1TWHH

Rna polymerase ii complexed with 2'datp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 19
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twhH00
4IJLA 1E24A 4B3RL 1PH2A 4RG1A 5IT9c 4TQUS 2UXBL 2LSSA 3HKZG 4A3MG 1G6PA 3M4PA 2N78A 3B6YA 3M9BA 5GADC 1VQOA 1S72A 4PMWA 4DR1Q 4TVAB 1OXTA 2MO0A 1UE1A 3WWVA 1VQFA 4DNIA 4BY1G 4QJFA 3SGIA 4EQ5A 3J81i 2DUDA 3PIPA 2E2IH 1VQPA 2UUAL 3HOZH 3PUZA 5M5XH 5FJ8G 1BKBA 4AIMA 1Q7YC 2KENA 5M3MH 1EWIA 3DLLA 3F2BA 5J3BA 4A3KG 2KCMA 4X62Q 2JA5H 1XJVA 4JV5Q 1N36Q 4GN5A 1I94L 3TREA 5GAHC 5IYDG 4IO9A 5ELNA 4KHPQ 4L5QA 1A8VA 2UUCQ 2VUMG 2BH2A 2AHOB 1NJIC 1TWFH 3W1BA 1HNZQ 4UPAA 4DV2L 3F2DA 4R4TA 3F2CA 4JI6Q 3S14H 1AE3A 1C9OA 1X3FA 2I5LX 2JA9A 4DV5L 2UU9Q 1JE5A 3UDGA 1NTGA 1WI5A 4X64L 2K5NA 4MTNA 2Q2UA 1UEBA 1JT8A 3TRZA 2RHQB 3FHWA 4PZ7A 5IP9H 2ZM6L 1V9PA 3CXCA 4A3GH 1X9NA 4AYBG 4A75A 4A3IH 1PVOA 4DV6Q 2ZJPA 1H95A 4JI8L 1FVIA 3U50C 3HOYG 2RCNA 4GKJL 1GD7A 1XNQQ 1PH7A 3A74A 4NXML 2H5XA 2KBNA 1KXLA 1UE6A 5E7NA 1BVSA 3RLNA 4IFDJ 3RZDH 3PF5A 2HIXA 4P71A 4A3FH 4LFCQ 4P72A 1XNQL 1IBLQ 2DGYA 2JEAI 1N8RC 5FJ8H 4LF9L 4IOCA 2I0QA 4WJ3M 3AFPA 2D62A 3GTKH 4BY1H 5C44G 1A63A 2XTIA 2GVAA 2ES2A 2ASBA 2N8NA 1L2FA 4DAYB 3OW2A 4X64Q 1MKHA 1GO3E 3JAMc 4MZ9A 1PHJA 3EIVA 1HR0W 1K8AC 4QGUA 4DV5Q 2JA8H 3RN2A 1SR3A 2RHSB 4X65Q 4DV2Q 4A3LG 2JA7H 2K5VA 1K3RA 1HNWL 2V1CC 1V43A 3S1MH 1I94Q 1X3EA 1JJGA 4C3IH 1LM0A 2JA7G 3H3VI 2HQLA 1I6HH 4XIGS 1E1TA 1ASZA 4L5SA 4PG3A 1GM5A 2QEXA 1P8LA 1Y1WH 2NVQH 3J80c 3GTGH 3EBEA 1KRSA 5IE8A 2K4KA 4P74A 2CCZA 3ICEA 2YTXA 4JG2A 4JI5L 3I4MH 4K0KQ 4KLKA 2HHHL 1PH5A 2F4VQ 3TEHB 5C3EG 1D8LA 1VQ8A 3RZOH 4LFAQ 1FGUA 4DUYQ 2NN6G 3H15A 4OWWB 3EN2A 1G51A 2KCTA 1GKHA 4H02A 3UDXA 1VQJA 1KIXA 3M7NA 1T9HA 4X6AH 2NVTH 3W5OA 1XPOA 3PO3H 5IY0A 4OWXB 4JI7Q 4OX9Q 1VQNA 2UXDQ 4DR4Q 1WFQA 4YWLA 1YHAA 3Q8DA 4X66Q 1YJWA 3M4QA 4P73A 3PIOA 1MJCA 1XNRQ 1VQCA 2PMZE 2B63G 2YU9H 2MFIA 4A3GG 3H3VH 2JEBI 4LFBL 5IP9G 4YHHL 4DUZL 1CKOA 1Y14B 4LUVA 4R4QA 3ERSX 2HIVA 5LMNW 3GO5A 1XPRA 1FL0A 4YWKA 2VQFQ 1VQIA 3KDFA 2WB1E 3J7A5 1UWVA 5IP7H 2UXCQ 1TXYA 4IFDI 1PH4A 4NB3A 1AE2A 3H0GH 2R92G 4X65L 4LUOA 3K7AH 1U5KA 5HY6A 1VQ6A 3K8AA 1HR0L 1D7QA 1KC8C 4JI2L 2E2JH 1HZ9A 5IWAL 2NVXH 4JI3L 2BA0A 3K80C 3KF6B 1NY4A 2CQOA 2MQHA 2EQSA 1HZAA 3DM3A 4PZ6A 4C3JH 4HIDA 4A3KH 2AWOA 4ME3A 5M3MG 1EYGA 3RLFA 3I56A 4WJ4A 2K75A 3D31A 3KJOA 3CC7A 2F3IA 2K5HA 1VQHA 1VQMA 3STBD 1O7IA 1XMOQ 1TWGH 1E7ZA 4DV4L 2ZJQA 1Q1BA 3RR5A 4LF4L 2B29A 4LFCL 1S3OA 3J81c 4JBWA 1PYBA 3CPFA 2JK8A 1X6OA 4C3HH 5JEAJ 3HOWG 1U0LA 3GTLH 4BY7G 1PA6A 4DR7Q 4JI6L 4NXMQ 1JJ2A 4MNOA 1KHIA 2ZTCA 4BBRG 1YZ6A 3CMEA 4HJ7A 1N33Q 3GTOH 1C7YA 2A8VA 5FLMH 1EFWA 4LWCA 4A3BG 3HOYH 3PUWA 4DUZQ 1KQSA 1M1KC 4R4OA 4EX5A 5IWAQ 1EQRA 4LF5Q 3RLOA 4GNXA 1N9WA 1X55A 4HIOA 2BH8A 2UU9L 3S24A 4A3DG 1R9TH 5EAYA 5M3FH 2AKWB 4X66L 4DKAC 4HIKA 1HZCA 1BBUA 4JI7L 2UXDL 1MIUA 3CCJA 4DV0L 4AQYQ 4A4IA 5GQOA 3OTOL 4JYAQ 2KHJA 1Z9FA 4DV7Q 2IY5B 1V1QA 1IBMQ 1MJEA 4GN4B 3HOXH 3J7ZC 3NENA 1EOVA 3G6EA 4ALPA 3CCSA 3AQQA 5LMUL 3CCEA 1WCMG 4GOPA 4JI5Q 5LMNQ 1Q12A 2Z6KC 4DR1L 3HOZG 2B3GA 4HJ9A 4B3ML 2VNUD 2E5LL 1IXRA 1C0AA 1I5FA 4OWTB 4HJ5A 1PH6A 1VQ5A 4Y7NH 4JBJA 1SROA 2IX0A 1VQDA 2GVBA 4GLXA 3M85A 1Y1WG 3BZKA 1VCIA 4DR3Q 5C4XG 1PFSA 4QIWE 5LMNL 3KDFB 2MO1A 3CAMA 1EUJA 1GVPA 2E8GA 2K50A 3TQYA 5AJ3Q 3G4SA 1LYLA 5FLMG 1EQQA 4A3BH 1AH9A 4DPGA 2ALYB 5IYBG 4DV3Q 1IBML 1VQLA 4YWMA 3ULJA 1UE5A 3AEVA 1Q86C 2RF4A 4GS3A 3I4NH 4JI1L 2Q2TA 4AQYL 1WOCA 4DV0Q 2JA8G 4DR2Q 4XTCS 1YVCA 2R6GA 3STBC 2Z6KA 4AH6A 2VW9A 1PH3A 5HGQA 5BR8L 1J5EQ 3S1QH 4BBSG 1YEZA 3HOVG 4LF5L 1QUQA 3S1NH 4A76A 3I2ZA 2OQKA 4PZ8A 2JA6H 1Q46A 3U58A 3GTPH 4A3FG 2QGQA 2JQOA 2NZOA 1YIJA 1OXUA 2VQEL 4L5RC 4JI8Q 4LF7Q 1IYJB 4GLVB 1NMGA 2Y0SE 4HJAA 3AFQA 4LF7L 2ATWA 3FP9A 1B7YB 2CWPA 5GAGC 2EIFA 3H0GG 4JI3Q 2R92H 2R7ZH 4B3SQ 4R4CA 1WJJA 4A3CG 4IPCA 3K7UC 4JI2Q 3CC2A 4R1JA 1J5EL 4LF4Q 1JJCB 3FKIG 3MEFA 1L1OB 1QVGA 3HOUG 4POGA 3CCRA 4GKJQ 4A93G 2PQAB 1A62A 1VQGA 2N3SA 2YV5A 3BJUA 4JCVE 4RMFA 3G71A 4DV6L 4JC0A 2UUCL 3FKIH 3I7FA 3HOUH 4A3DH 2XGTA 3S17H 2K14A 1PYSB 2ZM6Q 3CCQA 2LXJA 4B3TL 2WFWA 4JV5L 2NZHA 3CCVA 2WAQE 4LUZA 1QZHA 1I3QH 1HH2P 1HR0Q 3CC4A 4UP7A 3S15H 5C4JH 5IYDH 3JAMi 3S2DH 3CCMA 4DR4L 4BY7H 3U4ZA 4IPDA 3HOWH 4OO1G 1CKNA 5JEAG 1PV4A 4KI0A 4B3TQ 2OTLA 1YNXA 2UUBL 3F8TA 1E3PA 1N36L 5DLQE 5GAEC 4BBSH 2UXBQ 3J80i 4DAMA 1OTCA 2FXQA 3LGJA 3T1HL 1EIFA 4B3RQ 4DR6Q 4P75A 1N32L 4C2MH 3CW2C 2UUAQ 1XNRL 4A3MH 2F4VL 1CKNB 2PI2A 5C0XJ 4QL5A 1IBKQ 4JI0Q 3T1YL 1CSPA 1YJNA 1HZBA 4YCWA 1XMQL 3CCLA 3KFUA 3RNUA 1L1OA 2JJQA 1PH8A 4JBMA 4DK3C 1NMFA 3IRBA 4DV7L 1YHQA 4Y52H 3A5UA 3NBHB 1KAWA 5ELOA 3KF8B 1W2BA 4JYAL 3K81C 1J6QA 1YBYA 4YCVA 3G48A 4DUYL 1VQ7A 4LFAL 3ULLA 1ASYA 3CPWA 1HNWQ 1JB7A 3A0JA 1QZGA 2IX1A 3PSIA 2CKZB 4A3JG 3S1RH 2R7DA 4K0KL 3KJPA 3ULPA 3PGZA 4UP8A 1KD1C 1IL2A 5M5WH 2I5MX 2IHFA 2CWAA 1YHBA 1Y1VH 2NVYH 3GD7A 5C44H 1Q1EA 2A19A 2GN5A 2YTYA 4QY7A 1QUQB 1G291 1PH9A 3HKZE 3PF4A 1RL2A 5JJIA 1EIYB 2Q2IA 3E9HA 4A3EG 1OXXK 3KF6A 1VQAA 1Q81C 5K36G 4DV1L 1Z47A 2D0OA 2YTVA 2VY3A 4LF6L 3PO3G 1VQBA 4BXXG 2KHIA 4DR5Q 4DV3L 5C0XI 1W3SA 4KHZA 1RIPA 1E1OA 1I50H 1CSQA 4DR7L 1YI2A 5AJ3L 4NXNQ 1IBKL 4JI0L 1TWCH 1Y1VG 3A5ZB 4LF8Q 4UY8C 2Y0SG 2PI2E 2OQ0A 3KLWA 2F52A 2VS1A 5M3FG 1N32Q 4DR6L 1K73C 2R93H 3JC66 1XPUA 1Q8KA 2D0PA 4A93H 1L0WA 4HJ8A 5FLXc 4GNXB 3T1HQ 4GKKL 4LF9Q 1X56A 3PUYA 2C35B 3RN5A 3I55A 1IBLL 1LTLA 4B3MQ 1XMQQ 3PO2G 4IPGA 3PUXA 3GDEA 3M4OH 1X54A 4OONA 3T1YQ 1NE3A 1JMCA 2PNHA 1DGSA 5LMUQ 3ZJYC 1E22A 4DK6C 2VUMH 2PQAA 4A3LH 3L7ZC 1SE8A 2EXDA 4J15A 4O2DA 4UP9A 5H1SE 1HNZL 3GTQH 3TS2A 2UXCL 3D0FA 3I4OA 3OYYA 3CD6A 3CQZH 2VQFL 1CKMA 2OTJA 3GTMH 5GROA 3OTOQ 1XTDA 2Z0SA 2VL6A 4LW1A 3GTJH 1PH1A 2UUBQ 1BBWA 3BZCA 2A1AA 2OWOA 3HKSA 1IZ6A 4YHHQ 4GOPB 1B8AA 5JJKA 3PV0A 3PUVA 2IT1A 1VQ4A 5M5YH 3U4VA 1KL9A 3PCOB 4IOAA 1S40A 1KRTA 1HJPA 4GLAC 1P16A 2ZJRA 2E2HH 1M90C 4B3SL 3I4NG 3KOJA 2IHEA 4OXPA 3K0XA 2OCEA 4O0AA 3TS0A 3UDIA 3J81j 4IFDG 4KHPL 1UE7A 2AMCB 2MNAA 4X62L 2YYZA 1K0RA 4IPHA 1N33L 2CFMA 3PO2H 1WYDA 2LXKA 1VQ9A 1SMXA 3UE1A 4HIMA 1K83H 4A3IG 5IP7G 4LF8L 3L0OA 1OXSC 3UE0A 2ZTDA 2WAQG 2I5HA 5C4XH 4JI4L 1FJGQ 3ER0A 4JOIC 2HHHQ 5JJLA 4BA2I 1QVCA 2N49A 1K9MC 2R93G 4DV4Q 1HNXQ 1SFOH 1XMOL 3S16H 4DR5L 2B63H 1N34L 1VQEA 4A3CH 4APVA 2R7ZG 4GKKQ 1TWAH 4IJHA 3UDFA 1VS0A 4DV1Q 5IYCH 1TWHH 2Q2HA 2VQEQ 1A0IA 4GN3B 4YCUA 4JBKA 1X3GA 4YY3Q 1K8GA 3L2PA 1SN8A 1WCMH 4POFA 4AYBE 3M3YH 4BXXH 1X65A 4GNXC 4LNQA 3HOXG 1CUKA 2K52A 4NPSA 4NXNL 4A3EH 5BR8Q 4R4IA 1YJ9A 1VQKA 2JA5G 2BA1A 3MXNB 3CMAA 2QA4A 2JA6G 4QQBX 4DR2L 5IYCG 1QVFA 4BA1I 3HOVH 4L5TA 1YITA 4LF6Q 3CP0A 4JI1Q 3W1GA 2WB1G 4YY3L 5C3EH 3VDYA 2L15A 3I4MG 4OO1I 2NN6I 3AYHB 1Q82C 2HT1A 3S2HH 4LFBQ 1OXVA 2AWNA 4A3JH 1N34Q 1SRUA 3NELA 4JOIA 3KYHC 2E5LQ 1HNXL 3F1ZA 3CCUA 1SLJA 2WP8J 1L1OC 2ID0A 2VZAA 4GOPC 3NEMA 3E0EA 2R7FA 1NBWA 1B70B 3HFZB 5IYBH 3CF5A 4JI4Q 4OX9L 1FJGL 3E9IA 4DR3L 2JE6I 3BU2A 4BBRH 2ZTEA 4FDBA 5C0XG 1LUZA
chains in the Genus database with same CATH superfamily
1O7YA 4K8IA 4RG1A 5IT9c 4TQUS 5HURA 2LSSA 3HKZG 4A3MG 3M4PA 3B6YA 1VQOA 1S72A 1C8CA 1A15A 2MO0A 4DNIA 1B2TA 5IGFA 4QJFA 3TMEA 3H91A 4EQ5A 5A35A 5LHY1 1VQPA 1S5BD 5FJ8G 1BKBA 4H13C 2F1MA 2KCMA 1IW7C 3K5OA 4JV5Q 1CFMA 4GN5A 1I94L 5GAHC 2RBMA 5ELNA 5D14A 2VUMG 2F0NA 1MI2A 2BH2A 2AHOB 1NJIC 1I4PA 4IUUA 4DV2L 3S14H 1AE3A 1C9OA 2JA9A 1SE3A 2BOSA 4A3EB 2IWHA 3J80L 4HMIA 2MJ8A 1BXTA 1ZYRC 1ILQA 5I9PA 4CKBA 1JT8A 2RHQB 4PZ7A 5IP9H 3PO3B 1ET6A 1A3TA 1H9SA 1QNUA 5C6AA 1H95A 1FVIA 5FO8B 1CHPD 2A69C 1WD1A 3HOYG 3BZDB 1J8IA 3T51B 2EY5A 2DY7A 5E7NA 1JCKB 3PMFA 1K8MA 4FXKC 1EYAA 4IFDJ 2HIXA 4A3FH 2YU9B 1XNQL 3MXNA 5C4XB 5FJ8H 4IOCA 2I0QA 3SVMA 4IURA 5FK9C 3SXHA 1JE4A 1SYDA 4DAYB 4IUNA 4MZ9A 2FMMA 2JA8B 2HCIA 5FOBB 3MAQA 1D5XC 4DV2Q 1F9SA 3Q0AA 1DJRD 4PV1C 1A2TA 1NUCA 2V1CC 1V43A 3IL8A 3KBXA 2KECA 1JJGA 3H3VI 1QNKA 1EL0A 1F9PA 2QEXA 4ILWA 1P8LA 2CH4W 2I07B 3I73A 3EBEA 5IOCA 2RCFA 5IE8A 3BVZA 1EEID 3K7AB 2B2UC 4K2LA 4KLKA 3TEHB 2HCCA 4LFAQ 1FGUA 1BNZA 1TY2A 2NN6G 2KCTA 4P2CB 4H02A 3P75A 1KIXA 1VQJA 3M7NA 1T9HA 4G7ZC 2NVTH 4RFBA 4F8MA 1HQMC 1D6EC 4DXFA 1WFQA 1YJWA 1DOMA 2CW0D 1VQCA 1D5MC 3MVVA 2MHVA 3H3VH 4LFBL 5IP9G 1KNEA 4H7BA 4DUZL 1CKOA 1Y14B 3GO5A 4YWKA 1VQIA 1ONLA 2K01A 3KDFA 4KN4C 5C3WA 1AP0A 2F0EA 1STGA 4X65L 5HY6A 1VQ6A 1HR0L 1D7QA 3K6OA 1GXDC 4IFDH 1F9RA 3KF6B 2H4OA 4PZ6A 1EYCA 1HZAA 2PYKA 3HOWB 3VYSA 2AWOA 2HD3A 2O4XA 4ME3A 3I56A 2PCFB 4N9TA 2F3IA 1O7IA 1E7ZA 1EU3A 2ZJQA 3M4OB 3VR4A 3FPUB 4JBWA 1PYBA 4G7HC 5JEAH 2K05A 4PMBA 4OO1H 4BY7G 2M9VA 4A3JB 2EYLA 4FF3A 2F0VA 1LLRD 5FLXE 1KHIA 2HDMA 3HKZB 2KCCA 4IN3A 5DM63 1C7YA 2PQEA 1WVLA 1TWFB 1M1KC 1EQRA 1HUMA 1N9WA 3S24A 3IFTA 2B2TC 1WTHA 1JC7A 1HUNA 3H09A 1HZCA 2UXDL 4N8X1 3CCJA 2M2LA 1TT2A 3Q23A 2SOBA 3MC0B 2NVYB 2R3ZA 5C44B 1S5ED 1JQYD 3G7LA 4L8JA 4RKBA 1MD2D 3I8ZA 3BDCA 4DV7Q 1MJEA 3G6EA 3CCSA 3AQQA 5LMUL 3K5MA 1KAAA 4C56C 1K83B 4GOPA 2X6LA 2PMZB 2B3GA 2VNUD 3ERQA 4EQOA 1PH6A 3T4AC 3HOYB 1HXYD 4JBJA 1SROA 1VQDA 4GLXA 1Y1WG 4CDDC 1QJOA 3K0YA 4XYQA 4RHSA 3TQYA 2E8GA 1LTTD 5KNCA 1UE5A 1DYQA 2Q2TA 2JA8G 2F4IA 4RH6A 1JWSD 1TY0A 4XTCS 4AH6A 4DF7A 2Z6KA 1PH3A 1VF7A 4BBSG 4KKTA 1KDAA 2A6ED 3SR1A 4A76A 2F0HA 2OQKA 4K6LA 4A3FG 2JQOA 3NTHA 4OEMB 1YIJA 4L5RC 1WTOA 4PQXA 5C5MA 2CWPA 3QJYA 1D1KA 1GJXA 1Y8NB 1ENAA 4ODGA 4ZYSA 4WFN3 1SYGA 4R1JA 4KY6A 1QVGA 2PO4A 3CCRA 4GKJQ 1A62A 2YV5A 3I90A 3G71A 4A3DH 4JC0A 2UUCL 1I4QA 1EOTA 3S17H 2K14A 5FO9B 1PYSB 2K1BA 1WTQA 3S1QB 1U4PA 1ESFA 3TBIB 3ITPA 3BS1A 1ET9A 4BY7H 3U4ZA 4OO1G 3BVGA 5JAVA 5JEAG 2OTLA 1YNXA 2F0UA 1E3PA 2F0MA 5DLQE 5GAEC 1N36L 1GUNA 4BBSH 3T1HL 4ZRZA 3LNNA 3KLRA 4KN7C 4C3HB 1SYBA 1LT5D 4QL5A 4RGNA 4JI0Q 3T1YL 5C0XH 3RD4A 3CCLA 3RNUA 1L1OA 1PH8A 4JBMA 4DV7L 2P5ZX 1H9RA 1RTNA 2SNSA 4Y52H 4JYAL 5KGUA 2RA4A 3G48A 4LFAL 1VQ7A 1ASYA 2AUKA 1QZGA 4A3JG 1I6HB 3T13A 3KJPA 2ZXRA 1S5CD 3PGZA 1WCMB 3TDQA 1IL2A 2A5HA 2EJFC 1Z7TA 5KIXA 1R4PB 4QY7A 2GN5A 2YTYA 1QUQB 1PH9A 2O5JC 2Q2IA 1J9OA 1QILA 2D0OA 2QW7A 2K5QA 2VY3A 1DM0B 2F0TA 4LF6L 1VQBA 2B8GA 4DAPA 4WJWA 5C0XI 3SK5A 1YI2A 4JI0L 1Y69U 3S14B 4ZK9B 2C5CA 1FNVA 4UY8C 4FO2A 5M3FG 1N32Q 1K73C 1Q8KA 2L1BA 2RVLA 1V1OA 4X3UA 5ELCA 3QWNA 3CKIB 4B3MQ 2F3WA 3GDEA 3QR8A 3F2UA 4HSPA 3ZJYC 4DK6C 4QMGA 4O2DA 4UP9A 3CQZB 2UXCL 3D0FA 5DNFA 2KUMA 2LS01 1CKMA 3GTJH 2A74C 1BBWA 2A1AA 1S5DD 3NE5B 3HKSA 1V8QA 2F0FA 1VQ4A 3O13A 1HJPA 4GLAC 1VDZA 1M90C 3H6MA 3I4NG 4OXPA 3K0XA 5HGTA 4FNFA 1HTLD 1U4RA 3J81j 5FO7B 2MNAA 4DK1A 2YYZA 1EQVA 1I4GA 1PZJD 3PO2H 1WYDA 1Y8PB 1SAPA 3UE1A 5NUCA 3WDNA 5IP7G 4A3IG 2PZWA 3UE0A 2WAQG 1FJGQ 5C4XH 3ER0A 1IW7D 3A7AB 4BA2I 2R93G 1ICWA 4OIJA 5E3FA 1XMOL 4DR5L 4EQPA 4GKKQ 2XRQD 1VMPA 2F0IA 4IJHA 3UDFA 5EPJA 4YCUA 3QO2A 1JOQA 1WCMH 2WB1B 3FVQA 2K7VA 3MWYW 1SNCA 4AYBE 3M3YH 1X65A 4FP5D 4LNQA 4BXXH 1SXTA 2JA5G 3DUZA 1YJ9A 5KRUA 4R4IA 3A8IE 1D1IA 5ELDA 2BA1A 4M1UB 3CMAA 2JA6G 1DXMA 4QQBX 1CTMA 2EOTA 3I4LA 3S1MB 3NQIA 4L5TA 3CRLC 1BO0A 3CRKC 4KTAA 1Q82C 1PRTC 1SRUA 2JYOA 5ISRA 2EDGA 4RGOS 5IODA 4GOPC 2R7FA 5I4DA 5IYBH 1FJGL 3NQTA 4DR3L 1ILPA 3BU2A 4WRDA 1U9RA 4BBRH 2ZTEA 4IJLA 4B3RL 4DK0A 1PH2A 3J7AF 3VA5A 4DFAA 1AZQA 4DXGA 1ML0D 4C3HG 3M9BA 2N78A 5GADC 1BUVT 4PMWA 4DR1Q 2FFKB 2NBFA 1OXTA 3SK8A 4BY1G 2E2IH 1LV9A 2UUAL 5D3IB 5M5XH 4ZCKA 4EGVA 2KENA 1FNWA 1EWIA 3H94A 4K2KA 3F2BA 2KA7A 4X62Q 1XJVA 1U4LA 4KHPQ 4L5QA 3K58A 1BCPF 2UUCQ 4XT1B 1TWFH 3W1BA 3F2DA 4R4TA 4FYDA 5EKIA 4DV5L 4RAUC 4MN3A 5ELEA 3UDGA 4A3KB 1I50B 1WI5A 2K5NA 2Q2UA 1UEBA 1D2BA 3C3LA 3TRZA 4OL7A 1V9PA 4A3GH 1AEXA 4A75A 1RHPA 4JI8L 3U50C 5KYIA 4GKJL 3A7LA 1XNQQ 1PH7A 3A74A 2XWJB 1D5ZC 3RZDH 2EYFA 4P72A 2CQAA 2DGYA 2JEAI 3PO2B 1N8RC 1DOLA 1LTBD 5C44G 2ASBA 4X3KA 1DOKA 1PLFA 3JAMc 2HDLA 1LTAD 4QIWB 1HR0W 3P1HA 1KDBA 2E2HB 4X65Q 1FR3A 4A3LG 2QKIC 3D4DA 1X3EA 5CBAE 1LM0A 4F88A 4L5SA 3GTGB 1BR9A 1EY7A 3ZYYX 4HTHA 2CCZA 3MFYA 3VR6A 3WOFA 3ICEA 1RTOA 2YTXA 4JI5L 1NR4A 3NP8A 4K0KQ 1PH5A 3H0GB 5A2QL 3VYUA 1VQ8A 2JXMB 2Z4HA 3H15A 1CA5A 4OWWB 3EN2A 1G51A 2WACA 3FKIB 1STYA 1GKHA 3TP5A 3UDXA 4X6AH 4A3IB 2WAQB 4A93B 5K36H 2UXDQ 3OSOA 4JVZA 1YHAA 3Q8DA 2F0QA 4BBSB 3M4QA 4IALA 3PIOA 3D4WA 1HA6A 2MFIA 5EBCA 2PW7A 1JICA 2QF7A 3R93A 1X3QA 1FL0A 2VQFQ 4FXDA 4NDXA 1UWVA 5IP7H 1QE6A 1TXYA 2UXCQ 4NB3A 2A6HC 4OHJA 2EE1A 4FF2A 4NW2A 5CYUA 3NXWA 2B2TA 4JI3L 2BA0A 2CQOA 1HA5A 3SE0A 4BY7B 5FKAC 2EJGC 3RLFA 1B3QA 3A8KE 1W6KA 3D31A 1SJHD 4ZKCB 3RR5A 4LFCL 2JK8A 1PRTD 3W3AA 4C3HH 1PA6A 5M3MB 2PZTA 3I3CA 2FHTA 4HSVA 4MNOA 2QEJC 1YZ6A 1U4MA 5FLMH 1EFWA 1DD2A 1WTPA 1KQSA 4OGQC 4R4OA 4EX5A 5J1ZA 4TSSA 1X55A 3PIP3 4OELB 3T56B 3M3YB 1ZYRD 2TMPA 5EAYA 4DKAC 4HIKA 3P7JA 5AFWA 1BBUA 2F0LA 4JI7L 1SMYD 2PW5A 4AQYQ 5GQOA 3OTOL 2Q8IB 5EPKA 4R8IA 4TKOB 5M9OA 4FVMA 1YNJC 2O2LD 2OT2A 4GN4B 1Y1WB 1WD0A 1PFNA 5IT9L 3CCEA 1WCMG 2RDGA 4JI5Q 1W6JA 2Z6KC 3HOZG 2EYMA 1ESRA 4DNRB 4OWTB 2B8FA 3VA7A 4HJ5A 3KBGA 4Y7NH 1EEFD 1Q8IA 2IX0A 2GVBA 1CK1A 1A3UA 3M85A 1SMYC 2KQ3A 3BZKA 1VCIA 4DR3Q 1K28A 5C4XG 1KLGD 4QIWE 4G57A 1II3A 2M00A 1EUJA 2K50A 1GVPA 3CAMA 5AJ3Q 1GUSA 3PIO3 1LYLA 5FLMG 1EQQA 4X3TA 4DNTB 1IL8A 4IUVA 4NMZA 5IYBG 5LL6S 4DV3Q 5M3FB 1TIID 1Q86C 4GS3A 4AQYL 4DV0Q 2DNCA 1SNOA 1O80A 4XT3B 4DR2Q 4I7AA 2CHBD 4IZ8A 5D65A 1XX8A 5BR8L 2VB2X 1EU4A 2D2CC 3S1NH 4JK1C 3BYTB 4R9WA 2JA6H 3GTPH 1LT4D 1HCZA 2D9UA 4I65A 4JI8Q 2Y0SE 2K33A 4J8QA 3AFQA 4LF7L 2ATWA 3J81L 3FP9A 2A68C 3T16A 1MGSA 3H0GG 4JI3Q 2R92H 2R7ZH 4C1NI 1SNMA 3K7UC 4JI2Q 2IX3A 4LF4Q 3FKIG 2QDLA 3MEFA 1Z6HA 4POGA 1VQGA 2N3SA 3V96A 3BJUA 3OIQA 5T1GA 2LMCB 3I7FA 3Q22A 3NSWA 2HUGA 4V0BA 2ZM6Q 3CCQA 2E2DC 2J7ZA 2NZHA 2WAQE 2LY7A 1HH2P 3R3OA 3S1RB 3S15H 1M4VA 5IYDH 3JAMi 3I4MB 2R93B 3QIAA 2X69A 3S2DH 3CCMA 1PDQA 4C3JB 4DR4L 4IPDA 1CKNA 2F0JA 3EQLC 1EZ6A 3J80i 3LGJA 3DXJC 4A3BB 1EY6A 1RJTA 1QOHA 4C2MH 1SYFA 3OPOA 3V2TA 1XNRL 3W2DA 1TS5A 2JA5B 4K6DA 1EIGA 4RCOA 1XMQL 3RUZA 4DK3C 1NMFA 1QCBD 3SEBA 3A5UA 3GTJB 3KF8B 1SE2A 3K81C 1J6QA 5K5PA 2Z4IA 2MP1A 5KYLA 3ULLA 4LJZC 2IX1A 2G9HD 4K5VA 2R7DA 5ELBA 1KD1C 1AFPA 1RD9D 4ZUJA 4H0LC 4JPBW 1DONA 1SBBB 2IHFA 1YHBA 1CHQD 3GD7A 3M4YA 3E9HA 4JW0A 4DN4M 1Q81C 2JSOA 4RHRA 5K36G 4ME5A 5IT9E 2Z6BA 2E74C 5JPNC 1WTWA 2BE5D 4DV3L 3NHHA 2BDNA 4DR7L 5IIFA 3I70A 5AJ3L 1TWCH 2G5DA 5I9OA 3GQBA 1MSGA 2OQ0A 2PI2E 4XQJA 2R93H 4DR6L 4QUCA 1XPUA 5DAUA 2D0PA 4A93H 2GA4B 1L0WA 4GNXB 4GKKL 4LF9Q 1X56A 2C35B 3D8GA 5EKLA 3HEJA 4C2MB 4IPGA 3PUXA 5M5XB 4OONA 1NE3A 2PNHA 4CDCC 1G91A 3HP3A 1L0YB 2PQAA 1O7LA 4A3LH 1HNZL 1T5EA 5CV9A 4N9PA 4C3IB 2OTJA 2WKCA 1XTDA 2ICEC 2VL6A 4LW1A 3BZCA 1LABA 1IZ6A 3CHBD 1B8AA 3NTKA 3X3MA 5JJKA 3HG9A 3PV0A 5M5YH 4IOAA 2JA7B 1KRTA 4OIKA 2E2HH 4IUQA 1HFGA 2OCEA 1H9KA 3A56A 5G3LF 3UDIA 4UHVA 3LX0A 3OIPA 2AMCB 3TN2A 1E2ZA 3TZDA 4X62L 2D5DA 5EBDA 5C3EB 2LXKA 1VQ9A 3EROA 1K83H 4A3FB 3DMUA 2ZTDA 2I5HA 5JJLA 4JOIC 1FYCA 1QVCA 2N49A 1K9MC 4DV4Q 1C48A 5I2XA 2JA6B 3GTPB 1N34L 1VQEA 1TWAH 3SHLA 4TRDA 4DV1Q 2C9OA 2OF1A 4JBKA 1A0IA 4GN3B 1X3GA 4YY3Q 3FMCA 1SN8A 4POFA 2XWBB 5KNDA 1UEAB 4NPSA 2K52A 4NXNL 2EJMA 2RQXA 2QA4A 2PZUA 2R92B 3CP0A 1JORA 2IPKD 4YY3L 3A54A 3VDYA 2I46A 2AWNA 4KY5A 1N34Q 2RSOA 3NELA 2E5LQ 1YNJD 5M5YB 4CJ2C 3KLSA 3BG3A 4KV6A 3E0EA 1TU2B 1B9NA 3CU7A 3CF5A 4OX9L 2F0DA 4BY1B 2JE6I 1BCPC 5C0XG 1JWUD 4I7ZC 1E24A 1I4RA 2UXBL 3Q6SA 4TVAB 1UE1A 3SGIA 1RODA 1XXGA 2B2WA 4RKLA 1QB5D 4IUTA 5M3MH 4A3KG 2JA5H 1DCZA 1N36Q 3TREA 2N55A 2ZT9C 2KHSA 5I6YA 4L6TB 4V190 3K5NA 1HNZQ 3I72A 5EJWA 4JI6Q 3R2TA 1X3FA 2QILA 1JE5A 2A68D 4X64L 1FNUA 4MTNA 1E0BA 1LT6D 1X9NA 2B2VA 4R8NA 4AYBG 4A3IH 1PVOA 4J6HA 4DV6Q 5EPLA 3OMCA 2B2WC 2RCNA 1CZWA 1GD7A 1K3BC 4NXML 1JR0D 1PFMA 2H5XA 1PRTB 1HTPA 1SFOB 1KXLA 1EIHA 1G8ZD 1BVSA 3RLNA 2IW3A 3D3RA 4H44C 1MHWC 1IBLQ 1KNAA 2RDHA 4WJ3M 4ZLTF 3AFPA 2D62A 2RSNA 4KKSA 3NPPA 4BY1H 5IGBA 5BN3A 1L2FA 4X64Q 1MKHA 1GO3E 4B08A 5CV8A 3EIVA 3MZ5A 2Z8LA 4DV5Q 2JA8H 5DEHA 1SR3A 2RHSB 2F0SA 3HOZB 4C3IG 5E4WC 2K5VA 1K3RA 1HNWL 2XRSD 4YIJA 1CQVA 1I94Q 1NAPA 4C3IH 2HQLA 4XIGS 1E1TA 1H9MA 4PG3A 5DM73 3QB3A 1Y1WH 3GTGH 2E2JB 2K4KA 1Q90A 2KJXA 1G2TA 2XN9C 2F4VQ 1I4XA 1D8LA 3RZOH 3BVMA 2CW0C 4DUYQ 1EY8A 1TWAB 4LMQD 3HOUB 3MXPA 3W5OA 1STNA 3HZXA 4JI7Q 4OX9Q 1VQNA 4CKCA 1GUGA 1UUPA 4EQNA 4X66Q 1WTVA 2EYJA 2NN6H 2AQ3B 1MJCA 4DAVA 4ZQ3A 2NZ1D 4ZKBB 1NSNS 4R4QA 3A8JE 3ERSX 1XPRA 3QOJA 3J7A5 1EY0A 1Y8OB 1AE2A 1TR5A 2TSSA 4LUOA 3K7AH 1U5KA 3K8AA 1ZEQX 2E2JH 2ENBA 4ULLA 5J39A 1T5XD 2NVXH 5IGGA 3DM3A 4A3KH 4C3JH 5M3MG 1CA6A 4WJ4A 3OWFA 2K75A 5E1FA 3KJOA 2K5HA 4CDEC 1VQHA 1XMOQ 3BYYB 1TWGH 2K28A 2F0KA 1E2VA 3P20A 2EZVA 1YNND 5JEAJ 1U0LA 4JI6L 5C3XA 4C3JG 1C4QA 1M8AA 3CMEA 1N33Q 3GTOH 2EYHA 2A8VA 4A3BG 4LWCA 3HOYH 3PUWA 2L5TA 4GNXA 1GUOA 1QWYA 2UU9L 4A3DG 1R9TH 1RCVD 1NNXA 5M3FH 4MIUA 2AKWB 4X66L 5C4JB 4KHVA 1PMRA 4M8AA 4DV0L 3NWTA 4A4IA 2L9HA 2NTSA 3D6CA 1PZID 3OMGA 2AQ1B 4JYAQ 2IY5B 4ZUIA 3HOXH 3J7ZC 3NENA 4ALPA 2NVQB 3K57A 5LMNQ 1Q12A 2EY1A 4DR1L 1E2WA 4B3ML 2QCPX 2E5LL 2NWGA 3URYA 1VQ5A 1FGBD 4MHEA 5C5LA 3BDOA 2WV6D 1F2MA 2PPBC 1PFSA 5LMNL 3KDFB 2K32A 1H9JA 3VYRA 4E6IA 2F03A 4G7OC 3G4SA 1IKLA 4A3BH 1EYDA 2ALYB 1VQLA 2A73B 3EJIA 5M5WB 4X3SA 4YWMA 3ULJA 1A3VA 3AEVA 1LO5D 3N6RA 4RCNA 2EVBA 1PFBA 2RF4A 5CC4A 1EFID 2K5WA 2L55A 1EQTA 5CMDA 3VYTA 5KNBA 1YVCA 2K03A 2F0PA 2R6GA 2VW9A 1FD7D 4KKUA 1J5EQ 1A6XA 1AN8A 1QUQA 3RMHA 4LF5L 4HEDA 3I2ZA 4A3GB 1Q46A 2QGQA 2NZOA 1OXUA 1IYJB 4GLVB 1EZ8A 3FEWX 2A6EC 2EXZA 1B7YB 3BDLA 3NUCA 3UI2A 4K5WA 5GAGC 2EIFA 4B3SQ 1WJJA 4O1NA 4IPCA 3LWEA 3JAME 1JJCB 3HOUG 1L1OB 3AMUA 4A93G 1R4QB 2PQAB 1JWMD 3H3VC 4JCVE 4RMFA 3FKIH 1GUTA 2XGTA 3KK7A 1V1PB 1X3PA 1B9MA 1JOOA 4LUZA 2JP1A 2WKDA 3S17B 1SEBD 1I3QH 1CQFA 3CC4A 3GV6A 4UP7A 5C4JH 3DEOA 4HN7A 4B9WA 1GHKA 1STAA 4KI0A 2UUBL 3F8TA 2UXBQ 4DAMA 1F77A 1OTCA 2FXQA 3AU7A 4RWSC 5CORA 4BWGB 1PZKD 1EIFA 3FPPA 4UAIA 4DR6Q 4P75A 4KD3A 3CW2C 2KEEA 2UUAQ 3GTLB 2DY8A 4A3MH 2F4VL 5C0XJ 1JOKA 3NBHA 1CSPA 4YCWA 2VB3X 3KFUA 5I6WA 2JJQA 3J7AV 4CBVA 1YHQA 3GTKB 1W2BA 1KAWA 2RDFA 1YBYA 4YCVA 3K59A 1V1PA 4DUYL 2MPMA 1HNWQ 1JB7A 3A0JA 1PTOB 2EPBA 3S1RH 4K0KL 1SDFA 1CI3M 3GTQB 4UP8A 5CGKA 5M5WH 3U9OA 1Q1EA 2A19A 1F9QA 1G291 3HKZE 3PF4A 1RL2A 2RKSA 1EIYB 4A3EG 1OXXK 3KF6A 1HQRD 4DV1L 2YTVA 1B44D 2FJ2A 4HAEA 4DR5Q 3EA6A 1W3SA 4KHZA 1E1OA 1CSQA 4NXNQ 4WORA 1HRJA 1MSHA 1Y1VG 3A5ZB 4LF8Q 1BDOA 1ICFB 3DM1A 2F52A 3KLWA 3J7YW 4HJ8A 3T1HQ 3RN5A 3I55A 1BQQT 3QOLA 3S1NB 2E2IB 1XMQQ 1JMCA 1SE4A 1DGSA 2VUMH 3S16B 1E22A 5BN5A 3E6ZX 3L7ZC 1SE8A 4J15A 3GTQH 2F0OA 3TS2A 1UNSA 3TZUA 3D4RA 3CQZH 4C1NK 3OTOQ 3MA2B 2OWOA 2Z9HA 4YHHQ 4DAYA 4ZAIA 3U4VA 1STHA 2ZJRA 4B3SL 5CV4A 1BF4A 4O0AA 4U673 4IFDG 3DEPA 4Y7NB 1UE7A 3ND8A 4IPHA 1K0RA 5EKKA 1N33L 2F0WA 2CFMA 2NB0A 5JPMC 3SK4A 1SMXA 4HIMA 3S2DB 3RZDB 1Q3LA 1WTXA 4F87A 2O5IC 1HFNA 2K04A 1SFOH 3S16H 1I3QB 4A3CH 2KCNA 2R7ZG 3NWSA 5JJZA 5IYCH 2VQEQ 2Q2HA 3MXUA 4O42A 1K8GA 2MUYA 4GNXC 1CZGA 1KABA 1IHZA 1BCPD 1IKMA 4DR2L 4L63B 4BA1I 3HOVH 4LF6Q 4G4KA 3V05A 2CH4A 3W1GA 1A2UA 5BN4A 5C3EH 3C1FA 2L15A 5E4XA 3I4MG 1EY9A 4OO1I 2EYOA 3HOXB 1OXVA 3C1EA 4JOIA 3KYHC 5L37A 3L3OC 4KY7A 1SLJA 3JAML 1S4ZA 3E3XA 1L1OC 2ID0A 2WP8J 2VZAA 3N52A 3NEMA 1TS2A 1NBWA 1H9SB 3OHXC 3HFZB 3RZOB 3E9IA 1MBYA 2Z1CA 3D6WA 4HMJA 4FXGC 4CKEA 2H1EA 4BBRB 1G6PA 2B2VC 4IQZA 2SEBD 2N88A 3WWVA 1VQFA 5IGEA 1ZKOA 3J81i 2DUDA 3PIPA 3HOZH 3PUZA 2V4DA 3DWQA 5CV5A 4AIMA 1Q7YC 2Y0SB 1PYWD 3DLLA 5J3BA 3OW7A 4A3MB 5IYDG 2X6GA 4IO9A 4KJOA 1A8VA 1EY4A 1OO9B 4UPAA 3F2CA 1KDCA 2I5LX 2UU9Q 1CT1D 1NTGA 4K5XA 4CDFC 3FHWA 2ZM6L 3CXCA 2VUMB 5CBEE 2ZJPA 4FF1A 5ELFA 2KBNA 2WIIB 1UE6A 2G9DA 3EVQA 3PF5A 4P71A 4LFCQ 1HPCA 2EYPA 1BBXC 1BOSA 5C4HA 4KK7A 4LF9L 3GTKH 2AUJD 1A63A 2XTIA 1XWEA 2GVAA 2ES2A 2DJGC 2N8NA 2VXWA 3GP7A 3OW2A 1I4HA 5F2DA 1PHJA 1K8AC 4QGUA 3RN2A 1STBA 3R8BA 2KEDA 2JA7H 5C4ZA 4XQQA 3S1MH 4N8FA 1TWGB 2JA7G 1G2SA 1I6HH 2L11A 1ASZA 1GM5A 3ND9A 3VR2A 2NVQH 3MXGA 4NP5A 3J80c 1KRSA 4P74A 4JG2A 3I4MH 2HHHL 4EVOA 5C3EG 2SNMA 3TP8A 1XPOA 3PO3H 5IY0A 4NKLA 2NUCA 1PTOH 4OWXB 4Q0FA 1JB3A 4YWLA 4DR4Q 2FINB 2KVMA 1F2YA 4B9XA 1O7ZA 1SNQA 4HCEA 4P73A 2KOLA 1XNRQ 2PMZE 2B63G 3KF8A 2EY2A 1ENFA 2YU9H 4A3GG 2JEBI 4YHHL 3MHBA 4LUVA 1VF5C 1PRTF 2HIVA 4QUFA 5LMNW 3K5LA 4CHTB 2E75C 2WB1E 2Q8RE 4IFDI 1PH4A 3H0GH 2R92G 4RGTA 1CM9A 1GOZA 1KC8C 4JI2L 2DNEA 4XDXA 1HZ9A 5IWAL 3HS0C 3K80C 1NY4A 5TSSA 2MQHA 2EQSA 3TP7A 4HIDA 1EYGA 4XYOA 3CC7A 1VQMA 3STBD 4DV4L 4LF4L 1Q1BA 2B29A 1S3OA 3J81c 3CPFA 1DZ1A 2NYZD 4KJNA 3NBIA 1X6OA 3HOWG 1RF2D 1SJED 3VR5A 3GTLH 3SDZA 4DR7Q 4NXMQ 1TS3A 1F2ZA 1JJ2A 2ZTCA 3TSSA 3OWEB 2CVRA 4BBRG 4HJ7A 3DHQA 5I2YA 3QG1A 4DUZQ 4F7XA 5IWAQ 2IJ0A 5IGCA 3GV3A 4LF5Q 3RLOA 3GTMB 4HIOA 2BH8A 2E76C 2R61A 3E5SA 4QCLA 2NVTB 2NVXB 3PQIA 1MIUA 3FDTA 1XTCD 1SYEA 1B53A 2KHJA 1Z9FA 2J4XA 2DJFC 1V1QA 1IBMQ 3L9AX 4UDUC 3S2HB 1EOVA 2K5DA 2XVSA 4AYBB 2ZXOA 2IL8A 1TWCB 4HJ9A 4HR7B 4QB4A 1IXRA 1C0AA 1I5FA 3GTOB 2F3VA 2OXPA 3X3NA 3KLSX 3DWAA 1AW7A 2L12A 1LTRD 2MO1A 2DN8A 3KUPA 1AH9A 4J1MA 4DPGA 1IBML 1O78A 1NR2A 5FLXL 3S9WA 3I4NH 4PNYA 4JI1L 1WOCA 3NTIA 5EQ0A 3STBC 1LACA 5HGQA 3S1QH 5CR3A 1YEZA 1TWHB 3HOVG 1X32A 4KMUC 4PZ8A 3U58A 1KTKA 4DGZA 2VQEL 2EY6A 4LF7Q 2SDFA 1NMGA 4ABNA 5CV6A 4HJAA 1B50A 1R9TB 3C2PA 2B39A 3MTSA 3HRZC 1B3AA 4R4CA 4A3CG 4HCSA 3Q24A 3CC2A 1J5EL 3WOEA 3I91A 4DV6L 1STEA 3HOUH 1YNNC 2LXJA 4XQNA 2WFWA 3A55A 4B3TL 4JV5L 4K14A 4CGYB 3CCVA 1QZHA 3J81E 2B63B 3ONAB 1HR0Q 2QDBA 3IAYA 2Q8TA 3HOWH 3MEHA 3OOCA 1PV4A 4B3TQ 3SK6A 2J0TD 2A6HD 1WTRA 5COYA 1G6ZA 4CJ0B 1LTID 2XSCA 3TP6A 5A2QE 4B3RQ 4XXEA 3E0JA 1UAPA 2F0GA 1N32L 5JOBA 1CKNB 2PI2A 1ENCA 1IBKQ 4Q5VA 1TS4A 1HHVA 1YJNA 1PTOF 1HZBA 5D3DA 2OEOA 2FMCA 1K8OA 1EWHA 3IRBA 1S5FD 3NBHB 5ELOA 2NTTA 2XIWA 4DA2A 3CPWA 3PSIA 2CKZB 1SNDA 1TVXA 4S3SA 3ULPA 1EWCA 4MTKA 2LKVA 5T1IA 1TQOA 1ZXTA 2PNRC 2I5MX 2CWAA 1Y1VH 2NVYH 5C44H 1RDPD 3HGBA 1Y1VB 5JJIA 4A3DB 2HQEA 1VQAA 1GHJA 1LTGD 1Z47A 1SYCA 5CV7A 3PO3G 3C46A 4BXXG 1F2LA 2KHIA 2LFNA 4LAAA 1QG7A 5JVG3 1RIPA 1I50H 2A69D 1IBKL 1KLUD 2Y0SG 5J22A 2B2YC 1I6VC 2VS1A 3JC66 3S15B 5FLXc 1RKNA 3J80E 3PUYA 3AB9A 1IBLL 1LTLA 1PTOD 4IUPA 3PO2G 1PXUA 3M4OH 1X54A 2WINB 3R2IA 3VR3A 3T1YQ 2AQ2B 4Z9CB 3IKJA 1VMCA 5LMUQ 1TKWB 1SNPA 3LWUA 3M7GA 2EXDA 3G6JB 4RA8A 5H1SE 1XYIA 1IYVA 1SSOA 3I4OA 3OYYA 3CD6A 2VQFL 3GTMH 3NK9A 5GROA 1PH1A 2Z0SA 2UUBQ 5IGDA 1B4OA 4GOPB 2BDOA 3PUVA 1L0XB 2B2YA 2IT1A 1KL9A 3PCOB 2ICIA 1S40A 1PTOC 1P16A 4PMCA 3KOJA 2IHEA 1GUWA 3TS0A 4KHPL 1K0SA 3FRPB 4ID6A 1LTSD 2R7ZB 2BCOA 3HOVB 4LF8L 1IYUA 3L0OA 1OXSC 4JI4L 2XNAC 2HHHQ 3I4NB 1BCPB 1AZPA 2ZXPA 2JN4A 1HNXQ 2L4NA 4KD4A 2B63H 2K6AA 3IFDA 4APVA 2B2UA 1VS0A 1EY5A 1TWHH 2MGSA 3U9SA 5KEEA 4BS9A 4FF4A 3L2PA 3MFGA 3HOXG 1CUKA 1VQKA 4A3EH 4RGMA 5BR8Q 3DWPA 3MXNB 4QF4A 5IYCG 5JVH3 1QVFA 4GZYC 4CJ1B 1YITA 4JI1Q 2BE5C 2WB1G 2NN6I 3AYHB 2HT1A 3S2HH 4LFBQ 4A3JH 4K8JA 1NCVA 3T53B 1B1ZA 1HNXL 3F1ZA 5EGTA 3CCUA 5G3LD 2L0CA 1B70B 4DU9A 4JI4Q 1LT3D 4LK1C 3EFXD 4U68A 5LL6X 4FDBA 1LUZA
chains in the Genus database with same CATH topology
4IJLA 1E24A 4B3RL 1PH2A 4RG1A 5IT9c 4TQUS 2UXBL 2LSSA 3HKZG 4A3MG 1G6PA 3M4PA 2N78A 3B6YA 3M9BA 5GADC 1VQOA 1S72A 4PMWA 4DR1Q 4TVAB 1OXTA 2MO0A 1UE1A 3WWVA 1VQFA 4DNIA 4BY1G 4QJFA 3SGIA 4EQ5A 3J81i 2DUDA 3PIPA 2E2IH 1VQPA 2UUAL 3HOZH 3PUZA 5M5XH 5FJ8G 1BKBA 4AIMA 1Q7YC 2KENA 5M3MH 1EWIA 3DLLA 3F2BA 5J3BA 4A3KG 2KCMA 4X62Q 2JA5H 1XJVA 4JV5Q 1N36Q 4GN5A 1I94L 3TREA 5GAHC 5IYDG 4IO9A 5ELNA 4KHPQ 4L5QA 1A8VA 2UUCQ 2VUMG 2BH2A 2AHOB 1NJIC 1TWFH 3W1BA 1HNZQ 4UPAA 4DV2L 3F2DA 4R4TA 3F2CA 4JI6Q 3S14H 1AE3A 1C9OA 1X3FA 2I5LX 2JA9A 4DV5L 2UU9Q 1JE5A 3UDGA 1NTGA 1WI5A 4X64L 2K5NA 4MTNA 2Q2UA 1UEBA 1JT8A 3TRZA 2RHQB 3FHWA 4PZ7A 5IP9H 2ZM6L 1V9PA 3CXCA 4A3GH 1X9NA 4AYBG 4A75A 4A3IH 1PVOA 4DV6Q 2ZJPA 1H95A 4JI8L 1FVIA 3U50C 3HOYG 2RCNA 4GKJL 1GD7A 1XNQQ 1PH7A 3A74A 4NXML 2H5XA 2KBNA 1KXLA 1UE6A 5E7NA 1BVSA 3RLNA 4IFDJ 3RZDH 3PF5A 2HIXA 4P71A 4A3FH 4LFCQ 4P72A 1XNQL 1IBLQ 2DGYA 2JEAI 1N8RC 5FJ8H 4LF9L 4IOCA 2I0QA 4WJ3M 3AFPA 2D62A 3GTKH 4BY1H 5C44G 1A63A 2XTIA 2GVAA 2ES2A 2ASBA 2N8NA 1L2FA 4DAYB 3OW2A 4X64Q 1MKHA 1GO3E 3JAMc 4MZ9A 1PHJA 3EIVA 1HR0W 1K8AC 4QGUA 4DV5Q 2JA8H 3RN2A 1SR3A 2RHSB 4X65Q 4DV2Q 4A3LG 2JA7H 2K5VA 1K3RA 1HNWL 2V1CC 1V43A 3S1MH 1I94Q 1X3EA 1JJGA 4C3IH 1LM0A 2JA7G 3H3VI 2HQLA 1I6HH 4XIGS 1E1TA 1ASZA 4L5SA 4PG3A 1GM5A 2QEXA 1P8LA 1Y1WH 2NVQH 3J80c 3GTGH 3EBEA 1KRSA 5IE8A 2K4KA 4P74A 2CCZA 3ICEA 2YTXA 4JG2A 4JI5L 3I4MH 4K0KQ 4KLKA 2HHHL 1PH5A 2F4VQ 3TEHB 5C3EG 1D8LA 1VQ8A 3RZOH 4LFAQ 1FGUA 4DUYQ 2NN6G 3H15A 4OWWB 3EN2A 1G51A 2KCTA 1GKHA 4H02A 3UDXA 1VQJA 1KIXA 3M7NA 1T9HA 4X6AH 2NVTH 3W5OA 1XPOA 3PO3H 5IY0A 4OWXB 4JI7Q 4OX9Q 1VQNA 2UXDQ 4DR4Q 1WFQA 4YWLA 1YHAA 3Q8DA 4X66Q 1YJWA 3M4QA 4P73A 3PIOA 1MJCA 1XNRQ 1VQCA 2PMZE 2B63G 2YU9H 2MFIA 4A3GG 3H3VH 2JEBI 4LFBL 5IP9G 4YHHL 4DUZL 1CKOA 1Y14B 4LUVA 4R4QA 3ERSX 2HIVA 5LMNW 3GO5A 1XPRA 1FL0A 4YWKA 2VQFQ 1VQIA 3KDFA 2WB1E 3J7A5 1UWVA 5IP7H 2UXCQ 1TXYA 4IFDI 1PH4A 4NB3A 1AE2A 3H0GH 2R92G 4X65L 4LUOA 3K7AH 1U5KA 5HY6A 1VQ6A 3K8AA 1HR0L 1D7QA 1KC8C 4JI2L 2E2JH 1HZ9A 5IWAL 2NVXH 4JI3L 2BA0A 3K80C 3KF6B 1NY4A 2CQOA 2MQHA 2EQSA 1HZAA 3DM3A 4PZ6A 4C3JH 4HIDA 4A3KH 2AWOA 4ME3A 5M3MG 1EYGA 3RLFA 3I56A 4WJ4A 2K75A 3D31A 3KJOA 3CC7A 2F3IA 2K5HA 1VQHA 1VQMA 3STBD 1O7IA 1XMOQ 1TWGH 1E7ZA 4DV4L 2ZJQA 1Q1BA 3RR5A 4LF4L 2B29A 4LFCL 1S3OA 3J81c 4JBWA 1PYBA 3CPFA 2JK8A 1X6OA 4C3HH 5JEAJ 3HOWG 1U0LA 3GTLH 4BY7G 1PA6A 4DR7Q 4JI6L 4NXMQ 1JJ2A 4MNOA 1KHIA 2ZTCA 4BBRG 1YZ6A 3CMEA 4HJ7A 1N33Q 3GTOH 1C7YA 2A8VA 5FLMH 1EFWA 4LWCA 4A3BG 3HOYH 3PUWA 4DUZQ 1KQSA 1M1KC 4R4OA 4EX5A 5IWAQ 1EQRA 4LF5Q 3RLOA 4GNXA 1N9WA 1X55A 4HIOA 2BH8A 2UU9L 3S24A 4A3DG 1R9TH 5EAYA 5M3FH 2AKWB 4X66L 4DKAC 4HIKA 1HZCA 1BBUA 4JI7L 2UXDL 1MIUA 3CCJA 4DV0L 4AQYQ 4A4IA 5GQOA 3OTOL 4JYAQ 2KHJA 1Z9FA 4DV7Q 2IY5B 1V1QA 1IBMQ 1MJEA 4GN4B 3HOXH 3J7ZC 3NENA 1EOVA 3G6EA 4ALPA 3CCSA 3AQQA 5LMUL 3CCEA 1WCMG 4GOPA 4JI5Q 5LMNQ 1Q12A 2Z6KC 4DR1L 3HOZG 2B3GA 4HJ9A 4B3ML 2VNUD 2E5LL 1IXRA 1C0AA 1I5FA 4OWTB 4HJ5A 1PH6A 1VQ5A 4Y7NH 4JBJA 1SROA 2IX0A 1VQDA 2GVBA 4GLXA 3M85A 1Y1WG 3BZKA 1VCIA 4DR3Q 5C4XG 1PFSA 4QIWE 5LMNL 3KDFB 2MO1A 3CAMA 1EUJA 1GVPA 2E8GA 2K50A 3TQYA 5AJ3Q 3G4SA 1LYLA 5FLMG 1EQQA 4A3BH 1AH9A 4DPGA 2ALYB 5IYBG 4DV3Q 1IBML 1VQLA 4YWMA 3ULJA 1UE5A 3AEVA 1Q86C 2RF4A 4GS3A 3I4NH 4JI1L 2Q2TA 4AQYL 1WOCA 4DV0Q 2JA8G 4DR2Q 4XTCS 1YVCA 2R6GA 3STBC 2Z6KA 4AH6A 2VW9A 1PH3A 5HGQA 5BR8L 1J5EQ 3S1QH 4BBSG 1YEZA 3HOVG 4LF5L 1QUQA 3S1NH 4A76A 3I2ZA 2OQKA 4PZ8A 2JA6H 1Q46A 3U58A 3GTPH 4A3FG 2QGQA 2JQOA 2NZOA 1YIJA 1OXUA 2VQEL 4L5RC 4JI8Q 4LF7Q 1IYJB 4GLVB 1NMGA 2Y0SE 4HJAA 3AFQA 4LF7L 2ATWA 3FP9A 1B7YB 2CWPA 5GAGC 2EIFA 3H0GG 4JI3Q 2R92H 2R7ZH 4B3SQ 4R4CA 1WJJA 4A3CG 4IPCA 3K7UC 4JI2Q 3CC2A 4R1JA 1J5EL 4LF4Q 1JJCB 3FKIG 3MEFA 1L1OB 1QVGA 3HOUG 4POGA 3CCRA 4GKJQ 4A93G 2PQAB 1A62A 1VQGA 2N3SA 2YV5A 3BJUA 4JCVE 4RMFA 3G71A 4DV6L 4JC0A 2UUCL 3FKIH 3I7FA 3HOUH 4A3DH 2XGTA 3S17H 2K14A 1PYSB 2ZM6Q 3CCQA 2LXJA 4B3TL 2WFWA 4JV5L 2NZHA 3CCVA 2WAQE 4LUZA 1QZHA 1I3QH 1HH2P 1HR0Q 3CC4A 4UP7A 3S15H 5C4JH 5IYDH 3JAMi 3S2DH 3CCMA 4DR4L 4BY7H 3U4ZA 4IPDA 3HOWH 4OO1G 1CKNA 5JEAG 1PV4A 4KI0A 4B3TQ 2OTLA 1YNXA 2UUBL 3F8TA 1E3PA 1N36L 5DLQE 5GAEC 4BBSH 2UXBQ 3J80i 4DAMA 1OTCA 2FXQA 3LGJA 3T1HL 1EIFA 4B3RQ 4DR6Q 4P75A 1N32L 4C2MH 3CW2C 2UUAQ 1XNRL 4A3MH 2F4VL 1CKNB 2PI2A 5C0XJ 4QL5A 1IBKQ 4JI0Q 3T1YL 1CSPA 1YJNA 1HZBA 4YCWA 1XMQL 3CCLA 3KFUA 3RNUA 1L1OA 2JJQA 1PH8A 4JBMA 4DK3C 1NMFA 3IRBA 4DV7L 1YHQA 4Y52H 3A5UA 3NBHB 1KAWA 5ELOA 3KF8B 1W2BA 4JYAL 3K81C 1J6QA 1YBYA 4YCVA 3G48A 4DUYL 1VQ7A 4LFAL 3ULLA 1ASYA 3CPWA 1HNWQ 1JB7A 3A0JA 1QZGA 2IX1A 3PSIA 2CKZB 4A3JG 3S1RH 2R7DA 4K0KL 3KJPA 3ULPA 3PGZA 4UP8A 1KD1C 1IL2A 5M5WH 2I5MX 2IHFA 2CWAA 1YHBA 1Y1VH 2NVYH 3GD7A 5C44H 1Q1EA 2A19A 2GN5A 2YTYA 4QY7A 1QUQB 1G291 1PH9A 3HKZE 3PF4A 1RL2A 5JJIA 1EIYB 2Q2IA 3E9HA 4A3EG 1OXXK 3KF6A 1VQAA 1Q81C 5K36G 4DV1L 1Z47A 2D0OA 2YTVA 2VY3A 4LF6L 3PO3G 1VQBA 4BXXG 2KHIA 4DR5Q 4DV3L 5C0XI 1W3SA 4KHZA 1RIPA 1E1OA 1I50H 1CSQA 4DR7L 1YI2A 5AJ3L 4NXNQ 1IBKL 4JI0L 1TWCH 1Y1VG 3A5ZB 4LF8Q 4UY8C 2Y0SG 2PI2E 2OQ0A 3KLWA 2F52A 2VS1A 5M3FG 1N32Q 4DR6L 1K73C 2R93H 3JC66 1XPUA 1Q8KA 2D0PA 4A93H 1L0WA 4HJ8A 5FLXc 4GNXB 3T1HQ 4GKKL 4LF9Q 1X56A 3PUYA 2C35B 3RN5A 3I55A 1IBLL 1LTLA 4B3MQ 1XMQQ 3PO2G 4IPGA 3PUXA 3GDEA 3M4OH 1X54A 4OONA 3T1YQ 1NE3A 1JMCA 2PNHA 1DGSA 5LMUQ 3ZJYC 1E22A 4DK6C 2VUMH 2PQAA 4A3LH 3L7ZC 1SE8A 2EXDA 4J15A 4O2DA 4UP9A 5H1SE 1HNZL 3GTQH 3TS2A 2UXCL 3D0FA 3I4OA 3OYYA 3CD6A 3CQZH 2VQFL 1CKMA 2OTJA 3GTMH 5GROA 3OTOQ 1XTDA 2Z0SA 2VL6A 4LW1A 3GTJH 1PH1A 2UUBQ 1BBWA 3BZCA 2A1AA 2OWOA 3HKSA 1IZ6A 4YHHQ 4GOPB 1B8AA 5JJKA 3PV0A 3PUVA 2IT1A 1VQ4A 5M5YH 3U4VA 1KL9A 3PCOB 4IOAA 1S40A 1KRTA 1HJPA 4GLAC 1P16A 2ZJRA 2E2HH 1M90C 4B3SL 3I4NG 3KOJA 2IHEA 4OXPA 3K0XA 2OCEA 4O0AA 3TS0A 3UDIA 3J81j 4IFDG 4KHPL 1UE7A 2AMCB 2MNAA 4X62L 2YYZA 1K0RA 4IPHA 1N33L 2CFMA 3PO2H 1WYDA 2LXKA 1VQ9A 1SMXA 3UE1A 4HIMA 1K83H 4A3IG 5IP7G 4LF8L 3L0OA 1OXSC 3UE0A 2ZTDA 2WAQG 2I5HA 5C4XH 4JI4L 1FJGQ 3ER0A 4JOIC 2HHHQ 5JJLA 4BA2I 1QVCA 2N49A 1K9MC 2R93G 4DV4Q 1HNXQ 1SFOH 1XMOL 3S16H 4DR5L 2B63H 1N34L 1VQEA 4A3CH 4APVA 2R7ZG 4GKKQ 1TWAH 4IJHA 3UDFA 1VS0A 4DV1Q 5IYCH 1TWHH 2Q2HA 2VQEQ 1A0IA 4GN3B 4YCUA 4JBKA 1X3GA 4YY3Q 1K8GA 3L2PA 1SN8A 1WCMH 4POFA 4AYBE 3M3YH 4BXXH 1X65A 4GNXC 4LNQA 3HOXG 1CUKA 2K52A 4NPSA 4NXNL 4A3EH 5BR8Q 4R4IA 1YJ9A 1VQKA 2JA5G 2BA1A 3MXNB 3CMAA 2QA4A 2JA6G 4QQBX 4DR2L 5IYCG 1QVFA 4BA1I 3HOVH 4L5TA 1YITA 4LF6Q 3CP0A 4JI1Q 3W1GA 2WB1G 4YY3L 5C3EH 3VDYA 2L15A 3I4MG 4OO1I 2NN6I 3AYHB 1Q82C 2HT1A 3S2HH 4LFBQ 1OXVA 2AWNA 4A3JH 1N34Q 1SRUA 3NELA 4JOIA 3KYHC 2E5LQ 1HNXL 3F1ZA 3CCUA 1SLJA 2WP8J 1L1OC 2ID0A 2VZAA 4GOPC 3NEMA 3E0EA 2R7FA 1NBWA 1B70B 3HFZB 5IYBH 3CF5A 4JI4Q 4OX9L 1FJGL 3E9IA 4DR3L 2JE6I 3BU2A 4BBRH 2ZTEA 4FDBA 5C0XG 1LUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJL A;  1E24 A;  4B3R L;  1PH2 A;  4RG1 A;  5IT9 c;  4TQU S;  2UXB L;  2LSS A;  3HKZ G;  4A3M G;  1G6P A;  3M4P A;  2N78 A;  3B6Y A;  3M9B A;  5GAD C;  1VQO A;  1S72 A;  4PMW A;  4DR1 Q;  4TVA B;  1OXT A;  2MO0 A;  1UE1 A;  3WWV A;  1VQF A;  4DNI A;  4BY1 G;  4QJF A;  3SGI A;  4EQ5 A;  3J81 i;  2DUD A;  3PIP A;  2E2I H;  1VQP A;  2UUA L;  3HOZ H;  3PUZ A;  5M5X H;  5FJ8 G;  1BKB A;  4AIM A;  1Q7Y C;  2KEN A;  5M3M H;  1EWI A;  3DLL A;  3F2B A;  5J3B A;  4A3K G;  2KCM A;  4X62 Q;  2JA5 H;  1XJV A;  4JV5 Q;  1N36 Q;  4GN5 A;  1I94 L;  3TRE A;  5GAH C;  5IYD G;  4IO9 A;  5ELN A;  4KHP Q;  4L5Q A;  1A8V A;  2UUC Q;  2VUM G;  2BH2 A;  2AHO B;  1NJI C;  1TWF H;  3W1B A;  1HNZ Q;  4UPA A;  4DV2 L;  3F2D A;  4R4T A;  3F2C A;  4JI6 Q;  3S14 H;  1AE3 A;  1C9O A;  1X3F A;  2I5L X;  2JA9 A;  4DV5 L;  2UU9 Q;  1JE5 A;  3UDG A;  1NTG A;  1WI5 A;  4X64 L;  2K5N A;  4MTN A;  2Q2U A;  1UEB A;  1JT8 A;  3TRZ A;  2RHQ B;  3FHW A;  4PZ7 A;  5IP9 H;  2ZM6 L;  1V9P A;  3CXC A;  4A3G H;  1X9N A;  4AYB G;  4A75 A;  4A3I H;  1PVO A;  4DV6 Q;  2ZJP A;  1H95 A;  4JI8 L;  1FVI A;  3U50 C;  3HOY G;  2RCN A;  4GKJ L;  1GD7 A;  1XNQ Q;  1PH7 A;  3A74 A;  4NXM L;  2H5X A;  2KBN A;  1KXL A;  1UE6 A;  5E7N A;  1BVS A;  3RLN A;  4IFD J;  3RZD H;  3PF5 A;  2HIX A;  4P71 A;  4A3F H;  4LFC Q;  4P72 A;  1XNQ L;  1IBL Q;  2DGY A;  2JEA I;  1N8R C;  5FJ8 H;  4LF9 L;  4IOC A;  2I0Q A;  4WJ3 M;  3AFP A;  2D62 A;  3GTK H;  4BY1 H;  5C44 G;  1A63 A;  2XTI A;  2GVA A;  2ES2 A;  2ASB A;  2N8N A;  1L2F A;  4DAY B;  3OW2 A;  4X64 Q;  1MKH A;  1GO3 E;  3JAM c;  4MZ9 A;  1PHJ A;  3EIV A;  1HR0 W;  1K8A C;  4QGU A;  4DV5 Q;  2JA8 H;  3RN2 A;  1SR3 A;  2RHS B;  4X65 Q;  4DV2 Q;  4A3L G;  2JA7 H;  2K5V A;  1K3R A;  1HNW L;  2V1C C;  1V43 A;  3S1M H;  1I94 Q;  1X3E A;  1JJG A;  4C3I H;  1LM0 A;  2JA7 G;  3H3V I;  2HQL A;  1I6H H;  4XIG S;  1E1T A;  1ASZ A;  4L5S A;  4PG3 A;  1GM5 A;  2QEX A;  1P8L A;  1Y1W H;  2NVQ H;  3J80 c;  3GTG H;  3EBE A;  1KRS A;  5IE8 A;  2K4K A;  4P74 A;  2CCZ A;  3ICE A;  2YTX A;  4JG2 A;  4JI5 L;  3I4M H;  4K0K Q;  4KLK A;  2HHH L;  1PH5 A;  2F4V Q;  3TEH B;  5C3E G;  1D8L A;  1VQ8 A;  3RZO H;  4LFA Q;  1FGU A;  4DUY Q;  2NN6 G;  3H15 A;  4OWW B;  3EN2 A;  1G51 A;  2KCT A;  1GKH A;  4H02 A;  3UDX A;  1VQJ A;  1KIX A;  3M7N A;  1T9H A;  4X6A H;  2NVT H;  3W5O A;  1XPO A;  3PO3 H;  5IY0 A;  4OWX B;  4JI7 Q;  4OX9 Q;  1VQN A;  2UXD Q;  4DR4 Q;  1WFQ A;  4YWL A;  1YHA A;  3Q8D A;  4X66 Q;  1YJW A;  3M4Q A;  4P73 A;  3PIO A;  1MJC A;  1XNR Q;  1VQC A;  2PMZ E;  2B63 G;  2YU9 H;  2MFI A;  4A3G G;  3H3V H;  2JEB I;  4LFB L;  5IP9 G;  4YHH L;  4DUZ L;  1CKO A;  1Y14 B;  4LUV A;  4R4Q A;  3ERS X;  2HIV A;  5LMN W;  3GO5 A;  1XPR A;  1FL0 A;  4YWK A;  2VQF Q;  1VQI A;  3KDF A;  2WB1 E;  3J7A 5;  1UWV A;  5IP7 H;  2UXC Q;  1TXY A;  4IFD I;  1PH4 A;  4NB3 A;  1AE2 A;  3H0G H;  2R92 G;  4X65 L;  4LUO A;  3K7A H;  1U5K A;  5HY6 A;  1VQ6 A;  3K8A A;  1HR0 L;  1D7Q A;  1KC8 C;  4JI2 L;  2E2J H;  1HZ9 A;  5IWA L;  2NVX H;  4JI3 L;  2BA0 A;  3K80 C;  3KF6 B;  1NY4 A;  2CQO A;  2MQH A;  2EQS A;  1HZA A;  3DM3 A;  4PZ6 A;  4C3J H;  4HID A;  4A3K H;  2AWO A;  4ME3 A;  5M3M G;  1EYG A;  3RLF A;  3I56 A;  4WJ4 A;  2K75 A;  3D31 A;  3KJO A;  3CC7 A;  2F3I A;  2K5H A;  1VQH A;  1VQM A;  3STB D;  1O7I A;  1XMO Q;  1TWG H;  1E7Z A;  4DV4 L;  2ZJQ A;  1Q1B A;  3RR5 A;  4LF4 L;  2B29 A;  4LFC L;  1S3O A;  3J81 c;  4JBW A;  1PYB A;  3CPF A;  2JK8 A;  1X6O A;  4C3H H;  5JEA J;  3HOW G;  1U0L A;  3GTL H;  4BY7 G;  1PA6 A;  4DR7 Q;  4JI6 L;  4NXM Q;  1JJ2 A;  4MNO A;  1KHI A;  2ZTC A;  4BBR G;  1YZ6 A;  3CME A;  4HJ7 A;  1N33 Q;  3GTO H;  1C7Y A;  2A8V A;  5FLM H;  1EFW A;  4LWC A;  4A3B G;  3HOY H;  3PUW A;  4DUZ Q;  1KQS A;  1M1K C;  4R4O A;  4EX5 A;  5IWA Q;  1EQR A;  4LF5 Q;  3RLO A;  4GNX A;  1N9W A;  1X55 A;  4HIO A;  2BH8 A;  2UU9 L;  3S24 A;  4A3D G;  1R9T H;  5EAY A;  5M3F H;  2AKW B;  4X66 L;  4DKA C;  4HIK A;  1HZC A;  1BBU A;  4JI7 L;  2UXD L;  1MIU A;  3CCJ A;  4DV0 L;  4AQY Q;  4A4I A;  5GQO A;  3OTO L;  4JYA Q;  2KHJ A;  1Z9F A;  4DV7 Q;  2IY5 B;  1V1Q A;  1IBM Q;  1MJE A;  4GN4 B;  3HOX H;  3J7Z C;  3NEN A;  1EOV A;  3G6E A;  4ALP A;  3CCS A;  3AQQ A;  5LMU L;  3CCE A;  1WCM G;  4GOP A;  4JI5 Q;  5LMN Q;  1Q12 A;  2Z6K C;  4DR1 L;  3HOZ G;  2B3G A;  4HJ9 A;  4B3M L;  2VNU D;  2E5L L;  1IXR A;  1C0A A;  1I5F A;  4OWT B;  4HJ5 A;  1PH6 A;  1VQ5 A;  4Y7N H;  4JBJ A;  1SRO A;  2IX0 A;  1VQD A;  2GVB A;  4GLX A;  3M85 A;  1Y1W G;  3BZK A;  1VCI A;  4DR3 Q;  5C4X G;  1PFS A;  4QIW E;  5LMN L;  3KDF B;  2MO1 A;  3CAM A;  1EUJ A;  1GVP A;  2E8G A;  2K50 A;  3TQY A;  5AJ3 Q;  3G4S A;  1LYL A;  5FLM G;  1EQQ A;  4A3B H;  1AH9 A;  4DPG A;  2ALY B;  5IYB G;  4DV3 Q;  1IBM L;  1VQL A;  4YWM A;  3ULJ A;  1UE5 A;  3AEV A;  1Q86 C;  2RF4 A;  4GS3 A;  3I4N H;  4JI1 L;  2Q2T A;  4AQY L;  1WOC A;  4DV0 Q;  2JA8 G;  4DR2 Q;  4XTC S;  1YVC A;  2R6G A;  3STB C;  2Z6K A;  4AH6 A;  2VW9 A;  1PH3 A;  5HGQ A;  5BR8 L;  1J5E Q;  3S1Q H;  4BBS G;  1YEZ A;  3HOV G;  4LF5 L;  1QUQ A;  3S1N H;  4A76 A;  3I2Z A;  2OQK A;  4PZ8 A;  2JA6 H;  1Q46 A;  3U58 A;  3GTP H;  4A3F G;  2QGQ A;  2JQO A;  2NZO A;  1YIJ A;  1OXU A;  2VQE L;  4L5R C;  4JI8 Q;  4LF7 Q;  1IYJ B;  4GLV B;  1NMG A;  2Y0S E;  4HJA A;  3AFQ A;  4LF7 L;  2ATW A;  3FP9 A;  1B7Y B;  2CWP A;  5GAG C;  2EIF A;  3H0G G;  4JI3 Q;  2R92 H;  2R7Z H;  4B3S Q;  4R4C A;  1WJJ A;  4A3C G;  4IPC A;  3K7U C;  4JI2 Q;  3CC2 A;  4R1J A;  1J5E L;  4LF4 Q;  1JJC B;  3FKI G;  3MEF A;  1L1O B;  1QVG A;  3HOU G;  4POG A;  3CCR A;  4GKJ Q;  4A93 G;  2PQA B;  1A62 A;  1VQG A;  2N3S A;  2YV5 A;  3BJU A;  4JCV E;  4RMF A;  3G71 A;  4DV6 L;  4JC0 A;  2UUC L;  3FKI H;  3I7F A;  3HOU H;  4A3D H;  2XGT A;  3S17 H;  2K14 A;  1PYS B;  2ZM6 Q;  3CCQ A;  2LXJ A;  4B3T L;  2WFW A;  4JV5 L;  2NZH A;  3CCV A;  2WAQ E;  4LUZ A;  1QZH A;  1I3Q H;  1HH2 P;  1HR0 Q;  3CC4 A;  4UP7 A;  3S15 H;  5C4J H;  5IYD H;  3JAM i;  3S2D H;  3CCM A;  4DR4 L;  4BY7 H;  3U4Z A;  4IPD A;  3HOW H;  4OO1 G;  1CKN A;  5JEA G;  1PV4 A;  4KI0 A;  4B3T Q;  2OTL A;  1YNX A;  2UUB L;  3F8T A;  1E3P A;  1N36 L;  5DLQ E;  5GAE C;  4BBS H;  2UXB Q;  3J80 i;  4DAM A;  1OTC A;  2FXQ A;  3LGJ A;  3T1H L;  1EIF A;  4B3R Q;  4DR6 Q;  4P75 A;  1N32 L;  4C2M H;  3CW2 C;  2UUA Q;  1XNR L;  4A3M H;  2F4V L;  1CKN B;  2PI2 A;  5C0X J;  4QL5 A;  1IBK Q;  4JI0 Q;  3T1Y L;  1CSP A;  1YJN A;  1HZB A;  4YCW A;  1XMQ L;  3CCL A;  3KFU A;  3RNU A;  1L1O A;  2JJQ A;  1PH8 A;  4JBM A;  4DK3 C;  1NMF A;  3IRB A;  4DV7 L;  1YHQ A;  4Y52 H;  3A5U A;  3NBH B;  1KAW A;  5ELO A;  3KF8 B;  1W2B A;  4JYA L;  3K81 C;  1J6Q A;  1YBY A;  4YCV A;  3G48 A;  4DUY L;  1VQ7 A;  4LFA L;  3ULL A;  1ASY A;  3CPW A;  1HNW Q;  1JB7 A;  3A0J A;  1QZG A;  2IX1 A;  3PSI A;  2CKZ B;  4A3J G;  3S1R H;  2R7D A;  4K0K L;  3KJP A;  3ULP A;  3PGZ A;  4UP8 A;  1KD1 C;  1IL2 A;  5M5W H;  2I5M X;  2IHF A;  2CWA A;  1YHB A;  1Y1V H;  2NVY H;  3GD7 A;  5C44 H;  1Q1E A;  2A19 A;  2GN5 A;  2YTY A;  4QY7 A;  1QUQ B;  1G29 1;  1PH9 A;  3HKZ E;  3PF4 A;  1RL2 A;  5JJI A;  1EIY B;  2Q2I A;  3E9H A;  4A3E G;  1OXX K;  3KF6 A;  1VQA A;  1Q81 C;  5K36 G;  4DV1 L;  1Z47 A;  2D0O A;  2YTV A;  2VY3 A;  4LF6 L;  3PO3 G;  1VQB A;  4BXX G;  2KHI A;  4DR5 Q;  4DV3 L;  5C0X I;  1W3S A;  4KHZ A;  1RIP A;  1E1O A;  1I50 H;  1CSQ A;  4DR7 L;  1YI2 A;  5AJ3 L;  4NXN Q;  1IBK L;  4JI0 L;  1TWC H;  1Y1V G;  3A5Z B;  4LF8 Q;  4UY8 C;  2Y0S G;  2PI2 E;  2OQ0 A;  3KLW A;  2F52 A;  2VS1 A;  5M3F G;  1N32 Q;  4DR6 L;  1K73 C;  2R93 H;  3JC6 6;  1XPU A;  1Q8K A;  2D0P A;  4A93 H;  1L0W A;  4HJ8 A;  5FLX c;  4GNX B;  3T1H Q;  4GKK L;  4LF9 Q;  1X56 A;  3PUY A;  2C35 B;  3RN5 A;  3I55 A;  1IBL L;  1LTL A;  4B3M Q;  1XMQ Q;  3PO2 G;  4IPG A;  3PUX A;  3GDE A;  3M4O H;  1X54 A;  4OON A;  3T1Y Q;  1NE3 A;  1JMC A;  2PNH A;  1DGS A;  5LMU Q;  3ZJY C;  1E22 A;  4DK6 C;  2VUM H;  2PQA A;  4A3L H;  3L7Z C;  1SE8 A;  2EXD A;  4J15 A;  4O2D A;  4UP9 A;  5H1S E;  1HNZ L;  3GTQ H;  3TS2 A;  2UXC L;  3D0F A;  3I4O A;  3OYY A;  3CD6 A;  3CQZ H;  2VQF L;  1CKM A;  2OTJ A;  3GTM H;  5GRO A;  3OTO Q;  1XTD A;  2Z0S A;  2VL6 A;  4LW1 A;  3GTJ H;  1PH1 A;  2UUB Q;  1BBW A;  3BZC A;  2A1A A;  2OWO A;  3HKS A;  1IZ6 A;  4YHH Q;  4GOP B;  1B8A A;  5JJK A;  3PV0 A;  3PUV A;  2IT1 A;  1VQ4 A;  5M5Y H;  3U4V A;  1KL9 A;  3PCO B;  4IOA A;  1S40 A;  1KRT A;  1HJP A;  4GLA C;  1P16 A;  2ZJR A;  2E2H H;  1M90 C;  4B3S L;  3I4N G;  3KOJ A;  2IHE A;  4OXP A;  3K0X A;  2OCE A;  4O0A A;  3TS0 A;  3UDI A;  3J81 j;  4IFD G;  4KHP L;  1UE7 A;  2AMC B;  2MNA A;  4X62 L;  2YYZ A;  1K0R A;  4IPH A;  1N33 L;  2CFM A;  3PO2 H;  1WYD A;  2LXK A;  1VQ9 A;  1SMX A;  3UE1 A;  4HIM A;  1K83 H;  4A3I G;  5IP7 G;  4LF8 L;  3L0O A;  1OXS C;  3UE0 A;  2ZTD A;  2WAQ G;  2I5H A;  5C4X H;  4JI4 L;  1FJG Q;  3ER0 A;  4JOI C;  2HHH Q;  5JJL A;  4BA2 I;  1QVC A;  2N49 A;  1K9M C;  2R93 G;  4DV4 Q;  1HNX Q;  1SFO H;  1XMO L;  3S16 H;  4DR5 L;  2B63 H;  1N34 L;  1VQE A;  4A3C H;  4APV A;  2R7Z G;  4GKK Q;  1TWA H;  4IJH A;  3UDF A;  1VS0 A;  4DV1 Q;  5IYC H;  1TWH H;  2Q2H A;  2VQE Q;  1A0I A;  4GN3 B;  4YCU A;  4JBK A;  1X3G A;  4YY3 Q;  1K8G A;  3L2P A;  1SN8 A;  1WCM H;  4POF A;  4AYB E;  3M3Y H;  4BXX H;  1X65 A;  4GNX C;  4LNQ A;  3HOX G;  1CUK A;  2K52 A;  4NPS A;  4NXN L;  4A3E H;  5BR8 Q;  4R4I A;  1YJ9 A;  1VQK A;  2JA5 G;  2BA1 A;  3MXN B;  3CMA A;  2QA4 A;  2JA6 G;  4QQB X;  4DR2 L;  5IYC G;  1QVF A;  4BA1 I;  3HOV H;  4L5T A;  1YIT A;  4LF6 Q;  3CP0 A;  4JI1 Q;  3W1G A;  2WB1 G;  4YY3 L;  5C3E H;  3VDY A;  2L15 A;  3I4M G;  4OO1 I;  2NN6 I;  3AYH B;  1Q82 C;  2HT1 A;  3S2H H;  4LFB Q;  1OXV A;  2AWN A;  4A3J H;  1N34 Q;  1SRU A;  3NEL A;  4JOI A;  3KYH C;  2E5L Q;  1HNX L;  3F1Z A;  3CCU A;  1SLJ A;  2WP8 J;  1L1O C;  2ID0 A;  2VZA A;  4GOP C;  3NEM A;  3E0E A;  2R7F A;  1NBW A;  1B70 B;  3HFZ B;  5IYB H;  3CF5 A;  4JI4 Q;  4OX9 L;  1FJG L;  3E9I A;  4DR3 L;  2JE6 I;  3BU2 A;  4BBR H;  2ZTE A;  4FDB A;  5C0X G;  1LUZ A; 
#chains in the Genus database with same CATH topology
 1O7Y A;  4K8I A;  4RG1 A;  5IT9 c;  4TQU S;  5HUR A;  2LSS A;  3HKZ G;  4A3M G;  3M4P A;  3B6Y A;  1VQO A;  1S72 A;  1C8C A;  1A15 A;  2MO0 A;  4DNI A;  1B2T A;  5IGF A;  4QJF A;  3TME A;  3H91 A;  4EQ5 A;  5A35 A;  5LHY 1;  1VQP A;  1S5B D;  5FJ8 G;  1BKB A;  4H13 C;  2F1M A;  2KCM A;  1IW7 C;  3K5O A;  4JV5 Q;  1CFM A;  4GN5 A;  1I94 L;  5GAH C;  2RBM A;  5ELN A;  5D14 A;  2VUM G;  2F0N A;  1MI2 A;  2BH2 A;  2AHO B;  1NJI C;  1I4P A;  4IUU A;  4DV2 L;  3S14 H;  1AE3 A;  1C9O A;  2JA9 A;  1SE3 A;  2BOS A;  4A3E B;  2IWH A;  3J80 L;  4HMI A;  2MJ8 A;  1BXT A;  1ZYR C;  1ILQ A;  5I9P A;  4CKB A;  1JT8 A;  2RHQ B;  4PZ7 A;  5IP9 H;  3PO3 B;  1ET6 A;  1A3T A;  1H9S A;  1QNU A;  5C6A A;  1H95 A;  1FVI A;  5FO8 B;  1CHP D;  2A69 C;  1WD1 A;  3HOY G;  3BZD B;  1J8I A;  3T51 B;  2EY5 A;  2DY7 A;  5E7N A;  1JCK B;  3PMF A;  1K8M A;  4FXK C;  1EYA A;  4IFD J;  2HIX A;  4A3F H;  2YU9 B;  1XNQ L;  3MXN A;  5C4X B;  5FJ8 H;  4IOC A;  2I0Q A;  3SVM A;  4IUR A;  5FK9 C;  3SXH A;  1JE4 A;  1SYD A;  4DAY B;  4IUN A;  4MZ9 A;  2FMM A;  2JA8 B;  2HCI A;  5FOB B;  3MAQ A;  1D5X C;  4DV2 Q;  1F9S A;  3Q0A A;  1DJR D;  4PV1 C;  1A2T A;  1NUC A;  2V1C C;  1V43 A;  3IL8 A;  3KBX A;  2KEC A;  1JJG A;  3H3V I;  1QNK A;  1EL0 A;  1F9P A;  2QEX A;  4ILW A;  1P8L A;  2CH4 W;  2I07 B;  3I73 A;  3EBE A;  5IOC A;  2RCF A;  5IE8 A;  3BVZ A;  1EEI D;  3K7A B;  2B2U C;  4K2L A;  4KLK A;  3TEH B;  2HCC A;  4LFA Q;  1FGU A;  1BNZ A;  1TY2 A;  2NN6 G;  2KCT A;  4P2C B;  4H02 A;  3P75 A;  1KIX A;  1VQJ A;  3M7N A;  1T9H A;  4G7Z C;  2NVT H;  4RFB A;  4F8M A;  1HQM C;  1D6E C;  4DXF A;  1WFQ A;  1YJW A;  1DOM A;  2CW0 D;  1VQC A;  1D5M C;  3MVV A;  2MHV A;  3H3V H;  4LFB L;  5IP9 G;  1KNE A;  4H7B A;  4DUZ L;  1CKO A;  1Y14 B;  3GO5 A;  4YWK A;  1VQI A;  1ONL A;  2K01 A;  3KDF A;  4KN4 C;  5C3W A;  1AP0 A;  2F0E A;  1STG A;  4X65 L;  5HY6 A;  1VQ6 A;  1HR0 L;  1D7Q A;  3K6O A;  1GXD C;  4IFD H;  1F9R A;  3KF6 B;  2H4O A;  4PZ6 A;  1EYC A;  1HZA A;  2PYK A;  3HOW B;  3VYS A;  2AWO A;  2HD3 A;  2O4X A;  4ME3 A;  3I56 A;  2PCF B;  4N9T A;  2F3I A;  1O7I A;  1E7Z A;  1EU3 A;  2ZJQ A;  3M4O B;  3VR4 A;  3FPU B;  4JBW A;  1PYB A;  4G7H C;  5JEA H;  2K05 A;  4PMB A;  4OO1 H;  4BY7 G;  2M9V A;  4A3J B;  2EYL A;  4FF3 A;  2F0V A;  1LLR D;  5FLX E;  1KHI A;  2HDM A;  3HKZ B;  2KCC A;  4IN3 A;  5DM6 3;  1C7Y A;  2PQE A;  1WVL A;  1TWF B;  1M1K C;  1EQR A;  1HUM A;  1N9W A;  3S24 A;  3IFT A;  2B2T C;  1WTH A;  1JC7 A;  1HUN A;  3H09 A;  1HZC A;  2UXD L;  4N8X 1;  3CCJ A;  2M2L A;  1TT2 A;  3Q23 A;  2SOB A;  3MC0 B;  2NVY B;  2R3Z A;  5C44 B;  1S5E D;  1JQY D;  3G7L A;  4L8J A;  4RKB A;  1MD2 D;  3I8Z A;  3BDC A;  4DV7 Q;  1MJE A;  3G6E A;  3CCS A;  3AQQ A;  5LMU L;  3K5M A;  1KAA A;  4C56 C;  1K83 B;  4GOP A;  2X6L A;  2PMZ B;  2B3G A;  2VNU D;  3ERQ A;  4EQO A;  1PH6 A;  3T4A C;  3HOY B;  1HXY D;  4JBJ A;  1SRO A;  1VQD A;  4GLX A;  1Y1W G;  4CDD C;  1QJO A;  3K0Y A;  4XYQ A;  4RHS A;  3TQY A;  2E8G A;  1LTT D;  5KNC A;  1UE5 A;  1DYQ A;  2Q2T A;  2JA8 G;  2F4I A;  4RH6 A;  1JWS D;  1TY0 A;  4XTC S;  4AH6 A;  4DF7 A;  2Z6K A;  1PH3 A;  1VF7 A;  4BBS G;  4KKT A;  1KDA A;  2A6E D;  3SR1 A;  4A76 A;  2F0H A;  2OQK A;  4K6L A;  4A3F G;  2JQO A;  3NTH A;  4OEM B;  1YIJ A;  4L5R C;  1WTO A;  4PQX A;  5C5M A;  2CWP A;  3QJY A;  1D1K A;  1GJX A;  1Y8N B;  1ENA A;  4ODG A;  4ZYS A;  4WFN 3;  1SYG A;  4R1J A;  4KY6 A;  1QVG A;  2PO4 A;  3CCR A;  4GKJ Q;  1A62 A;  2YV5 A;  3I90 A;  3G71 A;  4A3D H;  4JC0 A;  2UUC L;  1I4Q A;  1EOT A;  3S17 H;  2K14 A;  5FO9 B;  1PYS B;  2K1B A;  1WTQ A;  3S1Q B;  1U4P A;  1ESF A;  3TBI B;  3ITP A;  3BS1 A;  1ET9 A;  4BY7 H;  3U4Z A;  4OO1 G;  3BVG A;  5JAV A;  5JEA G;  2OTL A;  1YNX A;  2F0U A;  1E3P A;  2F0M A;  5DLQ E;  5GAE C;  1N36 L;  1GUN A;  4BBS H;  3T1H L;  4ZRZ A;  3LNN A;  3KLR A;  4KN7 C;  4C3H B;  1SYB A;  1LT5 D;  4QL5 A;  4RGN A;  4JI0 Q;  3T1Y L;  5C0X H;  3RD4 A;  3CCL A;  3RNU A;  1L1O A;  1PH8 A;  4JBM A;  4DV7 L;  2P5Z X;  1H9R A;  1RTN A;  2SNS A;  4Y52 H;  4JYA L;  5KGU A;  2RA4 A;  3G48 A;  4LFA L;  1VQ7 A;  1ASY A;  2AUK A;  1QZG A;  4A3J G;  1I6H B;  3T13 A;  3KJP A;  2ZXR A;  1S5C D;  3PGZ A;  1WCM B;  3TDQ A;  1IL2 A;  2A5H A;  2EJF C;  1Z7T A;  5KIX A;  1R4P B;  4QY7 A;  2GN5 A;  2YTY A;  1QUQ B;  1PH9 A;  2O5J C;  2Q2I A;  1J9O A;  1QIL A;  2D0O A;  2QW7 A;  2K5Q A;  2VY3 A;  1DM0 B;  2F0T A;  4LF6 L;  1VQB A;  2B8G A;  4DAP A;  4WJW A;  5C0X I;  3SK5 A;  1YI2 A;  4JI0 L;  1Y69 U;  3S14 B;  4ZK9 B;  2C5C A;  1FNV A;  4UY8 C;  4FO2 A;  5M3F G;  1N32 Q;  1K73 C;  1Q8K A;  2L1B A;  2RVL A;  1V1O A;  4X3U A;  5ELC A;  3QWN A;  3CKI B;  4B3M Q;  2F3W A;  3GDE A;  3QR8 A;  3F2U A;  4HSP A;  3ZJY C;  4DK6 C;  4QMG A;  4O2D A;  4UP9 A;  3CQZ B;  2UXC L;  3D0F A;  5DNF A;  2KUM A;  2LS0 1;  1CKM A;  3GTJ H;  2A74 C;  1BBW A;  2A1A A;  1S5D D;  3NE5 B;  3HKS A;  1V8Q A;  2F0F A;  1VQ4 A;  3O13 A;  1HJP A;  4GLA C;  1VDZ A;  1M90 C;  3H6M A;  3I4N G;  4OXP A;  3K0X A;  5HGT A;  4FNF A;  1HTL D;  1U4R A;  3J81 j;  5FO7 B;  2MNA A;  4DK1 A;  2YYZ A;  1EQV A;  1I4G A;  1PZJ D;  3PO2 H;  1WYD A;  1Y8P B;  1SAP A;  3UE1 A;  5NUC A;  3WDN A;  5IP7 G;  4A3I G;  2PZW A;  3UE0 A;  2WAQ G;  1FJG Q;  5C4X H;  3ER0 A;  1IW7 D;  3A7A B;  4BA2 I;  2R93 G;  1ICW A;  4OIJ A;  5E3F A;  1XMO L;  4DR5 L;  4EQP A;  4GKK Q;  2XRQ D;  1VMP A;  2F0I A;  4IJH A;  3UDF A;  5EPJ A;  4YCU A;  3QO2 A;  1JOQ A;  1WCM H;  2WB1 B;  3FVQ A;  2K7V A;  3MWY W;  1SNC A;  4AYB E;  3M3Y H;  1X65 A;  4FP5 D;  4LNQ A;  4BXX H;  1SXT A;  2JA5 G;  3DUZ A;  1YJ9 A;  5KRU A;  4R4I A;  3A8I E;  1D1I A;  5ELD A;  2BA1 A;  4M1U B;  3CMA A;  2JA6 G;  1DXM A;  4QQB X;  1CTM A;  2EOT A;  3I4L A;  3S1M B;  3NQI A;  4L5T A;  3CRL C;  1BO0 A;  3CRK C;  4KTA A;  1Q82 C;  1PRT C;  1SRU A;  2JYO A;  5ISR A;  2EDG A;  4RGO S;  5IOD A;  4GOP C;  2R7F A;  5I4D A;  5IYB H;  1FJG L;  3NQT A;  4DR3 L;  1ILP A;  3BU2 A;  4WRD A;  1U9R A;  4BBR H;  2ZTE A;  4IJL A;  4B3R L;  4DK0 A;  1PH2 A;  3J7A F;  3VA5 A;  4DFA A;  1AZQ A;  4DXG A;  1ML0 D;  4C3H G;  3M9B A;  2N78 A;  5GAD C;  1BUV T;  4PMW A;  4DR1 Q;  2FFK B;  2NBF A;  1OXT A;  3SK8 A;  4BY1 G;  2E2I H;  1LV9 A;  2UUA L;  5D3I B;  5M5X H;  4ZCK A;  4EGV A;  2KEN A;  1FNW A;  1EWI A;  3H94 A;  4K2K A;  3F2B A;  2KA7 A;  4X62 Q;  1XJV A;  1U4L A;  4KHP Q;  4L5Q A;  3K58 A;  1BCP F;  2UUC Q;  4XT1 B;  1TWF H;  3W1B A;  3F2D A;  4R4T A;  4FYD A;  5EKI A;  4DV5 L;  4RAU C;  4MN3 A;  5ELE A;  3UDG A;  4A3K B;  1I50 B;  1WI5 A;  2K5N A;  2Q2U A;  1UEB A;  1D2B A;  3C3L A;  3TRZ A;  4OL7 A;  1V9P A;  4A3G H;  1AEX A;  4A75 A;  1RHP A;  4JI8 L;  3U50 C;  5KYI A;  4GKJ L;  3A7L A;  1XNQ Q;  1PH7 A;  3A74 A;  2XWJ B;  1D5Z C;  3RZD H;  2EYF A;  4P72 A;  2CQA A;  2DGY A;  2JEA I;  3PO2 B;  1N8R C;  1DOL A;  1LTB D;  5C44 G;  2ASB A;  4X3K A;  1DOK A;  1PLF A;  3JAM c;  2HDL A;  1LTA D;  4QIW B;  1HR0 W;  3P1H A;  1KDB A;  2E2H B;  4X65 Q;  1FR3 A;  4A3L G;  2QKI C;  3D4D A;  1X3E A;  5CBA E;  1LM0 A;  4F88 A;  4L5S A;  3GTG B;  1BR9 A;  1EY7 A;  3ZYY X;  4HTH A;  2CCZ A;  3MFY A;  3VR6 A;  3WOF A;  3ICE A;  1RTO A;  2YTX A;  4JI5 L;  1NR4 A;  3NP8 A;  4K0K Q;  1PH5 A;  3H0G B;  5A2Q L;  3VYU A;  1VQ8 A;  2JXM B;  2Z4H A;  3H15 A;  1CA5 A;  4OWW B;  3EN2 A;  1G51 A;  2WAC A;  3FKI B;  1STY A;  1GKH A;  3TP5 A;  3UDX A;  4X6A H;  4A3I B;  2WAQ B;  4A93 B;  5K36 H;  2UXD Q;  3OSO A;  4JVZ A;  1YHA A;  3Q8D A;  2F0Q A;  4BBS B;  3M4Q A;  4IAL A;  3PIO A;  3D4W A;  1HA6 A;  2MFI A;  5EBC A;  2PW7 A;  1JIC A;  2QF7 A;  3R93 A;  1X3Q A;  1FL0 A;  2VQF Q;  4FXD A;  4NDX A;  1UWV A;  5IP7 H;  1QE6 A;  1TXY A;  2UXC Q;  4NB3 A;  2A6H C;  4OHJ A;  2EE1 A;  4FF2 A;  4NW2 A;  5CYU A;  3NXW A;  2B2T A;  4JI3 L;  2BA0 A;  2CQO A;  1HA5 A;  3SE0 A;  4BY7 B;  5FKA C;  2EJG C;  3RLF A;  1B3Q A;  3A8K E;  1W6K A;  3D31 A;  1SJH D;  4ZKC B;  3RR5 A;  4LFC L;  2JK8 A;  1PRT D;  3W3A A;  4C3H H;  1PA6 A;  5M3M B;  2PZT A;  3I3C A;  2FHT A;  4HSV A;  4MNO A;  2QEJ C;  1YZ6 A;  1U4M A;  5FLM H;  1EFW A;  1DD2 A;  1WTP A;  1KQS A;  4OGQ C;  4R4O A;  4EX5 A;  5J1Z A;  4TSS A;  1X55 A;  3PIP 3;  4OEL B;  3T56 B;  3M3Y B;  1ZYR D;  2TMP A;  5EAY A;  4DKA C;  4HIK A;  3P7J A;  5AFW A;  1BBU A;  2F0L A;  4JI7 L;  1SMY D;  2PW5 A;  4AQY Q;  5GQO A;  3OTO L;  2Q8I B;  5EPK A;  4R8I A;  4TKO B;  5M9O A;  4FVM A;  1YNJ C;  2O2L D;  2OT2 A;  4GN4 B;  1Y1W B;  1WD0 A;  1PFN A;  5IT9 L;  3CCE A;  1WCM G;  2RDG A;  4JI5 Q;  1W6J A;  2Z6K C;  3HOZ G;  2EYM A;  1ESR A;  4DNR B;  4OWT B;  2B8F A;  3VA7 A;  4HJ5 A;  3KBG A;  4Y7N H;  1EEF D;  1Q8I A;  2IX0 A;  2GVB A;  1CK1 A;  1A3U A;  3M85 A;  1SMY C;  2KQ3 A;  3BZK A;  1VCI A;  4DR3 Q;  1K28 A;  5C4X G;  1KLG D;  4QIW E;  4G57 A;  1II3 A;  2M00 A;  1EUJ A;  2K50 A;  1GVP A;  3CAM A;  5AJ3 Q;  1GUS A;  3PIO 3;  1LYL A;  5FLM G;  1EQQ A;  4X3T A;  4DNT B;  1IL8 A;  4IUV A;  4NMZ A;  5IYB G;  5LL6 S;  4DV3 Q;  5M3F B;  1TII D;  1Q86 C;  4GS3 A;  4AQY L;  4DV0 Q;  2DNC A;  1SNO A;  1O80 A;  4XT3 B;  4DR2 Q;  4I7A A;  2CHB D;  4IZ8 A;  5D65 A;  1XX8 A;  5BR8 L;  2VB2 X;  1EU4 A;  2D2C C;  3S1N H;  4JK1 C;  3BYT B;  4R9W A;  2JA6 H;  3GTP H;  1LT4 D;  1HCZ A;  2D9U A;  4I65 A;  4JI8 Q;  2Y0S E;  2K33 A;  4J8Q A;  3AFQ A;  4LF7 L;  2ATW A;  3J81 L;  3FP9 A;  2A68 C;  3T16 A;  1MGS A;  3H0G G;  4JI3 Q;  2R92 H;  2R7Z H;  4C1N I;  1SNM A;  3K7U C;  4JI2 Q;  2IX3 A;  4LF4 Q;  3FKI G;  2QDL A;  3MEF A;  1Z6H A;  4POG A;  1VQG A;  2N3S A;  3V96 A;  3BJU A;  3OIQ A;  5T1G A;  2LMC B;  3I7F A;  3Q22 A;  3NSW A;  2HUG A;  4V0B A;  2ZM6 Q;  3CCQ A;  2E2D C;  2J7Z A;  2NZH A;  2WAQ E;  2LY7 A;  1HH2 P;  3R3O A;  3S1R B;  3S15 H;  1M4V A;  5IYD H;  3JAM i;  3I4M B;  2R93 B;  3QIA A;  2X69 A;  3S2D H;  3CCM A;  1PDQ A;  4C3J B;  4DR4 L;  4IPD A;  1CKN A;  2F0J A;  3EQL C;  1EZ6 A;  3J80 i;  3LGJ A;  3DXJ C;  4A3B B;  1EY6 A;  1RJT A;  1QOH A;  4C2M H;  1SYF A;  3OPO A;  3V2T A;  1XNR L;  3W2D A;  1TS5 A;  2JA5 B;  4K6D A;  1EIG A;  4RCO A;  1XMQ L;  3RUZ A;  4DK3 C;  1NMF A;  1QCB D;  3SEB A;  3A5U A;  3GTJ B;  3KF8 B;  1SE2 A;  3K81 C;  1J6Q A;  5K5P A;  2Z4I A;  2MP1 A;  5KYL A;  3ULL A;  4LJZ C;  2IX1 A;  2G9H D;  4K5V A;  2R7D A;  5ELB A;  1KD1 C;  1AFP A;  1RD9 D;  4ZUJ A;  4H0L C;  4JPB W;  1DON A;  1SBB B;  2IHF A;  1YHB A;  1CHQ D;  3GD7 A;  3M4Y A;  3E9H A;  4JW0 A;  4DN4 M;  1Q81 C;  2JSO A;  4RHR A;  5K36 G;  4ME5 A;  5IT9 E;  2Z6B A;  2E74 C;  5JPN C;  1WTW A;  2BE5 D;  4DV3 L;  3NHH A;  2BDN A;  4DR7 L;  5IIF A;  3I70 A;  5AJ3 L;  1TWC H;  2G5D A;  5I9O A;  3GQB A;  1MSG A;  2OQ0 A;  2PI2 E;  4XQJ A;  2R93 H;  4DR6 L;  4QUC A;  1XPU A;  5DAU A;  2D0P A;  4A93 H;  2GA4 B;  1L0W A;  4GNX B;  4GKK L;  4LF9 Q;  1X56 A;  2C35 B;  3D8G A;  5EKL A;  3HEJ A;  4C2M B;  4IPG A;  3PUX A;  5M5X B;  4OON A;  1NE3 A;  2PNH A;  4CDC C;  1G91 A;  3HP3 A;  1L0Y B;  2PQA A;  1O7L A;  4A3L H;  1HNZ L;  1T5E A;  5CV9 A;  4N9P A;  4C3I B;  2OTJ A;  2WKC A;  1XTD A;  2ICE C;  2VL6 A;  4LW1 A;  3BZC A;  1LAB A;  1IZ6 A;  3CHB D;  1B8A A;  3NTK A;  3X3M A;  5JJK A;  3HG9 A;  3PV0 A;  5M5Y H;  4IOA A;  2JA7 B;  1KRT A;  4OIK A;  2E2H H;  4IUQ A;  1HFG A;  2OCE A;  1H9K A;  3A56 A;  5G3L F;  3UDI A;  4UHV A;  3LX0 A;  3OIP A;  2AMC B;  3TN2 A;  1E2Z A;  3TZD A;  4X62 L;  2D5D A;  5EBD A;  5C3E B;  2LXK A;  1VQ9 A;  3ERO A;  1K83 H;  4A3F B;  3DMU A;  2ZTD A;  2I5H A;  5JJL A;  4JOI C;  1FYC A;  1QVC A;  2N49 A;  1K9M C;  4DV4 Q;  1C48 A;  5I2X A;  2JA6 B;  3GTP B;  1N34 L;  1VQE A;  1TWA H;  3SHL A;  4TRD A;  4DV1 Q;  2C9O A;  2OF1 A;  4JBK A;  1A0I A;  4GN3 B;  1X3G A;  4YY3 Q;  3FMC A;  1SN8 A;  4POF A;  2XWB B;  5KND A;  1UEA B;  4NPS A;  2K52 A;  4NXN L;  2EJM A;  2RQX A;  2QA4 A;  2PZU A;  2R92 B;  3CP0 A;  1JOR A;  2IPK D;  4YY3 L;  3A54 A;  3VDY A;  2I46 A;  2AWN A;  4KY5 A;  1N34 Q;  2RSO A;  3NEL A;  2E5L Q;  1YNJ D;  5M5Y B;  4CJ2 C;  3KLS A;  3BG3 A;  4KV6 A;  3E0E A;  1TU2 B;  1B9N A;  3CU7 A;  3CF5 A;  4OX9 L;  2F0D A;  4BY1 B;  2JE6 I;  1BCP C;  5C0X G;  1JWU D;  4I7Z C;  1E24 A;  1I4R A;  2UXB L;  3Q6S A;  4TVA B;  1UE1 A;  3SGI A;  1ROD A;  1XXG A;  2B2W A;  4RKL A;  1QB5 D;  4IUT A;  5M3M H;  4A3K G;  2JA5 H;  1DCZ A;  1N36 Q;  3TRE A;  2N55 A;  2ZT9 C;  2KHS A;  5I6Y A;  4L6T B;  4V19 0;  3K5N A;  1HNZ Q;  3I72 A;  5EJW A;  4JI6 Q;  3R2T A;  1X3F A;  2QIL A;  1JE5 A;  2A68 D;  4X64 L;  1FNU A;  4MTN A;  1E0B A;  1LT6 D;  1X9N A;  2B2V A;  4R8N A;  4AYB G;  4A3I H;  1PVO A;  4J6H A;  4DV6 Q;  5EPL A;  3OMC A;  2B2W C;  2RCN A;  1CZW A;  1GD7 A;  1K3B C;  4NXM L;  1JR0 D;  1PFM A;  2H5X A;  1PRT B;  1HTP A;  1SFO B;  1KXL A;  1EIH A;  1G8Z D;  1BVS A;  3RLN A;  2IW3 A;  3D3R A;  4H44 C;  1MHW C;  1IBL Q;  1KNA A;  2RDH A;  4WJ3 M;  4ZLT F;  3AFP A;  2D62 A;  2RSN A;  4KKS A;  3NPP A;  4BY1 H;  5IGB A;  5BN3 A;  1L2F A;  4X64 Q;  1MKH A;  1GO3 E;  4B08 A;  5CV8 A;  3EIV A;  3MZ5 A;  2Z8L A;  4DV5 Q;  2JA8 H;  5DEH A;  1SR3 A;  2RHS B;  2F0S A;  3HOZ B;  4C3I G;  5E4W C;  2K5V A;  1K3R A;  1HNW L;  2XRS D;  4YIJ A;  1CQV A;  1I94 Q;  1NAP A;  4C3I H;  2HQL A;  4XIG S;  1E1T A;  1H9M A;  4PG3 A;  5DM7 3;  3QB3 A;  1Y1W H;  3GTG H;  2E2J B;  2K4K A;  1Q90 A;  2KJX A;  1G2T A;  2XN9 C;  2F4V Q;  1I4X A;  1D8L A;  3RZO H;  3BVM A;  2CW0 C;  4DUY Q;  1EY8 A;  1TWA B;  4LMQ D;  3HOU B;  3MXP A;  3W5O A;  1STN A;  3HZX A;  4JI7 Q;  4OX9 Q;  1VQN A;  4CKC A;  1GUG A;  1UUP A;  4EQN A;  4X66 Q;  1WTV A;  2EYJ A;  2NN6 H;  2AQ3 B;  1MJC A;  4DAV A;  4ZQ3 A;  2NZ1 D;  4ZKB B;  1NSN S;  4R4Q A;  3A8J E;  3ERS X;  1XPR A;  3QOJ A;  3J7A 5;  1EY0 A;  1Y8O B;  1AE2 A;  1TR5 A;  2TSS A;  4LUO A;  3K7A H;  1U5K A;  3K8A A;  1ZEQ X;  2E2J H;  2ENB A;  4ULL A;  5J39 A;  1T5X D;  2NVX H;  5IGG A;  3DM3 A;  4A3K H;  4C3J H;  5M3M G;  1CA6 A;  4WJ4 A;  3OWF A;  2K75 A;  5E1F A;  3KJO A;  2K5H A;  4CDE C;  1VQH A;  1XMO Q;  3BYY B;  1TWG H;  2K28 A;  2F0K A;  1E2V A;  3P20 A;  2EZV A;  1YNN D;  5JEA J;  1U0L A;  4JI6 L;  5C3X A;  4C3J G;  1C4Q A;  1M8A A;  3CME A;  1N33 Q;  3GTO H;  2EYH A;  2A8V A;  4A3B G;  4LWC A;  3HOY H;  3PUW A;  2L5T A;  4GNX A;  1GUO A;  1QWY A;  2UU9 L;  4A3D G;  1R9T H;  1RCV D;  1NNX A;  5M3F H;  4MIU A;  2AKW B;  4X66 L;  5C4J B;  4KHV A;  1PMR A;  4M8A A;  4DV0 L;  3NWT A;  4A4I A;  2L9H A;  2NTS A;  3D6C A;  1PZI D;  3OMG A;  2AQ1 B;  4JYA Q;  2IY5 B;  4ZUI A;  3HOX H;  3J7Z C;  3NEN A;  4ALP A;  2NVQ B;  3K57 A;  5LMN Q;  1Q12 A;  2EY1 A;  4DR1 L;  1E2W A;  4B3M L;  2QCP X;  2E5L L;  2NWG A;  3URY A;  1VQ5 A;  1FGB D;  4MHE A;  5C5L A;  3BDO A;  2WV6 D;  1F2M A;  2PPB C;  1PFS A;  5LMN L;  3KDF B;  2K32 A;  1H9J A;  3VYR A;  4E6I A;  2F03 A;  4G7O C;  3G4S A;  1IKL A;  4A3B H;  1EYD A;  2ALY B;  1VQL A;  2A73 B;  3EJI A;  5M5W B;  4X3S A;  4YWM A;  3ULJ A;  1A3V A;  3AEV A;  1LO5 D;  3N6R A;  4RCN A;  2EVB A;  1PFB A;  2RF4 A;  5CC4 A;  1EFI D;  2K5W A;  2L55 A;  1EQT A;  5CMD A;  3VYT A;  5KNB A;  1YVC A;  2K03 A;  2F0P A;  2R6G A;  2VW9 A;  1FD7 D;  4KKU A;  1J5E Q;  1A6X A;  1AN8 A;  1QUQ A;  3RMH A;  4LF5 L;  4HED A;  3I2Z A;  4A3G B;  1Q46 A;  2QGQ A;  2NZO A;  1OXU A;  1IYJ B;  4GLV B;  1EZ8 A;  3FEW X;  2A6E C;  2EXZ A;  1B7Y B;  3BDL A;  3NUC A;  3UI2 A;  4K5W A;  5GAG C;  2EIF A;  4B3S Q;  1WJJ A;  4O1N A;  4IPC A;  3LWE A;  3JAM E;  1JJC B;  3HOU G;  1L1O B;  3AMU A;  4A93 G;  1R4Q B;  2PQA B;  1JWM D;  3H3V C;  4JCV E;  4RMF A;  3FKI H;  1GUT A;  2XGT A;  3KK7 A;  1V1P B;  1X3P A;  1B9M A;  1JOO A;  4LUZ A;  2JP1 A;  2WKD A;  3S17 B;  1SEB D;  1I3Q H;  1CQF A;  3CC4 A;  3GV6 A;  4UP7 A;  5C4J H;  3DEO A;  4HN7 A;  4B9W A;  1GHK A;  1STA A;  4KI0 A;  2UUB L;  3F8T A;  2UXB Q;  4DAM A;  1F77 A;  1OTC A;  2FXQ A;  3AU7 A;  4RWS C;  5COR A;  4BWG B;  1PZK D;  1EIF A;  3FPP A;  4UAI A;  4DR6 Q;  4P75 A;  4KD3 A;  3CW2 C;  2KEE A;  2UUA Q;  3GTL B;  2DY8 A;  4A3M H;  2F4V L;  5C0X J;  1JOK A;  3NBH A;  1CSP A;  4YCW A;  2VB3 X;  3KFU A;  5I6W A;  2JJQ A;  3J7A V;  4CBV A;  1YHQ A;  3GTK B;  1W2B A;  1KAW A;  2RDF A;  1YBY A;  4YCV A;  3K59 A;  1V1P A;  4DUY L;  2MPM A;  1HNW Q;  1JB7 A;  3A0J A;  1PTO B;  2EPB A;  3S1R H;  4K0K L;  1SDF A;  1CI3 M;  3GTQ B;  4UP8 A;  5CGK A;  5M5W H;  3U9O A;  1Q1E A;  2A19 A;  1F9Q A;  1G29 1;  3HKZ E;  3PF4 A;  1RL2 A;  2RKS A;  1EIY B;  4A3E G;  1OXX K;  3KF6 A;  1HQR D;  4DV1 L;  2YTV A;  1B44 D;  2FJ2 A;  4HAE A;  4DR5 Q;  3EA6 A;  1W3S A;  4KHZ A;  1E1O A;  1CSQ A;  4NXN Q;  4WOR A;  1HRJ A;  1MSH A;  1Y1V G;  3A5Z B;  4LF8 Q;  1BDO A;  1ICF B;  3DM1 A;  2F52 A;  3KLW A;  3J7Y W;  4HJ8 A;  3T1H Q;  3RN5 A;  3I55 A;  1BQQ T;  3QOL A;  3S1N B;  2E2I B;  1XMQ Q;  1JMC A;  1SE4 A;  1DGS A;  2VUM H;  3S16 B;  1E22 A;  5BN5 A;  3E6Z X;  3L7Z C;  1SE8 A;  4J15 A;  3GTQ H;  2F0O A;  3TS2 A;  1UNS A;  3TZU A;  3D4R A;  3CQZ H;  4C1N K;  3OTO Q;  3MA2 B;  2OWO A;  2Z9H A;  4YHH Q;  4DAY A;  4ZAI A;  3U4V A;  1STH A;  2ZJR A;  4B3S L;  5CV4 A;  1BF4 A;  4O0A A;  4U67 3;  4IFD G;  3DEP A;  4Y7N B;  1UE7 A;  3ND8 A;  4IPH A;  1K0R A;  5EKK A;  1N33 L;  2F0W A;  2CFM A;  2NB0 A;  5JPM C;  3SK4 A;  1SMX A;  4HIM A;  3S2D B;  3RZD B;  1Q3L A;  1WTX A;  4F87 A;  2O5I C;  1HFN A;  2K04 A;  1SFO H;  3S16 H;  1I3Q B;  4A3C H;  2KCN A;  2R7Z G;  3NWS A;  5JJZ A;  5IYC H;  2VQE Q;  2Q2H A;  3MXU A;  4O42 A;  1K8G A;  2MUY A;  4GNX C;  1CZG A;  1KAB A;  1IHZ A;  1BCP D;  1IKM A;  4DR2 L;  4L63 B;  4BA1 I;  3HOV H;  4LF6 Q;  4G4K A;  3V05 A;  2CH4 A;  3W1G A;  1A2U A;  5BN4 A;  5C3E H;  3C1F A;  2L15 A;  5E4X A;  3I4M G;  1EY9 A;  4OO1 I;  2EYO A;  3HOX B;  1OXV A;  3C1E A;  4JOI A;  3KYH C;  5L37 A;  3L3O C;  4KY7 A;  1SLJ A;  3JAM L;  1S4Z A;  3E3X A;  1L1O C;  2ID0 A;  2WP8 J;  2VZA A;  3N52 A;  3NEM A;  1TS2 A;  1NBW A;  1H9S B;  3OHX C;  3HFZ B;  3RZO B;  3E9I A;  1MBY A;  2Z1C A;  3D6W A;  4HMJ A;  4FXG C;  4CKE A;  2H1E A;  4BBR B;  1G6P A;  2B2V C;  4IQZ A;  2SEB D;  2N88 A;  3WWV A;  1VQF A;  5IGE A;  1ZKO A;  3J81 i;  2DUD A;  3PIP A;  3HOZ H;  3PUZ A;  2V4D A;  3DWQ A;  5CV5 A;  4AIM A;  1Q7Y C;  2Y0S B;  1PYW D;  3DLL A;  5J3B A;  3OW7 A;  4A3M B;  5IYD G;  2X6G A;  4IO9 A;  4KJO A;  1A8V A;  1EY4 A;  1OO9 B;  4UPA A;  3F2C A;  1KDC A;  2I5L X;  2UU9 Q;  1CT1 D;  1NTG A;  4K5X A;  4CDF C;  3FHW A;  2ZM6 L;  3CXC A;  2VUM B;  5CBE E;  2ZJP A;  4FF1 A;  5ELF A;  2KBN A;  2WII B;  1UE6 A;  2G9D A;  3EVQ A;  3PF5 A;  4P71 A;  4LFC Q;  1HPC A;  2EYP A;  1BBX C;  1BOS A;  5C4H A;  4KK7 A;  4LF9 L;  3GTK H;  2AUJ D;  1A63 A;  2XTI A;  1XWE A;  2GVA A;  2ES2 A;  2DJG C;  2N8N A;  2VXW A;  3GP7 A;  3OW2 A;  1I4H A;  5F2D A;  1PHJ A;  1K8A C;  4QGU A;  3RN2 A;  1STB A;  3R8B A;  2KED A;  2JA7 H;  5C4Z A;  4XQQ A;  3S1M H;  4N8F A;  1TWG B;  2JA7 G;  1G2S A;  1I6H H;  2L11 A;  1ASZ A;  1GM5 A;  3ND9 A;  3VR2 A;  2NVQ H;  3MXG A;  4NP5 A;  3J80 c;  1KRS A;  4P74 A;  4JG2 A;  3I4M H;  2HHH L;  4EVO A;  5C3E G;  2SNM A;  3TP8 A;  1XPO A;  3PO3 H;  5IY0 A;  4NKL A;  2NUC A;  1PTO H;  4OWX B;  4Q0F A;  1JB3 A;  4YWL A;  4DR4 Q;  2FIN B;  2KVM A;  1F2Y A;  4B9X A;  1O7Z A;  1SNQ A;  4HCE A;  4P73 A;  2KOL A;  1XNR Q;  2PMZ E;  2B63 G;  3KF8 A;  2EY2 A;  1ENF A;  2YU9 H;  4A3G G;  2JEB I;  4YHH L;  3MHB A;  4LUV A;  1VF5 C;  1PRT F;  2HIV A;  4QUF A;  5LMN W;  3K5L A;  4CHT B;  2E75 C;  2WB1 E;  2Q8R E;  4IFD I;  1PH4 A;  3H0G H;  2R92 G;  4RGT A;  1CM9 A;  1GOZ A;  1KC8 C;  4JI2 L;  2DNE A;  4XDX A;  1HZ9 A;  5IWA L;  3HS0 C;  3K80 C;  1NY4 A;  5TSS A;  2MQH A;  2EQS A;  3TP7 A;  4HID A;  1EYG A;  4XYO A;  3CC7 A;  1VQM A;  3STB D;  4DV4 L;  4LF4 L;  1Q1B A;  2B29 A;  1S3O A;  3J81 c;  3CPF A;  1DZ1 A;  2NYZ D;  4KJN A;  3NBI A;  1X6O A;  3HOW G;  1RF2 D;  1SJE D;  3VR5 A;  3GTL H;  3SDZ A;  4DR7 Q;  4NXM Q;  1TS3 A;  1F2Z A;  1JJ2 A;  2ZTC A;  3TSS A;  3OWE B;  2CVR A;  4BBR G;  4HJ7 A;  3DHQ A;  5I2Y A;  3QG1 A;  4DUZ Q;  4F7X A;  5IWA Q;  2IJ0 A;  5IGC A;  3GV3 A;  4LF5 Q;  3RLO A;  3GTM B;  4HIO A;  2BH8 A;  2E76 C;  2R61 A;  3E5S A;  4QCL A;  2NVT B;  2NVX B;  3PQI A;  1MIU A;  3FDT A;  1XTC D;  1SYE A;  1B53 A;  2KHJ A;  1Z9F A;  2J4X A;  2DJF C;  1V1Q A;  1IBM Q;  3L9A X;  4UDU C;  3S2H B;  1EOV A;  2K5D A;  2XVS A;  4AYB B;  2ZXO A;  2IL8 A;  1TWC B;  4HJ9 A;  4HR7 B;  4QB4 A;  1IXR A;  1C0A A;  1I5F A;  3GTO B;  2F3V A;  2OXP A;  3X3N A;  3KLS X;  3DWA A;  1AW7 A;  2L12 A;  1LTR D;  2MO1 A;  2DN8 A;  3KUP A;  1AH9 A;  4J1M A;  4DPG A;  1IBM L;  1O78 A;  1NR2 A;  5FLX L;  3S9W A;  3I4N H;  4PNY A;  4JI1 L;  1WOC A;  3NTI A;  5EQ0 A;  3STB C;  1LAC A;  5HGQ A;  3S1Q H;  5CR3 A;  1YEZ A;  1TWH B;  3HOV G;  1X32 A;  4KMU C;  4PZ8 A;  3U58 A;  1KTK A;  4DGZ A;  2VQE L;  2EY6 A;  4LF7 Q;  2SDF A;  1NMG A;  4ABN A;  5CV6 A;  4HJA A;  1B50 A;  1R9T B;  3C2P A;  2B39 A;  3MTS A;  3HRZ C;  1B3A A;  4R4C A;  4A3C G;  4HCS A;  3Q24 A;  3CC2 A;  1J5E L;  3WOE A;  3I91 A;  4DV6 L;  1STE A;  3HOU H;  1YNN C;  2LXJ A;  4XQN A;  2WFW A;  3A55 A;  4B3T L;  4JV5 L;  4K14 A;  4CGY B;  3CCV A;  1QZH A;  3J81 E;  2B63 B;  3ONA B;  1HR0 Q;  2QDB A;  3IAY A;  2Q8T A;  3HOW H;  3MEH A;  3OOC A;  1PV4 A;  4B3T Q;  3SK6 A;  2J0T D;  2A6H D;  1WTR A;  5COY A;  1G6Z A;  4CJ0 B;  1LTI D;  2XSC A;  3TP6 A;  5A2Q E;  4B3R Q;  4XXE A;  3E0J A;  1UAP A;  2F0G A;  1N32 L;  5JOB A;  1CKN B;  2PI2 A;  1ENC A;  1IBK Q;  4Q5V A;  1TS4 A;  1HHV A;  1YJN A;  1PTO F;  1HZB A;  5D3D A;  2OEO A;  2FMC A;  1K8O A;  1EWH A;  3IRB A;  1S5F D;  3NBH B;  5ELO A;  2NTT A;  2XIW A;  4DA2 A;  3CPW A;  3PSI A;  2CKZ B;  1SND A;  1TVX A;  4S3S A;  3ULP A;  1EWC A;  4MTK A;  2LKV A;  5T1I A;  1TQO A;  1ZXT A;  2PNR C;  2I5M X;  2CWA A;  1Y1V H;  2NVY H;  5C44 H;  1RDP D;  3HGB A;  1Y1V B;  5JJI A;  4A3D B;  2HQE A;  1VQA A;  1GHJ A;  1LTG D;  1Z47 A;  1SYC A;  5CV7 A;  3PO3 G;  3C46 A;  4BXX G;  1F2L A;  2KHI A;  2LFN A;  4LAA A;  1QG7 A;  5JVG 3;  1RIP A;  1I50 H;  2A69 D;  1IBK L;  1KLU D;  2Y0S G;  5J22 A;  2B2Y C;  1I6V C;  2VS1 A;  3JC6 6;  3S15 B;  5FLX c;  1RKN A;  3J80 E;  3PUY A;  3AB9 A;  1IBL L;  1LTL A;  1PTO D;  4IUP A;  3PO2 G;  1PXU A;  3M4O H;  1X54 A;  2WIN B;  3R2I A;  3VR3 A;  3T1Y Q;  2AQ2 B;  4Z9C B;  3IKJ A;  1VMC A;  5LMU Q;  1TKW B;  1SNP A;  3LWU A;  3M7G A;  2EXD A;  3G6J B;  4RA8 A;  5H1S E;  1XYI A;  1IYV A;  1SSO A;  3I4O A;  3OYY A;  3CD6 A;  2VQF L;  3GTM H;  3NK9 A;  5GRO A;  1PH1 A;  2Z0S A;  2UUB Q;  5IGD A;  1B4O A;  4GOP B;  2BDO A;  3PUV A;  1L0X B;  2B2Y A;  2IT1 A;  1KL9 A;  3PCO B;  2ICI A;  1S40 A;  1PTO C;  1P16 A;  4PMC A;  3KOJ A;  2IHE A;  1GUW A;  3TS0 A;  4KHP L;  1K0S A;  3FRP B;  4ID6 A;  1LTS D;  2R7Z B;  2BCO A;  3HOV B;  4LF8 L;  1IYU A;  3L0O A;  1OXS C;  4JI4 L;  2XNA C;  2HHH Q;  3I4N B;  1BCP B;  1AZP A;  2ZXP A;  2JN4 A;  1HNX Q;  2L4N A;  4KD4 A;  2B63 H;  2K6A A;  3IFD A;  4APV A;  2B2U A;  1VS0 A;  1EY5 A;  1TWH H;  2MGS A;  3U9S A;  5KEE A;  4BS9 A;  4FF4 A;  3L2P A;  3MFG A;  3HOX G;  1CUK A;  1VQK A;  4A3E H;  4RGM A;  5BR8 Q;  3DWP A;  3MXN B;  4QF4 A;  5IYC G;  5JVH 3;  1QVF A;  4GZY C;  4CJ1 B;  1YIT A;  4JI1 Q;  2BE5 C;  2WB1 G;  2NN6 I;  3AYH B;  2HT1 A;  3S2H H;  4LFB Q;  4A3J H;  4K8J A;  1NCV A;  3T53 B;  1B1Z A;  1HNX L;  3F1Z A;  5EGT A;  3CCU A;  5G3L D;  2L0C A;  1B70 B;  4DU9 A;  4JI4 Q;  1LT3 D;  4LK1 C;  3EFX D;  4U68 A;  5LL6 X;  4FDB A;  1LUZ A; 
#chains in the Genus database with same CATH homology
 4IJL A;  1E24 A;  4B3R L;  1PH2 A;  4RG1 A;  5IT9 c;  4TQU S;  2UXB L;  2LSS A;  3HKZ G;  4A3M G;  1G6P A;  3M4P A;  2N78 A;  3B6Y A;  3M9B A;  5GAD C;  1VQO A;  1S72 A;  4PMW A;  4DR1 Q;  4TVA B;  1OXT A;  2MO0 A;  1UE1 A;  3WWV A;  1VQF A;  4DNI A;  4BY1 G;  4QJF A;  3SGI A;  4EQ5 A;  3J81 i;  2DUD A;  3PIP A;  2E2I H;  1VQP A;  2UUA L;  3HOZ H;  3PUZ A;  5M5X H;  5FJ8 G;  1BKB A;  4AIM A;  1Q7Y C;  2KEN A;  5M3M H;  1EWI A;  3DLL A;  3F2B A;  5J3B A;  4A3K G;  2KCM A;  4X62 Q;  2JA5 H;  1XJV A;  4JV5 Q;  1N36 Q;  4GN5 A;  1I94 L;  3TRE A;  5GAH C;  5IYD G;  4IO9 A;  5ELN A;  4KHP Q;  4L5Q A;  1A8V A;  2UUC Q;  2VUM G;  2BH2 A;  2AHO B;  1NJI C;  1TWF H;  3W1B A;  1HNZ Q;  4UPA A;  4DV2 L;  3F2D A;  4R4T A;  3F2C A;  4JI6 Q;  3S14 H;  1AE3 A;  1C9O A;  1X3F A;  2I5L X;  2JA9 A;  4DV5 L;  2UU9 Q;  1JE5 A;  3UDG A;  1NTG A;  1WI5 A;  4X64 L;  2K5N A;  4MTN A;  2Q2U A;  1UEB A;  1JT8 A;  3TRZ A;  2RHQ B;  3FHW A;  4PZ7 A;  5IP9 H;  2ZM6 L;  1V9P A;  3CXC A;  4A3G H;  1X9N A;  4AYB G;  4A75 A;  4A3I H;  1PVO A;  4DV6 Q;  2ZJP A;  1H95 A;  4JI8 L;  1FVI A;  3U50 C;  3HOY G;  2RCN A;  4GKJ L;  1GD7 A;  1XNQ Q;  1PH7 A;  3A74 A;  4NXM L;  2H5X A;  2KBN A;  1KXL A;  1UE6 A;  5E7N A;  1BVS A;  3RLN A;  4IFD J;  3RZD H;  3PF5 A;  2HIX A;  4P71 A;  4A3F H;  4LFC Q;  4P72 A;  1XNQ L;  1IBL Q;  2DGY A;  2JEA I;  1N8R C;  5FJ8 H;  4LF9 L;  4IOC A;  2I0Q A;  4WJ3 M;  3AFP A;  2D62 A;  3GTK H;  4BY1 H;  5C44 G;  1A63 A;  2XTI A;  2GVA A;  2ES2 A;  2ASB A;  2N8N A;  1L2F A;  4DAY B;  3OW2 A;  4X64 Q;  1MKH A;  1GO3 E;  3JAM c;  4MZ9 A;  1PHJ A;  3EIV A;  1HR0 W;  1K8A C;  4QGU A;  4DV5 Q;  2JA8 H;  3RN2 A;  1SR3 A;  2RHS B;  4X65 Q;  4DV2 Q;  4A3L G;  2JA7 H;  2K5V A;  1K3R A;  1HNW L;  2V1C C;  1V43 A;  3S1M H;  1I94 Q;  1X3E A;  1JJG A;  4C3I H;  1LM0 A;  2JA7 G;  3H3V I;  2HQL A;  1I6H H;  4XIG S;  1E1T A;  1ASZ A;  4L5S A;  4PG3 A;  1GM5 A;  2QEX A;  1P8L A;  1Y1W H;  2NVQ H;  3J80 c;  3GTG H;  3EBE A;  1KRS A;  5IE8 A;  2K4K A;  4P74 A;  2CCZ A;  3ICE A;  2YTX A;  4JG2 A;  4JI5 L;  3I4M H;  4K0K Q;  4KLK A;  2HHH L;  1PH5 A;  2F4V Q;  3TEH B;  5C3E G;  1D8L A;  1VQ8 A;  3RZO H;  4LFA Q;  1FGU A;  4DUY Q;  2NN6 G;  3H15 A;  4OWW B;  3EN2 A;  1G51 A;  2KCT A;  1GKH A;  4H02 A;  3UDX A;  1VQJ A;  1KIX A;  3M7N A;  1T9H A;  4X6A H;  2NVT H;  3W5O A;  1XPO A;  3PO3 H;  5IY0 A;  4OWX B;  4JI7 Q;  4OX9 Q;  1VQN A;  2UXD Q;  4DR4 Q;  1WFQ A;  4YWL A;  1YHA A;  3Q8D A;  4X66 Q;  1YJW A;  3M4Q A;  4P73 A;  3PIO A;  1MJC A;  1XNR Q;  1VQC A;  2PMZ E;  2B63 G;  2YU9 H;  2MFI A;  4A3G G;  3H3V H;  2JEB I;  4LFB L;  5IP9 G;  4YHH L;  4DUZ L;  1CKO A;  1Y14 B;  4LUV A;  4R4Q A;  3ERS X;  2HIV A;  5LMN W;  3GO5 A;  1XPR A;  1FL0 A;  4YWK A;  2VQF Q;  1VQI A;  3KDF A;  2WB1 E;  3J7A 5;  1UWV A;  5IP7 H;  2UXC Q;  1TXY A;  4IFD I;  1PH4 A;  4NB3 A;  1AE2 A;  3H0G H;  2R92 G;  4X65 L;  4LUO A;  3K7A H;  1U5K A;  5HY6 A;  1VQ6 A;  3K8A A;  1HR0 L;  1D7Q A;  1KC8 C;  4JI2 L;  2E2J H;  1HZ9 A;  5IWA L;  2NVX H;  4JI3 L;  2BA0 A;  3K80 C;  3KF6 B;  1NY4 A;  2CQO A;  2MQH A;  2EQS A;  1HZA A;  3DM3 A;  4PZ6 A;  4C3J H;  4HID A;  4A3K H;  2AWO A;  4ME3 A;  5M3M G;  1EYG A;  3RLF A;  3I56 A;  4WJ4 A;  2K75 A;  3D31 A;  3KJO A;  3CC7 A;  2F3I A;  2K5H A;  1VQH A;  1VQM A;  3STB D;  1O7I A;  1XMO Q;  1TWG H;  1E7Z A;  4DV4 L;  2ZJQ A;  1Q1B A;  3RR5 A;  4LF4 L;  2B29 A;  4LFC L;  1S3O A;  3J81 c;  4JBW A;  1PYB A;  3CPF A;  2JK8 A;  1X6O A;  4C3H H;  5JEA J;  3HOW G;  1U0L A;  3GTL H;  4BY7 G;  1PA6 A;  4DR7 Q;  4JI6 L;  4NXM Q;  1JJ2 A;  4MNO A;  1KHI A;  2ZTC A;  4BBR G;  1YZ6 A;  3CME A;  4HJ7 A;  1N33 Q;  3GTO H;  1C7Y A;  2A8V A;  5FLM H;  1EFW A;  4LWC A;  4A3B G;  3HOY H;  3PUW A;  4DUZ Q;  1KQS A;  1M1K C;  4R4O A;  4EX5 A;  5IWA Q;  1EQR A;  4LF5 Q;  3RLO A;  4GNX A;  1N9W A;  1X55 A;  4HIO A;  2BH8 A;  2UU9 L;  3S24 A;  4A3D G;  1R9T H;  5EAY A;  5M3F H;  2AKW B;  4X66 L;  4DKA C;  4HIK A;  1HZC A;  1BBU A;  4JI7 L;  2UXD L;  1MIU A;  3CCJ A;  4DV0 L;  4AQY Q;  4A4I A;  5GQO A;  3OTO L;  4JYA Q;  2KHJ A;  1Z9F A;  4DV7 Q;  2IY5 B;  1V1Q A;  1IBM Q;  1MJE A;  4GN4 B;  3HOX H;  3J7Z C;  3NEN A;  1EOV A;  3G6E A;  4ALP A;  3CCS A;  3AQQ A;  5LMU L;  3CCE A;  1WCM G;  4GOP A;  4JI5 Q;  5LMN Q;  1Q12 A;  2Z6K C;  4DR1 L;  3HOZ G;  2B3G A;  4HJ9 A;  4B3M L;  2VNU D;  2E5L L;  1IXR A;  1C0A A;  1I5F A;  4OWT B;  4HJ5 A;  1PH6 A;  1VQ5 A;  4Y7N H;  4JBJ A;  1SRO A;  2IX0 A;  1VQD A;  2GVB A;  4GLX A;  3M85 A;  1Y1W G;  3BZK A;  1VCI A;  4DR3 Q;  5C4X G;  1PFS A;  4QIW E;  5LMN L;  3KDF B;  2MO1 A;  3CAM A;  1EUJ A;  1GVP A;  2E8G A;  2K50 A;  3TQY A;  5AJ3 Q;  3G4S A;  1LYL A;  5FLM G;  1EQQ A;  4A3B H;  1AH9 A;  4DPG A;  2ALY B;  5IYB G;  4DV3 Q;  1IBM L;  1VQL A;  4YWM A;  3ULJ A;  1UE5 A;  3AEV A;  1Q86 C;  2RF4 A;  4GS3 A;  3I4N H;  4JI1 L;  2Q2T A;  4AQY L;  1WOC A;  4DV0 Q;  2JA8 G;  4DR2 Q;  4XTC S;  1YVC A;  2R6G A;  3STB C;  2Z6K A;  4AH6 A;  2VW9 A;  1PH3 A;  5HGQ A;  5BR8 L;  1J5E Q;  3S1Q H;  4BBS G;  1YEZ A;  3HOV G;  4LF5 L;  1QUQ A;  3S1N H;  4A76 A;  3I2Z A;  2OQK A;  4PZ8 A;  2JA6 H;  1Q46 A;  3U58 A;  3GTP H;  4A3F G;  2QGQ A;  2JQO A;  2NZO A;  1YIJ A;  1OXU A;  2VQE L;  4L5R C;  4JI8 Q;  4LF7 Q;  1IYJ B;  4GLV B;  1NMG A;  2Y0S E;  4HJA A;  3AFQ A;  4LF7 L;  2ATW A;  3FP9 A;  1B7Y B;  2CWP A;  5GAG C;  2EIF A;  3H0G G;  4JI3 Q;  2R92 H;  2R7Z H;  4B3S Q;  4R4C A;  1WJJ A;  4A3C G;  4IPC A;  3K7U C;  4JI2 Q;  3CC2 A;  4R1J A;  1J5E L;  4LF4 Q;  1JJC B;  3FKI G;  3MEF A;  1L1O B;  1QVG A;  3HOU G;  4POG A;  3CCR A;  4GKJ Q;  4A93 G;  2PQA B;  1A62 A;  1VQG A;  2N3S A;  2YV5 A;  3BJU A;  4JCV E;  4RMF A;  3G71 A;  4DV6 L;  4JC0 A;  2UUC L;  3FKI H;  3I7F A;  3HOU H;  4A3D H;  2XGT A;  3S17 H;  2K14 A;  1PYS B;  2ZM6 Q;  3CCQ A;  2LXJ A;  4B3T L;  2WFW A;  4JV5 L;  2NZH A;  3CCV A;  2WAQ E;  4LUZ A;  1QZH A;  1I3Q H;  1HH2 P;  1HR0 Q;  3CC4 A;  4UP7 A;  3S15 H;  5C4J H;  5IYD H;  3JAM i;  3S2D H;  3CCM A;  4DR4 L;  4BY7 H;  3U4Z A;  4IPD A;  3HOW H;  4OO1 G;  1CKN A;  5JEA G;  1PV4 A;  4KI0 A;  4B3T Q;  2OTL A;  1YNX A;  2UUB L;  3F8T A;  1E3P A;  1N36 L;  5DLQ E;  5GAE C;  4BBS H;  2UXB Q;  3J80 i;  4DAM A;  1OTC A;  2FXQ A;  3LGJ A;  3T1H L;  1EIF A;  4B3R Q;  4DR6 Q;  4P75 A;  1N32 L;  4C2M H;  3CW2 C;  2UUA Q;  1XNR L;  4A3M H;  2F4V L;  1CKN B;  2PI2 A;  5C0X J;  4QL5 A;  1IBK Q;  4JI0 Q;  3T1Y L;  1CSP A;  1YJN A;  1HZB A;  4YCW A;  1XMQ L;  3CCL A;  3KFU A;  3RNU A;  1L1O A;  2JJQ A;  1PH8 A;  4JBM A;  4DK3 C;  1NMF A;  3IRB A;  4DV7 L;  1YHQ A;  4Y52 H;  3A5U A;  3NBH B;  1KAW A;  5ELO A;  3KF8 B;  1W2B A;  4JYA L;  3K81 C;  1J6Q A;  1YBY A;  4YCV A;  3G48 A;  4DUY L;  1VQ7 A;  4LFA L;  3ULL A;  1ASY A;  3CPW A;  1HNW Q;  1JB7 A;  3A0J A;  1QZG A;  2IX1 A;  3PSI A;  2CKZ B;  4A3J G;  3S1R H;  2R7D A;  4K0K L;  3KJP A;  3ULP A;  3PGZ A;  4UP8 A;  1KD1 C;  1IL2 A;  5M5W H;  2I5M X;  2IHF A;  2CWA A;  1YHB A;  1Y1V H;  2NVY H;  3GD7 A;  5C44 H;  1Q1E A;  2A19 A;  2GN5 A;  2YTY A;  4QY7 A;  1QUQ B;  1G29 1;  1PH9 A;  3HKZ E;  3PF4 A;  1RL2 A;  5JJI A;  1EIY B;  2Q2I A;  3E9H A;  4A3E G;  1OXX K;  3KF6 A;  1VQA A;  1Q81 C;  5K36 G;  4DV1 L;  1Z47 A;  2D0O A;  2YTV A;  2VY3 A;  4LF6 L;  3PO3 G;  1VQB A;  4BXX G;  2KHI A;  4DR5 Q;  4DV3 L;  5C0X I;  1W3S A;  4KHZ A;  1RIP A;  1E1O A;  1I50 H;  1CSQ A;  4DR7 L;  1YI2 A;  5AJ3 L;  4NXN Q;  1IBK L;  4JI0 L;  1TWC H;  1Y1V G;  3A5Z B;  4LF8 Q;  4UY8 C;  2Y0S G;  2PI2 E;  2OQ0 A;  3KLW A;  2F52 A;  2VS1 A;  5M3F G;  1N32 Q;  4DR6 L;  1K73 C;  2R93 H;  3JC6 6;  1XPU A;  1Q8K A;  2D0P A;  4A93 H;  1L0W A;  4HJ8 A;  5FLX c;  4GNX B;  3T1H Q;  4GKK L;  4LF9 Q;  1X56 A;  3PUY A;  2C35 B;  3RN5 A;  3I55 A;  1IBL L;  1LTL A;  4B3M Q;  1XMQ Q;  3PO2 G;  4IPG A;  3PUX A;  3GDE A;  3M4O H;  1X54 A;  4OON A;  3T1Y Q;  1NE3 A;  1JMC A;  2PNH A;  1DGS A;  5LMU Q;  3ZJY C;  1E22 A;  4DK6 C;  2VUM H;  2PQA A;  4A3L H;  3L7Z C;  1SE8 A;  2EXD A;  4J15 A;  4O2D A;  4UP9 A;  5H1S E;  1HNZ L;  3GTQ H;  3TS2 A;  2UXC L;  3D0F A;  3I4O A;  3OYY A;  3CD6 A;  3CQZ H;  2VQF L;  1CKM A;  2OTJ A;  3GTM H;  5GRO A;  3OTO Q;  1XTD A;  2Z0S A;  2VL6 A;  4LW1 A;  3GTJ H;  1PH1 A;  2UUB Q;  1BBW A;  3BZC A;  2A1A A;  2OWO A;  3HKS A;  1IZ6 A;  4YHH Q;  4GOP B;  1B8A A;  5JJK A;  3PV0 A;  3PUV A;  2IT1 A;  1VQ4 A;  5M5Y H;  3U4V A;  1KL9 A;  3PCO B;  4IOA A;  1S40 A;  1KRT A;  1HJP A;  4GLA C;  1P16 A;  2ZJR A;  2E2H H;  1M90 C;  4B3S L;  3I4N G;  3KOJ A;  2IHE A;  4OXP A;  3K0X A;  2OCE A;  4O0A A;  3TS0 A;  3UDI A;  3J81 j;  4IFD G;  4KHP L;  1UE7 A;  2AMC B;  2MNA A;  4X62 L;  2YYZ A;  1K0R A;  4IPH A;  1N33 L;  2CFM A;  3PO2 H;  1WYD A;  2LXK A;  1VQ9 A;  1SMX A;  3UE1 A;  4HIM A;  1K83 H;  4A3I G;  5IP7 G;  4LF8 L;  3L0O A;  1OXS C;  3UE0 A;  2ZTD A;  2WAQ G;  2I5H A;  5C4X H;  4JI4 L;  1FJG Q;  3ER0 A;  4JOI C;  2HHH Q;  5JJL A;  4BA2 I;  1QVC A;  2N49 A;  1K9M C;  2R93 G;  4DV4 Q;  1HNX Q;  1SFO H;  1XMO L;  3S16 H;  4DR5 L;  2B63 H;  1N34 L;  1VQE A;  4A3C H;  4APV A;  2R7Z G;  4GKK Q;  1TWA H;  4IJH A;  3UDF A;  1VS0 A;  4DV1 Q;  5IYC H;  1TWH H;  2Q2H A;  2VQE Q;  1A0I A;  4GN3 B;  4YCU A;  4JBK A;  1X3G A;  4YY3 Q;  1K8G A;  3L2P A;  1SN8 A;  1WCM H;  4POF A;  4AYB E;  3M3Y H;  4BXX H;  1X65 A;  4GNX C;  4LNQ A;  3HOX G;  1CUK A;  2K52 A;  4NPS A;  4NXN L;  4A3E H;  5BR8 Q;  4R4I A;  1YJ9 A;  1VQK A;  2JA5 G;  2BA1 A;  3MXN B;  3CMA A;  2QA4 A;  2JA6 G;  4QQB X;  4DR2 L;  5IYC G;  1QVF A;  4BA1 I;  3HOV H;  4L5T A;  1YIT A;  4LF6 Q;  3CP0 A;  4JI1 Q;  3W1G A;  2WB1 G;  4YY3 L;  5C3E H;  3VDY A;  2L15 A;  3I4M G;  4OO1 I;  2NN6 I;  3AYH B;  1Q82 C;  2HT1 A;  3S2H H;  4LFB Q;  1OXV A;  2AWN A;  4A3J H;  1N34 Q;  1SRU A;  3NEL A;  4JOI A;  3KYH C;  2E5L Q;  1HNX L;  3F1Z A;  3CCU A;  1SLJ A;  2WP8 J;  1L1O C;  2ID0 A;  2VZA A;  4GOP C;  3NEM A;  3E0E A;  2R7F A;  1NBW A;  1B70 B;  3HFZ B;  5IYB H;  3CF5 A;  4JI4 Q;  4OX9 L;  1FJG L;  3E9I A;  4DR3 L;  2JE6 I;  3BU2 A;  4BBR H;  2ZTE A;  4FDB A;  5C0X G;  1LUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...