1TWHH

Rna polymerase ii complexed with 2'datp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
molecule tags Transcription
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 19
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twhH00
2MO0A 3FP9A 5C3EH 3H3VH 4C3HH 1YBYA 1G51A 5IYBH 1SLJA 4HJ9A 1VQCA 1TWAH 3HOXG 2JA7G 4GKJQ 1VQLA 2FXQA 1B8AA 1X6OA 2WAQG 3U50C 3CMEA 4JYAQ 3PUZA 1VQMA 2JA5H 3CQZH 3T1HQ 3SGIA 1PHJA 2MQHA 4TQUS 1IBMQ 3M9BA 1OXTA 1Y1WH 2YYZA 5AJ3L 4KI0A 1NMFA 2JQOA 4ME3A 4JI2Q 1W2BA 4JC0A 1HNWQ 2PQAA 4A3JG 1HNXL 2E2JH 2UUBQ 2ZJQA 4HJ5A 3GTJH 3CC4A 4A3MG 4OO1I 1L1OB 1K0RA 3PIOA 1IBKL 3F2CA 4LF7L 1KRSA 5IP7H 1UE6A 1LTLA 1YZ6A 1U0LA 4YWKA 1KAWA 1J5EQ 2HT1A 1CKNA 4APVA 4YHHL 2N49A 1WI5A 2EXDA 4X62L 4A3FH 4JI8L 1CUKA 1D7QA 4DNIA 2NVYH 4DR5Q 1C0AA 4NXNL 3CCUA 2K52A 4BA1I 3H0GG 4C3JH 3W1BA 4DV5L 4A3KG 3HOVG 2IX1A 5EAYA 3I4MH 4GN4B 2NN6G 2R93G 4A3GH 5FLXc 3CPFA 4DV1L 3L2PA 1JJCB 1OXXK 1EUJA 2KHJA 4L5QA 4A3IG 3HOZG 1UE5A 2KENA 5M3FH 1V9PA 1Y1VG 1E1OA 4A3BG 4UP7A 1KC8C 1XNQQ 1N32Q 2I5HA 3MXNB 3W1GA 4P74A 4IFDJ 1C9OA 5C44G 2HHHL 4JI7L 1N33L 3FKIH 2H5XA 5LMNL 1X3GA 2D0PA 2XTIA 4GLAC 3ERSX 2UXDQ 1VCIA 4NXNQ 2VW9A 3CCQA 2VY3A 2E8GA 2AWOA 4AQYL 2Q2HA 1HNZL 4A3DH 3K81C 2K5HA 1WOCA 2VZAA 3PUWA 4LUOA 1NBWA 2CWPA 4DR1Q 4DUYL 4DR4Q 1I94L 3M4OH 3A74A 5LMUL 4DR3Q 5GAGC 3UDGA 1PH7A 1TWHH 5GAEC 4DV2Q 1QVGA 4JI4Q 3CCJA 1VQJA 4LFBQ 4IOCA 3I7FA 4KHZA 4OO1G 2N78A 3H0GH 4GN5A 3UDXA 3EIVA 5LMNQ 2MFIA 2UXDL 1PYBA 1IYJB 1Z9FA 1YIJA 4GKJL 2JA6G 2RCNA 1IL2A 4JYAL 1K83H 1C7YA 3L7ZC 3K7UC 3PF5A 3WWVA 1N32L 2I5MX 2UU9Q 1YJWA 4JI6Q 1TWGH 4DV3L 1OXVA 3TQYA 2Z0SA 3CCLA 4DV2L 1HZCA 3EBEA 3M7NA 4X6AH 1YVCA 1L1OA 3RLNA 4LFAL 2N8NA 3CW2C 5E7NA 1HZ9A 1I5FA 3TRZA 1PVOA 1B7YB 1X9NA 4Y7NH 4BY1G 1YITA 3GTOH 5JJLA 4NPSA 3DM3A 5M5YH 5IWAL 1W3SA 2UUCQ 5FJ8G 3KF6A 3NELA 2AWNA 2IHFA 5BR8L 4P73A 1KRTA 4A93H 2IY5B 4JBMA 3KLWA 2LXKA 1TXYA 2HIVA 1HZBA 2OQ0A 5FLMH 1CSQA 1PH6A 2PQAB 3NEMA 4OONA 1E7ZA 1UWVA 4PZ6A 4BBRG 2K14A 1ASYA 1VQ6A 3DLLA 3HOXH 4DR6L 3I4OA 2EIFA 5IYBG 1QVCA 4DV7L 1NE3A 3G4SA 2QEXA 4LFAQ 1SROA 1NY4A 4UP8A 3UDFA 4QY7A 5M3MG 4YWLA 4DV0Q 4DAYB 3RNUA 3STBC 5HY6A 3K8AA 4LF4L 3J7ZC 4UP9A 2PNHA 3PO3G 5IYDH 4PMWA 3J80i 5C4XG 4GKKQ 1WFQA 3HKSA 3HKZE 4K0KQ 4BY7G 3I2ZA 1SRUA 4A3JH 4HIOA 3U4ZA 4DR2L 1FJGL 3JAMi 2CWAA 5JEAJ 3G48A 4MNOA 3S17H 4A3EH 3CP0A 4KHPQ 3TREA 4IJHA 2B29A 2JA7H 1S3OA 1QZGA 1MJCA 2JA8G 4A3LH 3PO3H 3KYHC 4DR3L 1M90C 1JMCA 4JI5L 3TS0A 4GS3A 4DR1L 1K73C 4JI2L 4JI0Q 3FHWA 4LW1A 4R4CA 2NVTH 4GN3B 1WYDA 1FL0A 3A5UA 1CSPA 2WB1E 4YCUA 2F52A 4AH6A 5C0XI 5LMNW 4GNXC 1JB7A 4B3MQ 4A3CG 2N3SA 2OTJA 4IPHA 2YTYA 1N34L 3I4NG 1G6PA 4RG1A 3LGJA 3CCRA 4HJAA 3GDEA 4C2MH 1NTGA 2V1CC 2AKWB 3ULPA 1PH2A 3KJOA 4LF8L 1HR0Q 3U4VA 2Y0SG 2L15A 4HIMA 1SMXA 3T1YQ 2Q2UA 1L2FA 2Q2IA 1AE2A 3GO5A 3BU2A 4A3DG 2VL6A 4JV5L 4EQ5A 1YJ9A 2R93H 3RR5A 4A3EG 4A3CH 4WJ4A 3B6YA 3G71A 2NZOA 1HJPA 2XGTA 3ULLA 2K75A 3I4NH 4BBSG 1GKHA 4K0KL 1JE5A 3CD6A 4JI4L 3GTKH 3CC7A 3CAMA 3AQQA 3ZJYC 3CCMA 2BH8A 2HQLA 1HNWL 1HNXQ 4DV6L 3GTPH 3I56A 1HZAA 3F2BA 1AE3A 1VQEA 4AQYQ 1EIYB 1Q1EA 3HFZB 4B3ML 3S14H 1M1KC 3S1RH 3CCVA 1VQFA 3BZCA 3RN5A 4P71A 1R9TH 1RIPA 2KBNA 4PG3A 1YHAA 4PZ7A 1K8AC 1VQNA 4GLVB 3H3VI 1V43A 2UXCQ 1XJVA 1Y14B 4LFCQ 3UE0A 4GNXB 5FJ8H 2YV5A 1KIXA 2RHQB 3S1QH 1JJ2A 4IFDG 4X66L 2ZJPA 2RHSB 3RZOH 1IBKQ 1VQIA 3S24A 1B70B 4IPCA 4J15A 3STBD 4DV4Q 4C3IH 1XMQQ 2F4VQ 3HOWG 2JA6H 1XTDA 3RZDH 4POGA 3G6EA 1VQ4A 4PZ8A 4A75A 3PO2H 4LFCL 4TVAB 3CF5A 1N36L 2DGYA 2UXCL 4R4TA 1YHBA 4JV5Q 2NZHA 3J81i 1IBML 3RLOA 5BR8Q 3VDYA 5IYCG 4LF4Q 3HOWH 1E24A 4IOAA 4BXXG 4A3FG 1I3QH 1VS0A 4DK3C 1UE1A 1IBLQ 4A93G 5H1SE 3S2DH 5IP9G 1IZ6A 3S2HH 1N9WA 3PGZA 1MIUA 1WCMG 1Q8KA 2CQOA 2WFWA 3KOJA 1X65A 1N34Q 4DV7Q 4O0AA 5GADC 3F2DA 3S1NH 4KHPL 3GTLH 3KJPA 4YY3L 1N8RC 1D8LA 4IPGA 4JI3L 1PH5A 4LF9L 3OYYA 1Y1VH 3KDFA 4JBJA 2VQEL 3NENA 2R92G 4JI8Q 2ZTEA 4H02A 4LUVA 4R1JA 4POFA 1X56A 4DK6C 5M3MH 4BA2I 1J5EL 1U5KA 4JI0L 3PUVA 5C4XH 4KLKA 4JI5Q 5IYDG 2VQFL 4HJ8A 2JEBI 4BY7H 3HOYH 1SR3A 4DUZL 4NXMQ 1Q86C 4L5RC 1O7IA 2ATWA 3E9HA 4A3IH 1HNZQ 4HJ7A 2E2IH 4L5SA 3HOZH 1QUQB 1PH4A 3KDFB 1EWIA 2OCEA 4JI1Q 5JEAG 2MO1A 3IRBA 2WP8J 2IT1A 1MKHA 4GNXA 2Z6KC 2D62A 3PCOB 1WCMH 4IPDA 1SN8A 4X64L 3TS2A 2OQKA 1X54A 4QQBX 2BA0A 4DUZQ 2WB1G 4EX5A 2NVQH 4WJ3M 3AFQA 1RL2A 1KHIA 1E1TA 5LMUQ 2VUMH 5K36G 4YWMA 3PF4A 2A8VA 4DR4L 1VQOA 4P75A 1PA6A 4LF5Q 2OTLA 1E22A 2YU9H 1L0WA 3HOUG 1K9MC 4JI6L 3RN2A 2IX0A 1XPOA 1HH2P 3KF8B 4DAMA 1NMGA 2ZTCA 2LXJA 1YJNA 2VS1A 2ASBA 1BBUA 4X64Q 3S1MH 1X3FA 2Z6KA 2Y0SE 3KF6B 2F3IA 5IE8A 1PH8A 3HOYG 4A3GG 1GM5A 2UXBL 2ZM6L 4B3TL 2R7DA 1IXRA 2UUCL 1XPRA 2CKZB 1FVIA 4AYBE 3S16H 1G291 2R6GA 1EYGA 2JA9A 3PSIA 2DUDA 3JC66 4L5TA 1OTCA 1QUQA 4R4IA 2K5NA 4X65Q 1YEZA 2UU9L 1A8VA 1EIFA 4OX9L 1WJJA 3FKIG 2LSSA 1A0IA 1FGUA 1Q81C 2BH2A 3U58A 1AH9A 4DR6Q 3MEFA 2UXBQ 1DGSA 2CCZA 4GOPB 4OWXB 1LM0A 4BY1H 1S40A 2NN6I 4O2DA 2WAQE 1VQKA 3EN2A 4YHHQ 1Q1BA 4FDBA 5M3FG 4AYBG 2VQEQ 1QZHA 2I0QA 1HR0W 4DV4L 4JOIC 1XMOQ 1XMQL 1KQSA 4LF5L 3AEVA 4GKKL 1YNXA 4OXPA 5FLMG 4XIGS 3TEHB 3JAMc 2B63G 3T1YL 5C44H 2OWOA 1HR0L 3K0XA 3CMAA 4DR7Q 4X66Q 4B3SQ 1VQGA 1EFWA 4Y52H 1L1OC 3RLFA 2E2HH 4A3LG 2ID0A 4MZ9A 3Q8DA 3CC2A 3M3YH 3ER0A 1VQPA 2D0OA 2R7ZH 4MTNA 2R7FA 1JJGA 2A1AA 4IO9A 4JI1L 4OX9Q 5GROA 2B63H 4LUZA 1KL9A 4JOIA 4UPAA 3ICEA 4DV6Q 4LFBL 1I6HH 4YCVA 1JT8A 1PH1A 4DR7L 2MNAA 1BBWA 1SE8A 1T9HA 2R92H 3A5ZB 1XNRQ 3KFUA 2KCMA 4DV1Q 1I94Q 3OW2A 1VQ9A 4BXXH 4NB3A 4DV3Q 1Q82C 3GTQH 1VQAA 3J7A5 1PV4A 1CKNB 2E5LL 1OXUA 3PUXA 2JEAI 4B3RL 3UE1A 5C3EG 3CXCA 4JI7Q 1N33Q 1KD1C 4LF7Q 5IWAQ 3W5OA 2BA1A 2ZJRA 1CKMA 4JBWA 4DV0L 1SFOH 1Q46A 1NJIC 4JCVE 3D31A 3M4QA 3K80C 4BBSH 4IFDI 2IHEA 5ELOA 2ES2A 2EQSA 2RF4A 2R7ZG 2JK8A 4BBRH 4QL5A 5HGQA 1X3EA 2GVAA 1KXLA 2PMZE 2E5LQ 1N36Q 2NVXH 2AMCB 3PUYA 1P16A 3CPWA 4B3RQ 1A62A 2JJQA 1TWCH 1BKBA 1VQHA 1Q12A 1QVFA 4A3BH 2K4KA 3PV0A 4HIDA 4YCWA 1PYSB 3D0FA 1MJEA 3M85A 2ZTDA 4HIKA 4UY8C 2GVBA 2F4VL 1EOVA 1VQDA 2UUAQ 1EQRA 5J3BA 3E9IA 5GQOA 3HOVH 1XPUA 4A3KH 5C4JH 1Q7YC 3I4MG 2C35B 3GTMH 4P72A 2GN5A 2ZM6Q 2AHOB 3AYHB 4JI3Q 4LF9Q 2VUMG 3BJUA 5IT9c 2B3GA 3T1HL 1P8LA 4OWTB 1J6QA 4DPGA 4GLXA 2HHHQ 5M5XH 2PI2A 2QGQA 3L0OA 2JA8H 3GTGH 2VNUD 3PIPA 3HOUH 4X65L 1CKOA 4QIWE 2QA4A 1VQ8A 1GO3E 3OTOQ 2UUAL 5C0XJ 1XNRL 3I55A 4LNQA 1A63A 1S72A 2CFMA 2ALYB 3S15H 4DUYQ 4OWWB 1X55A 1E3PA 4AIMA 2KHIA 1UEBA 3F1ZA 4RMFA 1XMOL 1K8GA 1BVSA 4DR5L 3GD7A 1H95A 1OXSC 4X62Q 5AJ3Q 3H15A 5GAHC 1PH9A 4LF6Q 4LWCA 1GD7A 3HKZG 4A76A 4DR2Q 1FJGQ 3ULJA 2YTVA 2PI2E 3CCSA 4ALPA 1TWFH 2YTXA 2I5LX 1VQ5A 3E0EA 1UE7A 1YHQA 4B3SL 1XNQL 5M5WH 5IYCH 3OTOL 4R4OA 5DLQE 3J81c 3CCEA 3NBHB 4JG2A 1ASZA 4GOPC 2KCTA 3AFPA 4A4IA 1YI2A 1IBLL 2JE6I 1V1QA 3K7AH 4DKAC 3A0JA 5ELNA 3J80c 2K5VA 5IP9H 1VQ7A 4JBKA 1PFSA 2VQFQ 2A19A 2Q2TA 1LYLA 5JJKA 2K50A 4GOPA 5JJIA 4B3TQ 4QGUA 3J81j 4DV5Q 1K3RA 3M4PA 3F8TA 5IY0A 4A3MH 4LF6L 1Z47A 3BZKA 3UDIA 1GVPA 5IP7G 4YY3Q 4R4QA 4QJFA 1PH3A 1I50H 2HIXA 4IJLA 4XTCS 2JA5G 1EQQA 1VQBA 1Y1WG 1LUZA 4NXML 3PO2G 5C0XG 4LF8Q 2UUBL
chains in the Genus database with same CATH superfamily
2PZUA 4C3HH 3VR6A 2JA7G 4GKJQ 4MIUA 1Y1WH 1OXTA 2DN8A 1TS5A 1SXTA 1BO0A 3GTJB 1VF5C 5HGTA 4IURA 2EY2A 1HNWQ 4A3JG 4HJ5A 4OO1I 1JWSD 1K0RA 1IBKL 1KRSA 5IGGA 1U0LA 1K83B 2B2VA 3BYTB 1J5EQ 1H9RA 1CHQD 2EXDA 1B4OA 4JI8L 4ZLTF 3DM1A 1D7QA 4L6TB 1ZKOA 1DOLA 3NHHA 4BA1I 1IYUA 4LK1C 4A3KG 4MHEA 2IX1A 3KF8A 4A3GH 4DV1L 3L2PA 1OXXK 2OXPA 4L5QA 4A3IG 2YU9B 3HOZG 3D4WA 1PTOD 2KENA 2B8FA 3SDZA 4A3BG 4FVMA 1RD9D 4F8MA 3DWQA 2HHHL 4JI7L 2H5XA 2UXDQ 3ERSX 2KHSA 2VY3A 3D4RA 1QOHA 4AQYL 4IUNA 3K81C 1BOSA 1NCVA 1R4QB 4DR4Q 3S2DB 3PIO3 3M4OH 3A74A 4XT1B 5J39A 5GAGC 1PH7A 5IGEA 5IGFA 1JCKB 2XN9C 3UDXA 1IYJB 1YIJA 3H91A 4K2LA 3P20A 1EQTA 4JYAL 1K83H 1C7YA 3N6RA 2I5MX 1JR0D 2UU9Q 3FRPB 1L1OA 4QUCA 4IQZA 2N8NA 3SK5A 1HZ9A 1X9NA 1QCBD 4Y7NH 1SBBB 5IWAL 4HR7B 4IUQA 2UUCQ 4A93H 2IY5B 3NUCA 2LXKA 2B2WA 5FLXE 2HIVA 1IHZA 1SJED 1XTCD 5ISRA 1B53A 1NE3A 4C3HB 1NY4A 1SROA 3UDFA 4YWLA 4DAYB 5EKKA 5HY6A 3QIAA 3J7ZC 1QB5D 5C4XG 4GKKQ 1LTTD 2DNCA 1MHWC 1PFNA 3HKSA 2M2LA 3I2ZA 2CWAA 3VA5A 1R9TB 3QR8A 5ELFA 1YNJC 2TSSA 3O13A 1L0YB 2JA8G 3KYHC 4JI5L 4DR1L 3H6MA 4IZ8A 4JI2L 3FHWA 4R4CA 1LTAD 4IALA 1E0BA 3A8JE 1JB3A 4AH6A 1JB7A 1K8OA 3I4NG 1G6PA 2K5WA 3IAYA 1CT1D 3LGJA 2V1CC 1AEXA 3WOFA 2Y0SG 4TKOB 1STAA 1ZXTA 4HIMA 3QOJA 1L2FA 1AE2A 2JSOA 3HOUB 4JV5L 2B2VC 3OW7A 1W6KA 3RR5A 2NYZD 1I4HA 3I4NH 3GTKH 3CAMA 2M00A 3AQQA 3C1EA 4V190 2QEJC 1AE3A 4K2KA 1VQEA 2CH4W 1Q1EA 3MFGA 1ONLA 1JWUD 3Q24A 3S1RH 3SVMA 1VQNA 4KK7A 1V43A 1XJVA 5CV6A 3UE0A 5FJ8H 5J22A 1KIXA 3S1QH 1BNZA 4X66L 1IBKQ 5KGUA 1VQIA 3DHQA 3NXWA 4TSSA 1AZQA 2JA6H 5C5MA 1F9SA 1SFOB 3PO2H 4KD4A 5C4ZA 3BS1A 2J4XA 1SYGA 2EPBA 2ENBA 4RGNA 1N36L 1A3TA 2UXCL 2NZHA 5EPLA 1S5DD 1V8QA 1A2UA 4BXXG 4A3FG 4DK3C 1UE1A 4CKCA 5H1SE 5IP9G 1IYVA 2O5IC 2RBMA 1EIGA 2Y0SB 2SNMA 2SEBD 3GTLH 4X3TA 3NBIA 4B9XA 1CHPD 4JI3L 4LF9L 1GOZA 3NENA 1C8CA 5M3MH 1X56A 4DK6C 1I4QA 1J5EL 1U5KA 4ZUIA 4KLKA 5IYDG 4HJ8A 2JEBI 2CQAA 4BY7H 3VYSA 4DUZL 4HCEA 2IWHA 1S5CD 4HJ7A 4A3FB 3KDFB 5JEAG 2MO1A 1LTID 1IW7D 2IT1A 2KQ3A 1F2LA 1SN8A 2KUMA 3TS2A 2E2JB 2K5DA 4DN4M 3NQIA 3AMUA 4ODGA 1V1PB 4DR4L 2JXMB 2Z9HA 2CH4A 1PA6A 4LF5Q 3D6WA 2OTLA 1BR9A 3NK9A 1K9MC 3RN2A 4DAMA 2BE5D 2ZTCA 2ASBA 2VS1A 2XRSD 3J81L 2J7ZA 1PTOF 1JWMD 2CKZB 1FVIA 4AYBE 1PRTD 3J7AV 4QB4A 1SAPA 2UU9L 4X65Q 4F87A 4OX9L 1Q81C 3CRKC 4DR6Q 1DD2A 2A68D 4DK0A 4LAAA 4OWXB 1LM0A 1WCMB 3FVQA 4BY1H 4JPBW 4NW2A 3BYYB 1VQKA 5M3FG 4AYBG 1HR0W 4DV4L 1XMQL 1B3AA 1CTMA 4N8FA 4G7HC 2B63G 3T1YL 2AQ2B 4ZQ3A 3CMAA 1ET6A 2K1BA 2EYJA 4B3SQ 2G9HD 3BVMA 1EFWA 1L1OC 5T1GA 3RLFA 2QILA 2E2HH 3I4NB 4CJ2C 4A3LG 5C4XB 3TZDA 1NAPA 3M3YH 3X3NA 4NKLA 1WD0A 4MTNA 2R7FA 4IO9A 2B63H 1Y8PB 1YNJD 5CV4A 4DV6Q 3T13A 1JT8A 4YCVA 2MNAA 1BBWA 4OL7A 4C2MB 3K7AB 4OHJA 3A5ZB 1HQRD 1NR2A 3NP8A 1I94Q 3OW2A 2K01A 4UDUC 3MFYA 4DV3Q 1HUMA 2AQ1B 4Q0FA 3HGBA 2JEAI 2PZWA 3AB9A 3QB3A 2EYOA 3E3XA 3W5OA 3AU7A 2ZJRA 1Q46A 4JCVE 3K80C 4BBSH 1TS2A 2IHEA 1JOQA 2EQSA 3LWUA 4ZKCB 4CGYB 2GVAA 1E2WA 3OOCA 3L3OC 3TDQA 4CDFC 2E5LQ 3BDOA 3CPWA 3KLRA 1JOOA 4BBRB 4A3BH 2RSOA 4YCWA 1PYSB 1QG7A 3R3OA 3DUZA 2E76C 4UAIA 4OIJA 1CK1A 5GQOA 4C3JG 2VB3X 3GTMH 4P72A 1J8IA 4FO2A 3BZDB 4A3BB 1GJXA 2HHHQ 4GLXA 1D2BA 4RHRA 3HP3A 4K6LA 1X32A 4XXEA 4KJNA 1EY7A 2JYOA 1H9JA 1RTNA 1VQ8A 2UUAL 1A63A 1PZKD 1S72A 2ALYB 3V05A 4AIMA 3ERQA 4BBSB 2KHIA 1UEBA 4RMFA 1AZPA 3LX0A 3A54A 3VR4A 4X62Q 5AJ3Q 1PH9A 2EE1A 4LF6Q 4LWCA 1GD7A 4DR2Q 2YTVA 2BDOA 2PI2E 2V4DA 3QG1A 1BCPB 1YHQA 4HTHA 5M5WH 3URYA 4HAEA 5HURA 3J81c 3CCEA 1EYDA 4JG2A 1ASZA 3A56A 2PW7A 3A0JA 5ELNA 3J80c 2K5VA 4JBKA 4L63B 2WKDA 2ZT9C 3Q6SA 1ET9A 5JJKA 2K50A 4GOPA 3R93A 4B3TQ 3J81j 1A3VA 4RGOS 2F0VA 5IP7G 1KDCA 1NSNS 2HIXA 1ICFB 1VQBA 5DM73 1BCPF 2UUBL 3FP9A 3F2UA 3H3VH 1CA5A 1G51A 4C3JB 2K6AA 3MXUA 1TWAH 3SK4A 3J80L 3HOXG 1EEFD 2FXQA 1X6OA 3I70A 4JYAQ 3PUZA 3CQZH 1PHJA 3SGIA 2MQHA 1TU2B 2NWGA 4KI0A 3T53B 4V0BA 4JI2Q 3I90A 1W2BA 2NVQB 1TY2A 2ZJQA 1F9PA 3CC4A 1O7LA 3PIOA 4LF7L 3C1FA 1RTOA 3F2CA 5IP7H 1PRTC 1KAWA 5CV5A 4APVA 4X62L 2NVYH 1STEA 1KDAA 1EWHA 4DV5L 3H0GG 4C3JH 2KECA 5EAYA 1H9SB 4GN4B 1JJCB 1EUJA 4DNRB 1SMYC 1V9PA 1Y1VG 1E1OA 2CW0C 3K59A 3H09A 1N33L 3FKIH 2D2CC 5LMNL 1X3GA 3QO2A 5NUCA 4GLAC 2DJFC 2VW9A 2AWOA 2Q2HA 1Q90A 2XSCA 3FEWX 4A3DH 1Z7TA 1RF2D 4LUOA 1DOKA 1O7ZA 4DR1Q 3NSWA 4DUYL 1I94L 4RAUC 2WKCA 4HCSA 5M5WB 5LMUL 1K3BC 3UDGA 4RCOA 4RGMA 1TWHH 1QVGA 1SYBA 3CCJA 4LFBQ 4OO1G 2N78A 3D6CA 3H0GH 1KABA 3BDLA 2UXDL 2JA6G 4F88A 3JAML 4C3IB 2C5CA 3PF5A 4JI6Q 1TWGH 3TQYA 2IJ0A 4I65A 5IOCA 4DV2L 5FKAC 3NQTA 3TRZA 4FNFA 1I5FA 2QKIC 3DM3A 1W3SA 2EYFA 2AWNA 4P73A 3K5NA 3KLWA 3V96A 5I2XA 4JK1C 1SE2A 3Q22A 2OQ0A 2A73B 5FLMH 1CSQA 4S3SA 1H9SA 4OONA 1UWVA 4BBRG 2F0WA 1ILPA 2OF1A 1A3UA 3NPPA 1QVCA 2F0QA 2KEDA 4QIWB 1MBYA 2M9VA 3OIQA 1HQMC 5M3MG 3D8GA 1Y69U 2FFKB 3K8AA 4LF4L 4KV6A 1F77A 5IYDH 4PMWA 2WAQB 3HKZE 3HZXA 3OWEB 4HIOA 3CHBD 1FJGL 1XX8A 5FO9B 5JEAJ 5KIXA 3CP0A 3TREA 1B9NA 4IJHA 4R9WA 1EY8A 4H13C 1JMCA 4GS3A 1K73C 3MZ5A 1STNA 3LWEA 2EZVA 4H0LC 1FL0A 4EQOA 4L8JA 1HHVA 2XVSA 4XYQA 1AFPA 2WB1E 4H44C 4KY5A 3J7AF 1H9MA 1STBA 5LMNW 2N3SA 4IPHA 5E1FA 1CQFA 4RG1A 3TZUA 1W6JA 3GDEA 1NTGA 2EYPA 4C2MH 4LF8L 2Q2UA 5C4HA 4A3DG 2PCFB 3NBHA 4XQNA 5DAUA 2R93H 2FMCA 3GTGB 2MHVA 2NZOA 1HJPA 2K03A 1SNPA 1GKHA 5IT9E 1JE5A 3CD6A 2QDBA 3ZJYC 3A8KE 3TP8A 2FMMA 1B50A 1HNWL 2MJ8A 4XDXA 4FXDA 3GTPH 5A35A 3F2BA 4XQQA 1LTRD 5IODA 1EIYB 2BDNA 3HFZB 3FDTA 1EY6A 1G6ZA 2EJGC 4FXKC 4P71A 1XXGA 1R9TH 1PTOC 4UHVA 3H94A 4LFCQ 3NTHA 3DWAA 5KYLA 4GNXB 2YV5A 4OEMB 2RHQB 2RDFA 4Z9CB 4OIKA 1L0XB 4DV4Q 4J15A 1XMQQ 3STBD 4C3IH 1VQ4A 4PZ8A 5C3WA 1D1IA 5CR3A 3CF5A 3T4AC 4R4TA 1YHBA 1HPCA 4JV5Q 1EY5A 5BR8Q 5IYCG 4LF4Q 1E24A 2OEOA 5EQ0A 4IOAA 4A93B 1IBLQ 4CDDC 5BN4A 3K0YA 1IZ6A 3S2HH 1N9WA 1EY4A 4QF4A 4Y7NB 1Q8KA 1WTOA 1X65A 1D6EC 4DV7Q 3F2DA 2F0GA 3SK8A 2D5DA 5KYIA 3S1NH 1OO9B 4YY3L 1N8RC 1S4ZA 1LACA 1CA6A 2R92G 4JI8Q 2ZTEA 4H02A 5EGTA 4POFA 2PZTA 4JW0A 4HSPA 5IGBA 1KLUD 4G7OC 2LY7A 4NXMQ 4L5RC 5IT9L 1WVLA 1CI3M 1B2TA 5LHY1 5CBEE 4A3IH 3HOZH 4L5SA 2OT2A 4M1UB 3IL8A 1PH4A 5ELEA 2N55A 3S1MB 1EYCA 5EBDA 4CJ1B 2IL8A 1MKHA 2Z6KC 5K5PA 2D62A 3PCOB 4IPDA 3ND9A 1MSHA 5KEEA 4CHTB 3OHXC 5KNCA 1EYAA 3PMFA 4DUZQ 3I72A 1SNDA 2NVQH 1I4RA 1U4MA 1E1TA 2VUMH 5K36G 4HSVA 3VA7A 3D3RA 2YU9H 1L0WA 3GP7A 2IX0A 2LS01 5D3IB 3RD4A 1NMGA 4LF8Q 4X64Q 1TWAB 5IE8A 3KF6B 2UXBL 1GM5A 1EU4A 3MVVA 3KLSA 4KD3A 2EDGA 3RZDB 2UUCL 2MP1A 4JVZA 4DNTB 1KAAA 1PFMA 3E5SA 4R4IA 2HCIA 2Q8IB 5LL6S 1X3PA 2CCZA 5JVH3 2O4XA 2EY1A 4IUVA 1Y1WB 3S14B 2HUGA 2Q8TA 4YHHQ 1Q1BA 2I0QA 4LF5L 1XMOQ 5DNFA 2DNEA 4EQPA 4GKKL 3JAMc 4A3IB 3HOZB 4DR7Q 1JICA 1FNVA 4RH6A 5JOBA 1J9OA 3VR2A 1JQYD 4LJZC 2ID0A 1EY0A 3OPOA 2XRQD 2B2YC 1I50B 5IGDA 2A1AA 2E2DC 4OX9Q 3S15B 1KL9A 4JOIA 4UPAA 4C1NK 1KLGD 1K8MA 4C1NI 3HG9A 2R61A 4K14A 1IW7C 3TSSA 4N8X1 3E6ZX 2KCMA 2L11A 4DV1Q 1TR5A 1SDFA 1I3QB 1NNXA 4DK1A 3GTQH 4IUPA 2DY7A 5FO7B 2B8GA 2RCFA 4B3RL 5C3EG 1VF7A 5C4JB 4JI7Q 3HOVB 1HTLD 2VXWA 2WIIB 1DYQA 4FXGC 1CKMA 4JBWA 4DV0L 4YIJA 5CV9A 2O2LD 2KCCA 5KRUA 1I4PA 3BDCA 2ES2A 2RF4A 1PZID 2F1MA 5CV7A 1X3EA 1KXLA 3NTKA 2NUCA 4FF1A 4O42A 4ZUJA 1N36Q 2CVRA 1SYEA 2F03A 2PPBC 1VQHA 1Q12A 2K4KA 3PV0A 1JORA 2X69A 3D0FA 4RCNA 1O78A 4HIKA 2GVBA 3GTMB 1EOVA 2WACA 1ESRA 1ML0D 2L12A 5J3BA 2K04A 3E9IA 1H9KA 3HOVH 4ZKBB 2IW3A 3A8IE 3D4DA 5C4JH 2MPMA 2HCCA 2GN5A 3HRZC 2RQXA 4JI3Q 4LF9Q 3BJUA 2B3GA 3T1HL 1IKLA 4KTAA 5BN3A 5FOBB 4OWTB 1J6QA 2A6EC 2JA8H 5M5XH 2QGQA 2QF7A 3GTOB 3PIPA 3VYUA 3TN2A 3IFDA 5CMDA 3GV6A 2MUYA 2CFMA 3S15H 4G4KA 4DUYQ 2F0DA 1GHJA 1X55A 4OWWB 1U4LA 1XMOL 1BVSA 3GD7A 1H95A 4IUTA 3M3YB 5D3DA 2E2HB 3ULJA 2F4IA 1GUWA 1TWFH 2YTXA 2I5LX 1VQ5A 3E0EA 2CHBD 3KUPA 1JE4A 3M4OB 1ENCA 4R4OA 5DLQE 2EYLA 2KCTA 1IBLL 1DM0B 2R92B 3K7AH 5IP9H 3T16A 1LT5D 3S17B 5JJIA 1G2SA 3M4PA 5IY0A 4A3MH 2B63B 4LF6L 3UDIA 1GVPA 3A7AB 1YNNC 1R4PB 4R4QA 4YY3Q 1PDQA 4IJLA 1LT6D 5D65A 1EZ8A 4KKSA 5M3FB 1A15A 4ABNA 1LTGD 2MO0A 3I4MB 5C3EH 1YBYA 1ZYRC 1NUCA 1B8AA 2WAQG 3CMEA 3T1HQ 1IBMQ 4TQUS 3M9BA 2YYZA 3BVZA 5AJ3L 1F9RA 1GHKA 3DXJC 2JQOA 3CU7A 5M5YB 4CKBA 1HNXL 2E2JH 2UUBQ 3GTJH 4A3MG 2F0MA 4KKUA 1UE6A 1RKNA 1EIHA 2R3ZA 1KTKA 4YHHL 1WI5A 4A3FH 1CUKA 4DNIA 4DR5Q 1C0AA 2A6HC 3DWPA 4NXNL 3CCUA 3EQLC 3W1BA 2H4OA 5KNDA 3HOVG 3VYRA 2NN6G 5G3LF 2R93G 5FLXc 3CPFA 1PV4A 1Q8IA 1UE5A 5CC4A 2A69C 4UP7A 1N32Q 4N9PA 4P74A 1C9OA 5C44G 4IFDJ 3MAQA 4A3DB 3GTLB 3S1NB 1VCIA 2EY6A 2E8GA 3FKIB 1HNZL 2K5HA 2VZAA 1MSGA 3S2HB 1NBWA 5I2YA 3SHLA 5GAEC 4JI4Q 1VQJA 4ZYSA 4IOCA 3I7FA 4KHZA 1SSOA 5LMNQ 5A2QE 1PYBA 1AN8A 1Z9FA 3CKIB 2RCNA 4EVOA 3L7ZC 1BCPC 3K7UC 3MC0B 1YJWA 4DV3L 1OXVA 3EBEA 3RLNA 2X6LA 3CW2C 3IKJA 4LFAL 3S1QB 3Q23A 5JJLA 2F0TA 5M5YH 4GZYC 5FJ8G 1WTQA 5BR8L 4RHSA 5IIFA 2F0HA 1HZBA 1E7ZA 1CFMA 1ASYA 3DLLA 1BQQT 3C2PA 3I4OA 2EIFA 4DV7L 3BVGA 1PZJD 1KNAA 3G4SA 4UP8A 3OIPA 4DV0Q 1LV9A 3STBC 4UP9A 1K28A 3MTSA 3PO3G 1A6XA 2LMCB 1ESFA 4K0KQ 2FHTA 4BY7G 2NVXB 4A3JH 1SRUA 5ELDA 1TQOA 4DR2L 3I91A 4R8IA 1UNSA 3G48A 4EQNA 1E2ZA 2G5DA 3S17H 4A3EH 4KHPQ 2B29A 2GA4B 1S3OA 2EXZA 1QZGA 4A3LH 3PO3H 4P2CB 1M90C 4U673 3TS0A 2G9DA 3J81E 5A2QL 5CORA 2TMPA 4GN3B 1SNQA 1WYDA 2F3VA 1VDZA 2NN6H 1CSPA 1STGA 3EVQA 1MI2A 4YCUA 5BN5A 2F52A 5FLXL 5C0XI 4GNXC 4B3MQ 1DOMA 2KCNA 1FNUA 2OTJA 3CCRA 4HJAA 1G8ZD 2F0EA 3ULPA 1PH2A 1HR0Q 1K0SA 4G7ZC 2F0JA 1SMXA 3T1YQ 1C4QA 1QILA 3GO5A 2E74C 1SYFA 3K5LA 1YJ9A 5ELCA 4A3EG 2JA8B 3G71A 3SE0A 4BBSG 4JI4L 1MD2D 5JJZA 2NVTB 4ILWA 2A5HA 4DV6L 2PQEA 4QUFA 3EROA 4AQYQ 3MXNA 1M1KC 3ZYYX 3CCVA 3UI2A 3BZCA 2Z8LA 4PZ7A 4PG3A 2KBNA 3H3VI 2HQEA 4GLVB 4DFAA 1Y14B 1F9QA 2RHSB 2F4VQ 3HOWG 4POGA 3G6EA 2A74C 4K6DA 3I3CA 2L9HA 3J81i 3RLOA 3VDYA 5JPMC 4I7ZC 1TWHB 2L4NA 1ENAA 3HOWH 1BUVT 1I3QH 1PMRA 1S5ED 2EVBA 3S2DH 3PGZA 1MIUA 3KOJA 1N34Q 2Z4HA 4QCLA 5FK9C 1C48A 4O0AA 5GADC 1CQVA 4PMCA 1BXTA 4KHPL 3KJPA 2BCOA 1D8LA 1TIID 1PH5A 1G91A 4JBJA 4OELB 2ZXPA 2RKSA 4R1JA 1I6VC 3PUVA 2RA4A 5C4XH 1TS3A 2VQFL 3J7YW 3HOYH 1SR3A 3M7GA 4A3GB 1Q86C 3HOYB 3NWTA 1O7IA 2ATWA 2E2IH 2NVYB 4RGTA 1FGBD 5EKLA 2ICIA 3IRBA 4GNXA 3A55A 3I8ZA 4KY7A 1X54A 3FMCA 1PFBA 2BA0A 3ND8A 1EY9A 4WJ3M 5LMUQ 4YWMA 4CDCC 5I6YA 4AYBB 1TY0A 2CW0D 4Q5VA 5FO8B 1VQOA 3HOWB 1WTHA 1E22A 1LLRD 4WFN3 4JI6L 2F0LA 1SEBD 1X3FA 3HOYG 2Y0SE 4A3GG 4B3TL 4KN4C 1UUPA 4EGVA 3W2DA 4KY6A 1DJRD 3T56B 4DXGA 3S16H 3T51B 2R6GA 2JA9A 3PSIA 2DUDA 4L5TA 3Q0AA 1SE3A 1EIFA 1WJJA 2F3WA 3MEFA 4GOPB 3I73A 1S40A 2NN6I 4F7XA 3EN2A 3S1MH 2VQEQ 1LT4D 3AEVA 1YNXA 4OXPA 5FLMG 4XIGS 4NMZA 1IL8A 1QNUA 3TEHB 2Z1CA 2WV6D 2OWOA 1HUNA 5TSSA 1KNEA 1VQGA 4Y52H 3ITPA 4J1MA 5LL6X 2B2UC 4MZ9A 4IFDH 3CC2A 2SOBA 1VQPA 3MA2B 4ZCKA 5CBAE 2R7ZH 1EZ6A 4JI1L 4ZAIA 4LUZA 3ICEA 2C9OA 1PH1A 4WRDA 1QNKA 2K32A 1SE8A 1T9HA 3L9AX 1XNRQ 1AP0A 1ZEQX 1Z6HA 2JN4A 1VQ9A 4BXXH 3J7A5 3V2TA 2B2WC 1U4PA 1OXUA 3PUXA 2NTSA 2BOSA 2EJMA 3R8BA 3K5MA 1N33Q 4LF7Q 4A3KB 5IWAQ 2BA1A 1G2TA 4HMIA 4N9TA 1NJIC 4FYDA 3M4QA 2PW5A 1XYIA 4KMUC 4A3EB 5ELOA 2R7ZG 4DF7A 4BBRH 5HGQA 2QCPX 4XYOA 4A3JB 1RHPA 2AMCB 1P16A 4B3RQ 1A62A 4X3UA 1BKBA 4ME5A 4HIDA 1BCPD 1MJEA 3M85A 1O80A 2F4VL 1II3A 4CKEA 1VQDA 1EQRA 5I4DA 1M8AA 3I4MG 2A68C 1Y8OB 4HN7A 2C35B 2LFNA 2K28A 2ZM6Q 5IT9c 3FPUB 1KDBA 1TWCB 2EY5A 4HMJA 3L0OA 2AUJD 3GTGH 2R93B 5E4XA 2D9UA 2VNUD 3VR5A 3HOUH 2KA7A 4ZRZA 1GO3E 3OTOQ 1EQVA 1EOTA 1XNRL 3I55A 4K5VA 4OGQC 5COYA 1VMCA 1UEAB 1TKWB 3U9SA 4DR5L 1XWEA 2HD3A 1OXSC 4I7AA 3JAME 1I4XA 4K8IA 3GV3A 4WJWA 1TVXA 3HKZG 4A76A 3NTIA 2L55A 3CCSA 5DM63 4IUUA 5C44B 4TRDA 5IYCH 5ELBA 3IFTA 3NBHB 3TP7A 3OSOA 4GOPC 3KBGA 1T5XD 1V1QA 2JE6I 2E75C 5F2DA 2XWBB 4DKAC 1VQ7A 2NZ1D 4KJOA 2A19A 2Q2TA 1LYLA 1LT3D 2B2UA 1PH3A 5JEAH 4RKBA 3WOEA 4XTCS 2JA5G 3H3VC 1EQQA 1EWCA 1SYDA 1LUZA 4NXML 3PO2G 1A2TA 1HA6A 5IYBH 3TBIB 1SLJA 4HJ9A 1VQCA 1GXDC 3VR3A 1VQLA 3U50C 1VQMA 2JA5H 1NMFA 4ME3A 4JC0A 2PQAA 2Z6BA 1L1OB 1O7YA 1LTLA 1YZ6A 3S16B 4YWKA 4CJ0B 2JA5B 2HT1A 1CKNA 2N49A 2SNSA 2Z4IA 1B3QA 2B39A 5G3LD 2K52A 3H0GB 1HXYD 3I4MH 3HS0C 3J80E 2KHJA 1HRJA 4DXFA 4BY7B 5M3FH 1PLFA 3QOLA 2NB0A 1XNQQ 1QE6A 1STHA 1KC8C 1IKMA 3G6JB 2I5HA 3MXNB 3W1GA 5JVG3 2KOLA 2D0PA 2XTIA 4NXNQ 3K5OA 3CCQA 4K8JA 5EBCA 3KK7A 1WOCA 2F0IA 1I4GA 2P5ZX 2CWPA 3PUWA 2K05A 4DR3Q 2LKVA 2ICEC 4DV2Q 1BDOA 1U4RA 4RA8A 1V1OA 4DAVA 3PIP3 4GN5A 3EIVA 2QDLA 2RVLA 1WTRA 2MFIA 5JPNC 4GKJL 1IL2A 1PRTF 4C3IG 1SE4A 2JA6B 1Y1VB 1N32L 1T5EA 3WWVA 2Z0SA 3CCLA 2WB1B 1HZCA 3M7NA 4X6AH 1YVCA 1PVOA 5E7NA 1B7YB 4BY1G 1YITA 3GTOH 2DJGC 4NPSA 1D5XC 3NE5B 5M5XB 3KF6A 3NELA 2IHFA 1KRTA 4JBMA 1TXYA 4DA2A 4ZK9B 1PH6A 3CQZB 2PQAB 3NEMA 4PZ6A 2K14A 3DEOA 3DMUA 1VQ6A 1LTBD 2ZXOA 3HOXH 4DR6L 5IYBG 1RJTA 2Q8RE 3HKZB 4KN7C 2QEXA 4LFAQ 5JAVA 4QY7A 3RNUA 1HCZA 1HFNA 3K6OA 2PNHA 3J80i 4WORA 1F2MA 1S5BD 4BWGB 1WFQA 1GUSA 5C0XH 3U4ZA 4HEDA 4R8NA 3JAMi 1VMPA 3RUZA 1CM9A 4MNOA 2JA7H 4PMBA 1MJCA 3MHBA 4DR3L 4X3KA 5EKIA 2F0FA 4JI0Q 1RCVD 2I46A 2AQ3B 4LW1A 2NVTH 1EL0A 5C5LA 1ILQA 5M9OA 3A5UA 1WTWA 4DU9A 3CRLC 5EJWA 5K36H 2KEEA 1E2VA 1RODA 4A3CG 1FNWA 2YTYA 5DEHA 1N34L 2O5JC 1EFID 3P75A 2AKWB 3KJOA 2VB2X 1UAPA 3U4VA 2L15A 2Q2IA 3BU2A 1F2ZA 2VL6A 4EQ5A 4O1NA 4WJ4A 4A3CH 3B6YA 2XGTA 4NDXA 3ULLA 2K75A 3QWNA 5EPJA 1FD7D 4K0KL 1D5MC 1SNMA 3CC7A 1DZ1A 1STYA 4OO1H 3CCMA 3OMGA 4NP5A 2BH8A 1M4VA 2RSNA 2HQLA 1HNXQ 1TS4A 3I56A 1HZAA 1S5FD 1CZGA 3PO3B 3TMEA 2I07B 2F0OA 4B3ML 3S14H 2PNRC 3S9WA 1EU3A 2K33A 1VQFA 3RN5A 1BF4A 3LNNA 1RIPA 1YHAA 5L37A 1GUOA 2RDHA 3ONAB 1K8AC 2UXCQ 4XT3B 4IFDG 5KNBA 1JJ2A 2ZJPA 3RZOH 3S24A 1B70B 1FYCA 4IPCA 1JOKA 4RKLA 3R2IA 4BS9A 4DAYA 1XTDA 2L5TA 3RZDH 4A75A 4LFCL 3HOXB 4TVAB 2IPKD 2DGYA 2NTTA 3P1HA 1IBML 1TT2A 4FP5D 3MXPA 4XQJA 2B2YA 4J8QA 1WTVA 1VS0A 4A93G 2VUMB 3M4YA 1F2YA 1WCMG 2JP1A 2CQOA 2WFWA 3C46A 4RWSC 3MWYW 2RDGA 1ZYRD 4PNYA 4KHVA 4FF3A 4IPGA 1AW7A 2EYHA 3OYYA 1Y1VH 3KDFA 3W3AA 2VQEL 4LUVA 4BA2I 1HA5A 4JI0L 2E2IB 2KJXA 4JI5Q 5CV8A 1B9MA 2EYMA 1MGSA 1DCZA 3OWFA 2HDLA 5I9PA 3E9HA 1HNZQ 1QUQB 2AUKA 1EWIA 2OCEA 4JI1Q 1PTOB 1WTPA 2WP8J 1LABA 1LTSD 3QJYA 5E3FA 1WCMH 4BY1B 2X6GA 4X64L 2F0UA 2OQKA 4MN3A 4C56C 4QQBX 4K5XA 3EFXD 2WB1G 4EX5A 3AFQA 1RL2A 1KHIA 1B1ZA 1ICWA 2DY8A 3K57A 3PF4A 4B9WA 2A8VA 2MGSA 4E6IA 2A69D 4P75A 2F0NA 4IN3A 3GQBA 3HOUG 2L0CA 1XPOA 1HH2P 3KF8B 3I4LA 4FF4A 2LXJA 1YJNA 1Y8NB 1BBUA 1RDPD 2Z6KA 3EJIA 1PH8A 2F3IA 1CZWA 4QMGA 2ZM6L 3TP6A 2R7DA 3G7LA 1IXRA 1XPRA 5CGKA 2NBFA 1G291 1EYGA 3JC66 1X3QA 5EPKA 1OTCA 1QUQA 2K5NA 1YEZA 1A8VA 2BH2A 3FKIG 2LSSA 1A0IA 1FGUA 3DEPA 1DXMA 3P7JA 3U58A 1AH9A 4DAPA 2UXBQ 2QW7A 1DGSA 3VYTA 3X3MA 1SYCA 1U9RA 2KVMA 2SDFA 5I6WA 4O2DA 3BG3A 2WAQE 3MXGA 1PTOH 2EJFC 3SEBA 2XIWA 4FDBA 1QZHA 4JOIC 1KQSA 3GTPB 5AFWA 5CYUA 1BBXC 2H1EA 5IGCA 5C44H 5C3EB 4MTKA 1HR0L 3K0XA 2BE5C 4X66Q 2HDMA 4M8AA 2N88A 3Q8DA 4H7BA 3SXHA 2FINB 3ER0A 2D0OA 5M3MB 1JJGA 3WDNA 2IX3A 1YNND 5GROA 4A3MB 5J1ZA 1GUGA 2K7VA 5C3XA 4LFBL 1I6HH 3HEJA 4DR7L 4FF2A 2A6HD 2R92H 3A7LA 3KFUA 1WTXA 1PYWD 5I9OA 3NWSA 1NR4A 4NB3A 1SNCA 1Q82C 1VQAA 3K58A 1CKNB 5C6AA 1TWFB 2E5LL 4B08A 1ENFA 3UE1A 2PO4A 3CXCA 1LO5D 2PMZB 1KD1C 3OMCA 1SFOH 2PYKA 3PO2B 5E4WC 3D31A 1QJOA 4IFDI 1HTPA 4PQXA 3KBXA 2JK8A 3RZOB 2XNAC 4J6HA 4QL5A 2F0PA 2EOTA 2PMZE 4K5WA 2NVXH 3PUYA 2JJQA 4LMQD 1HFGA 1D5ZC 1TWCH 4DGZA 2A6ED 1QVFA 4ULLA 3S1RB 1FR3A 2ZTDA 4UY8C 2F0KA 2UUAQ 4U68A 3N52A 3EA6A 4RFBA 1XPUA 5D14A 2XWJB 4A3KH 1Q7YC 2L1BA 1GUNA 3E0JA 2J0TD 2AHOB 3AYHB 3FPPA 3GTKB 2F0SA 2VUMG 2ZXRA 3SK6A 1P8LA 3RMHA 4DPGA 2PI2A 2K5QA 1WD1A 4X65L 1CKOA 4QIWE 2QA4A 3R2TA 4CDEC 5C0XJ 4KKTA 4X3SA 4LNQA 1TWGB 1I6HB 1EEID 1SJHD 1V1PA 2WINB 1E3PA 3F1ZA 3U9OA 3PQIA 1K8GA 4ID6A 1GUTA 1SMYD 4C3HG 5GAHC 3H15A 1FJGQ 1SNOA 1DONA 1PRTB 4ALPA 1JC7A 1UE7A 3GTQB 1Q3LA 4B3SL 1B44D 1XNQL 3OTOL 2B2TA 3AFPA 4A4IA 2B2TC 1YI2A 1PXUA 2JA7B 1PFSA 3SR1A 2VQFQ 1QWYA 4QGUA 5T1IA 1K3RA 4G57A 3F8TA 4DV5Q 1Z47A 3BZKA 4PV1C 3TP5A 2R7ZB 4QJFA 1I50H 4CBVA 3KLSX 3C3LA 1Y1WG 1D1KA 2FJ2A 5C0XG 3MEHA
chains in the Genus database with same CATH topology
2MO0A 3FP9A 5C3EH 3H3VH 4C3HH 1YBYA 1G51A 5IYBH 1SLJA 4HJ9A 1VQCA 1TWAH 3HOXG 2JA7G 4GKJQ 1VQLA 2FXQA 1B8AA 1X6OA 2WAQG 3U50C 3CMEA 4JYAQ 3PUZA 1VQMA 2JA5H 3CQZH 3T1HQ 3SGIA 1PHJA 2MQHA 4TQUS 1IBMQ 3M9BA 1OXTA 1Y1WH 2YYZA 5AJ3L 4KI0A 1NMFA 2JQOA 4ME3A 4JI2Q 1W2BA 4JC0A 1HNWQ 2PQAA 4A3JG 1HNXL 2E2JH 2UUBQ 2ZJQA 4HJ5A 3GTJH 3CC4A 4A3MG 4OO1I 1L1OB 1K0RA 3PIOA 1IBKL 3F2CA 4LF7L 1KRSA 5IP7H 1UE6A 1LTLA 1YZ6A 1U0LA 4YWKA 1KAWA 1J5EQ 2HT1A 1CKNA 4APVA 4YHHL 2N49A 1WI5A 2EXDA 4X62L 4A3FH 4JI8L 1CUKA 1D7QA 4DNIA 2NVYH 4DR5Q 1C0AA 4NXNL 3CCUA 2K52A 4BA1I 3H0GG 4C3JH 3W1BA 4DV5L 4A3KG 3HOVG 2IX1A 5EAYA 3I4MH 4GN4B 2NN6G 2R93G 4A3GH 5FLXc 3CPFA 4DV1L 3L2PA 1JJCB 1OXXK 1EUJA 2KHJA 4L5QA 4A3IG 3HOZG 1UE5A 2KENA 5M3FH 1V9PA 1Y1VG 1E1OA 4A3BG 4UP7A 1KC8C 1XNQQ 1N32Q 2I5HA 3MXNB 3W1GA 4P74A 4IFDJ 1C9OA 5C44G 2HHHL 4JI7L 1N33L 3FKIH 2H5XA 5LMNL 1X3GA 2D0PA 2XTIA 4GLAC 3ERSX 2UXDQ 1VCIA 4NXNQ 2VW9A 3CCQA 2VY3A 2E8GA 2AWOA 4AQYL 2Q2HA 1HNZL 4A3DH 3K81C 2K5HA 1WOCA 2VZAA 3PUWA 4LUOA 1NBWA 2CWPA 4DR1Q 4DUYL 4DR4Q 1I94L 3M4OH 3A74A 5LMUL 4DR3Q 5GAGC 3UDGA 1PH7A 1TWHH 5GAEC 4DV2Q 1QVGA 4JI4Q 3CCJA 1VQJA 4LFBQ 4IOCA 3I7FA 4KHZA 4OO1G 2N78A 3H0GH 4GN5A 3UDXA 3EIVA 5LMNQ 2MFIA 2UXDL 1PYBA 1IYJB 1Z9FA 1YIJA 4GKJL 2JA6G 2RCNA 1IL2A 4JYAL 1K83H 1C7YA 3L7ZC 3K7UC 3PF5A 3WWVA 1N32L 2I5MX 2UU9Q 1YJWA 4JI6Q 1TWGH 4DV3L 1OXVA 3TQYA 2Z0SA 3CCLA 4DV2L 1HZCA 3EBEA 3M7NA 4X6AH 1YVCA 1L1OA 3RLNA 4LFAL 2N8NA 3CW2C 5E7NA 1HZ9A 1I5FA 3TRZA 1PVOA 1B7YB 1X9NA 4Y7NH 4BY1G 1YITA 3GTOH 5JJLA 4NPSA 3DM3A 5M5YH 5IWAL 1W3SA 2UUCQ 5FJ8G 3KF6A 3NELA 2AWNA 2IHFA 5BR8L 4P73A 1KRTA 4A93H 2IY5B 4JBMA 3KLWA 2LXKA 1TXYA 2HIVA 1HZBA 2OQ0A 5FLMH 1CSQA 1PH6A 2PQAB 3NEMA 4OONA 1E7ZA 1UWVA 4PZ6A 4BBRG 2K14A 1ASYA 1VQ6A 3DLLA 3HOXH 4DR6L 3I4OA 2EIFA 5IYBG 1QVCA 4DV7L 1NE3A 3G4SA 2QEXA 4LFAQ 1SROA 1NY4A 4UP8A 3UDFA 4QY7A 5M3MG 4YWLA 4DV0Q 4DAYB 3RNUA 3STBC 5HY6A 3K8AA 4LF4L 3J7ZC 4UP9A 2PNHA 3PO3G 5IYDH 4PMWA 3J80i 5C4XG 4GKKQ 1WFQA 3HKSA 3HKZE 4K0KQ 4BY7G 3I2ZA 1SRUA 4A3JH 4HIOA 3U4ZA 4DR2L 1FJGL 3JAMi 2CWAA 5JEAJ 3G48A 4MNOA 3S17H 4A3EH 3CP0A 4KHPQ 3TREA 4IJHA 2B29A 2JA7H 1S3OA 1QZGA 1MJCA 2JA8G 4A3LH 3PO3H 3KYHC 4DR3L 1M90C 1JMCA 4JI5L 3TS0A 4GS3A 4DR1L 1K73C 4JI2L 4JI0Q 3FHWA 4LW1A 4R4CA 2NVTH 4GN3B 1WYDA 1FL0A 3A5UA 1CSPA 2WB1E 4YCUA 2F52A 4AH6A 5C0XI 5LMNW 4GNXC 1JB7A 4B3MQ 4A3CG 2N3SA 2OTJA 4IPHA 2YTYA 1N34L 3I4NG 1G6PA 4RG1A 3LGJA 3CCRA 4HJAA 3GDEA 4C2MH 1NTGA 2V1CC 2AKWB 3ULPA 1PH2A 3KJOA 4LF8L 1HR0Q 3U4VA 2Y0SG 2L15A 4HIMA 1SMXA 3T1YQ 2Q2UA 1L2FA 2Q2IA 1AE2A 3GO5A 3BU2A 4A3DG 2VL6A 4JV5L 4EQ5A 1YJ9A 2R93H 3RR5A 4A3EG 4A3CH 4WJ4A 3B6YA 3G71A 2NZOA 1HJPA 2XGTA 3ULLA 2K75A 3I4NH 4BBSG 1GKHA 4K0KL 1JE5A 3CD6A 4JI4L 3GTKH 3CC7A 3CAMA 3AQQA 3ZJYC 3CCMA 2BH8A 2HQLA 1HNWL 1HNXQ 4DV6L 3GTPH 3I56A 1HZAA 3F2BA 1AE3A 1VQEA 4AQYQ 1EIYB 1Q1EA 3HFZB 4B3ML 3S14H 1M1KC 3S1RH 3CCVA 1VQFA 3BZCA 3RN5A 4P71A 1R9TH 1RIPA 2KBNA 4PG3A 1YHAA 4PZ7A 1K8AC 1VQNA 4GLVB 3H3VI 1V43A 2UXCQ 1XJVA 1Y14B 4LFCQ 3UE0A 4GNXB 5FJ8H 2YV5A 1KIXA 2RHQB 3S1QH 1JJ2A 4IFDG 4X66L 2ZJPA 2RHSB 3RZOH 1IBKQ 1VQIA 3S24A 1B70B 4IPCA 4J15A 3STBD 4DV4Q 4C3IH 1XMQQ 2F4VQ 3HOWG 2JA6H 1XTDA 3RZDH 4POGA 3G6EA 1VQ4A 4PZ8A 4A75A 3PO2H 4LFCL 4TVAB 3CF5A 1N36L 2DGYA 2UXCL 4R4TA 1YHBA 4JV5Q 2NZHA 3J81i 1IBML 3RLOA 5BR8Q 3VDYA 5IYCG 4LF4Q 3HOWH 1E24A 4IOAA 4BXXG 4A3FG 1I3QH 1VS0A 4DK3C 1UE1A 1IBLQ 4A93G 5H1SE 3S2DH 5IP9G 1IZ6A 3S2HH 1N9WA 3PGZA 1MIUA 1WCMG 1Q8KA 2CQOA 2WFWA 3KOJA 1X65A 1N34Q 4DV7Q 4O0AA 5GADC 3F2DA 3S1NH 4KHPL 3GTLH 3KJPA 4YY3L 1N8RC 1D8LA 4IPGA 4JI3L 1PH5A 4LF9L 3OYYA 1Y1VH 3KDFA 4JBJA 2VQEL 3NENA 2R92G 4JI8Q 2ZTEA 4H02A 4LUVA 4R1JA 4POFA 1X56A 4DK6C 5M3MH 4BA2I 1J5EL 1U5KA 4JI0L 3PUVA 5C4XH 4KLKA 4JI5Q 5IYDG 2VQFL 4HJ8A 2JEBI 4BY7H 3HOYH 1SR3A 4DUZL 4NXMQ 1Q86C 4L5RC 1O7IA 2ATWA 3E9HA 4A3IH 1HNZQ 4HJ7A 2E2IH 4L5SA 3HOZH 1QUQB 1PH4A 3KDFB 1EWIA 2OCEA 4JI1Q 5JEAG 2MO1A 3IRBA 2WP8J 2IT1A 1MKHA 4GNXA 2Z6KC 2D62A 3PCOB 1WCMH 4IPDA 1SN8A 4X64L 3TS2A 2OQKA 1X54A 4QQBX 2BA0A 4DUZQ 2WB1G 4EX5A 2NVQH 4WJ3M 3AFQA 1RL2A 1KHIA 1E1TA 5LMUQ 2VUMH 5K36G 4YWMA 3PF4A 2A8VA 4DR4L 1VQOA 4P75A 1PA6A 4LF5Q 2OTLA 1E22A 2YU9H 1L0WA 3HOUG 1K9MC 4JI6L 3RN2A 2IX0A 1XPOA 1HH2P 3KF8B 4DAMA 1NMGA 2ZTCA 2LXJA 1YJNA 2VS1A 2ASBA 1BBUA 4X64Q 3S1MH 1X3FA 2Z6KA 2Y0SE 3KF6B 2F3IA 5IE8A 1PH8A 3HOYG 4A3GG 1GM5A 2UXBL 2ZM6L 4B3TL 2R7DA 1IXRA 2UUCL 1XPRA 2CKZB 1FVIA 4AYBE 3S16H 1G291 2R6GA 1EYGA 2JA9A 3PSIA 2DUDA 3JC66 4L5TA 1OTCA 1QUQA 4R4IA 2K5NA 4X65Q 1YEZA 2UU9L 1A8VA 1EIFA 4OX9L 1WJJA 3FKIG 2LSSA 1A0IA 1FGUA 1Q81C 2BH2A 3U58A 1AH9A 4DR6Q 3MEFA 2UXBQ 1DGSA 2CCZA 4GOPB 4OWXB 1LM0A 4BY1H 1S40A 2NN6I 4O2DA 2WAQE 1VQKA 3EN2A 4YHHQ 1Q1BA 4FDBA 5M3FG 4AYBG 2VQEQ 1QZHA 2I0QA 1HR0W 4DV4L 4JOIC 1XMOQ 1XMQL 1KQSA 4LF5L 3AEVA 4GKKL 1YNXA 4OXPA 5FLMG 4XIGS 3TEHB 3JAMc 2B63G 3T1YL 5C44H 2OWOA 1HR0L 3K0XA 3CMAA 4DR7Q 4X66Q 4B3SQ 1VQGA 1EFWA 4Y52H 1L1OC 3RLFA 2E2HH 4A3LG 2ID0A 4MZ9A 3Q8DA 3CC2A 3M3YH 3ER0A 1VQPA 2D0OA 2R7ZH 4MTNA 2R7FA 1JJGA 2A1AA 4IO9A 4JI1L 4OX9Q 5GROA 2B63H 4LUZA 1KL9A 4JOIA 4UPAA 3ICEA 4DV6Q 4LFBL 1I6HH 4YCVA 1JT8A 1PH1A 4DR7L 2MNAA 1BBWA 1SE8A 1T9HA 2R92H 3A5ZB 1XNRQ 3KFUA 2KCMA 4DV1Q 1I94Q 3OW2A 1VQ9A 4BXXH 4NB3A 4DV3Q 1Q82C 3GTQH 1VQAA 3J7A5 1PV4A 1CKNB 2E5LL 1OXUA 3PUXA 2JEAI 4B3RL 3UE1A 5C3EG 3CXCA 4JI7Q 1N33Q 1KD1C 4LF7Q 5IWAQ 3W5OA 2BA1A 2ZJRA 1CKMA 4JBWA 4DV0L 1SFOH 1Q46A 1NJIC 4JCVE 3D31A 3M4QA 3K80C 4BBSH 4IFDI 2IHEA 5ELOA 2ES2A 2EQSA 2RF4A 2R7ZG 2JK8A 4BBRH 4QL5A 5HGQA 1X3EA 2GVAA 1KXLA 2PMZE 2E5LQ 1N36Q 2NVXH 2AMCB 3PUYA 1P16A 3CPWA 4B3RQ 1A62A 2JJQA 1TWCH 1BKBA 1VQHA 1Q12A 1QVFA 4A3BH 2K4KA 3PV0A 4HIDA 4YCWA 1PYSB 3D0FA 1MJEA 3M85A 2ZTDA 4HIKA 4UY8C 2GVBA 2F4VL 1EOVA 1VQDA 2UUAQ 1EQRA 5J3BA 3E9IA 5GQOA 3HOVH 1XPUA 4A3KH 5C4JH 1Q7YC 3I4MG 2C35B 3GTMH 4P72A 2GN5A 2ZM6Q 2AHOB 3AYHB 4JI3Q 4LF9Q 2VUMG 3BJUA 5IT9c 2B3GA 3T1HL 1P8LA 4OWTB 1J6QA 4DPGA 4GLXA 2HHHQ 5M5XH 2PI2A 2QGQA 3L0OA 2JA8H 3GTGH 2VNUD 3PIPA 3HOUH 4X65L 1CKOA 4QIWE 2QA4A 1VQ8A 1GO3E 3OTOQ 2UUAL 5C0XJ 1XNRL 3I55A 4LNQA 1A63A 1S72A 2CFMA 2ALYB 3S15H 4DUYQ 4OWWB 1X55A 1E3PA 4AIMA 2KHIA 1UEBA 3F1ZA 4RMFA 1XMOL 1K8GA 1BVSA 4DR5L 3GD7A 1H95A 1OXSC 4X62Q 5AJ3Q 3H15A 5GAHC 1PH9A 4LF6Q 4LWCA 1GD7A 3HKZG 4A76A 4DR2Q 1FJGQ 3ULJA 2YTVA 2PI2E 3CCSA 4ALPA 1TWFH 2YTXA 2I5LX 1VQ5A 3E0EA 1UE7A 1YHQA 4B3SL 1XNQL 5M5WH 5IYCH 3OTOL 4R4OA 5DLQE 3J81c 3CCEA 3NBHB 4JG2A 1ASZA 4GOPC 2KCTA 3AFPA 4A4IA 1YI2A 1IBLL 2JE6I 1V1QA 3K7AH 4DKAC 3A0JA 5ELNA 3J80c 2K5VA 5IP9H 1VQ7A 4JBKA 1PFSA 2VQFQ 2A19A 2Q2TA 1LYLA 5JJKA 2K50A 4GOPA 5JJIA 4B3TQ 4QGUA 3J81j 4DV5Q 1K3RA 3M4PA 3F8TA 5IY0A 4A3MH 4LF6L 1Z47A 3BZKA 3UDIA 1GVPA 5IP7G 4YY3Q 4R4QA 4QJFA 1PH3A 1I50H 2HIXA 4IJLA 4XTCS 2JA5G 1EQQA 1VQBA 1Y1WG 1LUZA 4NXML 3PO2G 5C0XG 4LF8Q 2UUBL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MO0 A;  3FP9 A;  5C3E H;  3H3V H;  4C3H H;  1YBY A;  1G51 A;  5IYB H;  1SLJ A;  4HJ9 A;  1VQC A;  1TWA H;  3HOX G;  2JA7 G;  4GKJ Q;  1VQL A;  2FXQ A;  1B8A A;  1X6O A;  2WAQ G;  3U50 C;  3CME A;  4JYA Q;  3PUZ A;  1VQM A;  2JA5 H;  3CQZ H;  3T1H Q;  3SGI A;  1PHJ A;  2MQH A;  4TQU S;  1IBM Q;  3M9B A;  1OXT A;  1Y1W H;  2YYZ A;  5AJ3 L;  4KI0 A;  1NMF A;  2JQO A;  4ME3 A;  4JI2 Q;  1W2B A;  4JC0 A;  1HNW Q;  2PQA A;  4A3J G;  1HNX L;  2E2J H;  2UUB Q;  2ZJQ A;  4HJ5 A;  3GTJ H;  3CC4 A;  4A3M G;  4OO1 I;  1L1O B;  1K0R A;  3PIO A;  1IBK L;  3F2C A;  4LF7 L;  1KRS A;  5IP7 H;  1UE6 A;  1LTL A;  1YZ6 A;  1U0L A;  4YWK A;  1KAW A;  1J5E Q;  2HT1 A;  1CKN A;  4APV A;  4YHH L;  2N49 A;  1WI5 A;  2EXD A;  4X62 L;  4A3F H;  4JI8 L;  1CUK A;  1D7Q A;  4DNI A;  2NVY H;  4DR5 Q;  1C0A A;  4NXN L;  3CCU A;  2K52 A;  4BA1 I;  3H0G G;  4C3J H;  3W1B A;  4DV5 L;  4A3K G;  3HOV G;  2IX1 A;  5EAY A;  3I4M H;  4GN4 B;  2NN6 G;  2R93 G;  4A3G H;  5FLX c;  3CPF A;  4DV1 L;  3L2P A;  1JJC B;  1OXX K;  1EUJ A;  2KHJ A;  4L5Q A;  4A3I G;  3HOZ G;  1UE5 A;  2KEN A;  5M3F H;  1V9P A;  1Y1V G;  1E1O A;  4A3B G;  4UP7 A;  1KC8 C;  1XNQ Q;  1N32 Q;  2I5H A;  3MXN B;  3W1G A;  4P74 A;  4IFD J;  1C9O A;  5C44 G;  2HHH L;  4JI7 L;  1N33 L;  3FKI H;  2H5X A;  5LMN L;  1X3G A;  2D0P A;  2XTI A;  4GLA C;  3ERS X;  2UXD Q;  1VCI A;  4NXN Q;  2VW9 A;  3CCQ A;  2VY3 A;  2E8G A;  2AWO A;  4AQY L;  2Q2H A;  1HNZ L;  4A3D H;  3K81 C;  2K5H A;  1WOC A;  2VZA A;  3PUW A;  4LUO A;  1NBW A;  2CWP A;  4DR1 Q;  4DUY L;  4DR4 Q;  1I94 L;  3M4O H;  3A74 A;  5LMU L;  4DR3 Q;  5GAG C;  3UDG A;  1PH7 A;  1TWH H;  5GAE C;  4DV2 Q;  1QVG A;  4JI4 Q;  3CCJ A;  1VQJ A;  4LFB Q;  4IOC A;  3I7F A;  4KHZ A;  4OO1 G;  2N78 A;  3H0G H;  4GN5 A;  3UDX A;  3EIV A;  5LMN Q;  2MFI A;  2UXD L;  1PYB A;  1IYJ B;  1Z9F A;  1YIJ A;  4GKJ L;  2JA6 G;  2RCN A;  1IL2 A;  4JYA L;  1K83 H;  1C7Y A;  3L7Z C;  3K7U C;  3PF5 A;  3WWV A;  1N32 L;  2I5M X;  2UU9 Q;  1YJW A;  4JI6 Q;  1TWG H;  4DV3 L;  1OXV A;  3TQY A;  2Z0S A;  3CCL A;  4DV2 L;  1HZC A;  3EBE A;  3M7N A;  4X6A H;  1YVC A;  1L1O A;  3RLN A;  4LFA L;  2N8N A;  3CW2 C;  5E7N A;  1HZ9 A;  1I5F A;  3TRZ A;  1PVO A;  1B7Y B;  1X9N A;  4Y7N H;  4BY1 G;  1YIT A;  3GTO H;  5JJL A;  4NPS A;  3DM3 A;  5M5Y H;  5IWA L;  1W3S A;  2UUC Q;  5FJ8 G;  3KF6 A;  3NEL A;  2AWN A;  2IHF A;  5BR8 L;  4P73 A;  1KRT A;  4A93 H;  2IY5 B;  4JBM A;  3KLW A;  2LXK A;  1TXY A;  2HIV A;  1HZB A;  2OQ0 A;  5FLM H;  1CSQ A;  1PH6 A;  2PQA B;  3NEM A;  4OON A;  1E7Z A;  1UWV A;  4PZ6 A;  4BBR G;  2K14 A;  1ASY A;  1VQ6 A;  3DLL A;  3HOX H;  4DR6 L;  3I4O A;  2EIF A;  5IYB G;  1QVC A;  4DV7 L;  1NE3 A;  3G4S A;  2QEX A;  4LFA Q;  1SRO A;  1NY4 A;  4UP8 A;  3UDF A;  4QY7 A;  5M3M G;  4YWL A;  4DV0 Q;  4DAY B;  3RNU A;  3STB C;  5HY6 A;  3K8A A;  4LF4 L;  3J7Z C;  4UP9 A;  2PNH A;  3PO3 G;  5IYD H;  4PMW A;  3J80 i;  5C4X G;  4GKK Q;  1WFQ A;  3HKS A;  3HKZ E;  4K0K Q;  4BY7 G;  3I2Z A;  1SRU A;  4A3J H;  4HIO A;  3U4Z A;  4DR2 L;  1FJG L;  3JAM i;  2CWA A;  5JEA J;  3G48 A;  4MNO A;  3S17 H;  4A3E H;  3CP0 A;  4KHP Q;  3TRE A;  4IJH A;  2B29 A;  2JA7 H;  1S3O A;  1QZG A;  1MJC A;  2JA8 G;  4A3L H;  3PO3 H;  3KYH C;  4DR3 L;  1M90 C;  1JMC A;  4JI5 L;  3TS0 A;  4GS3 A;  4DR1 L;  1K73 C;  4JI2 L;  4JI0 Q;  3FHW A;  4LW1 A;  4R4C A;  2NVT H;  4GN3 B;  1WYD A;  1FL0 A;  3A5U A;  1CSP A;  2WB1 E;  4YCU A;  2F52 A;  4AH6 A;  5C0X I;  5LMN W;  4GNX C;  1JB7 A;  4B3M Q;  4A3C G;  2N3S A;  2OTJ A;  4IPH A;  2YTY A;  1N34 L;  3I4N G;  1G6P A;  4RG1 A;  3LGJ A;  3CCR A;  4HJA A;  3GDE A;  4C2M H;  1NTG A;  2V1C C;  2AKW B;  3ULP A;  1PH2 A;  3KJO A;  4LF8 L;  1HR0 Q;  3U4V A;  2Y0S G;  2L15 A;  4HIM A;  1SMX A;  3T1Y Q;  2Q2U A;  1L2F A;  2Q2I A;  1AE2 A;  3GO5 A;  3BU2 A;  4A3D G;  2VL6 A;  4JV5 L;  4EQ5 A;  1YJ9 A;  2R93 H;  3RR5 A;  4A3E G;  4A3C H;  4WJ4 A;  3B6Y A;  3G71 A;  2NZO A;  1HJP A;  2XGT A;  3ULL A;  2K75 A;  3I4N H;  4BBS G;  1GKH A;  4K0K L;  1JE5 A;  3CD6 A;  4JI4 L;  3GTK H;  3CC7 A;  3CAM A;  3AQQ A;  3ZJY C;  3CCM A;  2BH8 A;  2HQL A;  1HNW L;  1HNX Q;  4DV6 L;  3GTP H;  3I56 A;  1HZA A;  3F2B A;  1AE3 A;  1VQE A;  4AQY Q;  1EIY B;  1Q1E A;  3HFZ B;  4B3M L;  3S14 H;  1M1K C;  3S1R H;  3CCV A;  1VQF A;  3BZC A;  3RN5 A;  4P71 A;  1R9T H;  1RIP A;  2KBN A;  4PG3 A;  1YHA A;  4PZ7 A;  1K8A C;  1VQN A;  4GLV B;  3H3V I;  1V43 A;  2UXC Q;  1XJV A;  1Y14 B;  4LFC Q;  3UE0 A;  4GNX B;  5FJ8 H;  2YV5 A;  1KIX A;  2RHQ B;  3S1Q H;  1JJ2 A;  4IFD G;  4X66 L;  2ZJP A;  2RHS B;  3RZO H;  1IBK Q;  1VQI A;  3S24 A;  1B70 B;  4IPC A;  4J15 A;  3STB D;  4DV4 Q;  4C3I H;  1XMQ Q;  2F4V Q;  3HOW G;  2JA6 H;  1XTD A;  3RZD H;  4POG A;  3G6E A;  1VQ4 A;  4PZ8 A;  4A75 A;  3PO2 H;  4LFC L;  4TVA B;  3CF5 A;  1N36 L;  2DGY A;  2UXC L;  4R4T A;  1YHB A;  4JV5 Q;  2NZH A;  3J81 i;  1IBM L;  3RLO A;  5BR8 Q;  3VDY A;  5IYC G;  4LF4 Q;  3HOW H;  1E24 A;  4IOA A;  4BXX G;  4A3F G;  1I3Q H;  1VS0 A;  4DK3 C;  1UE1 A;  1IBL Q;  4A93 G;  5H1S E;  3S2D H;  5IP9 G;  1IZ6 A;  3S2H H;  1N9W A;  3PGZ A;  1MIU A;  1WCM G;  1Q8K A;  2CQO A;  2WFW A;  3KOJ A;  1X65 A;  1N34 Q;  4DV7 Q;  4O0A A;  5GAD C;  3F2D A;  3S1N H;  4KHP L;  3GTL H;  3KJP A;  4YY3 L;  1N8R C;  1D8L A;  4IPG A;  4JI3 L;  1PH5 A;  4LF9 L;  3OYY A;  1Y1V H;  3KDF A;  4JBJ A;  2VQE L;  3NEN A;  2R92 G;  4JI8 Q;  2ZTE A;  4H02 A;  4LUV A;  4R1J A;  4POF A;  1X56 A;  4DK6 C;  5M3M H;  4BA2 I;  1J5E L;  1U5K A;  4JI0 L;  3PUV A;  5C4X H;  4KLK A;  4JI5 Q;  5IYD G;  2VQF L;  4HJ8 A;  2JEB I;  4BY7 H;  3HOY H;  1SR3 A;  4DUZ L;  4NXM Q;  1Q86 C;  4L5R C;  1O7I A;  2ATW A;  3E9H A;  4A3I H;  1HNZ Q;  4HJ7 A;  2E2I H;  4L5S A;  3HOZ H;  1QUQ B;  1PH4 A;  3KDF B;  1EWI A;  2OCE A;  4JI1 Q;  5JEA G;  2MO1 A;  3IRB A;  2WP8 J;  2IT1 A;  1MKH A;  4GNX A;  2Z6K C;  2D62 A;  3PCO B;  1WCM H;  4IPD A;  1SN8 A;  4X64 L;  3TS2 A;  2OQK A;  1X54 A;  4QQB X;  2BA0 A;  4DUZ Q;  2WB1 G;  4EX5 A;  2NVQ H;  4WJ3 M;  3AFQ A;  1RL2 A;  1KHI A;  1E1T A;  5LMU Q;  2VUM H;  5K36 G;  4YWM A;  3PF4 A;  2A8V A;  4DR4 L;  1VQO A;  4P75 A;  1PA6 A;  4LF5 Q;  2OTL A;  1E22 A;  2YU9 H;  1L0W A;  3HOU G;  1K9M C;  4JI6 L;  3RN2 A;  2IX0 A;  1XPO A;  1HH2 P;  3KF8 B;  4DAM A;  1NMG A;  2ZTC A;  2LXJ A;  1YJN A;  2VS1 A;  2ASB A;  1BBU A;  4X64 Q;  3S1M H;  1X3F A;  2Z6K A;  2Y0S E;  3KF6 B;  2F3I A;  5IE8 A;  1PH8 A;  3HOY G;  4A3G G;  1GM5 A;  2UXB L;  2ZM6 L;  4B3T L;  2R7D A;  1IXR A;  2UUC L;  1XPR A;  2CKZ B;  1FVI A;  4AYB E;  3S16 H;  1G29 1;  2R6G A;  1EYG A;  2JA9 A;  3PSI A;  2DUD A;  3JC6 6;  4L5T A;  1OTC A;  1QUQ A;  4R4I A;  2K5N A;  4X65 Q;  1YEZ A;  2UU9 L;  1A8V A;  1EIF A;  4OX9 L;  1WJJ A;  3FKI G;  2LSS A;  1A0I A;  1FGU A;  1Q81 C;  2BH2 A;  3U58 A;  1AH9 A;  4DR6 Q;  3MEF A;  2UXB Q;  1DGS A;  2CCZ A;  4GOP B;  4OWX B;  1LM0 A;  4BY1 H;  1S40 A;  2NN6 I;  4O2D A;  2WAQ E;  1VQK A;  3EN2 A;  4YHH Q;  1Q1B A;  4FDB A;  5M3F G;  4AYB G;  2VQE Q;  1QZH A;  2I0Q A;  1HR0 W;  4DV4 L;  4JOI C;  1XMO Q;  1XMQ L;  1KQS A;  4LF5 L;  3AEV A;  4GKK L;  1YNX A;  4OXP A;  5FLM G;  4XIG S;  3TEH B;  3JAM c;  2B63 G;  3T1Y L;  5C44 H;  2OWO A;  1HR0 L;  3K0X A;  3CMA A;  4DR7 Q;  4X66 Q;  4B3S Q;  1VQG A;  1EFW A;  4Y52 H;  1L1O C;  3RLF A;  2E2H H;  4A3L G;  2ID0 A;  4MZ9 A;  3Q8D A;  3CC2 A;  3M3Y H;  3ER0 A;  1VQP A;  2D0O A;  2R7Z H;  4MTN A;  2R7F A;  1JJG A;  2A1A A;  4IO9 A;  4JI1 L;  4OX9 Q;  5GRO A;  2B63 H;  4LUZ A;  1KL9 A;  4JOI A;  4UPA A;  3ICE A;  4DV6 Q;  4LFB L;  1I6H H;  4YCV A;  1JT8 A;  1PH1 A;  4DR7 L;  2MNA A;  1BBW A;  1SE8 A;  1T9H A;  2R92 H;  3A5Z B;  1XNR Q;  3KFU A;  2KCM A;  4DV1 Q;  1I94 Q;  3OW2 A;  1VQ9 A;  4BXX H;  4NB3 A;  4DV3 Q;  1Q82 C;  3GTQ H;  1VQA A;  3J7A 5;  1PV4 A;  1CKN B;  2E5L L;  1OXU A;  3PUX A;  2JEA I;  4B3R L;  3UE1 A;  5C3E G;  3CXC A;  4JI7 Q;  1N33 Q;  1KD1 C;  4LF7 Q;  5IWA Q;  3W5O A;  2BA1 A;  2ZJR A;  1CKM A;  4JBW A;  4DV0 L;  1SFO H;  1Q46 A;  1NJI C;  4JCV E;  3D31 A;  3M4Q A;  3K80 C;  4BBS H;  4IFD I;  2IHE A;  5ELO A;  2ES2 A;  2EQS A;  2RF4 A;  2R7Z G;  2JK8 A;  4BBR H;  4QL5 A;  5HGQ A;  1X3E A;  2GVA A;  1KXL A;  2PMZ E;  2E5L Q;  1N36 Q;  2NVX H;  2AMC B;  3PUY A;  1P16 A;  3CPW A;  4B3R Q;  1A62 A;  2JJQ A;  1TWC H;  1BKB A;  1VQH A;  1Q12 A;  1QVF A;  4A3B H;  2K4K A;  3PV0 A;  4HID A;  4YCW A;  1PYS B;  3D0F A;  1MJE A;  3M85 A;  2ZTD A;  4HIK A;  4UY8 C;  2GVB A;  2F4V L;  1EOV A;  1VQD A;  2UUA Q;  1EQR A;  5J3B A;  3E9I A;  5GQO A;  3HOV H;  1XPU A;  4A3K H;  5C4J H;  1Q7Y C;  3I4M G;  2C35 B;  3GTM H;  4P72 A;  2GN5 A;  2ZM6 Q;  2AHO B;  3AYH B;  4JI3 Q;  4LF9 Q;  2VUM G;  3BJU A;  5IT9 c;  2B3G A;  3T1H L;  1P8L A;  4OWT B;  1J6Q A;  4DPG A;  4GLX A;  2HHH Q;  5M5X H;  2PI2 A;  2QGQ A;  3L0O A;  2JA8 H;  3GTG H;  2VNU D;  3PIP A;  3HOU H;  4X65 L;  1CKO A;  4QIW E;  2QA4 A;  1VQ8 A;  1GO3 E;  3OTO Q;  2UUA L;  5C0X J;  1XNR L;  3I55 A;  4LNQ A;  1A63 A;  1S72 A;  2CFM A;  2ALY B;  3S15 H;  4DUY Q;  4OWW B;  1X55 A;  1E3P A;  4AIM A;  2KHI A;  1UEB A;  3F1Z A;  4RMF A;  1XMO L;  1K8G A;  1BVS A;  4DR5 L;  3GD7 A;  1H95 A;  1OXS C;  4X62 Q;  5AJ3 Q;  3H15 A;  5GAH C;  1PH9 A;  4LF6 Q;  4LWC A;  1GD7 A;  3HKZ G;  4A76 A;  4DR2 Q;  1FJG Q;  3ULJ A;  2YTV A;  2PI2 E;  3CCS A;  4ALP A;  1TWF H;  2YTX A;  2I5L X;  1VQ5 A;  3E0E A;  1UE7 A;  1YHQ A;  4B3S L;  1XNQ L;  5M5W H;  5IYC H;  3OTO L;  4R4O A;  5DLQ E;  3J81 c;  3CCE A;  3NBH B;  4JG2 A;  1ASZ A;  4GOP C;  2KCT A;  3AFP A;  4A4I A;  1YI2 A;  1IBL L;  2JE6 I;  1V1Q A;  3K7A H;  4DKA C;  3A0J A;  5ELN A;  3J80 c;  2K5V A;  5IP9 H;  1VQ7 A;  4JBK A;  1PFS A;  2VQF Q;  2A19 A;  2Q2T A;  1LYL A;  5JJK A;  2K50 A;  4GOP A;  5JJI A;  4B3T Q;  4QGU A;  3J81 j;  4DV5 Q;  1K3R A;  3M4P A;  3F8T A;  5IY0 A;  4A3M H;  4LF6 L;  1Z47 A;  3BZK A;  3UDI A;  1GVP A;  5IP7 G;  4YY3 Q;  4R4Q A;  4QJF A;  1PH3 A;  1I50 H;  2HIX A;  4IJL A;  4XTC S;  2JA5 G;  1EQQ A;  1VQB A;  1Y1W G;  1LUZ A;  4NXM L;  3PO2 G;  5C0X G;  4LF8 Q;  2UUB L; 
#chains in the Genus database with same CATH topology
 2PZU A;  4C3H H;  3VR6 A;  2JA7 G;  4GKJ Q;  4MIU A;  1Y1W H;  1OXT A;  2DN8 A;  1TS5 A;  1SXT A;  1BO0 A;  3GTJ B;  1VF5 C;  5HGT A;  4IUR A;  2EY2 A;  1HNW Q;  4A3J G;  4HJ5 A;  4OO1 I;  1JWS D;  1K0R A;  1IBK L;  1KRS A;  5IGG A;  1U0L A;  1K83 B;  2B2V A;  3BYT B;  1J5E Q;  1H9R A;  1CHQ D;  2EXD A;  1B4O A;  4JI8 L;  4ZLT F;  3DM1 A;  1D7Q A;  4L6T B;  1ZKO A;  1DOL A;  3NHH A;  4BA1 I;  1IYU A;  4LK1 C;  4A3K G;  4MHE A;  2IX1 A;  3KF8 A;  4A3G H;  4DV1 L;  3L2P A;  1OXX K;  2OXP A;  4L5Q A;  4A3I G;  2YU9 B;  3HOZ G;  3D4W A;  1PTO D;  2KEN A;  2B8F A;  3SDZ A;  4A3B G;  4FVM A;  1RD9 D;  4F8M A;  3DWQ A;  2HHH L;  4JI7 L;  2H5X A;  2UXD Q;  3ERS X;  2KHS A;  2VY3 A;  3D4R A;  1QOH A;  4AQY L;  4IUN A;  3K81 C;  1BOS A;  1NCV A;  1R4Q B;  4DR4 Q;  3S2D B;  3PIO 3;  3M4O H;  3A74 A;  4XT1 B;  5J39 A;  5GAG C;  1PH7 A;  5IGE A;  5IGF A;  1JCK B;  2XN9 C;  3UDX A;  1IYJ B;  1YIJ A;  3H91 A;  4K2L A;  3P20 A;  1EQT A;  4JYA L;  1K83 H;  1C7Y A;  3N6R A;  2I5M X;  1JR0 D;  2UU9 Q;  3FRP B;  1L1O A;  4QUC A;  4IQZ A;  2N8N A;  3SK5 A;  1HZ9 A;  1X9N A;  1QCB D;  4Y7N H;  1SBB B;  5IWA L;  4HR7 B;  4IUQ A;  2UUC Q;  4A93 H;  2IY5 B;  3NUC A;  2LXK A;  2B2W A;  5FLX E;  2HIV A;  1IHZ A;  1SJE D;  1XTC D;  5ISR A;  1B53 A;  1NE3 A;  4C3H B;  1NY4 A;  1SRO A;  3UDF A;  4YWL A;  4DAY B;  5EKK A;  5HY6 A;  3QIA A;  3J7Z C;  1QB5 D;  5C4X G;  4GKK Q;  1LTT D;  2DNC A;  1MHW C;  1PFN A;  3HKS A;  2M2L A;  3I2Z A;  2CWA A;  3VA5 A;  1R9T B;  3QR8 A;  5ELF A;  1YNJ C;  2TSS A;  3O13 A;  1L0Y B;  2JA8 G;  3KYH C;  4JI5 L;  4DR1 L;  3H6M A;  4IZ8 A;  4JI2 L;  3FHW A;  4R4C A;  1LTA D;  4IAL A;  1E0B A;  3A8J E;  1JB3 A;  4AH6 A;  1JB7 A;  1K8O A;  3I4N G;  1G6P A;  2K5W A;  3IAY A;  1CT1 D;  3LGJ A;  2V1C C;  1AEX A;  3WOF A;  2Y0S G;  4TKO B;  1STA A;  1ZXT A;  4HIM A;  3QOJ A;  1L2F A;  1AE2 A;  2JSO A;  3HOU B;  4JV5 L;  2B2V C;  3OW7 A;  1W6K A;  3RR5 A;  2NYZ D;  1I4H A;  3I4N H;  3GTK H;  3CAM A;  2M00 A;  3AQQ A;  3C1E A;  4V19 0;  2QEJ C;  1AE3 A;  4K2K A;  1VQE A;  2CH4 W;  1Q1E A;  3MFG A;  1ONL A;  1JWU D;  3Q24 A;  3S1R H;  3SVM A;  1VQN A;  4KK7 A;  1V43 A;  1XJV A;  5CV6 A;  3UE0 A;  5FJ8 H;  5J22 A;  1KIX A;  3S1Q H;  1BNZ A;  4X66 L;  1IBK Q;  5KGU A;  1VQI A;  3DHQ A;  3NXW A;  4TSS A;  1AZQ A;  2JA6 H;  5C5M A;  1F9S A;  1SFO B;  3PO2 H;  4KD4 A;  5C4Z A;  3BS1 A;  2J4X A;  1SYG A;  2EPB A;  2ENB A;  4RGN A;  1N36 L;  1A3T A;  2UXC L;  2NZH A;  5EPL A;  1S5D D;  1V8Q A;  1A2U A;  4BXX G;  4A3F G;  4DK3 C;  1UE1 A;  4CKC A;  5H1S E;  5IP9 G;  1IYV A;  2O5I C;  2RBM A;  1EIG A;  2Y0S B;  2SNM A;  2SEB D;  3GTL H;  4X3T A;  3NBI A;  4B9X A;  1CHP D;  4JI3 L;  4LF9 L;  1GOZ A;  3NEN A;  1C8C A;  5M3M H;  1X56 A;  4DK6 C;  1I4Q A;  1J5E L;  1U5K A;  4ZUI A;  4KLK A;  5IYD G;  4HJ8 A;  2JEB I;  2CQA A;  4BY7 H;  3VYS A;  4DUZ L;  4HCE A;  2IWH A;  1S5C D;  4HJ7 A;  4A3F B;  3KDF B;  5JEA G;  2MO1 A;  1LTI D;  1IW7 D;  2IT1 A;  2KQ3 A;  1F2L A;  1SN8 A;  2KUM A;  3TS2 A;  2E2J B;  2K5D A;  4DN4 M;  3NQI A;  3AMU A;  4ODG A;  1V1P B;  4DR4 L;  2JXM B;  2Z9H A;  2CH4 A;  1PA6 A;  4LF5 Q;  3D6W A;  2OTL A;  1BR9 A;  3NK9 A;  1K9M C;  3RN2 A;  4DAM A;  2BE5 D;  2ZTC A;  2ASB A;  2VS1 A;  2XRS D;  3J81 L;  2J7Z A;  1PTO F;  1JWM D;  2CKZ B;  1FVI A;  4AYB E;  1PRT D;  3J7A V;  4QB4 A;  1SAP A;  2UU9 L;  4X65 Q;  4F87 A;  4OX9 L;  1Q81 C;  3CRK C;  4DR6 Q;  1DD2 A;  2A68 D;  4DK0 A;  4LAA A;  4OWX B;  1LM0 A;  1WCM B;  3FVQ A;  4BY1 H;  4JPB W;  4NW2 A;  3BYY B;  1VQK A;  5M3F G;  4AYB G;  1HR0 W;  4DV4 L;  1XMQ L;  1B3A A;  1CTM A;  4N8F A;  4G7H C;  2B63 G;  3T1Y L;  2AQ2 B;  4ZQ3 A;  3CMA A;  1ET6 A;  2K1B A;  2EYJ A;  4B3S Q;  2G9H D;  3BVM A;  1EFW A;  1L1O C;  5T1G A;  3RLF A;  2QIL A;  2E2H H;  3I4N B;  4CJ2 C;  4A3L G;  5C4X B;  3TZD A;  1NAP A;  3M3Y H;  3X3N A;  4NKL A;  1WD0 A;  4MTN A;  2R7F A;  4IO9 A;  2B63 H;  1Y8P B;  1YNJ D;  5CV4 A;  4DV6 Q;  3T13 A;  1JT8 A;  4YCV A;  2MNA A;  1BBW A;  4OL7 A;  4C2M B;  3K7A B;  4OHJ A;  3A5Z B;  1HQR D;  1NR2 A;  3NP8 A;  1I94 Q;  3OW2 A;  2K01 A;  4UDU C;  3MFY A;  4DV3 Q;  1HUM A;  2AQ1 B;  4Q0F A;  3HGB A;  2JEA I;  2PZW A;  3AB9 A;  3QB3 A;  2EYO A;  3E3X A;  3W5O A;  3AU7 A;  2ZJR A;  1Q46 A;  4JCV E;  3K80 C;  4BBS H;  1TS2 A;  2IHE A;  1JOQ A;  2EQS A;  3LWU A;  4ZKC B;  4CGY B;  2GVA A;  1E2W A;  3OOC A;  3L3O C;  3TDQ A;  4CDF C;  2E5L Q;  3BDO A;  3CPW A;  3KLR A;  1JOO A;  4BBR B;  4A3B H;  2RSO A;  4YCW A;  1PYS B;  1QG7 A;  3R3O A;  3DUZ A;  2E76 C;  4UAI A;  4OIJ A;  1CK1 A;  5GQO A;  4C3J G;  2VB3 X;  3GTM H;  4P72 A;  1J8I A;  4FO2 A;  3BZD B;  4A3B B;  1GJX A;  2HHH Q;  4GLX A;  1D2B A;  4RHR A;  3HP3 A;  4K6L A;  1X32 A;  4XXE A;  4KJN A;  1EY7 A;  2JYO A;  1H9J A;  1RTN A;  1VQ8 A;  2UUA L;  1A63 A;  1PZK D;  1S72 A;  2ALY B;  3V05 A;  4AIM A;  3ERQ A;  4BBS B;  2KHI A;  1UEB A;  4RMF A;  1AZP A;  3LX0 A;  3A54 A;  3VR4 A;  4X62 Q;  5AJ3 Q;  1PH9 A;  2EE1 A;  4LF6 Q;  4LWC A;  1GD7 A;  4DR2 Q;  2YTV A;  2BDO A;  2PI2 E;  2V4D A;  3QG1 A;  1BCP B;  1YHQ A;  4HTH A;  5M5W H;  3URY A;  4HAE A;  5HUR A;  3J81 c;  3CCE A;  1EYD A;  4JG2 A;  1ASZ A;  3A56 A;  2PW7 A;  3A0J A;  5ELN A;  3J80 c;  2K5V A;  4JBK A;  4L63 B;  2WKD A;  2ZT9 C;  3Q6S A;  1ET9 A;  5JJK A;  2K50 A;  4GOP A;  3R93 A;  4B3T Q;  3J81 j;  1A3V A;  4RGO S;  2F0V A;  5IP7 G;  1KDC A;  1NSN S;  2HIX A;  1ICF B;  1VQB A;  5DM7 3;  1BCP F;  2UUB L;  3FP9 A;  3F2U A;  3H3V H;  1CA5 A;  1G51 A;  4C3J B;  2K6A A;  3MXU A;  1TWA H;  3SK4 A;  3J80 L;  3HOX G;  1EEF D;  2FXQ A;  1X6O A;  3I70 A;  4JYA Q;  3PUZ A;  3CQZ H;  1PHJ A;  3SGI A;  2MQH A;  1TU2 B;  2NWG A;  4KI0 A;  3T53 B;  4V0B A;  4JI2 Q;  3I90 A;  1W2B A;  2NVQ B;  1TY2 A;  2ZJQ A;  1F9P A;  3CC4 A;  1O7L A;  3PIO A;  4LF7 L;  3C1F A;  1RTO A;  3F2C A;  5IP7 H;  1PRT C;  1KAW A;  5CV5 A;  4APV A;  4X62 L;  2NVY H;  1STE A;  1KDA A;  1EWH A;  4DV5 L;  3H0G G;  4C3J H;  2KEC A;  5EAY A;  1H9S B;  4GN4 B;  1JJC B;  1EUJ A;  4DNR B;  1SMY C;  1V9P A;  1Y1V G;  1E1O A;  2CW0 C;  3K59 A;  3H09 A;  1N33 L;  3FKI H;  2D2C C;  5LMN L;  1X3G A;  3QO2 A;  5NUC A;  4GLA C;  2DJF C;  2VW9 A;  2AWO A;  2Q2H A;  1Q90 A;  2XSC A;  3FEW X;  4A3D H;  1Z7T A;  1RF2 D;  4LUO A;  1DOK A;  1O7Z A;  4DR1 Q;  3NSW A;  4DUY L;  1I94 L;  4RAU C;  2WKC A;  4HCS A;  5M5W B;  5LMU L;  1K3B C;  3UDG A;  4RCO A;  4RGM A;  1TWH H;  1QVG A;  1SYB A;  3CCJ A;  4LFB Q;  4OO1 G;  2N78 A;  3D6C A;  3H0G H;  1KAB A;  3BDL A;  2UXD L;  2JA6 G;  4F88 A;  3JAM L;  4C3I B;  2C5C A;  3PF5 A;  4JI6 Q;  1TWG H;  3TQY A;  2IJ0 A;  4I65 A;  5IOC A;  4DV2 L;  5FKA C;  3NQT A;  3TRZ A;  4FNF A;  1I5F A;  2QKI C;  3DM3 A;  1W3S A;  2EYF A;  2AWN A;  4P73 A;  3K5N A;  3KLW A;  3V96 A;  5I2X A;  4JK1 C;  1SE2 A;  3Q22 A;  2OQ0 A;  2A73 B;  5FLM H;  1CSQ A;  4S3S A;  1H9S A;  4OON A;  1UWV A;  4BBR G;  2F0W A;  1ILP A;  2OF1 A;  1A3U A;  3NPP A;  1QVC A;  2F0Q A;  2KED A;  4QIW B;  1MBY A;  2M9V A;  3OIQ A;  1HQM C;  5M3M G;  3D8G A;  1Y69 U;  2FFK B;  3K8A A;  4LF4 L;  4KV6 A;  1F77 A;  5IYD H;  4PMW A;  2WAQ B;  3HKZ E;  3HZX A;  3OWE B;  4HIO A;  3CHB D;  1FJG L;  1XX8 A;  5FO9 B;  5JEA J;  5KIX A;  3CP0 A;  3TRE A;  1B9N A;  4IJH A;  4R9W A;  1EY8 A;  4H13 C;  1JMC A;  4GS3 A;  1K73 C;  3MZ5 A;  1STN A;  3LWE A;  2EZV A;  4H0L C;  1FL0 A;  4EQO A;  4L8J A;  1HHV A;  2XVS A;  4XYQ A;  1AFP A;  2WB1 E;  4H44 C;  4KY5 A;  3J7A F;  1H9M A;  1STB A;  5LMN W;  2N3S A;  4IPH A;  5E1F A;  1CQF A;  4RG1 A;  3TZU A;  1W6J A;  3GDE A;  1NTG A;  2EYP A;  4C2M H;  4LF8 L;  2Q2U A;  5C4H A;  4A3D G;  2PCF B;  3NBH A;  4XQN A;  5DAU A;  2R93 H;  2FMC A;  3GTG B;  2MHV A;  2NZO A;  1HJP A;  2K03 A;  1SNP A;  1GKH A;  5IT9 E;  1JE5 A;  3CD6 A;  2QDB A;  3ZJY C;  3A8K E;  3TP8 A;  2FMM A;  1B50 A;  1HNW L;  2MJ8 A;  4XDX A;  4FXD A;  3GTP H;  5A35 A;  3F2B A;  4XQQ A;  1LTR D;  5IOD A;  1EIY B;  2BDN A;  3HFZ B;  3FDT A;  1EY6 A;  1G6Z A;  2EJG C;  4FXK C;  4P71 A;  1XXG A;  1R9T H;  1PTO C;  4UHV A;  3H94 A;  4LFC Q;  3NTH A;  3DWA A;  5KYL A;  4GNX B;  2YV5 A;  4OEM B;  2RHQ B;  2RDF A;  4Z9C B;  4OIK A;  1L0X B;  4DV4 Q;  4J15 A;  1XMQ Q;  3STB D;  4C3I H;  1VQ4 A;  4PZ8 A;  5C3W A;  1D1I A;  5CR3 A;  3CF5 A;  3T4A C;  4R4T A;  1YHB A;  1HPC A;  4JV5 Q;  1EY5 A;  5BR8 Q;  5IYC G;  4LF4 Q;  1E24 A;  2OEO A;  5EQ0 A;  4IOA A;  4A93 B;  1IBL Q;  4CDD C;  5BN4 A;  3K0Y A;  1IZ6 A;  3S2H H;  1N9W A;  1EY4 A;  4QF4 A;  4Y7N B;  1Q8K A;  1WTO A;  1X65 A;  1D6E C;  4DV7 Q;  3F2D A;  2F0G A;  3SK8 A;  2D5D A;  5KYI A;  3S1N H;  1OO9 B;  4YY3 L;  1N8R C;  1S4Z A;  1LAC A;  1CA6 A;  2R92 G;  4JI8 Q;  2ZTE A;  4H02 A;  5EGT A;  4POF A;  2PZT A;  4JW0 A;  4HSP A;  5IGB A;  1KLU D;  4G7O C;  2LY7 A;  4NXM Q;  4L5R C;  5IT9 L;  1WVL A;  1CI3 M;  1B2T A;  5LHY 1;  5CBE E;  4A3I H;  3HOZ H;  4L5S A;  2OT2 A;  4M1U B;  3IL8 A;  1PH4 A;  5ELE A;  2N55 A;  3S1M B;  1EYC A;  5EBD A;  4CJ1 B;  2IL8 A;  1MKH A;  2Z6K C;  5K5P A;  2D62 A;  3PCO B;  4IPD A;  3ND9 A;  1MSH A;  5KEE A;  4CHT B;  3OHX C;  5KNC A;  1EYA A;  3PMF A;  4DUZ Q;  3I72 A;  1SND A;  2NVQ H;  1I4R A;  1U4M A;  1E1T A;  2VUM H;  5K36 G;  4HSV A;  3VA7 A;  3D3R A;  2YU9 H;  1L0W A;  3GP7 A;  2IX0 A;  2LS0 1;  5D3I B;  3RD4 A;  1NMG A;  4LF8 Q;  4X64 Q;  1TWA B;  5IE8 A;  3KF6 B;  2UXB L;  1GM5 A;  1EU4 A;  3MVV A;  3KLS A;  4KD3 A;  2EDG A;  3RZD B;  2UUC L;  2MP1 A;  4JVZ A;  4DNT B;  1KAA A;  1PFM A;  3E5S A;  4R4I A;  2HCI A;  2Q8I B;  5LL6 S;  1X3P A;  2CCZ A;  5JVH 3;  2O4X A;  2EY1 A;  4IUV A;  1Y1W B;  3S14 B;  2HUG A;  2Q8T A;  4YHH Q;  1Q1B A;  2I0Q A;  4LF5 L;  1XMO Q;  5DNF A;  2DNE A;  4EQP A;  4GKK L;  3JAM c;  4A3I B;  3HOZ B;  4DR7 Q;  1JIC A;  1FNV A;  4RH6 A;  5JOB A;  1J9O A;  3VR2 A;  1JQY D;  4LJZ C;  2ID0 A;  1EY0 A;  3OPO A;  2XRQ D;  2B2Y C;  1I50 B;  5IGD A;  2A1A A;  2E2D C;  4OX9 Q;  3S15 B;  1KL9 A;  4JOI A;  4UPA A;  4C1N K;  1KLG D;  1K8M A;  4C1N I;  3HG9 A;  2R61 A;  4K14 A;  1IW7 C;  3TSS A;  4N8X 1;  3E6Z X;  2KCM A;  2L11 A;  4DV1 Q;  1TR5 A;  1SDF A;  1I3Q B;  1NNX A;  4DK1 A;  3GTQ H;  4IUP A;  2DY7 A;  5FO7 B;  2B8G A;  2RCF A;  4B3R L;  5C3E G;  1VF7 A;  5C4J B;  4JI7 Q;  3HOV B;  1HTL D;  2VXW A;  2WII B;  1DYQ A;  4FXG C;  1CKM A;  4JBW A;  4DV0 L;  4YIJ A;  5CV9 A;  2O2L D;  2KCC A;  5KRU A;  1I4P A;  3BDC A;  2ES2 A;  2RF4 A;  1PZI D;  2F1M A;  5CV7 A;  1X3E A;  1KXL A;  3NTK A;  2NUC A;  4FF1 A;  4O42 A;  4ZUJ A;  1N36 Q;  2CVR A;  1SYE A;  2F03 A;  2PPB C;  1VQH A;  1Q12 A;  2K4K A;  3PV0 A;  1JOR A;  2X69 A;  3D0F A;  4RCN A;  1O78 A;  4HIK A;  2GVB A;  3GTM B;  1EOV A;  2WAC A;  1ESR A;  1ML0 D;  2L12 A;  5J3B A;  2K04 A;  3E9I A;  1H9K A;  3HOV H;  4ZKB B;  2IW3 A;  3A8I E;  3D4D A;  5C4J H;  2MPM A;  2HCC A;  2GN5 A;  3HRZ C;  2RQX A;  4JI3 Q;  4LF9 Q;  3BJU A;  2B3G A;  3T1H L;  1IKL A;  4KTA A;  5BN3 A;  5FOB B;  4OWT B;  1J6Q A;  2A6E C;  2JA8 H;  5M5X H;  2QGQ A;  2QF7 A;  3GTO B;  3PIP A;  3VYU A;  3TN2 A;  3IFD A;  5CMD A;  3GV6 A;  2MUY A;  2CFM A;  3S15 H;  4G4K A;  4DUY Q;  2F0D A;  1GHJ A;  1X55 A;  4OWW B;  1U4L A;  1XMO L;  1BVS A;  3GD7 A;  1H95 A;  4IUT A;  3M3Y B;  5D3D A;  2E2H B;  3ULJ A;  2F4I A;  1GUW A;  1TWF H;  2YTX A;  2I5L X;  1VQ5 A;  3E0E A;  2CHB D;  3KUP A;  1JE4 A;  3M4O B;  1ENC A;  4R4O A;  5DLQ E;  2EYL A;  2KCT A;  1IBL L;  1DM0 B;  2R92 B;  3K7A H;  5IP9 H;  3T16 A;  1LT5 D;  3S17 B;  5JJI A;  1G2S A;  3M4P A;  5IY0 A;  4A3M H;  2B63 B;  4LF6 L;  3UDI A;  1GVP A;  3A7A B;  1YNN C;  1R4P B;  4R4Q A;  4YY3 Q;  1PDQ A;  4IJL A;  1LT6 D;  5D65 A;  1EZ8 A;  4KKS A;  5M3F B;  1A15 A;  4ABN A;  1LTG D;  2MO0 A;  3I4M B;  5C3E H;  1YBY A;  1ZYR C;  1NUC A;  1B8A A;  2WAQ G;  3CME A;  3T1H Q;  1IBM Q;  4TQU S;  3M9B A;  2YYZ A;  3BVZ A;  5AJ3 L;  1F9R A;  1GHK A;  3DXJ C;  2JQO A;  3CU7 A;  5M5Y B;  4CKB A;  1HNX L;  2E2J H;  2UUB Q;  3GTJ H;  4A3M G;  2F0M A;  4KKU A;  1UE6 A;  1RKN A;  1EIH A;  2R3Z A;  1KTK A;  4YHH L;  1WI5 A;  4A3F H;  1CUK A;  4DNI A;  4DR5 Q;  1C0A A;  2A6H C;  3DWP A;  4NXN L;  3CCU A;  3EQL C;  3W1B A;  2H4O A;  5KND A;  3HOV G;  3VYR A;  2NN6 G;  5G3L F;  2R93 G;  5FLX c;  3CPF A;  1PV4 A;  1Q8I A;  1UE5 A;  5CC4 A;  2A69 C;  4UP7 A;  1N32 Q;  4N9P A;  4P74 A;  1C9O A;  5C44 G;  4IFD J;  3MAQ A;  4A3D B;  3GTL B;  3S1N B;  1VCI A;  2EY6 A;  2E8G A;  3FKI B;  1HNZ L;  2K5H A;  2VZA A;  1MSG A;  3S2H B;  1NBW A;  5I2Y A;  3SHL A;  5GAE C;  4JI4 Q;  1VQJ A;  4ZYS A;  4IOC A;  3I7F A;  4KHZ A;  1SSO A;  5LMN Q;  5A2Q E;  1PYB A;  1AN8 A;  1Z9F A;  3CKI B;  2RCN A;  4EVO A;  3L7Z C;  1BCP C;  3K7U C;  3MC0 B;  1YJW A;  4DV3 L;  1OXV A;  3EBE A;  3RLN A;  2X6L A;  3CW2 C;  3IKJ A;  4LFA L;  3S1Q B;  3Q23 A;  5JJL A;  2F0T A;  5M5Y H;  4GZY C;  5FJ8 G;  1WTQ A;  5BR8 L;  4RHS A;  5IIF A;  2F0H A;  1HZB A;  1E7Z A;  1CFM A;  1ASY A;  3DLL A;  1BQQ T;  3C2P A;  3I4O A;  2EIF A;  4DV7 L;  3BVG A;  1PZJ D;  1KNA A;  3G4S A;  4UP8 A;  3OIP A;  4DV0 Q;  1LV9 A;  3STB C;  4UP9 A;  1K28 A;  3MTS A;  3PO3 G;  1A6X A;  2LMC B;  1ESF A;  4K0K Q;  2FHT A;  4BY7 G;  2NVX B;  4A3J H;  1SRU A;  5ELD A;  1TQO A;  4DR2 L;  3I91 A;  4R8I A;  1UNS A;  3G48 A;  4EQN A;  1E2Z A;  2G5D A;  3S17 H;  4A3E H;  4KHP Q;  2B29 A;  2GA4 B;  1S3O A;  2EXZ A;  1QZG A;  4A3L H;  3PO3 H;  4P2C B;  1M90 C;  4U67 3;  3TS0 A;  2G9D A;  3J81 E;  5A2Q L;  5COR A;  2TMP A;  4GN3 B;  1SNQ A;  1WYD A;  2F3V A;  1VDZ A;  2NN6 H;  1CSP A;  1STG A;  3EVQ A;  1MI2 A;  4YCU A;  5BN5 A;  2F52 A;  5FLX L;  5C0X I;  4GNX C;  4B3M Q;  1DOM A;  2KCN A;  1FNU A;  2OTJ A;  3CCR A;  4HJA A;  1G8Z D;  2F0E A;  3ULP A;  1PH2 A;  1HR0 Q;  1K0S A;  4G7Z C;  2F0J A;  1SMX A;  3T1Y Q;  1C4Q A;  1QIL A;  3GO5 A;  2E74 C;  1SYF A;  3K5L A;  1YJ9 A;  5ELC A;  4A3E G;  2JA8 B;  3G71 A;  3SE0 A;  4BBS G;  4JI4 L;  1MD2 D;  5JJZ A;  2NVT B;  4ILW A;  2A5H A;  4DV6 L;  2PQE A;  4QUF A;  3ERO A;  4AQY Q;  3MXN A;  1M1K C;  3ZYY X;  3CCV A;  3UI2 A;  3BZC A;  2Z8L A;  4PZ7 A;  4PG3 A;  2KBN A;  3H3V I;  2HQE A;  4GLV B;  4DFA A;  1Y14 B;  1F9Q A;  2RHS B;  2F4V Q;  3HOW G;  4POG A;  3G6E A;  2A74 C;  4K6D A;  3I3C A;  2L9H A;  3J81 i;  3RLO A;  3VDY A;  5JPM C;  4I7Z C;  1TWH B;  2L4N A;  1ENA A;  3HOW H;  1BUV T;  1I3Q H;  1PMR A;  1S5E D;  2EVB A;  3S2D H;  3PGZ A;  1MIU A;  3KOJ A;  1N34 Q;  2Z4H A;  4QCL A;  5FK9 C;  1C48 A;  4O0A A;  5GAD C;  1CQV A;  4PMC A;  1BXT A;  4KHP L;  3KJP A;  2BCO A;  1D8L A;  1TII D;  1PH5 A;  1G91 A;  4JBJ A;  4OEL B;  2ZXP A;  2RKS A;  4R1J A;  1I6V C;  3PUV A;  2RA4 A;  5C4X H;  1TS3 A;  2VQF L;  3J7Y W;  3HOY H;  1SR3 A;  3M7G A;  4A3G B;  1Q86 C;  3HOY B;  3NWT A;  1O7I A;  2ATW A;  2E2I H;  2NVY B;  4RGT A;  1FGB D;  5EKL A;  2ICI A;  3IRB A;  4GNX A;  3A55 A;  3I8Z A;  4KY7 A;  1X54 A;  3FMC A;  1PFB A;  2BA0 A;  3ND8 A;  1EY9 A;  4WJ3 M;  5LMU Q;  4YWM A;  4CDC C;  5I6Y A;  4AYB B;  1TY0 A;  2CW0 D;  4Q5V A;  5FO8 B;  1VQO A;  3HOW B;  1WTH A;  1E22 A;  1LLR D;  4WFN 3;  4JI6 L;  2F0L A;  1SEB D;  1X3F A;  3HOY G;  2Y0S E;  4A3G G;  4B3T L;  4KN4 C;  1UUP A;  4EGV A;  3W2D A;  4KY6 A;  1DJR D;  3T56 B;  4DXG A;  3S16 H;  3T51 B;  2R6G A;  2JA9 A;  3PSI A;  2DUD A;  4L5T A;  3Q0A A;  1SE3 A;  1EIF A;  1WJJ A;  2F3W A;  3MEF A;  4GOP B;  3I73 A;  1S40 A;  2NN6 I;  4F7X A;  3EN2 A;  3S1M H;  2VQE Q;  1LT4 D;  3AEV A;  1YNX A;  4OXP A;  5FLM G;  4XIG S;  4NMZ A;  1IL8 A;  1QNU A;  3TEH B;  2Z1C A;  2WV6 D;  2OWO A;  1HUN A;  5TSS A;  1KNE A;  1VQG A;  4Y52 H;  3ITP A;  4J1M A;  5LL6 X;  2B2U C;  4MZ9 A;  4IFD H;  3CC2 A;  2SOB A;  1VQP A;  3MA2 B;  4ZCK A;  5CBA E;  2R7Z H;  1EZ6 A;  4JI1 L;  4ZAI A;  4LUZ A;  3ICE A;  2C9O A;  1PH1 A;  4WRD A;  1QNK A;  2K32 A;  1SE8 A;  1T9H A;  3L9A X;  1XNR Q;  1AP0 A;  1ZEQ X;  1Z6H A;  2JN4 A;  1VQ9 A;  4BXX H;  3J7A 5;  3V2T A;  2B2W C;  1U4P A;  1OXU A;  3PUX A;  2NTS A;  2BOS A;  2EJM A;  3R8B A;  3K5M A;  1N33 Q;  4LF7 Q;  4A3K B;  5IWA Q;  2BA1 A;  1G2T A;  4HMI A;  4N9T A;  1NJI C;  4FYD A;  3M4Q A;  2PW5 A;  1XYI A;  4KMU C;  4A3E B;  5ELO A;  2R7Z G;  4DF7 A;  4BBR H;  5HGQ A;  2QCP X;  4XYO A;  4A3J B;  1RHP A;  2AMC B;  1P16 A;  4B3R Q;  1A62 A;  4X3U A;  1BKB A;  4ME5 A;  4HID A;  1BCP D;  1MJE A;  3M85 A;  1O80 A;  2F4V L;  1II3 A;  4CKE A;  1VQD A;  1EQR A;  5I4D A;  1M8A A;  3I4M G;  2A68 C;  1Y8O B;  4HN7 A;  2C35 B;  2LFN A;  2K28 A;  2ZM6 Q;  5IT9 c;  3FPU B;  1KDB A;  1TWC B;  2EY5 A;  4HMJ A;  3L0O A;  2AUJ D;  3GTG H;  2R93 B;  5E4X A;  2D9U A;  2VNU D;  3VR5 A;  3HOU H;  2KA7 A;  4ZRZ A;  1GO3 E;  3OTO Q;  1EQV A;  1EOT A;  1XNR L;  3I55 A;  4K5V A;  4OGQ C;  5COY A;  1VMC A;  1UEA B;  1TKW B;  3U9S A;  4DR5 L;  1XWE A;  2HD3 A;  1OXS C;  4I7A A;  3JAM E;  1I4X A;  4K8I A;  3GV3 A;  4WJW A;  1TVX A;  3HKZ G;  4A76 A;  3NTI A;  2L55 A;  3CCS A;  5DM6 3;  4IUU A;  5C44 B;  4TRD A;  5IYC H;  5ELB A;  3IFT A;  3NBH B;  3TP7 A;  3OSO A;  4GOP C;  3KBG A;  1T5X D;  1V1Q A;  2JE6 I;  2E75 C;  5F2D A;  2XWB B;  4DKA C;  1VQ7 A;  2NZ1 D;  4KJO A;  2A19 A;  2Q2T A;  1LYL A;  1LT3 D;  2B2U A;  1PH3 A;  5JEA H;  4RKB A;  3WOE A;  4XTC S;  2JA5 G;  3H3V C;  1EQQ A;  1EWC A;  1SYD A;  1LUZ A;  4NXM L;  3PO2 G;  1A2T A;  1HA6 A;  5IYB H;  3TBI B;  1SLJ A;  4HJ9 A;  1VQC A;  1GXD C;  3VR3 A;  1VQL A;  3U50 C;  1VQM A;  2JA5 H;  1NMF A;  4ME3 A;  4JC0 A;  2PQA A;  2Z6B A;  1L1O B;  1O7Y A;  1LTL A;  1YZ6 A;  3S16 B;  4YWK A;  4CJ0 B;  2JA5 B;  2HT1 A;  1CKN A;  2N49 A;  2SNS A;  2Z4I A;  1B3Q A;  2B39 A;  5G3L D;  2K52 A;  3H0G B;  1HXY D;  3I4M H;  3HS0 C;  3J80 E;  2KHJ A;  1HRJ A;  4DXF A;  4BY7 B;  5M3F H;  1PLF A;  3QOL A;  2NB0 A;  1XNQ Q;  1QE6 A;  1STH A;  1KC8 C;  1IKM A;  3G6J B;  2I5H A;  3MXN B;  3W1G A;  5JVG 3;  2KOL A;  2D0P A;  2XTI A;  4NXN Q;  3K5O A;  3CCQ A;  4K8J A;  5EBC A;  3KK7 A;  1WOC A;  2F0I A;  1I4G A;  2P5Z X;  2CWP A;  3PUW A;  2K05 A;  4DR3 Q;  2LKV A;  2ICE C;  4DV2 Q;  1BDO A;  1U4R A;  4RA8 A;  1V1O A;  4DAV A;  3PIP 3;  4GN5 A;  3EIV A;  2QDL A;  2RVL A;  1WTR A;  2MFI A;  5JPN C;  4GKJ L;  1IL2 A;  1PRT F;  4C3I G;  1SE4 A;  2JA6 B;  1Y1V B;  1N32 L;  1T5E A;  3WWV A;  2Z0S A;  3CCL A;  2WB1 B;  1HZC A;  3M7N A;  4X6A H;  1YVC A;  1PVO A;  5E7N A;  1B7Y B;  4BY1 G;  1YIT A;  3GTO H;  2DJG C;  4NPS A;  1D5X C;  3NE5 B;  5M5X B;  3KF6 A;  3NEL A;  2IHF A;  1KRT A;  4JBM A;  1TXY A;  4DA2 A;  4ZK9 B;  1PH6 A;  3CQZ B;  2PQA B;  3NEM A;  4PZ6 A;  2K14 A;  3DEO A;  3DMU A;  1VQ6 A;  1LTB D;  2ZXO A;  3HOX H;  4DR6 L;  5IYB G;  1RJT A;  2Q8R E;  3HKZ B;  4KN7 C;  2QEX A;  4LFA Q;  5JAV A;  4QY7 A;  3RNU A;  1HCZ A;  1HFN A;  3K6O A;  2PNH A;  3J80 i;  4WOR A;  1F2M A;  1S5B D;  4BWG B;  1WFQ A;  1GUS A;  5C0X H;  3U4Z A;  4HED A;  4R8N A;  3JAM i;  1VMP A;  3RUZ A;  1CM9 A;  4MNO A;  2JA7 H;  4PMB A;  1MJC A;  3MHB A;  4DR3 L;  4X3K A;  5EKI A;  2F0F A;  4JI0 Q;  1RCV D;  2I46 A;  2AQ3 B;  4LW1 A;  2NVT H;  1EL0 A;  5C5L A;  1ILQ A;  5M9O A;  3A5U A;  1WTW A;  4DU9 A;  3CRL C;  5EJW A;  5K36 H;  2KEE A;  1E2V A;  1ROD A;  4A3C G;  1FNW A;  2YTY A;  5DEH A;  1N34 L;  2O5J C;  1EFI D;  3P75 A;  2AKW B;  3KJO A;  2VB2 X;  1UAP A;  3U4V A;  2L15 A;  2Q2I A;  3BU2 A;  1F2Z A;  2VL6 A;  4EQ5 A;  4O1N A;  4WJ4 A;  4A3C H;  3B6Y A;  2XGT A;  4NDX A;  3ULL A;  2K75 A;  3QWN A;  5EPJ A;  1FD7 D;  4K0K L;  1D5M C;  1SNM A;  3CC7 A;  1DZ1 A;  1STY A;  4OO1 H;  3CCM A;  3OMG A;  4NP5 A;  2BH8 A;  1M4V A;  2RSN A;  2HQL A;  1HNX Q;  1TS4 A;  3I56 A;  1HZA A;  1S5F D;  1CZG A;  3PO3 B;  3TME A;  2I07 B;  2F0O A;  4B3M L;  3S14 H;  2PNR C;  3S9W A;  1EU3 A;  2K33 A;  1VQF A;  3RN5 A;  1BF4 A;  3LNN A;  1RIP A;  1YHA A;  5L37 A;  1GUO A;  2RDH A;  3ONA B;  1K8A C;  2UXC Q;  4XT3 B;  4IFD G;  5KNB A;  1JJ2 A;  2ZJP A;  3RZO H;  3S24 A;  1B70 B;  1FYC A;  4IPC A;  1JOK A;  4RKL A;  3R2I A;  4BS9 A;  4DAY A;  1XTD A;  2L5T A;  3RZD H;  4A75 A;  4LFC L;  3HOX B;  4TVA B;  2IPK D;  2DGY A;  2NTT A;  3P1H A;  1IBM L;  1TT2 A;  4FP5 D;  3MXP A;  4XQJ A;  2B2Y A;  4J8Q A;  1WTV A;  1VS0 A;  4A93 G;  2VUM B;  3M4Y A;  1F2Y A;  1WCM G;  2JP1 A;  2CQO A;  2WFW A;  3C46 A;  4RWS C;  3MWY W;  2RDG A;  1ZYR D;  4PNY A;  4KHV A;  4FF3 A;  4IPG A;  1AW7 A;  2EYH A;  3OYY A;  1Y1V H;  3KDF A;  3W3A A;  2VQE L;  4LUV A;  4BA2 I;  1HA5 A;  4JI0 L;  2E2I B;  2KJX A;  4JI5 Q;  5CV8 A;  1B9M A;  2EYM A;  1MGS A;  1DCZ A;  3OWF A;  2HDL A;  5I9P A;  3E9H A;  1HNZ Q;  1QUQ B;  2AUK A;  1EWI A;  2OCE A;  4JI1 Q;  1PTO B;  1WTP A;  2WP8 J;  1LAB A;  1LTS D;  3QJY A;  5E3F A;  1WCM H;  4BY1 B;  2X6G A;  4X64 L;  2F0U A;  2OQK A;  4MN3 A;  4C56 C;  4QQB X;  4K5X A;  3EFX D;  2WB1 G;  4EX5 A;  3AFQ A;  1RL2 A;  1KHI A;  1B1Z A;  1ICW A;  2DY8 A;  3K57 A;  3PF4 A;  4B9W A;  2A8V A;  2MGS A;  4E6I A;  2A69 D;  4P75 A;  2F0N A;  4IN3 A;  3GQB A;  3HOU G;  2L0C A;  1XPO A;  1HH2 P;  3KF8 B;  3I4L A;  4FF4 A;  2LXJ A;  1YJN A;  1Y8N B;  1BBU A;  1RDP D;  2Z6K A;  3EJI A;  1PH8 A;  2F3I A;  1CZW A;  4QMG A;  2ZM6 L;  3TP6 A;  2R7D A;  3G7L A;  1IXR A;  1XPR A;  5CGK A;  2NBF A;  1G29 1;  1EYG A;  3JC6 6;  1X3Q A;  5EPK A;  1OTC A;  1QUQ A;  2K5N A;  1YEZ A;  1A8V A;  2BH2 A;  3FKI G;  2LSS A;  1A0I A;  1FGU A;  3DEP A;  1DXM A;  3P7J A;  3U58 A;  1AH9 A;  4DAP A;  2UXB Q;  2QW7 A;  1DGS A;  3VYT A;  3X3M A;  1SYC A;  1U9R A;  2KVM A;  2SDF A;  5I6W A;  4O2D A;  3BG3 A;  2WAQ E;  3MXG A;  1PTO H;  2EJF C;  3SEB A;  2XIW A;  4FDB A;  1QZH A;  4JOI C;  1KQS A;  3GTP B;  5AFW A;  5CYU A;  1BBX C;  2H1E A;  5IGC A;  5C44 H;  5C3E B;  4MTK A;  1HR0 L;  3K0X A;  2BE5 C;  4X66 Q;  2HDM A;  4M8A A;  2N88 A;  3Q8D A;  4H7B A;  3SXH A;  2FIN B;  3ER0 A;  2D0O A;  5M3M B;  1JJG A;  3WDN A;  2IX3 A;  1YNN D;  5GRO A;  4A3M B;  5J1Z A;  1GUG A;  2K7V A;  5C3X A;  4LFB L;  1I6H H;  3HEJ A;  4DR7 L;  4FF2 A;  2A6H D;  2R92 H;  3A7L A;  3KFU A;  1WTX A;  1PYW D;  5I9O A;  3NWS A;  1NR4 A;  4NB3 A;  1SNC A;  1Q82 C;  1VQA A;  3K58 A;  1CKN B;  5C6A A;  1TWF B;  2E5L L;  4B08 A;  1ENF A;  3UE1 A;  2PO4 A;  3CXC A;  1LO5 D;  2PMZ B;  1KD1 C;  3OMC A;  1SFO H;  2PYK A;  3PO2 B;  5E4W C;  3D31 A;  1QJO A;  4IFD I;  1HTP A;  4PQX A;  3KBX A;  2JK8 A;  3RZO B;  2XNA C;  4J6H A;  4QL5 A;  2F0P A;  2EOT A;  2PMZ E;  4K5W A;  2NVX H;  3PUY A;  2JJQ A;  4LMQ D;  1HFG A;  1D5Z C;  1TWC H;  4DGZ A;  2A6E D;  1QVF A;  4ULL A;  3S1R B;  1FR3 A;  2ZTD A;  4UY8 C;  2F0K A;  2UUA Q;  4U68 A;  3N52 A;  3EA6 A;  4RFB A;  1XPU A;  5D14 A;  2XWJ B;  4A3K H;  1Q7Y C;  2L1B A;  1GUN A;  3E0J A;  2J0T D;  2AHO B;  3AYH B;  3FPP A;  3GTK B;  2F0S A;  2VUM G;  2ZXR A;  3SK6 A;  1P8L A;  3RMH A;  4DPG A;  2PI2 A;  2K5Q A;  1WD1 A;  4X65 L;  1CKO A;  4QIW E;  2QA4 A;  3R2T A;  4CDE C;  5C0X J;  4KKT A;  4X3S A;  4LNQ A;  1TWG B;  1I6H B;  1EEI D;  1SJH D;  1V1P A;  2WIN B;  1E3P A;  3F1Z A;  3U9O A;  3PQI A;  1K8G A;  4ID6 A;  1GUT A;  1SMY D;  4C3H G;  5GAH C;  3H15 A;  1FJG Q;  1SNO A;  1DON A;  1PRT B;  4ALP A;  1JC7 A;  1UE7 A;  3GTQ B;  1Q3L A;  4B3S L;  1B44 D;  1XNQ L;  3OTO L;  2B2T A;  3AFP A;  4A4I A;  2B2T C;  1YI2 A;  1PXU A;  2JA7 B;  1PFS A;  3SR1 A;  2VQF Q;  1QWY A;  4QGU A;  5T1I A;  1K3R A;  4G57 A;  3F8T A;  4DV5 Q;  1Z47 A;  3BZK A;  4PV1 C;  3TP5 A;  2R7Z B;  4QJF A;  1I50 H;  4CBV A;  3KLS X;  3C3L A;  1Y1W G;  1D1K A;  2FJ2 A;  5C0X G;  3MEH A; 
#chains in the Genus database with same CATH homology
 2MO0 A;  3FP9 A;  5C3E H;  3H3V H;  4C3H H;  1YBY A;  1G51 A;  5IYB H;  1SLJ A;  4HJ9 A;  1VQC A;  1TWA H;  3HOX G;  2JA7 G;  4GKJ Q;  1VQL A;  2FXQ A;  1B8A A;  1X6O A;  2WAQ G;  3U50 C;  3CME A;  4JYA Q;  3PUZ A;  1VQM A;  2JA5 H;  3CQZ H;  3T1H Q;  3SGI A;  1PHJ A;  2MQH A;  4TQU S;  1IBM Q;  3M9B A;  1OXT A;  1Y1W H;  2YYZ A;  5AJ3 L;  4KI0 A;  1NMF A;  2JQO A;  4ME3 A;  4JI2 Q;  1W2B A;  4JC0 A;  1HNW Q;  2PQA A;  4A3J G;  1HNX L;  2E2J H;  2UUB Q;  2ZJQ A;  4HJ5 A;  3GTJ H;  3CC4 A;  4A3M G;  4OO1 I;  1L1O B;  1K0R A;  3PIO A;  1IBK L;  3F2C A;  4LF7 L;  1KRS A;  5IP7 H;  1UE6 A;  1LTL A;  1YZ6 A;  1U0L A;  4YWK A;  1KAW A;  1J5E Q;  2HT1 A;  1CKN A;  4APV A;  4YHH L;  2N49 A;  1WI5 A;  2EXD A;  4X62 L;  4A3F H;  4JI8 L;  1CUK A;  1D7Q A;  4DNI A;  2NVY H;  4DR5 Q;  1C0A A;  4NXN L;  3CCU A;  2K52 A;  4BA1 I;  3H0G G;  4C3J H;  3W1B A;  4DV5 L;  4A3K G;  3HOV G;  2IX1 A;  5EAY A;  3I4M H;  4GN4 B;  2NN6 G;  2R93 G;  4A3G H;  5FLX c;  3CPF A;  4DV1 L;  3L2P A;  1JJC B;  1OXX K;  1EUJ A;  2KHJ A;  4L5Q A;  4A3I G;  3HOZ G;  1UE5 A;  2KEN A;  5M3F H;  1V9P A;  1Y1V G;  1E1O A;  4A3B G;  4UP7 A;  1KC8 C;  1XNQ Q;  1N32 Q;  2I5H A;  3MXN B;  3W1G A;  4P74 A;  4IFD J;  1C9O A;  5C44 G;  2HHH L;  4JI7 L;  1N33 L;  3FKI H;  2H5X A;  5LMN L;  1X3G A;  2D0P A;  2XTI A;  4GLA C;  3ERS X;  2UXD Q;  1VCI A;  4NXN Q;  2VW9 A;  3CCQ A;  2VY3 A;  2E8G A;  2AWO A;  4AQY L;  2Q2H A;  1HNZ L;  4A3D H;  3K81 C;  2K5H A;  1WOC A;  2VZA A;  3PUW A;  4LUO A;  1NBW A;  2CWP A;  4DR1 Q;  4DUY L;  4DR4 Q;  1I94 L;  3M4O H;  3A74 A;  5LMU L;  4DR3 Q;  5GAG C;  3UDG A;  1PH7 A;  1TWH H;  5GAE C;  4DV2 Q;  1QVG A;  4JI4 Q;  3CCJ A;  1VQJ A;  4LFB Q;  4IOC A;  3I7F A;  4KHZ A;  4OO1 G;  2N78 A;  3H0G H;  4GN5 A;  3UDX A;  3EIV A;  5LMN Q;  2MFI A;  2UXD L;  1PYB A;  1IYJ B;  1Z9F A;  1YIJ A;  4GKJ L;  2JA6 G;  2RCN A;  1IL2 A;  4JYA L;  1K83 H;  1C7Y A;  3L7Z C;  3K7U C;  3PF5 A;  3WWV A;  1N32 L;  2I5M X;  2UU9 Q;  1YJW A;  4JI6 Q;  1TWG H;  4DV3 L;  1OXV A;  3TQY A;  2Z0S A;  3CCL A;  4DV2 L;  1HZC A;  3EBE A;  3M7N A;  4X6A H;  1YVC A;  1L1O A;  3RLN A;  4LFA L;  2N8N A;  3CW2 C;  5E7N A;  1HZ9 A;  1I5F A;  3TRZ A;  1PVO A;  1B7Y B;  1X9N A;  4Y7N H;  4BY1 G;  1YIT A;  3GTO H;  5JJL A;  4NPS A;  3DM3 A;  5M5Y H;  5IWA L;  1W3S A;  2UUC Q;  5FJ8 G;  3KF6 A;  3NEL A;  2AWN A;  2IHF A;  5BR8 L;  4P73 A;  1KRT A;  4A93 H;  2IY5 B;  4JBM A;  3KLW A;  2LXK A;  1TXY A;  2HIV A;  1HZB A;  2OQ0 A;  5FLM H;  1CSQ A;  1PH6 A;  2PQA B;  3NEM A;  4OON A;  1E7Z A;  1UWV A;  4PZ6 A;  4BBR G;  2K14 A;  1ASY A;  1VQ6 A;  3DLL A;  3HOX H;  4DR6 L;  3I4O A;  2EIF A;  5IYB G;  1QVC A;  4DV7 L;  1NE3 A;  3G4S A;  2QEX A;  4LFA Q;  1SRO A;  1NY4 A;  4UP8 A;  3UDF A;  4QY7 A;  5M3M G;  4YWL A;  4DV0 Q;  4DAY B;  3RNU A;  3STB C;  5HY6 A;  3K8A A;  4LF4 L;  3J7Z C;  4UP9 A;  2PNH A;  3PO3 G;  5IYD H;  4PMW A;  3J80 i;  5C4X G;  4GKK Q;  1WFQ A;  3HKS A;  3HKZ E;  4K0K Q;  4BY7 G;  3I2Z A;  1SRU A;  4A3J H;  4HIO A;  3U4Z A;  4DR2 L;  1FJG L;  3JAM i;  2CWA A;  5JEA J;  3G48 A;  4MNO A;  3S17 H;  4A3E H;  3CP0 A;  4KHP Q;  3TRE A;  4IJH A;  2B29 A;  2JA7 H;  1S3O A;  1QZG A;  1MJC A;  2JA8 G;  4A3L H;  3PO3 H;  3KYH C;  4DR3 L;  1M90 C;  1JMC A;  4JI5 L;  3TS0 A;  4GS3 A;  4DR1 L;  1K73 C;  4JI2 L;  4JI0 Q;  3FHW A;  4LW1 A;  4R4C A;  2NVT H;  4GN3 B;  1WYD A;  1FL0 A;  3A5U A;  1CSP A;  2WB1 E;  4YCU A;  2F52 A;  4AH6 A;  5C0X I;  5LMN W;  4GNX C;  1JB7 A;  4B3M Q;  4A3C G;  2N3S A;  2OTJ A;  4IPH A;  2YTY A;  1N34 L;  3I4N G;  1G6P A;  4RG1 A;  3LGJ A;  3CCR A;  4HJA A;  3GDE A;  4C2M H;  1NTG A;  2V1C C;  2AKW B;  3ULP A;  1PH2 A;  3KJO A;  4LF8 L;  1HR0 Q;  3U4V A;  2Y0S G;  2L15 A;  4HIM A;  1SMX A;  3T1Y Q;  2Q2U A;  1L2F A;  2Q2I A;  1AE2 A;  3GO5 A;  3BU2 A;  4A3D G;  2VL6 A;  4JV5 L;  4EQ5 A;  1YJ9 A;  2R93 H;  3RR5 A;  4A3E G;  4A3C H;  4WJ4 A;  3B6Y A;  3G71 A;  2NZO A;  1HJP A;  2XGT A;  3ULL A;  2K75 A;  3I4N H;  4BBS G;  1GKH A;  4K0K L;  1JE5 A;  3CD6 A;  4JI4 L;  3GTK H;  3CC7 A;  3CAM A;  3AQQ A;  3ZJY C;  3CCM A;  2BH8 A;  2HQL A;  1HNW L;  1HNX Q;  4DV6 L;  3GTP H;  3I56 A;  1HZA A;  3F2B A;  1AE3 A;  1VQE A;  4AQY Q;  1EIY B;  1Q1E A;  3HFZ B;  4B3M L;  3S14 H;  1M1K C;  3S1R H;  3CCV A;  1VQF A;  3BZC A;  3RN5 A;  4P71 A;  1R9T H;  1RIP A;  2KBN A;  4PG3 A;  1YHA A;  4PZ7 A;  1K8A C;  1VQN A;  4GLV B;  3H3V I;  1V43 A;  2UXC Q;  1XJV A;  1Y14 B;  4LFC Q;  3UE0 A;  4GNX B;  5FJ8 H;  2YV5 A;  1KIX A;  2RHQ B;  3S1Q H;  1JJ2 A;  4IFD G;  4X66 L;  2ZJP A;  2RHS B;  3RZO H;  1IBK Q;  1VQI A;  3S24 A;  1B70 B;  4IPC A;  4J15 A;  3STB D;  4DV4 Q;  4C3I H;  1XMQ Q;  2F4V Q;  3HOW G;  2JA6 H;  1XTD A;  3RZD H;  4POG A;  3G6E A;  1VQ4 A;  4PZ8 A;  4A75 A;  3PO2 H;  4LFC L;  4TVA B;  3CF5 A;  1N36 L;  2DGY A;  2UXC L;  4R4T A;  1YHB A;  4JV5 Q;  2NZH A;  3J81 i;  1IBM L;  3RLO A;  5BR8 Q;  3VDY A;  5IYC G;  4LF4 Q;  3HOW H;  1E24 A;  4IOA A;  4BXX G;  4A3F G;  1I3Q H;  1VS0 A;  4DK3 C;  1UE1 A;  1IBL Q;  4A93 G;  5H1S E;  3S2D H;  5IP9 G;  1IZ6 A;  3S2H H;  1N9W A;  3PGZ A;  1MIU A;  1WCM G;  1Q8K A;  2CQO A;  2WFW A;  3KOJ A;  1X65 A;  1N34 Q;  4DV7 Q;  4O0A A;  5GAD C;  3F2D A;  3S1N H;  4KHP L;  3GTL H;  3KJP A;  4YY3 L;  1N8R C;  1D8L A;  4IPG A;  4JI3 L;  1PH5 A;  4LF9 L;  3OYY A;  1Y1V H;  3KDF A;  4JBJ A;  2VQE L;  3NEN A;  2R92 G;  4JI8 Q;  2ZTE A;  4H02 A;  4LUV A;  4R1J A;  4POF A;  1X56 A;  4DK6 C;  5M3M H;  4BA2 I;  1J5E L;  1U5K A;  4JI0 L;  3PUV A;  5C4X H;  4KLK A;  4JI5 Q;  5IYD G;  2VQF L;  4HJ8 A;  2JEB I;  4BY7 H;  3HOY H;  1SR3 A;  4DUZ L;  4NXM Q;  1Q86 C;  4L5R C;  1O7I A;  2ATW A;  3E9H A;  4A3I H;  1HNZ Q;  4HJ7 A;  2E2I H;  4L5S A;  3HOZ H;  1QUQ B;  1PH4 A;  3KDF B;  1EWI A;  2OCE A;  4JI1 Q;  5JEA G;  2MO1 A;  3IRB A;  2WP8 J;  2IT1 A;  1MKH A;  4GNX A;  2Z6K C;  2D62 A;  3PCO B;  1WCM H;  4IPD A;  1SN8 A;  4X64 L;  3TS2 A;  2OQK A;  1X54 A;  4QQB X;  2BA0 A;  4DUZ Q;  2WB1 G;  4EX5 A;  2NVQ H;  4WJ3 M;  3AFQ A;  1RL2 A;  1KHI A;  1E1T A;  5LMU Q;  2VUM H;  5K36 G;  4YWM A;  3PF4 A;  2A8V A;  4DR4 L;  1VQO A;  4P75 A;  1PA6 A;  4LF5 Q;  2OTL A;  1E22 A;  2YU9 H;  1L0W A;  3HOU G;  1K9M C;  4JI6 L;  3RN2 A;  2IX0 A;  1XPO A;  1HH2 P;  3KF8 B;  4DAM A;  1NMG A;  2ZTC A;  2LXJ A;  1YJN A;  2VS1 A;  2ASB A;  1BBU A;  4X64 Q;  3S1M H;  1X3F A;  2Z6K A;  2Y0S E;  3KF6 B;  2F3I A;  5IE8 A;  1PH8 A;  3HOY G;  4A3G G;  1GM5 A;  2UXB L;  2ZM6 L;  4B3T L;  2R7D A;  1IXR A;  2UUC L;  1XPR A;  2CKZ B;  1FVI A;  4AYB E;  3S16 H;  1G29 1;  2R6G A;  1EYG A;  2JA9 A;  3PSI A;  2DUD A;  3JC6 6;  4L5T A;  1OTC A;  1QUQ A;  4R4I A;  2K5N A;  4X65 Q;  1YEZ A;  2UU9 L;  1A8V A;  1EIF A;  4OX9 L;  1WJJ A;  3FKI G;  2LSS A;  1A0I A;  1FGU A;  1Q81 C;  2BH2 A;  3U58 A;  1AH9 A;  4DR6 Q;  3MEF A;  2UXB Q;  1DGS A;  2CCZ A;  4GOP B;  4OWX B;  1LM0 A;  4BY1 H;  1S40 A;  2NN6 I;  4O2D A;  2WAQ E;  1VQK A;  3EN2 A;  4YHH Q;  1Q1B A;  4FDB A;  5M3F G;  4AYB G;  2VQE Q;  1QZH A;  2I0Q A;  1HR0 W;  4DV4 L;  4JOI C;  1XMO Q;  1XMQ L;  1KQS A;  4LF5 L;  3AEV A;  4GKK L;  1YNX A;  4OXP A;  5FLM G;  4XIG S;  3TEH B;  3JAM c;  2B63 G;  3T1Y L;  5C44 H;  2OWO A;  1HR0 L;  3K0X A;  3CMA A;  4DR7 Q;  4X66 Q;  4B3S Q;  1VQG A;  1EFW A;  4Y52 H;  1L1O C;  3RLF A;  2E2H H;  4A3L G;  2ID0 A;  4MZ9 A;  3Q8D A;  3CC2 A;  3M3Y H;  3ER0 A;  1VQP A;  2D0O A;  2R7Z H;  4MTN A;  2R7F A;  1JJG A;  2A1A A;  4IO9 A;  4JI1 L;  4OX9 Q;  5GRO A;  2B63 H;  4LUZ A;  1KL9 A;  4JOI A;  4UPA A;  3ICE A;  4DV6 Q;  4LFB L;  1I6H H;  4YCV A;  1JT8 A;  1PH1 A;  4DR7 L;  2MNA A;  1BBW A;  1SE8 A;  1T9H A;  2R92 H;  3A5Z B;  1XNR Q;  3KFU A;  2KCM A;  4DV1 Q;  1I94 Q;  3OW2 A;  1VQ9 A;  4BXX H;  4NB3 A;  4DV3 Q;  1Q82 C;  3GTQ H;  1VQA A;  3J7A 5;  1PV4 A;  1CKN B;  2E5L L;  1OXU A;  3PUX A;  2JEA I;  4B3R L;  3UE1 A;  5C3E G;  3CXC A;  4JI7 Q;  1N33 Q;  1KD1 C;  4LF7 Q;  5IWA Q;  3W5O A;  2BA1 A;  2ZJR A;  1CKM A;  4JBW A;  4DV0 L;  1SFO H;  1Q46 A;  1NJI C;  4JCV E;  3D31 A;  3M4Q A;  3K80 C;  4BBS H;  4IFD I;  2IHE A;  5ELO A;  2ES2 A;  2EQS A;  2RF4 A;  2R7Z G;  2JK8 A;  4BBR H;  4QL5 A;  5HGQ A;  1X3E A;  2GVA A;  1KXL A;  2PMZ E;  2E5L Q;  1N36 Q;  2NVX H;  2AMC B;  3PUY A;  1P16 A;  3CPW A;  4B3R Q;  1A62 A;  2JJQ A;  1TWC H;  1BKB A;  1VQH A;  1Q12 A;  1QVF A;  4A3B H;  2K4K A;  3PV0 A;  4HID A;  4YCW A;  1PYS B;  3D0F A;  1MJE A;  3M85 A;  2ZTD A;  4HIK A;  4UY8 C;  2GVB A;  2F4V L;  1EOV A;  1VQD A;  2UUA Q;  1EQR A;  5J3B A;  3E9I A;  5GQO A;  3HOV H;  1XPU A;  4A3K H;  5C4J H;  1Q7Y C;  3I4M G;  2C35 B;  3GTM H;  4P72 A;  2GN5 A;  2ZM6 Q;  2AHO B;  3AYH B;  4JI3 Q;  4LF9 Q;  2VUM G;  3BJU A;  5IT9 c;  2B3G A;  3T1H L;  1P8L A;  4OWT B;  1J6Q A;  4DPG A;  4GLX A;  2HHH Q;  5M5X H;  2PI2 A;  2QGQ A;  3L0O A;  2JA8 H;  3GTG H;  2VNU D;  3PIP A;  3HOU H;  4X65 L;  1CKO A;  4QIW E;  2QA4 A;  1VQ8 A;  1GO3 E;  3OTO Q;  2UUA L;  5C0X J;  1XNR L;  3I55 A;  4LNQ A;  1A63 A;  1S72 A;  2CFM A;  2ALY B;  3S15 H;  4DUY Q;  4OWW B;  1X55 A;  1E3P A;  4AIM A;  2KHI A;  1UEB A;  3F1Z A;  4RMF A;  1XMO L;  1K8G A;  1BVS A;  4DR5 L;  3GD7 A;  1H95 A;  1OXS C;  4X62 Q;  5AJ3 Q;  3H15 A;  5GAH C;  1PH9 A;  4LF6 Q;  4LWC A;  1GD7 A;  3HKZ G;  4A76 A;  4DR2 Q;  1FJG Q;  3ULJ A;  2YTV A;  2PI2 E;  3CCS A;  4ALP A;  1TWF H;  2YTX A;  2I5L X;  1VQ5 A;  3E0E A;  1UE7 A;  1YHQ A;  4B3S L;  1XNQ L;  5M5W H;  5IYC H;  3OTO L;  4R4O A;  5DLQ E;  3J81 c;  3CCE A;  3NBH B;  4JG2 A;  1ASZ A;  4GOP C;  2KCT A;  3AFP A;  4A4I A;  1YI2 A;  1IBL L;  2JE6 I;  1V1Q A;  3K7A H;  4DKA C;  3A0J A;  5ELN A;  3J80 c;  2K5V A;  5IP9 H;  1VQ7 A;  4JBK A;  1PFS A;  2VQF Q;  2A19 A;  2Q2T A;  1LYL A;  5JJK A;  2K50 A;  4GOP A;  5JJI A;  4B3T Q;  4QGU A;  3J81 j;  4DV5 Q;  1K3R A;  3M4P A;  3F8T A;  5IY0 A;  4A3M H;  4LF6 L;  1Z47 A;  3BZK A;  3UDI A;  1GVP A;  5IP7 G;  4YY3 Q;  4R4Q A;  4QJF A;  1PH3 A;  1I50 H;  2HIX A;  4IJL A;  4XTC S;  2JA5 G;  1EQQ A;  1VQB A;  1Y1W G;  1LUZ A;  4NXM L;  3PO2 G;  5C0X G;  4LF8 Q;  2UUB L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...