLA 2I56A 3S83A 2JEQA 1VFHA 4LAKA 5T9CE 1EJTC 4AD1A 4ZO8A 3TR9A 4E0CA 1PYMA 1GVIA 2VDIA 1HJVA 2QMKA 3AXIA 3ZVHB 3LXAA 4JICA 1C8VA 5C2XA 4ZO7A 3AHZA 3MKCA 1DE5A 4CN6A 2YXXA 3HO8A 2E5BA 4YXGA 4TQTA 3CUHA 3IK2A 3M43A 3N12A 5AC7A 1H1NA 3TN3A 4AU0A 3MMWA 5IM51 3DFHA 3P7YA 3VUSA 1ZU8A 3ANUA 3L65A 3ES8A 3RPMA 1HKMA 1FX6A 4K3ZA 1K8ZA 4ADTA 2J25A 2WKJA 3GHTA 5A6LA 1KWGA 2PA6A 3MJMA 3OB8A 5HAOA 1XP3A 3ITTA 3HGOA 1DQUA 3VU2A 5DN1A 3W23A 1IEVA 2AL2B 3FSUA 3G8RA 1KRMA 3RX3A 3ZT6A 1UR3M 1WP6A 4UTTC 3ITGA 5DANA 2BX7A 3D5HA 4DX3A 3I10A 3TYCA 1J0JA 2X30A 4MWAE 2V5KA 5KETA 3ZJ7A 4PMQA 1ZL1A 3O6CA 4Q8NA 4LVFA 3QLDA 3L2MA 2E4TA 5CPLA 5DCEA 3DHUA 4NJIA 2ZZ4A 2A7PA 4LAZA 3EX4A 5HWMA 1XR2A 3TX9A 3W00A 2QQ6A 4KPLA 3TKFA 1Q7QA 4N42A 1VENA 4AHOA 4AVNA 2DSUA 2UY4A 4KFPA 3NQ8A 1RJQA 4F0RA 2ZRVA 4EWND 5I23A 4K1GA 5DMNA 1QCWA 1OFPA 2BY2A 5HNUA 4WDUA 3A22A 5K7JA 2XFWA 5DY2A 2DJXA 1EJUC 3KWSA 1R86A 3KTCA 1ICQA 1QHPA 3QQ0A 2PDHA 3MSRA 4ZFMA 1GOWA 3CH9A 1ML1A 2AKZA 1OIFA 1G7VA 1JDEA 2ZOXA 4HCLA 2E9MA 2YA2A 2ZBTA 1U1HA 1J4EA 2CLIA 3UG5A 2VVNA 1B3WA 1GHSA 2FKPA 4M19A 1C8YA 2VRJA 1E0WA 2E6DA 2J7DA 3VIFA 5HNTA 1YE4A 1L8PA 3TYAA 1XPGA 3GFZA 1EP2A 2IS7A 3W0KA 4PUEA 4LB4A 2J74A 2FZDA 1FQ0A 4OWGA 4AIBA 4O4VA 3KHJA 1V3MA 1HJSA 1EBHA 2ESCA 2D69A 2V9DA 2J62A 1KTNA 1LOSA 3PVFA 3NQBA 2BZNA 4H41A 5ABHA 1S5MA 1DTNA 3TW6A 4LJ3A 4N9CA 4PCNA 3WH5A 4H01A 1HG3A 3KEHA 1KBJA 4AC7C 6XIAA 2X7WA 5KZ6A 3B8IA 3WFLA 4IXHA 3MZ2A 3RYSA 3EOLA 1YDNA 4YTRA 3PZNA 2P3ZA 2E8ZA 1I2OA 3VMPA 4EPKA 1WBJA 1QXLA 3HN3A 3SJ3A 3UNDA 3LBMA 1KXVA 1L2QA 1A5OC 3VFCA 4JQ1A 1KNWA 1AVAA 5E0KA 1JAEA 2O56A 2HE5A 1EF3A 3EDKA 1I0BA 1BYAA 3E2VA 1FUYA 1GOXA 1GYLA 2O4MA 1IT7A 1GKRA 3GM8A 1MXSA 1OYAA 3N17A 2P0OA 2EG8A 3D0CA 3H4GA 4C6FA 2WJDA 2QPSA 1AG1O 4LEFA 1H5VA 1XG4A 3BGGA 1J0IA 2EPOA 2EG6A 5LNVA 2QUUA 3PJXA 1BYBA 4LYKA 3IVSA 1L6WA 2XN2A 2QLYA 3EXSA 3PPGA 4QNWA 5AC6A 4PUMA 3UJSA 4DJEA 4WJ8A 1A3XA 4HNLA 2ZX5A 3RU8X 1H7OA 2BOGX 5G1TA 1EXBA 2XSAA 3OBEA 3O6YX 3AXMA 4NILA 2QEZA 1C29A 3QYSA 3RLHA 3S2LA 4B4HA 4IPLA 3FA4A 1UW9A 4CNTA 1U30A 4JL1A 1XL9A 2ZRXA 5F2IA 1P7TA 2B7PA 3MO4A 3T9PA 1V0LA 4M6UA 3GTFA 3N9KA 3W1RA 1UKSA 5H8MA 4B2DD 4GUHA 1HJUA 4B92A 4DNMA 4A05A 1VZWA 1TPC1 1Q6CA 1SJBA 1J01A 4MJZA 2PB1A 1MQPA 1SO5A 1XIMA 2MUCA 3G6LA 1IXOA 3RO6A 2RKXA 1E6SM 3BLOA 5CZKA 1PDYA 2EPHA 3NL2A 2YCIX 2WLYA 4GNKB 5HPOA 1OIMA 1K8CA 3WNNA 1T41A 1W1PA 2QZRA 3GDRA 4GINA 1GZJA 2WKGA 3I7QA 1FH7A 1QVBA 4Q32A 4OQVA 1OJXA 3LYEA 1BYDA 3AMKA 1CGTA 1NFBA 5FL0A 1U1JA 4L1WA 2WBKA 2A3EA 3P74A 1A3WA 3DUGA 1Q5MA 4DY1A 1FCVA 3WF1A 4RZ4A 2WKLA 2PLJA 4D6FA 3T55A 1YNQA 4GZEA 2G8ZA 1V77A 3TQ0A 3HPXA 2HDJA 4YHGA 3DZ1A 3SURA 3EA3A 8XIAA 4D6EA 4QQ3A 4XG1A 3T05A 1N8WA 2J4GA 1A0CA 4J3ZA 3SAZA 3WUEA 3WQPA 5HMDA 1HT6A 4N6EA 1YNPA 1BWLA 1KGUA 1N82A 1R9XA 4DZAA 1FVPA 3Q37A 3ANYA 4C6CA 3OVGA 3B0VC 2YBVA 5E6ZA 3ZR5A 3H23A 2PP1A 2PC8A 2Z25A 2ZRYA 3BLDA 1MEWA 2OT0A 1ITQA 1I6NA 2QUMA 2ZXBA 3N25A 3RLVA 3F4CA 2NVCA 1PAMA 1YMYA 1QOQA 4DUXA 4LH8A 1NM9A 3M16A 5A2CA 3LA4A 3FYOA 3GYEA 1AA1B 2NX3A 1XRTA 2CU0A 2V69A 1US0A 3A13A 1V3HA 5A2AA 3RCYA 1GZ1A 3H2FA 3EZ4A 3N6HA 2FH8A 1KBBA 4QIUA 3QR1A 4NRSA 1SPQA 3DIPA 4H9YA 4JFTA 1YRRA 2JE8A 2IKHA 5D2WA 2E6YA 3NO1A 3NYZA 4JN8A 7ENLA 1TMHA 2PDGA 4UQBA 1B1YA 1CTNA 3DHPA 4JIHA 1YTEA 3LZ3A 4HIBA 9XIAA 2GUUA 2WBGA 5XINA 4DQWA 3WQ6A 1D2KA 2OU4A 4ZOBA 5HMEA 1F8IA 2QVNA 4M82A 2F6XA 4O28A 2OO6A 3VA8A 3UQNA 4DZIA 4X9SA 1X6LA 4LS1A 2PZNA 3S5ZA 2WK2A 3LENA 3S5SA 3A6OA 3NQVA 3VFLA 3H2AA 3MMDA 1DORA 1GVOA 4GVIA 4L6DA 1KTBA 2I16A 1O94A 3IANA 4E38A 1E51A 4HSNA 1JZ2A 1UYQA 3LN3A 4ROPA 4MWAB 3VE9A 1H49A 4RV3A 4B91A 5I3JA 1W1B1 1GK8A 2WZIA 5I00A 4HNCA 1PKMA 3AALA 4JFVA 1HVXA 2ATMA 4L64A 3T78A 3OVPA 4N9DA 1E6RA 3R8HA 5CGTA 1ZJAA 2GDVA 2YCJA 1JUEA 4D6HA 5D8WA 3CMJA 3TJIA 4Z1YA 3MCMA 5CBBA 1EX1A 2Y89A 1IT0A 1NEYA 5D37A 3DFTA 5M03A 1CGWA 4GACA 2CCRA 1WOBA 2ZTJA 4WEVX 4NX0A 3VABA 3C4UA 1QBBA 1XIBA 1YPFA 3UA3A 1RD6A 4Z2JA 7REQA 3PTKA 3OZOA 4US5A 2XVPA 1QWKA 1XBXA 3CYJA 5EMLA 2PURA 1R47A 1UPPA 4L56A 2NQHA 1TX0A 2YCLB 4W8BA 4DJEC 4LRSA 2C15A 2OYKA 1E0TA 3VIJA 3VVGA 4GIRA 3L12A 1GPWA 4UMBA 3ZM8A 4LUSA 4BS0A 2CHRA 3ZSSA 3EA1A 3UP8A 1XISA 4ACZA 1G4SA 1TX2A 4IGHA 3IACA 4AISA 4WXZA 4LY8A 4DF2A 2V67A 5ENLA 3NM3A 1EUNA 3GFYA 1XLFA 3I3EA 4RLIA 4B9YA 5AYYA 1GVFA 4J5NA 3L4YA 5LNRA 3E6EA 4DZ5A 4DNHA 1ZSXA 2PS2A 5AHFA 2DVXA 2ZUUA 3GIPA 1JDDA 2BP1A 2QW5A 3QV7A 4DRSA 3V1PA 4TXEA 1DE6A 4EF8A 3PTQA 1JPIA 4QG6A 5IDIA 5MF5A 1HKIA 2V82A 1VH7A 3W7NA 5M5DA 3PANA 1TPB1 2UZ9A 5ABFA 3W1PA 4B5UA 3SY1A 3M1ZA 1IEXA 1FKWA 4AH7A 2A85A 3O2LA 3LI1A 3L0KA 4BF9A 4IQLA 4IMGA 3F7JA 3CIVA 2DZUA 5I79A 1I75A 4Q3MA 4IJCA 1W3JA 3W87A 1A5SA 3TQKA 4TV6A 2Z1VA 1H50A 1WKEA 2VWTA 4X63A 4DLFA 1YBQB 1E3XA 1ONRA 1HZYA 1XKJA 3QMRA 3G24A 4ZB0A 2OOFA 5BXTA 5HUOA 3L4XA 3F5KA 3S9YA 4XAZA 4GUFA 1Z48A 5CBJA 3UFYA 1FFQA 3HBLA 4KGJA 2MANA 2WV8A 4ACYA 3G5EA 3IUDA 4GYPA 4UTIA 2VEFA 2R24A 2NQ9A 4NASA 1P6BA 4U5KA 3ZR4A 3SIMA 1F3TA 3WNMA 1VFUA 4LNYA 1B3OA 3SFKA 1TREA 1PCKA 3PULA 1DJXA 5ABEA 3NEVA 2W67A 4O14A 2G97A 5CG0A 2VZVA 1IGSA 2PWUA 2PRLA 2V5DA 2XGBA 3S1UA 4A3RA 1XDLA 2OOGA 2OEJA 4DYEA 4TV5A 3KP1A 3LHZA 1EYEA 5BXRA 3EKLA 3M5VA 3DC8A 4EOUA 1K77A 4OUEA 3CJPA 1XS2A 4L6OA 3LX9A 3OPSA 4GI4A 4HOZA 5HANA 5LA2A 4LVDA 2AMGA 3THAA 4I9MA 1O5RA 5CSRA 4FXSA 4JTHA 2WZTA 3E5PA 3MCOA 5A8GA 1EGMA 2FDSA 1UWRA 1W9XA 2ZUWA 4MY9A 1DXFA 4NRRA 4PTXA 3WYZA 4AD3A 1BHGA 3G0SA 5I09A 2PMQA 1FWTA 3KTSA 5H2ZA 2PU0A 1J5SA 4MF4A 2PI6A 1T8QA 4I6VA 1ONWA 3LNMA 2OSWA 2PGFA 2WMJA 5C8BB 1J0KA 2H6RA 5KZEA 1NDYA 1OHLA 2C13A 4UFHA 4DJDA 3EPNA 1ZB5A 3C0LA 4FI4A 2ZC8A 4KERA 1U22A 2GOKA 3AHXA 4LB3A 3U4AA 4LBUA 1PYFA 2JFEX 3LOTA 1V0NA 3QPEA 2ANUA 2ZUSA 3BAJA 4F3HA 2L5HA 3V35A 4XZ9A 2IMRA 1TPWA 3P80A 2O9OA 6PTDA 2CLFA 1VJIA 3EAUA 3XINA 3CQHA 3KCLA 2X2GA 3WQVA 1ALDA 3IS4A 3CUIA 4RXGA 1KRCC 3FK4A 3MZNA 2F8QA 3VNLA 1L6FA 3WJYA 4LUSB 2W0UA 2DIKA 3TUUA 4Q6XA 2BWGA 4CNSA 3IEBA 3RRAA 2WHKA 3VILA 3N19B 4A35A 5TIMA 3TTQA 3P8JA 2Q09A 1AODA 3VKCA 4QBXA 4EXQA 1MUMA 3QOKA 5CLTA 3M5ZA 2ZX6A 3GXDA 1W3LA 3BH4A 6REQA 5C55A 1IZCA 3TN4A 4S3EA 3CZLA 2W61A 1Z44A 3LCGA 2BLEA 4OU1A 3LY0A 3HJEA 2W3ZA 2OYLA 3SQLA 1G5AA 3XISA 1SFTA 3I7SA 4JTDA 1SJDA 3H53A 3N14A 1PHQA 3WDQA 4CU7A 4ZE4A 3BSHA 4GXMA 3BJTA 3WSUA 5K9CA 4JOMA 3XIMA 1KFBA 4LVBA 5F2MA 3CHDA 1L0PA 5AKQA 4JQAA 8CGTA 3S46A 1UMYA 2HS6A 1B57A 4GG9A 3TIMA 1FWBC 9RUBA 2UV8G 4PTWA 1GQNA 2QUTA 1E4MM 4JKLA 1XGZA 3H12A 3USBA 3R58A 2Y70A 3B05A 4A8IA 4GI8A 1JGMA 3VUPA 1JULA 4ZB5A 5J04A 4AEEA 2DUXA 2C1GA 1YTDA 1G0CA 4XWUA 1REQA 3NSNA 4E2BA 4QTGA 3PJWA 1DKWA 3ZT5A 2OPJA 4QROA 5LIUX 4O13A 5D9NA 4NX5A 3ARQA 5C9UA 3POCA 1R3TA 5BZAA 1T6MA 5E70A 3PTMA 1LUCB 2YOCA 1Q8JA 4HSOA 1X8FA 3L66A 2PGRA 5LKYA 5CZ0A 4X0NA 3E9AA 1V93A 4PMOA 4XAFA 1RQBA 1H7NA 1BTCA 4H6QA 4X60A 1P0KA 4GYPC 2NV1A 3UGRA 1SJAA 3ORWA 4BK9A 5CPTA 2GWNA 1XYFA 4S3FA 2FGZA 4KT2A 3THQA 4IZGA 1H7XA 3BW2A 5LIYX 4XQ6A 3RMJA 4B5VA 1GTHA 2E6FA 2YR1A 3T81A 1VP5A 1N2VA 5DRIA 1OFRA 1YKWA 2BVWA 3T4WA 1Z32X 5A6KA 3VKKA 1KD0A 3LHVA 1QUMA 4Z2KA 1A49A 3DDMA 1WQ5A 1NP2A 3WJXA 4ZEPA 3BZJA 4CQCA 1E73M 1XLDA 4QJ5B 1QW8A 5EBUA 3C86A 5CAHA 3DESA 3WK0A 3E0FA 3GNRA 3B0PA 4RW5A 4NNAA 1J0HA 1DL3A 2INFA 2ZC1A 3DAQA 1XIHA 4Z1AA 3L4VA 5EMMA 2XZ7A 2H8XA 4DJFA 2HRWA 4KRUA 2Z7GA 5I03A 1CXIA 2Y5EA 3M4HA 5I3GA 4H9UA 3KOWA 1YE6A 1N8FA 3SY5A 3EBVA 1EKOA 1O12A 4Q8TA 2VGBA 3IVTA 3LD5A 1UJQA 5EPDA 4NUWA 5G2HA 3V5FA 4E4UA 2VFHA 4NQ1A 3CQJA 4AD4A 2VEIA 3I4EA 4LRTA 1IZJA 4KKXA 1TIMA 5A6SA 1CXHA 3LRMA 2BDQA 4GE8A 3BMXA 2QVHA 3PBGA 1WAWA 1JCNA 2PSNA 4MKSA 1MZHA 4O8RA 4ICCX 7TAAA 1SM9A 2IW0A 4H7CA 4DJDC 1TZ7A 1H60A 3QV9A 1DYSA 4YYCA 1VBJA 2IKGA 5I78A 2A7RA 3Q45A 2EO7A 4FOKA 3AUOA 3MBFA 3CH0A 3WH6A 3RJYA 4PSRA 3DECA 4C1LA 5E1QA 1BXCA 3MUIA 3WD0A 1EFZA 1KQZA 4MOZA 5D09A 1L8NA 1S3HA 1W3TA 4N7QA 3B9DA 1V02A 6ALDA 1LM1A 3NQGA 3L21A 3K2GA 3CT2A 1XYAA 2J9ZA 3S1GA 1OQFA 4M80A 5LNSA 3LTPA 2V3GA 3KVMA 2OQYA 4UZSA 3TK7A 1BXBA 3DFYA 3QV8A 2Q8LA 4HZ7A 4ZA0A 4D72A 5GNZA 2GGHA 2XWEA 3CWNA 3CS2A 4HYWA 3VOHA 3BLEA 1PHWA 1X98A 4Q8OA 1BAGA 3Q67A 4RL3A 2AGTA 4HZMA 1TRDA 2VT0A 1UZ1A 3O0KA 3TEVA 4K38A 3OG2A 2VKZG 4GIAA 2BS9A 3GO2A 2ADAA 4YVVA 3SUSA 2FHFA 1QBAA 2I9EA 1W9PA 1LT8A 2VFEA 2Q8ZA 5CPOA 3WF2A 4MTVA 1LYXA 4KWOA 1PWMA 2XVNA 2WHJA 1OC7A 1GQKA 3AWNA 3NQ2A 1PEZA 3ZXWA 5LIKX 3HIJA 4IHCA 5F2LA 4GQQA 1G4TA 1VFTA 1EGVA 3P67A 4PCPA 1O1HA 3DFQA 3KS6A 4IFKA 2WNQA 3W2JA 2G3JA 4WHBA 4IUGA 4TO8A 4U3CA 4JL2A 1XI3A 4TTGA 3KOYA 5D8ZA 2RDUA 3TFXA 1UUMA 5HR7A 3K8LA 1HGWA 1CXLA 3AZTA 3VYLA 5F4SA 4GPNA 1OYBA 1OZQA 1UG6A 1SZGA 3UVIA 3B9EA 2OCZA 4HK7A 3AMGA 4DUVA 4YHEA 1D3CA 4UTLA 3MSGA 1FA2A 3GQYA 3TTEA 1MEHA 3FAXA 3A9BA 3EEGA 1ZQ5A 3WUGA 1BVWA 1OY0A 5I3IA 5FEZA 2OSYA 3JRKA 3GG1A 3UWEA 3JS3A 4G9PA 3EOUA 5D2VA 4UCFA 3NQFA 4M51A 4YL2A 2ZX7A 4S39A 3ABXA 4LBRA 3O9NA 1ECEA 2QAPA 1CB7B 4HPNA 3N4EA 5E9AA 3OBKA 4ZMGA 3LCFA 4PCFA 1TG7A 1XIJA 4CNOA 3PK7A 1P6CA 2VZTA 1S5TA 3VMNA 3NOYA 3U8GA 4QHRA 2WMIB 1CZ1A 3NL3A 4BKNA 1W9DM 5CBIA 2ZICA 4MWAD 4HVXA 4JIEA 4M8UA 3BO9A 4MYAA 2OKOA 1LQ2A 4MNJA 1J96A 4PH6A 1TQXA 3KLKA 3LM7A 1Z9AA 3MB9A 5DMLA 4LAMA 1PBGA 1C91A 2QPXA 1GG0A 4LXFA 2J8GA 3VOGA 4KFNA 1C93A 1YADA 2FGLA 4Y7EA 3LGDA 4AHPA 2E40A 3MP5A 3TNBA 3KOZA 2VX4A 2X8RA 4FB7A 1IWPA 4L9XA 4KFOA 1K9TA 1ZAIA 4RX0A 1SR0A 4AIEA 2D2GA 4DJED 1TTQA 1IWAA 3OA3A 5LYRA 3QTGA 3SDOA 2WWDA 4ZENA 1W5OA 4E3TA 5I24A 3EXTA 4Q4RA 2J8TA 3A4JA 4KEZA 3AIWA 2PP0A 3BSMA 1EZ2A 4O50A 3TYEA 1UKPA 3TOPA 2BY3A 4AW7A 3WX7A 4DJFC 2VTFA 1NDZA 2GVYA 3CWHA 1IXQA 2VX6A 3GTIA 2IQDA 3THCA 3DHDA 4F48A 4AZCA 3W7DA 5EMKA 1RY8A 4GO8A 5JBDA 4AY8A 3QPZA 4LCRA 1EJXC 5XIAA 4NZ1A 5AECA 4M6VA 1AK5A 5EFDA 4IG2B 4LYPA 2FMNA 3DI0A 3WF3A 1ZAHA 3AS2A 5H1WA 4IOTA 4GZIA 4HU3A 4EAMA 3GVQA 1TVNA 3AICA 4I9AA 3BLPX 3OU8A 3TROA 3F2BA 5I3DA 3DXIA 3EXRA 1V6UA 1A5BA 1I8JA 1VYSX 2EPLX 4MNLA 5BXSA 2ON3A 1G6CA 3STFA 1W2PA 2QMJA 3IIVA 3O16A 1ONEA 5HATA 4IGSA 3TTYA 2TRSA 1KGXA 3WJZA 1XINA 3BQ6A 1WA3A 1DQXA 3WF0A 5C7HA 1XCWA 2CLKA 2EKCA 3AUJA 3CU2A 4YVXA 3P84A 3BV7A 1FCQA 3W86A 5LA0A 2OT1A 3MQTA 3BL3A 3ABOA 3I6RA 1FP9A 2E28A 2DQWA 3W75A 1UZ4A 4POCA 1EC8A 2VUNA 5E0CA 1VYPX 3AXKA 5BOFA 3W4RA 3TSDA 4EVZA 4C65A 1Q66A 2B31A 5EMUA 5HWJA 2ZFAA 4MJ2A 1AQFA 3LK6A 1XX1A 4LC6A 4H83A 3Q4DA 1EIXA 1DTUA 3AROA 2VENA 3G18A 2PLCA 3PZUA 4W8LA 3NG3A 1FWSA 1X96A 3S4TA 4UZUA 4LUTA 2KZHA 2WSRA 3MDUA 1NOFA 2OGJA 4IMFA 3BJSA 5TNVA 1LT7A 3TW9A 4FLSA 4W5ZA 3T8QA 5CZSA 5EU9A 1KM5A 3PZOA 2V5BA 1V3KA 1ITXA 3VK5A 3GZAA 3HPAA 3W28A 2EJ1A 3TAKA 1MYRA 3MI3A 4IPPA 2Z26A 4E8GA 1ZUAX 4RNJA 4C7FA 5CJNA 3UXAA 1QI0A 4P7QA 3WF4A 1UC5A 4PSPA 2RDXA 2JGQA 5T91A 1FWRA 2I57A 4H4IA 3OLGA 4JIPA 1JDCA 1WAUA 2C18A 4FF5A 3GHRA 3BCFA 3FXYA 2QKFA 1SUXA 3EMCA 1JCTA 2PBGA 3VGEA 1PV8A 2VR2A 3LMZA 1YDOA 3QRHA 4W87A 4C6LA 2YX0A 2XH7A 3H2NA 3NO5A 5AHIA 1EUAA 4PZVA 1BSLA 1JFHA 4YS1A 3B40A 4AX7A 5IRPA 2ZDRA 2DW6A 4RNFA 1UA3A 3AIBA 1IXPA 5CJ5A 4AYSA 4LVGA 5G1YA 3QHMA 5BCAA 3N04A 1R6WA 5AHEA 1KLZA 1HFBA 2TYSA 2EQDA 3LBOA 1O6IA 3GB6A 4IIFA 3FGCA 3T0CA 2EF9A 1RVKA 4GY0A 3QBUA 2FB2A 1Q85A 3KBWA 4H8UA 3S2CA 1SZRA 1VPQA 5KZMA 3CZGA 4CGTA 3FV9A 3PG9A 3QKEA 4ZODA 3MDWA 4HPHA 1UBSA 4NAEA 1W54A 4KQNA 3QN3A 4HMNA 2EPKX 5FEWA 3CTLA 1YPIA 4M24A 2QCCA 1XRSA 4J9JA 4FA3A 4UFLA 4IPJA 4I8YA 2QCNA 1ODZA 1X7IA 3VX0A 3NQ7A 4W88A 1TWWA 4IP5A 3GHUA 1QO5A 2ZYFA 3R11A 1TPFA 5L9FA 1UWIA 3T07A 4YLWA 4XB3A 3RFAA 4KS0A 3WH7A 1O7AA 3HMJG 3FW6A 4P8UA 5AC5A 1ISZA 3W71A 2B4GA 4ZOAA 1IV8A 1POJA 2REQB 1YXCA 1NQKA 3EKZA 3LSBA 4YJ5A 4GUJA 3STEA 3RK8A 1TV4A 1GQJA 1UD5A 2BGNE 3TAOA 4FXRA 1R0MA 2BVDA 3VNMA 3O3RA 3VNZA 5K2ZA 4JN7A 4GOAA 4MMWA 5AY7A 4CN1A 3CLWA 1KBLA 4MUZA 3LHUA 2E67A 1Q6OA 5GNXA 5EY5A 2XTKA 3KM8A 3NEHA 1OEPA 1P0DA 3CUXA 3IIXA 4B16A 1XRFA 2WQDA 4XSLA 3NZ1A 2XH0A 2WC3A 4C6IA 4Z0JA 3PPFA 1QRQA 5CEWA 2BY1A 2OX1A 5BOOA 4XKYB 4PCTA 4JHMA 1E1FA 2P88A 2O9RA 4AEOA 4IP4A 2GJXA 2WNWA 1OC6A 3CK5A 2Z1SA 1NAL1 4G1NA 4GZ7A 3G0UA 1RCOB 5I6SA 4NG3A 4EPEC 3W1MA 2W6RA 4W8AA 2BHUA 2E6AA 2PTXA 1V0MA 2E0PA 3IJQA 1F3XA 2BXVA 3STCA 2JK2A 4KW2A 4MB5A 1JEZA 3BLIA 4MGGA 5D2XA 3EMZA 1TR9A 5JBEA 3CQ0A 3RM4A 4O18A 4ERIA 2GLKA 2UY2A 1FDJA 1I2RA 1NARA 1OINA 1EA0A 1FXQA 4DM1A 4WQ6A 3A23A 4UUIA 3POHA 5LSMA 1ADSA 3CHVA 2PD5A 3WLNA 3D46A 2A0NA 3GG0A 1WDWA 4C6KA 4YTUA 1QDSA 3KRUA 5J8LA 3TJXA 5AFDA 2R1KA 4ZB2A 4J7RA 3HQOA 3W2NA 4HCHA 1JPDX 1MRQA 2WVSA 2GGIA 2IPFA 2GGEA 3PZGA 4GI6A 4HN4A 3S47A 1U1UA 1TMQA 4Y9AA 4PMZA 4H2HA 1B5TA 3A5FA 4ATWA 3CYVA 3U9IA 2X09A 1NOUA 2YA0A 3WKZA 3A3HA 4J3WA 3I3BA 2WO5A 3WZ0E 1ZENA 4OOUA 3VIOA 4GKLA 2Y7DA 1C8QA 3N9SA 5IFPA 1U2YA 4S3DA 1MEIA 4ONVA 2P1FA 1F4AA 3WLOA 3AZSA 4AEFA 3ZS4A 2PCEA 3KRZA 3ARRA 4E4PA 1JVNA 3BW4A 3EX3A 4PMDA 4HD5A 3GVGA 4XZNX 1EA9C 2QJNA 4FP1A 4FIQA 4AZBA 3VOFA 3UPMA 4WLCA 4Z08A 4BFAA 4X9YA 4CVUA 4JTRA 4HHHA 1Q2RA 1SJCA 5C9RA 1IEQA 1GVYA 4B2DA 1I2QA 5LHEA 1CWYA 3W38A 4XISA 2ISVA 1W17A 4ADUA 4BI5A 5LHFA 1J6OA 3BLKA 4S2CA 1XIEA 3A4AA 1UIPA 1GJWA 4DI9A 3NQ6A 4O1DA 3FN9A 2VFGA 3HM7A 4FK9A 2FFCA 4O52A 1UPMB 5ABGA 1OYCA 4W85A 4DBEA 5HQEA 4H9TA 4M1BA 3W53A 2XISA 4OBRA 3BJFA 4BQ5A 1KM0A 2XDFA 3NAVA 3C2EA 1XHGA 2FTWA 2IPJA 2EGZA 3AC0A 3MHUA 3T4CA 4H00A 1FHLA 3UWWA 4ENLA 1RBAA 2OB3A 2IKIA 4F0HA 4NAEB 3RLGA 4PUUA 5BRBA 2VEPA 1AMKA 1W6TA 1GOMA 1M3UA 2EEXA 2V2CA 5JXQA 1RA5A 4HHPA 4PL1A 4C1NA 1DOSA 3UXIA 3MSDA 2NWSA 4MZ1A 4IH3A 1Z42A 4LUJA 5FA5A 4C1KA 3EWXA 4HJFA 1J11A 3DEQA 3NVDA 2JBMA 3HPSA 3PUEA 4ERAA 5FKYA 3HA1A 2WMFA 1F6PA 1J9YA 1BF2A 2H9AB 5BMWA 2FHCA 3S0CA 1R8LA 1MW2A 4O1BA 7CGTA 4ZVJA 4KWWA 4YPJA 3LCXA 1QPQA 2C0HA 3IGHX 3ELFA 1F07A 1M7XA 1IXNA 4BWLA 2QIIA 3TNOA 3U2EA 3EPMA 1G67A 1UR2A 1M53A 5ABTA 2QUVA 4IP7A 4F66A 3BAIA 4EKJA 1DIEA 2W79A 2GPTA 1UOKA 1UUQA 1TMLA 1ISYA 3E38A 1WKFA 3GVVA 4BY3A 3R8RA 2WHMA 2J24A 1AJ2A 3UWVA 3P14A 3M0YA 1JPMA 4OT7A 2YB1A 4QSFA 3VCCA 3T1GA 4KCVA 3KBJA 1WXZA 3NQMA 2DZVA 3TU9A 2GJXB 4W5UA 4GVGA 4F9DA 2VP8A 5C9ZA 5EMJA 4S2BA 3M46A 5D04C 1XFBA 2BXYA 1GGOA 1GOIA 1GVSA 2VRQA 1ZALA 3NL6A 4WIWA 1V8EA 4B15A 3UZZA 3AI0A 4GQGA 1SZEA 3RX4A 1XCXA 3GNNA 3SN1A 1Q6FA 1E0VA 3BURA 1XQKA 1JZ5A 3B06A 1JZ6A 4PTDA 1EX5A 3IGUA 2ZE3A 3EWYA 2A1YA 3S9IA 4ZQPA 4JQ2A 1EP1A 3FKRA 3IARA 2W9MA 4B3ZA 3QHOA 1ODUA 1BD0A 3TA9A 8XIMA 4HU0A 5EBAA 5K4ZA 3N9RA 4NJHA 3UR7A 1B3VA 1KLYA 1O5KA 1LTDA 1QI5A 2PDCA 3PBUA 4FR6A 1UR4A 4NYUA 1V79A 3GH4A 4MM1A 4RDWA 7PTDA 4LSBA 2FJKA 1VF8A 4F0MA 1GTEA 3LU2A 4C60A 2V3DA 2YL8A 5JH1A 1EJWC 3BOFA 4W93A 3OA5A 5JMUA 3NPXA 1FP8A 5I5RA 4AWSA 1B9BA 3TXZA 1KWKA 3OZMA 1H3GA 2FHBA 3GR4A 4OV9A 3V3WA 1GORA 1B31A 2E3ZA 1SO6A 3T0DA 4W4QA 3VGBA 5BROA 1WDQA 2PLMA 5D4YA 1QASA 2Y61A 2VEMA 3MC5A 3CO8A 5DBUA 3OLIA 2JALA 4YVPA 2OZTA 2GVJA 4MG4A 4DB7A 1W5PA 5CPNA 1XSIA 3A24A 3NM1A 1E4LA 1E9YB 3CQKA 3PN8A 4IGNA 1H7RA 1VC4A 4AIOA 1KFEA 2OLHA 4US6A 1A53A 3MKKA 2VM8A 5JVLA 3H4XA 1UP0A 1I60A 1OX4B 1XC4A 3L0NA 2D2OA 2E5CA 4R53A 4H9MA 4C7GA 3NQCA 3UVAA 2HVMA 3G1AA 3IIZA 4XD6A 4JAWA 5BMXA 3O0FA 4F0LA 3K46A 1E71M 2VELA 1WDPA 3HB9A 1ZBWA 3ARTA 2G50A 4QJ3B 3M41A 2PWHA 1G1YA 1OG6A 2XVGA 3WBYA 2CXEA 1QNQA 3EX2A 4DJFD 3GDLA 3M0KA 4ES4A 2Y88A 3D6NA 1YX1A 3DYPA 1BF6A 1EHNA 3R94A 4O15A 1OCJA 3C2RA 2J75A 3H2CA 3QY6A 2DIEA 2D24A 3QMTA 3EWCA 1EXPA 1GONA 3VDHA 3FS2A 3EPOA 3NPUA 3R5EA 1SFLA 2CLMA 3RU6A 1K1DA 4D8ZA 1BRLB 1XDJA 3IV8A 1AH4A 1WDSA 3P60A 1VLIA 4QG9A 1CLKA 1PO9A 3AYVA 4GJJA 2J7BA 5LIWX 3GH5A 1EO7A 1JNEA 2G0WA 2Y7FA 3TXVA 5A95A 1ZLPA 4CLMA 3EWZA 5GVJA 1QW7A 3GC5A 1SGJA 4KIRA 1K8XA 3PUGA 4G5DA 2NLIA 1P0NA 2DVUA 2QHAA 3DG7A 4GUGA 3QZAA 3UJFA 1M5WA 3CBWA 1Q6GA 1V6YA 3SCRA 5HJYA 5JQ9A 1MDLA 3APGA 5A6AA 2CKSA 3WLKX 3FA5A 1KTCA 1L6YA 3KWXA 2VR5A 3CLMA 3RR4A 4JPGA 1H62A 4BWLC 4AD2A 1SZNA 4K1WA 4G7EB 1KR1A 4N4QA 3LSCA 1WUFA 4O10A 2VUYA 1UWSA 2H8ZA 2F7FA 2VD9A 4QS5A 1VFSA 4WCJA 1PTDA 5A69A 3N2BA 3C2FA 3LI0A 3TR2A 1JR1A 5AYBA 3UWQA 4B5XA 1UD2A 2G4FA 3ITOA 2RGLA 2CFFA 1QFEA 3IWPA 1HKKA 3EDJA 1XM3A 2Z28A 3UZJA 2Q71A 4IIBA 4Z2GA 1ME8A 4C6DA 1UZHA 3NXLA 1UH4A 1GHRA 4LF2A 1H0GA 4FAMA 4DWSB 1XC6A 2WSKA 3NDZA 3ID7A 1K8YA 2PRMA 3UNTA 1DEDA 1XDMA 2GL5A 4MVAA 4XZBA 3V0UA 2QYGA 2WQPA 1S38A 4NKCA 4C5ZA 3ALFA 3GRIA 4M0XA 1NFPA 1OFBA 4N9BA 4L7ZA 3EOOA 1MW3A 4XZMX 1HF6A 3A47A 2GJRA 1TELA 2QF8A 1FY6A 2Q3OA 3L4UA 1QI4A 4X2PA 2Z24A 3UCDA 4MJ4A 4ZO6A 2Y7GA 1TSIA 1ZZMA 4KMQA 2F2KA 2V38A 3TSMA 1DWJM 3VZXA 1RBOB 1EB3A 3GTNA 3CWOX 2Y0FA 4QLLA 4RDZA 5CC6A 3ZVHA 2PDQA 4GFIA 4AMAA 5D38A 1WZAA 3PZTA 3AJXA 4DBSA 3AHTA 5HPCA 2YKKA 1HN1A 1ZAJA 4O12A 4O54A 3UZYA 2OQLA 4YN5A 3LPPA 1O1ZA 4ZZ9A 2QR6A 3PAOA 1R9ZA 2BV9A 5HWNA 3URNA 3GC2A 2OELA 3L68A 5JBFA 3FHAA 3E2QA 4M29A 5CQ1A 4JTCA 4F2BA 4QP0A 3E1F1 3M0MA 4GA8A 4WGHA 1NFGA 4CD7A 4YYFA 1DWFM 3G2GA 4K7YA 1XLCA 3MWAA 2J7CA 4WSKA 4MHBA 5TQLA 3TH6A 1RA0A 2Y8KA 3PBVA 1MWOA 1CPUA 1EC9A 4R7WA 2HBXA 3W7LA 1JDAA 4WK9A 2HNEA 2Y63A 1Y5XA 4DPQA 4UTWA 1KXHA 4MAZA 3MYPA 3KCOA 3QKZA 2Q6ZA 1QJWA 2NUYA 4HOXA 3B8TA 3W7MA 2J13A 3OP2A 3BVJA 2WSYA 3HF3A 4TTUA 1RLDA 2A3LA 5K3VA 3URQA 1UROA 3SUVA 4HOWA 4GVFA 3VCNA 2YFOA 2YCKX 1V6XA 4Y2WA 4M7SA 1LORA 3LLFA 2PDWA 3OTRA 1Z41A 5AYIA 1ZHAA 2NSXA 3S1WA 3CV1A 3EWUA 1CX9A 3UCCA 2UY3A 4XBJA 1Q6QA 3SBFA 4G56A 5FI8A 3NFUA 3NXFA 5CC5A 3B8VA 4GMEA 4JIRA 3WQEA 5HNRA 1FWHC 4IQEA 4IIGA 4PB4A 2GK1A 3CL7A 1IGWA 1XLIA 3G77A 1EBGA 1GEHA 3FYPA 3SRDA 3TYUA 3M0JA 2C8NA 3AMCA 1CXFA 1TE6A 3QW3A 1X6NA 1UOZA 3UBPC 5LXEA 3TLLA 3T08A 5A6BD 2EXOA 2JKAA 2Y7EA 2ACSA 1FWWA 7ODCA 4RZ5A 3OJGA 3DN5A 1OGGA 1WXYA 3FCPA 2V68A 1TJ2A 2W63A 4JTSA 1EHAA 3PR2A 3W7GA 4YMZA 3LHWA 3ENLA 4GX9A 3AIUA 4HTYA 3ICJA 3DH7A 1F5ZA 1TCMA 3G3MA 1RSCA 4R88A 3V4BA 3P5YA 1Q4WA 4IMAA 4AB4A 1IQ8A 2OZ0A 1TZ9A 2V5JA 2IQ0A 2Y8UA 4XSMA 3GDTA 4ALDA 1EOKA 3CV7A 3KBMA 2A4AA 5AC8A 4YNGA 3PJTA 3O6AA 3NCOA 3W7QA 1W9VA 4U5IA 5ECUA 3U5UA 2V30A 2OVLA 3LMYA 4LCSA 1UWQA 3U2CA 3UZWA 2CBVA 1XSKA 4WUIA 3GXMA 1JFXA 3N4FA 2ZUNA 5BOEA 2EJAA 3H4WA 3FX4A 3VIIA 4JGDA 3GNXA 1OCBA 1XIFA 2Y8VA 2PDNA 1W2VA 2PWDA 4LYRA 4JXCA 2D0HA 3STGA 2WVUA 2NV2A 2QF7A 2G3FA 3AZRA 2ABAA 4IX0A 2V5LA 1HKVA 5C71A 1GOKA 5JH2A 3W7OA 3IAPA 4E2VA 3CZJA 2P8CA 2FZ9A 1E5NA 4AZGA 2NZLA 3LNPA 4Z17A 3E0VA 2FTYA 2VOMA 4XD4A 4BEQA 4CQ8A 1F4HA 5C9XA 1US3A 2Y5JA 2FQIA 3TWBA 3BGJA 5F7UA 5E9XA 2A6NA 1TWIA 1O60A 5J5RA 4ZGYA 4BI7A 2POZA 2A3CA 4N2YA 3ABRA 4MB1A 2PDYA 4LY4A 4AYGA 4QS6A 5A6MA 1SMAA 2OEMA 5E6YA 3M9YA 4UR7A 4CNPA 1WUEA 1VGAA 1WDRA 3N3TA 3VIKA 1GYMA 4L80A 3TTSA 4GFSA 4JBRA 5FJIA 1OT2A 3RGTA 4D2JA 2PWFA 3H22A 4G6CA 3VPLA 3BMWA 2WZEA 3W1XA 4Z1BA 3IV3A 1JIBA 1QI2A 3GY1A 3W7JA 3FJ6A 3NQAA 5HJLA 3PSWA 2XPKA 3C0QA 1V6TA 4O8AA 4UR9A 2YZ5A 3N2OA 5IOBA 2X1UA 4DN1A 3UZXA 1AW2A 1YXDA 1QOXA 3JVAA 1R87A 3MSYA 5GJPA 4NJJA 1VBGA 4IX2A 5CH9A 3M7WA 1EWDA 1TWZA 5CGMA 3DERA 5DXXA 3S1XA 5E5CA 5DLCA 1OX6A 2UY5A 4U28A 1MW0A 3VD7A 4A8RA 4C6JA 4C7DA 5BU9A 3H2OA 1MO0A 3UETA 1FHDA 4NZFA 4A3QA 3AFBA 1MNZA 1LZOA 4H6RA 4RR4A 4X22A 3LG3A 1WB0A 3L4TA 3HG2A 4B5NA 4V1XA 5F4XA 2NT1A 3OGVA 1DJZA 3RDKA 3PFMA 4UTWC 3TMLA 4EPDC 2FVKA 3A4WA 3KAOA 3AIVA 3NDOA 4HP5A 3CAWA 2QDHA 1A5NC 3T0TA 3ZIZA 4JR5A 1BGAA 3W6YA 5CAKA 4O1FA 4Q4SA 4CQDA 3WD1A 2O7QA 2VEKA 4ZFCA 1EC7A 2IXVA 3TLQA 3RAOA 2B81A 3SCUA 4P5UA 3WELA 1FOBA 2POTA 5LGZA 4KEVA 3P0WA 2G3IA 3R0KA 3LRLA 3CO4A 3BG9A 4GQRA 3J7HA 4GY7A 4AY1A 1FWJC 2WCGA 3HQNA 2DEPA 2GK1B 1EPVA 2EHHA 5EFFA 3OODA 5FJJA 1SO4A 5FF3A 2AQWA 1F6YA 4XX6A 4AG0A 3G8EA 3CAKA 2VFFA 4S3AA 4AF0B 2GVLA 4C6PA 1M03A 3MW7A 3QYQA 4JCLA 3ZSTA 2CNCA 2VI0A 2Z6IA 3GW0A 1EJRC 3R1ZA 3WK3A 5HUPA 1AL7A 2R94A 2ZZ3A 3CUFA 4HCDA 1TZZA 3AQUA 3U0HA 4JTLA 3VNDA 1R38A 1JRCA 3VKDA 2FYMA 3OGSA 3ABQA 2ZUMA 3W82A 4BF7A 4S1FA 1JNDA 1LBMA 3M07A 1R2TA 3WQ5A 2E9LA 3UERA 2W66A 3W24A 3EMQA 4MWAA 1SFJA 3G1XA 4K6AA 4A8NA 2ZDSA 1ZGDA 4H6EA 4MFDA 4I7UA 2PWGA 3II1A 1FHVA 3AXXA 3WMSA 2F61A 4M5PA 4E6MA 3CMFA 2Z00A 5FJOA 3TYBA 3ATZA 3GU9A 1DXEA 5B7YA 2XJ7A 5BNKA 3R7MA 2VHLA 1RJPA 4IMEA 4U33A 2WJFA 1MFUA 4S38A 3GWQA 5I2UA 4ORIA 3W88A 3CEUA 3CEPA 3EDDA 4CQAA 3T0AA 2I17A 1Q4NX 2E9BA 3WLPA 3FOKA 3VD5A 1KGWA 2QGHA 1WKDA 3ITCA 1UKQA 3FAWA 5F1VA 4DAFA 1JL8A 3PWAA 3FKKA 5CPQA 1JI2A 2B7QA 1O68A 4TX9A 4R27A 4QFUA 1W37A 2VX7A 1A4LA 3PB0A 4I6KA 3VNYA 3WLRA 4PFHA 4Q4KA 5IXEA 3ARWA 1VFFA 4RE2A 2D1ZA 2PUZA 4UFMA 4Q8QA 4BQ3A 5PTDA 5FESA 3ZOAA 2V8ZA 3BGAA 3M47A 4EWJA 3TZFA 1LLOA 3AHYA 4CQBA 1CGUA 2YCLA 4B9ZA 3E0WA 2QCEA 2XIMA 3GC4A 3P61A 1HVQA 3W7RA 3MUZ1 3MJYA 1DWAM 3REQB 4E4FA 2XN1A 2YJQA 2GJPA 3BCDA 1DBTA 4MLJA 2P10A 1XIIA 4FALA 2RJHA 1WPCA 4UNLA 1YHTA 3AU2A 2J8FA 4J35A 3ABZA 4PRTA 4R85A 1E6QM 3BK0A 1F7BA 3UY7A 5LXXA 2D2JA 2ZQ0A 4TU1A 4H7VA 2ZCGA 3W29A 3HURA 2ZZ5A 4Y9OA 3GXFA 1OD8A 4NI3A 4I9TA 4IWWA 1GNXA 2Q01A 4K8GA 5D32A 3ANVA 2VMFA 1PL9A 1W32A 1UD3A 2O4QA 2QJHA 1S2CA 3GIYA 4TMBA 3QVQA 3CZ8A 3EGJA 4ADSA 4DLMA 3W1NA 2JF7A 3OYZA 4PA8A 1DJHA 3ZVIA 3ZR6A 4J40A 4A2RA 1T8XA 1EP3A 1BEUA 4JNZA 3A4XA 5DT5A 4E8CA 2OZ8A 4FZIA 5REQB 4RW3A 2AKMA 1I1XA 4HMDA 4J3VA 1TYGA 4XO7A 1XIDA 1UKTA 1PTAA 2AL1A 3WK2A 8TIMA 3U3HA 1YBQA 3UR2A 1HJWA 3E3HA 5CGQA 5CC7A 4LALA 1J2WA 3W01A 2TMDA 5FL1A 4RNIA 4RV8A 3SM0A 4MNKA 4IFOA 2EBNA 5EKYA 3A64A 1JUKA 1Q6RA 1R7AA 1ZCOA 4O53A 4HKPA 2O92A 1Z7AA 2OKTA 4Q7IA 1D9EA 1IEIA 4AZIA 1MZRA 2PU1A 3UR8A 2Q02A 1VBRA 2VCBA 4GBDA 3IUHA 3LTYA 4HTBA 3ZLHA 1TO3A 3S1VA 3C3UA 3T6CA 3R8GA 1MSSA 4NZ3A 2VDGA 2WC7A 1YLVA 4GCXA 4O4WA 4X0VA 4NAFB 3UJ2A 1YEYA 5AHNA 3WLSA 2ICSA 1RQEA 1YTKA 1CI1A 1V08A 3M0HA 3ZQ9A 1UD6A 3ITYA 5AOUA 4ILSA 2ZZ6A 3CT7A 4CCEA 4GC4A 5J5DA 3SQSA 1KBIA 1R5YA 3TYZA 4LGXA 3MP4A 5HA7A 3MKVA 1NJJA 4OUIA 2OYMA 3PFRA 3U48A 4AQLA 3PNZA 4LC8A 5FF4A 4D6DA 4HYVA 2A79A 1P4CA 3YPIA 4IPNB 4HZ8A 3FXGA 3T0BA 4DWSD 4XAYA 2RJGA 2A6LA 3TP4A 2HZGA 1MUWA 1A5AA 3KDOA 2HCVA 2TPSA 3GFXA 2O55A 4GRSA 2BVTA 4C5YA 2OTDA 3GUWA 1OADA 1M04A 2PFHA 3B8DA 5G5IA 5A8MA 1R9YA 3B4YA 4ZOEA 3WLIA 5HMSA 3TQVA 4FSAA 1TTIA 2DH3A 1KO0A 4HA1A 4DYJA 3SQMA 2IXUA 1C8XA 5D9PA 5CZTA 1QI3A 1EJSC 4XTIA 1JD9A 5BRPA 4UXDA 3AO0A 4KH2A 3S42A 4HNVA 1PX8A 4MWAC 3WG6A 2NT0A 3VKAA 3GLCA 3WH9A 3RRXA 1ISWA 1VLWA 1TPH1 3GXTA 2NXHA 1EIBA 1AD1A 2XH4A 2D0GA 4IISA 3P2VA 5A8NA 1F9CA 2V6AA 4ASTA 4QNEA 1GT8A 1FWGC 4FNUA 2VX5A 3V16A 4LYQA 3TVAA 1X7FA 3KZSA 3S8HA 1GQLA 3OIXA 4PBFA 4GUIA 3GDKA 3R25A 2DZXA 1DIDA 2YL9A 2WHLA 3DFNA 4LNCA 3GU2A 4CKQA 3LQGA 3OO2A 3TJLA 3RO8A 5A94A 4MPQA 1QPKA 2BVYA 3GAKA 2HVOA 5CZJA 3TFCA 3VO0A 3GH7A 3G1YA 3TN5A 9CGTA 4WKHA 2BSLA 2X1TA 4UQEA 1K9FA 4LX4A 2JKPA 3NSMA 5F1UA 4ML9A 3WJSA 2JF6A 2HBVA 5I3KA 3GR7A 5I3FA 3UXLA 4CD6A 1FBAA 3RIKA 2AQOA 1WNOA 3RX2A 2DP3A 5LNUA 4FNPA 4HNUA 2BY0A 4IUOA 2DVTA 5KITA 4CN4A 2VGIA 2CWXA 2QIWA 4R7JA 4OVXA 1EPXA 3PHAA 4JTKA 1X1ZA 3TSBA 4H9XA 5M2FX 4WVXA 1SR9A 3R6IA 2GZXA 4HN8A 3PS7A 4LV9A 3VZZA 1ADOA 3W74A 2HNHA 2NSOA 4NXSA 2WW5A 1VCFA 1F8MA 3MT1A 4TR9A 5I0DA 3E5BA 4O17A 3VNKA 1OC5A 4AHQA 3LQLA 1PIGA 1JUBA 3CGTA 1YDVA 2YDRA 1JG9A 5GPRA 1V3IA 1KV8A 5LGXA 1X1OA 2CBUA 2B7OA 4QCEA 2PDPA 1BFNA 1XICA 2WC4A 1J12A 4NY2A 4KEUA 4TX6A 3U7VA 2J7HA 4AIUA 4FEZA 1CYGA 1XYMA 2C7FA 3O7UA 1SMDA 3BTNA 3AU6A 5FACA 3ONCA 3PPCA 1HL9A 3RJXA 3WDPP 5HMFA 2QDDA 3RCMA 2PZ0A 2I5GA 1C92A 1NF0A 1UB3A 4GIYA 3T44A 2DT0A 3SRKA 3FDKA 1TTPA 3WENA 2P0IA 1R3VA 3ZWTA 3B9OA 5HJXA 2ZVIA 1HGYA 3PJUA 2YL6A 3NUKA 1AMYA 4EIVA 1O4UA 5FSEC 4BF5A 3VINA 3BARA 3VDAA 4O11A 2OFJA 1F61A 3K8KA 1MW1A 2WVVB 3QOMA 1D3GA 1TVPA 4REQB 1HL8A 1XLEA 5DXYA 2X2YA 4CUCA 1LUCA 3TDFA 2EG7A 1MRAA 4XZLX 4GQBA 2PCQA 3BG5A 5D9OA 2F9RA 4AXKA 2X0YA 2QCHA 2WYSA 3FNDA 1VR6A 1VIZA 3B9AA 3VTRA 3W1UA 1Z8AA 4PMYA 1Q45A 3G1VA 4N9EA 3QGKC 2PAJA 3MANA 1JGIA 4NXKA 3S2MA 3GS6A 4W86A 1I45A 4IF2A 4QLJA 4BEUA 3W1QA 5HQMA 4JY9A 2VCAA 4JS3A 4Q8MA 2BGQA 1E0UA 1VCVA 2ISSA 1LBLA 1E72M 1IIGA 2I14A 1S46A 1HJXA 2A21A 3VDCA 1VYRA 4QISA 1G69A 3GNOA 2PPGA 1DWHM 5DBTA 3WCZA 1XLHA 4JFUA 4IL0A 4S3KA 2QGYA 3EOEA 4V15A 1K7EA 4O1AA 4DPPA 5I06A 3CNYA 3MWCA 3M7SA 3RN6A 1UH2A 4JTEA 4D1JA 3JZEA 5KSWA 1YNYA 3LLDA 3LTSA 2XG9A 2YW4A 3V0SA 3KFTA 5HR6A 4MADA 3VM7A 1GJUA 1E6NA 4BJHA 3O15A 5KEZA 4HPGA 1V6VA 3W70A 2Z4GA 3IJ7A 8RUCA 5TF0A 4E2DA 2E09A 1LG2A 4ZBCA 3S6TA 2B7NA 5CSYA 2DT1A 3CL8A 5K4XA 1CXEA 3BAWA 1G7UA 1PUDA 3NR0A 3UCQA 1Y65A 2RHGA 1W1IE 1VBUA 3MCNA 3COTA 3VKBA 2G3MA 2XUCA 3CPRA 3WDHA 3TA6A 1DQWA 2ACRA 5CKSA 2G37A 1KFWA 3P82A 3JUGA 2BASA 4IXXA 2CZFA 5C5YA 4WY0F 4H7ZA 3INPA 1JZ4A 3ARZA 4XZIA 1JPHA 2BXZA 1DPMA 2OMAA 2F38A 1NELA 5M1TA 4J3UA 3VNJA 2Y2WA 1RAKA 5BU6A 1J10A 1W8SA 7A3HA 4PR4A 3NO3A 3UA4A 4PE8A 1RLCL 5HNNA 4DEFA 1CLXA 2RDTA 3N11A 3CZEA 2XFFA 1SYTA 1M41A 3PSVA 1DJGA 3DENA 3M5YA 2NUXA 3HG5A 3M6YA 2ZXQA 4R5EA 1TPEA 3WQOA 5A8PA 4NI8A 3HJZA 3CIXA 4A6GA 3WL1A 4IQJA 5L6UA 3QQWA 3D3AA 1A80A 1F3WA 1I4NA 5C9WA 1Y5WA 1FCUA 2HISA 4XVEA 7TIMA 5KINA 3WNPA 2Z1WA 1TRIA 1DHPA 1VPXA 3W72A 2PWVA 2V2DA 2GVGA 3QY8A 4IIEA 2Y1HA 1AUSL 1QR7A 3FYYA 1AZ1A 3LCWA 4WF7A 1VD6A 4MLRA 1CW2A 3G1FA 1OGSA 1SQ7A 1UR1A 3V5CA 5HOSA 3GG8A 3KOXA 1RH9A 3GDMA 2E25A 3W85A 3QZEA 1EDQA 5MKGB 1RK5A 3WLHA 4U4MA 3PP7A 1XLKA 3GTHA 2WPGA 4QXIA 1RK6A 1UUOA 2FGBA 3BSGA 3ECQA 3TTOA 3SFWA 2DZWA 3MYOA 3LPFA 3F2DA 3UXDA 3V36A 4BQ4A 4L9YA 5C7VA 4HA4A 1J93A 1PVNA 4HJWA 3H2MA 3MHFA 5H8UA 5FF0A 1XW8A 4QE4A 1CLVA 4RKAA 3PWIA 2VQTA 2CPUA 2OWCA 5EL1A 1WX0A 3SRHA 5AB3A 3WD4A 3U2OA 2NVDA 1JZ8A 2R1NA 1ZTVA 3PZVA 3FFSA 4O1CA 1M68A 3SR7A 1JD7A 1NY1A 3FJNA 1R2SA 3W83A 4NHVA 1E70M 5G1MA 3F4VA 3VXGA 4JHZA 3RG6A 2RH9A 3H7RA 2Z29A 4K8EA 1RPXA 2CLEA 1TVLA 3L2IA 4FNQA 1F73A 5XIMA 1AD4A 4A29A 2ACQA 1CGYA 1M01A 3E0IA 5K9DA 1R3RA 1V03A 2CWNA 1IZKA 2WMIA 1GZGA 4AWTA 5AZ1A 4B5TA 3N1AA 2KAUC 2OX4A 5DCBA 4AUBA 3VGFA 1QOPA 2XU2A 1P6WA 2JKEA 4ZQNA 3BWWA 3R0UA 4RPPA 5C2GA 4IT1A 4L65A 4D1IA 1KFCA 1HO1A 4GJ1A 1UQZA 4HA3A 5JIPA 4LFYA 3FHQA 4XZHA 4IL2A 3DYMA 2ABBA 5DCDA 3WDIA 4JEQA 4JFWA 1NWUA 3HGSA 3OVRA 2R9RA 1E9IA 4PB5A 1XBZA 1E1CB 3P93A 4XAPA 1UH3A 2FLIA 4EX4A 3LCHA 3ZJ6A 4HMEA 2Y62A 2IKJA 1QO2A 3WLMA 3VNIA 3UF9A 4TOQA 1W31A 4U2YA 2Z27A 1XBYA 3AIEA 2ZIDA 4HNNA 4HNTA 2J7GA 2PLKA 2ZZ7A 4QDPA 1UR8A 2QXWA 1T0OA 4GC3A 1E9LA 3HQ1A 2NXGA 4V33A 3TCSA 4LUIA 1ZJIA 4LWWA 4U3AA 3B4UA 1TUXA 5FCZA 4GISA 4JDBA 4IG2A 1W9UA 3EDFA 4EANA 3VGHA 1QTWA 1EDTA 3E2SA 3V7PA 2BHYA 5D03A 2CZDA 4PTVA 4PMVA 3LGGA 4Q22A 1PB0A 3S2JA 1HKJA 1JF6A 4BZYA 3KW3A 2DT2A 2UWFA 3GXNA 4FXJA 2C71A 2FDMA 3ME3A 3OZYA 4UFJA 1C9DA 3B0YA 4S23A 4OFCA 3WUBA 5HULA 1CNVA 3NA8A 1ICPA 4Z1DA 4ZQCA 3ABSA 1GVQA 1VRXA 1VHNA 3KVJA 2WCSA 4ZTYA 4UOZA 3HU7A 3WLQA 1KW1A 2GGGA 2HJPA 1B3XA 2QUNA 1GOQA 3IK4A 4KBXA 4D9PA 3AWOA 2JGYA 1A50A 4ERGA 3F4DA 3L23A 3NQDA 2YDSA 1BQGA 1MMFA 3CASA 1PXGA 3UG8A 3F2CA 1SZFA 2BODX 1PKNA 2NW0A 3WBAA 3SO7A 3LB0A 1QNRA 1FH8A 4M3PA 3WLTA 1ZBCA 3NOEA 3AAMA 3NPWA 1VAHA 1BWVA 3PB2A 3FJ4A 3N15A 1H2JA 3MUY1 4IGMA 4I5RA 3UWZA 4XAGA 5CC3A 3VMOA 2PDIA 3VDGA 2GSEA 3GBDA 1MQQA 2J78A 3KL5A 1E15A 5ECVA 4PULA 3CIWA 3LV6A 2XFRA 3WQGA 1FKXA 2QCDA 1U5JA 2VDHA 1IR1A 5HXMA 1KRBC 4BA0A 3M0IA 1KM2A 4Y6GA 3GE7A 4UFKA 1TUFA 4EF9A 3SY8A 3VIMA 4TX8A 1JF5A 1KCLA 3TOYA 3WD3A 4GKTA 2XM2A 4KF1A 2GQ8A 4JDYA 3ZFHA 3P81A 3R0DA 4A3YA 5BRQA 4Y8FA 2X0SA 4LOCA 2WNNA 3JW7A 4MZYA 4I5UA 4O0ZA 3F4NA 4YU1A 4NNCA 4S3CA 5I7GA 3IJ8A 4PMUA 3VIPA 1YYAA 1VIWA 2ZADA 2CZVA 1S2VA 2J6VA 1X6UA 4Q7BA 3ES7A 4E5TA 1T7LA 5A6TC 1FDYA 2BFGA 2DDXA 3UW6A 3PY2A 3KZPA 3W7IA 3HFTA 3OLEA 4TVCA 4CQ9A 2I1OA 5A8OA 2YBUA 3R4IA 2WMGA 5C6MA 3NQEA 4J3SA 5TBOA 3IRSA 2OG9A 1K6WA 1XRVA 4ML4A 3RUBL 4FNTA 1WV2A 4GHRA 3PZ9A 2YL5A 1CCWB 3VD3A 3SN4A 4RDYA 4RZBA 5EYWA 2DW7A 2P76A 3WDJA 3VAVA 3MUCA 3SJNA 1N55A 4NJKA 2EPNA 2I7GA 3KVKA 4DVOA 4I7VA 2DQXA 1KR0A 1BPLB 3BW3A 1JAKA 4LS0A 2J79A 2REQA 3UR5A 4KRZA 3CZKA 3QGAC 3SCQA 3NTYA 1O5XA 3DOPA 1BVNP 3CB3A 1DP0A 3DBNA 4CEUC 3K30A 3B04A 3RXZA 3NDYA 2ISDA 1V4YA 1N7KA 1L9WA 2CITA 1QPNA 2AGKA 5A2BA 3U2ZA 4CU6A 4NU7A 3FVMA 2DH2A 3QQ1A 4L61A 4K68A 4Y9NA 3AIRA 2J9YA 2PODA 1JCMP 5FJRA 2V2HA 1LWIA 3KBVA 4ZL1A 1JZ7A 5IDZA 1KM4A 2A3BA 3I68A 1KA9F 2XHYA 4WR3A 5C2CA 3AJ7A 4QG8A 1HQTA 4URIA 3OBAA 1CGXA 3C2VA 4FO4A 4FMVA 1QNVA 2DSWA 4XKYA 3FEMA 1UR9A 1SVDA 1ESWA 1HO4A 3GUGA 2ZWZA 4PN2A 6A3HA 3W7KA 5A6BA 3GX9A 4WXYA 2ZX8A 3OEXA 1HX0A 3SEPA 4HK6A 2YYTA 5E93A 1QPOA 1U5VA 4F0KA 4JTJA 5HDRA 3W76A 1DJIA 2VWSA 4L4OA 3UPBA 1XLMA 5DFAA 2ZXDA 3N4AA 1M7PA 3PC0A 4KETA 1VPYA 3N34A 3F03K 6TIMA 4OHQA 5K9XA 3WLLA 2PGWA 1YDYA 1HKWA 1OFAA 2DPEA 5HQLA 1LL6A 4GQ0A 5DT7A 3WQCA 4CNNA 2XSXA 2D3NA 3LZ5A 1R3YA 2QS8A 2VVSA 2PEVA 3NJ3A 1EJ7L 1JQXA 3SN0A 1HL2A 4KESA 4QDWA 6CGTA 1M1BA 3FSTA 4GO9A 1P1MA 3CC1A 2C3ZA 3SCWA 2RFGA 2SFPA 3F5LA 3VD4A 1H11A 2XIIA 3VOJA 3RPTA 3L67A 1H41A 3EX6A 1X38A 3AYSA 3KUMA 3SSZA 2CYGA 3DKJA 4C6BA 4KRTA 3N6JA 1W1VA 1NU5A 4QM1A 4P8XA 3WQWA 3FVDA 4FF7A 3W7HA 4HU4A 4XBKA 1B54A 4PC8A 1UKOA 4PRWA 4QJ1A 4WSHA 4BCEA 1OT1A 3SGGA 4XUGA 1AW1A 1MXGA 1E1EA 3BV4A 2VGFA 2X16A 3H7UA 3UZ5A 1TV5A 1PZ3A 1Z6KA 4UQ9A 3IJ9A 3TMQA 3S6DA 3BUVA 1AH3A 5FAJA 2R1LA 4PUDA 3MMTA 3MVIA 2WWCA 1ONXA 5CCZA 2DSZA 2IQTA 4DYKA 2QCDB 1ZRQA 2PE4A 4PUWA 4ZCWA 3L5AA 6XIMA 3O6DA 3AOFA 1XLJA 4Q4OA 1B4KA 3R2GA 3TW7A 3FEQA 4B5SA 3AMDA 3MUXA 1S2TA 3DG3A 3B8SA 3SCSA 4TVUA 1JYNA 4YIWA 5DRCA 3PZIA 3UD6A 2QV4A 3RMEA 3W1TA 1CECA 1E56A 1B4EA 3T7VA 1WO2A 1MDRA 1RUSA 1TR1A 1R46A 1B3YA 1Q13A 1A3HA 2FPYA 3IGXA 1AH0A 2XM1A 5CSUA 1EQPA 5D9MA 4E8DA 1A5KC 2D20A 3H6OA 4PBGA 4D8LA 1D7KA 4NZ4A 3KLLA 5DMMA 3ALGA 2PDBA 1HUVA 1E6ZA 3A3WA 4A8LA 1KKRA 3U57A 2NWRA 2A7NA 1MVYA 2ALRA 1ADDA 1F05A 2WNZA 1XIGA 1VS1A 2PTWA 2OJPA 1QHZA 4PYSA 5JIWA 1B9ZA 3FDGA 2WZHA 3OHIA 4LVAA 3TYDA 3CL6A 3GG7A 2HPMA 1TE1A 3WMLA 1JCYA 3B8WA 4L4PA 4UWMA 2ISFA 4EXBA 1JXKA 2WLZA 3VC6A 1P7TB 1RXOB 2BOEX 3TONA 2ZVRA 2WSPA 3R79A 3QPYA 1ZFJA 1VB9A 2C1IA 1RP9A 4K2SA 4UTHA 1DWGM 3M0LA 1NF7A 1WXJA 1RV8A 4O0KA 4RZ6A 4XK2A 1ZBVA 3CV2A 4PMXA 4KEMA 2H9AA 2PRHA 2BNJA 3KL3A 2W4XA 1HXJA 4A21A 1PCWA 3H24A 3W02A 1QW9A 2YB4A 4RE3A 2TODA 3WLJA 3UWUA 3ZLGA 3MPGA 3FJLA 3IJDA 3PUDA 3SGUA 1R85A 3N2CA 4I8DA 1SU5A 3LCIA 4QE1A 2B0MA 3GKFA 3I6TA 4GIEA 1XH2A 4L4MA 3T42A 1K9EA 1A0DA 4F4RA 1VRDA 4JEJA 4K36A 3SCVA 4J4KA 1DIKA 3DI1A 4JQ3A 1OCNA 2WJEA 3T2QA 4WOQA 1FXPA 1TB3A 4Q33A 4HSHA 3V1HA 4Z42C 3CM4A 4GK8A 4JZ5A 2G41A 2WB5A 3LPGA 1ENUA 2ZRZA 3AMLA 4FXFA 5KTLA 1OGBA 1OFDA 2XVLA 1HNYA 3DHFA 4W7UA 3R13A 4C6MA 2V3EA 3E2RA 1LJYA 1G9HA 1YW1A 3QFEA 4F79A 4ORMA 4LPCA 2VZOA 1Q2SA 4QR6A 1GKPA 2FVMA 4CNUA 1X39A 2PDLA 4RE4A 4D6JA 4AD5A 4R7OA 2RDWA 4FX8A 3OLDA 9XIMA 3P62A 3V0TA 4RCXA 3WY1A 3B97A 1L2UA 2AMXA 4LBSA 2JIEA 3LM3A 3MVTA 4K8HA 5U7SA 3LHYA 3EEZA 4PUJA 2YA1A 4JKKA 3KTXA 3LRKA 4LAUA 1UP3A 1JPKA 4DBWA 2XVKA 4JTGA 3RNDA 4JQ4A 2C16A 5LIXX 3DKLA 1OFQA 4ZXOA 3OVQA 4TIMA 2VURA 4MKNA 1ME7A 2HMCA 1WZMA 2ZA2A 2ZWYA 3W2KA 4UR8A 3K1DA 3GXIA 1OD0A 4M81A 3SUWA 2YCEA 4WKAA 4HT3A 3BC9A 4L4LA 1TPUA 4XV0A 4Y8EA 4QITA 1L6GA 3AS3A 4RPQA 1PWLA 2NQJA 3H54A 5FIPA 3E74A 4I3GA 3B9NA 3WUFA 4AX6A 3VIGA 1XH1A 4NT0A 5MHBA 1Q6LA 4OGZA 2D2HA 5AN7A 3UPWA 4MDPA 3VCRA 2FIQA 1O5QA 3VE7A 2ALDA 1A5CA 1J0YA 3OZPA 4PGLA 2XINA 2J9XA 1P48A 1QNPA 4A3HA 1GG1A 4XD3A 3RM9A 4OBTA 4E2OA 1LF1A 2DUZA 3HG3A 2VZUA 3WNKA 2H3BA 4JNMA 4KWUA 1F6KA 2QPUA 4U31A 8A3HA 4C90A 2OO0A 3PBMA 5H6HA 3WEOA 1WZLA 4UTFA 4FHAA 4JYFA 1LQ0A 4P8VA 1X1NA 3GHSA 2XGIA 3PZQA 3G6MA 2PTDA 3I4KA 1QATA 2ZRWA 3CMGA 4LCQA 4P7NA 2ZXAA 1VEPA 4P8WA 4F40A 5C70A 2XIOA 1CENA 3TN6A 3DGBA 4DO6A 1JDFA 1OCQA 3QMSA 3H2EA 2PGEA 3W1LA 2DFAA 1LWJA 4O1EA 5A1AA 1OX4A 1GYNA 3TZNA 5BYWA 1JI1A 1OFOA 1L6SA 4HHMA 2RAGA 3IJIA 2E68A 3HGRA 4PEEA 3GNDA 4IPIA 1UJPA 2QJMA 4ATLA 2J66A 1FWDC 1NDWA 3WNLA 2WXDM 1SSDA 4FNSA 1HTIA 2Z1KA 7REQB 4Y9PA 1Y8BA 3SIZA 1VHCA 3WNOA 3LV5A 1M65A 4CCZA 3BOLA 3UJEA 3L2LA 1EWEA 1FCBA 3ERPA 1M6JA 4GX8A 3C3NA 2HXTA 2NQ5A 5D30A 3IIOA 5EA9A 3P8IA 1KXQA 1QHOA 1BRLA 2OLSA 3OOQA 3UJRA 4WDWA 3WIJA 2FVLA 4J1OA 4ACZB 4XTDA 3FY1A 1XGDA 2E7FA 1K4GA 1CT5A 2NXIA 4X2RA 2MNRA 1XLBA 3NZQA 1KB3A 1VJZA 4IMCA 3O05A 3W37A 4C6NA 1Y5VA 2W91A 1PKLA 5HINA 3E49A 1OBAA 1OFEA 3E96A 1XYCA 2Q8XA 1GQIA 3W3OA 5JUVA 4CCCA 4N02A 3CHEA 4MYXA 3MI6A 3TWAA 1LQAA 2OXNA 1I2PA 5ABFB 5I02A 1V6WA 3VD9A 5CLWA 2Z6JA 3FIGA 1J2BA 1XBVA 3BXWA 4H19A 1JQVA 2DSKA 1SFSA 3MMUA 2J77A 4G7EA 1V7AA 1UD4A 4F2TA 3M0ZA 5A3HA 2I5QA 4GD0A 3KDNA 1R2RA 1YPXA 3R12A 4RUBA 4MIMA 3M0XA 2DY3A 2X1IA 1IYXA 1KCXA 4HPJA 2OGYA 3BLFA 3NPVA 2ONEA 1BG9A 1VFMA 1S2UA 2V81A 1V3JA 1GW9A 2QCLA 2VGGA 5M17A 1A5MC 3LXCA 1M7OA 3LLXA 1AZ2A 4DWSA 3AISA 2I9UA 3H26A 2XIBA 4WX2A 4IM4A 2V63A 4FOJA 2Z7KA 2R14A 2HPIA 1CBGA 3ITVA 3W7PA 1THFD 2JIWA 5GJMA 4JTUA 5FAGA 3WO8A 1XLGA 3UU0A 4M7TA 3EKGA 3W07A 4R33A 2HEJA 4Y90A 4DHGA 3UESA 3VGDA 2Z0IA 4EP8C 4CD8A 2OSXA 3L9CA 1HP5A 4MB4A 2WANA 2P3EA 3M64A 1F76A 4ZE5A 1D8WA 2BOFX 1B90A 3V18A 2GQ3A 4E3VA 1V02E 2OLAA 6ENLA 2VC6A 1RCQA 5DO8A 3MY9A 4GH3A 3C2OA 5CSSA 3H7VA 1ELSA 1RR2A 3W26A 1H0IA 3L5LA 4UBPC 3O1NA 4JIIX 2C14A 2VZSA 4UTJA 3ZLFA 4JX5A 3KRBA 1RALA 2XIQA 3KXQA 4K37A 4JTFA 1XXXA 3BICA 1K7FA 2G96A 3OQEA 4OTKA 1LWHA 4OBSA 4A3UA 4ZOCA 2DZSA 1VFOA 1KCZA 1XUZA 3EWWA 2V5CA 3NWRA 3EB3A 4P7LA 3GU1A 5HBFA 1SSGA 3AIQA 4KCWA 1ISVA 2FZBA 2YIHA 4D6GA 3I7RA 4J27A 1S1RA 1YQ2A 1JYXA 4WJXA 3W2LA 3K8MA 1WCGA 4TVDA 1X97A 1XYBA 1DXIA 1AQMA 3ISIX 2PF0A 2QJGA 4QLKA 2HWGA 3EYPA 3B3DA 4B5WA 3HGJA 1A5UA 4Q6JA 1ECQA 2E5DA 3CXOA 3UWYA 2O7SA 3NURA 2DZBA 1W3KA 4OV4A 4P7RA 4FLRA 3VM5A 4UTMA 4FLOA 5DMYA 1OK4A 4UOQA 3GBEA 1AJZA 4P7OA 3MP3A 3F1QA 5G2WA 4J3XA 3URBA 5FSDC 2UBPC 1AW5A 3W73A 3E12A 1GOOA 4PB3A 3I6EA 2NX9A 3UYIA 4GNJA 3GD6A 5HK4A 3CUZA 3NGFA 4UNKA 4I5XA 5KMYA 3E02A 1XKYA 4GGHA 1UBPC 1P43A 3KRSA 5IFTA 4UFIA 1EQCA 5JU6A 1IT8A 4KIEA 4C6OA 2CEQA 1EDGA 3HV9A 2D3LA 4PMJA 2ZKMX 4AXNA 1W5MA 3AYTA 3EX1A 1KC7A 2O9TA 2CBIA 2QT3A 1NWSA 4QGCA 1LL7A 1Y7VA 2V0TA 5TAOA 6REQB 1IR2A 5CPMA 3Q58A 4DO7A 1E6PA 2J88A 3DGRA 4Y96A 1CB2A 1TV2A 1UC4A 5IBXA 1QAPA 4FPSA 5EB8A 4YTSA 1RD5A 1W1YA 4ZSUA 2DIJA 3HG4A 2YSWA 2NQLA 3EOSA 4HMCA 2HK0A 4AVOA 1QNSA 4IJBA 3BAKA 2A3HA 5D02A 2BMBA 4A2SA 2CETA 4GNVA 1A4MA 4U2ZA 3QR3A 2PDJA 2F6UA 3VX1A 3K1GA 1W1TA 1AQ0A 2NLYA 5D33A 3KHDA 4HA0A 4L1XA 1BTMA 3S5YA 2Z2AA 3RM8A 2WAGA 2YLAA 1WKYA 2XYLA 3VOIA 4D71A 2YDAA 3OG3A 1FWCC 1BKHA 2YDQA 3BAYA 1X8CA 3APYA 3I65A 2GVEA 1CXKA 4DXKA 3MS8A 3ARUA 3DC0A 1REQB 1E40A 2CLOA 4BR1A 3K5XA 1LRTA 3MV01 1VJSA 3CB8A 1I0DA 4L1GA 5GJNA 3PAJA 1VEMA 1TQJA 1EL3A 2H90A 1TCDA 1Z69A 3HZ3A 4F8XA 1TV8A 1UMLA 1DV7A 1PTGA 3N3MA 3R89A 3C61A 1QK0A 2J7EA 4Z0SA 3RHGA 1UHVA 1J0ZA 2RGMA 3WFZA 1US2A 1QU4A 3W1AA 4DWSC 4LU0A 3B0XA 4BHYA 1B30A 4MPKA 2HK1A 3N2TA 1OK6A 4FR1A 2ZZ2A 4DUOA 4PMNA 4V1YA 1K7XA 4M6QA 3UY8A 1UP2A 2PDFA 3WL0A 4ZQMA 4MNMA 1EEPA 4Z2HA 1SW7A 1VKFA 2AQVA 4G2DA 4Q4MA 3W7EA 4ATDA 2W92A 3GIQA 3S5NA 1DJWA 3G1SA 3LDVA 3PPHA 2WMKA 1RPKA 2X7VA 1PDZA 4LANA 3C5QA 5H91A 1OB0A 5LNWA 1KFKA 4YTQA 4PRRA 2FTPA 3AHVA 2J7FA 1XLLA 3C2YA 3H70A 3NZGA 4JTQA 4NZCA 4LS2A 3W6MA 3UG3A 4KWSA 3DG6A 3R43A 3JU2A 1UR0A 4P2VA 4MZ8A 3LUTA 3IIPA 1OF8A 2HQAA 3N2MA 1V7YA 4KCUA 4J28A 4LW7A 5DF0A 3WQDA 1LBFA 4DXXA 3H55A 2FB3A 1VCGA 1F2JA 1J5TA 3UGVA 4CCDA 1NDVA 1U83A 5AVNA 2W5FA 3SECA 3G22A 1BG4A 4WZHA 3V75A 3ITXA 4NIRA 2FZ8A 2GQAA 3BZGA 3LEPA 1JYVA 2FZNA 2X41A 2R82A 4AWUA 1RY0A 4D6IA 1XF0A 3GDBA 3CAVA 4GXWA 1E5JA 3C0SA 5EGRA 1D3HA 1NH6A 2HS8A 1QWGA 1CEOA 3VI2A 2CESA 1XV8A 1DWIM 3LBCA 1MXDA 4XD5A 3PF3A 3SCNA 4QJ4B 1P5BA 4FIRA 3DX5A 1K70A 2OWWA