1TWHH

Rna polymerase ii complexed with 2'datp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 19
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twhH00
2DGYA 3KJOA 1WJJA 3M85A 4DV5L 1W2BA 3E0EA 3K7UC 1BBWA 1LM0A 4A3MH 2HIVA 1WI5A 4C3JH 1ASZA 1JB7A 1EIFA 3TQYA 4DR1L 4JI1L 2IY5B 2JA5G 1NMGA 2EXDA 2DUDA 4LF6L 1GKHA 2F52A 4O2DA 4DV2L 4BY1G 1CKMA 1XMQL 3S16H 4X64Q 2YTVA 3CCUA 3CCVA 3CC7A 1E24A 2F4VL 1X3FA 5GADC 4DV3Q 5IY0A 1FJGQ 4PG3A 4JOIC 3CCJA 4A3MG 2BH8A 1A0IA 2Q2TA 4NXNL 4IJLA 3UE1A 4JOIA 2VQFL 2E8GA 2R92G 5C3EH 2NZOA 2IT1A 1HNZQ 4BXXH 1IBLQ 4L5QA 1K0RA 4YWKA 2JA7G 2R7ZH 1VQNA 2ZM6Q 3HKZE 1SN8A 2B63H 4P75A 2KHJA 2KHIA 2VZAA 3GTMH 3KJPA 4MNOA 1PVOA 2RCNA 4UP9A 5GAGC 2YTXA 3PUVA 4YCWA 3F2BA 1Y1WH 4LFAL 4K0KL 2UXCQ 3KOJA 5IYDH 2K5VA 2PQAA 5C3EG 1QZGA 3S1QH 4IPDA 2UUBQ 2B29A 1XPOA 2CKZB 4POGA 4BXXG 1TWAH 4IPCA 1VQ5A 2RHSB 1HH2P 1VQAA 4A76A 4NB3A 2GN5A 3GTLH 2Z0SA 2B3GA 4OWTB 2R7ZG 1GM5A 2JA9A 1VQJA 1UE6A 2B63G 3I7FA 2VUMH 3CQZH 2Q2IA 4DR2L 4IOAA 2NZHA 1HNWL 3I56A 1U0LA 1Y1WG 2A19A 3A0JA 1VQ7A 1WCMH 2HHHQ 4JI0Q 3CD6A 5IYDG 2OCEA 3IRBA 4P71A 1TWHH 4HJ9A 3G6EA 4DR3Q 5ELOA 3CP0A 4QGUA 4DUZQ 2CWPA 3HKSA 1KAWA 2L15A 4GOPB 5ELNA 3AEVA 4GKJL 3G4SA 1K8AC 5DLQE 3K80C 3UE0A 1WYDA 4POFA 1X65A 4A3JH 4QIWE 2E5LQ 4XIGS 3HOZH 1WOCA 1U5KA 5IP9H 2UU9L 3NELA 1FVIA 1RIPA 1XPRA 1PYBA 1WCMG 2OQKA 4B3TL 4JI7L 5IE8A 3RLNA 3S17H 1N36Q 2BA0A 3M4QA 4DR7Q 5IYCH 1QZHA 3J80c 5IWAL 3CC2A 1D7QA 2XGTA 1SRUA 2UUCL 4A3JG 4JV5Q 2I5HA 1VQEA 2AMCB 5IP9G 3HOZG 1V43A 3CAMA 3S1NH 4JI6Q 3OTOQ 4X65L 5LMNL 1L1OB 4YWMA 4DV6Q 4IJHA 4JBMA 1NE3A 3STBC 5IYCG 3I4NH 1YITA 3W1GA 2ALYB 3S2DH 4A93H 1T9HA 1K9MC 3SGIA 5LMNW 3ULLA 5AJ3Q 1YJWA 1PH2A 2Q2UA 2I5LX 2JK8A 1JT8A 4DAMA 4Y7NH 1JE5A 3I2ZA 1OXSC 1CSQA 1I94L 2ATWA 1CUKA 1X55A 4DK3C 1L2FA 1QUQB 3RN2A 1A63A 3RZDH 3I4NG 2WFWA 4DV0L 5M3FH 2ES2A 4JYAL 2VS1A 4A93G 2PNHA 1A62A 2K50A 4DR5L 3JAMi 1N34Q 1TWGH 2ZTCA 3F8TA 3U50C 5E7NA 2YU9H 2JEBI 4EQ5A 5C4XH 4X62Q 4OWXB 1KL9A 1Q46A 4APVA 1PH1A 1EYGA 2I5MX 1N33Q 4R4CA 4DV1Q 4OO1I 5FJ8H 1IXRA 1SR3A 1HNXL 5M3FG 2ZJPA 4LF5Q 1NY4A 1KIXA 4LF7L 3RZOH 1V9PA 3PUXA 2H5XA 4A3IH 2A8VA 4OO1G 1KXLA 2WB1E 1PH5A 2PMZE 1X6OA 3U4VA 4JBWA 3GTJH 4HIKA 2A1AA 3GTGH 5C4XG 4LW1A 3UDIA 4DKAC 2CCZA 1PHJA 4YY3L 4DV2Q 3AFQA 1VQGA 2V1CC 3L2PA 4B3SL 1Z9FA 1CKOA 2UXDL 1NMFA 4B3ML 1EQQA 3BZKA 4EX5A 3M9BA 3DLLA 1N32Q 3G48A 1EQRA 4JI4L 1J5EQ 2UXBQ 1R9TH 4GNXB 4A3IG 4JI8L 1JJGA 1QVFA 1VQ9A 1C0AA 1L0WA 4GOPA 4KHPQ 1NJIC 5BR8L 3KF6B 2Y0SG 1XMOL 1YZ6A 4LFCQ 3RN5A 2R92H 1X54A 3M7NA 2PI2E 3RLOA 3S24A 1EFWA 1I5FA 1YHBA 4BA1I 5C44H 3J7ZC 4DUYL 1RL2A 3KYHC 4XTCS 4HIOA 2ZTEA 4AQYL 1Q81C 1KQSA 1S72A 4IPGA 1XPUA 2JA7H 4BA2I 2R7FA 5K36G 1XNRQ 1M1KC 4DAYB 4A3KH 2BH2A 2C35B 3FHWA 1IBKQ 5FLXc 1Q7YC 2JA8H 2ZJRA 4QQBX 4A3CG 1UE7A 2MO0A 2ZTDA 4LUVA 5LMUQ 2N3SA 4LF9Q 2IX1A 5JJIA 1MIUA 3E9HA 5HY6A 5IP7H 1IYJB 2F3IA 4P72A 5C44G 3J81c 3F2CA 2R7DA 4A75A 1YI2A 3NEMA 4LNQA 5GROA 1V1QA 4R4TA 5H1SE 1S40A 2KBNA 5HGQA 2ASBA 3S2HH 4FDBA 4A3KG 3PIOA 1M90C 1VQCA 4DV4L 2IX0A 2CWAA 3FP9A 3KDFA 3I4MH 4JI5L 3T1YQ 2JA8G 4DV7L 2NVQH 1Q1EA 2LXKA 3AYHB 5IP7G 2JJQA 4UP7A 2NVTH 3GTKH 4PZ8A 4GKJQ 2NVYH 4A3EH 1CKNB 4HJ7A 1OXUA 1IL2A 1QUQA 2MO1A 5M5XH 1VQ8A 1YHAA 3PF5A 1YHQA 4JI2Q 1PH4A 1AE2A 2EIFA 3I4MG 1X3EA 4YCUA 1G51A 3UDFA 3HFZB 4MTNA 4X64L 1SFOH 3PGZA 4JI7Q 4DR6Q 4DV3L 1E22A 4YHHQ 1MJCA 1FJGL 3L7ZC 1IBMQ 4BBRH 5IWAQ 3J81i 3I4OA 4A3EG 4DR4Q 2K75A 4L5RC 2I0QA 1X56A 2K5NA 1NBWA 2E2HH 1HNZL 3GO5A 3MXNB 3H15A 1VQ4A 3RNUA 5LMNQ 3L0OA 2QEXA 2MFIA 5M5WH 2GVBA 3AQQA 2YTYA 4DPGA 2ZM6L 1H95A 4WJ3M 2AHOB 4BBSH 3D31A 4BBRG 3PV0A 4X66Q 4WJ4A 3TS2A 1VQDA 3S1RH 3PUZA 3ZJYC 2UXCL 1SE8A 4HJAA 1QVCA 4LF8Q 4YWLA 4GKKQ 1YBYA 1VQBA 3CPWA 2UUBL 2ZJQA 3HOVH 4QY7A 2K52A 4C3IH 4AYBG 1BKBA 2VNUD 2OTLA 2LSSA 2UUAQ 1NTGA 4A4IA 1XJVA 2RF4A 2YV5A 4JC0A 2QA4A 4OWWB 3CC4A 4BBSG 1G291 1Y14B 3HOXH 2N49A 3KF6A 2PI2A 3TRZA 3WWVA 1MJEA 4KHZA 1SLJA 2CQOA 2K14A 1VQLA 2E2JH 5GQOA 2MNAA 4LF4Q 4IFDJ 3T1HQ 4LFBQ 1TWFH 4OONA 1XTDA 3HOVG 1LYLA 1HJPA 1GD7A 1SMXA 1B8AA 1BVSA 1FL0A 4MZ9A 3HOWG 2E5LL 4R1JA 3HOXG 2K5HA 4R4IA 4IOCA 3J80i 4LF7Q 4RG1A 1BBUA 2CFMA 1TXYA 1PV4A 2E2IH 1OXVA 4O0AA 1OXXK 1O7IA 2VW9A 1HZAA 1KC8C 4C2MH 1N36L 4IFDI 2WP8J 2JE6I 2HT1A 4YY3Q 2XTIA 3ULJA 1WFQA 4HJ8A 2RHQB 4KI0A 4OX9Q 3KLWA 4UP8A 4DV5Q 4R4OA 3OTOL 1UEBA 2D62A 3U58A 2NVXH 4NXML 2OTJA 3STBD 3CXCA 1UE1A 4DR1Q 4JI1Q 4DV6L 1K8GA 1EUJA 1D8LA 1VQPA 1CKNA 2D0OA 5EAYA 4LF6Q 4DK6C 5JJKA 1HR0L 1XMQQ 3FKIH 2VQEL 3ULPA 3CCLA 2MQHA 4DUYQ 4JI3L 4AQYQ 5AJ3L 2F4VQ 1CSPA 4C3HH 1PH9A 4GOPC 1YEZA 2NN6I 3K81C 1HR0W 1PFSA 1A8VA 4A3BH 4NXNQ 2IHFA 2JEAI 1UE5A 1UWVA 4TVAB 1VQFA 2VQFQ 1FGUA 2WAQG 4PZ6A 4DNIA 1Q12A 2K4KA 4P73A 4A3CH 2Z6KC 3EBEA 1QVGA 3FKIG 3PCOB 5JEAJ 1N34L 1EOVA 2D0PA 4ME3A 2KCTA 2KENA 3BZCA 4R4QA 2Z6KA 4BY7G 2N8NA 1LUZA 4X62L 3CPFA 1VQIA 1N33L 1K83H 4DV1L 4A3BG 4LFAQ 4K0KQ 5GAEC 1P16A 4DV7Q 1SROA 4QJFA 1PH6A 4LF5L 3H3VH 2HQLA 1L1OC 1X3GA 3K8AA 2VL6A 4AH6A 3PUYA 3H3VI 4P74A 4B3RL 1L1OA 2HIXA 2QGQA 3B6YA 4DR2Q 1KRTA 3TS0A 1HNWQ 3CCSA 3M4OH 3MEFA 1E3PA 2IHEA 1G6PA 5JEAG 2OWOA 1VCIA 3H0GH 5J3BA 4KLKA 3CCMA 3UDGA 2KCMA 1J5EL 2UXBL 2ID0A 4J15A 1JJ2A 3Q8DA 2YYZA 4A3FH 4KHPL 1YJ9A 1AE3A 4GLAC 3KFUA 1VS0A 4LFCL 3TREA 2UU9Q 4A3DG 4Y52H 5FLMH 1E1TA 4HIDA 3GTOH 3D0FA 3S15H 1MKHA 3U4ZA 1IZ6A 3PF4A 1XNQL 4B3TQ 4RMFA 3H0GG 1N32L 3W5OA 1N9WA 4QL5A 4L5SA 1XNRL 3EIVA 4PMWA 3CMAA 1YJNA 1C7YA 5M3MH 2Y0SE 2WAQE 4LUZA 1JMCA 4A3FG 2UUCQ 1IBKL 3J7A5 4H02A 3K0XA 5C4JH 2R6GA 5FLMG 5LMUL 4LF9L 4HIMA 3M3YH 4X65Q 3F1ZA 5IT9c 2R93H 1JJCB 1IBLL 1EWIA 4ALPA 4UPAA 1Y1VH 1PYSB 3JC66 4GN4B 4GS3A 3TEHB 5M3MG 4UY8C 1VQ6A 4A3LH 1E1OA 1GVPA 3DM3A 1E7ZA 1Q8KA 1TWCH 5C0XJ 3T1YL 4JBKA 3S1MH 4GNXC 4JBJA 1HZBA 3S14H 1Q82C 3GDEA 2R93G 3AFPA 3A74A 1I94Q 2AKWB 3NENA 5M5YH 1Y1VG 2LXJA 3KF8B 1Q1BA 4GNXA 3NBHB 4LUOA 4DV0Q 1PH3A 2VUMG 3HOWH 3PIPA 4JYAQ 1I6HH 4JI2L 3CCEA 1I50H 3W1BA 1PA6A 1ASYA 4A3LG 4DR5Q 1PH8A 4JI0L 4DR6L 2HHHL 1N8RC 4YHHL 1KHIA 4DR3L 5C0XI 1IBML 3E9IA 2WB1G 3EN2A 4DUZL 1AH9A 5GAHC 3JAMc 2AWNA 1Q86C 4DR4L 4L5TA 1HNXQ 4NPSA 1LTLA 5C0XG 1I3QH 1J6QA 4NXMQ 3PO3H 4A3GH 2AWOA 3UDXA 4IPHA 2FXQA 4OXPA 4DR7L 1B7YB 2EQSA 3KDFB 1YIJA 4AIMA 3A5ZB 4X66L 3GTQH 1HR0Q 4IO9A 3ICEA 2VQEQ 3HOUH 1B70B 4B3SQ 4JI3Q 2UXDQ 2PQAB 4PZ7A 1P8LA 3CCQA 4B3MQ 2VY3A 4LF8L 1OTCA 4GKKL 4JV5L 1HZ9A 4IFDG 4JI4Q 3BJUA 3PO3G 4A3GG 4HJ5A 4JI6L 4YCVA 1VQMA 4JI8Q 3G71A 1GO3E 3CW2C 1X9NA 2UUAL 5JJLA 3BU2A 5BR8Q 1XMOQ 3I55A 3M4PA 1VQHA 2BA1A 3CCRA 3PSIA 3HOUG 3A5UA 1W3SA 2JQOA 3GTPH 3RR5A 4LF4L 3HOYH 3T1HL 4AYBE 4LFBL 3PO2H 1KD1C 4BY7H 3GD7A 4LWCA 2JA6H 4GLXA 3HKZG 3CMEA 2Q2HA 1DGSA 3OYYA 4JG2A 3CF5A 1PH7A 4GLVB 5IYBH 3VDYA 3ERSX 2NN6G 3K7AH 3LGJA 3J81j 1C9OA 4A3DH 4TQUS 1Z47A 2N78A 3OW2A 2OQ0A 3HOYG 1S3OA 3PUWA 4X6AH 3PO2G 4GN3B 4GN5A 1EIYB 3RLFA 2JA5H 1YNXA 1XNQQ 4B3RQ 1K3RA 1OXTA 1HZCA 1K73C 2JA6G 5FJ8G 3F2DA 4DV4Q 1YVCA 1KRSA 1VQKA 2GVAA 3ER0A 4BY1H 1VQOA 4JI5Q 5IYBG 4OX9L 4JCVE
chains in the Genus database with same CATH superfamily
2EXZA 1WJJA 4WORA 3M85A 4A3MH 1LM0A 1WI5A 4C3JH 1TY0A 1JB7A 1TS2A 4JI1L 4KN7C 1I3QB 3NBHA 2E2IB 1GKHA 4O2DA 1UUPA 4MHEA 3S16H 4ZKCB 2JSOA 3CCUA 3CCVA 2F4VL 3T16A 5IY0A 3J81L 2BH8A 1A0IA 4EVOA 4NXNL 3GV6A 4IJLA 1VMPA 1EYAA 2VQFL 1B3QA 2R92G 1BCPD 1WTHA 1HNZQ 2NVXB 4X3UA 1FNWA 2R7ZH 1VQNA 2MGSA 1SN8A 2B63H 2VZAA 2EYOA 4UP9A 5F2DA 3T51B 5GAGC 3F2BA 4LFAL 4K0KL 2UXCQ 3PO2B 1DOMA 1KTKA 5C3EG 1QZGA 4IPDA 1WD0A 2B29A 2F0DA 2CKZB 1XPOA 1M4VA 1VQAA 2B3GA 2JA9A 3MXGA 4RA8A 1UE6A 2VUMH 4K5WA 2XRQD 3I56A 5DEHA 4DK0A 2CH4A 3KBGA 2OCEA 1Y8OB 4MIUA 2LKVA 3CP0A 4DUZQ 3HKSA 3AB9A 4GKJL 4C1NK 1K8AC 2A73B 3EQLC 1WYDA 3VYSA 4A3JH 1ONLA 1NR4A 2RBMA 4XIGS 5IP9H 1MSHA 1S5DD 2F3WA 4HR7B 2OQKA 4Q5VA 2BA0A 4FXKC 1QZHA 5EJWA 1D7QA 2KEEA 3RMHA 2UUCL 2I5HA 3H0GB 3HP3A 1JR0D 3CAMA 5C5LA 4JI6Q 4ZRZA 2RSNA 1FNVA 4YWMA 4DV6Q 5IYCG 3FVQA 4JW0A 3ULLA 2X6LA 3T53B 2Q2UA 2I5LX 2JK8A 1TQOA 1XX8A 3TN2A 1JE5A 5M3MB 1CSQA 5DM73 2F0QA 1EY5A 2ATWA 4DK3C 1ENFA 1F9RA 3U9SA 5M3FH 3K5OA 1I4PA 2A6HC 5KIXA 4IUQA 1Y1VB 1DD2A 2YU9H 2JEBI 4J8QA 5C4XH 1PH1A 3K5NA 2PQEA 1ZXTA 1EYGA 1SYCA 4ZYSA 1TWHB 2ZJPA 1JCKB 3CRLC 2L1BA 2WB1B 4LF7L 3S14B 1SNMA 1V9PA 2WB1E 2WKDA 1VF5C 3GTGH 3NK9A 1PHJA 4YY3L 3AFQA 2UXDL 3L2PA 2OT2A 3BZKA 3DLLA 2RDFA 1F2MA 2AQ2B 5I9OA 3HEJA 2RVLA 2MP1A 3S1NB 3KF8A 2L0CA 2K5DA 3RN5A 2R92H 1X54A 4IALA 4KY5A 1I5FA 4OIJA 1XNQQ 3J7ZC 1RTOA 3KYHC 2L9HA 2NBFA 1XPUA 2R61A 1EEID 3ONAB 4KV6A 5K36G 1M1KC 3GTQB 3L9AX 2BH2A 4QF4A 2JA8H 2ZJRA 2EY1A 3E5SA 4QQBX 4A3CG 1UE7A 4LUVA 2ZTDA 5LMUQ 2N3SA 2IX1A 5HY6A 4A75A 2K5WA 5C44G 1YI2A 4R4TA 5JVH3 2KBNA 1KDBA 2V4DA 4A3KG 2K1BA 3PIOA 1V1PB 1VQCA 1DYQA 1TWGB 3I4MH 3HS0C 1CQFA 1PTOC 2F0VA 3AYHB 2JA6B 4CDDC 1EWCA 1PFNA 1ENCA 4ZQ3A 4HJ7A 2H4OA 1YHAA 3PF5A 3KK7A 1AE2A 1SFOH 3PGZA 4DR6Q 1E22A 1MJCA 2XNAC 4ULLA 5T1IA 5IT9L 2HUGA 3I4OA 3FPPA 2AUJD 4YIJA 4DR4Q 1IYUA 2PPBC 1X56A 3BDCA 1NBWA 1HNZL 4C3JB 3MXNB 1STEA 1VQ4A 3OMCA 1Z6HA 3L0OA 3AQQA 3BVGA 2B2WC 1L0XB 4K2LA 4U673 4K5VA 1PTOD 3PUZA 2UXCL 2JA7B 4JK1C 2B2WA 2G9DA 3D6WA 4K8JA 2K01A 2RDHA 2IW3A 3VR4A 2EY6A 4C3IH 1SNDA 2LSSA 2RF4A 4JC0A 3ZYYX 4BWGB 2CQAA 4FF2A 1G291 1Q8IA 2AUKA 5C6AA 5GQOA 2MNAA 4ZUIA 3T1HQ 4OONA 2B63B 1EQTA 1XTDA 4K6DA 3E3XA 2NVQB 1FL0A 3HOWG 3GP7A 2K5HA 3J80i 5I4DA 3GTKB 2B8GA 1GXDC 2VW9A 3K57A 3HG9A 4XT3B 3M4YA 1V1PA 2RHQB 4KI0A 1F2YA 3S9WA 4WRDA 4KMUC 5E3FA 3CKIB 2D62A 3CXCA 3U9OA 1SYEA 4DV6L 5JJZA 2D0OA 1PMRA 4ID6A 1G8ZD 4JI3L 1F9QA 4AQYQ 1GJXA 4C3HH 2FMMA 3NSWA 1S5FD 3WDNA 3S1RB 1PFSA 5I2YA 1UWVA 1SYGA 2RCFA 4P73A 5L37A 4A3CH 5HGTA 3GV3A 4KJOA 1EWHA 3MXNA 1S5ED 3HOXB 2F0FA 2N8NA 4RKBA 1L0YB 1FD7D 2XSCA 1TWFB 4DV7Q 1SROA 1QWYA 1X3GA 2J4XA 2FMCA 2DY8A 2E75C 3PUYA 5M3FB 2F0SA 4P74A 2IL8A 1SE4A 3CCSA 2IHEA 2YU9B 4C2MB 1VCIA 5T1GA 3A7LA 2I07B 5C4XB 1UEAB 2ID0A 1EY7A 2YYZA 4FO2A 1AE3A 1F9SA 1I6VC 1VS0A 4RFBA 2F0HA 5FLMH 5CORA 3D0FA 3S15H 3PF4A 4F88A 5CV9A 1XNQL 3H0GG 3I3CA 2Y0SB 2BE5C 4L5SA 4PMWA 1YJNA 2Y0SE 1JMCA 1RTNA 1YNJC 3NQTA 1XYIA 3J7A5 1RDPD 3K0XA 1CHPD 4CDEC 5LMUL 4KTAA 4CJ2C 3QIAA 3M3YH 1JJCB 1EWIA 4ALPA 3K6OA 5M3MG 2F0IA 4A3LH 1E7ZA 1Q8KA 1TWCH 4JBKA 2KOLA 2WV6D 2A6EC 2OEOA 1HZBA 1LABA 2XN9C 1IKMA 3A74A 3N52A 2BDOA 5M5YH 1Y1VG 1SBBB 2LXJA 4LUOA 4DV0Q 3HOWH 1KABA 4UAIA 3PIPA 3CCEA 2BE5D 1MBYA 3OPOA 4DR6L 1JWUD 1HUMA 1KHIA 1YNJD 3E9IA 1PRTC 2EY5A 2WB1G 3I4LA 3I4MB 1AH9A 3JAMc 1CM9A 4DR4L 1B53A 3RD4A 2FINB 5C0XG 4IFDH 3SK4A 1I3QH 4A3GH 3V2TA 1X32A 1TKWB 3TP5A 1BF4A 3D4WA 4X3TA 4DR7L 2EQSA 1NUCA 4RGTA 3ICEA 4IO9A 2VQEQ 3HOUH 2A6ED 3MVVA 1P8LA 4QMGA 5IGFA 2VY3A 4K8IA 2AQ3B 4B3MQ 4JV5L 2H1EA 3PO3G 4HJ5A 4YCVA 4JI8Q 1JC7A 2DNEA 1EU4A 2OXPA 3C1FA 5FO9B 3M4PA 5BN5A 2B2UC 3CCRA 2R93B 2A69D 1W3SA 2JQOA 1PRTD 3T1HL 4AYBE 3PO2H 4L63B 4KY7A 2CHBD 1SAPA 1PDQA 3CMEA 3S1MB 4JG2A 3KUPA 1EL0A 5IGGA 2BCOA 3LGJA 1C9OA 4C3IB 2QF7A 3BVMA 3OW2A 3PUWA 1EIYB 2VXWA 2JA5H 1I50B 2JA6G 1K73C 3L3OC 4BY1H 2GVAA 3A8KE 3ER0A 4JPBW 1PTOF 5FO8B 1EY4A 1W2BA 3K7UC 1BBWA 2HIVA 5COYA 1AFPA 2PO4A 3QG1A 1NMGA 2DUDA 4DV2L 1CKMA 4X64Q 3CC7A 1E24A 1GHKA 1FJGQ 4PG3A 4A3MG 4C3JG 2Q2TA 4KD4A 1TU2B 3C1EA 2E8GA 2EJMA 2SEBD 4XQQA 2JYOA 2NZOA 5CV6A 4IUUA 4L5QA 4YWKA 4FF3A 2JA7G 4RGNA 1QILA 1EY0A 2AQ1B 4FXGC 1DCZA 2KHIA 4ABNA 1PVOA 3P1HA 1Y1WH 2B2YC 1ICWA 1TWAH 2L4NA 1VQ5A 3GTLH 2RHSB 3IFDA 2R7ZG 3VR5A 2Z0SA 2B2YA 3OOCA 1ESRA 3K7AB 2B63G 3PIO3 2Q2IA 4A3DB 2A19A 3IAYA 1VQ7A 4JI0Q 3K5MA 4RHSA 3CD6A 1TWHH 4HJ9A 4DR3Q 4N9TA 4RH6A 2Z4IA 4OHJA 2L15A 4GOPB 4IURA 1TS4A 2F0NA 2KJXA 1LT4D 2EOTA 3KBXA 3HOZH 1JICA 3NELA 3E0JA 1XPRA 1B3AA 1A2TA 5E1FA 5EQ0A 2HCCA 2F0EA 1KAAA 2XGTA 5EPJA 1SRUA 4A3JG 1CA6A 2AMCB 4IUNA 5IP9G 3S1NH 4DFAA 1HFNA 5LMNL 1L1OB 3VR6A 1NE3A 2G9HD 2ALYB 4G7OC 2L55A 5DM63 5LMNW 5AJ3Q 5BN3A 1M8AA 1Y8PB 1JT8A 3LWUA 4DAMA 2K5QA 3DWAA 4G57A 3BYYB 1CUKA 1L2FA 1IHZA 1QUQB 1BO0A 3RN2A 3RZDH 3S1QB 4DV0L 3R93A 2ES2A 1STAA 4NMZA 1TWGH 3U50C 3QOLA 1I4GA 1HUNA 2IWHA 2Z9HA 3T56B 4I65A 1ICFB 4DV1Q 3N6RA 4BS9A 5M3FG 4MN3A 1EY8A 5EKLA 1D6EC 1NY4A 3OWEB 5KNBA 2H5XA 4KKTA 2A8VA 1PH5A 4DGZA 1X6OA 3GTJH 2A1AA 5C4XG 3UDIA 4DKAC 1J9OA 3V96A 1JJGA 1CKOA 4B3ML 1V1OA 2DN8A 3M9BA 2A5HA 1D2BA 1EQRA 1C48A 4JI8L 2B2TA 2IJ0A 1I4XA 3MC0B 4GOPA 4RCOA 4G7ZC 2Y0SG 3QR8A 1YZ6A 1IW7C 4A3GB 3LNNA 3RLOA 1CQVA 1EFWA 4DUYL 3I4NB 2JA7H 5JPNC 4BA2I 4IPGA 5G3LF 2EY2A 1XNRQ 1JOKA 3HOUB 3OHXC 5C4ZA 2XWBB 1GHJA 2C35B 3FHWA 1IBKQ 5FLXc 4Y7NB 1Q7YC 5KNDA 2QCPX 1MIUA 2Z1CA 5IP7H 1IYJB 2OF1A 5NUCA 3NEMA 1STGA 3TMEA 1V1QA 3S2HH 2D9UA 5HGQA 1GUOA 2O5JC 1RODA 2XWJB 2IX0A 3FP9A 3KDFA 1MHWC 2JA8G 5FLXE 2NVQH 2J0TD 4DNRB 2ZXRA 2LXKA 3GTKH 2JJQA 4PZ8A 2IX3A 1E2ZA 3O13A 1IW7D 1OXUA 4UDUC 1QUQA 4ZLTF 1EOTA 2DNCA 3FPUB 3RZOB 4JI2Q 3I73A 4A3IB 3I4MG 1X3EA 5ELCA 4X64L 3HFZB 4RCNA 4QB4A 4JI7Q 3Q22A 2JA5B 2C5CA 1JQYD 1FJGL 1ESFA 1STNA 3L7ZC 4ODGA 4BY1B 5IWAQ 3SK6A 3BG3A 4KKSA 1G91A 1JE4A 2RDGA 2MFIA 2GVBA 4DPGA 2AHOB 5CV5A 4BBSH 5IGCA 1E2VA 3TS2A 2B39A 4DXGA 3LWEA 3S1RH 4DNTB 5IGDA 1FGBD 1QVCA 4YWLA 4GKKQ 1YBYA 3IL8A 3CPWA 2ZJQA 3HOVH 5JAVA 4AYBG 1BKBA 4XYQA 3FMCA 2UUAQ 1LT3D 2K04A 1Q3LA 3HOXH 1Y14B 4KHZA 2CQOA 2BOSA 4LF4Q 1TWFH 5IGEA 1KDAA 1LYLA 1HJPA 4C3IG 1GD7A 3PQIA 1H9JA 1Y1WB 1AZPA 1BVSA 3DXJC 3BDLA 3NP8A 4R4IA 2E2DC 3PIP3 2NVTB 4RG1A 1TWAB 1BBUA 4A3EB 3GTLB 1OXVA 4CKBA 1O7IA 3G6JB 4C2MH 2WP8J 4F8MA 3MEHA 2CH4W 4HCSA 1D5XC 1TY2A 4KJNA 4BBRB 3CHBD 3EROA 4UP8A 4DV5Q 4NXML 4DR1Q 4H7BA 1EUJA 4CDFC 1VQPA 3HOZB 2E2HB 2EYLA 4LF6Q 4ZCKA 2F0GA 3NTKA 4FXDA 2F0JA 1XMQQ 3ULPA 3CCLA 4EQPA 5AJ3L 1PZID 5JPMC 1YEZA 2NN6I 2PZWA 1NCVA 2IHFA 4CGYB 4IZ8A 1UE5A 5J22A 2A6HD 2SNSA 1Q12A 1K3BC 2Z6KC 3EBEA 5JEAJ 1LT6D 2HQEA 1EOVA 2D0PA 2KHSA 4C3HG 4GZYC 4R4QA 3CU7A 2Z6KA 2HD3A 1G2TA 5A2QE 4DV1L 1O80A 5ELFA 4FNFA 2NB0A 4QJFA 3TP7A 1PH6A 1F2ZA 2MHVA 1LACA 1Z7TA 4HAEA 3RZDB 2VL6A 5KYIA 3B6YA 3TS0A 4EGVA 3MEFA 1G6PA 1NSNS 2OWOA 1CI3M 5J3BA 2EDGA 5EKKA 3Q8DA 2WINB 4A3FH 1YJ9A 1Y69U 1U4LA 5CGKA 3VYRA 4J1MA 4IUVA 1MKHA 2XVSA 3GTJB 2WKCA 1PLFA 3W5OA 2WAQB 3RUZA 1EIHA 1XNRL 1B2TA 1C7YA 1PFMA 3P75A 4LUZA 2WAQE 1HA6A 1IBKL 4H02A 1JOOA 2R6GA 5FLMG 3DMUA 4R8NA 2R93H 1ZKOA 4UPAA 3NHHA 2KQ3A 1I4HA 3S1MH 1H9RA 2L11A 1Q82C 1I94Q 3DWPA 1PH3A 1I6HH 4JYAQ 4JI2L 1I50H 1LTGD 3W1BA 1PA6A 4A3LG 4DR5Q 3S2HB 1N8RC 2SOBA 4I7ZC 2JN4A 2WACA 3T13A 4DUZL 5GAHC 1Q86C 4DAVA 4NPSA 2GA4B 1TS3A 4L8JA 1F77A 1SMYC 3D3RA 1KLGD 1EEFD 4R8IA 1BCPF 3Q23A 3SR1A 1YIJA 1OO9B 4AIMA 3A5ZB 4N8FA 1HR0Q 1BDOA 2SDFA 1B70B 2D2CC 4RGMA 3CCQA 4GKKL 1OTCA 4PMCA 1HZ9A 4K5XA 4IFDG 1WD1A 3BJUA 4A3GG 4JI6L 1S4ZA 1VDZA 1AEXA 3G71A 2UUAL 1EYCA 2LFNA 5FKAC 5BR8Q 5I2XA 1VQHA 2BA1A 4XYOA 3PSIA 3HOUG 1SNQA 5CYUA 4LF4L 3HOYH 1PYWD 4BBSB 1KD1C 1SJHD 4GLXA 1ET9A 5AFWA 2Q2HA 1DGSA 3OIPA 5DAUA 3CF5A 1PH7A 5IYBH 3K7AH 3HOVB 1A15A 1BXTA 1K8OA 4A3DH 4TQUS 2EYMA 2OQ0A 2F0KA 3BYTB 4GN3B 3Q6SA 3PO2G 4B3RQ 5CV7A 3K59A 2LS01 5C3XA 5FJ8G 4DV4Q 1VQKA 1KRSA 2J7ZA 1VQOA 1UAPA 3BDOA 4JCVE 2DGYA 4DV5L 1G6ZA 2QKIC 1ASZA 1B9MA 4DR1L 2IY5B 5J1ZA 2JA5G 2EXDA 2K33A 4LF6L 1PZJD 2F52A 4BY1G 1XMQL 5JOBA 5GADC 1GOZA 4KKUA 4OL7A 2PW5A 4DN4M 1SSOA 1WTQA 5JVG3 4DA2A 1RKNA 3QB3A 3UE1A 4M8AA 4V0BA 4XQJA 4BXXH 2TMPA 3HKZB 1IBLQ 2ZM6Q 3W2DA 3HKZE 4P75A 1ILPA 3KJPA 4MNOA 2RCNA 4LJZC 3GTPB 3KLSX 1E0BA 1QNUA 2M00A 3PUVA 4YCWA 3KOJA 4KD3A 1JOQA 2MPMA 5IYDH 3S1QH 1TR5A 1CFMA 4DK1A 5D14A 4NB3A 4OWTB 4PMBA 1HQRD 1GM5A 1B44D 5EGTA 1KNEA 4IOAA 2NZHA 3SHLA 1U0LA 2HDLA 1SJED 3QO2A 1Y1WG 1WCMH 2HHHQ 1YNNC 3R2TA 1VF7A 2I46A 3IRBA 5LHY1 1XTCD 1IYVA 5ELOA 5E4XA 5EBCA 3AEVA 1HRJA 1F2LA 5DLQE 3UE0A 3S2DB 1X65A 5KGUA 1AN8A 1WOCA 1U5KA 1FVIA 5C4HA 1RIPA 5D3IB 5IE8A 3I70A 5TSSA 2K28A 3J80c 1JORA 3CC2A 3HOZG 1V43A 4H0LC 3KLRA 4A3FB 2TSSA 4JBMA 1RHPA 3STBC 3I4NH 5E4WC 1YITA 1ZYRC 3W1GA 3J80E 4A93H 1YNND 1K9MC 3NPPA 3JAME 1YJWA 4Z9CB 3GTMB 3BZDB 4Y7NH 1HA5A 1RD9D 1X3QA 1I94L 1A63A 1R4QB 3MA2B 4JYAL 2VS1A 2PNHA 4DR5L 2K50A 5D3DA 1Q90A 4Q0FA 2ZTCA 3F8TA 4OO1H 5E7NA 1SYFA 3CQZB 2BDNA 4OWXB 1KL9A 1Q46A 4APVA 1DM0B 3BS1A 1N33Q 4OO1I 5FJ8H 1C4QA 1IXRA 1D5ZC 1SR3A 4FF4A 4B9WA 3MHBA 3OMGA 5DNFA 5FK9C 4ZUJA 3RZOH 3PUXA 4A3IH 3U4VA 4JBWA 4HIKA 1I6HB 3J7AF 1F9PA 2CCZA 1I4QA 1DJRD 3CRKC 1AP0A 1EIGA 1VQGA 2Z8LA 1Z9FA 1EQQA 3S17B 1WTPA 4OELB 1SDFA 2SNMA 3G48A 4CJ0B 1H9MA 3K0YA 1J5EQ 2UXBQ 4RKLA 1DOLA 1R9TH 4GNXB 2PW7A 1L0WA 4KHPQ 1NJIC 5BR8L 3KF6B 4LFCQ 3AMUA 2PI2E 3S24A 1EQVA 1YHBA 4BA1I 4AQYL 1RL2A 1QB5D 4XTCS 3TSSA 2F4IA 1N32Q 1S72A 2N88A 2R7FA 4DAYB 2EYJA 2F0MA 4LF9Q 5JJIA 3F2CA 2F3IA 4P72A 3J81c 2K7VA 5ELBA 5GROA 1S40A 2NUCA 2ASBA 1EFID 4FDBA 1GUWA 3I72A 4S3SA 3H09A 4DV4L 2CWAA 3HOYB 3R3OA 2LMCB 2E74C 5CR3A 4G7HC 4DV7L 3IKJA 2F0OA 1Q1EA 3NXWA 5IP7G 2NVTH 4UP7A 4GKJQ 4A3EH 2RQXA 3J81E 1CKNB 5FO7B 1IL2A 1JWMD 1SXTA 1VQ8A 1YHQA 1MSGA 2EIFA 2NZ1D 4MTNA 2A74C 3R8BA 4BBRH 5CV8A 4FYDA 1CTMA 4ZKBB 3X3NA 2K75A 2KA7A 5IODA 4L5RC 2I0QA 2E2HH 3GO5A 3H15A 3MFGA 1A3VA 2QEXA 2ZM6L 1H95A 2YTYA 4WJ3M 1BCPB 3D31A 1O78A 5KEEA 5C44B 1VQDA 4FP5D 4X3KA 4HJAA 2ZXPA 3GQBA 3NE5B 4A3KB 4QY7A 2VNUD 2OTLA 1XJVA 2QA4A 2YV5A 4BBSG 2KCCA 1W6JA 2N49A 3KF6A 2PI2A 3TRZA 2F0PA 3JAML 1SLJA 2K14A 1HHVA 5FOBB 4IFDJ 2R3ZA 3HOVG 1SMXA 1B8AA 3VYUA 2NYZD 1K28A 4R1JA 3VA7A 3EA6A 3HOXG 2F3VA 4IOCA 4LF7Q 3W3AA 2CFMA 2NVYB 5LL6S 4O0AA 2B8FA 4M1UB 1KC8C 5M5XB 4K14A 4UHVA 1LTID 2HT1A 4YY3Q 2XTIA 2QDLA 1EY6A 1WCMB 3ULJA 4LK1C 2G5DA 3ITPA 4OX9Q 2XRSD 4R4OA 3G7LA 3U58A 3FEWX 1SNOA 3D4DA 1UE1A 2O5IC 1W6KA 1CKNA 3FKIH 2VQEL 5M5WB 2MQHA 3MXPA 3A7AB 2B2TC 1CSPA 4GOPC 5IOCA 1STBA 3VR2A 2ICEC 2JEAI 4A3BH 5HURA 2Z6BA 1VQFA 3H6MA 4DNIA 4PZ6A 4TRDA 1FNUA 2K4KA 3K5LA 2KCTA 2KENA 3BZCA 3P7JA 3KLSA 4A93B 4NP5A 2E2JB 4N9PA 1N33L 1T5XD 3I90A 5JEAH 2ZT9C 3H3VH 3IFTA 1L1OC 4HSVA 2B2VC 3K8AA 3H3VI 1L1OA 2HIXA 4NKLA 2QGQA 4DR2Q 2B2VA 1HNWQ 2WIIB 1E3PA 4CDCC 1X3PA 4DXFA 4ME5A 4KLKA 3CCMA 1AZQA 4IN3A 4HSPA 1J5EL 3C3LA 2UXBL 3NWSA 1BOSA 4J15A 1EYDA 4KHPL 3WOFA 4GLAC 4LFCL 3TREA 2UU9Q 4Y52H 4HMJA 1E1TA 3GTOH 1LLRD 4B3TQ 4RMFA 1N32L 4F87A 1N9WA 4RHRA 1PRTF 1SNCA 3EIVA 3CMAA 3C2PA 3P20A 4LAAA 2F03A 2K6AA 4A3FG 1LO5D 4LF9L 1R9TB 4X65Q 2O2LD 5IT9c 5C3WA 4WJWA 4FF1A 3HRZC 1PYSB 3R2IA 5M9OA 4GS3A 5D65A 3TEHB 4MTKA 1VQ6A 2DJGC 4HN7A 1E1OA 5C0XJ 3QOJA 5ELEA 3V05A 1LTBD 1CA5A 4JBJA 4DAPA 1K83B 2R93G 5IT9E 3AFPA 1U9RA 2AKWB 3KF8B 4ZAIA 3TZUA 3EVQA 1LV9A 1CHQD 1A3TA 3I91A 4IQZA 1PH8A 2L5TA 4JI0L 4L6TB 5KRUA 4DR3L 3EN2A 3M4OB 4H44C 2AWNA 4L5TA 1HNXQ 1LTLA 4IUTA 5BN4A 1U4PA 1J6QA 1V8QA 1HTPA 2C9OA 2ICIA 2FJ2A 3OWFA 4OXPA 1B7YB 3SE0A 1S5CD 4B3SQ 4JI3Q 2CW0C 2PQAB 4RWSC 5I6WA 4KN4C 4JI4Q 3TP6A 1PTOB 3Q24A 5JJLA 5CMDA 5C4JB 1XMOQ 2NN6H 4I7AA 2EZVA 3A5UA 3GTPH 1HQMC 2EYFA 3RR5A 1BNZA 5EPLA 4NW2A 1XXGA 4X3SA 4LWCA 2XIWA 3OYYA 3VDYA 3ERSX 3J81j 3VR3A 2D5DA 4OEMB 3HOYG 1S3OA 4X6AH 2JP1A 3RLFA 1YNXA 4CKEA 1PFBA 2CW0D 1K3RA 1HZCA 3F2DA 1YVCA 2L12A 1ML0D 4JI5Q 5IYBG 4OX9L 3S2DH 1ASYA 3KJOA 3E0EA 4A3DG 4O42A 3DEPA 1EIFA 3TQYA 2EPBA 1S5BD 3PO3B 1BR9A 1HXYD 3NUCA 1FYCA 2YTVA 5FLXL 2PCFB 1X3FA 4RGOS 4DV3Q 4XXEA 3TZDA 4JOIC 3CCJA 2K05A 4CKCA 1LTRD 1A2UA 4JOIA 2N55A 1H9SB 5C3EH 1BUVT 2IT1A 3D6CA 3ERQA 5CC4A 1K0RA 1WVLA 3GTMH 2EVBA 2KHJA 3H94A 3SEBA 3FKIB 2YTXA 3Q0AA 2K5VA 2PQAA 4BY7B 5LL6X 1B50A 2UUBQ 1EZ6A 2F0UA 4POGA 4BXXG 4IPCA 4A3BB 1HH2P 4A76A 2GN5A 5CV4A 1VQJA 3I7FA 3CQZH 4DR2L 1BBXC 1HNWL 4HCEA 3A0JA 2EJGC 1LT5D 3TP8A 4P71A 5IYDG 1WTXA 1DONA 1D1IA 3VYTA 3G6EA 4QGUA 2CWPA 1KAWA 1TIID 5ELNA 4QIWB 3G4SA 3K80C 4POFA 4QIWE 2E5LQ 1CK1A 3NBIA 1QNKA 4A3MB 2UU9L 3SVMA 2KEDA 1PYBA 1WCMG 4B3TL 1HFGA 1SNPA 4JI7L 1K8MA 3RLNA 4HTHA 1N36Q 3S17H 4DR7Q 3M4QA 5IYCH 3A54A 1RF2D 3S16B 2IPKD 4ZK9B 5IIFA 5IWAL 4DF7A 1GUTA 4JV5Q 1MD2D 2QILA 1TT2A 1VQEA 4EQOA 4FVMA 3OTOQ 4X65L 1SYBA 3DM1A 3HGBA 4IJHA 3MTSA 3M7GA 4CBVA 3GTOB 4F7XA 1T9HA 2ENBA 3SGIA 2R7ZB 2E76C 1PH2A 1K0SA 2EJFC 2LY7A 3J7AV 1G2SA 2CVRA 3QWNA 3I2ZA 1OXSC 3SK5A 1X55A 1MGSA 1GUSA 3NWTA 3I4NG 2WFWA 4A93G 3MAQA 1H9SA 1A62A 3JAMi 1N34Q 2RKSA 2DY7A 4OIKA 1STYA 1DZ1A 4CJ1B 4WFN3 2VUMB 4EQ5A 1T5EA 3FRPB 4X62Q 2O4XA 2I5MX 4R4CA 3ND9A 1E2WA 1SMYD 1HNXL 4LF5Q 1KIXA 2PMZB 4OO1G 1NAPA 5EBDA 1J8IA 1KXLA 4A3JB 2PMZE 3NTIA 4LW1A 1IKLA 1LTSD 5A2QL 4DV2Q 4B3SL 2V1CC 1NMFA 4EX5A 4KHVA 4JI4L 3A8IE 5K36H 4A3IG 5CBAE 3H3VC 1QVFA 1VQ9A 1C0AA 1KNAA 1BQQT 1SE3A 2PZUA 1JB3A 1XMOL 3NQIA 1Y8NB 3M7NA 1SYDA 3NTHA 1JWSD 4B08A 5C44H 4HIOA 2ZTEA 1Q81C 1KQSA 4ILWA 3C46A 1PZKD 3D8GA 4A3KH 4TSSA 1PRTB 5J39A 5ISRA 4NDXA 2MO0A 3PMFA 3E9HA 2HCIA 4QUFA 4LNQA 2MJ8A 2R7DA 1VMCA 5H1SE 1CZGA 2Q8RE 3WOEA 1M90C 1TVXA 3H91A 4E6IA 4JI5L 3T1YQ 2X6GA 1CT1D 3K58A 2NVYH 3MZ5A 4XT1B 2A68C 2MO1A 5M5XH 1QE6A 1PH4A 4P2CB 4YCUA 1QOHA 1G51A 3UDFA 2FHTA 3GTGB 4DV3L 4R9WA 4YHHQ 2RSOA 1IBMQ 3J81i 4A3EG 3MXUA 3TDQA 2M9VA 2K5NA 4OGQC 3RNUA 1GUGA 3URYA 5LMNQ 1WTRA 5M5WH 4G4KA 2R92B 4BBRG 3PV0A 4PNYA 5KNCA 4X66Q 4V190 1ZEQX 1LTTD 2PNRC 5K5PA 4WJ4A 3ZJYC 1QG7A 1SE8A 2KVMA 4LF8Q 1VQBA 2EYHA 2VB3X 3SK8A 2DJFC 2UUBL 2Z4HA 4HMIA 2K52A 2A68D 1O7ZA 1DXMA 1NTGA 4A4IA 5CBEE 2JA8B 4OWWB 3CC4A 5C3EB 5C5MA 2PZTA 3F2UA 4H13C 3WWVA 1MJEA 3OW7A 1VQLA 2E2JH 3I8ZA 5G3LD 1B4OA 1UNSA 4K2KA 5I9PA 2A69C 4LFBQ 2QEJC 2RA4A 1KLUD 1D5MC 1A3UA 4XQNA 4KY6A 4MZ9A 2EYPA 2E5LL 2NTTA 1A6XA 1PV4A 2P5ZX 1TXYA 2E2IH 1DOKA 1OXXK 1HZAA 1N36L 4IFDI 3OSOA 3DEOA 2JE6I 1EU3A 2QW7A 2JXMB 1SFOB 3MWYW 3A56A 1WFQA 4HJ8A 1O7YA 3D4RA 3KLWA 2OTJA 3OTOL 2NVXH 1UEBA 3QJYA 1SEBD 3STBD 1U4RA 1ZYRD 4JI1Q 1K8GA 1ENAA 1D8LA 3LX0A 5EAYA 4DK6C 4N8X1 5JJKA 4AYBB 1HR0L 4KK7A 2F0TA 4DUYQ 1RCVD 2F4VQ 2B2UA 1PH9A 3K81C 3UI2A 1HR0W 1A8VA 1AW7A 3SXHA 4NXNQ 4TVAB 2VQFQ 1FGUA 4LMQD 2WAQG 4PQXA 4IUPA 4U68A 3BVZA 1QVGA 3FKIG 4RAUC 3PCOB 3FDTA 1WTOA 1N34L 2FFKB 1SE2A 4ME3A 4BY7G 5I6YA 1LUZA 4X62L 3CPFA 1VQIA 5IGBA 2M2LA 1K83H 1NR2A 4A3BG 4LFAQ 4K0KQ 5GAEC 2K32A 1P16A 1NNXA 2F0WA 1B1ZA 4LF5L 1PXUA 2HQLA 1R4PB 1XWEA 4AH6A 4B3RL 3EFXD 1KRTA 2VB2X 3M4OH 3DUZA 1ILQA 5JEAG 2QDBA 3H0GH 3UDGA 2KCMA 1JJ2A 2NTSA 5EKIA 1HPCA 1I4RA 3KFUA 2Q8IB 1ET6A 4DU9A 1IL8A 4EQNA 4HIDA 2K03A 1IZ6A 3U4ZA 5A35A 4QL5A 2KCNA 4C1NI 3SDZA 5M3MH 1O7LA 1PTOH 4C3HB 2UUCQ 4HEDA 4PV1C 5C4JH 2F0LA 4QCLA 4HIMA 1RJTA 3F1ZA 1IBLL 4QUCA 1Y1VH 3JC66 4GN4B 1B9NA 2X69A 4TKOB 5KYLA 4UY8C 1II3A 1HTLD 1GVPA 3DM3A 3T1YL 3T4AC 3A55A 5EPKA 4XDXA 3EJIA 4GNXC 3E6ZX 3S14H 3GDEA 1U4MA 3NENA 2KUMA 3J7YW 4GNXA 1Q1BA 3VA5A 3NBHB 2VUMG 3J80L 4K6LA 5C0XH 1FR3A 3X3MA 3AU7A 2HHHL 4YHHL 4JVZA 3TBIB 5C0XI 1IBML 3DHQA 4DAYA 4NXMQ 3PO3H 2AWOA 3UDXA 3A8JE 1LTAD 4IPHA 1KDCA 2FXQA 3KDFB 5ELDA 3S15B 4X66L 3GTQH 1QCBD 1WTVA 2UXDQ 4PZ7A 4LF8L 2HDMA 1WTWA 1CZWA 2F1MA 1QJOA 3OIQA 4B9XA 1VQMA 1C8CA 1GO3E 3CW2C 1X9NA 2EE1A 3BU2A 3I55A 3M3YB 1STHA 2KECA 1HCZA 2PYKA 3MFYA 3ND8A 2ZXOA 4LFBL 4O1NA 4BY7H 1H9KA 1EY9A 3GD7A 2JA6H 3HKZG 1TWCB 1EZ8A 4C56C 3HZXA 4GLVB 2NN6G 1D1KA 2NWGA 1TS5A 2MUYA 5M5YB 3DWQA 1Z47A 2N78A 1BCPC 3HOWB 4GN5A 1MI2A 1OXTA 4CHTB 4J6HA 1GUNA 2Q8TA
chains in the Genus database with same CATH topology
2DGYA 3KJOA 1WJJA 3M85A 4DV5L 1W2BA 3E0EA 3K7UC 1BBWA 1LM0A 4A3MH 2HIVA 1WI5A 4C3JH 1ASZA 1JB7A 1EIFA 3TQYA 4DR1L 4JI1L 2IY5B 2JA5G 1NMGA 2EXDA 2DUDA 4LF6L 1GKHA 2F52A 4O2DA 4DV2L 4BY1G 1CKMA 1XMQL 3S16H 4X64Q 2YTVA 3CCUA 3CCVA 3CC7A 1E24A 2F4VL 1X3FA 5GADC 4DV3Q 5IY0A 1FJGQ 4PG3A 4JOIC 3CCJA 4A3MG 2BH8A 1A0IA 2Q2TA 4NXNL 4IJLA 3UE1A 4JOIA 2VQFL 2E8GA 2R92G 5C3EH 2NZOA 2IT1A 1HNZQ 4BXXH 1IBLQ 4L5QA 1K0RA 4YWKA 2JA7G 2R7ZH 1VQNA 2ZM6Q 3HKZE 1SN8A 2B63H 4P75A 2KHJA 2KHIA 2VZAA 3GTMH 3KJPA 4MNOA 1PVOA 2RCNA 4UP9A 5GAGC 2YTXA 3PUVA 4YCWA 3F2BA 1Y1WH 4LFAL 4K0KL 2UXCQ 3KOJA 5IYDH 2K5VA 2PQAA 5C3EG 1QZGA 3S1QH 4IPDA 2UUBQ 2B29A 1XPOA 2CKZB 4POGA 4BXXG 1TWAH 4IPCA 1VQ5A 2RHSB 1HH2P 1VQAA 4A76A 4NB3A 2GN5A 3GTLH 2Z0SA 2B3GA 4OWTB 2R7ZG 1GM5A 2JA9A 1VQJA 1UE6A 2B63G 3I7FA 2VUMH 3CQZH 2Q2IA 4DR2L 4IOAA 2NZHA 1HNWL 3I56A 1U0LA 1Y1WG 2A19A 3A0JA 1VQ7A 1WCMH 2HHHQ 4JI0Q 3CD6A 5IYDG 2OCEA 3IRBA 4P71A 1TWHH 4HJ9A 3G6EA 4DR3Q 5ELOA 3CP0A 4QGUA 4DUZQ 2CWPA 3HKSA 1KAWA 2L15A 4GOPB 5ELNA 3AEVA 4GKJL 3G4SA 1K8AC 5DLQE 3K80C 3UE0A 1WYDA 4POFA 1X65A 4A3JH 4QIWE 2E5LQ 4XIGS 3HOZH 1WOCA 1U5KA 5IP9H 2UU9L 3NELA 1FVIA 1RIPA 1XPRA 1PYBA 1WCMG 2OQKA 4B3TL 4JI7L 5IE8A 3RLNA 3S17H 1N36Q 2BA0A 3M4QA 4DR7Q 5IYCH 1QZHA 3J80c 5IWAL 3CC2A 1D7QA 2XGTA 1SRUA 2UUCL 4A3JG 4JV5Q 2I5HA 1VQEA 2AMCB 5IP9G 3HOZG 1V43A 3CAMA 3S1NH 4JI6Q 3OTOQ 4X65L 5LMNL 1L1OB 4YWMA 4DV6Q 4IJHA 4JBMA 1NE3A 3STBC 5IYCG 3I4NH 1YITA 3W1GA 2ALYB 3S2DH 4A93H 1T9HA 1K9MC 3SGIA 5LMNW 3ULLA 5AJ3Q 1YJWA 1PH2A 2Q2UA 2I5LX 2JK8A 1JT8A 4DAMA 4Y7NH 1JE5A 3I2ZA 1OXSC 1CSQA 1I94L 2ATWA 1CUKA 1X55A 4DK3C 1L2FA 1QUQB 3RN2A 1A63A 3RZDH 3I4NG 2WFWA 4DV0L 5M3FH 2ES2A 4JYAL 2VS1A 4A93G 2PNHA 1A62A 2K50A 4DR5L 3JAMi 1N34Q 1TWGH 2ZTCA 3F8TA 3U50C 5E7NA 2YU9H 2JEBI 4EQ5A 5C4XH 4X62Q 4OWXB 1KL9A 1Q46A 4APVA 1PH1A 1EYGA 2I5MX 1N33Q 4R4CA 4DV1Q 4OO1I 5FJ8H 1IXRA 1SR3A 1HNXL 5M3FG 2ZJPA 4LF5Q 1NY4A 1KIXA 4LF7L 3RZOH 1V9PA 3PUXA 2H5XA 4A3IH 2A8VA 4OO1G 1KXLA 2WB1E 1PH5A 2PMZE 1X6OA 3U4VA 4JBWA 3GTJH 4HIKA 2A1AA 3GTGH 5C4XG 4LW1A 3UDIA 4DKAC 2CCZA 1PHJA 4YY3L 4DV2Q 3AFQA 1VQGA 2V1CC 3L2PA 4B3SL 1Z9FA 1CKOA 2UXDL 1NMFA 4B3ML 1EQQA 3BZKA 4EX5A 3M9BA 3DLLA 1N32Q 3G48A 1EQRA 4JI4L 1J5EQ 2UXBQ 1R9TH 4GNXB 4A3IG 4JI8L 1JJGA 1QVFA 1VQ9A 1C0AA 1L0WA 4GOPA 4KHPQ 1NJIC 5BR8L 3KF6B 2Y0SG 1XMOL 1YZ6A 4LFCQ 3RN5A 2R92H 1X54A 3M7NA 2PI2E 3RLOA 3S24A 1EFWA 1I5FA 1YHBA 4BA1I 5C44H 3J7ZC 4DUYL 1RL2A 3KYHC 4XTCS 4HIOA 2ZTEA 4AQYL 1Q81C 1KQSA 1S72A 4IPGA 1XPUA 2JA7H 4BA2I 2R7FA 5K36G 1XNRQ 1M1KC 4DAYB 4A3KH 2BH2A 2C35B 3FHWA 1IBKQ 5FLXc 1Q7YC 2JA8H 2ZJRA 4QQBX 4A3CG 1UE7A 2MO0A 2ZTDA 4LUVA 5LMUQ 2N3SA 4LF9Q 2IX1A 5JJIA 1MIUA 3E9HA 5HY6A 5IP7H 1IYJB 2F3IA 4P72A 5C44G 3J81c 3F2CA 2R7DA 4A75A 1YI2A 3NEMA 4LNQA 5GROA 1V1QA 4R4TA 5H1SE 1S40A 2KBNA 5HGQA 2ASBA 3S2HH 4FDBA 4A3KG 3PIOA 1M90C 1VQCA 4DV4L 2IX0A 2CWAA 3FP9A 3KDFA 3I4MH 4JI5L 3T1YQ 2JA8G 4DV7L 2NVQH 1Q1EA 2LXKA 3AYHB 5IP7G 2JJQA 4UP7A 2NVTH 3GTKH 4PZ8A 4GKJQ 2NVYH 4A3EH 1CKNB 4HJ7A 1OXUA 1IL2A 1QUQA 2MO1A 5M5XH 1VQ8A 1YHAA 3PF5A 1YHQA 4JI2Q 1PH4A 1AE2A 2EIFA 3I4MG 1X3EA 4YCUA 1G51A 3UDFA 3HFZB 4MTNA 4X64L 1SFOH 3PGZA 4JI7Q 4DR6Q 4DV3L 1E22A 4YHHQ 1MJCA 1FJGL 3L7ZC 1IBMQ 4BBRH 5IWAQ 3J81i 3I4OA 4A3EG 4DR4Q 2K75A 4L5RC 2I0QA 1X56A 2K5NA 1NBWA 2E2HH 1HNZL 3GO5A 3MXNB 3H15A 1VQ4A 3RNUA 5LMNQ 3L0OA 2QEXA 2MFIA 5M5WH 2GVBA 3AQQA 2YTYA 4DPGA 2ZM6L 1H95A 4WJ3M 2AHOB 4BBSH 3D31A 4BBRG 3PV0A 4X66Q 4WJ4A 3TS2A 1VQDA 3S1RH 3PUZA 3ZJYC 2UXCL 1SE8A 4HJAA 1QVCA 4LF8Q 4YWLA 4GKKQ 1YBYA 1VQBA 3CPWA 2UUBL 2ZJQA 3HOVH 4QY7A 2K52A 4C3IH 4AYBG 1BKBA 2VNUD 2OTLA 2LSSA 2UUAQ 1NTGA 4A4IA 1XJVA 2RF4A 2YV5A 4JC0A 2QA4A 4OWWB 3CC4A 4BBSG 1G291 1Y14B 3HOXH 2N49A 3KF6A 2PI2A 3TRZA 3WWVA 1MJEA 4KHZA 1SLJA 2CQOA 2K14A 1VQLA 2E2JH 5GQOA 2MNAA 4LF4Q 4IFDJ 3T1HQ 4LFBQ 1TWFH 4OONA 1XTDA 3HOVG 1LYLA 1HJPA 1GD7A 1SMXA 1B8AA 1BVSA 1FL0A 4MZ9A 3HOWG 2E5LL 4R1JA 3HOXG 2K5HA 4R4IA 4IOCA 3J80i 4LF7Q 4RG1A 1BBUA 2CFMA 1TXYA 1PV4A 2E2IH 1OXVA 4O0AA 1OXXK 1O7IA 2VW9A 1HZAA 1KC8C 4C2MH 1N36L 4IFDI 2WP8J 2JE6I 2HT1A 4YY3Q 2XTIA 3ULJA 1WFQA 4HJ8A 2RHQB 4KI0A 4OX9Q 3KLWA 4UP8A 4DV5Q 4R4OA 3OTOL 1UEBA 2D62A 3U58A 2NVXH 4NXML 2OTJA 3STBD 3CXCA 1UE1A 4DR1Q 4JI1Q 4DV6L 1K8GA 1EUJA 1D8LA 1VQPA 1CKNA 2D0OA 5EAYA 4LF6Q 4DK6C 5JJKA 1HR0L 1XMQQ 3FKIH 2VQEL 3ULPA 3CCLA 2MQHA 4DUYQ 4JI3L 4AQYQ 5AJ3L 2F4VQ 1CSPA 4C3HH 1PH9A 4GOPC 1YEZA 2NN6I 3K81C 1HR0W 1PFSA 1A8VA 4A3BH 4NXNQ 2IHFA 2JEAI 1UE5A 1UWVA 4TVAB 1VQFA 2VQFQ 1FGUA 2WAQG 4PZ6A 4DNIA 1Q12A 2K4KA 4P73A 4A3CH 2Z6KC 3EBEA 1QVGA 3FKIG 3PCOB 5JEAJ 1N34L 1EOVA 2D0PA 4ME3A 2KCTA 2KENA 3BZCA 4R4QA 2Z6KA 4BY7G 2N8NA 1LUZA 4X62L 3CPFA 1VQIA 1N33L 1K83H 4DV1L 4A3BG 4LFAQ 4K0KQ 5GAEC 1P16A 4DV7Q 1SROA 4QJFA 1PH6A 4LF5L 3H3VH 2HQLA 1L1OC 1X3GA 3K8AA 2VL6A 4AH6A 3PUYA 3H3VI 4P74A 4B3RL 1L1OA 2HIXA 2QGQA 3B6YA 4DR2Q 1KRTA 3TS0A 1HNWQ 3CCSA 3M4OH 3MEFA 1E3PA 2IHEA 1G6PA 5JEAG 2OWOA 1VCIA 3H0GH 5J3BA 4KLKA 3CCMA 3UDGA 2KCMA 1J5EL 2UXBL 2ID0A 4J15A 1JJ2A 3Q8DA 2YYZA 4A3FH 4KHPL 1YJ9A 1AE3A 4GLAC 3KFUA 1VS0A 4LFCL 3TREA 2UU9Q 4A3DG 4Y52H 5FLMH 1E1TA 4HIDA 3GTOH 3D0FA 3S15H 1MKHA 3U4ZA 1IZ6A 3PF4A 1XNQL 4B3TQ 4RMFA 3H0GG 1N32L 3W5OA 1N9WA 4QL5A 4L5SA 1XNRL 3EIVA 4PMWA 3CMAA 1YJNA 1C7YA 5M3MH 2Y0SE 2WAQE 4LUZA 1JMCA 4A3FG 2UUCQ 1IBKL 3J7A5 4H02A 3K0XA 5C4JH 2R6GA 5FLMG 5LMUL 4LF9L 4HIMA 3M3YH 4X65Q 3F1ZA 5IT9c 2R93H 1JJCB 1IBLL 1EWIA 4ALPA 4UPAA 1Y1VH 1PYSB 3JC66 4GN4B 4GS3A 3TEHB 5M3MG 4UY8C 1VQ6A 4A3LH 1E1OA 1GVPA 3DM3A 1E7ZA 1Q8KA 1TWCH 5C0XJ 3T1YL 4JBKA 3S1MH 4GNXC 4JBJA 1HZBA 3S14H 1Q82C 3GDEA 2R93G 3AFPA 3A74A 1I94Q 2AKWB 3NENA 5M5YH 1Y1VG 2LXJA 3KF8B 1Q1BA 4GNXA 3NBHB 4LUOA 4DV0Q 1PH3A 2VUMG 3HOWH 3PIPA 4JYAQ 1I6HH 4JI2L 3CCEA 1I50H 3W1BA 1PA6A 1ASYA 4A3LG 4DR5Q 1PH8A 4JI0L 4DR6L 2HHHL 1N8RC 4YHHL 1KHIA 4DR3L 5C0XI 1IBML 3E9IA 2WB1G 3EN2A 4DUZL 1AH9A 5GAHC 3JAMc 2AWNA 1Q86C 4DR4L 4L5TA 1HNXQ 4NPSA 1LTLA 5C0XG 1I3QH 1J6QA 4NXMQ 3PO3H 4A3GH 2AWOA 3UDXA 4IPHA 2FXQA 4OXPA 4DR7L 1B7YB 2EQSA 3KDFB 1YIJA 4AIMA 3A5ZB 4X66L 3GTQH 1HR0Q 4IO9A 3ICEA 2VQEQ 3HOUH 1B70B 4B3SQ 4JI3Q 2UXDQ 2PQAB 4PZ7A 1P8LA 3CCQA 4B3MQ 2VY3A 4LF8L 1OTCA 4GKKL 4JV5L 1HZ9A 4IFDG 4JI4Q 3BJUA 3PO3G 4A3GG 4HJ5A 4JI6L 4YCVA 1VQMA 4JI8Q 3G71A 1GO3E 3CW2C 1X9NA 2UUAL 5JJLA 3BU2A 5BR8Q 1XMOQ 3I55A 3M4PA 1VQHA 2BA1A 3CCRA 3PSIA 3HOUG 3A5UA 1W3SA 2JQOA 3GTPH 3RR5A 4LF4L 3HOYH 3T1HL 4AYBE 4LFBL 3PO2H 1KD1C 4BY7H 3GD7A 4LWCA 2JA6H 4GLXA 3HKZG 3CMEA 2Q2HA 1DGSA 3OYYA 4JG2A 3CF5A 1PH7A 4GLVB 5IYBH 3VDYA 3ERSX 2NN6G 3K7AH 3LGJA 3J81j 1C9OA 4A3DH 4TQUS 1Z47A 2N78A 3OW2A 2OQ0A 3HOYG 1S3OA 3PUWA 4X6AH 3PO2G 4GN3B 4GN5A 1EIYB 3RLFA 2JA5H 1YNXA 1XNQQ 4B3RQ 1K3RA 1OXTA 1HZCA 1K73C 2JA6G 5FJ8G 3F2DA 4DV4Q 1YVCA 1KRSA 1VQKA 2GVAA 3ER0A 4BY1H 1VQOA 4JI5Q 5IYBG 4OX9L 4JCVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DGY A;  3KJO A;  1WJJ A;  3M85 A;  4DV5 L;  1W2B A;  3E0E A;  3K7U C;  1BBW A;  1LM0 A;  4A3M H;  2HIV A;  1WI5 A;  4C3J H;  1ASZ A;  1JB7 A;  1EIF A;  3TQY A;  4DR1 L;  4JI1 L;  2IY5 B;  2JA5 G;  1NMG A;  2EXD A;  2DUD A;  4LF6 L;  1GKH A;  2F52 A;  4O2D A;  4DV2 L;  4BY1 G;  1CKM A;  1XMQ L;  3S16 H;  4X64 Q;  2YTV A;  3CCU A;  3CCV A;  3CC7 A;  1E24 A;  2F4V L;  1X3F A;  5GAD C;  4DV3 Q;  5IY0 A;  1FJG Q;  4PG3 A;  4JOI C;  3CCJ A;  4A3M G;  2BH8 A;  1A0I A;  2Q2T A;  4NXN L;  4IJL A;  3UE1 A;  4JOI A;  2VQF L;  2E8G A;  2R92 G;  5C3E H;  2NZO A;  2IT1 A;  1HNZ Q;  4BXX H;  1IBL Q;  4L5Q A;  1K0R A;  4YWK A;  2JA7 G;  2R7Z H;  1VQN A;  2ZM6 Q;  3HKZ E;  1SN8 A;  2B63 H;  4P75 A;  2KHJ A;  2KHI A;  2VZA A;  3GTM H;  3KJP A;  4MNO A;  1PVO A;  2RCN A;  4UP9 A;  5GAG C;  2YTX A;  3PUV A;  4YCW A;  3F2B A;  1Y1W H;  4LFA L;  4K0K L;  2UXC Q;  3KOJ A;  5IYD H;  2K5V A;  2PQA A;  5C3E G;  1QZG A;  3S1Q H;  4IPD A;  2UUB Q;  2B29 A;  1XPO A;  2CKZ B;  4POG A;  4BXX G;  1TWA H;  4IPC A;  1VQ5 A;  2RHS B;  1HH2 P;  1VQA A;  4A76 A;  4NB3 A;  2GN5 A;  3GTL H;  2Z0S A;  2B3G A;  4OWT B;  2R7Z G;  1GM5 A;  2JA9 A;  1VQJ A;  1UE6 A;  2B63 G;  3I7F A;  2VUM H;  3CQZ H;  2Q2I A;  4DR2 L;  4IOA A;  2NZH A;  1HNW L;  3I56 A;  1U0L A;  1Y1W G;  2A19 A;  3A0J A;  1VQ7 A;  1WCM H;  2HHH Q;  4JI0 Q;  3CD6 A;  5IYD G;  2OCE A;  3IRB A;  4P71 A;  1TWH H;  4HJ9 A;  3G6E A;  4DR3 Q;  5ELO A;  3CP0 A;  4QGU A;  4DUZ Q;  2CWP A;  3HKS A;  1KAW A;  2L15 A;  4GOP B;  5ELN A;  3AEV A;  4GKJ L;  3G4S A;  1K8A C;  5DLQ E;  3K80 C;  3UE0 A;  1WYD A;  4POF A;  1X65 A;  4A3J H;  4QIW E;  2E5L Q;  4XIG S;  3HOZ H;  1WOC A;  1U5K A;  5IP9 H;  2UU9 L;  3NEL A;  1FVI A;  1RIP A;  1XPR A;  1PYB A;  1WCM G;  2OQK A;  4B3T L;  4JI7 L;  5IE8 A;  3RLN A;  3S17 H;  1N36 Q;  2BA0 A;  3M4Q A;  4DR7 Q;  5IYC H;  1QZH A;  3J80 c;  5IWA L;  3CC2 A;  1D7Q A;  2XGT A;  1SRU A;  2UUC L;  4A3J G;  4JV5 Q;  2I5H A;  1VQE A;  2AMC B;  5IP9 G;  3HOZ G;  1V43 A;  3CAM A;  3S1N H;  4JI6 Q;  3OTO Q;  4X65 L;  5LMN L;  1L1O B;  4YWM A;  4DV6 Q;  4IJH A;  4JBM A;  1NE3 A;  3STB C;  5IYC G;  3I4N H;  1YIT A;  3W1G A;  2ALY B;  3S2D H;  4A93 H;  1T9H A;  1K9M C;  3SGI A;  5LMN W;  3ULL A;  5AJ3 Q;  1YJW A;  1PH2 A;  2Q2U A;  2I5L X;  2JK8 A;  1JT8 A;  4DAM A;  4Y7N H;  1JE5 A;  3I2Z A;  1OXS C;  1CSQ A;  1I94 L;  2ATW A;  1CUK A;  1X55 A;  4DK3 C;  1L2F A;  1QUQ B;  3RN2 A;  1A63 A;  3RZD H;  3I4N G;  2WFW A;  4DV0 L;  5M3F H;  2ES2 A;  4JYA L;  2VS1 A;  4A93 G;  2PNH A;  1A62 A;  2K50 A;  4DR5 L;  3JAM i;  1N34 Q;  1TWG H;  2ZTC A;  3F8T A;  3U50 C;  5E7N A;  2YU9 H;  2JEB I;  4EQ5 A;  5C4X H;  4X62 Q;  4OWX B;  1KL9 A;  1Q46 A;  4APV A;  1PH1 A;  1EYG A;  2I5M X;  1N33 Q;  4R4C A;  4DV1 Q;  4OO1 I;  5FJ8 H;  1IXR A;  1SR3 A;  1HNX L;  5M3F G;  2ZJP A;  4LF5 Q;  1NY4 A;  1KIX A;  4LF7 L;  3RZO H;  1V9P A;  3PUX A;  2H5X A;  4A3I H;  2A8V A;  4OO1 G;  1KXL A;  2WB1 E;  1PH5 A;  2PMZ E;  1X6O A;  3U4V A;  4JBW A;  3GTJ H;  4HIK A;  2A1A A;  3GTG H;  5C4X G;  4LW1 A;  3UDI A;  4DKA C;  2CCZ A;  1PHJ A;  4YY3 L;  4DV2 Q;  3AFQ A;  1VQG A;  2V1C C;  3L2P A;  4B3S L;  1Z9F A;  1CKO A;  2UXD L;  1NMF A;  4B3M L;  1EQQ A;  3BZK A;  4EX5 A;  3M9B A;  3DLL A;  1N32 Q;  3G48 A;  1EQR A;  4JI4 L;  1J5E Q;  2UXB Q;  1R9T H;  4GNX B;  4A3I G;  4JI8 L;  1JJG A;  1QVF A;  1VQ9 A;  1C0A A;  1L0W A;  4GOP A;  4KHP Q;  1NJI C;  5BR8 L;  3KF6 B;  2Y0S G;  1XMO L;  1YZ6 A;  4LFC Q;  3RN5 A;  2R92 H;  1X54 A;  3M7N A;  2PI2 E;  3RLO A;  3S24 A;  1EFW A;  1I5F A;  1YHB A;  4BA1 I;  5C44 H;  3J7Z C;  4DUY L;  1RL2 A;  3KYH C;  4XTC S;  4HIO A;  2ZTE A;  4AQY L;  1Q81 C;  1KQS A;  1S72 A;  4IPG A;  1XPU A;  2JA7 H;  4BA2 I;  2R7F A;  5K36 G;  1XNR Q;  1M1K C;  4DAY B;  4A3K H;  2BH2 A;  2C35 B;  3FHW A;  1IBK Q;  5FLX c;  1Q7Y C;  2JA8 H;  2ZJR A;  4QQB X;  4A3C G;  1UE7 A;  2MO0 A;  2ZTD A;  4LUV A;  5LMU Q;  2N3S A;  4LF9 Q;  2IX1 A;  5JJI A;  1MIU A;  3E9H A;  5HY6 A;  5IP7 H;  1IYJ B;  2F3I A;  4P72 A;  5C44 G;  3J81 c;  3F2C A;  2R7D A;  4A75 A;  1YI2 A;  3NEM A;  4LNQ A;  5GRO A;  1V1Q A;  4R4T A;  5H1S E;  1S40 A;  2KBN A;  5HGQ A;  2ASB A;  3S2H H;  4FDB A;  4A3K G;  3PIO A;  1M90 C;  1VQC A;  4DV4 L;  2IX0 A;  2CWA A;  3FP9 A;  3KDF A;  3I4M H;  4JI5 L;  3T1Y Q;  2JA8 G;  4DV7 L;  2NVQ H;  1Q1E A;  2LXK A;  3AYH B;  5IP7 G;  2JJQ A;  4UP7 A;  2NVT H;  3GTK H;  4PZ8 A;  4GKJ Q;  2NVY H;  4A3E H;  1CKN B;  4HJ7 A;  1OXU A;  1IL2 A;  1QUQ A;  2MO1 A;  5M5X H;  1VQ8 A;  1YHA A;  3PF5 A;  1YHQ A;  4JI2 Q;  1PH4 A;  1AE2 A;  2EIF A;  3I4M G;  1X3E A;  4YCU A;  1G51 A;  3UDF A;  3HFZ B;  4MTN A;  4X64 L;  1SFO H;  3PGZ A;  4JI7 Q;  4DR6 Q;  4DV3 L;  1E22 A;  4YHH Q;  1MJC A;  1FJG L;  3L7Z C;  1IBM Q;  4BBR H;  5IWA Q;  3J81 i;  3I4O A;  4A3E G;  4DR4 Q;  2K75 A;  4L5R C;  2I0Q A;  1X56 A;  2K5N A;  1NBW A;  2E2H H;  1HNZ L;  3GO5 A;  3MXN B;  3H15 A;  1VQ4 A;  3RNU A;  5LMN Q;  3L0O A;  2QEX A;  2MFI A;  5M5W H;  2GVB A;  3AQQ A;  2YTY A;  4DPG A;  2ZM6 L;  1H95 A;  4WJ3 M;  2AHO B;  4BBS H;  3D31 A;  4BBR G;  3PV0 A;  4X66 Q;  4WJ4 A;  3TS2 A;  1VQD A;  3S1R H;  3PUZ A;  3ZJY C;  2UXC L;  1SE8 A;  4HJA A;  1QVC A;  4LF8 Q;  4YWL A;  4GKK Q;  1YBY A;  1VQB A;  3CPW A;  2UUB L;  2ZJQ A;  3HOV H;  4QY7 A;  2K52 A;  4C3I H;  4AYB G;  1BKB A;  2VNU D;  2OTL A;  2LSS A;  2UUA Q;  1NTG A;  4A4I A;  1XJV A;  2RF4 A;  2YV5 A;  4JC0 A;  2QA4 A;  4OWW B;  3CC4 A;  4BBS G;  1G29 1;  1Y14 B;  3HOX H;  2N49 A;  3KF6 A;  2PI2 A;  3TRZ A;  3WWV A;  1MJE A;  4KHZ A;  1SLJ A;  2CQO A;  2K14 A;  1VQL A;  2E2J H;  5GQO A;  2MNA A;  4LF4 Q;  4IFD J;  3T1H Q;  4LFB Q;  1TWF H;  4OON A;  1XTD A;  3HOV G;  1LYL A;  1HJP A;  1GD7 A;  1SMX A;  1B8A A;  1BVS A;  1FL0 A;  4MZ9 A;  3HOW G;  2E5L L;  4R1J A;  3HOX G;  2K5H A;  4R4I A;  4IOC A;  3J80 i;  4LF7 Q;  4RG1 A;  1BBU A;  2CFM A;  1TXY A;  1PV4 A;  2E2I H;  1OXV A;  4O0A A;  1OXX K;  1O7I A;  2VW9 A;  1HZA A;  1KC8 C;  4C2M H;  1N36 L;  4IFD I;  2WP8 J;  2JE6 I;  2HT1 A;  4YY3 Q;  2XTI A;  3ULJ A;  1WFQ A;  4HJ8 A;  2RHQ B;  4KI0 A;  4OX9 Q;  3KLW A;  4UP8 A;  4DV5 Q;  4R4O A;  3OTO L;  1UEB A;  2D62 A;  3U58 A;  2NVX H;  4NXM L;  2OTJ A;  3STB D;  3CXC A;  1UE1 A;  4DR1 Q;  4JI1 Q;  4DV6 L;  1K8G A;  1EUJ A;  1D8L A;  1VQP A;  1CKN A;  2D0O A;  5EAY A;  4LF6 Q;  4DK6 C;  5JJK A;  1HR0 L;  1XMQ Q;  3FKI H;  2VQE L;  3ULP A;  3CCL A;  2MQH A;  4DUY Q;  4JI3 L;  4AQY Q;  5AJ3 L;  2F4V Q;  1CSP A;  4C3H H;  1PH9 A;  4GOP C;  1YEZ A;  2NN6 I;  3K81 C;  1HR0 W;  1PFS A;  1A8V A;  4A3B H;  4NXN Q;  2IHF A;  2JEA I;  1UE5 A;  1UWV A;  4TVA B;  1VQF A;  2VQF Q;  1FGU A;  2WAQ G;  4PZ6 A;  4DNI A;  1Q12 A;  2K4K A;  4P73 A;  4A3C H;  2Z6K C;  3EBE A;  1QVG A;  3FKI G;  3PCO B;  5JEA J;  1N34 L;  1EOV A;  2D0P A;  4ME3 A;  2KCT A;  2KEN A;  3BZC A;  4R4Q A;  2Z6K A;  4BY7 G;  2N8N A;  1LUZ A;  4X62 L;  3CPF A;  1VQI A;  1N33 L;  1K83 H;  4DV1 L;  4A3B G;  4LFA Q;  4K0K Q;  5GAE C;  1P16 A;  4DV7 Q;  1SRO A;  4QJF A;  1PH6 A;  4LF5 L;  3H3V H;  2HQL A;  1L1O C;  1X3G A;  3K8A A;  2VL6 A;  4AH6 A;  3PUY A;  3H3V I;  4P74 A;  4B3R L;  1L1O A;  2HIX A;  2QGQ A;  3B6Y A;  4DR2 Q;  1KRT A;  3TS0 A;  1HNW Q;  3CCS A;  3M4O H;  3MEF A;  1E3P A;  2IHE A;  1G6P A;  5JEA G;  2OWO A;  1VCI A;  3H0G H;  5J3B A;  4KLK A;  3CCM A;  3UDG A;  2KCM A;  1J5E L;  2UXB L;  2ID0 A;  4J15 A;  1JJ2 A;  3Q8D A;  2YYZ A;  4A3F H;  4KHP L;  1YJ9 A;  1AE3 A;  4GLA C;  3KFU A;  1VS0 A;  4LFC L;  3TRE A;  2UU9 Q;  4A3D G;  4Y52 H;  5FLM H;  1E1T A;  4HID A;  3GTO H;  3D0F A;  3S15 H;  1MKH A;  3U4Z A;  1IZ6 A;  3PF4 A;  1XNQ L;  4B3T Q;  4RMF A;  3H0G G;  1N32 L;  3W5O A;  1N9W A;  4QL5 A;  4L5S A;  1XNR L;  3EIV A;  4PMW A;  3CMA A;  1YJN A;  1C7Y A;  5M3M H;  2Y0S E;  2WAQ E;  4LUZ A;  1JMC A;  4A3F G;  2UUC Q;  1IBK L;  3J7A 5;  4H02 A;  3K0X A;  5C4J H;  2R6G A;  5FLM G;  5LMU L;  4LF9 L;  4HIM A;  3M3Y H;  4X65 Q;  3F1Z A;  5IT9 c;  2R93 H;  1JJC B;  1IBL L;  1EWI A;  4ALP A;  4UPA A;  1Y1V H;  1PYS B;  3JC6 6;  4GN4 B;  4GS3 A;  3TEH B;  5M3M G;  4UY8 C;  1VQ6 A;  4A3L H;  1E1O A;  1GVP A;  3DM3 A;  1E7Z A;  1Q8K A;  1TWC H;  5C0X J;  3T1Y L;  4JBK A;  3S1M H;  4GNX C;  4JBJ A;  1HZB A;  3S14 H;  1Q82 C;  3GDE A;  2R93 G;  3AFP A;  3A74 A;  1I94 Q;  2AKW B;  3NEN A;  5M5Y H;  1Y1V G;  2LXJ A;  3KF8 B;  1Q1B A;  4GNX A;  3NBH B;  4LUO A;  4DV0 Q;  1PH3 A;  2VUM G;  3HOW H;  3PIP A;  4JYA Q;  1I6H H;  4JI2 L;  3CCE A;  1I50 H;  3W1B A;  1PA6 A;  1ASY A;  4A3L G;  4DR5 Q;  1PH8 A;  4JI0 L;  4DR6 L;  2HHH L;  1N8R C;  4YHH L;  1KHI A;  4DR3 L;  5C0X I;  1IBM L;  3E9I A;  2WB1 G;  3EN2 A;  4DUZ L;  1AH9 A;  5GAH C;  3JAM c;  2AWN A;  1Q86 C;  4DR4 L;  4L5T A;  1HNX Q;  4NPS A;  1LTL A;  5C0X G;  1I3Q H;  1J6Q A;  4NXM Q;  3PO3 H;  4A3G H;  2AWO A;  3UDX A;  4IPH A;  2FXQ A;  4OXP A;  4DR7 L;  1B7Y B;  2EQS A;  3KDF B;  1YIJ A;  4AIM A;  3A5Z B;  4X66 L;  3GTQ H;  1HR0 Q;  4IO9 A;  3ICE A;  2VQE Q;  3HOU H;  1B70 B;  4B3S Q;  4JI3 Q;  2UXD Q;  2PQA B;  4PZ7 A;  1P8L A;  3CCQ A;  4B3M Q;  2VY3 A;  4LF8 L;  1OTC A;  4GKK L;  4JV5 L;  1HZ9 A;  4IFD G;  4JI4 Q;  3BJU A;  3PO3 G;  4A3G G;  4HJ5 A;  4JI6 L;  4YCV A;  1VQM A;  4JI8 Q;  3G71 A;  1GO3 E;  3CW2 C;  1X9N A;  2UUA L;  5JJL A;  3BU2 A;  5BR8 Q;  1XMO Q;  3I55 A;  3M4P A;  1VQH A;  2BA1 A;  3CCR A;  3PSI A;  3HOU G;  3A5U A;  1W3S A;  2JQO A;  3GTP H;  3RR5 A;  4LF4 L;  3HOY H;  3T1H L;  4AYB E;  4LFB L;  3PO2 H;  1KD1 C;  4BY7 H;  3GD7 A;  4LWC A;  2JA6 H;  4GLX A;  3HKZ G;  3CME A;  2Q2H A;  1DGS A;  3OYY A;  4JG2 A;  3CF5 A;  1PH7 A;  4GLV B;  5IYB H;  3VDY A;  3ERS X;  2NN6 G;  3K7A H;  3LGJ A;  3J81 j;  1C9O A;  4A3D H;  4TQU S;  1Z47 A;  2N78 A;  3OW2 A;  2OQ0 A;  3HOY G;  1S3O A;  3PUW A;  4X6A H;  3PO2 G;  4GN3 B;  4GN5 A;  1EIY B;  3RLF A;  2JA5 H;  1YNX A;  1XNQ Q;  4B3R Q;  1K3R A;  1OXT A;  1HZC A;  1K73 C;  2JA6 G;  5FJ8 G;  3F2D A;  4DV4 Q;  1YVC A;  1KRS A;  1VQK A;  2GVA A;  3ER0 A;  4BY1 H;  1VQO A;  4JI5 Q;  5IYB G;  4OX9 L;  4JCV E; 
#chains in the Genus database with same CATH topology
 2EXZ A;  1WJJ A;  4WOR A;  3M85 A;  4A3M H;  1LM0 A;  1WI5 A;  4C3J H;  1TY0 A;  1JB7 A;  1TS2 A;  4JI1 L;  4KN7 C;  1I3Q B;  3NBH A;  2E2I B;  1GKH A;  4O2D A;  1UUP A;  4MHE A;  3S16 H;  4ZKC B;  2JSO A;  3CCU A;  3CCV A;  2F4V L;  3T16 A;  5IY0 A;  3J81 L;  2BH8 A;  1A0I A;  4EVO A;  4NXN L;  3GV6 A;  4IJL A;  1VMP A;  1EYA A;  2VQF L;  1B3Q A;  2R92 G;  1BCP D;  1WTH A;  1HNZ Q;  2NVX B;  4X3U A;  1FNW A;  2R7Z H;  1VQN A;  2MGS A;  1SN8 A;  2B63 H;  2VZA A;  2EYO A;  4UP9 A;  5F2D A;  3T51 B;  5GAG C;  3F2B A;  4LFA L;  4K0K L;  2UXC Q;  3PO2 B;  1DOM A;  1KTK A;  5C3E G;  1QZG A;  4IPD A;  1WD0 A;  2B29 A;  2F0D A;  2CKZ B;  1XPO A;  1M4V A;  1VQA A;  2B3G A;  2JA9 A;  3MXG A;  4RA8 A;  1UE6 A;  2VUM H;  4K5W A;  2XRQ D;  3I56 A;  5DEH A;  4DK0 A;  2CH4 A;  3KBG A;  2OCE A;  1Y8O B;  4MIU A;  2LKV A;  3CP0 A;  4DUZ Q;  3HKS A;  3AB9 A;  4GKJ L;  4C1N K;  1K8A C;  2A73 B;  3EQL C;  1WYD A;  3VYS A;  4A3J H;  1ONL A;  1NR4 A;  2RBM A;  4XIG S;  5IP9 H;  1MSH A;  1S5D D;  2F3W A;  4HR7 B;  2OQK A;  4Q5V A;  2BA0 A;  4FXK C;  1QZH A;  5EJW A;  1D7Q A;  2KEE A;  3RMH A;  2UUC L;  2I5H A;  3H0G B;  3HP3 A;  1JR0 D;  3CAM A;  5C5L A;  4JI6 Q;  4ZRZ A;  2RSN A;  1FNV A;  4YWM A;  4DV6 Q;  5IYC G;  3FVQ A;  4JW0 A;  3ULL A;  2X6L A;  3T53 B;  2Q2U A;  2I5L X;  2JK8 A;  1TQO A;  1XX8 A;  3TN2 A;  1JE5 A;  5M3M B;  1CSQ A;  5DM7 3;  2F0Q A;  1EY5 A;  2ATW A;  4DK3 C;  1ENF A;  1F9R A;  3U9S A;  5M3F H;  3K5O A;  1I4P A;  2A6H C;  5KIX A;  4IUQ A;  1Y1V B;  1DD2 A;  2YU9 H;  2JEB I;  4J8Q A;  5C4X H;  1PH1 A;  3K5N A;  2PQE A;  1ZXT A;  1EYG A;  1SYC A;  4ZYS A;  1TWH B;  2ZJP A;  1JCK B;  3CRL C;  2L1B A;  2WB1 B;  4LF7 L;  3S14 B;  1SNM A;  1V9P A;  2WB1 E;  2WKD A;  1VF5 C;  3GTG H;  3NK9 A;  1PHJ A;  4YY3 L;  3AFQ A;  2UXD L;  3L2P A;  2OT2 A;  3BZK A;  3DLL A;  2RDF A;  1F2M A;  2AQ2 B;  5I9O A;  3HEJ A;  2RVL A;  2MP1 A;  3S1N B;  3KF8 A;  2L0C A;  2K5D A;  3RN5 A;  2R92 H;  1X54 A;  4IAL A;  4KY5 A;  1I5F A;  4OIJ A;  1XNQ Q;  3J7Z C;  1RTO A;  3KYH C;  2L9H A;  2NBF A;  1XPU A;  2R61 A;  1EEI D;  3ONA B;  4KV6 A;  5K36 G;  1M1K C;  3GTQ B;  3L9A X;  2BH2 A;  4QF4 A;  2JA8 H;  2ZJR A;  2EY1 A;  3E5S A;  4QQB X;  4A3C G;  1UE7 A;  4LUV A;  2ZTD A;  5LMU Q;  2N3S A;  2IX1 A;  5HY6 A;  4A75 A;  2K5W A;  5C44 G;  1YI2 A;  4R4T A;  5JVH 3;  2KBN A;  1KDB A;  2V4D A;  4A3K G;  2K1B A;  3PIO A;  1V1P B;  1VQC A;  1DYQ A;  1TWG B;  3I4M H;  3HS0 C;  1CQF A;  1PTO C;  2F0V A;  3AYH B;  2JA6 B;  4CDD C;  1EWC A;  1PFN A;  1ENC A;  4ZQ3 A;  4HJ7 A;  2H4O A;  1YHA A;  3PF5 A;  3KK7 A;  1AE2 A;  1SFO H;  3PGZ A;  4DR6 Q;  1E22 A;  1MJC A;  2XNA C;  4ULL A;  5T1I A;  5IT9 L;  2HUG A;  3I4O A;  3FPP A;  2AUJ D;  4YIJ A;  4DR4 Q;  1IYU A;  2PPB C;  1X56 A;  3BDC A;  1NBW A;  1HNZ L;  4C3J B;  3MXN B;  1STE A;  1VQ4 A;  3OMC A;  1Z6H A;  3L0O A;  3AQQ A;  3BVG A;  2B2W C;  1L0X B;  4K2L A;  4U67 3;  4K5V A;  1PTO D;  3PUZ A;  2UXC L;  2JA7 B;  4JK1 C;  2B2W A;  2G9D A;  3D6W A;  4K8J A;  2K01 A;  2RDH A;  2IW3 A;  3VR4 A;  2EY6 A;  4C3I H;  1SND A;  2LSS A;  2RF4 A;  4JC0 A;  3ZYY X;  4BWG B;  2CQA A;  4FF2 A;  1G29 1;  1Q8I A;  2AUK A;  5C6A A;  5GQO A;  2MNA A;  4ZUI A;  3T1H Q;  4OON A;  2B63 B;  1EQT A;  1XTD A;  4K6D A;  3E3X A;  2NVQ B;  1FL0 A;  3HOW G;  3GP7 A;  2K5H A;  3J80 i;  5I4D A;  3GTK B;  2B8G A;  1GXD C;  2VW9 A;  3K57 A;  3HG9 A;  4XT3 B;  3M4Y A;  1V1P A;  2RHQ B;  4KI0 A;  1F2Y A;  3S9W A;  4WRD A;  4KMU C;  5E3F A;  3CKI B;  2D62 A;  3CXC A;  3U9O A;  1SYE A;  4DV6 L;  5JJZ A;  2D0O A;  1PMR A;  4ID6 A;  1G8Z D;  4JI3 L;  1F9Q A;  4AQY Q;  1GJX A;  4C3H H;  2FMM A;  3NSW A;  1S5F D;  3WDN A;  3S1R B;  1PFS A;  5I2Y A;  1UWV A;  1SYG A;  2RCF A;  4P73 A;  5L37 A;  4A3C H;  5HGT A;  3GV3 A;  4KJO A;  1EWH A;  3MXN A;  1S5E D;  3HOX B;  2F0F A;  2N8N A;  4RKB A;  1L0Y B;  1FD7 D;  2XSC A;  1TWF B;  4DV7 Q;  1SRO A;  1QWY A;  1X3G A;  2J4X A;  2FMC A;  2DY8 A;  2E75 C;  3PUY A;  5M3F B;  2F0S A;  4P74 A;  2IL8 A;  1SE4 A;  3CCS A;  2IHE A;  2YU9 B;  4C2M B;  1VCI A;  5T1G A;  3A7L A;  2I07 B;  5C4X B;  1UEA B;  2ID0 A;  1EY7 A;  2YYZ A;  4FO2 A;  1AE3 A;  1F9S A;  1I6V C;  1VS0 A;  4RFB A;  2F0H A;  5FLM H;  5COR A;  3D0F A;  3S15 H;  3PF4 A;  4F88 A;  5CV9 A;  1XNQ L;  3H0G G;  3I3C A;  2Y0S B;  2BE5 C;  4L5S A;  4PMW A;  1YJN A;  2Y0S E;  1JMC A;  1RTN A;  1YNJ C;  3NQT A;  1XYI A;  3J7A 5;  1RDP D;  3K0X A;  1CHP D;  4CDE C;  5LMU L;  4KTA A;  4CJ2 C;  3QIA A;  3M3Y H;  1JJC B;  1EWI A;  4ALP A;  3K6O A;  5M3M G;  2F0I A;  4A3L H;  1E7Z A;  1Q8K A;  1TWC H;  4JBK A;  2KOL A;  2WV6 D;  2A6E C;  2OEO A;  1HZB A;  1LAB A;  2XN9 C;  1IKM A;  3A74 A;  3N52 A;  2BDO A;  5M5Y H;  1Y1V G;  1SBB B;  2LXJ A;  4LUO A;  4DV0 Q;  3HOW H;  1KAB A;  4UAI A;  3PIP A;  3CCE A;  2BE5 D;  1MBY A;  3OPO A;  4DR6 L;  1JWU D;  1HUM A;  1KHI A;  1YNJ D;  3E9I A;  1PRT C;  2EY5 A;  2WB1 G;  3I4L A;  3I4M B;  1AH9 A;  3JAM c;  1CM9 A;  4DR4 L;  1B53 A;  3RD4 A;  2FIN B;  5C0X G;  4IFD H;  3SK4 A;  1I3Q H;  4A3G H;  3V2T A;  1X32 A;  1TKW B;  3TP5 A;  1BF4 A;  3D4W A;  4X3T A;  4DR7 L;  2EQS A;  1NUC A;  4RGT A;  3ICE A;  4IO9 A;  2VQE Q;  3HOU H;  2A6E D;  3MVV A;  1P8L A;  4QMG A;  5IGF A;  2VY3 A;  4K8I A;  2AQ3 B;  4B3M Q;  4JV5 L;  2H1E A;  3PO3 G;  4HJ5 A;  4YCV A;  4JI8 Q;  1JC7 A;  2DNE A;  1EU4 A;  2OXP A;  3C1F A;  5FO9 B;  3M4P A;  5BN5 A;  2B2U C;  3CCR A;  2R93 B;  2A69 D;  1W3S A;  2JQO A;  1PRT D;  3T1H L;  4AYB E;  3PO2 H;  4L63 B;  4KY7 A;  2CHB D;  1SAP A;  1PDQ A;  3CME A;  3S1M B;  4JG2 A;  3KUP A;  1EL0 A;  5IGG A;  2BCO A;  3LGJ A;  1C9O A;  4C3I B;  2QF7 A;  3BVM A;  3OW2 A;  3PUW A;  1EIY B;  2VXW A;  2JA5 H;  1I50 B;  2JA6 G;  1K73 C;  3L3O C;  4BY1 H;  2GVA A;  3A8K E;  3ER0 A;  4JPB W;  1PTO F;  5FO8 B;  1EY4 A;  1W2B A;  3K7U C;  1BBW A;  2HIV A;  5COY A;  1AFP A;  2PO4 A;  3QG1 A;  1NMG A;  2DUD A;  4DV2 L;  1CKM A;  4X64 Q;  3CC7 A;  1E24 A;  1GHK A;  1FJG Q;  4PG3 A;  4A3M G;  4C3J G;  2Q2T A;  4KD4 A;  1TU2 B;  3C1E A;  2E8G A;  2EJM A;  2SEB D;  4XQQ A;  2JYO A;  2NZO A;  5CV6 A;  4IUU A;  4L5Q A;  4YWK A;  4FF3 A;  2JA7 G;  4RGN A;  1QIL A;  1EY0 A;  2AQ1 B;  4FXG C;  1DCZ A;  2KHI A;  4ABN A;  1PVO A;  3P1H A;  1Y1W H;  2B2Y C;  1ICW A;  1TWA H;  2L4N A;  1VQ5 A;  3GTL H;  2RHS B;  3IFD A;  2R7Z G;  3VR5 A;  2Z0S A;  2B2Y A;  3OOC A;  1ESR A;  3K7A B;  2B63 G;  3PIO 3;  2Q2I A;  4A3D B;  2A19 A;  3IAY A;  1VQ7 A;  4JI0 Q;  3K5M A;  4RHS A;  3CD6 A;  1TWH H;  4HJ9 A;  4DR3 Q;  4N9T A;  4RH6 A;  2Z4I A;  4OHJ A;  2L15 A;  4GOP B;  4IUR A;  1TS4 A;  2F0N A;  2KJX A;  1LT4 D;  2EOT A;  3KBX A;  3HOZ H;  1JIC A;  3NEL A;  3E0J A;  1XPR A;  1B3A A;  1A2T A;  5E1F A;  5EQ0 A;  2HCC A;  2F0E A;  1KAA A;  2XGT A;  5EPJ A;  1SRU A;  4A3J G;  1CA6 A;  2AMC B;  4IUN A;  5IP9 G;  3S1N H;  4DFA A;  1HFN A;  5LMN L;  1L1O B;  3VR6 A;  1NE3 A;  2G9H D;  2ALY B;  4G7O C;  2L55 A;  5DM6 3;  5LMN W;  5AJ3 Q;  5BN3 A;  1M8A A;  1Y8P B;  1JT8 A;  3LWU A;  4DAM A;  2K5Q A;  3DWA A;  4G57 A;  3BYY B;  1CUK A;  1L2F A;  1IHZ A;  1QUQ B;  1BO0 A;  3RN2 A;  3RZD H;  3S1Q B;  4DV0 L;  3R93 A;  2ES2 A;  1STA A;  4NMZ A;  1TWG H;  3U50 C;  3QOL A;  1I4G A;  1HUN A;  2IWH A;  2Z9H A;  3T56 B;  4I65 A;  1ICF B;  4DV1 Q;  3N6R A;  4BS9 A;  5M3F G;  4MN3 A;  1EY8 A;  5EKL A;  1D6E C;  1NY4 A;  3OWE B;  5KNB A;  2H5X A;  4KKT A;  2A8V A;  1PH5 A;  4DGZ A;  1X6O A;  3GTJ H;  2A1A A;  5C4X G;  3UDI A;  4DKA C;  1J9O A;  3V96 A;  1JJG A;  1CKO A;  4B3M L;  1V1O A;  2DN8 A;  3M9B A;  2A5H A;  1D2B A;  1EQR A;  1C48 A;  4JI8 L;  2B2T A;  2IJ0 A;  1I4X A;  3MC0 B;  4GOP A;  4RCO A;  4G7Z C;  2Y0S G;  3QR8 A;  1YZ6 A;  1IW7 C;  4A3G B;  3LNN A;  3RLO A;  1CQV A;  1EFW A;  4DUY L;  3I4N B;  2JA7 H;  5JPN C;  4BA2 I;  4IPG A;  5G3L F;  2EY2 A;  1XNR Q;  1JOK A;  3HOU B;  3OHX C;  5C4Z A;  2XWB B;  1GHJ A;  2C35 B;  3FHW A;  1IBK Q;  5FLX c;  4Y7N B;  1Q7Y C;  5KND A;  2QCP X;  1MIU A;  2Z1C A;  5IP7 H;  1IYJ B;  2OF1 A;  5NUC A;  3NEM A;  1STG A;  3TME A;  1V1Q A;  3S2H H;  2D9U A;  5HGQ A;  1GUO A;  2O5J C;  1ROD A;  2XWJ B;  2IX0 A;  3FP9 A;  3KDF A;  1MHW C;  2JA8 G;  5FLX E;  2NVQ H;  2J0T D;  4DNR B;  2ZXR A;  2LXK A;  3GTK H;  2JJQ A;  4PZ8 A;  2IX3 A;  1E2Z A;  3O13 A;  1IW7 D;  1OXU A;  4UDU C;  1QUQ A;  4ZLT F;  1EOT A;  2DNC A;  3FPU B;  3RZO B;  4JI2 Q;  3I73 A;  4A3I B;  3I4M G;  1X3E A;  5ELC A;  4X64 L;  3HFZ B;  4RCN A;  4QB4 A;  4JI7 Q;  3Q22 A;  2JA5 B;  2C5C A;  1JQY D;  1FJG L;  1ESF A;  1STN A;  3L7Z C;  4ODG A;  4BY1 B;  5IWA Q;  3SK6 A;  3BG3 A;  4KKS A;  1G91 A;  1JE4 A;  2RDG A;  2MFI A;  2GVB A;  4DPG A;  2AHO B;  5CV5 A;  4BBS H;  5IGC A;  1E2V A;  3TS2 A;  2B39 A;  4DXG A;  3LWE A;  3S1R H;  4DNT B;  5IGD A;  1FGB D;  1QVC A;  4YWL A;  4GKK Q;  1YBY A;  3IL8 A;  3CPW A;  2ZJQ A;  3HOV H;  5JAV A;  4AYB G;  1BKB A;  4XYQ A;  3FMC A;  2UUA Q;  1LT3 D;  2K04 A;  1Q3L A;  3HOX H;  1Y14 B;  4KHZ A;  2CQO A;  2BOS A;  4LF4 Q;  1TWF H;  5IGE A;  1KDA A;  1LYL A;  1HJP A;  4C3I G;  1GD7 A;  3PQI A;  1H9J A;  1Y1W B;  1AZP A;  1BVS A;  3DXJ C;  3BDL A;  3NP8 A;  4R4I A;  2E2D C;  3PIP 3;  2NVT B;  4RG1 A;  1TWA B;  1BBU A;  4A3E B;  3GTL B;  1OXV A;  4CKB A;  1O7I A;  3G6J B;  4C2M H;  2WP8 J;  4F8M A;  3MEH A;  2CH4 W;  4HCS A;  1D5X C;  1TY2 A;  4KJN A;  4BBR B;  3CHB D;  3ERO A;  4UP8 A;  4DV5 Q;  4NXM L;  4DR1 Q;  4H7B A;  1EUJ A;  4CDF C;  1VQP A;  3HOZ B;  2E2H B;  2EYL A;  4LF6 Q;  4ZCK A;  2F0G A;  3NTK A;  4FXD A;  2F0J A;  1XMQ Q;  3ULP A;  3CCL A;  4EQP A;  5AJ3 L;  1PZI D;  5JPM C;  1YEZ A;  2NN6 I;  2PZW A;  1NCV A;  2IHF A;  4CGY B;  4IZ8 A;  1UE5 A;  5J22 A;  2A6H D;  2SNS A;  1Q12 A;  1K3B C;  2Z6K C;  3EBE A;  5JEA J;  1LT6 D;  2HQE A;  1EOV A;  2D0P A;  2KHS A;  4C3H G;  4GZY C;  4R4Q A;  3CU7 A;  2Z6K A;  2HD3 A;  1G2T A;  5A2Q E;  4DV1 L;  1O80 A;  5ELF A;  4FNF A;  2NB0 A;  4QJF A;  3TP7 A;  1PH6 A;  1F2Z A;  2MHV A;  1LAC A;  1Z7T A;  4HAE A;  3RZD B;  2VL6 A;  5KYI A;  3B6Y A;  3TS0 A;  4EGV A;  3MEF A;  1G6P A;  1NSN S;  2OWO A;  1CI3 M;  5J3B A;  2EDG A;  5EKK A;  3Q8D A;  2WIN B;  4A3F H;  1YJ9 A;  1Y69 U;  1U4L A;  5CGK A;  3VYR A;  4J1M A;  4IUV A;  1MKH A;  2XVS A;  3GTJ B;  2WKC A;  1PLF A;  3W5O A;  2WAQ B;  3RUZ A;  1EIH A;  1XNR L;  1B2T A;  1C7Y A;  1PFM A;  3P75 A;  4LUZ A;  2WAQ E;  1HA6 A;  1IBK L;  4H02 A;  1JOO A;  2R6G A;  5FLM G;  3DMU A;  4R8N A;  2R93 H;  1ZKO A;  4UPA A;  3NHH A;  2KQ3 A;  1I4H A;  3S1M H;  1H9R A;  2L11 A;  1Q82 C;  1I94 Q;  3DWP A;  1PH3 A;  1I6H H;  4JYA Q;  4JI2 L;  1I50 H;  1LTG D;  3W1B A;  1PA6 A;  4A3L G;  4DR5 Q;  3S2H B;  1N8R C;  2SOB A;  4I7Z C;  2JN4 A;  2WAC A;  3T13 A;  4DUZ L;  5GAH C;  1Q86 C;  4DAV A;  4NPS A;  2GA4 B;  1TS3 A;  4L8J A;  1F77 A;  1SMY C;  3D3R A;  1KLG D;  1EEF D;  4R8I A;  1BCP F;  3Q23 A;  3SR1 A;  1YIJ A;  1OO9 B;  4AIM A;  3A5Z B;  4N8F A;  1HR0 Q;  1BDO A;  2SDF A;  1B70 B;  2D2C C;  4RGM A;  3CCQ A;  4GKK L;  1OTC A;  4PMC A;  1HZ9 A;  4K5X A;  4IFD G;  1WD1 A;  3BJU A;  4A3G G;  4JI6 L;  1S4Z A;  1VDZ A;  1AEX A;  3G71 A;  2UUA L;  1EYC A;  2LFN A;  5FKA C;  5BR8 Q;  5I2X A;  1VQH A;  2BA1 A;  4XYO A;  3PSI A;  3HOU G;  1SNQ A;  5CYU A;  4LF4 L;  3HOY H;  1PYW D;  4BBS B;  1KD1 C;  1SJH D;  4GLX A;  1ET9 A;  5AFW A;  2Q2H A;  1DGS A;  3OIP A;  5DAU A;  3CF5 A;  1PH7 A;  5IYB H;  3K7A H;  3HOV B;  1A15 A;  1BXT A;  1K8O A;  4A3D H;  4TQU S;  2EYM A;  2OQ0 A;  2F0K A;  3BYT B;  4GN3 B;  3Q6S A;  3PO2 G;  4B3R Q;  5CV7 A;  3K59 A;  2LS0 1;  5C3X A;  5FJ8 G;  4DV4 Q;  1VQK A;  1KRS A;  2J7Z A;  1VQO A;  1UAP A;  3BDO A;  4JCV E;  2DGY A;  4DV5 L;  1G6Z A;  2QKI C;  1ASZ A;  1B9M A;  4DR1 L;  2IY5 B;  5J1Z A;  2JA5 G;  2EXD A;  2K33 A;  4LF6 L;  1PZJ D;  2F52 A;  4BY1 G;  1XMQ L;  5JOB A;  5GAD C;  1GOZ A;  4KKU A;  4OL7 A;  2PW5 A;  4DN4 M;  1SSO A;  1WTQ A;  5JVG 3;  4DA2 A;  1RKN A;  3QB3 A;  3UE1 A;  4M8A A;  4V0B A;  4XQJ A;  4BXX H;  2TMP A;  3HKZ B;  1IBL Q;  2ZM6 Q;  3W2D A;  3HKZ E;  4P75 A;  1ILP A;  3KJP A;  4MNO A;  2RCN A;  4LJZ C;  3GTP B;  3KLS X;  1E0B A;  1QNU A;  2M00 A;  3PUV A;  4YCW A;  3KOJ A;  4KD3 A;  1JOQ A;  2MPM A;  5IYD H;  3S1Q H;  1TR5 A;  1CFM A;  4DK1 A;  5D14 A;  4NB3 A;  4OWT B;  4PMB A;  1HQR D;  1GM5 A;  1B44 D;  5EGT A;  1KNE A;  4IOA A;  2NZH A;  3SHL A;  1U0L A;  2HDL A;  1SJE D;  3QO2 A;  1Y1W G;  1WCM H;  2HHH Q;  1YNN C;  3R2T A;  1VF7 A;  2I46 A;  3IRB A;  5LHY 1;  1XTC D;  1IYV A;  5ELO A;  5E4X A;  5EBC A;  3AEV A;  1HRJ A;  1F2L A;  5DLQ E;  3UE0 A;  3S2D B;  1X65 A;  5KGU A;  1AN8 A;  1WOC A;  1U5K A;  1FVI A;  5C4H A;  1RIP A;  5D3I B;  5IE8 A;  3I70 A;  5TSS A;  2K28 A;  3J80 c;  1JOR A;  3CC2 A;  3HOZ G;  1V43 A;  4H0L C;  3KLR A;  4A3F B;  2TSS A;  4JBM A;  1RHP A;  3STB C;  3I4N H;  5E4W C;  1YIT A;  1ZYR C;  3W1G A;  3J80 E;  4A93 H;  1YNN D;  1K9M C;  3NPP A;  3JAM E;  1YJW A;  4Z9C B;  3GTM B;  3BZD B;  4Y7N H;  1HA5 A;  1RD9 D;  1X3Q A;  1I94 L;  1A63 A;  1R4Q B;  3MA2 B;  4JYA L;  2VS1 A;  2PNH A;  4DR5 L;  2K50 A;  5D3D A;  1Q90 A;  4Q0F A;  2ZTC A;  3F8T A;  4OO1 H;  5E7N A;  1SYF A;  3CQZ B;  2BDN A;  4OWX B;  1KL9 A;  1Q46 A;  4APV A;  1DM0 B;  3BS1 A;  1N33 Q;  4OO1 I;  5FJ8 H;  1C4Q A;  1IXR A;  1D5Z C;  1SR3 A;  4FF4 A;  4B9W A;  3MHB A;  3OMG A;  5DNF A;  5FK9 C;  4ZUJ A;  3RZO H;  3PUX A;  4A3I H;  3U4V A;  4JBW A;  4HIK A;  1I6H B;  3J7A F;  1F9P A;  2CCZ A;  1I4Q A;  1DJR D;  3CRK C;  1AP0 A;  1EIG A;  1VQG A;  2Z8L A;  1Z9F A;  1EQQ A;  3S17 B;  1WTP A;  4OEL B;  1SDF A;  2SNM A;  3G48 A;  4CJ0 B;  1H9M A;  3K0Y A;  1J5E Q;  2UXB Q;  4RKL A;  1DOL A;  1R9T H;  4GNX B;  2PW7 A;  1L0W A;  4KHP Q;  1NJI C;  5BR8 L;  3KF6 B;  4LFC Q;  3AMU A;  2PI2 E;  3S24 A;  1EQV A;  1YHB A;  4BA1 I;  4AQY L;  1RL2 A;  1QB5 D;  4XTC S;  3TSS A;  2F4I A;  1N32 Q;  1S72 A;  2N88 A;  2R7F A;  4DAY B;  2EYJ A;  2F0M A;  4LF9 Q;  5JJI A;  3F2C A;  2F3I A;  4P72 A;  3J81 c;  2K7V A;  5ELB A;  5GRO A;  1S40 A;  2NUC A;  2ASB A;  1EFI D;  4FDB A;  1GUW A;  3I72 A;  4S3S A;  3H09 A;  4DV4 L;  2CWA A;  3HOY B;  3R3O A;  2LMC B;  2E74 C;  5CR3 A;  4G7H C;  4DV7 L;  3IKJ A;  2F0O A;  1Q1E A;  3NXW A;  5IP7 G;  2NVT H;  4UP7 A;  4GKJ Q;  4A3E H;  2RQX A;  3J81 E;  1CKN B;  5FO7 B;  1IL2 A;  1JWM D;  1SXT A;  1VQ8 A;  1YHQ A;  1MSG A;  2EIF A;  2NZ1 D;  4MTN A;  2A74 C;  3R8B A;  4BBR H;  5CV8 A;  4FYD A;  1CTM A;  4ZKB B;  3X3N A;  2K75 A;  2KA7 A;  5IOD A;  4L5R C;  2I0Q A;  2E2H H;  3GO5 A;  3H15 A;  3MFG A;  1A3V A;  2QEX A;  2ZM6 L;  1H95 A;  2YTY A;  4WJ3 M;  1BCP B;  3D31 A;  1O78 A;  5KEE A;  5C44 B;  1VQD A;  4FP5 D;  4X3K A;  4HJA A;  2ZXP A;  3GQB A;  3NE5 B;  4A3K B;  4QY7 A;  2VNU D;  2OTL A;  1XJV A;  2QA4 A;  2YV5 A;  4BBS G;  2KCC A;  1W6J A;  2N49 A;  3KF6 A;  2PI2 A;  3TRZ A;  2F0P A;  3JAM L;  1SLJ A;  2K14 A;  1HHV A;  5FOB B;  4IFD J;  2R3Z A;  3HOV G;  1SMX A;  1B8A A;  3VYU A;  2NYZ D;  1K28 A;  4R1J A;  3VA7 A;  3EA6 A;  3HOX G;  2F3V A;  4IOC A;  4LF7 Q;  3W3A A;  2CFM A;  2NVY B;  5LL6 S;  4O0A A;  2B8F A;  4M1U B;  1KC8 C;  5M5X B;  4K14 A;  4UHV A;  1LTI D;  2HT1 A;  4YY3 Q;  2XTI A;  2QDL A;  1EY6 A;  1WCM B;  3ULJ A;  4LK1 C;  2G5D A;  3ITP A;  4OX9 Q;  2XRS D;  4R4O A;  3G7L A;  3U58 A;  3FEW X;  1SNO A;  3D4D A;  1UE1 A;  2O5I C;  1W6K A;  1CKN A;  3FKI H;  2VQE L;  5M5W B;  2MQH A;  3MXP A;  3A7A B;  2B2T C;  1CSP A;  4GOP C;  5IOC A;  1STB A;  3VR2 A;  2ICE C;  2JEA I;  4A3B H;  5HUR A;  2Z6B A;  1VQF A;  3H6M A;  4DNI A;  4PZ6 A;  4TRD A;  1FNU A;  2K4K A;  3K5L A;  2KCT A;  2KEN A;  3BZC A;  3P7J A;  3KLS A;  4A93 B;  4NP5 A;  2E2J B;  4N9P A;  1N33 L;  1T5X D;  3I90 A;  5JEA H;  2ZT9 C;  3H3V H;  3IFT A;  1L1O C;  4HSV A;  2B2V C;  3K8A A;  3H3V I;  1L1O A;  2HIX A;  4NKL A;  2QGQ A;  4DR2 Q;  2B2V A;  1HNW Q;  2WII B;  1E3P A;  4CDC C;  1X3P A;  4DXF A;  4ME5 A;  4KLK A;  3CCM A;  1AZQ A;  4IN3 A;  4HSP A;  1J5E L;  3C3L A;  2UXB L;  3NWS A;  1BOS A;  4J15 A;  1EYD A;  4KHP L;  3WOF A;  4GLA C;  4LFC L;  3TRE A;  2UU9 Q;  4Y52 H;  4HMJ A;  1E1T A;  3GTO H;  1LLR D;  4B3T Q;  4RMF A;  1N32 L;  4F87 A;  1N9W A;  4RHR A;  1PRT F;  1SNC A;  3EIV A;  3CMA A;  3C2P A;  3P20 A;  4LAA A;  2F03 A;  2K6A A;  4A3F G;  1LO5 D;  4LF9 L;  1R9T B;  4X65 Q;  2O2L D;  5IT9 c;  5C3W A;  4WJW A;  4FF1 A;  3HRZ C;  1PYS B;  3R2I A;  5M9O A;  4GS3 A;  5D65 A;  3TEH B;  4MTK A;  1VQ6 A;  2DJG C;  4HN7 A;  1E1O A;  5C0X J;  3QOJ A;  5ELE A;  3V05 A;  1LTB D;  1CA5 A;  4JBJ A;  4DAP A;  1K83 B;  2R93 G;  5IT9 E;  3AFP A;  1U9R A;  2AKW B;  3KF8 B;  4ZAI A;  3TZU A;  3EVQ A;  1LV9 A;  1CHQ D;  1A3T A;  3I91 A;  4IQZ A;  1PH8 A;  2L5T A;  4JI0 L;  4L6T B;  5KRU A;  4DR3 L;  3EN2 A;  3M4O B;  4H44 C;  2AWN A;  4L5T A;  1HNX Q;  1LTL A;  4IUT A;  5BN4 A;  1U4P A;  1J6Q A;  1V8Q A;  1HTP A;  2C9O A;  2ICI A;  2FJ2 A;  3OWF A;  4OXP A;  1B7Y B;  3SE0 A;  1S5C D;  4B3S Q;  4JI3 Q;  2CW0 C;  2PQA B;  4RWS C;  5I6W A;  4KN4 C;  4JI4 Q;  3TP6 A;  1PTO B;  3Q24 A;  5JJL A;  5CMD A;  5C4J B;  1XMO Q;  2NN6 H;  4I7A A;  2EZV A;  3A5U A;  3GTP H;  1HQM C;  2EYF A;  3RR5 A;  1BNZ A;  5EPL A;  4NW2 A;  1XXG A;  4X3S A;  4LWC A;  2XIW A;  3OYY A;  3VDY A;  3ERS X;  3J81 j;  3VR3 A;  2D5D A;  4OEM B;  3HOY G;  1S3O A;  4X6A H;  2JP1 A;  3RLF A;  1YNX A;  4CKE A;  1PFB A;  2CW0 D;  1K3R A;  1HZC A;  3F2D A;  1YVC A;  2L12 A;  1ML0 D;  4JI5 Q;  5IYB G;  4OX9 L;  3S2D H;  1ASY A;  3KJO A;  3E0E A;  4A3D G;  4O42 A;  3DEP A;  1EIF A;  3TQY A;  2EPB A;  1S5B D;  3PO3 B;  1BR9 A;  1HXY D;  3NUC A;  1FYC A;  2YTV A;  5FLX L;  2PCF B;  1X3F A;  4RGO S;  4DV3 Q;  4XXE A;  3TZD A;  4JOI C;  3CCJ A;  2K05 A;  4CKC A;  1LTR D;  1A2U A;  4JOI A;  2N55 A;  1H9S B;  5C3E H;  1BUV T;  2IT1 A;  3D6C A;  3ERQ A;  5CC4 A;  1K0R A;  1WVL A;  3GTM H;  2EVB A;  2KHJ A;  3H94 A;  3SEB A;  3FKI B;  2YTX A;  3Q0A A;  2K5V A;  2PQA A;  4BY7 B;  5LL6 X;  1B50 A;  2UUB Q;  1EZ6 A;  2F0U A;  4POG A;  4BXX G;  4IPC A;  4A3B B;  1HH2 P;  4A76 A;  2GN5 A;  5CV4 A;  1VQJ A;  3I7F A;  3CQZ H;  4DR2 L;  1BBX C;  1HNW L;  4HCE A;  3A0J A;  2EJG C;  1LT5 D;  3TP8 A;  4P71 A;  5IYD G;  1WTX A;  1DON A;  1D1I A;  3VYT A;  3G6E A;  4QGU A;  2CWP A;  1KAW A;  1TII D;  5ELN A;  4QIW B;  3G4S A;  3K80 C;  4POF A;  4QIW E;  2E5L Q;  1CK1 A;  3NBI A;  1QNK A;  4A3M B;  2UU9 L;  3SVM A;  2KED A;  1PYB A;  1WCM G;  4B3T L;  1HFG A;  1SNP A;  4JI7 L;  1K8M A;  3RLN A;  4HTH A;  1N36 Q;  3S17 H;  4DR7 Q;  3M4Q A;  5IYC H;  3A54 A;  1RF2 D;  3S16 B;  2IPK D;  4ZK9 B;  5IIF A;  5IWA L;  4DF7 A;  1GUT A;  4JV5 Q;  1MD2 D;  2QIL A;  1TT2 A;  1VQE A;  4EQO A;  4FVM A;  3OTO Q;  4X65 L;  1SYB A;  3DM1 A;  3HGB A;  4IJH A;  3MTS A;  3M7G A;  4CBV A;  3GTO B;  4F7X A;  1T9H A;  2ENB A;  3SGI A;  2R7Z B;  2E76 C;  1PH2 A;  1K0S A;  2EJF C;  2LY7 A;  3J7A V;  1G2S A;  2CVR A;  3QWN A;  3I2Z A;  1OXS C;  3SK5 A;  1X55 A;  1MGS A;  1GUS A;  3NWT A;  3I4N G;  2WFW A;  4A93 G;  3MAQ A;  1H9S A;  1A62 A;  3JAM i;  1N34 Q;  2RKS A;  2DY7 A;  4OIK A;  1STY A;  1DZ1 A;  4CJ1 B;  4WFN 3;  2VUM B;  4EQ5 A;  1T5E A;  3FRP B;  4X62 Q;  2O4X A;  2I5M X;  4R4C A;  3ND9 A;  1E2W A;  1SMY D;  1HNX L;  4LF5 Q;  1KIX A;  2PMZ B;  4OO1 G;  1NAP A;  5EBD A;  1J8I A;  1KXL A;  4A3J B;  2PMZ E;  3NTI A;  4LW1 A;  1IKL A;  1LTS D;  5A2Q L;  4DV2 Q;  4B3S L;  2V1C C;  1NMF A;  4EX5 A;  4KHV A;  4JI4 L;  3A8I E;  5K36 H;  4A3I G;  5CBA E;  3H3V C;  1QVF A;  1VQ9 A;  1C0A A;  1KNA A;  1BQQ T;  1SE3 A;  2PZU A;  1JB3 A;  1XMO L;  3NQI A;  1Y8N B;  3M7N A;  1SYD A;  3NTH A;  1JWS D;  4B08 A;  5C44 H;  4HIO A;  2ZTE A;  1Q81 C;  1KQS A;  4ILW A;  3C46 A;  1PZK D;  3D8G A;  4A3K H;  4TSS A;  1PRT B;  5J39 A;  5ISR A;  4NDX A;  2MO0 A;  3PMF A;  3E9H A;  2HCI A;  4QUF A;  4LNQ A;  2MJ8 A;  2R7D A;  1VMC A;  5H1S E;  1CZG A;  2Q8R E;  3WOE A;  1M90 C;  1TVX A;  3H91 A;  4E6I A;  4JI5 L;  3T1Y Q;  2X6G A;  1CT1 D;  3K58 A;  2NVY H;  3MZ5 A;  4XT1 B;  2A68 C;  2MO1 A;  5M5X H;  1QE6 A;  1PH4 A;  4P2C B;  4YCU A;  1QOH A;  1G51 A;  3UDF A;  2FHT A;  3GTG B;  4DV3 L;  4R9W A;  4YHH Q;  2RSO A;  1IBM Q;  3J81 i;  4A3E G;  3MXU A;  3TDQ A;  2M9V A;  2K5N A;  4OGQ C;  3RNU A;  1GUG A;  3URY A;  5LMN Q;  1WTR A;  5M5W H;  4G4K A;  2R92 B;  4BBR G;  3PV0 A;  4PNY A;  5KNC A;  4X66 Q;  4V19 0;  1ZEQ X;  1LTT D;  2PNR C;  5K5P A;  4WJ4 A;  3ZJY C;  1QG7 A;  1SE8 A;  2KVM A;  4LF8 Q;  1VQB A;  2EYH A;  2VB3 X;  3SK8 A;  2DJF C;  2UUB L;  2Z4H A;  4HMI A;  2K52 A;  2A68 D;  1O7Z A;  1DXM A;  1NTG A;  4A4I A;  5CBE E;  2JA8 B;  4OWW B;  3CC4 A;  5C3E B;  5C5M A;  2PZT A;  3F2U A;  4H13 C;  3WWV A;  1MJE A;  3OW7 A;  1VQL A;  2E2J H;  3I8Z A;  5G3L D;  1B4O A;  1UNS A;  4K2K A;  5I9P A;  2A69 C;  4LFB Q;  2QEJ C;  2RA4 A;  1KLU D;  1D5M C;  1A3U A;  4XQN A;  4KY6 A;  4MZ9 A;  2EYP A;  2E5L L;  2NTT A;  1A6X A;  1PV4 A;  2P5Z X;  1TXY A;  2E2I H;  1DOK A;  1OXX K;  1HZA A;  1N36 L;  4IFD I;  3OSO A;  3DEO A;  2JE6 I;  1EU3 A;  2QW7 A;  2JXM B;  1SFO B;  3MWY W;  3A56 A;  1WFQ A;  4HJ8 A;  1O7Y A;  3D4R A;  3KLW A;  2OTJ A;  3OTO L;  2NVX H;  1UEB A;  3QJY A;  1SEB D;  3STB D;  1U4R A;  1ZYR D;  4JI1 Q;  1K8G A;  1ENA A;  1D8L A;  3LX0 A;  5EAY A;  4DK6 C;  4N8X 1;  5JJK A;  4AYB B;  1HR0 L;  4KK7 A;  2F0T A;  4DUY Q;  1RCV D;  2F4V Q;  2B2U A;  1PH9 A;  3K81 C;  3UI2 A;  1HR0 W;  1A8V A;  1AW7 A;  3SXH A;  4NXN Q;  4TVA B;  2VQF Q;  1FGU A;  4LMQ D;  2WAQ G;  4PQX A;  4IUP A;  4U68 A;  3BVZ A;  1QVG A;  3FKI G;  4RAU C;  3PCO B;  3FDT A;  1WTO A;  1N34 L;  2FFK B;  1SE2 A;  4ME3 A;  4BY7 G;  5I6Y A;  1LUZ A;  4X62 L;  3CPF A;  1VQI A;  5IGB A;  2M2L A;  1K83 H;  1NR2 A;  4A3B G;  4LFA Q;  4K0K Q;  5GAE C;  2K32 A;  1P16 A;  1NNX A;  2F0W A;  1B1Z A;  4LF5 L;  1PXU A;  2HQL A;  1R4P B;  1XWE A;  4AH6 A;  4B3R L;  3EFX D;  1KRT A;  2VB2 X;  3M4O H;  3DUZ A;  1ILQ A;  5JEA G;  2QDB A;  3H0G H;  3UDG A;  2KCM A;  1JJ2 A;  2NTS A;  5EKI A;  1HPC A;  1I4R A;  3KFU A;  2Q8I B;  1ET6 A;  4DU9 A;  1IL8 A;  4EQN A;  4HID A;  2K03 A;  1IZ6 A;  3U4Z A;  5A35 A;  4QL5 A;  2KCN A;  4C1N I;  3SDZ A;  5M3M H;  1O7L A;  1PTO H;  4C3H B;  2UUC Q;  4HED A;  4PV1 C;  5C4J H;  2F0L A;  4QCL A;  4HIM A;  1RJT A;  3F1Z A;  1IBL L;  4QUC A;  1Y1V H;  3JC6 6;  4GN4 B;  1B9N A;  2X69 A;  4TKO B;  5KYL A;  4UY8 C;  1II3 A;  1HTL D;  1GVP A;  3DM3 A;  3T1Y L;  3T4A C;  3A55 A;  5EPK A;  4XDX A;  3EJI A;  4GNX C;  3E6Z X;  3S14 H;  3GDE A;  1U4M A;  3NEN A;  2KUM A;  3J7Y W;  4GNX A;  1Q1B A;  3VA5 A;  3NBH B;  2VUM G;  3J80 L;  4K6L A;  5C0X H;  1FR3 A;  3X3M A;  3AU7 A;  2HHH L;  4YHH L;  4JVZ A;  3TBI B;  5C0X I;  1IBM L;  3DHQ A;  4DAY A;  4NXM Q;  3PO3 H;  2AWO A;  3UDX A;  3A8J E;  1LTA D;  4IPH A;  1KDC A;  2FXQ A;  3KDF B;  5ELD A;  3S15 B;  4X66 L;  3GTQ H;  1QCB D;  1WTV A;  2UXD Q;  4PZ7 A;  4LF8 L;  2HDM A;  1WTW A;  1CZW A;  2F1M A;  1QJO A;  3OIQ A;  4B9X A;  1VQM A;  1C8C A;  1GO3 E;  3CW2 C;  1X9N A;  2EE1 A;  3BU2 A;  3I55 A;  3M3Y B;  1STH A;  2KEC A;  1HCZ A;  2PYK A;  3MFY A;  3ND8 A;  2ZXO A;  4LFB L;  4O1N A;  4BY7 H;  1H9K A;  1EY9 A;  3GD7 A;  2JA6 H;  3HKZ G;  1TWC B;  1EZ8 A;  4C56 C;  3HZX A;  4GLV B;  2NN6 G;  1D1K A;  2NWG A;  1TS5 A;  2MUY A;  5M5Y B;  3DWQ A;  1Z47 A;  2N78 A;  1BCP C;  3HOW B;  4GN5 A;  1MI2 A;  1OXT A;  4CHT B;  4J6H A;  1GUN A;  2Q8T A; 
#chains in the Genus database with same CATH homology
 2DGY A;  3KJO A;  1WJJ A;  3M85 A;  4DV5 L;  1W2B A;  3E0E A;  3K7U C;  1BBW A;  1LM0 A;  4A3M H;  2HIV A;  1WI5 A;  4C3J H;  1ASZ A;  1JB7 A;  1EIF A;  3TQY A;  4DR1 L;  4JI1 L;  2IY5 B;  2JA5 G;  1NMG A;  2EXD A;  2DUD A;  4LF6 L;  1GKH A;  2F52 A;  4O2D A;  4DV2 L;  4BY1 G;  1CKM A;  1XMQ L;  3S16 H;  4X64 Q;  2YTV A;  3CCU A;  3CCV A;  3CC7 A;  1E24 A;  2F4V L;  1X3F A;  5GAD C;  4DV3 Q;  5IY0 A;  1FJG Q;  4PG3 A;  4JOI C;  3CCJ A;  4A3M G;  2BH8 A;  1A0I A;  2Q2T A;  4NXN L;  4IJL A;  3UE1 A;  4JOI A;  2VQF L;  2E8G A;  2R92 G;  5C3E H;  2NZO A;  2IT1 A;  1HNZ Q;  4BXX H;  1IBL Q;  4L5Q A;  1K0R A;  4YWK A;  2JA7 G;  2R7Z H;  1VQN A;  2ZM6 Q;  3HKZ E;  1SN8 A;  2B63 H;  4P75 A;  2KHJ A;  2KHI A;  2VZA A;  3GTM H;  3KJP A;  4MNO A;  1PVO A;  2RCN A;  4UP9 A;  5GAG C;  2YTX A;  3PUV A;  4YCW A;  3F2B A;  1Y1W H;  4LFA L;  4K0K L;  2UXC Q;  3KOJ A;  5IYD H;  2K5V A;  2PQA A;  5C3E G;  1QZG A;  3S1Q H;  4IPD A;  2UUB Q;  2B29 A;  1XPO A;  2CKZ B;  4POG A;  4BXX G;  1TWA H;  4IPC A;  1VQ5 A;  2RHS B;  1HH2 P;  1VQA A;  4A76 A;  4NB3 A;  2GN5 A;  3GTL H;  2Z0S A;  2B3G A;  4OWT B;  2R7Z G;  1GM5 A;  2JA9 A;  1VQJ A;  1UE6 A;  2B63 G;  3I7F A;  2VUM H;  3CQZ H;  2Q2I A;  4DR2 L;  4IOA A;  2NZH A;  1HNW L;  3I56 A;  1U0L A;  1Y1W G;  2A19 A;  3A0J A;  1VQ7 A;  1WCM H;  2HHH Q;  4JI0 Q;  3CD6 A;  5IYD G;  2OCE A;  3IRB A;  4P71 A;  1TWH H;  4HJ9 A;  3G6E A;  4DR3 Q;  5ELO A;  3CP0 A;  4QGU A;  4DUZ Q;  2CWP A;  3HKS A;  1KAW A;  2L15 A;  4GOP B;  5ELN A;  3AEV A;  4GKJ L;  3G4S A;  1K8A C;  5DLQ E;  3K80 C;  3UE0 A;  1WYD A;  4POF A;  1X65 A;  4A3J H;  4QIW E;  2E5L Q;  4XIG S;  3HOZ H;  1WOC A;  1U5K A;  5IP9 H;  2UU9 L;  3NEL A;  1FVI A;  1RIP A;  1XPR A;  1PYB A;  1WCM G;  2OQK A;  4B3T L;  4JI7 L;  5IE8 A;  3RLN A;  3S17 H;  1N36 Q;  2BA0 A;  3M4Q A;  4DR7 Q;  5IYC H;  1QZH A;  3J80 c;  5IWA L;  3CC2 A;  1D7Q A;  2XGT A;  1SRU A;  2UUC L;  4A3J G;  4JV5 Q;  2I5H A;  1VQE A;  2AMC B;  5IP9 G;  3HOZ G;  1V43 A;  3CAM A;  3S1N H;  4JI6 Q;  3OTO Q;  4X65 L;  5LMN L;  1L1O B;  4YWM A;  4DV6 Q;  4IJH A;  4JBM A;  1NE3 A;  3STB C;  5IYC G;  3I4N H;  1YIT A;  3W1G A;  2ALY B;  3S2D H;  4A93 H;  1T9H A;  1K9M C;  3SGI A;  5LMN W;  3ULL A;  5AJ3 Q;  1YJW A;  1PH2 A;  2Q2U A;  2I5L X;  2JK8 A;  1JT8 A;  4DAM A;  4Y7N H;  1JE5 A;  3I2Z A;  1OXS C;  1CSQ A;  1I94 L;  2ATW A;  1CUK A;  1X55 A;  4DK3 C;  1L2F A;  1QUQ B;  3RN2 A;  1A63 A;  3RZD H;  3I4N G;  2WFW A;  4DV0 L;  5M3F H;  2ES2 A;  4JYA L;  2VS1 A;  4A93 G;  2PNH A;  1A62 A;  2K50 A;  4DR5 L;  3JAM i;  1N34 Q;  1TWG H;  2ZTC A;  3F8T A;  3U50 C;  5E7N A;  2YU9 H;  2JEB I;  4EQ5 A;  5C4X H;  4X62 Q;  4OWX B;  1KL9 A;  1Q46 A;  4APV A;  1PH1 A;  1EYG A;  2I5M X;  1N33 Q;  4R4C A;  4DV1 Q;  4OO1 I;  5FJ8 H;  1IXR A;  1SR3 A;  1HNX L;  5M3F G;  2ZJP A;  4LF5 Q;  1NY4 A;  1KIX A;  4LF7 L;  3RZO H;  1V9P A;  3PUX A;  2H5X A;  4A3I H;  2A8V A;  4OO1 G;  1KXL A;  2WB1 E;  1PH5 A;  2PMZ E;  1X6O A;  3U4V A;  4JBW A;  3GTJ H;  4HIK A;  2A1A A;  3GTG H;  5C4X G;  4LW1 A;  3UDI A;  4DKA C;  2CCZ A;  1PHJ A;  4YY3 L;  4DV2 Q;  3AFQ A;  1VQG A;  2V1C C;  3L2P A;  4B3S L;  1Z9F A;  1CKO A;  2UXD L;  1NMF A;  4B3M L;  1EQQ A;  3BZK A;  4EX5 A;  3M9B A;  3DLL A;  1N32 Q;  3G48 A;  1EQR A;  4JI4 L;  1J5E Q;  2UXB Q;  1R9T H;  4GNX B;  4A3I G;  4JI8 L;  1JJG A;  1QVF A;  1VQ9 A;  1C0A A;  1L0W A;  4GOP A;  4KHP Q;  1NJI C;  5BR8 L;  3KF6 B;  2Y0S G;  1XMO L;  1YZ6 A;  4LFC Q;  3RN5 A;  2R92 H;  1X54 A;  3M7N A;  2PI2 E;  3RLO A;  3S24 A;  1EFW A;  1I5F A;  1YHB A;  4BA1 I;  5C44 H;  3J7Z C;  4DUY L;  1RL2 A;  3KYH C;  4XTC S;  4HIO A;  2ZTE A;  4AQY L;  1Q81 C;  1KQS A;  1S72 A;  4IPG A;  1XPU A;  2JA7 H;  4BA2 I;  2R7F A;  5K36 G;  1XNR Q;  1M1K C;  4DAY B;  4A3K H;  2BH2 A;  2C35 B;  3FHW A;  1IBK Q;  5FLX c;  1Q7Y C;  2JA8 H;  2ZJR A;  4QQB X;  4A3C G;  1UE7 A;  2MO0 A;  2ZTD A;  4LUV A;  5LMU Q;  2N3S A;  4LF9 Q;  2IX1 A;  5JJI A;  1MIU A;  3E9H A;  5HY6 A;  5IP7 H;  1IYJ B;  2F3I A;  4P72 A;  5C44 G;  3J81 c;  3F2C A;  2R7D A;  4A75 A;  1YI2 A;  3NEM A;  4LNQ A;  5GRO A;  1V1Q A;  4R4T A;  5H1S E;  1S40 A;  2KBN A;  5HGQ A;  2ASB A;  3S2H H;  4FDB A;  4A3K G;  3PIO A;  1M90 C;  1VQC A;  4DV4 L;  2IX0 A;  2CWA A;  3FP9 A;  3KDF A;  3I4M H;  4JI5 L;  3T1Y Q;  2JA8 G;  4DV7 L;  2NVQ H;  1Q1E A;  2LXK A;  3AYH B;  5IP7 G;  2JJQ A;  4UP7 A;  2NVT H;  3GTK H;  4PZ8 A;  4GKJ Q;  2NVY H;  4A3E H;  1CKN B;  4HJ7 A;  1OXU A;  1IL2 A;  1QUQ A;  2MO1 A;  5M5X H;  1VQ8 A;  1YHA A;  3PF5 A;  1YHQ A;  4JI2 Q;  1PH4 A;  1AE2 A;  2EIF A;  3I4M G;  1X3E A;  4YCU A;  1G51 A;  3UDF A;  3HFZ B;  4MTN A;  4X64 L;  1SFO H;  3PGZ A;  4JI7 Q;  4DR6 Q;  4DV3 L;  1E22 A;  4YHH Q;  1MJC A;  1FJG L;  3L7Z C;  1IBM Q;  4BBR H;  5IWA Q;  3J81 i;  3I4O A;  4A3E G;  4DR4 Q;  2K75 A;  4L5R C;  2I0Q A;  1X56 A;  2K5N A;  1NBW A;  2E2H H;  1HNZ L;  3GO5 A;  3MXN B;  3H15 A;  1VQ4 A;  3RNU A;  5LMN Q;  3L0O A;  2QEX A;  2MFI A;  5M5W H;  2GVB A;  3AQQ A;  2YTY A;  4DPG A;  2ZM6 L;  1H95 A;  4WJ3 M;  2AHO B;  4BBS H;  3D31 A;  4BBR G;  3PV0 A;  4X66 Q;  4WJ4 A;  3TS2 A;  1VQD A;  3S1R H;  3PUZ A;  3ZJY C;  2UXC L;  1SE8 A;  4HJA A;  1QVC A;  4LF8 Q;  4YWL A;  4GKK Q;  1YBY A;  1VQB A;  3CPW A;  2UUB L;  2ZJQ A;  3HOV H;  4QY7 A;  2K52 A;  4C3I H;  4AYB G;  1BKB A;  2VNU D;  2OTL A;  2LSS A;  2UUA Q;  1NTG A;  4A4I A;  1XJV A;  2RF4 A;  2YV5 A;  4JC0 A;  2QA4 A;  4OWW B;  3CC4 A;  4BBS G;  1G29 1;  1Y14 B;  3HOX H;  2N49 A;  3KF6 A;  2PI2 A;  3TRZ A;  3WWV A;  1MJE A;  4KHZ A;  1SLJ A;  2CQO A;  2K14 A;  1VQL A;  2E2J H;  5GQO A;  2MNA A;  4LF4 Q;  4IFD J;  3T1H Q;  4LFB Q;  1TWF H;  4OON A;  1XTD A;  3HOV G;  1LYL A;  1HJP A;  1GD7 A;  1SMX A;  1B8A A;  1BVS A;  1FL0 A;  4MZ9 A;  3HOW G;  2E5L L;  4R1J A;  3HOX G;  2K5H A;  4R4I A;  4IOC A;  3J80 i;  4LF7 Q;  4RG1 A;  1BBU A;  2CFM A;  1TXY A;  1PV4 A;  2E2I H;  1OXV A;  4O0A A;  1OXX K;  1O7I A;  2VW9 A;  1HZA A;  1KC8 C;  4C2M H;  1N36 L;  4IFD I;  2WP8 J;  2JE6 I;  2HT1 A;  4YY3 Q;  2XTI A;  3ULJ A;  1WFQ A;  4HJ8 A;  2RHQ B;  4KI0 A;  4OX9 Q;  3KLW A;  4UP8 A;  4DV5 Q;  4R4O A;  3OTO L;  1UEB A;  2D62 A;  3U58 A;  2NVX H;  4NXM L;  2OTJ A;  3STB D;  3CXC A;  1UE1 A;  4DR1 Q;  4JI1 Q;  4DV6 L;  1K8G A;  1EUJ A;  1D8L A;  1VQP A;  1CKN A;  2D0O A;  5EAY A;  4LF6 Q;  4DK6 C;  5JJK A;  1HR0 L;  1XMQ Q;  3FKI H;  2VQE L;  3ULP A;  3CCL A;  2MQH A;  4DUY Q;  4JI3 L;  4AQY Q;  5AJ3 L;  2F4V Q;  1CSP A;  4C3H H;  1PH9 A;  4GOP C;  1YEZ A;  2NN6 I;  3K81 C;  1HR0 W;  1PFS A;  1A8V A;  4A3B H;  4NXN Q;  2IHF A;  2JEA I;  1UE5 A;  1UWV A;  4TVA B;  1VQF A;  2VQF Q;  1FGU A;  2WAQ G;  4PZ6 A;  4DNI A;  1Q12 A;  2K4K A;  4P73 A;  4A3C H;  2Z6K C;  3EBE A;  1QVG A;  3FKI G;  3PCO B;  5JEA J;  1N34 L;  1EOV A;  2D0P A;  4ME3 A;  2KCT A;  2KEN A;  3BZC A;  4R4Q A;  2Z6K A;  4BY7 G;  2N8N A;  1LUZ A;  4X62 L;  3CPF A;  1VQI A;  1N33 L;  1K83 H;  4DV1 L;  4A3B G;  4LFA Q;  4K0K Q;  5GAE C;  1P16 A;  4DV7 Q;  1SRO A;  4QJF A;  1PH6 A;  4LF5 L;  3H3V H;  2HQL A;  1L1O C;  1X3G A;  3K8A A;  2VL6 A;  4AH6 A;  3PUY A;  3H3V I;  4P74 A;  4B3R L;  1L1O A;  2HIX A;  2QGQ A;  3B6Y A;  4DR2 Q;  1KRT A;  3TS0 A;  1HNW Q;  3CCS A;  3M4O H;  3MEF A;  1E3P A;  2IHE A;  1G6P A;  5JEA G;  2OWO A;  1VCI A;  3H0G H;  5J3B A;  4KLK A;  3CCM A;  3UDG A;  2KCM A;  1J5E L;  2UXB L;  2ID0 A;  4J15 A;  1JJ2 A;  3Q8D A;  2YYZ A;  4A3F H;  4KHP L;  1YJ9 A;  1AE3 A;  4GLA C;  3KFU A;  1VS0 A;  4LFC L;  3TRE A;  2UU9 Q;  4A3D G;  4Y52 H;  5FLM H;  1E1T A;  4HID A;  3GTO H;  3D0F A;  3S15 H;  1MKH A;  3U4Z A;  1IZ6 A;  3PF4 A;  1XNQ L;  4B3T Q;  4RMF A;  3H0G G;  1N32 L;  3W5O A;  1N9W A;  4QL5 A;  4L5S A;  1XNR L;  3EIV A;  4PMW A;  3CMA A;  1YJN A;  1C7Y A;  5M3M H;  2Y0S E;  2WAQ E;  4LUZ A;  1JMC A;  4A3F G;  2UUC Q;  1IBK L;  3J7A 5;  4H02 A;  3K0X A;  5C4J H;  2R6G A;  5FLM G;  5LMU L;  4LF9 L;  4HIM A;  3M3Y H;  4X65 Q;  3F1Z A;  5IT9 c;  2R93 H;  1JJC B;  1IBL L;  1EWI A;  4ALP A;  4UPA A;  1Y1V H;  1PYS B;  3JC6 6;  4GN4 B;  4GS3 A;  3TEH B;  5M3M G;  4UY8 C;  1VQ6 A;  4A3L H;  1E1O A;  1GVP A;  3DM3 A;  1E7Z A;  1Q8K A;  1TWC H;  5C0X J;  3T1Y L;  4JBK A;  3S1M H;  4GNX C;  4JBJ A;  1HZB A;  3S14 H;  1Q82 C;  3GDE A;  2R93 G;  3AFP A;  3A74 A;  1I94 Q;  2AKW B;  3NEN A;  5M5Y H;  1Y1V G;  2LXJ A;  3KF8 B;  1Q1B A;  4GNX A;  3NBH B;  4LUO A;  4DV0 Q;  1PH3 A;  2VUM G;  3HOW H;  3PIP A;  4JYA Q;  1I6H H;  4JI2 L;  3CCE A;  1I50 H;  3W1B A;  1PA6 A;  1ASY A;  4A3L G;  4DR5 Q;  1PH8 A;  4JI0 L;  4DR6 L;  2HHH L;  1N8R C;  4YHH L;  1KHI A;  4DR3 L;  5C0X I;  1IBM L;  3E9I A;  2WB1 G;  3EN2 A;  4DUZ L;  1AH9 A;  5GAH C;  3JAM c;  2AWN A;  1Q86 C;  4DR4 L;  4L5T A;  1HNX Q;  4NPS A;  1LTL A;  5C0X G;  1I3Q H;  1J6Q A;  4NXM Q;  3PO3 H;  4A3G H;  2AWO A;  3UDX A;  4IPH A;  2FXQ A;  4OXP A;  4DR7 L;  1B7Y B;  2EQS A;  3KDF B;  1YIJ A;  4AIM A;  3A5Z B;  4X66 L;  3GTQ H;  1HR0 Q;  4IO9 A;  3ICE A;  2VQE Q;  3HOU H;  1B70 B;  4B3S Q;  4JI3 Q;  2UXD Q;  2PQA B;  4PZ7 A;  1P8L A;  3CCQ A;  4B3M Q;  2VY3 A;  4LF8 L;  1OTC A;  4GKK L;  4JV5 L;  1HZ9 A;  4IFD G;  4JI4 Q;  3BJU A;  3PO3 G;  4A3G G;  4HJ5 A;  4JI6 L;  4YCV A;  1VQM A;  4JI8 Q;  3G71 A;  1GO3 E;  3CW2 C;  1X9N A;  2UUA L;  5JJL A;  3BU2 A;  5BR8 Q;  1XMO Q;  3I55 A;  3M4P A;  1VQH A;  2BA1 A;  3CCR A;  3PSI A;  3HOU G;  3A5U A;  1W3S A;  2JQO A;  3GTP H;  3RR5 A;  4LF4 L;  3HOY H;  3T1H L;  4AYB E;  4LFB L;  3PO2 H;  1KD1 C;  4BY7 H;  3GD7 A;  4LWC A;  2JA6 H;  4GLX A;  3HKZ G;  3CME A;  2Q2H A;  1DGS A;  3OYY A;  4JG2 A;  3CF5 A;  1PH7 A;  4GLV B;  5IYB H;  3VDY A;  3ERS X;  2NN6 G;  3K7A H;  3LGJ A;  3J81 j;  1C9O A;  4A3D H;  4TQU S;  1Z47 A;  2N78 A;  3OW2 A;  2OQ0 A;  3HOY G;  1S3O A;  3PUW A;  4X6A H;  3PO2 G;  4GN3 B;  4GN5 A;  1EIY B;  3RLF A;  2JA5 H;  1YNX A;  1XNQ Q;  4B3R Q;  1K3R A;  1OXT A;  1HZC A;  1K73 C;  2JA6 G;  5FJ8 G;  3F2D A;  4DV4 Q;  1YVC A;  1KRS A;  1VQK A;  2GVA A;  3ER0 A;  4BY1 H;  1VQO A;  4JI5 Q;  5IYB G;  4OX9 L;  4JCV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...