1TWHH

Rna polymerase ii complexed with 2'datp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 19
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twhH00
3T1YQ 2E2IH 5LMUQ 1MKHA 3G71A 1Y14B 4AQYQ 4A3CH 1HZ9A 4YCVA 2QGQA 2GVAA 1IBKQ 4P73A 4JI5Q 3U58A 1X3FA 4DV7Q 4A3CG 2Z0SA 1CKOA 4BA1I 2CWPA 2F4VL 2A1AA 3GTJH 3F2BA 5JEAG 4UP7A 4JC0A 4JI7L 5IWAL 4POGA 3KOJA 3J80c 4FDBA 2HHHQ 3GTPH 4QJFA 2Q2UA 4B3TQ 2N3SA 1FJGQ 4GN3B 2XGTA 1VQCA 4IPHA 1HNXQ 3H3VH 2WAQE 1NE3A 2PQAB 3K8AA 3BZKA 3FP9A 3CCRA 4A3IH 2UUBL 1JJGA 3HOXG 4JI5L 2VS1A 3MXNB 1A62A 5C0XI 3ULPA 2ATWA 3I4NH 1UWVA 2F52A 3T1HQ 4LF4Q 2YYZA 1L1OC 2UU9Q 3F8TA 1VQLA 2UXDL 1IZ6A 1VS0A 3VDYA 1GD7A 3J7ZC 2MO0A 4DUYL 1PH9A 4B3SL 1KD1C 1YIJA 1UEBA 3PUVA 4ME3A 4QY7A 3S1NH 1B70B 1WYDA 2RHQB 4LFCL 3A5ZB 1Z9FA 3BZCA 3PGZA 4LUOA 1VQIA 1X9NA 1M1KC 5DLQE 3K7AH 3PSIA 1HNZQ 2A19A 1N32Q 4X6AH 4YY3Q 4BY1H 4DV0L 4A3FH 3ULJA 5JEAJ 4DV5Q 4JI3L 1OTCA 4B3RL 2L15A 4R1JA 4GNXA 2VY3A 3E9HA 3K7UC 3GTMH 4IFDG 1HNWL 1J5EL 2OTJA 5LMNQ 1AE2A 2JJQA 3K80C 2NVYH 4IOCA 4MTNA 4DKAC 4H02A 1T9HA 1WFQA 4DR3Q 3HKZG 3SGIA 1VQPA 2K5VA 2JEAI 1YNXA 2EQSA 3KF8B 2MNAA 1CSPA 2NN6I 1LUZA 4JI0L 2E5LL 1E7ZA 3CF5A 1I94Q 3PUXA 4LFBQ 5IYDH 3D0FA 4PG3A 1Y1VG 1SROA 3HOYG 4OO1G 4L5QA 2LXKA 4A3DG 4DR3L 1D7QA 3ZJYC 3T1HL 4A3LH 4KI0A 4P75A 1QVFA 3KYHC 4GOPC 2KHIA 3S2HH 1VQAA 2ZTDA 1YZ6A 1GO3E 3ICEA 4OONA 1NMFA 4X65Q 3CCEA 4AYBE 5C4XG 4QQBX 2RCNA 2IHFA 2FXQA 3OTOQ 4JOIA 2MQHA 1W2BA 4DUYQ 3CAMA 1PH2A 5GADC 2MFIA 1PVOA 2N78A 3GDEA 3FKIG 4P72A 1Q86C 1SLJA 3F2DA 1VQOA 2ASBA 2PI2A 3M3YH 2HT1A 3S1QH 4DV7L 4HJ8A 4Y52H 4JYAL 2Z6KA 1VQEA 3CXCA 4LF6L 2N8NA 1A0IA 1IBMQ 1XNQL 2JA7H 4P71A 1RL2A 4Y7NH 3U4VA 1EOVA 1K0RA 3D31A 1KL9A 5JJLA 5M5WH 4OWTB 2HQLA 1K8AC 5IYCG 1GM5A 1SR3A 4IJHA 1PHJA 4GKJQ 1SRUA 3GD7A 1QVGA 3PUYA 3PIPA 4JYAQ 1X65A 1S3OA 1CUKA 4DAYB 3J81j 4DV3Q 2Z6KC 3HOWG 2ZTCA 2R7FA 3Q8DA 2E2JH 3UDFA 4LFAQ 4DR5Q 1CKNA 4OO1I 1K83H 1DGSA 3RZDH 2BA1A 1IBLL 3M4OH 2WAQG 3I4MG 3STBD 3PF4A 4R4QA 5IP9H 5FJ8G 1Q8KA 3OW2A 4NXMQ 1O7IA 3U50C 4LUVA 1PH3A 3I4NG 1PH7A 4GOPA 1HZBA 4GN4B 4DV2Q 2EXDA 3M7NA 5C3EG 3HOXH 4A3BH 4B3ML 1EUJA 1U5KA 5BR8L 3G4SA 5GQOA 1CSQA 3RNUA 2UUAQ 3A0JA 3S1MH 2IT1A 1NBWA 2RHSB 1EQRA 2PNHA 2XTIA 4GS3A 4PZ6A 4A76A 4OWWB 4BY7H 1V9PA 4NPSA 1VQ7A 3CCVA 4DV0Q 4DR2L 2OCEA 4IOAA 4B3RQ 4NXNL 2IX0A 4MZ9A 4GKKL 1Q7YC 3J80i 5H1SE 1YJ9A 1QUQB 1WCMH 4R4TA 5AJ3L 4DR4L 5IT9c 4X66L 3TS0A 4GN5A 2ZJQA 3CP0A 4LF5L 3PO2G 2PI2E 1UE1A 2JA6H 3K81C 4JI6Q 1PA6A 1PH4A 3H0GG 3CCUA 1I5FA 1KQSA 4DR5L 1ASYA 4BXXG 2BA0A 1N9WA 5IE8A 4UY8C 2HIXA 4MNOA 4DV3L 4L5TA 1HH2P 5M3MH 2F4VQ 3CPFA 4YCWA 4YHHQ 4IFDI 4YWLA 4AQYL 1FL0A 2UUBQ 1XMOQ 4QIWE 5M3FH 4B3TL 3TS2A 3PO3H 2HIVA 1NMGA 1S72A 4JBKA 3S24A 3HOYH 1Y1VH 1EIFA 2VZAA 1FJGL 2UXCQ 2R7ZH 1GVPA 2JQOA 4LFAL 1XPUA 1PYSB 1VQKA 1G291 4OX9L 2ZTEA 4A4IA 2R92G 2VL6A 5IP7H 2I5MX 2VNUD 4A3MH 3HKSA 1C0AA 5IYBG 2I5LX 4TQUS 4IJLA 5EAYA 3CC7A 2R6GA 4DV6Q 3L2PA 4J15A 4GLAC 4DR1Q 1MJCA 1G51A 2Q2IA 2VQEQ 3S1RH 4YWKA 1LTLA 3M4PA 4A3FG 3EIVA 4BBSG 4DV5L 2YTXA 3AYHB 4BA2I 4DR4Q 1N34L 3RN5A 1C9OA 2R93H 1BKBA 4JI1Q 1UE7A 4JI4Q 4C3HH 1TWFH 4UP9A 4X64Q 4LW1A 4IO9A 3OTOL 1YHQA 2JEBI 2R7ZG 4WJ4A 2R7DA 1N36L 1QVCA 4DUZL 3GTQH 4JI1L 4OXPA 4JI4L 1QUQA 4X66Q 4LF8L 3W1BA 5M3FG 3PO3G 4A93H 1Q1EA 2CKZB 1W3SA 2JA9A 4JI0Q 3UDIA 3A74A 2B3GA 1VQ4A 3CCLA 2DUDA 4DPGA 4NXML 1YBYA 2OQ0A 3E0EA 3KF6A 3AFQA 3H0GH 5C0XJ 3JAMc 3CCMA 4BXXH 3HFZB 4LNQA 4XTCS 3PUZA 3JC66 4JI8L 3PV0A 2N49A 2NN6G 4KHZA 2JA6G 2E2HH 4LFBL 3PO2H 4HJ5A 3RN2A 4LF4L 1VQJA 3HKZE 3G48A 1EWIA 1TWCH 1KAWA 4A3JH 2IX1A 4K0KL 2K5HA 4QL5A 1YEZA 3KDFB 2VQEL 4L5RC 4OX9Q 5C44H 1VQNA 3PIOA 3CCJA 4BBRH 4NB3A 2YU9H 1XMQL 1Q81C 3BJUA 3HOZH 1XJVA 1K3RA 1HZAA 1Z47A 2LXJA 1J5EQ 4LUZA 4DV4Q 1XNQQ 1IXRA 5E7NA 3UDGA 4LF6Q 2CQOA 4DAMA 4A3GH 4KHPQ 1IL2A 2UXBL 1X55A 4HIDA 1Q82C 2YTYA 1SE8A 1PV4A 3S17H 1VCIA 4A3EG 4O2DA 4HJAA 4DR6Q 4KHPL 4LF7L 1A8VA 2DGYA 3RR5A 4R4CA 1Y1WG 1SFOH 4C3JH 5IP9G 4X62L 1VQ8A 1EIYB 4LF8Q 3I4MH 1FVIA 1JJCB 3AQQA 1N36Q 2K50A 4IPDA 1L1OB 3AFPA 3S14H 2NVTH 2VQFQ 2GVBA 1XMOL 3I4OA 2JK8A 2K14A 2R93G 2QA4A 1HZCA 3PF5A 2AHOB 3HOWH 5ELNA 1U0LA 4YWMA 2OTLA 1S40A 3GTOH 4TVAB 2D62A 1PH5A 4UPAA 4DK6C 1G6PA 4P74A 5IYCH 3RZOH 1OXUA 1QZGA 1TWGH 4JI8Q 3UDXA 4QGUA 5HGQA 1PH8A 5GROA 4LF9L 2D0PA 1HR0W 4O0AA 1E22A 1N34Q 2BH8A 3J81i 4DR2Q 2EIFA 2ID0A 4GOPB 2D0OA 4B3MQ 3M4QA 4GKKQ 2ZM6Q 2AWOA 2I0QA 1N8RC 3UE0A 1NY4A 4HIMA 4RG1A 2UXCL 3W1GA 4B3SQ 3J7A5 4DUZQ 4JI2Q 1KIXA 5FLMG 3KFUA 2UU9L 4PZ7A 2MO1A 3GO5A 5C4XH 1EYGA 5M3MG 1I50H 3S16H 1B7YB 2JA8G 1XPOA 1CKNB 3BU2A 1OXTA 2Y0SG 2NVQH 1X3GA 2JA8H 4A3LG 1OXVA 1IBLQ 1P16A 3KDFA 5GAHC 2ZJRA 5LMNW 1KRSA 1NTGA 5M5XH 5C4JH 1N33Q 1LM0A 4X62Q 3GTLH 4A3DH 2HHHL 3GTGH 5K36G 2YV5A 2ZJPA 2PMZE 1VQGA 4LF7Q 4AYBG 3ULLA 5IYDG 2JA5G 1N33L 1VQMA 1WCMG 3ER0A 3CQZH 1E1OA 2OQKA 2GN5A 1WI5A 2I5HA 4EX5A 2K5NA 3A5UA 2NVXH 1H95A 3GTKH 2VQFL 1OXSC 1QZHA 3RLFA 1K9MC 5JJIA 1VQHA 4BY7G 3CPWA 1EQQA 3E9IA 4C2MH 1VQ5A 2UXDQ 3RLOA 3G6EA 1E3PA 2VUMG 1YITA 4DV6L 1X6OA 1YHAA 4RMFA 1HNZL 1XNRQ 4HIOA 1E1TA 2ES2A 4PMWA 5C3EH 3MEFA 1JE5A 4A3BG 3NBHB 1I6HH 1AH9A 2E8GA 3IRBA 1XNRL 4L5SA 4A3KH 1YVCA 1HJPA 1XTDA 5FJ8H 2PQAA 1K73C 1PH1A 1Q1BA 3M9BA 3PUWA 4JI2L 3K0XA 1HR0Q 5ELOA 3CC2A 3I55A 3HOUH 3HOVH 2QEXA 1EFWA 1WJJA 1K8GA 3DLLA 3H15A 5AJ3Q 1RIPA 4HIKA 3HOVG 3HOUG 2ZM6L 1PH6A 4X64L 2Q2TA 3LGJA 4AIMA 3CMEA 3CW2C 5LMNL 4A3KG 1BBWA 2WP8J 1HR0L 2CCZA 4DK3C 5JJKA 2V1CC 4A3EH 1KXLA 4JI3Q 4UP8A 3M85A 4JV5Q 5FLXc 4JG2A 1B8AA 4JBJA 2A8VA 1PYBA 2VUMH 3TREA 4POFA 1TXYA 2F3IA 1IYJB 3KF6B 1XPRA 2E5LQ 2NZHA 2OWOA 1OXXK 1SN8A 4AH6A 2JA7G 2VW9A 4APVA 4GNXC 4BBRG 2UUCL 3TRZA 1VQBA 3EBEA 2CWAA 3L0OA 3F2CA 1PFSA 3PCOB 3W5OA 4A3JG 3FKIH 4YCUA 2JA5H 1X54A 1YHBA 3KJPA 3CC4A 1NJIC 1GKHA 1L1OA 4PZ8A 3CCQA 2JE6I 2LSSA 1MIUA 3EN2A 4C3IH 3H3VI 3WWVA 1C7YA 4GNXB 3NENA 3S15H 1XMQQ 5BR8Q 3J81c 3CD6A 1J6QA 1JT8A 2IY5B 3CMAA 4GLXA 3FHWA 5GAGC 1P8LA 2KBNA 1X56A 2RF4A 3TEHB 4A93G 1UE5A 2B29A 4R4IA 3L7ZC 4LFCQ 5FLMH 2UXBQ 1AE3A 3RLNA 1CKMA 4IPGA 4HJ7A 1KHIA 1BBUA 1YI2A 4JBWA 3S2DH 4DV4L 2KHJA 4JOIC 2AWNA 1V43A 2AKWB 4YY3L 3NEMA 4XIGS 3KJOA 2ALYB 2B63H 2Y0SE 1JJ2A 4JI7Q 2NZOA 1IBKL 3ERSX 4GLVB 4IFDJ 3I7FA 1JB7A 1L2FA 1VQ6A 5LMUL 1VQFA 1L0WA 2KCTA 4GKJL 5HY6A 1E24A 2C35B 4BBSH 5IY0A 2WFWA 4JI6L 4KLKA 1HNXL 1BVSA 5IWAQ 3T1YL 1A63A 4X65L 4HJ9A 3U4ZA 1JMCA 4EQ5A 2H5XA 3DM3A 1VQ9A 4JCVE 3STBC 1TWHH 2YTVA 4BY1G 4YHHL 1YJNA 1I94L 3CCSA 1YJWA 3B6YA 1TWAH 1Q12A 5IYBH 2BH2A 1X3EA 2K4KA 3KLWA 4DV2L 4A3MG 2CFMA 4K0KQ 5IP7G 2UUCQ 5C0XG 2K75A 2Q2HA 4LF9Q 2R92H 2AMCB 1UE6A 2K52A 3OYYA 3I2ZA 1LYLA 4DNIA 2B63G 4NXNQ 2IHEA 3I56A 1Y1WH 1KRTA 3F1ZA 1ASZA 2WB1E 3JAMi 5M5YH 4LWCA 4DV1Q 4WJ3M 4R4OA 4DR7L 4JV5L 2UUAL 4A75A 1I3QH 1Q46A 1KC8C 4DR6L 1N32L 4A3IG 1R9TH 3TQYA 4DV1L 4A3GG 1FGUA 2KCMA 4DR7Q 3NELA 5GAEC 3UE1A 5J3BA 1V1QA 1VQDA 4IPCA 4DR1L 4JBMA 4LF5Q 1MJEA 3HOZG 3AEVA 1M90C 2KENA 2WB1G 1HNWQ 4OWXB 1WOCA 4ALPA 1SMXA 5C44G 1IBML 1D8LA
chains in the Genus database with same CATH superfamily
2E2IH 3G71A 3RZOB 1GUSA 1IHZA 1HZ9A 1G2SA 4P73A 4JI5Q 2Z0SA 1CKOA 1DXMA 2CWPA 4MTKA 5JEAG 4UP7A 4V0BA 4DNTB 3GTPH 5ISRA 3S14B 4IPHA 4K6DA 2DN8A 4A3IH 2UUBL 3T4AC 1B9MA 3M4YA 3S15B 2VS1A 5C6AA 5C0XI 3MZ5A 1LTAD 4A93B 1JB3A 5D3DA 3T1HQ 3GTQB 3K59A 2YYZA 2UU9Q 1STNA 4A3GB 2K04A 1CT1D 1HTPA 3J7ZC 4B3SL 4ME3A 5C0XH 3C3LA 3IL8A 1SYDA 2OXPA 3PGZA 1VQIA 1EY6A 4BBRB 3PSIA 4RHRA 2A19A 4XQJA 2L15A 2VY3A 2ZXOA 3K7UC 5C5LA 1J5EL 3MWYW 2OTJA 1MBYA 5L37A 1KLUD 1T9HA 1GUOA 1PTOF 3HKZG 3VA5A 2JXMB 1VQPA 2K5VA 3R8BA 4RKLA 1YNXA 2MNAA 1LUZA 2I46A 4LFBQ 1DJRD 1HA5A 1EL0A 1Y1VG 3HOYG 5K36H 3EJIA 1SAPA 1D7QA 1SNMA 3ZJYC 1CM9A 3QOJA 5M3MB 1T5XD 4P75A 1HQRD 1B44D 2PW5A 3S2HH 1JOKA 1VQAA 3H09A 1RKNA 3ICEA 4OONA 3CCEA 3NUCA 4QUCA 3HS0C 2IHFA 2MQHA 5CC4A 4KN7C 2MFIA 1PVOA 3FRPB 4P2CB 4P72A 3F2DA 1SNQA 3M3YH 4DV7L 4HJ8A 4JYAL 3CXCA 1VQEA 3BVGA 2JA7H 2EYMA 1RL2A 3EFXD 4X3SA 3K5NA 2F0QA 1A3UA 2VB3X 3D31A 1KL9A 4OWTB 4UHVA 3S16B 4GKJQ 2FMMA 4DK1A 4JYAQ 1E2ZA 5KEEA 1X65A 3Q0AA 4DV3Q 2Z6KC 3HOWG 3MC0B 2E2JH 1HPCA 3IFDA 4DR5Q 4OO1I 3TP8A 2BA1A 4KKUA 3STBD 4C3JG 1Q8KA 3SXHA 5D3IB 1EWCA 2F0MA 1LABA 1HZBA 4DV2Q 1XXGA 4B3ML 1I6VC 1U5KA 3GV6A 1CSQA 2UUAQ 2SEBD 1NBWA 2D5DA 3OWEB 1TU2B 4PZ6A 4GS3A 4OWWB 5IGGA 3NWTA 3HOZB 2J0TD 5C4JB 1VQ7A 3CCVA 3QR8A 2OCEA 3QWNA 2IX0A 3BVZA 4MZ9A 1EY7A 5H1SE 2EYHA 4A3IB 1B3AA 3D3RA 5M9OA 1R4QB 5C4XB 2PI2E 5IIFA 2JA6H 3I70A 4BXXG 1ASYA 1YNJD 4EGVA 3CHBD 4B9XA 4UY8C 3J7AV 2F4VQ 5E4XA 1FL0A 2HCCA 3MXNA 4QIWE 3PO3H 4JBKA 3HOYH 1EIFA 1EEID 2VZAA 1VQKA 1G291 5IP7H 2I5MX 4A3MH 1C0AA 2JA7B 3J80E 5I4DA 4DV6Q 4GLAC 4DFAA 5EBCA 1MJCA 2L0CA 4K2KA 2VQEQ 2IJ0A 3BDCA 3BYTB 3F2UA 4DV5L 2YTXA 3S17B 4L6TB 4BA2I 3SVMA 3RN5A 2FJ2A 2DY8A 1JR0D 4EQOA 4UP9A 1PFMA 2JEBI 2OF1A 1QVCA 4DUZL 1EFID 3W1BA 3I4NB 3PO3G 1Q1EA 2G9DA 2B2VA 3GP7A 2XWJB 5EJWA 1VQ4A 1DOLA 4LJZC 4NXML 2PZTA 3AFQA 1E2WA 5C0XJ 2O2LD 4BXXH 1M4VA 3HFZB 4LNQA 5IOCA 2JA6G 2NN6G 1LT4D 2E2HH 4LFBL 2L1BA 3RN2A 5AFWA 1FNVA 2F0HA 3VR4A 1VQJA 3TDQA 3HKZE 3G48A 2K5HA 4ZAIA 2CW0C 4BBRH 1SNPA 5M3FB 2YU9H 4KV6A 4V190 3BJUA 1TS5A 5C4ZA 1J5EQ 4LUZA 1XNQQ 1F9SA 4DAMA 1PZKD 4A3GH 2LKVA 4FF1A 5D14A 2M2LA 2R3ZA 4KKSA 3S17H 4A3EG 4O2DA 4HJAA 4DR6Q 4KHPL 1A8VA 1E2VA 1VF7A 2DGYA 1SFOH 5ELBA 4DAVA 4LF8Q 1FVIA 3S2HB 2AQ2B 3A54A 3AQQA 4BS9A 1L1OB 1CA5A 3S14H 5KNDA 3NXWA 2JK8A 2K14A 2R93G 1HZCA 3BDOA 1TWAB 3TP6A 4BY7B 5EKIA 4DK6C 3C46A 5C3XA 1WTPA 2BE5C 3RZOH 2MGSA 1OXUA 1QZGA 2QCPX 3P75A 1EU4A 1F2LA 1RF2D 3HZXA 2BH8A 3J81i 4GOPB 2D0OA 1HA6A 2Z4HA 3OW7A 4RG1A 2PMZB 1KIXA 3KFUA 2UU9L 4PZ7A 2MO1A 3GO5A 5C4XH 4G4KA 1UAPA 1CKNB 2NVQH 4A3LG 4CDEC 5LHY1 1P16A 1SJED 1NNXA 5GAHC 1NTGA 5C4JH 2HHHL 2G9HD 4Q5VA 2JA5G 1N33L 2MPMA 4ILWA 1Y69U 1D2BA 1E1OA 4M1UB 2OQKA 3SEBA 4EX5A 3A5UA 2E76C 1H95A 2NBFA 3GTPB 4DF7A 2JP1A 2EXZA 2Q8TA 3T16A 1VQ5A 4YIJA 3RLOA 3G6EA 4NKLA 5E3FA 4DV6L 2K05A 4OGQC 1YHAA 1BCPF 1E1TA 4NP5A 5C3EH 2M00A 1AH9A 1HRJA 1DOKA 2K5QA 1XTDA 3OSOA 1K73C 1LTID 2CQAA 3PUWA 4JI2L 3K0XA 3HOUH 5ELOA 3HOVH 3D6CA 1EFWA 4WORA 3HOUG 2ZM6L 1PH6A 3BS1A 4R8NA 2Q2TA 3CW2C 4QIWB 3GTLB 2RSNA 4ZLTF 1JOQA 3MEHA 4JG2A 4JBJA 1STGA 1TXYA 5DAUA 3NWSA 4C3JB 2E5LQ 4TRDA 3QJYA 4KJNA 3TRZA 2BE5D 3EBEA 5JEAH 2B39A 2L11A 1ZXTA 1NJIC 1L1OA 3CCQA 2LSSA 3EN2A 1SYGA 1C4QA 4C3IH 3H3VI 3WWVA 1PMRA 3J81c 2WACA 2RQXA 1F9QA 4KY7A 3CMAA 4GLXA 4KY6A 2RSOA 4CJ0B 3TSSA 3S2DB 1DYQA 4A93G 1AE3A 4PNYA 1CKMA 4HMJA 4RWSC 1SYFA 4DV4L 2EJFC 2AWNA 4WJWA 4YY3L 2B63H 4LAAA 1XTCD 1ENAA 3E0JA 4C2MB 2AQ1B 2NZOA 4IFDJ 1VQ6A 1JB7A 2KCTA 2MJ8A 5HY6A 3TZDA 2VB2X 2C35B 3H3VC 4KLKA 2NVXB 5IWAQ 1A63A 2F1MA 3R2IA 1BCPC 1VMPA 3ITPA 2KJXA 3DM3A 4FVMA 1YJNA 1H9MA 3CCSA 1YJWA 1DCZA 2FMCA 1TWAH 4J8QA 2Q8RE 2QILA 3R2TA 2CFMA 3DEOA 2AQ3B 2R92H 3V05A 2EYLA 2K52A 3OYYA 1LTBD 3VYSA 4DNIA 5DNFA 1CHQD 4G7OC 1ASZA 1GOZA 2NB0A 1TS4A 1KABA 5CV8A 4JV5L 3G6JB 1Q46A 4QB4A 5CV5A 4A3GG 1DD2A 3MAQA 1FGUA 1GUNA 2KCMA 1WTRA 5GAEC 1V1QA 3NBIA 4OIKA 4UDUC 4DR1L 2Z9HA 4JBMA 4A3KB 1HNWQ 1M90C 5J39A 3E3XA 4K8IA 5A35A 3ND9A 1AZPA 4ID6A 4ALPA 1SMXA 2DY7A 1LLRD 1MKHA 2A6EC 5LMUQ 1GJXA 1D6EC 1IBKQ 1D5ZC 4XQNA 2PPBC 2TSSA 1U4LA 2H1EA 4JI7L 3NQIA 2NN6H 1K3BC 5IWAL 3FVQA 1A2TA 2WKDA 4FDBA 1PTOH 4QJFA 4GN3B 3W2DA 2XGTA 1VQCA 3T56B 3H3VH 5DEHA 5FLXE 3BZKA 1LO5D 1Y8OB 5KIXA 3I3CA 3HOXG 4C3IB 3A8IE 4FXGC 3I4NH 3SK5A 1ZKOA 4LF4Q 1L1OC 3F8TA 5FO8B 1VQLA 2EYFA 1VS0A 2MO0A 1PH9A 1GUGA 1B2TA 2ZT9C 1UEBA 3S1NH 2B2UC 2RHQB 1WYDA 4BBSB 3A5ZB 1X9NA 1M1KC 2RBMA 3K7AH 1HNZQ 1I6HB 4YY3Q 4BY1H 4JI3L 1TWCB 1HCZA 3J81L 1AE2A 3BG3A 3K80C 4MTNA 3FDTA 4DKAC 1WFQA 3HKZB 1I4RA 3A55A 2H4OA 1U4MA 4JI0L 2F0PA 5DM63 5M5WB 3PUXA 1WD0A 5IYDH 3MA2B 3TZUA 1ILPA 5EPKA 4PG3A 1SROA 3HG9A 3AU7A 4TKOB 4XT3B 4RKBA 3NSWA 3V2TA 2O5JC 2XIWA 3KYHC 4UAIA 2QW7A 2KHIA 3N6RA 2JA6B 4EQNA 1D1KA 5FKAC 4JOIA 1W2BA 2N78A 3GDEA 1Q86C 1JC7A 2PI2A 1V1OA 2BDOA 4Y52H 4O42A 1RDPD 4LF6L 2N8NA 1XNQL 1H9KA 3SDZA 1S5DD 1EY0A 2EY6A 1YNND 1IW7D 3VYTA 1SYEA 1QVGA 1PFNA 3PUYA 3SK8A 1TY2A 3PIPA 5IGFA 3H91A 1LACA 1S3OA 1CUKA 4DAYB 5CGKA 3J81j 2WV6D 5I2YA 4LFAQ 1K83H 3I8ZA 3M4OH 2A68D 2WAQG 1F77A 1HUMA 2BCOA 4NXMQ 3OW2A 4F7XA 3DXJC 1V1PA 2F0FA 4GN4B 4GOPA 3GTKB 4JPBW 1V1PB 2J4XA 3EA6A 4FXDA 5BR8L 3RNUA 3A0JA 2IT1A 1J9OA 4A76A 2F0WA 4BY7H 3BZDB 2K7VA 4DNRB 4RH6A 1H9SB 3J80i 3FPUB 3M3YB 2Y0SB 1WCMH 1MD2D 2EYPA 3DWQA 5AJ3L 4DR4L 1SFOB 4ODGA 4LF5L 4NMZA 4J1MA 1UE1A 2C5CA 4JI6Q 1N9WA 2HIXA 4MNOA 4DV3L 2XSCA 1A3TA 2EJMA 1SNOA 1HH2P 4ABNA 5M3MH 3CPFA 4YCWA 1BXTA 4YWLA 4AQYL 1XMOQ 1EQVA 5M3FH 4B3TL 1SYCA 2YU9B 2HIVA 4HSPA 2EJGC 1Y1VH 2K01A 2A74C 4XQQA 2F0LA 2ZTEA 4A4IA 2R92G 5JVG3 2VNUD 4CJ2C 4Y7NB 3G7LA 2F0KA 3I72A 2R6GA 3L2PA 2RA4A 4DR1Q 5C5MA 4IFDH 3J7AF 1RCVD 2SNSA 2ICIA 2XWBB 3NQTA 3EIVA 5E4WC 3FPPA 4DR4Q 1N34L 4LK1C 2R93H 2K33A 1CZWA 1BKBA 3HP3A 3LWUA 4C3HH 2K32A 5F2DA 5J22A 2R7ZG 1Z7TA 2R7DA 1TR5A 3UI2A 3GTQH 5EBDA 4JI1L 4JI4L 4A93H 1U4PA 1W3SA 2JA9A 4KK7A 1R4PB 3A74A 3VR6A 3CCLA 5FOBB 4FF3A 3KF6A 3JAMc 5ELDA 5A2QE 4XTCS 3JC66 4JI8L 1WVLA 4PQXA 3PO2H 4A3JH 4I7AA 4K0KL 4QL5A 2E2IB 4QF4A 4OX9Q 1VQNA 2F4IA 2RDHA 4NB3A 3PO3B 2XN9C 1HZAA 4N9PA 3CRKC 4XYQA 1IXRA 1LTGD 1TWFB 1LT3D 3FKIB 4S3SA 1M8AA 1S5ED 1X55A 1SNCA 3HOXB 4OL7A 2PYKA 4LF7L 4HCEA 3CRLC 4RGOS 2PZWA 3K5LA 4X62L 1Y8NB 3A8KE 3I4MH 1CI3M 1PTOD 4IPDA 3AFPA 1BOSA 2NVTH 2GVBA 1XMOL 4E6IA 2QKIC 2QA4A 3PF5A 5ELNA 1F9RA 1U0LA 3KBGA 4YWMA 5T1IA 3GTOH 2D62A 3ERQA 1G6PA 4P74A 5IYCH 1RHPA 1B3QA 3Q23A 1TWGH 2F0SA 1X32A 4KTAA 4QGUA 1PH8A 5GROA 1BNZA 1JWSD 5CMDA 4LF9L 1E22A 4B3MQ 1QOHA 2FFKB 2WAQB 2ZM6Q 4K5XA 1TIID 1R9TB 1N8RC 3UE0A 1I3QB 2RDFA 1XYIA 1X3QA 2K28A 3W1GA 4CJ1B 4DUZQ 1TKWB 1EYGA 1C8CA 5M3MG 1I50H 3T13A 3S16H 3BVMA 4G57A 3BU2A 1OXTA 4FP5D 2EY1A 3CKIB 2IL8A 3TMEA 1OXVA 1IBLQ 1JCKB 1QWYA 2WB1B 1SMYC 4X62Q 4A3DH 3GTGH 2YV5A 2ZJPA 1EOTA 1VQGA 3ULLA 1J8IA 1VQMA 1WCMG 3S1MB 2XVSA 5G3LD 5JOBA 1HQMC 2VQFL 1OXSC 4WFN3 1QZHA 2QEJC 1H9RA 1SE2A 4Z9CB 3CPWA 4BY7G 3MXPA 3PQIA 1EQQA 3E9IA 3VYRA 1EZ8A 4WRDA 1YITA 1HXYD 1XNRQ 1HNZL 4HIOA 2ES2A 1JE5A 3NBHB 3IRBA 2FINB 5EPJA 2PQAA 1Q1BA 5I9PA 4KMUC 2QEXA 1WJJA 2K03A 3DLLA 5AJ3Q 4X64L 3OHXC 3LGJA 3CMEA 5LMNL 2F0IA 4A3KG 5JJKA 4A3DB 4DK3C 4RHSA 1LTTD 4A3EH 4JI3Q 3NK9A 4FO2A 1B8AA 2X6GA 2VUMH 1MHWC 1IYJB 1XPRA 2NZHA 2OWOA 1OXXK 1SN8A 4AH6A 2ZXRA 4OELB 2CWAA 3ND8A 1KDCA 1PFSA 2ENBA 3W5OA 4A3JG 4I7ZC 1I4XA 3KJPA 3CC4A 3ONAB 1F2YA 1WD1A 1MIUA 3KLSA 1SDFA 1ML0D 3MTSA 1C7YA 3S15H 2IWHA 3SK4A 4C1NI 1P8LA 1WTVA 3T51B 4K5WA 5FLMH 3P7JA 4DXFA 4EVOA 1IKMA 4IPGA 3EROA 3RUZA 5IGCA 4HJ7A 4J6HA 1YI2A 4JBWA 2KHJA 2IX3A 2PNRC 4ZUIA 1TQOA 1CZGA 3QIAA 1L2FA 1PZID 3V96A 2WFWA 1TWHB 4HTHA 4X65L 1JMCA 3VYUA 1VQ9A 4DN4M 1EYAA 1TWHH 2YTVA 4BY1G 5FLXL 1A3VA 1PFBA 3T53B 3KLWA 5KRUA 4DV2L 2F0NA 2EOTA 1QE6A 2K75A 2UUCQ 4LF9Q 3A8JE 1UE6A 4KHVA 3R3OA 4NXNQ 1I4GA 1Y1WH 3PO2B 5M5YH 4DV1Q 4WJ3M 1SBBB 4R4OA 1SEBD 1N32L 5JJZA 1K0SA 4A3IG 1CK1A 2A73B 4JVZA 3TQYA 3UE1A 5J3BA 1MGSA 4IPCA 3HOZG 2KENA 5KNCA 4OWXB 5C44B 1LTLA 5C44G 5I2XA 4DAPA 3T1YQ 1Y14B 4AQYQ 1STAA 5JJLA 2GVAA 5C4HA 3U58A 1X3FA 4DV7Q 2MUYA 4BA1I 2A1AA 3GTJH 3F2BA 3Q6SA 1WTWA 4POGA 3DWPA 3J80c 2HHHQ 2Q2UA 1FJGQ 4C1NK 3D4RA 4NDXA 2WAQE 1NE3A 3I90A 1EYDA 3CQZB 5EQ0A 3K8AA 3CCRA 3FP9A 3Q22A 1EZ6A 2X6LA 1A62A 3MXNB 1XX8A 2ATWA 4A3EB 1KDAA 2F52A 4G7HC 5M5XB 4HN7A 4GZYC 2UXDL 2JA5B 3VDYA 2LMCB 5IT9L 4DUYL 3KLSX 3LNNA 1YIJA 3PUVA 2LS01 4FYDA 1GUTA 1B50A 1MSHA 4CKEA 3S9WA 3QO2A 2B2WC 3BZCA 4LUOA 5CV4A 1U9RA 1FNUA 2KCCA 4A3FH 4DV5Q 5JEAJ 1OTCA 4R1JA 3BDLA 3GTMH 1WTQA 3E9HA 5EGTA 1HNWL 5JPMC 3VR2A 3RZDB 2JJQA 2NVYH 4IOCA 3C1EA 3I73A 2F0DA 4DR3Q 3DUZA 3GV3A 3SGIA 3JAML 1QNKA 2Q8IB 2O5IC 5C3WA 3KF8B 1CSPA 3MFYA 3Q24A 4ME5A 5ELFA 1I94Q 1ICFB 3OMGA 4OO1G 2JSOA 4L5QA 5BN3A 1SE4A 4DR3L 2AUJD 3T1HL 2NTSA 4KI0A 3S1QB 4GOPC 4KD3A 1WTXA 2ZTDA 1YZ6A 1GO3E 1BR9A 1IYUA 2AUKA 2KHSA 2XRSD 2RCNA 4X3KA 2FXQA 3OTOQ 4M8AA 1PH2A 2QF7A 3CAMA 4DUYQ 3S1RB 5GADC 1SLJA 1VQOA 2ASBA 1RJTA 1IL8A 3WOEA 2HT1A 3S1QH 4ZQ3A 3U4VA 1EOVA 1JWMD 1WTOA 2HQLA 2R7ZB 5IYCG 1AW7A 1TY0A 2F0UA 1SR3A 2O4XA 2Z8LA 4IJHA 1PHJA 1HUNA 3AMUA 3RD4A 1AP0A 1EEFD 4O1NA 1G8ZD 2EVBA 5COYA 2ZTCA 3Q8DA 3UDFA 3H0GB 1NCVA 5ELEA 4F88A 1JORA 1DGSA 4EQPA 3RZDH 1IBLL 3I4MG 3PF4A 4R4QA 5IP9H 3U50C 4LUVA 1TT2A 3I4NG 1JICA 1PH7A 3DM1A 3M7NA 2EXDA 5C3EG 3HOXH 4AYBB 1BBXC 2BOSA 2CHBD 3IAYA 5GQOA 5J1ZA 5I6YA 1BDOA 1L0YB 1V9PA 5T1GA 4NPSA 1STEA 4IOAA 4NXNL 4CKCA 3K57A 4GKKL 1Q7YC 2JA8B 2RCFA 3QB3A 1YJ9A 4IZ8A 4A3JB 2B2YA 5IT9c 1LTSD 3FMCA 3PO2G 3CP0A 2F3VA 1QJOA 3W3AA 3EVQA 1EIGA 3H0GG 2BA0A 1B53A 1ENCA 5IE8A 4L5TA 1KLGD 1EYCA 2JN4A 4IFDI 1HHVA 3TS2A 2D9UA 2B2TC 4OO1H 5A2QL 2R7ZH 2JQOA 1XPUA 1PYSB 1BQQT 4C3HG 4KN4C 4KD4A 1RODA 2WKCA 2VL6A 2I07B 3K5OA 1SE3A 3OMCA 2I5LX 4TQUS 4IJLA 5EAYA 4F8MA 1H9JA 1HTLD 4IUTA 1NUCA 4HCSA 4QCLA 4I65A 1G51A 3K6OA 3S1RH 1EY9A 4YWKA 4A3FG 4HMIA 4BBSG 2IPKD 3AYHB 1C9OA 1MI2A 4PMBA 1UE7A 1UEAB 4X64Q 4LW1A 4IO9A 3OTOL 1YHQA 4RFBA 1JQYD 1N36L 1Y1VB 4OXPA 4X66Q 1PRTD 4JI0Q 4FNFA 2B3GA 1U4RA 2NYZD 2OQ0A 3E0EA 3H0GH 1A15A 4FF4A 1SXTA 1S5CD 3PUZA 2N49A 5CV6A 1RTOA 4LF4L 1BCPD 3H6MA 2NVYB 1A2UA 4N8X1 1EWIA 1KAWA 1SJHD 3GTMB 1YEZA 3KDFB 4L5RC 3CCJA 5CBAE 1Q81C 1C48A 1K3RA 1EY4A 4DV4Q 1D5XC 3HRZC 2CQOA 4LF6Q 1IL2A 2UXBL 1S5BD 5CORA 1Q8IA 1FNWA 1II3A 4R4CA 4QUFA 1VDZA 1Y1WG 3LWEA 5IP9G 3D4DA 2N55A 5TSSA 3VR5A 1X3PA 2NUCA 2K50A 3URYA 2JYOA 4IUUA 2IW3A 2VQFQ 3I4OA 3H94A 3K0YA 1T5EA 1S40A 4TVAB 1PH5A 5E1FA 1F9PA 5HURA 2B2VC 4H44C 1Z6HA 4JI8Q 4A3BB 1D5MC 2D0PA 1HR0W 4K5VA 4DR2Q 2ID0A 2KEEA 4ZKCB 4GKKQ 2AWOA 4HIMA 4PV1C 4B3SQ 4A3FB 3J7A5 4IUVA 4BWGB 2A6HD 1B7YB 2D2CC 1AN8A 1XPOA 2Y0SG 1TS3A 4MHEA 2JA8H 1AZQA 3DMUA 1N33Q 5LMNW 5M5XH 3GTLH 2L12A 2PMZE 4N9TA 5IYDG 1NSNS 4IN3A 3CQZH 4CDFC 2K5NA 4HAEA 1B1ZA 3RLFA 2L4NA 2PCFB 4QMGA 3GTJB 2E75C 1E3PA 3P20A 2RVLA 2VUMG 1SMYD 4RMFA 1LTRD 1QNUA 1PRTB 3C1FA 2KA7A 3MEFA 4A3BG 1I6HH 1XNRL 1WTHA 1YVCA 2B2UA 1PH1A 3LX0A 4HSVA 3M9BA 1HR0Q 4HIKA 3A56A 2CCZA 2V1CC 3NTHA 4UP8A 3M85A 1PZJD 4MN3A 4JV5Q 2KECA 1CFMA 2PQEA 4XYOA 1PYBA 3BYYB 2F3IA 1O7ZA 2JA7G 4H0LC 1O80A 3MXGA 4APVA 2CH4W 4BBRG 2VW9A 3F2CA 4GNXC 1A6XA 2EDGA 1YNJC 3PCOB 3RMHA 3FKIH 4YCUA 1DOMA 1X54A 4ULLA 4KY5A 1GKHA 4PZ8A 2KCNA 1ESFA 2F0GA 3FEWX 2DNEA 3SR1A 1Q3LA 4GNXB 2OT2A 4L8JA 2GA4B 3MXUA 1VF5C 3HEJA 5GAGC 3M7GA 4G7ZC 2QDBA 1K28A 3NP8A 2RF4A 2UXBQ 1UE5A 2B29A 4R4IA 3L7ZC 3RLNA 4RA8A 1KHIA 1Q90A 4IALA 4JOIC 2DJFC 4DU9A 3KJOA 2AKWB 1AEXA 2ALYB 2EY2A 5DM73 5FO9B 4JI7Q 3I7FA 1VMCA 3P1HA 4ZKBB 1W6JA 4IURA 1L0WA 4GKJL 1S4ZA 1E24A 1BVSA 1GXDC 3I91A 2C9OA 2MP1A 4JCVE 5EPLA 3STBC 1I94L 4YHHL 1IW7C 3GTGB 2K6AA 2R93B 2NTTA 1AFPA 5IYBH 1Q12A 2BH2A 1X3EA 4A3MG 4K0KQ 5IP7G 1BF4A 5C0XG 2F0TA 2AMCB 3I2ZA 1CQVA 1LYLA 2B63B 4ZYSA 1I50B 4K2LA 1YNNC 2KOLA 5IT9E 3OOCA 3JAMi 4LWCA 1ILQA 2CH4A 1NAPA 4DR7L 1I3QH 1KC8C 1R9TH 4OHJA 3NELA 2X69A 1QILA 1MJEA 4FF2A 1IBML 1D8LA 1DZ1A 3U9SA 4A3CH 4YCVA 2QGQA 4A3CG 1D1IA 2F4VL 4JW0A 1G91A 3GTOB 2G5DA 4JC0A 3QOLA 5M5YB 3KOJA 3D8GA 5KYIA 4B3TQ 2N3SA 1HNXQ 1WCMB 2PQAB 2HD3A 2L55A 1JJGA 5CYUA 4DAYA 4JI5L 3SK6A 3ULPA 1ET9A 3L3OC 1UWVA 2N88A 1FGBD 1STYA 4A3MB 2WIIB 1IZ6A 2K5DA 3TBIB 1GD7A 2F0VA 1KD1C 4QY7A 1B70B 4LFCL 2PO4A 5EKLA 3HOYB 1Z9FA 1I4PA 5DLQE 1N32Q 4X6AH 4B08A 4DV0L 1CA6A 3ULJA 4B3RL 4GNXA 4IFDG 5LMNQ 3M4OB 1QG7A 4H02A 2HUGA 4IUQA 2HDMA 2JEAI 2R61A 5I9OA 3PIO3 4RGTA 2EQSA 3ZYYX 2NN6I 2F0EA 3SE0A 2E5LL 1E7ZA 2A69D 3CF5A 3KBXA 3D0FA 2RDGA 3TP5A 2B2TA 5BN5A 4A3DG 2LXKA 3NE5B 3NPPA 1G6ZA 2DNCA 2NZ1D 2ZXPA 1I4QA 1QB5D 2L9HA 5IODA 4A3LH 1QVFA 4DK0A 3KF8A 1TVXA 1NMFA 1STBA 4X65Q 4AYBE 5C4XG 4U673 1ZYRD 2HDLA 3OIQA 2B2YC 3FKIG 4IUPA 1BCPB 2B2WA 4H13C 2HCIA 5CR3A 2RKSA 2Z6KA 3VA7A 2SNMA 4K8JA 5ELCA 1A0IA 3NHHA 1IBMQ 4P71A 4Y7NH 3J81E 2V4DA 1I4HA 1K0RA 1ZYRC 3QG1A 3NTKA 5M5WH 1K8AC 3JAME 1GM5A 4RAUC 1SRUA 3GD7A 5BN4A 5FO7B 1CHPD 1Y8PB 3K5MA 1SSOA 2R7FA 3WOFA 3HGBA 1CKNA 2P5ZX 5FJ8G 1V8QA 5K5PA 1O7IA 1SYBA 4U68A 3PMFA 1DM0B 3K7AB 1PH3A 1ICWA 2A69C 2OEOA 4DA2A 4A3BH 2A6HC 2F0JA 1KTKA 1EUJA 3S1NB 3G4SA 2WINB 3S1MH 4C3HB 2RHSB 1EQRA 1TS2A 2PNHA 2XTIA 1LV9A 1JOOA 2TMPA 5CBEE 4DV0Q 4DR2L 4B3RQ 1SNDA 3TP7A 1EWHA 1B4OA 1K8OA 1QUQB 4R4TA 1FR3A 1PDQA 4X66L 1O7LA 2A5HA 4ZCKA 4IQZA 4GN5A 3TS0A 2ZJQA 2ICEC 3K81C 2Z1CA 1DONA 1PA6A 1UUPA 3CCUA 5KYLA 1I5FA 4K14A 4DR5L 1PH4A 1KQSA 2F03A 4CBVA 4H7BA 3OIPA 1K83B 1G2TA 3KK7A 4YHHQ 1H9SA 2UUBQ 4QQBX 1LT5D 4NW2A 1NMGA 3D4WA 1S72A 3S24A 4MIUA 1FJGL 1GVPA 4LFAL 1JE4A 4OX9L 5CV9A 1GHKA 3GQBA 4C56C 2KUMA 3HKSA 4CGYB 4RCOA 5IYBG 4DXGA 1EY8A 3MVVA 3CC7A 2NVTB 4J15A 4HR7B 1QCBD 2HQEA 2Q2IA 3I4MB 3KUPA 1PLFA 3M4PA 1CQFA 3DEPA 5JAVA 2DJGC 1ESRA 2E2DC 4JI1Q 4JI4Q 1TWFH 4CDDC 1GUWA 5HGTA 4WJ4A 4LF8L 1QUQA 4JK1C 5M3FG 2CKZB 5G3LF 3UDIA 1RTNA 4B9WA 1HFGA 2B8GA 2DUDA 4DPGA 1YBYA 3E6ZX 3CCMA 4CDCC 3PV0A 4KHZA 1FD7D 3D6WA 4HJ5A 2E74C 2PW7A 1PRTF 1TWCH 2IX1A 1K8MA 3SHLA 3J80L 3EQLC 2VQEL 3J7YW 2EZVA 5C44H 2SOBA 5NUCA 3PIOA 1PXUA 1LT6D 1XMQL 4FXKC 2LFNA 3HOZH 1XJVA 1Z47A 2LXJA 3DHQA 2F3WA 2FHTA 4OEMB 5E7NA 3UDGA 3NBHA 3K58A 4KHPQ 4X3UA 4HIDA 4CHTB 1Q82C 2YTYA 1SE8A 1PV4A 2EY5A 1VCIA 5LL6S 2EPBA 1Y1WB 3RR5A 4ZUJA 4C3JH 1VQ8A 4IUNA 1EIYB 1JJCB 4RGNA 1N36Q 1KNAA 1PTOB 1ZEQX 1GHJA 2Z6BA 2E2JB 3HOWH 1MSGA 2AHOB 2OTLA 1PTOC 2EYOA 4UPAA 2CVRA 4XDXA 1KNEA 1ET6A 4DGZA 3HOVB 1NR4A 3UDXA 5HGQA 2M9VA 3OPOA 4Q0FA 4O0AA 1N34Q 2EIFA 3M4QA 3MFGA 4XXEA 2I0QA 1NY4A 2K5WA 3R93A 2UXCL 2CW0D 3VR3A 4JI2Q 5FLMG 5JVH3 2J7ZA 5D65A 3TN2A 2JA8G 5EKKA 2R92B 1X3GA 1UNSA 1EY5A 3KDFA 4LMQD 2ZJRA 1KRSA 2UXCQ 4C3IG 1LM0A 3CU7A 5K36G 2NWGA 5LL6X 4LF7Q 4AYBG 1F2ZA 1O7YA 1B9NA 3DWAA 3N52A 3ER0A 3C2PA 2XRQD 2NVQB 2GN5A 1WI5A 2I5HA 4N8FA 5CV7A 2NVXH 3GTKH 1K9MC 5JJIA 1VQHA 1BUVT 4C2MH 2UXDQ 1IKLA 2XNAC 2VUMB 5JPNC 1X6OA 4PMWA 2E8GA 2KEDA 3U9OA 4L5SA 4A3KH 1HJPA 5FJ8H 4K6LA 5FK9C 3CC2A 3I55A 3A7LA 3WDNA 2F0OA 1K8GA 1ONLA 3H15A 2LY7A 1RIPA 3HOVG 4AIMA 4RGMA 1HR0L 1BBWA 2WP8J 1KXLA 1W6KA 2EYJA 4HEDA 1EQTA 2QDLA 4X3TA 5FLXc 3L9AX 2A8VA 3TREA 4POFA 1BO0A 3KF6B 3NTIA 1KDBA 3OWFA 3X3NA 2UUCL 2L5TA 1VQBA 3L0OA 2Z4IA 1F2MA 1EU3A 2JA5H 3X3MA 1YHBA 3KLRA 5I6WA 1HFNA 2JE6I 5IGBA 3E5SA 2EE1A 3I4LA 1O78A 1EIHA 3NENA 1XMQQ 5BR8Q 3CD6A 1E0BA 1J6QA 1JT8A 2IY5B 1RD9D 3FHWA 3AB9A 2KBNA 1X56A 3TEHB 4RCNA 2KQ3A 4LFCQ 2E2HB 1STHA 3HOWB 1BBUA 1PYWD 3S2DH 2B8FA 2BDNA 1V43A 3NEMA 2SDFA 2VXWA 4XIGS 2Y0SE 4XT1B 1JJ2A 1IBKL 4BY1B 3ERSX 4GLVB 4ZK9B 5LMUL 1VQFA 2A68C 4BBSH 5IY0A 4JI6L 1TWGB 1HNXL 1FYCA 3T1YL 1NR2A 1S5FD 4HJ9A 3U4ZA 3IKJA 3IFTA 4TSSA 2H5XA 4EQ5A 4F87A 1L0XB 1JWUD 4R8IA 3B6YA 4CKBA 2A6ED 3MHBA 1OO9B 2K4KA 3PIP3 2Q2HA 5IGEA 5KGUA 2B63G 4PMCA 1IYVA 1PRTC 2PZUA 2IHEA 3O13A 3I56A 1KRTA 3F1ZA 2WB1E 4ZRZA 5KNBA 4R9WA 1KAAA 2UUAL 4A75A 4L63B 4DR6L 4DV1L 2KVMA 4DR7Q 2K1BA 1ENFA 5IGDA 3HOUB 4OIJA 1VQDA 4LF5Q 3AEVA 2WB1G 4KKTA 4KJOA 1CTMA 1WOCA 2MHVA 3A7AB 1XWEA 5C3EB
chains in the Genus database with same CATH topology
3T1YQ 2E2IH 5LMUQ 1MKHA 3G71A 1Y14B 4AQYQ 4A3CH 1HZ9A 4YCVA 2QGQA 2GVAA 1IBKQ 4P73A 4JI5Q 3U58A 1X3FA 4DV7Q 4A3CG 2Z0SA 1CKOA 4BA1I 2CWPA 2F4VL 2A1AA 3GTJH 3F2BA 5JEAG 4UP7A 4JC0A 4JI7L 5IWAL 4POGA 3KOJA 3J80c 4FDBA 2HHHQ 3GTPH 4QJFA 2Q2UA 4B3TQ 2N3SA 1FJGQ 4GN3B 2XGTA 1VQCA 4IPHA 1HNXQ 3H3VH 2WAQE 1NE3A 2PQAB 3K8AA 3BZKA 3FP9A 3CCRA 4A3IH 2UUBL 1JJGA 3HOXG 4JI5L 2VS1A 3MXNB 1A62A 5C0XI 3ULPA 2ATWA 3I4NH 1UWVA 2F52A 3T1HQ 4LF4Q 2YYZA 1L1OC 2UU9Q 3F8TA 1VQLA 2UXDL 1IZ6A 1VS0A 3VDYA 1GD7A 3J7ZC 2MO0A 4DUYL 1PH9A 4B3SL 1KD1C 1YIJA 1UEBA 3PUVA 4ME3A 4QY7A 3S1NH 1B70B 1WYDA 2RHQB 4LFCL 3A5ZB 1Z9FA 3BZCA 3PGZA 4LUOA 1VQIA 1X9NA 1M1KC 5DLQE 3K7AH 3PSIA 1HNZQ 2A19A 1N32Q 4X6AH 4YY3Q 4BY1H 4DV0L 4A3FH 3ULJA 5JEAJ 4DV5Q 4JI3L 1OTCA 4B3RL 2L15A 4R1JA 4GNXA 2VY3A 3E9HA 3K7UC 3GTMH 4IFDG 1HNWL 1J5EL 2OTJA 5LMNQ 1AE2A 2JJQA 3K80C 2NVYH 4IOCA 4MTNA 4DKAC 4H02A 1T9HA 1WFQA 4DR3Q 3HKZG 3SGIA 1VQPA 2K5VA 2JEAI 1YNXA 2EQSA 3KF8B 2MNAA 1CSPA 2NN6I 1LUZA 4JI0L 2E5LL 1E7ZA 3CF5A 1I94Q 3PUXA 4LFBQ 5IYDH 3D0FA 4PG3A 1Y1VG 1SROA 3HOYG 4OO1G 4L5QA 2LXKA 4A3DG 4DR3L 1D7QA 3ZJYC 3T1HL 4A3LH 4KI0A 4P75A 1QVFA 3KYHC 4GOPC 2KHIA 3S2HH 1VQAA 2ZTDA 1YZ6A 1GO3E 3ICEA 4OONA 1NMFA 4X65Q 3CCEA 4AYBE 5C4XG 4QQBX 2RCNA 2IHFA 2FXQA 3OTOQ 4JOIA 2MQHA 1W2BA 4DUYQ 3CAMA 1PH2A 5GADC 2MFIA 1PVOA 2N78A 3GDEA 3FKIG 4P72A 1Q86C 1SLJA 3F2DA 1VQOA 2ASBA 2PI2A 3M3YH 2HT1A 3S1QH 4DV7L 4HJ8A 4Y52H 4JYAL 2Z6KA 1VQEA 3CXCA 4LF6L 2N8NA 1A0IA 1IBMQ 1XNQL 2JA7H 4P71A 1RL2A 4Y7NH 3U4VA 1EOVA 1K0RA 3D31A 1KL9A 5JJLA 5M5WH 4OWTB 2HQLA 1K8AC 5IYCG 1GM5A 1SR3A 4IJHA 1PHJA 4GKJQ 1SRUA 3GD7A 1QVGA 3PUYA 3PIPA 4JYAQ 1X65A 1S3OA 1CUKA 4DAYB 3J81j 4DV3Q 2Z6KC 3HOWG 2ZTCA 2R7FA 3Q8DA 2E2JH 3UDFA 4LFAQ 4DR5Q 1CKNA 4OO1I 1K83H 1DGSA 3RZDH 2BA1A 1IBLL 3M4OH 2WAQG 3I4MG 3STBD 3PF4A 4R4QA 5IP9H 5FJ8G 1Q8KA 3OW2A 4NXMQ 1O7IA 3U50C 4LUVA 1PH3A 3I4NG 1PH7A 4GOPA 1HZBA 4GN4B 4DV2Q 2EXDA 3M7NA 5C3EG 3HOXH 4A3BH 4B3ML 1EUJA 1U5KA 5BR8L 3G4SA 5GQOA 1CSQA 3RNUA 2UUAQ 3A0JA 3S1MH 2IT1A 1NBWA 2RHSB 1EQRA 2PNHA 2XTIA 4GS3A 4PZ6A 4A76A 4OWWB 4BY7H 1V9PA 4NPSA 1VQ7A 3CCVA 4DV0Q 4DR2L 2OCEA 4IOAA 4B3RQ 4NXNL 2IX0A 4MZ9A 4GKKL 1Q7YC 3J80i 5H1SE 1YJ9A 1QUQB 1WCMH 4R4TA 5AJ3L 4DR4L 5IT9c 4X66L 3TS0A 4GN5A 2ZJQA 3CP0A 4LF5L 3PO2G 2PI2E 1UE1A 2JA6H 3K81C 4JI6Q 1PA6A 1PH4A 3H0GG 3CCUA 1I5FA 1KQSA 4DR5L 1ASYA 4BXXG 2BA0A 1N9WA 5IE8A 4UY8C 2HIXA 4MNOA 4DV3L 4L5TA 1HH2P 5M3MH 2F4VQ 3CPFA 4YCWA 4YHHQ 4IFDI 4YWLA 4AQYL 1FL0A 2UUBQ 1XMOQ 4QIWE 5M3FH 4B3TL 3TS2A 3PO3H 2HIVA 1NMGA 1S72A 4JBKA 3S24A 3HOYH 1Y1VH 1EIFA 2VZAA 1FJGL 2UXCQ 2R7ZH 1GVPA 2JQOA 4LFAL 1XPUA 1PYSB 1VQKA 1G291 4OX9L 2ZTEA 4A4IA 2R92G 2VL6A 5IP7H 2I5MX 2VNUD 4A3MH 3HKSA 1C0AA 5IYBG 2I5LX 4TQUS 4IJLA 5EAYA 3CC7A 2R6GA 4DV6Q 3L2PA 4J15A 4GLAC 4DR1Q 1MJCA 1G51A 2Q2IA 2VQEQ 3S1RH 4YWKA 1LTLA 3M4PA 4A3FG 3EIVA 4BBSG 4DV5L 2YTXA 3AYHB 4BA2I 4DR4Q 1N34L 3RN5A 1C9OA 2R93H 1BKBA 4JI1Q 1UE7A 4JI4Q 4C3HH 1TWFH 4UP9A 4X64Q 4LW1A 4IO9A 3OTOL 1YHQA 2JEBI 2R7ZG 4WJ4A 2R7DA 1N36L 1QVCA 4DUZL 3GTQH 4JI1L 4OXPA 4JI4L 1QUQA 4X66Q 4LF8L 3W1BA 5M3FG 3PO3G 4A93H 1Q1EA 2CKZB 1W3SA 2JA9A 4JI0Q 3UDIA 3A74A 2B3GA 1VQ4A 3CCLA 2DUDA 4DPGA 4NXML 1YBYA 2OQ0A 3E0EA 3KF6A 3AFQA 3H0GH 5C0XJ 3JAMc 3CCMA 4BXXH 3HFZB 4LNQA 4XTCS 3PUZA 3JC66 4JI8L 3PV0A 2N49A 2NN6G 4KHZA 2JA6G 2E2HH 4LFBL 3PO2H 4HJ5A 3RN2A 4LF4L 1VQJA 3HKZE 3G48A 1EWIA 1TWCH 1KAWA 4A3JH 2IX1A 4K0KL 2K5HA 4QL5A 1YEZA 3KDFB 2VQEL 4L5RC 4OX9Q 5C44H 1VQNA 3PIOA 3CCJA 4BBRH 4NB3A 2YU9H 1XMQL 1Q81C 3BJUA 3HOZH 1XJVA 1K3RA 1HZAA 1Z47A 2LXJA 1J5EQ 4LUZA 4DV4Q 1XNQQ 1IXRA 5E7NA 3UDGA 4LF6Q 2CQOA 4DAMA 4A3GH 4KHPQ 1IL2A 2UXBL 1X55A 4HIDA 1Q82C 2YTYA 1SE8A 1PV4A 3S17H 1VCIA 4A3EG 4O2DA 4HJAA 4DR6Q 4KHPL 4LF7L 1A8VA 2DGYA 3RR5A 4R4CA 1Y1WG 1SFOH 4C3JH 5IP9G 4X62L 1VQ8A 1EIYB 4LF8Q 3I4MH 1FVIA 1JJCB 3AQQA 1N36Q 2K50A 4IPDA 1L1OB 3AFPA 3S14H 2NVTH 2VQFQ 2GVBA 1XMOL 3I4OA 2JK8A 2K14A 2R93G 2QA4A 1HZCA 3PF5A 2AHOB 3HOWH 5ELNA 1U0LA 4YWMA 2OTLA 1S40A 3GTOH 4TVAB 2D62A 1PH5A 4UPAA 4DK6C 1G6PA 4P74A 5IYCH 3RZOH 1OXUA 1QZGA 1TWGH 4JI8Q 3UDXA 4QGUA 5HGQA 1PH8A 5GROA 4LF9L 2D0PA 1HR0W 4O0AA 1E22A 1N34Q 2BH8A 3J81i 4DR2Q 2EIFA 2ID0A 4GOPB 2D0OA 4B3MQ 3M4QA 4GKKQ 2ZM6Q 2AWOA 2I0QA 1N8RC 3UE0A 1NY4A 4HIMA 4RG1A 2UXCL 3W1GA 4B3SQ 3J7A5 4DUZQ 4JI2Q 1KIXA 5FLMG 3KFUA 2UU9L 4PZ7A 2MO1A 3GO5A 5C4XH 1EYGA 5M3MG 1I50H 3S16H 1B7YB 2JA8G 1XPOA 1CKNB 3BU2A 1OXTA 2Y0SG 2NVQH 1X3GA 2JA8H 4A3LG 1OXVA 1IBLQ 1P16A 3KDFA 5GAHC 2ZJRA 5LMNW 1KRSA 1NTGA 5M5XH 5C4JH 1N33Q 1LM0A 4X62Q 3GTLH 4A3DH 2HHHL 3GTGH 5K36G 2YV5A 2ZJPA 2PMZE 1VQGA 4LF7Q 4AYBG 3ULLA 5IYDG 2JA5G 1N33L 1VQMA 1WCMG 3ER0A 3CQZH 1E1OA 2OQKA 2GN5A 1WI5A 2I5HA 4EX5A 2K5NA 3A5UA 2NVXH 1H95A 3GTKH 2VQFL 1OXSC 1QZHA 3RLFA 1K9MC 5JJIA 1VQHA 4BY7G 3CPWA 1EQQA 3E9IA 4C2MH 1VQ5A 2UXDQ 3RLOA 3G6EA 1E3PA 2VUMG 1YITA 4DV6L 1X6OA 1YHAA 4RMFA 1HNZL 1XNRQ 4HIOA 1E1TA 2ES2A 4PMWA 5C3EH 3MEFA 1JE5A 4A3BG 3NBHB 1I6HH 1AH9A 2E8GA 3IRBA 1XNRL 4L5SA 4A3KH 1YVCA 1HJPA 1XTDA 5FJ8H 2PQAA 1K73C 1PH1A 1Q1BA 3M9BA 3PUWA 4JI2L 3K0XA 1HR0Q 5ELOA 3CC2A 3I55A 3HOUH 3HOVH 2QEXA 1EFWA 1WJJA 1K8GA 3DLLA 3H15A 5AJ3Q 1RIPA 4HIKA 3HOVG 3HOUG 2ZM6L 1PH6A 4X64L 2Q2TA 3LGJA 4AIMA 3CMEA 3CW2C 5LMNL 4A3KG 1BBWA 2WP8J 1HR0L 2CCZA 4DK3C 5JJKA 2V1CC 4A3EH 1KXLA 4JI3Q 4UP8A 3M85A 4JV5Q 5FLXc 4JG2A 1B8AA 4JBJA 2A8VA 1PYBA 2VUMH 3TREA 4POFA 1TXYA 2F3IA 1IYJB 3KF6B 1XPRA 2E5LQ 2NZHA 2OWOA 1OXXK 1SN8A 4AH6A 2JA7G 2VW9A 4APVA 4GNXC 4BBRG 2UUCL 3TRZA 1VQBA 3EBEA 2CWAA 3L0OA 3F2CA 1PFSA 3PCOB 3W5OA 4A3JG 3FKIH 4YCUA 2JA5H 1X54A 1YHBA 3KJPA 3CC4A 1NJIC 1GKHA 1L1OA 4PZ8A 3CCQA 2JE6I 2LSSA 1MIUA 3EN2A 4C3IH 3H3VI 3WWVA 1C7YA 4GNXB 3NENA 3S15H 1XMQQ 5BR8Q 3J81c 3CD6A 1J6QA 1JT8A 2IY5B 3CMAA 4GLXA 3FHWA 5GAGC 1P8LA 2KBNA 1X56A 2RF4A 3TEHB 4A93G 1UE5A 2B29A 4R4IA 3L7ZC 4LFCQ 5FLMH 2UXBQ 1AE3A 3RLNA 1CKMA 4IPGA 4HJ7A 1KHIA 1BBUA 1YI2A 4JBWA 3S2DH 4DV4L 2KHJA 4JOIC 2AWNA 1V43A 2AKWB 4YY3L 3NEMA 4XIGS 3KJOA 2ALYB 2B63H 2Y0SE 1JJ2A 4JI7Q 2NZOA 1IBKL 3ERSX 4GLVB 4IFDJ 3I7FA 1JB7A 1L2FA 1VQ6A 5LMUL 1VQFA 1L0WA 2KCTA 4GKJL 5HY6A 1E24A 2C35B 4BBSH 5IY0A 2WFWA 4JI6L 4KLKA 1HNXL 1BVSA 5IWAQ 3T1YL 1A63A 4X65L 4HJ9A 3U4ZA 1JMCA 4EQ5A 2H5XA 3DM3A 1VQ9A 4JCVE 3STBC 1TWHH 2YTVA 4BY1G 4YHHL 1YJNA 1I94L 3CCSA 1YJWA 3B6YA 1TWAH 1Q12A 5IYBH 2BH2A 1X3EA 2K4KA 3KLWA 4DV2L 4A3MG 2CFMA 4K0KQ 5IP7G 2UUCQ 5C0XG 2K75A 2Q2HA 4LF9Q 2R92H 2AMCB 1UE6A 2K52A 3OYYA 3I2ZA 1LYLA 4DNIA 2B63G 4NXNQ 2IHEA 3I56A 1Y1WH 1KRTA 3F1ZA 1ASZA 2WB1E 3JAMi 5M5YH 4LWCA 4DV1Q 4WJ3M 4R4OA 4DR7L 4JV5L 2UUAL 4A75A 1I3QH 1Q46A 1KC8C 4DR6L 1N32L 4A3IG 1R9TH 3TQYA 4DV1L 4A3GG 1FGUA 2KCMA 4DR7Q 3NELA 5GAEC 3UE1A 5J3BA 1V1QA 1VQDA 4IPCA 4DR1L 4JBMA 4LF5Q 1MJEA 3HOZG 3AEVA 1M90C 2KENA 2WB1G 1HNWQ 4OWXB 1WOCA 4ALPA 1SMXA 5C44G 1IBML 1D8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y Q;  2E2I H;  5LMU Q;  1MKH A;  3G71 A;  1Y14 B;  4AQY Q;  4A3C H;  1HZ9 A;  4YCV A;  2QGQ A;  2GVA A;  1IBK Q;  4P73 A;  4JI5 Q;  3U58 A;  1X3F A;  4DV7 Q;  4A3C G;  2Z0S A;  1CKO A;  4BA1 I;  2CWP A;  2F4V L;  2A1A A;  3GTJ H;  3F2B A;  5JEA G;  4UP7 A;  4JC0 A;  4JI7 L;  5IWA L;  4POG A;  3KOJ A;  3J80 c;  4FDB A;  2HHH Q;  3GTP H;  4QJF A;  2Q2U A;  4B3T Q;  2N3S A;  1FJG Q;  4GN3 B;  2XGT A;  1VQC A;  4IPH A;  1HNX Q;  3H3V H;  2WAQ E;  1NE3 A;  2PQA B;  3K8A A;  3BZK A;  3FP9 A;  3CCR A;  4A3I H;  2UUB L;  1JJG A;  3HOX G;  4JI5 L;  2VS1 A;  3MXN B;  1A62 A;  5C0X I;  3ULP A;  2ATW A;  3I4N H;  1UWV A;  2F52 A;  3T1H Q;  4LF4 Q;  2YYZ A;  1L1O C;  2UU9 Q;  3F8T A;  1VQL A;  2UXD L;  1IZ6 A;  1VS0 A;  3VDY A;  1GD7 A;  3J7Z C;  2MO0 A;  4DUY L;  1PH9 A;  4B3S L;  1KD1 C;  1YIJ A;  1UEB A;  3PUV A;  4ME3 A;  4QY7 A;  3S1N H;  1B70 B;  1WYD A;  2RHQ B;  4LFC L;  3A5Z B;  1Z9F A;  3BZC A;  3PGZ A;  4LUO A;  1VQI A;  1X9N A;  1M1K C;  5DLQ E;  3K7A H;  3PSI A;  1HNZ Q;  2A19 A;  1N32 Q;  4X6A H;  4YY3 Q;  4BY1 H;  4DV0 L;  4A3F H;  3ULJ A;  5JEA J;  4DV5 Q;  4JI3 L;  1OTC A;  4B3R L;  2L15 A;  4R1J A;  4GNX A;  2VY3 A;  3E9H A;  3K7U C;  3GTM H;  4IFD G;  1HNW L;  1J5E L;  2OTJ A;  5LMN Q;  1AE2 A;  2JJQ A;  3K80 C;  2NVY H;  4IOC A;  4MTN A;  4DKA C;  4H02 A;  1T9H A;  1WFQ A;  4DR3 Q;  3HKZ G;  3SGI A;  1VQP A;  2K5V A;  2JEA I;  1YNX A;  2EQS A;  3KF8 B;  2MNA A;  1CSP A;  2NN6 I;  1LUZ A;  4JI0 L;  2E5L L;  1E7Z A;  3CF5 A;  1I94 Q;  3PUX A;  4LFB Q;  5IYD H;  3D0F A;  4PG3 A;  1Y1V G;  1SRO A;  3HOY G;  4OO1 G;  4L5Q A;  2LXK A;  4A3D G;  4DR3 L;  1D7Q A;  3ZJY C;  3T1H L;  4A3L H;  4KI0 A;  4P75 A;  1QVF A;  3KYH C;  4GOP C;  2KHI A;  3S2H H;  1VQA A;  2ZTD A;  1YZ6 A;  1GO3 E;  3ICE A;  4OON A;  1NMF A;  4X65 Q;  3CCE A;  4AYB E;  5C4X G;  4QQB X;  2RCN A;  2IHF A;  2FXQ A;  3OTO Q;  4JOI A;  2MQH A;  1W2B A;  4DUY Q;  3CAM A;  1PH2 A;  5GAD C;  2MFI A;  1PVO A;  2N78 A;  3GDE A;  3FKI G;  4P72 A;  1Q86 C;  1SLJ A;  3F2D A;  1VQO A;  2ASB A;  2PI2 A;  3M3Y H;  2HT1 A;  3S1Q H;  4DV7 L;  4HJ8 A;  4Y52 H;  4JYA L;  2Z6K A;  1VQE A;  3CXC A;  4LF6 L;  2N8N A;  1A0I A;  1IBM Q;  1XNQ L;  2JA7 H;  4P71 A;  1RL2 A;  4Y7N H;  3U4V A;  1EOV A;  1K0R A;  3D31 A;  1KL9 A;  5JJL A;  5M5W H;  4OWT B;  2HQL A;  1K8A C;  5IYC G;  1GM5 A;  1SR3 A;  4IJH A;  1PHJ A;  4GKJ Q;  1SRU A;  3GD7 A;  1QVG A;  3PUY A;  3PIP A;  4JYA Q;  1X65 A;  1S3O A;  1CUK A;  4DAY B;  3J81 j;  4DV3 Q;  2Z6K C;  3HOW G;  2ZTC A;  2R7F A;  3Q8D A;  2E2J H;  3UDF A;  4LFA Q;  4DR5 Q;  1CKN A;  4OO1 I;  1K83 H;  1DGS A;  3RZD H;  2BA1 A;  1IBL L;  3M4O H;  2WAQ G;  3I4M G;  3STB D;  3PF4 A;  4R4Q A;  5IP9 H;  5FJ8 G;  1Q8K A;  3OW2 A;  4NXM Q;  1O7I A;  3U50 C;  4LUV A;  1PH3 A;  3I4N G;  1PH7 A;  4GOP A;  1HZB A;  4GN4 B;  4DV2 Q;  2EXD A;  3M7N A;  5C3E G;  3HOX H;  4A3B H;  4B3M L;  1EUJ A;  1U5K A;  5BR8 L;  3G4S A;  5GQO A;  1CSQ A;  3RNU A;  2UUA Q;  3A0J A;  3S1M H;  2IT1 A;  1NBW A;  2RHS B;  1EQR A;  2PNH A;  2XTI A;  4GS3 A;  4PZ6 A;  4A76 A;  4OWW B;  4BY7 H;  1V9P A;  4NPS A;  1VQ7 A;  3CCV A;  4DV0 Q;  4DR2 L;  2OCE A;  4IOA A;  4B3R Q;  4NXN L;  2IX0 A;  4MZ9 A;  4GKK L;  1Q7Y C;  3J80 i;  5H1S E;  1YJ9 A;  1QUQ B;  1WCM H;  4R4T A;  5AJ3 L;  4DR4 L;  5IT9 c;  4X66 L;  3TS0 A;  4GN5 A;  2ZJQ A;  3CP0 A;  4LF5 L;  3PO2 G;  2PI2 E;  1UE1 A;  2JA6 H;  3K81 C;  4JI6 Q;  1PA6 A;  1PH4 A;  3H0G G;  3CCU A;  1I5F A;  1KQS A;  4DR5 L;  1ASY A;  4BXX G;  2BA0 A;  1N9W A;  5IE8 A;  4UY8 C;  2HIX A;  4MNO A;  4DV3 L;  4L5T A;  1HH2 P;  5M3M H;  2F4V Q;  3CPF A;  4YCW A;  4YHH Q;  4IFD I;  4YWL A;  4AQY L;  1FL0 A;  2UUB Q;  1XMO Q;  4QIW E;  5M3F H;  4B3T L;  3TS2 A;  3PO3 H;  2HIV A;  1NMG A;  1S72 A;  4JBK A;  3S24 A;  3HOY H;  1Y1V H;  1EIF A;  2VZA A;  1FJG L;  2UXC Q;  2R7Z H;  1GVP A;  2JQO A;  4LFA L;  1XPU A;  1PYS B;  1VQK A;  1G29 1;  4OX9 L;  2ZTE A;  4A4I A;  2R92 G;  2VL6 A;  5IP7 H;  2I5M X;  2VNU D;  4A3M H;  3HKS A;  1C0A A;  5IYB G;  2I5L X;  4TQU S;  4IJL A;  5EAY A;  3CC7 A;  2R6G A;  4DV6 Q;  3L2P A;  4J15 A;  4GLA C;  4DR1 Q;  1MJC A;  1G51 A;  2Q2I A;  2VQE Q;  3S1R H;  4YWK A;  1LTL A;  3M4P A;  4A3F G;  3EIV A;  4BBS G;  4DV5 L;  2YTX A;  3AYH B;  4BA2 I;  4DR4 Q;  1N34 L;  3RN5 A;  1C9O A;  2R93 H;  1BKB A;  4JI1 Q;  1UE7 A;  4JI4 Q;  4C3H H;  1TWF H;  4UP9 A;  4X64 Q;  4LW1 A;  4IO9 A;  3OTO L;  1YHQ A;  2JEB I;  2R7Z G;  4WJ4 A;  2R7D A;  1N36 L;  1QVC A;  4DUZ L;  3GTQ H;  4JI1 L;  4OXP A;  4JI4 L;  1QUQ A;  4X66 Q;  4LF8 L;  3W1B A;  5M3F G;  3PO3 G;  4A93 H;  1Q1E A;  2CKZ B;  1W3S A;  2JA9 A;  4JI0 Q;  3UDI A;  3A74 A;  2B3G A;  1VQ4 A;  3CCL A;  2DUD A;  4DPG A;  4NXM L;  1YBY A;  2OQ0 A;  3E0E A;  3KF6 A;  3AFQ A;  3H0G H;  5C0X J;  3JAM c;  3CCM A;  4BXX H;  3HFZ B;  4LNQ A;  4XTC S;  3PUZ A;  3JC6 6;  4JI8 L;  3PV0 A;  2N49 A;  2NN6 G;  4KHZ A;  2JA6 G;  2E2H H;  4LFB L;  3PO2 H;  4HJ5 A;  3RN2 A;  4LF4 L;  1VQJ A;  3HKZ E;  3G48 A;  1EWI A;  1TWC H;  1KAW A;  4A3J H;  2IX1 A;  4K0K L;  2K5H A;  4QL5 A;  1YEZ A;  3KDF B;  2VQE L;  4L5R C;  4OX9 Q;  5C44 H;  1VQN A;  3PIO A;  3CCJ A;  4BBR H;  4NB3 A;  2YU9 H;  1XMQ L;  1Q81 C;  3BJU A;  3HOZ H;  1XJV A;  1K3R A;  1HZA A;  1Z47 A;  2LXJ A;  1J5E Q;  4LUZ A;  4DV4 Q;  1XNQ Q;  1IXR A;  5E7N A;  3UDG A;  4LF6 Q;  2CQO A;  4DAM A;  4A3G H;  4KHP Q;  1IL2 A;  2UXB L;  1X55 A;  4HID A;  1Q82 C;  2YTY A;  1SE8 A;  1PV4 A;  3S17 H;  1VCI A;  4A3E G;  4O2D A;  4HJA A;  4DR6 Q;  4KHP L;  4LF7 L;  1A8V A;  2DGY A;  3RR5 A;  4R4C A;  1Y1W G;  1SFO H;  4C3J H;  5IP9 G;  4X62 L;  1VQ8 A;  1EIY B;  4LF8 Q;  3I4M H;  1FVI A;  1JJC B;  3AQQ A;  1N36 Q;  2K50 A;  4IPD A;  1L1O B;  3AFP A;  3S14 H;  2NVT H;  2VQF Q;  2GVB A;  1XMO L;  3I4O A;  2JK8 A;  2K14 A;  2R93 G;  2QA4 A;  1HZC A;  3PF5 A;  2AHO B;  3HOW H;  5ELN A;  1U0L A;  4YWM A;  2OTL A;  1S40 A;  3GTO H;  4TVA B;  2D62 A;  1PH5 A;  4UPA A;  4DK6 C;  1G6P A;  4P74 A;  5IYC H;  3RZO H;  1OXU A;  1QZG A;  1TWG H;  4JI8 Q;  3UDX A;  4QGU A;  5HGQ A;  1PH8 A;  5GRO A;  4LF9 L;  2D0P A;  1HR0 W;  4O0A A;  1E22 A;  1N34 Q;  2BH8 A;  3J81 i;  4DR2 Q;  2EIF A;  2ID0 A;  4GOP B;  2D0O A;  4B3M Q;  3M4Q A;  4GKK Q;  2ZM6 Q;  2AWO A;  2I0Q A;  1N8R C;  3UE0 A;  1NY4 A;  4HIM A;  4RG1 A;  2UXC L;  3W1G A;  4B3S Q;  3J7A 5;  4DUZ Q;  4JI2 Q;  1KIX A;  5FLM G;  3KFU A;  2UU9 L;  4PZ7 A;  2MO1 A;  3GO5 A;  5C4X H;  1EYG A;  5M3M G;  1I50 H;  3S16 H;  1B7Y B;  2JA8 G;  1XPO A;  1CKN B;  3BU2 A;  1OXT A;  2Y0S G;  2NVQ H;  1X3G A;  2JA8 H;  4A3L G;  1OXV A;  1IBL Q;  1P16 A;  3KDF A;  5GAH C;  2ZJR A;  5LMN W;  1KRS A;  1NTG A;  5M5X H;  5C4J H;  1N33 Q;  1LM0 A;  4X62 Q;  3GTL H;  4A3D H;  2HHH L;  3GTG H;  5K36 G;  2YV5 A;  2ZJP A;  2PMZ E;  1VQG A;  4LF7 Q;  4AYB G;  3ULL A;  5IYD G;  2JA5 G;  1N33 L;  1VQM A;  1WCM G;  3ER0 A;  3CQZ H;  1E1O A;  2OQK A;  2GN5 A;  1WI5 A;  2I5H A;  4EX5 A;  2K5N A;  3A5U A;  2NVX H;  1H95 A;  3GTK H;  2VQF L;  1OXS C;  1QZH A;  3RLF A;  1K9M C;  5JJI A;  1VQH A;  4BY7 G;  3CPW A;  1EQQ A;  3E9I A;  4C2M H;  1VQ5 A;  2UXD Q;  3RLO A;  3G6E A;  1E3P A;  2VUM G;  1YIT A;  4DV6 L;  1X6O A;  1YHA A;  4RMF A;  1HNZ L;  1XNR Q;  4HIO A;  1E1T A;  2ES2 A;  4PMW A;  5C3E H;  3MEF A;  1JE5 A;  4A3B G;  3NBH B;  1I6H H;  1AH9 A;  2E8G A;  3IRB A;  1XNR L;  4L5S A;  4A3K H;  1YVC A;  1HJP A;  1XTD A;  5FJ8 H;  2PQA A;  1K73 C;  1PH1 A;  1Q1B A;  3M9B A;  3PUW A;  4JI2 L;  3K0X A;  1HR0 Q;  5ELO A;  3CC2 A;  3I55 A;  3HOU H;  3HOV H;  2QEX A;  1EFW A;  1WJJ A;  1K8G A;  3DLL A;  3H15 A;  5AJ3 Q;  1RIP A;  4HIK A;  3HOV G;  3HOU G;  2ZM6 L;  1PH6 A;  4X64 L;  2Q2T A;  3LGJ A;  4AIM A;  3CME A;  3CW2 C;  5LMN L;  4A3K G;  1BBW A;  2WP8 J;  1HR0 L;  2CCZ A;  4DK3 C;  5JJK A;  2V1C C;  4A3E H;  1KXL A;  4JI3 Q;  4UP8 A;  3M85 A;  4JV5 Q;  5FLX c;  4JG2 A;  1B8A A;  4JBJ A;  2A8V A;  1PYB A;  2VUM H;  3TRE A;  4POF A;  1TXY A;  2F3I A;  1IYJ B;  3KF6 B;  1XPR A;  2E5L Q;  2NZH A;  2OWO A;  1OXX K;  1SN8 A;  4AH6 A;  2JA7 G;  2VW9 A;  4APV A;  4GNX C;  4BBR G;  2UUC L;  3TRZ A;  1VQB A;  3EBE A;  2CWA A;  3L0O A;  3F2C A;  1PFS A;  3PCO B;  3W5O A;  4A3J G;  3FKI H;  4YCU A;  2JA5 H;  1X54 A;  1YHB A;  3KJP A;  3CC4 A;  1NJI C;  1GKH A;  1L1O A;  4PZ8 A;  3CCQ A;  2JE6 I;  2LSS A;  1MIU A;  3EN2 A;  4C3I H;  3H3V I;  3WWV A;  1C7Y A;  4GNX B;  3NEN A;  3S15 H;  1XMQ Q;  5BR8 Q;  3J81 c;  3CD6 A;  1J6Q A;  1JT8 A;  2IY5 B;  3CMA A;  4GLX A;  3FHW A;  5GAG C;  1P8L A;  2KBN A;  1X56 A;  2RF4 A;  3TEH B;  4A93 G;  1UE5 A;  2B29 A;  4R4I A;  3L7Z C;  4LFC Q;  5FLM H;  2UXB Q;  1AE3 A;  3RLN A;  1CKM A;  4IPG A;  4HJ7 A;  1KHI A;  1BBU A;  1YI2 A;  4JBW A;  3S2D H;  4DV4 L;  2KHJ A;  4JOI C;  2AWN A;  1V43 A;  2AKW B;  4YY3 L;  3NEM A;  4XIG S;  3KJO A;  2ALY B;  2B63 H;  2Y0S E;  1JJ2 A;  4JI7 Q;  2NZO A;  1IBK L;  3ERS X;  4GLV B;  4IFD J;  3I7F A;  1JB7 A;  1L2F A;  1VQ6 A;  5LMU L;  1VQF A;  1L0W A;  2KCT A;  4GKJ L;  5HY6 A;  1E24 A;  2C35 B;  4BBS H;  5IY0 A;  2WFW A;  4JI6 L;  4KLK A;  1HNX L;  1BVS A;  5IWA Q;  3T1Y L;  1A63 A;  4X65 L;  4HJ9 A;  3U4Z A;  1JMC A;  4EQ5 A;  2H5X A;  3DM3 A;  1VQ9 A;  4JCV E;  3STB C;  1TWH H;  2YTV A;  4BY1 G;  4YHH L;  1YJN A;  1I94 L;  3CCS A;  1YJW A;  3B6Y A;  1TWA H;  1Q12 A;  5IYB H;  2BH2 A;  1X3E A;  2K4K A;  3KLW A;  4DV2 L;  4A3M G;  2CFM A;  4K0K Q;  5IP7 G;  2UUC Q;  5C0X G;  2K75 A;  2Q2H A;  4LF9 Q;  2R92 H;  2AMC B;  1UE6 A;  2K52 A;  3OYY A;  3I2Z A;  1LYL A;  4DNI A;  2B63 G;  4NXN Q;  2IHE A;  3I56 A;  1Y1W H;  1KRT A;  3F1Z A;  1ASZ A;  2WB1 E;  3JAM i;  5M5Y H;  4LWC A;  4DV1 Q;  4WJ3 M;  4R4O A;  4DR7 L;  4JV5 L;  2UUA L;  4A75 A;  1I3Q H;  1Q46 A;  1KC8 C;  4DR6 L;  1N32 L;  4A3I G;  1R9T H;  3TQY A;  4DV1 L;  4A3G G;  1FGU A;  2KCM A;  4DR7 Q;  3NEL A;  5GAE C;  3UE1 A;  5J3B A;  1V1Q A;  1VQD A;  4IPC A;  4DR1 L;  4JBM A;  4LF5 Q;  1MJE A;  3HOZ G;  3AEV A;  1M90 C;  2KEN A;  2WB1 G;  1HNW Q;  4OWX B;  1WOC A;  4ALP A;  1SMX A;  5C44 G;  1IBM L;  1D8L A; 
#chains in the Genus database with same CATH topology
 2E2I H;  3G71 A;  3RZO B;  1GUS A;  1IHZ A;  1HZ9 A;  1G2S A;  4P73 A;  4JI5 Q;  2Z0S A;  1CKO A;  1DXM A;  2CWP A;  4MTK A;  5JEA G;  4UP7 A;  4V0B A;  4DNT B;  3GTP H;  5ISR A;  3S14 B;  4IPH A;  4K6D A;  2DN8 A;  4A3I H;  2UUB L;  3T4A C;  1B9M A;  3M4Y A;  3S15 B;  2VS1 A;  5C6A A;  5C0X I;  3MZ5 A;  1LTA D;  4A93 B;  1JB3 A;  5D3D A;  3T1H Q;  3GTQ B;  3K59 A;  2YYZ A;  2UU9 Q;  1STN A;  4A3G B;  2K04 A;  1CT1 D;  1HTP A;  3J7Z C;  4B3S L;  4ME3 A;  5C0X H;  3C3L A;  3IL8 A;  1SYD A;  2OXP A;  3PGZ A;  1VQI A;  1EY6 A;  4BBR B;  3PSI A;  4RHR A;  2A19 A;  4XQJ A;  2L15 A;  2VY3 A;  2ZXO A;  3K7U C;  5C5L A;  1J5E L;  3MWY W;  2OTJ A;  1MBY A;  5L37 A;  1KLU D;  1T9H A;  1GUO A;  1PTO F;  3HKZ G;  3VA5 A;  2JXM B;  1VQP A;  2K5V A;  3R8B A;  4RKL A;  1YNX A;  2MNA A;  1LUZ A;  2I46 A;  4LFB Q;  1DJR D;  1HA5 A;  1EL0 A;  1Y1V G;  3HOY G;  5K36 H;  3EJI A;  1SAP A;  1D7Q A;  1SNM A;  3ZJY C;  1CM9 A;  3QOJ A;  5M3M B;  1T5X D;  4P75 A;  1HQR D;  1B44 D;  2PW5 A;  3S2H H;  1JOK A;  1VQA A;  3H09 A;  1RKN A;  3ICE A;  4OON A;  3CCE A;  3NUC A;  4QUC A;  3HS0 C;  2IHF A;  2MQH A;  5CC4 A;  4KN7 C;  2MFI A;  1PVO A;  3FRP B;  4P2C B;  4P72 A;  3F2D A;  1SNQ A;  3M3Y H;  4DV7 L;  4HJ8 A;  4JYA L;  3CXC A;  1VQE A;  3BVG A;  2JA7 H;  2EYM A;  1RL2 A;  3EFX D;  4X3S A;  3K5N A;  2F0Q A;  1A3U A;  2VB3 X;  3D31 A;  1KL9 A;  4OWT B;  4UHV A;  3S16 B;  4GKJ Q;  2FMM A;  4DK1 A;  4JYA Q;  1E2Z A;  5KEE A;  1X65 A;  3Q0A A;  4DV3 Q;  2Z6K C;  3HOW G;  3MC0 B;  2E2J H;  1HPC A;  3IFD A;  4DR5 Q;  4OO1 I;  3TP8 A;  2BA1 A;  4KKU A;  3STB D;  4C3J G;  1Q8K A;  3SXH A;  5D3I B;  1EWC A;  2F0M A;  1LAB A;  1HZB A;  4DV2 Q;  1XXG A;  4B3M L;  1I6V C;  1U5K A;  3GV6 A;  1CSQ A;  2UUA Q;  2SEB D;  1NBW A;  2D5D A;  3OWE B;  1TU2 B;  4PZ6 A;  4GS3 A;  4OWW B;  5IGG A;  3NWT A;  3HOZ B;  2J0T D;  5C4J B;  1VQ7 A;  3CCV A;  3QR8 A;  2OCE A;  3QWN A;  2IX0 A;  3BVZ A;  4MZ9 A;  1EY7 A;  5H1S E;  2EYH A;  4A3I B;  1B3A A;  3D3R A;  5M9O A;  1R4Q B;  5C4X B;  2PI2 E;  5IIF A;  2JA6 H;  3I70 A;  4BXX G;  1ASY A;  1YNJ D;  4EGV A;  3CHB D;  4B9X A;  4UY8 C;  3J7A V;  2F4V Q;  5E4X A;  1FL0 A;  2HCC A;  3MXN A;  4QIW E;  3PO3 H;  4JBK A;  3HOY H;  1EIF A;  1EEI D;  2VZA A;  1VQK A;  1G29 1;  5IP7 H;  2I5M X;  4A3M H;  1C0A A;  2JA7 B;  3J80 E;  5I4D A;  4DV6 Q;  4GLA C;  4DFA A;  5EBC A;  1MJC A;  2L0C A;  4K2K A;  2VQE Q;  2IJ0 A;  3BDC A;  3BYT B;  3F2U A;  4DV5 L;  2YTX A;  3S17 B;  4L6T B;  4BA2 I;  3SVM A;  3RN5 A;  2FJ2 A;  2DY8 A;  1JR0 D;  4EQO A;  4UP9 A;  1PFM A;  2JEB I;  2OF1 A;  1QVC A;  4DUZ L;  1EFI D;  3W1B A;  3I4N B;  3PO3 G;  1Q1E A;  2G9D A;  2B2V A;  3GP7 A;  2XWJ B;  5EJW A;  1VQ4 A;  1DOL A;  4LJZ C;  4NXM L;  2PZT A;  3AFQ A;  1E2W A;  5C0X J;  2O2L D;  4BXX H;  1M4V A;  3HFZ B;  4LNQ A;  5IOC A;  2JA6 G;  2NN6 G;  1LT4 D;  2E2H H;  4LFB L;  2L1B A;  3RN2 A;  5AFW A;  1FNV A;  2F0H A;  3VR4 A;  1VQJ A;  3TDQ A;  3HKZ E;  3G48 A;  2K5H A;  4ZAI A;  2CW0 C;  4BBR H;  1SNP A;  5M3F B;  2YU9 H;  4KV6 A;  4V19 0;  3BJU A;  1TS5 A;  5C4Z A;  1J5E Q;  4LUZ A;  1XNQ Q;  1F9S A;  4DAM A;  1PZK D;  4A3G H;  2LKV A;  4FF1 A;  5D14 A;  2M2L A;  2R3Z A;  4KKS A;  3S17 H;  4A3E G;  4O2D A;  4HJA A;  4DR6 Q;  4KHP L;  1A8V A;  1E2V A;  1VF7 A;  2DGY A;  1SFO H;  5ELB A;  4DAV A;  4LF8 Q;  1FVI A;  3S2H B;  2AQ2 B;  3A54 A;  3AQQ A;  4BS9 A;  1L1O B;  1CA5 A;  3S14 H;  5KND A;  3NXW A;  2JK8 A;  2K14 A;  2R93 G;  1HZC A;  3BDO A;  1TWA B;  3TP6 A;  4BY7 B;  5EKI A;  4DK6 C;  3C46 A;  5C3X A;  1WTP A;  2BE5 C;  3RZO H;  2MGS A;  1OXU A;  1QZG A;  2QCP X;  3P75 A;  1EU4 A;  1F2L A;  1RF2 D;  3HZX A;  2BH8 A;  3J81 i;  4GOP B;  2D0O A;  1HA6 A;  2Z4H A;  3OW7 A;  4RG1 A;  2PMZ B;  1KIX A;  3KFU A;  2UU9 L;  4PZ7 A;  2MO1 A;  3GO5 A;  5C4X H;  4G4K A;  1UAP A;  1CKN B;  2NVQ H;  4A3L G;  4CDE C;  5LHY 1;  1P16 A;  1SJE D;  1NNX A;  5GAH C;  1NTG A;  5C4J H;  2HHH L;  2G9H D;  4Q5V A;  2JA5 G;  1N33 L;  2MPM A;  4ILW A;  1Y69 U;  1D2B A;  1E1O A;  4M1U B;  2OQK A;  3SEB A;  4EX5 A;  3A5U A;  2E76 C;  1H95 A;  2NBF A;  3GTP B;  4DF7 A;  2JP1 A;  2EXZ A;  2Q8T A;  3T16 A;  1VQ5 A;  4YIJ A;  3RLO A;  3G6E A;  4NKL A;  5E3F A;  4DV6 L;  2K05 A;  4OGQ C;  1YHA A;  1BCP F;  1E1T A;  4NP5 A;  5C3E H;  2M00 A;  1AH9 A;  1HRJ A;  1DOK A;  2K5Q A;  1XTD A;  3OSO A;  1K73 C;  1LTI D;  2CQA A;  3PUW A;  4JI2 L;  3K0X A;  3HOU H;  5ELO A;  3HOV H;  3D6C A;  1EFW A;  4WOR A;  3HOU G;  2ZM6 L;  1PH6 A;  3BS1 A;  4R8N A;  2Q2T A;  3CW2 C;  4QIW B;  3GTL B;  2RSN A;  4ZLT F;  1JOQ A;  3MEH A;  4JG2 A;  4JBJ A;  1STG A;  1TXY A;  5DAU A;  3NWS A;  4C3J B;  2E5L Q;  4TRD A;  3QJY A;  4KJN A;  3TRZ A;  2BE5 D;  3EBE A;  5JEA H;  2B39 A;  2L11 A;  1ZXT A;  1NJI C;  1L1O A;  3CCQ A;  2LSS A;  3EN2 A;  1SYG A;  1C4Q A;  4C3I H;  3H3V I;  3WWV A;  1PMR A;  3J81 c;  2WAC A;  2RQX A;  1F9Q A;  4KY7 A;  3CMA A;  4GLX A;  4KY6 A;  2RSO A;  4CJ0 B;  3TSS A;  3S2D B;  1DYQ A;  4A93 G;  1AE3 A;  4PNY A;  1CKM A;  4HMJ A;  4RWS C;  1SYF A;  4DV4 L;  2EJF C;  2AWN A;  4WJW A;  4YY3 L;  2B63 H;  4LAA A;  1XTC D;  1ENA A;  3E0J A;  4C2M B;  2AQ1 B;  2NZO A;  4IFD J;  1VQ6 A;  1JB7 A;  2KCT A;  2MJ8 A;  5HY6 A;  3TZD A;  2VB2 X;  2C35 B;  3H3V C;  4KLK A;  2NVX B;  5IWA Q;  1A63 A;  2F1M A;  3R2I A;  1BCP C;  1VMP A;  3ITP A;  2KJX A;  3DM3 A;  4FVM A;  1YJN A;  1H9M A;  3CCS A;  1YJW A;  1DCZ A;  2FMC A;  1TWA H;  4J8Q A;  2Q8R E;  2QIL A;  3R2T A;  2CFM A;  3DEO A;  2AQ3 B;  2R92 H;  3V05 A;  2EYL A;  2K52 A;  3OYY A;  1LTB D;  3VYS A;  4DNI A;  5DNF A;  1CHQ D;  4G7O C;  1ASZ A;  1GOZ A;  2NB0 A;  1TS4 A;  1KAB A;  5CV8 A;  4JV5 L;  3G6J B;  1Q46 A;  4QB4 A;  5CV5 A;  4A3G G;  1DD2 A;  3MAQ A;  1FGU A;  1GUN A;  2KCM A;  1WTR A;  5GAE C;  1V1Q A;  3NBI A;  4OIK A;  4UDU C;  4DR1 L;  2Z9H A;  4JBM A;  4A3K B;  1HNW Q;  1M90 C;  5J39 A;  3E3X A;  4K8I A;  5A35 A;  3ND9 A;  1AZP A;  4ID6 A;  4ALP A;  1SMX A;  2DY7 A;  1LLR D;  1MKH A;  2A6E C;  5LMU Q;  1GJX A;  1D6E C;  1IBK Q;  1D5Z C;  4XQN A;  2PPB C;  2TSS A;  1U4L A;  2H1E A;  4JI7 L;  3NQI A;  2NN6 H;  1K3B C;  5IWA L;  3FVQ A;  1A2T A;  2WKD A;  4FDB A;  1PTO H;  4QJF A;  4GN3 B;  3W2D A;  2XGT A;  1VQC A;  3T56 B;  3H3V H;  5DEH A;  5FLX E;  3BZK A;  1LO5 D;  1Y8O B;  5KIX A;  3I3C A;  3HOX G;  4C3I B;  3A8I E;  4FXG C;  3I4N H;  3SK5 A;  1ZKO A;  4LF4 Q;  1L1O C;  3F8T A;  5FO8 B;  1VQL A;  2EYF A;  1VS0 A;  2MO0 A;  1PH9 A;  1GUG A;  1B2T A;  2ZT9 C;  1UEB A;  3S1N H;  2B2U C;  2RHQ B;  1WYD A;  4BBS B;  3A5Z B;  1X9N A;  1M1K C;  2RBM A;  3K7A H;  1HNZ Q;  1I6H B;  4YY3 Q;  4BY1 H;  4JI3 L;  1TWC B;  1HCZ A;  3J81 L;  1AE2 A;  3BG3 A;  3K80 C;  4MTN A;  3FDT A;  4DKA C;  1WFQ A;  3HKZ B;  1I4R A;  3A55 A;  2H4O A;  1U4M A;  4JI0 L;  2F0P A;  5DM6 3;  5M5W B;  3PUX A;  1WD0 A;  5IYD H;  3MA2 B;  3TZU A;  1ILP A;  5EPK A;  4PG3 A;  1SRO A;  3HG9 A;  3AU7 A;  4TKO B;  4XT3 B;  4RKB A;  3NSW A;  3V2T A;  2O5J C;  2XIW A;  3KYH C;  4UAI A;  2QW7 A;  2KHI A;  3N6R A;  2JA6 B;  4EQN A;  1D1K A;  5FKA C;  4JOI A;  1W2B A;  2N78 A;  3GDE A;  1Q86 C;  1JC7 A;  2PI2 A;  1V1O A;  2BDO A;  4Y52 H;  4O42 A;  1RDP D;  4LF6 L;  2N8N A;  1XNQ L;  1H9K A;  3SDZ A;  1S5D D;  1EY0 A;  2EY6 A;  1YNN D;  1IW7 D;  3VYT A;  1SYE A;  1QVG A;  1PFN A;  3PUY A;  3SK8 A;  1TY2 A;  3PIP A;  5IGF A;  3H91 A;  1LAC A;  1S3O A;  1CUK A;  4DAY B;  5CGK A;  3J81 j;  2WV6 D;  5I2Y A;  4LFA Q;  1K83 H;  3I8Z A;  3M4O H;  2A68 D;  2WAQ G;  1F77 A;  1HUM A;  2BCO A;  4NXM Q;  3OW2 A;  4F7X A;  3DXJ C;  1V1P A;  2F0F A;  4GN4 B;  4GOP A;  3GTK B;  4JPB W;  1V1P B;  2J4X A;  3EA6 A;  4FXD A;  5BR8 L;  3RNU A;  3A0J A;  2IT1 A;  1J9O A;  4A76 A;  2F0W A;  4BY7 H;  3BZD B;  2K7V A;  4DNR B;  4RH6 A;  1H9S B;  3J80 i;  3FPU B;  3M3Y B;  2Y0S B;  1WCM H;  1MD2 D;  2EYP A;  3DWQ A;  5AJ3 L;  4DR4 L;  1SFO B;  4ODG A;  4LF5 L;  4NMZ A;  4J1M A;  1UE1 A;  2C5C A;  4JI6 Q;  1N9W A;  2HIX A;  4MNO A;  4DV3 L;  2XSC A;  1A3T A;  2EJM A;  1SNO A;  1HH2 P;  4ABN A;  5M3M H;  3CPF A;  4YCW A;  1BXT A;  4YWL A;  4AQY L;  1XMO Q;  1EQV A;  5M3F H;  4B3T L;  1SYC A;  2YU9 B;  2HIV A;  4HSP A;  2EJG C;  1Y1V H;  2K01 A;  2A74 C;  4XQQ A;  2F0L A;  2ZTE A;  4A4I A;  2R92 G;  5JVG 3;  2VNU D;  4CJ2 C;  4Y7N B;  3G7L A;  2F0K A;  3I72 A;  2R6G A;  3L2P A;  2RA4 A;  4DR1 Q;  5C5M A;  4IFD H;  3J7A F;  1RCV D;  2SNS A;  2ICI A;  2XWB B;  3NQT A;  3EIV A;  5E4W C;  3FPP A;  4DR4 Q;  1N34 L;  4LK1 C;  2R93 H;  2K33 A;  1CZW A;  1BKB A;  3HP3 A;  3LWU A;  4C3H H;  2K32 A;  5F2D A;  5J22 A;  2R7Z G;  1Z7T A;  2R7D A;  1TR5 A;  3UI2 A;  3GTQ H;  5EBD A;  4JI1 L;  4JI4 L;  4A93 H;  1U4P A;  1W3S A;  2JA9 A;  4KK7 A;  1R4P B;  3A74 A;  3VR6 A;  3CCL A;  5FOB B;  4FF3 A;  3KF6 A;  3JAM c;  5ELD A;  5A2Q E;  4XTC S;  3JC6 6;  4JI8 L;  1WVL A;  4PQX A;  3PO2 H;  4A3J H;  4I7A A;  4K0K L;  4QL5 A;  2E2I B;  4QF4 A;  4OX9 Q;  1VQN A;  2F4I A;  2RDH A;  4NB3 A;  3PO3 B;  2XN9 C;  1HZA A;  4N9P A;  3CRK C;  4XYQ A;  1IXR A;  1LTG D;  1TWF B;  1LT3 D;  3FKI B;  4S3S A;  1M8A A;  1S5E D;  1X55 A;  1SNC A;  3HOX B;  4OL7 A;  2PYK A;  4LF7 L;  4HCE A;  3CRL C;  4RGO S;  2PZW A;  3K5L A;  4X62 L;  1Y8N B;  3A8K E;  3I4M H;  1CI3 M;  1PTO D;  4IPD A;  3AFP A;  1BOS A;  2NVT H;  2GVB A;  1XMO L;  4E6I A;  2QKI C;  2QA4 A;  3PF5 A;  5ELN A;  1F9R A;  1U0L A;  3KBG A;  4YWM A;  5T1I A;  3GTO H;  2D62 A;  3ERQ A;  1G6P A;  4P74 A;  5IYC H;  1RHP A;  1B3Q A;  3Q23 A;  1TWG H;  2F0S A;  1X32 A;  4KTA A;  4QGU A;  1PH8 A;  5GRO A;  1BNZ A;  1JWS D;  5CMD A;  4LF9 L;  1E22 A;  4B3M Q;  1QOH A;  2FFK B;  2WAQ B;  2ZM6 Q;  4K5X A;  1TII D;  1R9T B;  1N8R C;  3UE0 A;  1I3Q B;  2RDF A;  1XYI A;  1X3Q A;  2K28 A;  3W1G A;  4CJ1 B;  4DUZ Q;  1TKW B;  1EYG A;  1C8C A;  5M3M G;  1I50 H;  3T13 A;  3S16 H;  3BVM A;  4G57 A;  3BU2 A;  1OXT A;  4FP5 D;  2EY1 A;  3CKI B;  2IL8 A;  3TME A;  1OXV A;  1IBL Q;  1JCK B;  1QWY A;  2WB1 B;  1SMY C;  4X62 Q;  4A3D H;  3GTG H;  2YV5 A;  2ZJP A;  1EOT A;  1VQG A;  3ULL A;  1J8I A;  1VQM A;  1WCM G;  3S1M B;  2XVS A;  5G3L D;  5JOB A;  1HQM C;  2VQF L;  1OXS C;  4WFN 3;  1QZH A;  2QEJ C;  1H9R A;  1SE2 A;  4Z9C B;  3CPW A;  4BY7 G;  3MXP A;  3PQI A;  1EQQ A;  3E9I A;  3VYR A;  1EZ8 A;  4WRD A;  1YIT A;  1HXY D;  1XNR Q;  1HNZ L;  4HIO A;  2ES2 A;  1JE5 A;  3NBH B;  3IRB A;  2FIN B;  5EPJ A;  2PQA A;  1Q1B A;  5I9P A;  4KMU C;  2QEX A;  1WJJ A;  2K03 A;  3DLL A;  5AJ3 Q;  4X64 L;  3OHX C;  3LGJ A;  3CME A;  5LMN L;  2F0I A;  4A3K G;  5JJK A;  4A3D B;  4DK3 C;  4RHS A;  1LTT D;  4A3E H;  4JI3 Q;  3NK9 A;  4FO2 A;  1B8A A;  2X6G A;  2VUM H;  1MHW C;  1IYJ B;  1XPR A;  2NZH A;  2OWO A;  1OXX K;  1SN8 A;  4AH6 A;  2ZXR A;  4OEL B;  2CWA A;  3ND8 A;  1KDC A;  1PFS A;  2ENB A;  3W5O A;  4A3J G;  4I7Z C;  1I4X A;  3KJP A;  3CC4 A;  3ONA B;  1F2Y A;  1WD1 A;  1MIU A;  3KLS A;  1SDF A;  1ML0 D;  3MTS A;  1C7Y A;  3S15 H;  2IWH A;  3SK4 A;  4C1N I;  1P8L A;  1WTV A;  3T51 B;  4K5W A;  5FLM H;  3P7J A;  4DXF A;  4EVO A;  1IKM A;  4IPG A;  3ERO A;  3RUZ A;  5IGC A;  4HJ7 A;  4J6H A;  1YI2 A;  4JBW A;  2KHJ A;  2IX3 A;  2PNR C;  4ZUI A;  1TQO A;  1CZG A;  3QIA A;  1L2F A;  1PZI D;  3V96 A;  2WFW A;  1TWH B;  4HTH A;  4X65 L;  1JMC A;  3VYU A;  1VQ9 A;  4DN4 M;  1EYA A;  1TWH H;  2YTV A;  4BY1 G;  5FLX L;  1A3V A;  1PFB A;  3T53 B;  3KLW A;  5KRU A;  4DV2 L;  2F0N A;  2EOT A;  1QE6 A;  2K75 A;  2UUC Q;  4LF9 Q;  3A8J E;  1UE6 A;  4KHV A;  3R3O A;  4NXN Q;  1I4G A;  1Y1W H;  3PO2 B;  5M5Y H;  4DV1 Q;  4WJ3 M;  1SBB B;  4R4O A;  1SEB D;  1N32 L;  5JJZ A;  1K0S A;  4A3I G;  1CK1 A;  2A73 B;  4JVZ A;  3TQY A;  3UE1 A;  5J3B A;  1MGS A;  4IPC A;  3HOZ G;  2KEN A;  5KNC A;  4OWX B;  5C44 B;  1LTL A;  5C44 G;  5I2X A;  4DAP A;  3T1Y Q;  1Y14 B;  4AQY Q;  1STA A;  5JJL A;  2GVA A;  5C4H A;  3U58 A;  1X3F A;  4DV7 Q;  2MUY A;  4BA1 I;  2A1A A;  3GTJ H;  3F2B A;  3Q6S A;  1WTW A;  4POG A;  3DWP A;  3J80 c;  2HHH Q;  2Q2U A;  1FJG Q;  4C1N K;  3D4R A;  4NDX A;  2WAQ E;  1NE3 A;  3I90 A;  1EYD A;  3CQZ B;  5EQ0 A;  3K8A A;  3CCR A;  3FP9 A;  3Q22 A;  1EZ6 A;  2X6L A;  1A62 A;  3MXN B;  1XX8 A;  2ATW A;  4A3E B;  1KDA A;  2F52 A;  4G7H C;  5M5X B;  4HN7 A;  4GZY C;  2UXD L;  2JA5 B;  3VDY A;  2LMC B;  5IT9 L;  4DUY L;  3KLS X;  3LNN A;  1YIJ A;  3PUV A;  2LS0 1;  4FYD A;  1GUT A;  1B50 A;  1MSH A;  4CKE A;  3S9W A;  3QO2 A;  2B2W C;  3BZC A;  4LUO A;  5CV4 A;  1U9R A;  1FNU A;  2KCC A;  4A3F H;  4DV5 Q;  5JEA J;  1OTC A;  4R1J A;  3BDL A;  3GTM H;  1WTQ A;  3E9H A;  5EGT A;  1HNW L;  5JPM C;  3VR2 A;  3RZD B;  2JJQ A;  2NVY H;  4IOC A;  3C1E A;  3I73 A;  2F0D A;  4DR3 Q;  3DUZ A;  3GV3 A;  3SGI A;  3JAM L;  1QNK A;  2Q8I B;  2O5I C;  5C3W A;  3KF8 B;  1CSP A;  3MFY A;  3Q24 A;  4ME5 A;  5ELF A;  1I94 Q;  1ICF B;  3OMG A;  4OO1 G;  2JSO A;  4L5Q A;  5BN3 A;  1SE4 A;  4DR3 L;  2AUJ D;  3T1H L;  2NTS A;  4KI0 A;  3S1Q B;  4GOP C;  4KD3 A;  1WTX A;  2ZTD A;  1YZ6 A;  1GO3 E;  1BR9 A;  1IYU A;  2AUK A;  2KHS A;  2XRS D;  2RCN A;  4X3K A;  2FXQ A;  3OTO Q;  4M8A A;  1PH2 A;  2QF7 A;  3CAM A;  4DUY Q;  3S1R B;  5GAD C;  1SLJ A;  1VQO A;  2ASB A;  1RJT A;  1IL8 A;  3WOE A;  2HT1 A;  3S1Q H;  4ZQ3 A;  3U4V A;  1EOV A;  1JWM D;  1WTO A;  2HQL A;  2R7Z B;  5IYC G;  1AW7 A;  1TY0 A;  2F0U A;  1SR3 A;  2O4X A;  2Z8L A;  4IJH A;  1PHJ A;  1HUN A;  3AMU A;  3RD4 A;  1AP0 A;  1EEF D;  4O1N A;  1G8Z D;  2EVB A;  5COY A;  2ZTC A;  3Q8D A;  3UDF A;  3H0G B;  1NCV A;  5ELE A;  4F88 A;  1JOR A;  1DGS A;  4EQP A;  3RZD H;  1IBL L;  3I4M G;  3PF4 A;  4R4Q A;  5IP9 H;  3U50 C;  4LUV A;  1TT2 A;  3I4N G;  1JIC A;  1PH7 A;  3DM1 A;  3M7N A;  2EXD A;  5C3E G;  3HOX H;  4AYB B;  1BBX C;  2BOS A;  2CHB D;  3IAY A;  5GQO A;  5J1Z A;  5I6Y A;  1BDO A;  1L0Y B;  1V9P A;  5T1G A;  4NPS A;  1STE A;  4IOA A;  4NXN L;  4CKC A;  3K57 A;  4GKK L;  1Q7Y C;  2JA8 B;  2RCF A;  3QB3 A;  1YJ9 A;  4IZ8 A;  4A3J B;  2B2Y A;  5IT9 c;  1LTS D;  3FMC A;  3PO2 G;  3CP0 A;  2F3V A;  1QJO A;  3W3A A;  3EVQ A;  1EIG A;  3H0G G;  2BA0 A;  1B53 A;  1ENC A;  5IE8 A;  4L5T A;  1KLG D;  1EYC A;  2JN4 A;  4IFD I;  1HHV A;  3TS2 A;  2D9U A;  2B2T C;  4OO1 H;  5A2Q L;  2R7Z H;  2JQO A;  1XPU A;  1PYS B;  1BQQ T;  4C3H G;  4KN4 C;  4KD4 A;  1ROD A;  2WKC A;  2VL6 A;  2I07 B;  3K5O A;  1SE3 A;  3OMC A;  2I5L X;  4TQU S;  4IJL A;  5EAY A;  4F8M A;  1H9J A;  1HTL D;  4IUT A;  1NUC A;  4HCS A;  4QCL A;  4I65 A;  1G51 A;  3K6O A;  3S1R H;  1EY9 A;  4YWK A;  4A3F G;  4HMI A;  4BBS G;  2IPK D;  3AYH B;  1C9O A;  1MI2 A;  4PMB A;  1UE7 A;  1UEA B;  4X64 Q;  4LW1 A;  4IO9 A;  3OTO L;  1YHQ A;  4RFB A;  1JQY D;  1N36 L;  1Y1V B;  4OXP A;  4X66 Q;  1PRT D;  4JI0 Q;  4FNF A;  2B3G A;  1U4R A;  2NYZ D;  2OQ0 A;  3E0E A;  3H0G H;  1A15 A;  4FF4 A;  1SXT A;  1S5C D;  3PUZ A;  2N49 A;  5CV6 A;  1RTO A;  4LF4 L;  1BCP D;  3H6M A;  2NVY B;  1A2U A;  4N8X 1;  1EWI A;  1KAW A;  1SJH D;  3GTM B;  1YEZ A;  3KDF B;  4L5R C;  3CCJ A;  5CBA E;  1Q81 C;  1C48 A;  1K3R A;  1EY4 A;  4DV4 Q;  1D5X C;  3HRZ C;  2CQO A;  4LF6 Q;  1IL2 A;  2UXB L;  1S5B D;  5COR A;  1Q8I A;  1FNW A;  1II3 A;  4R4C A;  4QUF A;  1VDZ A;  1Y1W G;  3LWE A;  5IP9 G;  3D4D A;  2N55 A;  5TSS A;  3VR5 A;  1X3P A;  2NUC A;  2K50 A;  3URY A;  2JYO A;  4IUU A;  2IW3 A;  2VQF Q;  3I4O A;  3H94 A;  3K0Y A;  1T5E A;  1S40 A;  4TVA B;  1PH5 A;  5E1F A;  1F9P A;  5HUR A;  2B2V C;  4H44 C;  1Z6H A;  4JI8 Q;  4A3B B;  1D5M C;  2D0P A;  1HR0 W;  4K5V A;  4DR2 Q;  2ID0 A;  2KEE A;  4ZKC B;  4GKK Q;  2AWO A;  4HIM A;  4PV1 C;  4B3S Q;  4A3F B;  3J7A 5;  4IUV A;  4BWG B;  2A6H D;  1B7Y B;  2D2C C;  1AN8 A;  1XPO A;  2Y0S G;  1TS3 A;  4MHE A;  2JA8 H;  1AZQ A;  3DMU A;  1N33 Q;  5LMN W;  5M5X H;  3GTL H;  2L12 A;  2PMZ E;  4N9T A;  5IYD G;  1NSN S;  4IN3 A;  3CQZ H;  4CDF C;  2K5N A;  4HAE A;  1B1Z A;  3RLF A;  2L4N A;  2PCF B;  4QMG A;  3GTJ B;  2E75 C;  1E3P A;  3P20 A;  2RVL A;  2VUM G;  1SMY D;  4RMF A;  1LTR D;  1QNU A;  1PRT B;  3C1F A;  2KA7 A;  3MEF A;  4A3B G;  1I6H H;  1XNR L;  1WTH A;  1YVC A;  2B2U A;  1PH1 A;  3LX0 A;  4HSV A;  3M9B A;  1HR0 Q;  4HIK A;  3A56 A;  2CCZ A;  2V1C C;  3NTH A;  4UP8 A;  3M85 A;  1PZJ D;  4MN3 A;  4JV5 Q;  2KEC A;  1CFM A;  2PQE A;  4XYO A;  1PYB A;  3BYY B;  2F3I A;  1O7Z A;  2JA7 G;  4H0L C;  1O80 A;  3MXG A;  4APV A;  2CH4 W;  4BBR G;  2VW9 A;  3F2C A;  4GNX C;  1A6X A;  2EDG A;  1YNJ C;  3PCO B;  3RMH A;  3FKI H;  4YCU A;  1DOM A;  1X54 A;  4ULL A;  4KY5 A;  1GKH A;  4PZ8 A;  2KCN A;  1ESF A;  2F0G A;  3FEW X;  2DNE A;  3SR1 A;  1Q3L A;  4GNX B;  2OT2 A;  4L8J A;  2GA4 B;  3MXU A;  1VF5 C;  3HEJ A;  5GAG C;  3M7G A;  4G7Z C;  2QDB A;  1K28 A;  3NP8 A;  2RF4 A;  2UXB Q;  1UE5 A;  2B29 A;  4R4I A;  3L7Z C;  3RLN A;  4RA8 A;  1KHI A;  1Q90 A;  4IAL A;  4JOI C;  2DJF C;  4DU9 A;  3KJO A;  2AKW B;  1AEX A;  2ALY B;  2EY2 A;  5DM7 3;  5FO9 B;  4JI7 Q;  3I7F A;  1VMC A;  3P1H A;  4ZKB B;  1W6J A;  4IUR A;  1L0W A;  4GKJ L;  1S4Z A;  1E24 A;  1BVS A;  1GXD C;  3I91 A;  2C9O A;  2MP1 A;  4JCV E;  5EPL A;  3STB C;  1I94 L;  4YHH L;  1IW7 C;  3GTG B;  2K6A A;  2R93 B;  2NTT A;  1AFP A;  5IYB H;  1Q12 A;  2BH2 A;  1X3E A;  4A3M G;  4K0K Q;  5IP7 G;  1BF4 A;  5C0X G;  2F0T A;  2AMC B;  3I2Z A;  1CQV A;  1LYL A;  2B63 B;  4ZYS A;  1I50 B;  4K2L A;  1YNN C;  2KOL A;  5IT9 E;  3OOC A;  3JAM i;  4LWC A;  1ILQ A;  2CH4 A;  1NAP A;  4DR7 L;  1I3Q H;  1KC8 C;  1R9T H;  4OHJ A;  3NEL A;  2X69 A;  1QIL A;  1MJE A;  4FF2 A;  1IBM L;  1D8L A;  1DZ1 A;  3U9S A;  4A3C H;  4YCV A;  2QGQ A;  4A3C G;  1D1I A;  2F4V L;  4JW0 A;  1G91 A;  3GTO B;  2G5D A;  4JC0 A;  3QOL A;  5M5Y B;  3KOJ A;  3D8G A;  5KYI A;  4B3T Q;  2N3S A;  1HNX Q;  1WCM B;  2PQA B;  2HD3 A;  2L55 A;  1JJG A;  5CYU A;  4DAY A;  4JI5 L;  3SK6 A;  3ULP A;  1ET9 A;  3L3O C;  1UWV A;  2N88 A;  1FGB D;  1STY A;  4A3M B;  2WII B;  1IZ6 A;  2K5D A;  3TBI B;  1GD7 A;  2F0V A;  1KD1 C;  4QY7 A;  1B70 B;  4LFC L;  2PO4 A;  5EKL A;  3HOY B;  1Z9F A;  1I4P A;  5DLQ E;  1N32 Q;  4X6A H;  4B08 A;  4DV0 L;  1CA6 A;  3ULJ A;  4B3R L;  4GNX A;  4IFD G;  5LMN Q;  3M4O B;  1QG7 A;  4H02 A;  2HUG A;  4IUQ A;  2HDM A;  2JEA I;  2R61 A;  5I9O A;  3PIO 3;  4RGT A;  2EQS A;  3ZYY X;  2NN6 I;  2F0E A;  3SE0 A;  2E5L L;  1E7Z A;  2A69 D;  3CF5 A;  3KBX A;  3D0F A;  2RDG A;  3TP5 A;  2B2T A;  5BN5 A;  4A3D G;  2LXK A;  3NE5 B;  3NPP A;  1G6Z A;  2DNC A;  2NZ1 D;  2ZXP A;  1I4Q A;  1QB5 D;  2L9H A;  5IOD A;  4A3L H;  1QVF A;  4DK0 A;  3KF8 A;  1TVX A;  1NMF A;  1STB A;  4X65 Q;  4AYB E;  5C4X G;  4U67 3;  1ZYR D;  2HDL A;  3OIQ A;  2B2Y C;  3FKI G;  4IUP A;  1BCP B;  2B2W A;  4H13 C;  2HCI A;  5CR3 A;  2RKS A;  2Z6K A;  3VA7 A;  2SNM A;  4K8J A;  5ELC A;  1A0I A;  3NHH A;  1IBM Q;  4P71 A;  4Y7N H;  3J81 E;  2V4D A;  1I4H A;  1K0R A;  1ZYR C;  3QG1 A;  3NTK A;  5M5W H;  1K8A C;  3JAM E;  1GM5 A;  4RAU C;  1SRU A;  3GD7 A;  5BN4 A;  5FO7 B;  1CHP D;  1Y8P B;  3K5M A;  1SSO A;  2R7F A;  3WOF A;  3HGB A;  1CKN A;  2P5Z X;  5FJ8 G;  1V8Q A;  5K5P A;  1O7I A;  1SYB A;  4U68 A;  3PMF A;  1DM0 B;  3K7A B;  1PH3 A;  1ICW A;  2A69 C;  2OEO A;  4DA2 A;  4A3B H;  2A6H C;  2F0J A;  1KTK A;  1EUJ A;  3S1N B;  3G4S A;  2WIN B;  3S1M H;  4C3H B;  2RHS B;  1EQR A;  1TS2 A;  2PNH A;  2XTI A;  1LV9 A;  1JOO A;  2TMP A;  5CBE E;  4DV0 Q;  4DR2 L;  4B3R Q;  1SND A;  3TP7 A;  1EWH A;  1B4O A;  1K8O A;  1QUQ B;  4R4T A;  1FR3 A;  1PDQ A;  4X66 L;  1O7L A;  2A5H A;  4ZCK A;  4IQZ A;  4GN5 A;  3TS0 A;  2ZJQ A;  2ICE C;  3K81 C;  2Z1C A;  1DON A;  1PA6 A;  1UUP A;  3CCU A;  5KYL A;  1I5F A;  4K14 A;  4DR5 L;  1PH4 A;  1KQS A;  2F03 A;  4CBV A;  4H7B A;  3OIP A;  1K83 B;  1G2T A;  3KK7 A;  4YHH Q;  1H9S A;  2UUB Q;  4QQB X;  1LT5 D;  4NW2 A;  1NMG A;  3D4W A;  1S72 A;  3S24 A;  4MIU A;  1FJG L;  1GVP A;  4LFA L;  1JE4 A;  4OX9 L;  5CV9 A;  1GHK A;  3GQB A;  4C56 C;  2KUM A;  3HKS A;  4CGY B;  4RCO A;  5IYB G;  4DXG A;  1EY8 A;  3MVV A;  3CC7 A;  2NVT B;  4J15 A;  4HR7 B;  1QCB D;  2HQE A;  2Q2I A;  3I4M B;  3KUP A;  1PLF A;  3M4P A;  1CQF A;  3DEP A;  5JAV A;  2DJG C;  1ESR A;  2E2D C;  4JI1 Q;  4JI4 Q;  1TWF H;  4CDD C;  1GUW A;  5HGT A;  4WJ4 A;  4LF8 L;  1QUQ A;  4JK1 C;  5M3F G;  2CKZ B;  5G3L F;  3UDI A;  1RTN A;  4B9W A;  1HFG A;  2B8G A;  2DUD A;  4DPG A;  1YBY A;  3E6Z X;  3CCM A;  4CDC C;  3PV0 A;  4KHZ A;  1FD7 D;  3D6W A;  4HJ5 A;  2E74 C;  2PW7 A;  1PRT F;  1TWC H;  2IX1 A;  1K8M A;  3SHL A;  3J80 L;  3EQL C;  2VQE L;  3J7Y W;  2EZV A;  5C44 H;  2SOB A;  5NUC A;  3PIO A;  1PXU A;  1LT6 D;  1XMQ L;  4FXK C;  2LFN A;  3HOZ H;  1XJV A;  1Z47 A;  2LXJ A;  3DHQ A;  2F3W A;  2FHT A;  4OEM B;  5E7N A;  3UDG A;  3NBH A;  3K58 A;  4KHP Q;  4X3U A;  4HID A;  4CHT B;  1Q82 C;  2YTY A;  1SE8 A;  1PV4 A;  2EY5 A;  1VCI A;  5LL6 S;  2EPB A;  1Y1W B;  3RR5 A;  4ZUJ A;  4C3J H;  1VQ8 A;  4IUN A;  1EIY B;  1JJC B;  4RGN A;  1N36 Q;  1KNA A;  1PTO B;  1ZEQ X;  1GHJ A;  2Z6B A;  2E2J B;  3HOW H;  1MSG A;  2AHO B;  2OTL A;  1PTO C;  2EYO A;  4UPA A;  2CVR A;  4XDX A;  1KNE A;  1ET6 A;  4DGZ A;  3HOV B;  1NR4 A;  3UDX A;  5HGQ A;  2M9V A;  3OPO A;  4Q0F A;  4O0A A;  1N34 Q;  2EIF A;  3M4Q A;  3MFG A;  4XXE A;  2I0Q A;  1NY4 A;  2K5W A;  3R93 A;  2UXC L;  2CW0 D;  3VR3 A;  4JI2 Q;  5FLM G;  5JVH 3;  2J7Z A;  5D65 A;  3TN2 A;  2JA8 G;  5EKK A;  2R92 B;  1X3G A;  1UNS A;  1EY5 A;  3KDF A;  4LMQ D;  2ZJR A;  1KRS A;  2UXC Q;  4C3I G;  1LM0 A;  3CU7 A;  5K36 G;  2NWG A;  5LL6 X;  4LF7 Q;  4AYB G;  1F2Z A;  1O7Y A;  1B9N A;  3DWA A;  3N52 A;  3ER0 A;  3C2P A;  2XRQ D;  2NVQ B;  2GN5 A;  1WI5 A;  2I5H A;  4N8F A;  5CV7 A;  2NVX H;  3GTK H;  1K9M C;  5JJI A;  1VQH A;  1BUV T;  4C2M H;  2UXD Q;  1IKL A;  2XNA C;  2VUM B;  5JPN C;  1X6O A;  4PMW A;  2E8G A;  2KED A;  3U9O A;  4L5S A;  4A3K H;  1HJP A;  5FJ8 H;  4K6L A;  5FK9 C;  3CC2 A;  3I55 A;  3A7L A;  3WDN A;  2F0O A;  1K8G A;  1ONL A;  3H15 A;  2LY7 A;  1RIP A;  3HOV G;  4AIM A;  4RGM A;  1HR0 L;  1BBW A;  2WP8 J;  1KXL A;  1W6K A;  2EYJ A;  4HED A;  1EQT A;  2QDL A;  4X3T A;  5FLX c;  3L9A X;  2A8V A;  3TRE A;  4POF A;  1BO0 A;  3KF6 B;  3NTI A;  1KDB A;  3OWF A;  3X3N A;  2UUC L;  2L5T A;  1VQB A;  3L0O A;  2Z4I A;  1F2M A;  1EU3 A;  2JA5 H;  3X3M A;  1YHB A;  3KLR A;  5I6W A;  1HFN A;  2JE6 I;  5IGB A;  3E5S A;  2EE1 A;  3I4L A;  1O78 A;  1EIH A;  3NEN A;  1XMQ Q;  5BR8 Q;  3CD6 A;  1E0B A;  1J6Q A;  1JT8 A;  2IY5 B;  1RD9 D;  3FHW A;  3AB9 A;  2KBN A;  1X56 A;  3TEH B;  4RCN A;  2KQ3 A;  4LFC Q;  2E2H B;  1STH A;  3HOW B;  1BBU A;  1PYW D;  3S2D H;  2B8F A;  2BDN A;  1V43 A;  3NEM A;  2SDF A;  2VXW A;  4XIG S;  2Y0S E;  4XT1 B;  1JJ2 A;  1IBK L;  4BY1 B;  3ERS X;  4GLV B;  4ZK9 B;  5LMU L;  1VQF A;  2A68 C;  4BBS H;  5IY0 A;  4JI6 L;  1TWG B;  1HNX L;  1FYC A;  3T1Y L;  1NR2 A;  1S5F D;  4HJ9 A;  3U4Z A;  3IKJ A;  3IFT A;  4TSS A;  2H5X A;  4EQ5 A;  4F87 A;  1L0X B;  1JWU D;  4R8I A;  3B6Y A;  4CKB A;  2A6E D;  3MHB A;  1OO9 B;  2K4K A;  3PIP 3;  2Q2H A;  5IGE A;  5KGU A;  2B63 G;  4PMC A;  1IYV A;  1PRT C;  2PZU A;  2IHE A;  3O13 A;  3I56 A;  1KRT A;  3F1Z A;  2WB1 E;  4ZRZ A;  5KNB A;  4R9W A;  1KAA A;  2UUA L;  4A75 A;  4L63 B;  4DR6 L;  4DV1 L;  2KVM A;  4DR7 Q;  2K1B A;  1ENF A;  5IGD A;  3HOU B;  4OIJ A;  1VQD A;  4LF5 Q;  3AEV A;  2WB1 G;  4KKT A;  4KJO A;  1CTM A;  1WOC A;  2MHV A;  3A7A B;  1XWE A;  5C3E B; 
#chains in the Genus database with same CATH homology
 3T1Y Q;  2E2I H;  5LMU Q;  1MKH A;  3G71 A;  1Y14 B;  4AQY Q;  4A3C H;  1HZ9 A;  4YCV A;  2QGQ A;  2GVA A;  1IBK Q;  4P73 A;  4JI5 Q;  3U58 A;  1X3F A;  4DV7 Q;  4A3C G;  2Z0S A;  1CKO A;  4BA1 I;  2CWP A;  2F4V L;  2A1A A;  3GTJ H;  3F2B A;  5JEA G;  4UP7 A;  4JC0 A;  4JI7 L;  5IWA L;  4POG A;  3KOJ A;  3J80 c;  4FDB A;  2HHH Q;  3GTP H;  4QJF A;  2Q2U A;  4B3T Q;  2N3S A;  1FJG Q;  4GN3 B;  2XGT A;  1VQC A;  4IPH A;  1HNX Q;  3H3V H;  2WAQ E;  1NE3 A;  2PQA B;  3K8A A;  3BZK A;  3FP9 A;  3CCR A;  4A3I H;  2UUB L;  1JJG A;  3HOX G;  4JI5 L;  2VS1 A;  3MXN B;  1A62 A;  5C0X I;  3ULP A;  2ATW A;  3I4N H;  1UWV A;  2F52 A;  3T1H Q;  4LF4 Q;  2YYZ A;  1L1O C;  2UU9 Q;  3F8T A;  1VQL A;  2UXD L;  1IZ6 A;  1VS0 A;  3VDY A;  1GD7 A;  3J7Z C;  2MO0 A;  4DUY L;  1PH9 A;  4B3S L;  1KD1 C;  1YIJ A;  1UEB A;  3PUV A;  4ME3 A;  4QY7 A;  3S1N H;  1B70 B;  1WYD A;  2RHQ B;  4LFC L;  3A5Z B;  1Z9F A;  3BZC A;  3PGZ A;  4LUO A;  1VQI A;  1X9N A;  1M1K C;  5DLQ E;  3K7A H;  3PSI A;  1HNZ Q;  2A19 A;  1N32 Q;  4X6A H;  4YY3 Q;  4BY1 H;  4DV0 L;  4A3F H;  3ULJ A;  5JEA J;  4DV5 Q;  4JI3 L;  1OTC A;  4B3R L;  2L15 A;  4R1J A;  4GNX A;  2VY3 A;  3E9H A;  3K7U C;  3GTM H;  4IFD G;  1HNW L;  1J5E L;  2OTJ A;  5LMN Q;  1AE2 A;  2JJQ A;  3K80 C;  2NVY H;  4IOC A;  4MTN A;  4DKA C;  4H02 A;  1T9H A;  1WFQ A;  4DR3 Q;  3HKZ G;  3SGI A;  1VQP A;  2K5V A;  2JEA I;  1YNX A;  2EQS A;  3KF8 B;  2MNA A;  1CSP A;  2NN6 I;  1LUZ A;  4JI0 L;  2E5L L;  1E7Z A;  3CF5 A;  1I94 Q;  3PUX A;  4LFB Q;  5IYD H;  3D0F A;  4PG3 A;  1Y1V G;  1SRO A;  3HOY G;  4OO1 G;  4L5Q A;  2LXK A;  4A3D G;  4DR3 L;  1D7Q A;  3ZJY C;  3T1H L;  4A3L H;  4KI0 A;  4P75 A;  1QVF A;  3KYH C;  4GOP C;  2KHI A;  3S2H H;  1VQA A;  2ZTD A;  1YZ6 A;  1GO3 E;  3ICE A;  4OON A;  1NMF A;  4X65 Q;  3CCE A;  4AYB E;  5C4X G;  4QQB X;  2RCN A;  2IHF A;  2FXQ A;  3OTO Q;  4JOI A;  2MQH A;  1W2B A;  4DUY Q;  3CAM A;  1PH2 A;  5GAD C;  2MFI A;  1PVO A;  2N78 A;  3GDE A;  3FKI G;  4P72 A;  1Q86 C;  1SLJ A;  3F2D A;  1VQO A;  2ASB A;  2PI2 A;  3M3Y H;  2HT1 A;  3S1Q H;  4DV7 L;  4HJ8 A;  4Y52 H;  4JYA L;  2Z6K A;  1VQE A;  3CXC A;  4LF6 L;  2N8N A;  1A0I A;  1IBM Q;  1XNQ L;  2JA7 H;  4P71 A;  1RL2 A;  4Y7N H;  3U4V A;  1EOV A;  1K0R A;  3D31 A;  1KL9 A;  5JJL A;  5M5W H;  4OWT B;  2HQL A;  1K8A C;  5IYC G;  1GM5 A;  1SR3 A;  4IJH A;  1PHJ A;  4GKJ Q;  1SRU A;  3GD7 A;  1QVG A;  3PUY A;  3PIP A;  4JYA Q;  1X65 A;  1S3O A;  1CUK A;  4DAY B;  3J81 j;  4DV3 Q;  2Z6K C;  3HOW G;  2ZTC A;  2R7F A;  3Q8D A;  2E2J H;  3UDF A;  4LFA Q;  4DR5 Q;  1CKN A;  4OO1 I;  1K83 H;  1DGS A;  3RZD H;  2BA1 A;  1IBL L;  3M4O H;  2WAQ G;  3I4M G;  3STB D;  3PF4 A;  4R4Q A;  5IP9 H;  5FJ8 G;  1Q8K A;  3OW2 A;  4NXM Q;  1O7I A;  3U50 C;  4LUV A;  1PH3 A;  3I4N G;  1PH7 A;  4GOP A;  1HZB A;  4GN4 B;  4DV2 Q;  2EXD A;  3M7N A;  5C3E G;  3HOX H;  4A3B H;  4B3M L;  1EUJ A;  1U5K A;  5BR8 L;  3G4S A;  5GQO A;  1CSQ A;  3RNU A;  2UUA Q;  3A0J A;  3S1M H;  2IT1 A;  1NBW A;  2RHS B;  1EQR A;  2PNH A;  2XTI A;  4GS3 A;  4PZ6 A;  4A76 A;  4OWW B;  4BY7 H;  1V9P A;  4NPS A;  1VQ7 A;  3CCV A;  4DV0 Q;  4DR2 L;  2OCE A;  4IOA A;  4B3R Q;  4NXN L;  2IX0 A;  4MZ9 A;  4GKK L;  1Q7Y C;  3J80 i;  5H1S E;  1YJ9 A;  1QUQ B;  1WCM H;  4R4T A;  5AJ3 L;  4DR4 L;  5IT9 c;  4X66 L;  3TS0 A;  4GN5 A;  2ZJQ A;  3CP0 A;  4LF5 L;  3PO2 G;  2PI2 E;  1UE1 A;  2JA6 H;  3K81 C;  4JI6 Q;  1PA6 A;  1PH4 A;  3H0G G;  3CCU A;  1I5F A;  1KQS A;  4DR5 L;  1ASY A;  4BXX G;  2BA0 A;  1N9W A;  5IE8 A;  4UY8 C;  2HIX A;  4MNO A;  4DV3 L;  4L5T A;  1HH2 P;  5M3M H;  2F4V Q;  3CPF A;  4YCW A;  4YHH Q;  4IFD I;  4YWL A;  4AQY L;  1FL0 A;  2UUB Q;  1XMO Q;  4QIW E;  5M3F H;  4B3T L;  3TS2 A;  3PO3 H;  2HIV A;  1NMG A;  1S72 A;  4JBK A;  3S24 A;  3HOY H;  1Y1V H;  1EIF A;  2VZA A;  1FJG L;  2UXC Q;  2R7Z H;  1GVP A;  2JQO A;  4LFA L;  1XPU A;  1PYS B;  1VQK A;  1G29 1;  4OX9 L;  2ZTE A;  4A4I A;  2R92 G;  2VL6 A;  5IP7 H;  2I5M X;  2VNU D;  4A3M H;  3HKS A;  1C0A A;  5IYB G;  2I5L X;  4TQU S;  4IJL A;  5EAY A;  3CC7 A;  2R6G A;  4DV6 Q;  3L2P A;  4J15 A;  4GLA C;  4DR1 Q;  1MJC A;  1G51 A;  2Q2I A;  2VQE Q;  3S1R H;  4YWK A;  1LTL A;  3M4P A;  4A3F G;  3EIV A;  4BBS G;  4DV5 L;  2YTX A;  3AYH B;  4BA2 I;  4DR4 Q;  1N34 L;  3RN5 A;  1C9O A;  2R93 H;  1BKB A;  4JI1 Q;  1UE7 A;  4JI4 Q;  4C3H H;  1TWF H;  4UP9 A;  4X64 Q;  4LW1 A;  4IO9 A;  3OTO L;  1YHQ A;  2JEB I;  2R7Z G;  4WJ4 A;  2R7D A;  1N36 L;  1QVC A;  4DUZ L;  3GTQ H;  4JI1 L;  4OXP A;  4JI4 L;  1QUQ A;  4X66 Q;  4LF8 L;  3W1B A;  5M3F G;  3PO3 G;  4A93 H;  1Q1E A;  2CKZ B;  1W3S A;  2JA9 A;  4JI0 Q;  3UDI A;  3A74 A;  2B3G A;  1VQ4 A;  3CCL A;  2DUD A;  4DPG A;  4NXM L;  1YBY A;  2OQ0 A;  3E0E A;  3KF6 A;  3AFQ A;  3H0G H;  5C0X J;  3JAM c;  3CCM A;  4BXX H;  3HFZ B;  4LNQ A;  4XTC S;  3PUZ A;  3JC6 6;  4JI8 L;  3PV0 A;  2N49 A;  2NN6 G;  4KHZ A;  2JA6 G;  2E2H H;  4LFB L;  3PO2 H;  4HJ5 A;  3RN2 A;  4LF4 L;  1VQJ A;  3HKZ E;  3G48 A;  1EWI A;  1TWC H;  1KAW A;  4A3J H;  2IX1 A;  4K0K L;  2K5H A;  4QL5 A;  1YEZ A;  3KDF B;  2VQE L;  4L5R C;  4OX9 Q;  5C44 H;  1VQN A;  3PIO A;  3CCJ A;  4BBR H;  4NB3 A;  2YU9 H;  1XMQ L;  1Q81 C;  3BJU A;  3HOZ H;  1XJV A;  1K3R A;  1HZA A;  1Z47 A;  2LXJ A;  1J5E Q;  4LUZ A;  4DV4 Q;  1XNQ Q;  1IXR A;  5E7N A;  3UDG A;  4LF6 Q;  2CQO A;  4DAM A;  4A3G H;  4KHP Q;  1IL2 A;  2UXB L;  1X55 A;  4HID A;  1Q82 C;  2YTY A;  1SE8 A;  1PV4 A;  3S17 H;  1VCI A;  4A3E G;  4O2D A;  4HJA A;  4DR6 Q;  4KHP L;  4LF7 L;  1A8V A;  2DGY A;  3RR5 A;  4R4C A;  1Y1W G;  1SFO H;  4C3J H;  5IP9 G;  4X62 L;  1VQ8 A;  1EIY B;  4LF8 Q;  3I4M H;  1FVI A;  1JJC B;  3AQQ A;  1N36 Q;  2K50 A;  4IPD A;  1L1O B;  3AFP A;  3S14 H;  2NVT H;  2VQF Q;  2GVB A;  1XMO L;  3I4O A;  2JK8 A;  2K14 A;  2R93 G;  2QA4 A;  1HZC A;  3PF5 A;  2AHO B;  3HOW H;  5ELN A;  1U0L A;  4YWM A;  2OTL A;  1S40 A;  3GTO H;  4TVA B;  2D62 A;  1PH5 A;  4UPA A;  4DK6 C;  1G6P A;  4P74 A;  5IYC H;  3RZO H;  1OXU A;  1QZG A;  1TWG H;  4JI8 Q;  3UDX A;  4QGU A;  5HGQ A;  1PH8 A;  5GRO A;  4LF9 L;  2D0P A;  1HR0 W;  4O0A A;  1E22 A;  1N34 Q;  2BH8 A;  3J81 i;  4DR2 Q;  2EIF A;  2ID0 A;  4GOP B;  2D0O A;  4B3M Q;  3M4Q A;  4GKK Q;  2ZM6 Q;  2AWO A;  2I0Q A;  1N8R C;  3UE0 A;  1NY4 A;  4HIM A;  4RG1 A;  2UXC L;  3W1G A;  4B3S Q;  3J7A 5;  4DUZ Q;  4JI2 Q;  1KIX A;  5FLM G;  3KFU A;  2UU9 L;  4PZ7 A;  2MO1 A;  3GO5 A;  5C4X H;  1EYG A;  5M3M G;  1I50 H;  3S16 H;  1B7Y B;  2JA8 G;  1XPO A;  1CKN B;  3BU2 A;  1OXT A;  2Y0S G;  2NVQ H;  1X3G A;  2JA8 H;  4A3L G;  1OXV A;  1IBL Q;  1P16 A;  3KDF A;  5GAH C;  2ZJR A;  5LMN W;  1KRS A;  1NTG A;  5M5X H;  5C4J H;  1N33 Q;  1LM0 A;  4X62 Q;  3GTL H;  4A3D H;  2HHH L;  3GTG H;  5K36 G;  2YV5 A;  2ZJP A;  2PMZ E;  1VQG A;  4LF7 Q;  4AYB G;  3ULL A;  5IYD G;  2JA5 G;  1N33 L;  1VQM A;  1WCM G;  3ER0 A;  3CQZ H;  1E1O A;  2OQK A;  2GN5 A;  1WI5 A;  2I5H A;  4EX5 A;  2K5N A;  3A5U A;  2NVX H;  1H95 A;  3GTK H;  2VQF L;  1OXS C;  1QZH A;  3RLF A;  1K9M C;  5JJI A;  1VQH A;  4BY7 G;  3CPW A;  1EQQ A;  3E9I A;  4C2M H;  1VQ5 A;  2UXD Q;  3RLO A;  3G6E A;  1E3P A;  2VUM G;  1YIT A;  4DV6 L;  1X6O A;  1YHA A;  4RMF A;  1HNZ L;  1XNR Q;  4HIO A;  1E1T A;  2ES2 A;  4PMW A;  5C3E H;  3MEF A;  1JE5 A;  4A3B G;  3NBH B;  1I6H H;  1AH9 A;  2E8G A;  3IRB A;  1XNR L;  4L5S A;  4A3K H;  1YVC A;  1HJP A;  1XTD A;  5FJ8 H;  2PQA A;  1K73 C;  1PH1 A;  1Q1B A;  3M9B A;  3PUW A;  4JI2 L;  3K0X A;  1HR0 Q;  5ELO A;  3CC2 A;  3I55 A;  3HOU H;  3HOV H;  2QEX A;  1EFW A;  1WJJ A;  1K8G A;  3DLL A;  3H15 A;  5AJ3 Q;  1RIP A;  4HIK A;  3HOV G;  3HOU G;  2ZM6 L;  1PH6 A;  4X64 L;  2Q2T A;  3LGJ A;  4AIM A;  3CME A;  3CW2 C;  5LMN L;  4A3K G;  1BBW A;  2WP8 J;  1HR0 L;  2CCZ A;  4DK3 C;  5JJK A;  2V1C C;  4A3E H;  1KXL A;  4JI3 Q;  4UP8 A;  3M85 A;  4JV5 Q;  5FLX c;  4JG2 A;  1B8A A;  4JBJ A;  2A8V A;  1PYB A;  2VUM H;  3TRE A;  4POF A;  1TXY A;  2F3I A;  1IYJ B;  3KF6 B;  1XPR A;  2E5L Q;  2NZH A;  2OWO A;  1OXX K;  1SN8 A;  4AH6 A;  2JA7 G;  2VW9 A;  4APV A;  4GNX C;  4BBR G;  2UUC L;  3TRZ A;  1VQB A;  3EBE A;  2CWA A;  3L0O A;  3F2C A;  1PFS A;  3PCO B;  3W5O A;  4A3J G;  3FKI H;  4YCU A;  2JA5 H;  1X54 A;  1YHB A;  3KJP A;  3CC4 A;  1NJI C;  1GKH A;  1L1O A;  4PZ8 A;  3CCQ A;  2JE6 I;  2LSS A;  1MIU A;  3EN2 A;  4C3I H;  3H3V I;  3WWV A;  1C7Y A;  4GNX B;  3NEN A;  3S15 H;  1XMQ Q;  5BR8 Q;  3J81 c;  3CD6 A;  1J6Q A;  1JT8 A;  2IY5 B;  3CMA A;  4GLX A;  3FHW A;  5GAG C;  1P8L A;  2KBN A;  1X56 A;  2RF4 A;  3TEH B;  4A93 G;  1UE5 A;  2B29 A;  4R4I A;  3L7Z C;  4LFC Q;  5FLM H;  2UXB Q;  1AE3 A;  3RLN A;  1CKM A;  4IPG A;  4HJ7 A;  1KHI A;  1BBU A;  1YI2 A;  4JBW A;  3S2D H;  4DV4 L;  2KHJ A;  4JOI C;  2AWN A;  1V43 A;  2AKW B;  4YY3 L;  3NEM A;  4XIG S;  3KJO A;  2ALY B;  2B63 H;  2Y0S E;  1JJ2 A;  4JI7 Q;  2NZO A;  1IBK L;  3ERS X;  4GLV B;  4IFD J;  3I7F A;  1JB7 A;  1L2F A;  1VQ6 A;  5LMU L;  1VQF A;  1L0W A;  2KCT A;  4GKJ L;  5HY6 A;  1E24 A;  2C35 B;  4BBS H;  5IY0 A;  2WFW A;  4JI6 L;  4KLK A;  1HNX L;  1BVS A;  5IWA Q;  3T1Y L;  1A63 A;  4X65 L;  4HJ9 A;  3U4Z A;  1JMC A;  4EQ5 A;  2H5X A;  3DM3 A;  1VQ9 A;  4JCV E;  3STB C;  1TWH H;  2YTV A;  4BY1 G;  4YHH L;  1YJN A;  1I94 L;  3CCS A;  1YJW A;  3B6Y A;  1TWA H;  1Q12 A;  5IYB H;  2BH2 A;  1X3E A;  2K4K A;  3KLW A;  4DV2 L;  4A3M G;  2CFM A;  4K0K Q;  5IP7 G;  2UUC Q;  5C0X G;  2K75 A;  2Q2H A;  4LF9 Q;  2R92 H;  2AMC B;  1UE6 A;  2K52 A;  3OYY A;  3I2Z A;  1LYL A;  4DNI A;  2B63 G;  4NXN Q;  2IHE A;  3I56 A;  1Y1W H;  1KRT A;  3F1Z A;  1ASZ A;  2WB1 E;  3JAM i;  5M5Y H;  4LWC A;  4DV1 Q;  4WJ3 M;  4R4O A;  4DR7 L;  4JV5 L;  2UUA L;  4A75 A;  1I3Q H;  1Q46 A;  1KC8 C;  4DR6 L;  1N32 L;  4A3I G;  1R9T H;  3TQY A;  4DV1 L;  4A3G G;  1FGU A;  2KCM A;  4DR7 Q;  3NEL A;  5GAE C;  3UE1 A;  5J3B A;  1V1Q A;  1VQD A;  4IPC A;  4DR1 L;  4JBM A;  4LF5 Q;  1MJE A;  3HOZ G;  3AEV A;  1M90 C;  2KEN A;  2WB1 G;  1HNW Q;  4OWX B;  1WOC A;  4ALP A;  1SMX A;  5C44 G;  1IBM L;  1D8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...