1TWHJ

Rna polymerase ii complexed with 2'datp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1twhJ00
1BJZA 1W0TA 1HDDC 4I76A 4B3AA 2HOSA 4A3LJ 1EF4A 2L7ZA 3BR6A 3OSGA 3FKIJ 1ETOA 3SJMA 2GBYA 4JYKA 2QF7A 4Y7NJ 4D7MA 2B63J 4XRMA 3OSFA 2WB1N 2GLOA 1QRYA 2JK3A 4BY7J 2L7MP 3OIOA 5HODA 1VNDA 1WH5A 3BG5A 5F0CA 3HOWJ 1ZKGA 1GVDA 2ECCA 2NVTJ 4XICA 5K7HA 1VFCA 1IDYA 3SDGA 1JGGA 4M3DA 2R5ZA 3RKQA 2TRTA 3O8GA 2E2JJ 1PUFB 5JLWA 2VKEA 1JUMA 4UUSB 1TWGJ 1CQTA 2EZKA 4M3BA 2HOAA 3HOVJ 3B6AA 3LSRA 3WHCA 1JTXA 2E1OA 2JMWA 3FK7A 3JRCA 1BW5A 4MFEA 3VPRA 3O8HA 5IP9J 1MBJA 1MNMC 1VI0A 3Q0VA 1GV5A 5M3MJ 1ZR4A 2R5ZB 2L0KA 4M3EA 3LSPA 1FIAA 1WH7A 2JJ7A 1TWHJ 4V2GA 3D1NI 1S7EA 4DZPA 1K83J 5EZGA 1I6HJ 4V2FA 3BR0A 2DN0A 3HKZN 3ZQLA 4M3FA 2DA2A 4XK4A 4FCYA 4MIMA 1BL0A 4JX6A 4UUTA 4FE4A 5EGOA 1LE8A 1POGA 2PMZN 4XIDA 3HBLA 1WI3A 1YRNA 4A3IJ 5K7ZA 1MH3A 3JRBA 2O7OA 1F43A 5C3EJ 2FD5A 2JN6A 2O8KA 1ZQ3P 5C4XJ 5IP6A 1R9TJ 3MVPA 2EQRA 4B4CA 2XB5A 3BTCA 2KDZA 2I10A 2LY9A 1TWCJ 4MFDA 5IYCJ 1MSEC 3BG9A 1MBHA 2DMNA 1U8BA 4BY1J 3HOYJ 4BBRJ 1AU7A 3HEFA 2NS7A 4IHWA 2VUMJ 3H0GJ 2LTPA 3S1NJ 1IRZA 1BW6A 5J3LA 2YUSA 1VF9A 2NVXJ 1H88C 2M34A 3LOCA 2LLKA 3TW7A 1ZK8A 2CJJA 4B1RA 5EYRA 1YRNB 1IC8A 3BTLA 3FK6A 1JJ8C 1WCMJ 2XRLA 3LSJA 3QPSA 2HXIA 2EZIA 1FJLA 5E3LA 3HOXJ 2ME0A 3JRHA 1LFBA 4L5EA 3S1MJ 1B72B 3CCYA 1HCRA 5IYBJ 3A01B 3IH2A 5GP9A 2DA6A 2DTZA 1X58A 3HOUJ 2CUEA 1RKWA 2OF7A 2XGDA 1IGNA 1QPIA 1TWFJ 4FISA 2EZLA 1FTZA 2E19A 2MW8A 2H1KA 1QVTA 2QCOA 3JRDA 4FTHA 4C3JJ 4A3MJ 1NK3P 2D5VA 3HM5A 4DW6A 2HXOA 3GTPJ 1ZR2A 2G0EA 4D5FA 9ANTA 3BTIA 1JKQC 5GPCA 5EG0A 3JR9A 5IPAA 5J1UA 2R93J 1HOMA 1D5YA 3ZQCA 4QTRA 1UG2A 2YS9A 3DCFA 4A3FJ 1ZTRA 2LFBA 1A5JA 2TCTA 2L7FP 4EEFG 4XRSA 2ZB9A 1FEXA 4W1UA 3K2AA 2DMTA 1AHDP 4A3GJ 2LD5A 3RQIA 1RETA 2Y31A 1OFCX 5IP7J 3A02A 2LKXA 2HQ5A 3TP0A 2R92J 1ETWA 4XRSG 3NAUA 1MBFA 3JRIA 3SFIA 4Y52J 5J1YA 1MH4A 1U9OA 3BT9A 3K7AJ 3L1PA 1JT0A 1GT0C 1IJWC 4A3BJ 2ID3A 3MKLA 4DYCA 4A3DJ 2IAIA 2ELKA 2NS8A 2R5YA 2GM4A 2MGQA 3S15J 2ME6A 3M3YJ 1FTTA 1RR7A 2Y2ZA 3HGGA 1APLC 5FKLA 4C2MJ 1JJ6C 3CQZJ 3HGYA 3Q0WA 1G2HA 4A3JJ 1IG7A 2O9LA 2NVQJ 2R0QC 2CQQA 2XSDC 3GTJJ 2HYJA 4A93J 1SANA 2MG4A 2XPVA 4FE7A 4RDUA 1O4XA 3QPLA 2M2EA 1UHSA 1Q1VA 1WGXA 1XG1A 5E3MA 2NOGA 1TC3C 5FJ8J 2VPRA 5F08A 1ENHA 2X9DA 4BBSJ 1GDTA 3RZOJ 5FLVA 1Z77A 5C44J 1ETKA 5M5XJ 3LNQA 2VI6A 3S16J 3BR1A 3I4MJ 1F36A 4DYRA 4NDLA 3G1MA 2DA1A 2W48A 1ETXA 4S0HB 2JA8J 2L9RA 5EGOB 4BKXA 3DEWA 1LE8B 5F04A 4A3CJ 1OCTC 5IYDJ 3JRAA 5DS9A 2AHQA 2K9NA 3HB9A 4HNVA 3S17J 3PO2J 3S2DJ 4I6ZA 2IBDA 2IEKA 5JLXA 2WV1A 2XPWA 1AKHA 5FKMA 2DA7A 2DJNA 5M5YJ 4G12A 4JX5A 2DMPA 5F27A 1QVUA 1RKTA 2CU7A 3PO3J 3F0CA 4CYCA 3B6CA 3C2BA 3G1OA 1B8IA 1JT6A 1DU0A 1OJLA 5J1RA 1MSFC 1MBKA 5EF6A 3G1LA 3HOZJ 5EZHA 1E3OC 1Y1VJ 3GTLJ 4A3KJ 3S1RJ 1WPKA 3NARA 2JA6J 1IDZA 3A03A 2Y9ZA 1LFUP 5IOYA 4GFBA 3I4NJ 1ORKA 2K40A 2Y0SN 1IV6A 3FIWA 1P7JA 2HDDA 4CYCB 3JRGA 3M4OJ 2DA4A 2DMQA 1PUFA 2ECBA 2E2HJ 1MBGA 1B8IB 1I50J 3BG3A 4A69C 4UUSA 1X2NA 1JKRC 1HF0A 1UMQA 1ITYA 1H8AC 3BR2A 1HLVA 1T56A 4C3HJ 3BQYA 1HDPA 4A3EJ 2E2IJ 4M3GA 5FKNA 3GBGA 3BQZA 4W97A 3IH3A 4D5CA 1DU6A 3GTQJ 4IHYA 4MLOA 5F0HA 3CDLA 5DTDA 3S1QJ 4MO7A 1JUPA 1I3QJ 2EBIA 2XPUA 3ZQHA 5EG0B 3TP3A 3PM1A 5FKOA 2CRGA 3ZQFA 4LOCA 5M3FJ 1W0UA 3FISA 1NTCA 3RZDJ 4IHXA 2CUFA 5K7FA 1ZGWA 2EH3A 4C3IJ 3GTGJ 3JRFA 4AYBN 3BR3A 2AO9A 3GTKJ 4AUXA 3E7LA 2KT0A 1T33A 4IEJA 2K9SA 4D7NA 3W6VA 4X1EA 3IH4A 2FX0A 2LR8A 3ZQGA 2X6OA 2Y30A 2YU9J 2XGCA 1RESA 3GTMJ 1ETYA 5F0FA 2DA5A 3Q0UA 5E3OA 4QSHA 1XC5A 1Y1WJ 5GPAA 2P81A 2OPTA 4JX4A 1BA5A 3H3VK 2R5YB 2FJ1A 2RAEA 2COBA 2M0CA 3IV5A 3BTJA 3MN2A 5IOZA 2K9QA 4BXXJ 3LSGA 1U9NA 4RBOA 3HDDA 3GTOJ 3Q3SA 1JTYA 2JA5J 3S14J 1MBEA 5EEAA 1GUUA 2DMUA 1K61A 2WAQN 2X48A 2H8RA 3S2HJ 2R7ZJ 5FLMJ 2JWTA 3UKGA 5FKKA 3TEDA 4QIWN 1P7IA 4DYQA 4AC0A 4X6AJ 1RPWA 4J19A 2HOTA 1GV2A 2M8GX 3JREA 3QQAA 2VKVA 1SFOJ 1XS9A 5BNGA 1B72A 2ID6A 3A01A 5E3NA 1OCPA 1NK2P 2MSYA 1H89C 1ETVA 1FIPA 3WHBA 2FQ4A 2Y9YA 3TW6A 3BR5A 4ABZA 4M6VA 1U78A 5EDNA 2JA7J 4JP0A 3OOUA 1ETQA 1IUFA 1JUSA 1TWAJ 1A6IA 2DA3A 3ZOBA 2EZHA 5F1JA 1JKPC 4IHVA 3ZQIA 2CQXA 2LVSA 5C4JJ 1Z0XA 2XB0X 2XGEA 3CMYA 2HI3A 4DZJA 1AKHB 5M5WJ 2M9HA 1JKOC 2N8GA 2LP0A 1X2MA 2NVYJ 2LK2A
chains in the Genus database with same CATH superfamily
2MFZA 1BJZA 1WSUA 1W0TA 3S3OA 1HDDC 3KCCA 4B3AA 4M9SA 2OBPA 1EH7A 4II3A 3AFHA 3OSGA 2A61A 3FKIJ 3K4JA 2QA4I 4ASNA 5D8KB 4XKWA 5KVRA 4Y7NJ 1YX3A 5D5XB 5HS8A 3CCJI 5HDNA 1LVKA 2WB1N 3LA2A 4NBQA 1JXSA 3A1YA 1SAUA 3KFWX 1O57A 4IPAA 3LSTA 2JTVA 3GFMA 3ROUA 3HOWJ 2LY2A 1ZKGA 2ECCA 1V54H 3G71I 1FLIA 1N25A 4GGGA 3H36A 3SDGA 1JGGA 3HXLA 4M3DA 2WV0A 2E35A 1E2XA 2DYSH 3F21A 2VKEA 2JRMA 1JUMA 2A69F 1VQOI 4L0YB 1CQTA 4KDPA 4ZC3A 2EZKA 4XOPA 4BXFA 3WG9A 4I09A 4IQ4A 4UV8A 1JTXA 3SDBA 2BXZA 5HNFA 3HYIA 5CVJA 2D2WA 3F8CA 4PFOA 2JZYA 3F3XA 3RTRA 3L2RA 2OZ6A 3QPTA 4A6EA 2F5CA 3ABLH 2B0LA 4XMYA 3NQOA 1MNMC 3Q0VA 2A5WA 2NOJB 2M8EA 1MKMA 3BG7A 3GFIA 3L00A 3DLLF 2XAQA 3LSPA 1FMWA 1W5CC 1FIAA 4HAMA 3NWSA 2B9SA 1SC7A 4V2GA 1UCRA 3I9V2 4HBLA 1S7EA 3ZMSA 2P4WA 1Z67A 5FGMA 1KONA 4GCVA 3PUBA 2CYYA 4R79A 1I6HJ 1LB2A 3BR0A 4OWRB 1S5LC 3CUQB 2LSOA 2KIFA 4M3FA 4FCYA 4PCQA 3DTKA 1CF7B 1BOAA 2QM3A 4JX6A 2M3AA 2V9VA 4PJNA 2H1LA 3WG7H 4XIDA 1S29A 3RKWA 4A3IJ 2Q0OA 4M6XA 2O7OA 4YIRX 5C3EJ 3FMQA 3K4MA 2K4BA 2PN6A 2M1BA 4B4CA 1HW1A 2ZBKA 4OU0A 5HLIA 2KDZA 1Y39A 5IYCJ 1BI3A 2KRHA 2JSPA 4D0PA 1QPMA 3CESA 4YFNF 4IX7A 1P6RA 2BVLA 1AU7A 1WJ5A 1YQAA 1DGRM 3HEFA 2EFNA 2ETHA 3HPHA 2EIJH 4ESBA 4OIRF 1BW6A 5J3LA 2YUSA 4RGUA 1AWCA 2NVXJ 2V79A 3LSMA 4N0BA 3LOCA 2LLKA 4PSXA 4IJAA 1JHHA 3AG4H 1ZK8A 4B1RA 2IS2A 1G3WA 3C3WA 4HRIA 1E0EA 1TP4A 2VQHA 4XONA 1T98A 5D6EA 4KN7X 3BTLA 3FK6A 3S8PA 1JJ8C 2HXIA 2XAJA 1FC3A 1FJLA 1UFMA 3HOXJ 3RKXA 4L5EA 4BL0B 1ZN2A 3WTWC 3S1MJ 1QA6A 3I64A 2HWVA 3IH2A 2OUMA 2O03A 1FWZA 2V7FA 5DYMA 3OYJA 1TWFJ 1WRJA 4FISA 2YR2A 4HV6A 1BC8C 2EZLA 1XB4A 4I0AA 2H1KA 2PMUA 4LD5A 3G6EI 3IAM2 3GUDA 3ASNH 4A0XA 4IRIA 3OS2A 3JRDA 3FDYA 4A3MJ 4ZYGA 3HM5A 1LDKB 1U0JA 1Z21A 5AIPA 1LJ9A 4DW6A 3D5LA 5K5RA 3K2ZA 2V4JC 1ZR2A 1J09A 4BE1A 1TL8A 1Z05A 2IVMA 2JT1A 5GPCA 4PJJA 3BPXA 3JAMK 1HOMA 1D5YA 3LMMA 3FXJA 3KP5A 4BU2A 3ZQCA 2A07F 3ECOA 4F55A 4HW0A 4OOIA 3FHZA 2YS9A 3CP8A 4Q48A 3M1CA 1ZTRA 2LFBA 4RM3A 3KPHA 2L7FP 3TDUC 1D1CA 2HQNA 1YIOA 3WU0A 1FEXA 4JQFA 3Q9SA 3UNGC 2EV0A 2KL4A 1HKQA 4NUBA 3K70D 3RQIA 1M1EB 3EYIA 2CWEA 1DP7P 5IP7J 1RUNA 1DP3A 1EV7A 2JSCA 3U21A 1OLTA 3TP0A 3V8JA 5E1XA 3M8EA 5LHGA 4OIOF 3NAUA 1SFXA 4EMSA 2HNHA 2ZNZA 5CVUA 3SFIA 1HKTA 1K78A 1RI7A 2ZFUA 1U9OA 3BT9A 3B02A 4BHCA 4OIQF 4L0ZB 2VBZA 2EFOA 2ID3A 1H9GA 3MKLA 4DYCA 2NS8A 2ELKA 5HS9A 4CUGA 5ICCA 5AONA 4IQJA 4ZTJA 3L09A 3OYAA 2A6EF 1OCZH 1FTTA 2Y2ZA 3A0BC 4B47A 3K4CA 3HGGA 2W1OA 5FKLA 4C2MJ 4EM1A 1WJDA 1J0RA 4CDGA 3HGYA 4ZDLA 2NVUB 1G2HA 2O9LA 2NVQJ 2LG4A 1X4PA 2CQQA 4RLFA 3DPLC 2DK5A 2HYJA 2PJRB 2O0YA 5KK1A 4FE7A 2GIVA 5LFAA 2DT7B 4RDUA 1O4XA 1SVOA 3QPLA 4XN0A 3L2WA 4B48A 3BG6A 3IWZA 3G4SI 1QHGA 2ZC2A 3CCEI 3N05A 1TC3C 4AU7A 3FXMA 4YFXF 3KP4A 1T0FA 3WODF 2ESNA 2IPQX 4BBSJ 4ETSA 3RZOJ 1Z3YA 2L9SA 4IRGA 1XCBA 1Z77A 5C44J 1KU9A 3QPHA 1G3YA 1Z1DA 2M87A 1T08B 3S16J 2ZKZA 3LQQA 4NDLA 3VSKA 4DYRA 5F1RA 3ZP5A 3G3ZA 2CUJA 2W48A 3WGGA 4P9FA 3P9KA 4OMYA 5B1BH 4MQVA 2AHQA 1G3SA 2OCEA 1P4XA 3PO2J 4KNYA 2OQRA 1SD5A 2IBDA 4G7ZF 2NYXA 2OJED 3ONQA 3ECHA 4U0YA 2K02A 3H3ZA 3PQKA 5FKMA 1TLHB 4G12A 3S32A 3ERED 5F27A 1Z91A 4HF1A 4M73A 3F0CA 3AAFA 1B6AA 4A0YA 2IA0A 1N75A 4KA4A 2LDUA 2WAQA 1MZBA 2L9VA 4DJAA 4HNUA 1JT6A 4BJTA 2VXZA 3DBLB 1DU0A 2DOEA 2EK5A 3F8FA 2GWRA 3HOZJ 4KIGA 4KISA 1ZRCA 1EH8A 2LKSA 5CVRA 2DFHA 4CCOA 4J00A 4L9NA 2JA6J 5FRMA 1QZEA 3A03A 1SAXA 1Z6TA 5KAFC 4YELA 3OR2C 1ORKA 4BH9A 4E7KA 2OA4A 3PFIA 3FIWA 3BZCA 1D0ZA 2DTRA 3O3KA 3ABMH 1YI2I 2AQEA 4WXDA 2K4JA 2DFIA 1PUFA 5ILUA 2ECBA 4UUSA 3QYEA 3IRQA 4E7ZA 2XROA 3CO7C 3WTTC 3BR2A 3U1DA 2FOWA 1HLVA 3CMAI 1HDPA 4AIKA 1BI2A 1XGSA 2CS3A 3G2BA 3CCMI 2E1MC 1HC8A 1U5TC 2W84A 2E71A 2FU4A 2MC3A 4U0WA 3ZRGA 1DU6A 5D4SA 4IHYA 2E34A 2KJBA 4MLOA 3HG9A 2AS5F 4LK0F 4M6YA 3SZTA 5K5QA 1JHFA 5EJCA 2M4GA 2PLYA 2HGCA 1L3LA 1GXQA 2OC6A 2K7LA 3ZQFA 2JPBA 5JHFA 3KP7A 3BCBA 5LRRA 3QAHA 1RIOH 1XSXA 1QQIA 2LYCA 1ZH5A 4RM2A 2QUFA 1MW7A 1ZGWA 4BQAA 5E17F 4EV0A 4C3IJ 1ZLKA 4A5NA 5LLQA 2FE3A 3HRSA 4DBRA 3V8KA 3BR3A 1EH6A 3R4KA 2BY1A 4EJVA 4IEJA 5BMZA 4D7NA 2NNYA 2EIMH 2Y30A 4ITVA 3OL4A 3GFLA 2KIMA 1ETYA 3L2CA 5F0FA 3ZGKA 1HSJA 4UHTA 3V7RA 5GAEJ 2P7VB 5HOOA 1XC5A 5E3OA 3MCZA 4WX9A 4WCGA 3P9IA 2OPTA 5DCFA 1XMKA 3HTSB 1IW7F 2Z99A 2R5YB 1FBQA 2FJ1A 2M7BA 1R22A 2L4MA 3BTJA 4LFUA 2HOEA 2KFDA 2K9QA 2R7QA 4Y33A 5J4YA 4LB6B 1U9NA 2TDXA 2XAFA 3K4KA 2QBYA 3ZQQA 1MBEA 1FOWA 2IW5A 4JOMA 2WAQN 2R7UA 1R49A 2JWTA 2YSRA 1TQPA 3DTIA 2CW8A 3FBIB 5D5VB 3TEDA 2HYGD 1YHQI 3H3UA 4NQWA 1YJ9I 1P7IA 1QBJA 3SEQA 5DCMA 2PMHA 2MD5A 1TTYA 3NRVA 5BPDA 2Y48A 2EILH 1NK2P 1V4RA 3A2KA 3OYFA 4G94A 4KMUX 1FYMA 4II2A 2FQ4A 2Y9YA 2XVCA 3BR5A 3SFZA 4ABZA 2DT5A 5L3BA 4IO9F 2KISA 2KIQA 3CD6I 1WQ2A 5DUKA 2KP6A 3VEPA 3FMSA 1ETQA 1TWAJ 2EZHA 3JTGA 3KYLA 2GXAA 4U0VA 4O3MA 3VOEA 1JKPC 3AL0C 2BVMA 2K85A 3N97A 3VB2A 2LVSA 5LHIA 1H0MA 1Z0XA 2XB0X 2EA4A 1X3ZB 2HQRA 3DBRB 4LG0B 3EUHA 3DP7A 2M9HA 1DQUA 2VB6A 2N8GA 4EATA 4F3QA 3PJRA 5LEKA 3HL2A 2QYOA 2NVYJ 2BV6A 1QGPA 1Z7UA 1MDMA 3RYRA 4IOAF 1R5HA 4I76A 2WAFA 3VODA 4A3LJ 1REPC 3BR6A 2DW4A 2KHMA 3SJMA 2GBYA 3H9JA 1KU7A 5DV5A 1I6XA 3WTYC 3HOTA 4FETA 2CUZA 5HODA 3M1EA 1VNDA 1G6NA 1YIJI 3MZHA 5F0CA 3WTXC 2COMA 3AG1H 2OTLI 1NG6A 4L9VA 2DQRA 4EJOA 3W2VA 2L4AA 2M5WA 3KYDB 1KA8A 1TNSA 2HR3A 3RPQA 3RKQA 2IP2A 3O8GA 1QZYA 1FP1D 3KLNA 5JLWA 3E6DA 3TOBA 5EEGA 1A04A 4LB5A 1FNNA 1E3PA 4CZCA 5KHDA 2UV1A 3OYGA 3WHCA 1U8RA 3RI4A 3CJQB 3JCUC 3ZN1A 1BW5A 2ZXJA 1YOVB 3OOPA 3ZMZA 1ON1A 5IP9J 2XAGA 1MBJA 3QODA 2LREA 4HG2A 2PI0A 3TOAA 4BHPA 5M3MJ 1Y0NA 2VPLA 3LSKA 1WH7A 5AIQA 2EB7A 3DEUA 1SMTA 2CFOA 1A36A 3D1NI 3V7CA 2RC4A 3J7YJ 2M4KA 4H0EA 2NRAC 1Z6RA 3HKZN 2EPFA 3CC2I 3RCOA 3ZQLA 4Z6YA 5FB2A 3PIOF 4UUTA 5EGOA 1QZZA 4C2UA 2R7RA 1K7AA 1I1SA 1WI3A 4XL9A 2Z2SB 4G6DA 2JN6A 4CYDA 4NNJA 2O8KA 3W2AA 5A2QZ 2ISYA 3U1KA 5IP6A 1EA3A 5DUIA 2EV6A 3BTCA 2HTJA 2I10A 2LY9A 3ASOH 1MSEC 4XM3A 1MBHA 2DMNA 2W24A 4RMNA 1P9QC 1TW2A 1QNTA 2I5UA 3IKVA 4ZDOA 2BOLA 2AQFA 3KYCB 2HVSA 2NXNB 1WZ2A 2BW3B 2DOAA 2F4MB 3H0GJ 2LTPA 2VUMJ 3IL2A 3S1NJ 2NNNA 1IRZA 1H88C 2LBFA 2CJJA 1XX5A 2VBWA 4I7HA 1WKMA 1IXSB 3M8JA 4AIJA 1ACIA 4M72A 1UB9A 2ZMEC 1EKEA 3D5RC 5HS7A 4XLPF 6PAXA 4I2OA 1K79A 1WCMJ 2X51A 4HPQA 2R7FA 2ME0A 1USSA 3QRFF 1H9TA 3JRHA 1LFBA 3FBNB 3GXOA 4Y13A 1B72B 3ZR8X 4PK4A 4YIFA 3A01B 2VT3A 1BI1A 2DTZA 3HOUJ 5ED4A 2CUEA 2K86A 4DIQA 2OF7A 3HRTA 1QPIA 5ICFA 5A2QK 2Y75A 2E19A 1D0XA 5JR3A 4C2TA 2EV5A 2FBHA 2FEZA 3X2QH 2HZDA 1BR4A 4C3JJ 2K27A 1LDJA 3EPZA 4HOBA 3GX4X 2ZJQF 4AVZA 4ZTFA 4HQEA 3GTPJ 2ZJPF 2VJJA 1W7PD 2ELJA 1W4MA 5EG0A 3JR9A 5IPAA 2HVRA 4BGDA 1K4SA 2B7EA 2CQNA 2KJCA 1R1TA 2P6TA 1R36A 4IHSA 3OYMA 1UG2A 3FXKA 4IVNA 5B5EC 4IL6C 4F91B 3G73A 4XRSA 2ZB9A 3OS1A 4W1UA 4ESJA 3K2AA 2V6CA 3OR1C 2JVHA 3K1PA 5L3FA 1RETA 5FD6A 1OFCX 2F4IA 3HSEA 3K9TA 3A02A 4BEHA 2DPUA 2LKXA 2HQ5A 4F52A 3WGHA 3H5AA 4RS8A 1IAWA 4D9JA 2FRHA 5HDKA 2HDCA 1VQ5I 2G9WA 3K7AJ 3J7ZI 3V42A 1IJWC 4A3BJ 3GWZA 4CXFA 3ISPA 1NHAA 2GM4A 2MGQA 4A12A 2P7CB 4XN3A 2F5DA 1VQMI 1RR8C 1MJAA 1XTAA 3MKZA 3DKWA 4BE2A 3P9CA 3CUQC 3EDPA 2LMDA 2CSOA 4E70A 1JJ6C 2JRTA 1J2XA 2VC0A 4U88A 2XF7A 3EUKL 4P96A 3C2GA 2DAOA 2HKOA 1HW5A 3I55I 1MMGA 4KJZA 3E6BA 3ZMTA 2MG4A 2L7KA 4KICA 1P2FA 2O8XA 1V55H 4D1QA 4AIDA 4F92B 4Q4ZF 1QU3A 3N4MA 2M2EA 1UHSA 4PJ0C 2NAZA 1VQ7I 3P5JA 5H6RA 1WGXA 5E3MA 2NOGA 2GA1A 4A6DA 3H9QA 1PJRA 1ENHA 2LF8A 5LEJA 2CFXA 2VKHA 4RB0A 3CCVI 1GDTA 5FLVA 1S3JA 2F5VA 2EA2A 1OR7C 2MBFA 3LSHA 3QOEA 4QPOA 3LNQA 4BDZA 1YE9A 2QZ8A 4EJWA 2VI6A 1XGMA 2QENA 3H1CA 5DEQA 1TNTA 1WVRA 1ETXA 4EQQA 3JAMZ 2L9RA 3DTEA 3W2WA 1CGPA 3WTUC 3E5QA 2EFPA 4LK1F 4HSRA 1FSHA 3S17J 5JI6A 3KP2A 3KIOA 3AG3H 3CCQI 3ZQ7A 2QSHX 2E7WA 4I6ZA 2IEKA 5JLXA 3OMYA 2XPWA 1BR2A 2DJNA 2HEOA 1RKTA 3TMOA 2UXXA 2MLKA 3F8BA 3HUGA 3T0YA 2O6GE 4CZZA 2WBMA 1WJFA 3C2BA 1F9NA 1GXPA 4I98B 5KAIC 4XQFA 2WAEA 5J1RA 1XCVA 1MBKA 3ULQB 2UZKA 3DV8A 4G8XA 2O3FA 2VLAA 1E3OC 4HDVA 1EJ9A 2Q1ZB 1A35A 4L9TA 4A3KJ 3S1RJ 1WPKA 5CQEA 1YYVA 2RQQA 3RQ4A 2RREA 2VKDA 2R7TA 1YW8A 2XRNA 5IOYA 1LFUP 4GFBA 3ZPLA 1P7JA 1ZLJA 1VZ0A 2HDWA 3HRUA 4E7SA 2E2HJ 1I50J 3BG3A 3KZYA 4A69C 3OIPA 3QU6A 5HVQC 2FUG2 2LKPA 4UV9A 1JKRC 1H8AC 3GEZA 3GMEA 1HKSA 2FNPA 3I0TA 3LL7A 4M3GA 2LOOA 3GBGA 3GLXA 4UVCA 3IKTA 3S1QJ 3E3VA 4XLAA 4YEJA 4XNFA 4KUMA 2FF4A 3W3CA 2ZJRF 4OMZA 4IXAA 4GYGA 1D8KA 2X4HA 5TGTA 2ELHA 5HDGA 5FKOA 1YFHA 2CRGA 4L18B 1MGTA 5BOXA 1S7AA 3EETA 2QWWA 3RZDJ 2RV8A 5J4VA 1R6RA 4FQGA 1LUJB 1X1AA 2CUFA 2DODA 4U87A 1GVJA 5JFRA 2DDAA 3Q9VA 1D5VA 2CQKA 4KN4X 1YW9A 2BYVE 2P5VA 2AO9A 2ZCWA 5FFZA 3QU3A 3DKXA 3TQNA 2IRFG 1R4NB 3CTAA 5F64A 5E18F 3WTVC 3FWEA 1K78B 3GZNB 3RPUD 3Q0UA 2XAHA 4PUSA 4GO1A 4KIBA 2M0MA 2P81A 2FMYA 2RAEA 1W36C 2M0CA 3IV5A 1X3WB 2MC4A 5IOZA 4BXXJ 3LSGA 4JK1X 3Q3SA 4HV5A 1JTYA 2UXNA 1O7FA 3KP3A 2DFFA 4CCNA 4CCKA 5EEAA 3VYSB 4NHJA 2ICWG 2IT0A 2BGCA 2CH0A 1YJWI 1ZG1A 3S2HJ 1XMAA 2R7ZJ 5GADJ 2IJLA 1T95A 4MQ9F 4DYQA 3IRRA 4M71A 2H6CA 4TV7A 1T39A 2KRFA 2DO7A 5KCMA 2HOTA 2GOXB 3QP6A 4IRHA 3COAC 2VKVA 1SFOJ 1XS9A 2Y69H 1SD4A 2BY2A 4XRFA 4GXOA 2PMZA 1OCPA 3U9GA 2MSYA 2LF7A 1FIPA 2GQQA 3WHBA 5ICGA 1VQ8I 1G8XA 5FLXZ 4M6VA 4BE0A 2JA7J 2OV7A 3K4NA 4CHUA 4E6KG 3LA3A 2V26A 5F1JA 3FF5A 2M45A 3TGNA 3HSRA 3CF5F 1FYLA 1BIAA 3ZQIA 4BACA 3F22A 2E5NA 1ZG3A 3ZMDA 1YX5A 4LJZF 3OV8A 5L3CA 2KQRA 4KMFA 1WJAA 2LP0A 1VTNC 5CVVA 4E7HA 4Q47A 3AKZA 4HZFA 2X1EA 1C0WA 4HEA2 4HQMA 1EF4A 3RIRA 2GXGA 3SQNA 5BS6A 2L7ZA 3FM5A 5DDGA 1ETOA 4NB5A 1IV8A 4K2EA 4D7MA 1U5TA 3LFUA 1KU2A 5TISC 1QRYA 2FMLA 3ZMUA 2L7MP 3O6BB 3IAS2 1WH5A 2OAZA 2VASA 3CCSI 3KLOA 5FLXK 3FXOA 1GVDA 1XDSA 4Y17A 2NVTJ 4XICA 1VFCA 1IDYA 4FX4A 1IN7A 2OCCH 1W5TA 1OKRA 1HA8A 4UB6C 2E2JJ 1PUFB 2W57A 3E5XA 5TRDA 1P4AA 4F7ZA 4UUSB 2OZUA 3K6GA 3HZJA 4M3BA 3IUOA 4H4KC 2HOAA 4LG3A 2Y0SA 4OAZA 4XLEA 5LGNA 5CJ9A 4R8HA 2JMWA 2ZFWA 4N4OB 1UG0A 3JRCA 2BZTA 3VYRB 4XLNF 1XPXA 3O8HA 1V5EA 3QYBA 1IXCA 3LA7A 5J8FA 2Z16A 2O61A 4HX7A 1GV5A 1ZR4A 1UZCA 4M3EA 1UJ8A 1SVLA 4P9UA 2H94A 2L54A 3OYKA 2JJ7A 5IT3A 1TWHJ 1X1BA 3CLQA 3F8MA 2VXDA 5BQTA 3WTSC 5J47A 1K83J 2Z3YA 1T2KA 2WY8Q 2F5FA 4UY8I 2DN0A 4XR6A 4B43A 4PJLA 2DA2A 4XK4A 4HX8A 1YITI 4YG2F 1BL0A 4FE4A 3LFKA 1TQMA 1LE8A 1POGA 2RDPA 2PMZN 3R60A 1X3UA 5K7ZA 1MH3A 2FOKA 2IS1A 1FBUA 1ZQ3P 5C4XJ 4AYBA 5K1YA 2EQRA 2XB5A 4WWCA 4S05A 3ZMVA 4GYIA 4MFDA 5DD8A 3DQVC 4BY1J 4CCJA 5DM7F 1Y56A 4BNCA 4GDFA 2BY3A 4EVIA 4HLXA 3CO6C 4IHWA 3CUOA 2STWA 2DXIA 4EJUA 3PNVA 3KX2A 3VYUB 1MMSA 1D8JA 3JSPA 1IZ1A 1G59A 3TW7A 2QBYB 3BROA 1F5TA 2VJIA 4RAYA 3OYEA 5E8GA 1DPRA 1IC8A 4ON0A 1IRFA 3CLOA 3GW2A 2XRLA 3QPSA 3TL4X 2HPMA 1D0YA 4MGRA 4NQWB 2R4GA 5E3LA 4ZDPA 1BR1A 4CGZA 5DCMB 1PDNC 3ESWB 3TO7A 1WJCA 3R0AA 1PVEA 2DA6A 1HXDA 1X58A 3BY6A 3KE2A 4HNTA 1ONVA 4XORA 4V19K 5K5OA 4HLYA 4S04A 2V9PA 1FTZA 3ABKH 2X1DA 2QCOA 3RJPA 1K6OA 3GYHX 4R1HA 4ENNA 1MMNA 2V1NA 1T6SA 4FTHA 1U6GA 3MAJA 1NK3P 2D5VA 3KZZA 4HDUA 2JQ7A 1ODDA 3C18A 2HXOA 3PSIA 3I59A 2VQCA 1DUXC 3OWTA 2BHZA 2MYSA 4D5FA 3EUHC 3BTIA 1N77A 2STTA 5D8LB 5IT9K 2OU2A 3BWGA 1FX7A 4CSWA 2D1VA 3WE3A 4DOZA 4ENKA 4HF0A 3CZ6A 1VQ4I 2VOPA 3K1NA 1I39A 2BBYA 2QSFX 1A5JA 2TCTA 2G7UA 2LY1A 4ENMA 1MDMB 1UELB 1STZA 2XDVA 1XMXA 2V1XA 1AHDP 1OYWA 4A3GJ 2OQGA 3H9GA 3T8TA 1XSVA 1FY7A 2Y31A 4BYYA 5E1WA 3I71A 1IN6A 3ZN0A 2VN2A 1YS7A 3E0JB 3K10A 3SZGA 5HNHA 4ZZLA 1VQLI 2DQLA 2X0LA 3JRIA 2GAUA 5J1YA 4LIVA 2A68F 3FXQA 2QLZA 1JT0A 1OQYA 2VQGA 3S93A 1J59A 2UUZA 3PFYA 2QKLB 3MWMA 2R3SA 5LRSA 3S15J 3QYFA 1ULYA 2XF5A 4RLQA 4CH7A 1Y8RB 1RUOA 1KYWA 4XBFA 2W7NA 1X1PA 4BHBA 3CQZJ 2GZWA 2K9MA 2PG4A 2P6SA 4G9YA 3MZYA 4RB2C 2C6YA 2QQBA 1YS6A 3J80K 1Y6IA 1IG7A 1DGWY 2KZGA 3F9KA 2XSDC 4U7BA 3GTJJ 3DLAA 4A93J 1SANA 2XPVA 4B8XA 2RKHA 2PBIA 1OYIA 1Z7LA 4HSTA 3L2VA 3F6VA 2RQPA 2VPRA 3KZIC 3FX3A 4XKBA 1SFUA 4L9JA 4WF2A 1E3HA 3HRMA 1ON2A 1LEAA 3S3MA 3CC4I 1FPQA 4A2UA 2IS4A 1ETKA 5M5XJ 3F8NA 2HS5A 3RKYA 4YFKF 4O6JA 2RNGA 2P8TA 3BR1A 1R1UA 1JI8A 3V4GA 2XKPA 2Z5UA 5EGOB 2CW0F 3DEWA 5F04A 1OCTC 2QKMB 3BJAA 3ABUA 5LBQA 4BDYA 1ZGJA 2HU9A 3HB9A 1SMYF 3ABTA 1F1ZA 3S2DJ 1D1BA 1WHUA 1BBYA 4IZZA 1MNDA 4XSZF 2WV1A 1AKHA 4QWQA 5M5YJ 3J81K 4JX5A 1TW3A 2IXSA 3K4BA 1QVUA 1YW7A 3M8FA 2CU7A 3PO3J 1KYZA 2JA2A 2XHKA 3RYPA 1BJAA 3B6CA 4P5OA 1YO5C 1B8IA 3IC7A 1L0OC 1IO2A 4UUVA 2MA3A 1OJLA 4Y15A 1X19A 1MSFC 2K9LA 4IOCF 3E97A 5EF6A 3G1LA 1USTA 2LBFB 1J75A 4MTEA 5CQGA 1Y1VJ 4G7OF 1OISA 5GAHJ 4B09A 2H8WA 2XGXA 2L2OA 3IHUA 1T38A 1QHHD 4RAFA 2Y9ZA 4UB8C 4XSXF 3D0SA 1XSDA 4CCMA 4ZYAA 2FBIA 1IV6A 3J7AY 3OYNA 1K4TA 3JRGA 3DWLE 2X6WA 2DMQA 2EFWA 4XLFA 4M74A 1MBGA 1B8IB 1WI9A 3H92A 1X2NA 2PX9A 1UMQA 5FD5A 1V3FA 4DQ2A 2CW7A 4C3HJ 3OYLA 1ZREA 1UHMA 3BQYA 3HC7A 1RZ4A 4A3EJ 3CJNA 2GA2A 1E17A 2A5YB 1JE8A 4I02A 2VQLA 4PFPA 3BQZA 5GAGJ 4LLNA 5DM6F 4O5VA 2MABA 3IH3A 4D5CA 2VJ5A 3I54A 1MMDA 5J6XA 4KFCA 5F0HA 3DEEA 3CDLA 3PNTA 3QWLA 1JUPA 3ERMA 3EYYA 2EBIA 2XPUA 2YX4A 3V8LA 3ZQHA 1G3TA 5EG0B 4IF4A 2XUBA 1Q1HA 1KQ0A 2K5CA 5L3GA 4ZYEA 1BI0A 1NTCA 3S3NA 4IHXA 2KLOA 3C2HA 2R7WA 3C1DA 3CUQA 1SD6A 3TDZC 3GTGJ 1U2WA 2EIKH 1HQCA 1I3AA 2CO5A 1CF7A 2IGOA 2V6EA 2LRDA 2RN7A 3K1MA 2VONA 3GTKJ 1J9IA 4BEHB 4AUXA 3DKYA 4KIFA 2DI3A 4ENJA 3E7LA 3MQ0A 1T33A 2K9SA 4PZJA 3DU5A 2WADA 3W6VA 3PIPF 4X1EA 2FX0A 2LR8A 2X6OA 2IS6A 3KETA 1OPCA 2XGCA 3W6KB 2YU9J 3LSIA 4Q5SF 3CDIA 1SVMA 2HKXA 3M9AA 2Y0MA 1KZHA 1Y1WJ 3PSFA 5GPAA 3FKJA 2ZNYA 1R4MB 4QPQA 2DK8A 3F6OA 4AIHA 2COBA 2J5PA 3OYHA 3MN2A 3M07A 1IF1A 1R7JA 4RBOA 1OR7A 4C30A 2FA5A 1KQ9A 2F6CA 2JA5J 2IGKA 3S14J 3SEZA 1GUUA 2E60A 3BZKA 1A6QA 1K61A 2H8RA 3DBHB 2HFHA 2DT6A 2IA1A 1I1GA 3L2UA 3UKGA 4WXHA 5FKKA 4QIWN 2Z1DA 1O3QA 1GHCA 2EINH 3H35A 4LITA 2LH9A 4BUPA 4X6AJ 2M8GX 1IXRC 3JREA 3QQAA 2ZSIB 2EFQA 1WWXA 1R00A 2DOFA 2DBBA 5FFXA 1LNWA 1ETVA 1H89C 3C7JA 4CA0A 2KZVA 1RNLA 1U78A 3FZVA 4FHTA 2FXAA 2PEXA 3MKYB 4JP0A 4RAZA 1YLFA 5D5WB 1IN8A 2DA3A 1A6IA 3ZOBA 1G4DA 2Z33A 2XAUA 2W25A 4IHVA 2CQXA 1ZHFA 1OCRH 4BJ5C 3OYDA 4B44A 2XGEA 3CMYA 2HI3A 2XKOA 1LDDA 2CV0A 5M5WJ 3P7NA 1R1VA 2OD5A 3FXRA 1HW2A 2HZTA 4RGRA 2FSWA 3HUGB 2R7OA 3KEYA 4DNCA 5HLTA 1MD0A 3GLLA 1LPQA 5H6QA 5B66C 2OTJI 4G6TB 2HOSA 2E1CA 3ELKA 4FX0A 3I58A 4JYKA 4BS9A 2QF7A 3T1BA 2B63J 4RB3C 4XRMA 3OSFA 2GLOA 1ZYRF 4I0BA 4AVPA 2JK3A 2X1CA 1O3TA 4BY7J 3MFKA 3OIOA 3I4PA 3CCRI 1BN5A 1YTYA 3BG5A 2QQ9A 5L3DA 1S7OA 1FYKA 1RC9A 4AWXB 5FROA 3FXUA 1Y8QB 5K7HA 1FSEA 2RGVA 1YJNI 2QEXI 2R5ZA 2EWNA 2TRTA 1SEUA 2F4OB 3WE2A 3HHGA 3BC8A 3SZPA 1XGNA 1TWGJ 2WY7Q 4OAYA 1BM9A 2WWYA 2PQ8A 2G7HA 3HOVJ 5E20A 3B6AA 3CP2A 4N9IA 3REOA 3LSRA 2CV2A 1UAAA 3HSFA 2A6TA 5CKTA 3FK7A 2E1OA 2AXTC 3LWFA 3HTUA 2IGMA 4XKVA 2PJRA 3PNYA 5L3EA 4MFEA 3JSOA 3GCMA 3VPRA 2A3SA 3S2WA 2NS0A 2VODA 1R58A 3F72A 3OS0A 3R6SA 3IP4B 5JHUA 1VI0A 4XLHA 1SD7A 4LIUA 1K6YA 4E7IA 4XKCA 3I3LA 2VOOA 2R5ZB 2L0KA 3I53A 4Z2YA 1R5ID 1FP2A 3GZ5A 2MLGA 2VC1A 4EGYA 3HHHA 4DZPA 2Q2EA 4UVAA 5E79C 1YG2A 5EZGA 2ACJA 1VQ9I 5JVGF 5J8CA 2CG4A 4L5JA 4V2FA 2ZXIA 1ERDA 1S72I 1PP7U 4MIMA 4ZH4F 4ZYHA 2D45A 2PFBA 2IGNA 2X85A 2CGPA 4CICA 1V5GA 3E1SA 3HBLA 3GZ6A 3FXLA 1YRNA 2P5LC 2V1DA 3JRBA 3B73A 4BQOA 1F43A 2ADUA 2FD5A 4G7HF 3EQLF 1AA7A 3K4LA 1R9TJ 3HPGA 4MEYF 3MVPA 1T0FC 3OL3A 4BQQA 1IRXA 4CO8A 2IA2A 4A5MA 1TWCJ 2KMUA 3BG9A 1U8BA 1RRJA 3DXJF 2QSGX 1TQIA 5H2FC 3HOYJ 4BBRJ 2Q2EB 4X0GA 2W00A 1VQPI 2NS7A 1P92A 1FMVA 3TO6A 1VF9A 4ZYDA 4UXNA 2M34A 1R71A 2ZJ2A 3T5XA 2HTSA 5D6FA 5EYRA 3FMRA 1YRNB 2GIZA 3LQRA 2DFEA 4RAGA 1TBXA 2VL8A 3RDIA 1Y0UA 3LSJA 4I01A 1KQ8A 2K3PA 2EZIA 2KKOA 2XV4S 1UHWA 5ERIA 4RGXA 3BP8A 3QOPA 4XOTA 2M30A 3I56I 5CPRB 5D4RA 5B1AH 1ZARA 4E4HA 1XN7A 2VE8A 3CCYA 4E7LA 5IYBJ 1HCRA 5GP9A 3SXYA 1RKWA 2XGDA 4KT5C 1IGNA 4PGGA 1B9MA 3A4CA 4NC8A 1MMAA 4PSWA 2X6YA 2F48A 2MW8A 3OYIA 3KEOA 1QVTA 3WU2C 5GTHC 2R7XA 5TJJA 1D1AA 4PGHA 3Q5FA 5D5UB 4U7DA 2P5KA 3K0LA 4UVBA 1S6LA 3VDXA 2ZSHB 2MD0A 1MNEA 3GFJA 4MEXF 3RSNA 2G0EA 1F4KA 2YX7A 9ANTA 4Y3OA 4P55A 3OYBA 2BEOA 1JKQC 2VBYA 1LVAA 5J1UA 2R93J 2EJRA 2QVOA 3AG2H 4EM0B 4QTRA 3CJRB 5KNLA 3MMYB 3DCFA 1W5SA 5HLGA 2XASA 4A3FJ 2AXLA 5H20A 4FT8A 4LGWA 1LEBA 1PUEE 2W82A 1ZRFA 4XLCA 4EEFG 2KPMA 4ANJA 1Z9CA 2DMTA 3M7GA 1B4AA 4EGZA 5DD4A 2LD5A 1LFPA 3ML6A 3GVAA 1OYYA 2DCEA 4HX4A 2E1MB 2R92J 1X1DA 1U5TB 3KP6A 5IY5H 1ETWA 4XRSG 3HOSA 1MBFA 1IN4A 3BZ6A 4Y52J 1MH4A 3L1PA 2M7AA 2F5EA 2CMPA 1VQNI 2HYFA 5EEHA 1GT0C 3VSLA 4UNOA 4A3DJ 2IAIA 1KU3A 2A05A 2V9KA 2R5YA 3L2QA 3O2PE 4F93B 2ME6A 3M3YJ 3WGIA 1I27A 2CV1A 1RR7A 1J7KA 1APLC 3E5UA 3WTZA 3PL8A 4GRIA 3QP5A 4PDKA 2L9NA 3Q0WA 3PUFA 4IKFA 4AM3A 3BOQA 3BJ6A 2RNJA 1PYVA 4A3JJ 3UR3C 2R0QC 1MJ9A 3DF8A 3CMEI 4OINF 3GO5A 2DDBA 2VJ4A 1W7PA 2J5OA 1WJBA 1Q1VA 3V7SA 4DBQA 1XG1A 2PJPA 3H0DA 3CF2A 4N4NB 1SFEA 5F6FA 5FJ8J 2O5RA 5F08A 2BHYA 4M9XA 3MKWB 1GLNA 3H5NA 2XC7A 2X9DA 4MHGA 2MH9A 4AD9A 4RGSA 4Y4RA 4C9YA 1XDUA 1OCCH 2VT2A 4FASD 2ZXWH 2KIUA 3MEXA 4QLCU 2JVGA 5LGUA 3J7AO 1IUYA 2X6XA 3I4MJ 1F36A 3JW4A 3G1MA 2QQ8A 1R5GA 3IWFA 2DA1A 5IT9Z 4S0HB 2JA8J 4BKXA 1LE8B 5IYDJ 4A3CJ 5B3SH 3JRAA 5DS9A 1QO0D 2K9NA 4HNVA 1W7PB 2DLLA 2JPCA 1T8IA 3TO9A 4KITB 2ZO4A 1ZGAA 2E1NA 2W85A 2RVCA 3W6JB 3HKZA 4NC6A 4LG0A 2Q8KA 2DA7A 2KRCA 5E1ZB 3L7WA 4RA2A 2DMPA 5LD2C 4PJMA 4CYCA 1LQ1A 3MZ8A 2V1UA 1B9NA 1X1CA 3G1OA 5FO5A 5GTIC 4J01A 1J5YA 2ZXHA 3F23A 2Z9OA 1W36D 2JUGA 4A0ZA 3BDDA 5JVTA 3BCAA 2BY0A 1FBSA 5EZHA 4YRVA 4BQNA 4WK8F 2WA0A 4L5IA 2LC2A 3GTLJ 4MTDA 4NC7A 3NARA 3AL0B 3L9FA 1IDZA 4I99C 3TKYA 3WU1B 3BPVA 1I5ZA 3I4NJ 2K40A 2Y0SN 3GF2A 3BLYA 3FHNA 1HBXG 2BXYA 2ESHA 4CYCB 2BE5F 2HDDA 2YU3A 2GXBA 3M4OJ 2DA4A 5FRNA 4G6QA 3VYTB 3J80Z 4KYWA 1HF0A 1BOBA 1ITYA 3PQJA 2HQAA 1N78A 1T56A 1B59A 4B3XA 1S9HA 5ILVA 4BXUA 1OCOH 2E2IJ 1KGSA 1NG7A 1W1WE 5FKNA 4CCLA 1ZG5A 4BAYA 4HA8A 4W97A 1MIJA 3GTQJ 3JTHA 2D1HA 2H09A 2JUCA 3CC7I 3I59B 1O3SA 3K69A 5DTDA 4MO7A 2HPIA 1FOYA 2LNBA 4EM2A 2VE9A 1I3QJ 3H5RA 5CVIA 2E36A 1A31A 2QGUA 1O3RA 2YPRA 3NWTA 1FT9A 2L3DA 4BJ6C 3TP3A 3PM1A 2XSJC 3CJTB 1OMIA 4YIIA 5M3FJ 4LOCA 2E5ZA 3A0HC 5LGTA 4KT6A 2WB1A 3SHFA 1W0UA 3OY9A 1R23A 2E7XA 3FISA 3ZXSA 2GOMA 2FNAA 4E7JA 5E8IA 4MNUA 3I5UA 4N9HA 5K7FA 3CCUI 2HVQA 2EH3A 4LLLA 3LAPA 3CDHA 1NH3A 3JRFA 4AYBN 3CMMA 2VBXA 3J81Z 2KT0A 2DU9A 1WFXA 1DDNA 3FM3A 1PP8F 3IH4A 1BC7C 1FOKA 3ZQGA 1FZPB 3GTMJ 1RESA 2F2EA 2DA5A 3ZCOA 1SFKA 1IRGA 1XD7A 4QSHA 5BPIA 1JGSA 2FBKA 2WC2A 5ILSA 1AOYA 4OIPF 4JX4A 3NEUA 1BA5A 3VFZA 3H3VK 3SYTA 3VWBA 1VQKI 3R0JA 2MH2A 2DYRH 3OIQA 1WJEA 2BW3A 1U3EM 3HDDA 3GTOJ 3LAJA 2KDOA 2R7DA 2DJIA 2A6HF 4LMYA 2DMUA 4ESFA 3D5SC 3DFGA 1Z3XA 2X48A 3DU6A 5LHHA 3E6MA 4P1WA 2K3FA 5FLMJ 2P0WA 5ICEA 1O7LA 1TZLA 4JBAA 4HF2A 2H27A 3E6CC 1S8NA 1LKXA 2ZMEA 4AC0A 2ISZA 1RPWA 4J19A 1GV2A 3DPUA 5CYVA 3TBIA 4ZJZA 3CCLI 1B72A 3R61A 5BNGA 2ID6A 4LLGF 3A01A 4ZZDA 5E3NA 4EJTA 2VIXA 4RB1A 3HIFA 1IN5A 1V5FA 2XIGA 1VQ6I 4IHTA 2L5QA 3BJOA 4HYEA 3OYCA 3K70C 3TW6A 1FOXA 2CQ7A 2L01A 2QQAA 1ZAOA 3MD2A 1P4WA 3T8RA 5EDNA 3KEQA 1ZRDA 2L02A 1BIBA 3OOUA 5J40A 1IUFA 2DPDA 1JUSA 4WXCA 1TT0A 2R7SA 1ZELA 1HSTA 3EUAA 2XF6A 2WTEA 1XGOA 3HJEA 5CLSA 1D3YA 2ZMEB 3U2RA 5C4JJ 4M9ZA 4DZJA 3RPUA 1AKHB 2H6BA 2W4SA 1JKOC 1X4OA 2UWMA 1DPUA 1X2MA 1MJBA 2R7VA 1TT5B 2FQ3A 4DGWB 1B1BA 5HLHA 2LK2A 3DPTA 2I8DA
chains in the Genus database with same CATH topology
1BJZA 1W0TA 1HDDC 4I76A 4B3AA 2HOSA 4A3LJ 1EF4A 2L7ZA 3BR6A 3OSGA 3FKIJ 1ETOA 3SJMA 2GBYA 4JYKA 2QF7A 4Y7NJ 4D7MA 2B63J 4XRMA 3OSFA 2WB1N 2GLOA 1QRYA 2JK3A 4BY7J 2L7MP 3OIOA 5HODA 1VNDA 1WH5A 3BG5A 5F0CA 3HOWJ 1ZKGA 1GVDA 2ECCA 2NVTJ 4XICA 5K7HA 1VFCA 1IDYA 3SDGA 1JGGA 4M3DA 2R5ZA 3RKQA 2TRTA 3O8GA 2E2JJ 1PUFB 5JLWA 2VKEA 1JUMA 4UUSB 1TWGJ 1CQTA 2EZKA 4M3BA 2HOAA 3HOVJ 3B6AA 3LSRA 3WHCA 1JTXA 2E1OA 2JMWA 3FK7A 3JRCA 1BW5A 4MFEA 3VPRA 3O8HA 5IP9J 1MBJA 1MNMC 1VI0A 3Q0VA 1GV5A 5M3MJ 1ZR4A 2R5ZB 2L0KA 4M3EA 3LSPA 1FIAA 1WH7A 2JJ7A 1TWHJ 4V2GA 3D1NI 1S7EA 4DZPA 1K83J 5EZGA 1I6HJ 4V2FA 3BR0A 2DN0A 3HKZN 3ZQLA 4M3FA 2DA2A 4XK4A 4FCYA 4MIMA 1BL0A 4JX6A 4UUTA 4FE4A 5EGOA 1LE8A 1POGA 2PMZN 4XIDA 3HBLA 1WI3A 1YRNA 4A3IJ 5K7ZA 1MH3A 3JRBA 2O7OA 1F43A 5C3EJ 2FD5A 2JN6A 2O8KA 1ZQ3P 5C4XJ 5IP6A 1R9TJ 3MVPA 2EQRA 4B4CA 2XB5A 3BTCA 2KDZA 2I10A 2LY9A 1TWCJ 4MFDA 5IYCJ 1MSEC 3BG9A 1MBHA 2DMNA 1U8BA 4BY1J 3HOYJ 4BBRJ 1AU7A 3HEFA 2NS7A 4IHWA 2VUMJ 3H0GJ 2LTPA 3S1NJ 1IRZA 1BW6A 5J3LA 2YUSA 1VF9A 2NVXJ 1H88C 2M34A 3LOCA 2LLKA 3TW7A 1ZK8A 2CJJA 4B1RA 5EYRA 1YRNB 1IC8A 3BTLA 3FK6A 1JJ8C 1WCMJ 2XRLA 3LSJA 3QPSA 2HXIA 2EZIA 1FJLA 5E3LA 3HOXJ 2ME0A 3JRHA 1LFBA 4L5EA 3S1MJ 1B72B 3CCYA 1HCRA 5IYBJ 3A01B 3IH2A 5GP9A 2DA6A 2DTZA 1X58A 3HOUJ 2CUEA 1RKWA 2OF7A 2XGDA 1IGNA 1QPIA 1TWFJ 4FISA 2EZLA 1FTZA 2E19A 2MW8A 2H1KA 1QVTA 2QCOA 3JRDA 4FTHA 4C3JJ 4A3MJ 1NK3P 2D5VA 3HM5A 4DW6A 2HXOA 3GTPJ 1ZR2A 2G0EA 4D5FA 9ANTA 3BTIA 1JKQC 5GPCA 5EG0A 3JR9A 5IPAA 5J1UA 2R93J 1HOMA 1D5YA 3ZQCA 4QTRA 1UG2A 2YS9A 3DCFA 4A3FJ 1ZTRA 2LFBA 1A5JA 2TCTA 2L7FP 4EEFG 4XRSA 2ZB9A 1FEXA 4W1UA 3K2AA 2DMTA 1AHDP 4A3GJ 2LD5A 3RQIA 1RETA 2Y31A 1OFCX 5IP7J 3A02A 2LKXA 2HQ5A 3TP0A 2R92J 1ETWA 4XRSG 3NAUA 1MBFA 3JRIA 3SFIA 4Y52J 5J1YA 1MH4A 1U9OA 3BT9A 3K7AJ 3L1PA 1JT0A 1GT0C 1IJWC 4A3BJ 2ID3A 3MKLA 4DYCA 4A3DJ 2IAIA 2ELKA 2NS8A 2R5YA 2GM4A 2MGQA 3S15J 2ME6A 3M3YJ 1FTTA 1RR7A 2Y2ZA 3HGGA 1APLC 5FKLA 4C2MJ 1JJ6C 3CQZJ 3HGYA 3Q0WA 1G2HA 4A3JJ 1IG7A 2O9LA 2NVQJ 2R0QC 2CQQA 2XSDC 3GTJJ 2HYJA 4A93J 1SANA 2MG4A 2XPVA 4FE7A 4RDUA 1O4XA 3QPLA 2M2EA 1UHSA 1Q1VA 1WGXA 1XG1A 5E3MA 2NOGA 1TC3C 5FJ8J 2VPRA 5F08A 1ENHA 2X9DA 4BBSJ 1GDTA 3RZOJ 5FLVA 1Z77A 5C44J 1ETKA 5M5XJ 3LNQA 2VI6A 3S16J 3BR1A 3I4MJ 1F36A 4DYRA 4NDLA 3G1MA 2DA1A 2W48A 1ETXA 4S0HB 2JA8J 2L9RA 5EGOB 4BKXA 3DEWA 1LE8B 5F04A 4A3CJ 1OCTC 5IYDJ 3JRAA 5DS9A 2AHQA 2K9NA 3HB9A 4HNVA 3S17J 3PO2J 3S2DJ 4I6ZA 2IBDA 2IEKA 5JLXA 2WV1A 2XPWA 1AKHA 5FKMA 2DA7A 2DJNA 5M5YJ 4G12A 4JX5A 2DMPA 5F27A 1QVUA 1RKTA 2CU7A 3PO3J 3F0CA 4CYCA 3B6CA 3C2BA 3G1OA 1B8IA 1JT6A 1DU0A 1OJLA 5J1RA 1MSFC 1MBKA 5EF6A 3G1LA 3HOZJ 5EZHA 1E3OC 1Y1VJ 3GTLJ 4A3KJ 3S1RJ 1WPKA 3NARA 2JA6J 1IDZA 3A03A 2Y9ZA 1LFUP 5IOYA 4GFBA 3I4NJ 1ORKA 2K40A 2Y0SN 1IV6A 3FIWA 1P7JA 2HDDA 4CYCB 3JRGA 3M4OJ 2DA4A 2DMQA 1PUFA 2ECBA 2E2HJ 1MBGA 1B8IB 1I50J 3BG3A 4A69C 4UUSA 1X2NA 1JKRC 1HF0A 1UMQA 1ITYA 1H8AC 3BR2A 1HLVA 1T56A 4C3HJ 3BQYA 1HDPA 4A3EJ 2E2IJ 4M3GA 5FKNA 3GBGA 3BQZA 4W97A 3IH3A 4D5CA 1DU6A 3GTQJ 4IHYA 4MLOA 5F0HA 3CDLA 5DTDA 3S1QJ 4MO7A 1JUPA 1I3QJ 2EBIA 2XPUA 3ZQHA 5EG0B 3TP3A 3PM1A 5FKOA 2CRGA 3ZQFA 4LOCA 5M3FJ 1W0UA 3FISA 1NTCA 3RZDJ 4IHXA 2CUFA 5K7FA 1ZGWA 2EH3A 4C3IJ 3GTGJ 3JRFA 4AYBN 3BR3A 2AO9A 3GTKJ 4AUXA 3E7LA 2KT0A 1T33A 4IEJA 2K9SA 4D7NA 3W6VA 4X1EA 3IH4A 2FX0A 2LR8A 3ZQGA 2X6OA 2Y30A 2YU9J 2XGCA 1RESA 3GTMJ 1ETYA 5F0FA 2DA5A 3Q0UA 5E3OA 4QSHA 1XC5A 1Y1WJ 5GPAA 2P81A 2OPTA 4JX4A 1BA5A 3H3VK 2R5YB 2FJ1A 2RAEA 2COBA 2M0CA 3IV5A 3BTJA 3MN2A 5IOZA 2K9QA 4BXXJ 3LSGA 1U9NA 4RBOA 3HDDA 3GTOJ 3Q3SA 1JTYA 2JA5J 3S14J 1MBEA 5EEAA 1GUUA 2DMUA 1K61A 2WAQN 2X48A 2H8RA 3S2HJ 2R7ZJ 5FLMJ 2JWTA 3UKGA 5FKKA 3TEDA 4QIWN 1P7IA 4DYQA 4AC0A 4X6AJ 1RPWA 4J19A 2HOTA 1GV2A 2M8GX 3JREA 3QQAA 2VKVA 1SFOJ 1XS9A 5BNGA 1B72A 2ID6A 3A01A 5E3NA 1OCPA 1NK2P 2MSYA 1H89C 1ETVA 1FIPA 3WHBA 2FQ4A 2Y9YA 3TW6A 3BR5A 4ABZA 4M6VA 1U78A 5EDNA 2JA7J 4JP0A 3OOUA 1ETQA 1IUFA 1JUSA 1TWAJ 1A6IA 2DA3A 3ZOBA 2EZHA 5F1JA 1JKPC 4IHVA 3ZQIA 2CQXA 2LVSA 5C4JJ 1Z0XA 2XB0X 2XGEA 3CMYA 2HI3A 4DZJA 1AKHB 5M5WJ 2M9HA 1JKOC 2N8GA 2LP0A 1X2MA 2NVYJ 2LK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJZ A;  1W0T A;  1HDD C;  4I76 A;  4B3A A;  2HOS A;  4A3L J;  1EF4 A;  2L7Z A;  3BR6 A;  3OSG A;  3FKI J;  1ETO A;  3SJM A;  2GBY A;  4JYK A;  2QF7 A;  4Y7N J;  4D7M A;  2B63 J;  4XRM A;  3OSF A;  2WB1 N;  2GLO A;  1QRY A;  2JK3 A;  4BY7 J;  2L7M P;  3OIO A;  5HOD A;  1VND A;  1WH5 A;  3BG5 A;  5F0C A;  3HOW J;  1ZKG A;  1GVD A;  2ECC A;  2NVT J;  4XIC A;  5K7H A;  1VFC A;  1IDY A;  3SDG A;  1JGG A;  4M3D A;  2R5Z A;  3RKQ A;  2TRT A;  3O8G A;  2E2J J;  1PUF B;  5JLW A;  2VKE A;  1JUM A;  4UUS B;  1TWG J;  1CQT A;  2EZK A;  4M3B A;  2HOA A;  3HOV J;  3B6A A;  3LSR A;  3WHC A;  1JTX A;  2E1O A;  2JMW A;  3FK7 A;  3JRC A;  1BW5 A;  4MFE A;  3VPR A;  3O8H A;  5IP9 J;  1MBJ A;  1MNM C;  1VI0 A;  3Q0V A;  1GV5 A;  5M3M J;  1ZR4 A;  2R5Z B;  2L0K A;  4M3E A;  3LSP A;  1FIA A;  1WH7 A;  2JJ7 A;  1TWH J;  4V2G A;  3D1N I;  1S7E A;  4DZP A;  1K83 J;  5EZG A;  1I6H J;  4V2F A;  3BR0 A;  2DN0 A;  3HKZ N;  3ZQL A;  4M3F A;  2DA2 A;  4XK4 A;  4FCY A;  4MIM A;  1BL0 A;  4JX6 A;  4UUT A;  4FE4 A;  5EGO A;  1LE8 A;  1POG A;  2PMZ N;  4XID A;  3HBL A;  1WI3 A;  1YRN A;  4A3I J;  5K7Z A;  1MH3 A;  3JRB A;  2O7O A;  1F43 A;  5C3E J;  2FD5 A;  2JN6 A;  2O8K A;  1ZQ3 P;  5C4X J;  5IP6 A;  1R9T J;  3MVP A;  2EQR A;  4B4C A;  2XB5 A;  3BTC A;  2KDZ A;  2I10 A;  2LY9 A;  1TWC J;  4MFD A;  5IYC J;  1MSE C;  3BG9 A;  1MBH A;  2DMN A;  1U8B A;  4BY1 J;  3HOY J;  4BBR J;  1AU7 A;  3HEF A;  2NS7 A;  4IHW A;  2VUM J;  3H0G J;  2LTP A;  3S1N J;  1IRZ A;  1BW6 A;  5J3L A;  2YUS A;  1VF9 A;  2NVX J;  1H88 C;  2M34 A;  3LOC A;  2LLK A;  3TW7 A;  1ZK8 A;  2CJJ A;  4B1R A;  5EYR A;  1YRN B;  1IC8 A;  3BTL A;  3FK6 A;  1JJ8 C;  1WCM J;  2XRL A;  3LSJ A;  3QPS A;  2HXI A;  2EZI A;  1FJL A;  5E3L A;  3HOX J;  2ME0 A;  3JRH A;  1LFB A;  4L5E A;  3S1M J;  1B72 B;  3CCY A;  1HCR A;  5IYB J;  3A01 B;  3IH2 A;  5GP9 A;  2DA6 A;  2DTZ A;  1X58 A;  3HOU J;  2CUE A;  1RKW A;  2OF7 A;  2XGD A;  1IGN A;  1QPI A;  1TWF J;  4FIS A;  2EZL A;  1FTZ A;  2E19 A;  2MW8 A;  2H1K A;  1QVT A;  2QCO A;  3JRD A;  4FTH A;  4C3J J;  4A3M J;  1NK3 P;  2D5V A;  3HM5 A;  4DW6 A;  2HXO A;  3GTP J;  1ZR2 A;  2G0E A;  4D5F A;  9ANT A;  3BTI A;  1JKQ C;  5GPC A;  5EG0 A;  3JR9 A;  5IPA A;  5J1U A;  2R93 J;  1HOM A;  1D5Y A;  3ZQC A;  4QTR A;  1UG2 A;  2YS9 A;  3DCF A;  4A3F J;  1ZTR A;  2LFB A;  1A5J A;  2TCT A;  2L7F P;  4EEF G;  4XRS A;  2ZB9 A;  1FEX A;  4W1U A;  3K2A A;  2DMT A;  1AHD P;  4A3G J;  2LD5 A;  3RQI A;  1RET A;  2Y31 A;  1OFC X;  5IP7 J;  3A02 A;  2LKX A;  2HQ5 A;  3TP0 A;  2R92 J;  1ETW A;  4XRS G;  3NAU A;  1MBF A;  3JRI A;  3SFI A;  4Y52 J;  5J1Y A;  1MH4 A;  1U9O A;  3BT9 A;  3K7A J;  3L1P A;  1JT0 A;  1GT0 C;  1IJW C;  4A3B J;  2ID3 A;  3MKL A;  4DYC A;  4A3D J;  2IAI A;  2ELK A;  2NS8 A;  2R5Y A;  2GM4 A;  2MGQ A;  3S15 J;  2ME6 A;  3M3Y J;  1FTT A;  1RR7 A;  2Y2Z A;  3HGG A;  1APL C;  5FKL A;  4C2M J;  1JJ6 C;  3CQZ J;  3HGY A;  3Q0W A;  1G2H A;  4A3J J;  1IG7 A;  2O9L A;  2NVQ J;  2R0Q C;  2CQQ A;  2XSD C;  3GTJ J;  2HYJ A;  4A93 J;  1SAN A;  2MG4 A;  2XPV A;  4FE7 A;  4RDU A;  1O4X A;  3QPL A;  2M2E A;  1UHS A;  1Q1V A;  1WGX A;  1XG1 A;  5E3M A;  2NOG A;  1TC3 C;  5FJ8 J;  2VPR A;  5F08 A;  1ENH A;  2X9D A;  4BBS J;  1GDT A;  3RZO J;  5FLV A;  1Z77 A;  5C44 J;  1ETK A;  5M5X J;  3LNQ A;  2VI6 A;  3S16 J;  3BR1 A;  3I4M J;  1F36 A;  4DYR A;  4NDL A;  3G1M A;  2DA1 A;  2W48 A;  1ETX A;  4S0H B;  2JA8 J;  2L9R A;  5EGO B;  4BKX A;  3DEW A;  1LE8 B;  5F04 A;  4A3C J;  1OCT C;  5IYD J;  3JRA A;  5DS9 A;  2AHQ A;  2K9N A;  3HB9 A;  4HNV A;  3S17 J;  3PO2 J;  3S2D J;  4I6Z A;  2IBD A;  2IEK A;  5JLX A;  2WV1 A;  2XPW A;  1AKH A;  5FKM A;  2DA7 A;  2DJN A;  5M5Y J;  4G12 A;  4JX5 A;  2DMP A;  5F27 A;  1QVU A;  1RKT A;  2CU7 A;  3PO3 J;  3F0C A;  4CYC A;  3B6C A;  3C2B A;  3G1O A;  1B8I A;  1JT6 A;  1DU0 A;  1OJL A;  5J1R A;  1MSF C;  1MBK A;  5EF6 A;  3G1L A;  3HOZ J;  5EZH A;  1E3O C;  1Y1V J;  3GTL J;  4A3K J;  3S1R J;  1WPK A;  3NAR A;  2JA6 J;  1IDZ A;  3A03 A;  2Y9Z A;  1LFU P;  5IOY A;  4GFB A;  3I4N J;  1ORK A;  2K40 A;  2Y0S N;  1IV6 A;  3FIW A;  1P7J A;  2HDD A;  4CYC B;  3JRG A;  3M4O J;  2DA4 A;  2DMQ A;  1PUF A;  2ECB A;  2E2H J;  1MBG A;  1B8I B;  1I50 J;  3BG3 A;  4A69 C;  4UUS A;  1X2N A;  1JKR C;  1HF0 A;  1UMQ A;  1ITY A;  1H8A C;  3BR2 A;  1HLV A;  1T56 A;  4C3H J;  3BQY A;  1HDP A;  4A3E J;  2E2I J;  4M3G A;  5FKN A;  3GBG A;  3BQZ A;  4W97 A;  3IH3 A;  4D5C A;  1DU6 A;  3GTQ J;  4IHY A;  4MLO A;  5F0H A;  3CDL A;  5DTD A;  3S1Q J;  4MO7 A;  1JUP A;  1I3Q J;  2EBI A;  2XPU A;  3ZQH A;  5EG0 B;  3TP3 A;  3PM1 A;  5FKO A;  2CRG A;  3ZQF A;  4LOC A;  5M3F J;  1W0U A;  3FIS A;  1NTC A;  3RZD J;  4IHX A;  2CUF A;  5K7F A;  1ZGW A;  2EH3 A;  4C3I J;  3GTG J;  3JRF A;  4AYB N;  3BR3 A;  2AO9 A;  3GTK J;  4AUX A;  3E7L A;  2KT0 A;  1T33 A;  4IEJ A;  2K9S A;  4D7N A;  3W6V A;  4X1E A;  3IH4 A;  2FX0 A;  2LR8 A;  3ZQG A;  2X6O A;  2Y30 A;  2YU9 J;  2XGC A;  1RES A;  3GTM J;  1ETY A;  5F0F A;  2DA5 A;  3Q0U A;  5E3O A;  4QSH A;  1XC5 A;  1Y1W J;  5GPA A;  2P81 A;  2OPT A;  4JX4 A;  1BA5 A;  3H3V K;  2R5Y B;  2FJ1 A;  2RAE A;  2COB A;  2M0C A;  3IV5 A;  3BTJ A;  3MN2 A;  5IOZ A;  2K9Q A;  4BXX J;  3LSG A;  1U9N A;  4RBO A;  3HDD A;  3GTO J;  3Q3S A;  1JTY A;  2JA5 J;  3S14 J;  1MBE A;  5EEA A;  1GUU A;  2DMU A;  1K61 A;  2WAQ N;  2X48 A;  2H8R A;  3S2H J;  2R7Z J;  5FLM J;  2JWT A;  3UKG A;  5FKK A;  3TED A;  4QIW N;  1P7I A;  4DYQ A;  4AC0 A;  4X6A J;  1RPW A;  4J19 A;  2HOT A;  1GV2 A;  2M8G X;  3JRE A;  3QQA A;  2VKV A;  1SFO J;  1XS9 A;  5BNG A;  1B72 A;  2ID6 A;  3A01 A;  5E3N A;  1OCP A;  1NK2 P;  2MSY A;  1H89 C;  1ETV A;  1FIP A;  3WHB A;  2FQ4 A;  2Y9Y A;  3TW6 A;  3BR5 A;  4ABZ A;  4M6V A;  1U78 A;  5EDN A;  2JA7 J;  4JP0 A;  3OOU A;  1ETQ A;  1IUF A;  1JUS A;  1TWA J;  1A6I A;  2DA3 A;  3ZOB A;  2EZH A;  5F1J A;  1JKP C;  4IHV A;  3ZQI A;  2CQX A;  2LVS A;  5C4J J;  1Z0X A;  2XB0 X;  2XGE A;  3CMY A;  2HI3 A;  4DZJ A;  1AKH B;  5M5W J;  2M9H A;  1JKO C;  2N8G A;  2LP0 A;  1X2M A;  2NVY J;  2LK2 A; 
#chains in the Genus database with same CATH topology
 2MFZ A;  1BJZ A;  1WSU A;  1W0T A;  3S3O A;  1HDD C;  3KCC A;  4B3A A;  4M9S A;  2OBP A;  1EH7 A;  4II3 A;  3AFH A;  3OSG A;  2A61 A;  3FKI J;  3K4J A;  2QA4 I;  4ASN A;  5D8K B;  4XKW A;  5KVR A;  4Y7N J;  1YX3 A;  5D5X B;  5HS8 A;  3CCJ I;  5HDN A;  1LVK A;  2WB1 N;  3LA2 A;  4NBQ A;  1JXS A;  3A1Y A;  1SAU A;  3KFW X;  1O57 A;  4IPA A;  3LST A;  2JTV A;  3GFM A;  3ROU A;  3HOW J;  2LY2 A;  1ZKG A;  2ECC A;  1V54 H;  3G71 I;  1FLI A;  1N25 A;  4GGG A;  3H36 A;  3SDG A;  1JGG A;  3HXL A;  4M3D A;  2WV0 A;  2E35 A;  1E2X A;  2DYS H;  3F21 A;  2VKE A;  2JRM A;  1JUM A;  2A69 F;  1VQO I;  4L0Y B;  1CQT A;  4KDP A;  4ZC3 A;  2EZK A;  4XOP A;  4BXF A;  3WG9 A;  4I09 A;  4IQ4 A;  4UV8 A;  1JTX A;  3SDB A;  2BXZ A;  5HNF A;  3HYI A;  5CVJ A;  2D2W A;  3F8C A;  4PFO A;  2JZY A;  3F3X A;  3RTR A;  3L2R A;  2OZ6 A;  3QPT A;  4A6E A;  2F5C A;  3ABL H;  2B0L A;  4XMY A;  3NQO A;  1MNM C;  3Q0V A;  2A5W A;  2NOJ B;  2M8E A;  1MKM A;  3BG7 A;  3GFI A;  3L00 A;  3DLL F;  2XAQ A;  3LSP A;  1FMW A;  1W5C C;  1FIA A;  4HAM A;  3NWS A;  2B9S A;  1SC7 A;  4V2G A;  1UCR A;  3I9V 2;  4HBL A;  1S7E A;  3ZMS A;  2P4W A;  1Z67 A;  5FGM A;  1KON A;  4GCV A;  3PUB A;  2CYY A;  4R79 A;  1I6H J;  1LB2 A;  3BR0 A;  4OWR B;  1S5L C;  3CUQ B;  2LSO A;  2KIF A;  4M3F A;  4FCY A;  4PCQ A;  3DTK A;  1CF7 B;  1BOA A;  2QM3 A;  4JX6 A;  2M3A A;  2V9V A;  4PJN A;  2H1L A;  3WG7 H;  4XID A;  1S29 A;  3RKW A;  4A3I J;  2Q0O A;  4M6X A;  2O7O A;  4YIR X;  5C3E J;  3FMQ A;  3K4M A;  2K4B A;  2PN6 A;  2M1B A;  4B4C A;  1HW1 A;  2ZBK A;  4OU0 A;  5HLI A;  2KDZ A;  1Y39 A;  5IYC J;  1BI3 A;  2KRH A;  2JSP A;  4D0P A;  1QPM A;  3CES A;  4YFN F;  4IX7 A;  1P6R A;  2BVL A;  1AU7 A;  1WJ5 A;  1YQA A;  1DGR M;  3HEF A;  2EFN A;  2ETH A;  3HPH A;  2EIJ H;  4ESB A;  4OIR F;  1BW6 A;  5J3L A;  2YUS A;  4RGU A;  1AWC A;  2NVX J;  2V79 A;  3LSM A;  4N0B A;  3LOC A;  2LLK A;  4PSX A;  4IJA A;  1JHH A;  3AG4 H;  1ZK8 A;  4B1R A;  2IS2 A;  1G3W A;  3C3W A;  4HRI A;  1E0E A;  1TP4 A;  2VQH A;  4XON A;  1T98 A;  5D6E A;  4KN7 X;  3BTL A;  3FK6 A;  3S8P A;  1JJ8 C;  2HXI A;  2XAJ A;  1FC3 A;  1FJL A;  1UFM A;  3HOX J;  3RKX A;  4L5E A;  4BL0 B;  1ZN2 A;  3WTW C;  3S1M J;  1QA6 A;  3I64 A;  2HWV A;  3IH2 A;  2OUM A;  2O03 A;  1FWZ A;  2V7F A;  5DYM A;  3OYJ A;  1TWF J;  1WRJ A;  4FIS A;  2YR2 A;  4HV6 A;  1BC8 C;  2EZL A;  1XB4 A;  4I0A A;  2H1K A;  2PMU A;  4LD5 A;  3G6E I;  3IAM 2;  3GUD A;  3ASN H;  4A0X A;  4IRI A;  3OS2 A;  3JRD A;  3FDY A;  4A3M J;  4ZYG A;  3HM5 A;  1LDK B;  1U0J A;  1Z21 A;  5AIP A;  1LJ9 A;  4DW6 A;  3D5L A;  5K5R A;  3K2Z A;  2V4J C;  1ZR2 A;  1J09 A;  4BE1 A;  1TL8 A;  1Z05 A;  2IVM A;  2JT1 A;  5GPC A;  4PJJ A;  3BPX A;  3JAM K;  1HOM A;  1D5Y A;  3LMM A;  3FXJ A;  3KP5 A;  4BU2 A;  3ZQC A;  2A07 F;  3ECO A;  4F55 A;  4HW0 A;  4OOI A;  3FHZ A;  2YS9 A;  3CP8 A;  4Q48 A;  3M1C A;  1ZTR A;  2LFB A;  4RM3 A;  3KPH A;  2L7F P;  3TDU C;  1D1C A;  2HQN A;  1YIO A;  3WU0 A;  1FEX A;  4JQF A;  3Q9S A;  3UNG C;  2EV0 A;  2KL4 A;  1HKQ A;  4NUB A;  3K70 D;  3RQI A;  1M1E B;  3EYI A;  2CWE A;  1DP7 P;  5IP7 J;  1RUN A;  1DP3 A;  1EV7 A;  2JSC A;  3U21 A;  1OLT A;  3TP0 A;  3V8J A;  5E1X A;  3M8E A;  5LHG A;  4OIO F;  3NAU A;  1SFX A;  4EMS A;  2HNH A;  2ZNZ A;  5CVU A;  3SFI A;  1HKT A;  1K78 A;  1RI7 A;  2ZFU A;  1U9O A;  3BT9 A;  3B02 A;  4BHC A;  4OIQ F;  4L0Z B;  2VBZ A;  2EFO A;  2ID3 A;  1H9G A;  3MKL A;  4DYC A;  2NS8 A;  2ELK A;  5HS9 A;  4CUG A;  5ICC A;  5AON A;  4IQJ A;  4ZTJ A;  3L09 A;  3OYA A;  2A6E F;  1OCZ H;  1FTT A;  2Y2Z A;  3A0B C;  4B47 A;  3K4C A;  3HGG A;  2W1O A;  5FKL A;  4C2M J;  4EM1 A;  1WJD A;  1J0R A;  4CDG A;  3HGY A;  4ZDL A;  2NVU B;  1G2H A;  2O9L A;  2NVQ J;  2LG4 A;  1X4P A;  2CQQ A;  4RLF A;  3DPL C;  2DK5 A;  2HYJ A;  2PJR B;  2O0Y A;  5KK1 A;  4FE7 A;  2GIV A;  5LFA A;  2DT7 B;  4RDU A;  1O4X A;  1SVO A;  3QPL A;  4XN0 A;  3L2W A;  4B48 A;  3BG6 A;  3IWZ A;  3G4S I;  1QHG A;  2ZC2 A;  3CCE I;  3N05 A;  1TC3 C;  4AU7 A;  3FXM A;  4YFX F;  3KP4 A;  1T0F A;  3WOD F;  2ESN A;  2IPQ X;  4BBS J;  4ETS A;  3RZO J;  1Z3Y A;  2L9S A;  4IRG A;  1XCB A;  1Z77 A;  5C44 J;  1KU9 A;  3QPH A;  1G3Y A;  1Z1D A;  2M87 A;  1T08 B;  3S16 J;  2ZKZ A;  3LQQ A;  4NDL A;  3VSK A;  4DYR A;  5F1R A;  3ZP5 A;  3G3Z A;  2CUJ A;  2W48 A;  3WGG A;  4P9F A;  3P9K A;  4OMY A;  5B1B H;  4MQV A;  2AHQ A;  1G3S A;  2OCE A;  1P4X A;  3PO2 J;  4KNY A;  2OQR A;  1SD5 A;  2IBD A;  4G7Z F;  2NYX A;  2OJE D;  3ONQ A;  3ECH A;  4U0Y A;  2K02 A;  3H3Z A;  3PQK A;  5FKM A;  1TLH B;  4G12 A;  3S32 A;  3ERE D;  5F27 A;  1Z91 A;  4HF1 A;  4M73 A;  3F0C A;  3AAF A;  1B6A A;  4A0Y A;  2IA0 A;  1N75 A;  4KA4 A;  2LDU A;  2WAQ A;  1MZB A;  2L9V A;  4DJA A;  4HNU A;  1JT6 A;  4BJT A;  2VXZ A;  3DBL B;  1DU0 A;  2DOE A;  2EK5 A;  3F8F A;  2GWR A;  3HOZ J;  4KIG A;  4KIS A;  1ZRC A;  1EH8 A;  2LKS A;  5CVR A;  2DFH A;  4CCO A;  4J00 A;  4L9N A;  2JA6 J;  5FRM A;  1QZE A;  3A03 A;  1SAX A;  1Z6T A;  5KAF C;  4YEL A;  3OR2 C;  1ORK A;  4BH9 A;  4E7K A;  2OA4 A;  3PFI A;  3FIW A;  3BZC A;  1D0Z A;  2DTR A;  3O3K A;  3ABM H;  1YI2 I;  2AQE A;  4WXD A;  2K4J A;  2DFI A;  1PUF A;  5ILU A;  2ECB A;  4UUS A;  3QYE A;  3IRQ A;  4E7Z A;  2XRO A;  3CO7 C;  3WTT C;  3BR2 A;  3U1D A;  2FOW A;  1HLV A;  3CMA I;  1HDP A;  4AIK A;  1BI2 A;  1XGS A;  2CS3 A;  3G2B A;  3CCM I;  2E1M C;  1HC8 A;  1U5T C;  2W84 A;  2E71 A;  2FU4 A;  2MC3 A;  4U0W A;  3ZRG A;  1DU6 A;  5D4S A;  4IHY A;  2E34 A;  2KJB A;  4MLO A;  3HG9 A;  2AS5 F;  4LK0 F;  4M6Y A;  3SZT A;  5K5Q A;  1JHF A;  5EJC A;  2M4G A;  2PLY A;  2HGC A;  1L3L A;  1GXQ A;  2OC6 A;  2K7L A;  3ZQF A;  2JPB A;  5JHF A;  3KP7 A;  3BCB A;  5LRR A;  3QAH A;  1RIO H;  1XSX A;  1QQI A;  2LYC A;  1ZH5 A;  4RM2 A;  2QUF A;  1MW7 A;  1ZGW A;  4BQA A;  5E17 F;  4EV0 A;  4C3I J;  1ZLK A;  4A5N A;  5LLQ A;  2FE3 A;  3HRS A;  4DBR A;  3V8K A;  3BR3 A;  1EH6 A;  3R4K A;  2BY1 A;  4EJV A;  4IEJ A;  5BMZ A;  4D7N A;  2NNY A;  2EIM H;  2Y30 A;  4ITV A;  3OL4 A;  3GFL A;  2KIM A;  1ETY A;  3L2C A;  5F0F A;  3ZGK A;  1HSJ A;  4UHT A;  3V7R A;  5GAE J;  2P7V B;  5HOO A;  1XC5 A;  5E3O A;  3MCZ A;  4WX9 A;  4WCG A;  3P9I A;  2OPT A;  5DCF A;  1XMK A;  3HTS B;  1IW7 F;  2Z99 A;  2R5Y B;  1FBQ A;  2FJ1 A;  2M7B A;  1R22 A;  2L4M A;  3BTJ A;  4LFU A;  2HOE A;  2KFD A;  2K9Q A;  2R7Q A;  4Y33 A;  5J4Y A;  4LB6 B;  1U9N A;  2TDX A;  2XAF A;  3K4K A;  2QBY A;  3ZQQ A;  1MBE A;  1FOW A;  2IW5 A;  4JOM A;  2WAQ N;  2R7U A;  1R49 A;  2JWT A;  2YSR A;  1TQP A;  3DTI A;  2CW8 A;  3FBI B;  5D5V B;  3TED A;  2HYG D;  1YHQ I;  3H3U A;  4NQW A;  1YJ9 I;  1P7I A;  1QBJ A;  3SEQ A;  5DCM A;  2PMH A;  2MD5 A;  1TTY A;  3NRV A;  5BPD A;  2Y48 A;  2EIL H;  1NK2 P;  1V4R A;  3A2K A;  3OYF A;  4G94 A;  4KMU X;  1FYM A;  4II2 A;  2FQ4 A;  2Y9Y A;  2XVC A;  3BR5 A;  3SFZ A;  4ABZ A;  2DT5 A;  5L3B A;  4IO9 F;  2KIS A;  2KIQ A;  3CD6 I;  1WQ2 A;  5DUK A;  2KP6 A;  3VEP A;  3FMS A;  1ETQ A;  1TWA J;  2EZH A;  3JTG A;  3KYL A;  2GXA A;  4U0V A;  4O3M A;  3VOE A;  1JKP C;  3AL0 C;  2BVM A;  2K85 A;  3N97 A;  3VB2 A;  2LVS A;  5LHI A;  1H0M A;  1Z0X A;  2XB0 X;  2EA4 A;  1X3Z B;  2HQR A;  3DBR B;  4LG0 B;  3EUH A;  3DP7 A;  2M9H A;  1DQU A;  2VB6 A;  2N8G A;  4EAT A;  4F3Q A;  3PJR A;  5LEK A;  3HL2 A;  2QYO A;  2NVY J;  2BV6 A;  1QGP A;  1Z7U A;  1MDM A;  3RYR A;  4IOA F;  1R5H A;  4I76 A;  2WAF A;  3VOD A;  4A3L J;  1REP C;  3BR6 A;  2DW4 A;  2KHM A;  3SJM A;  2GBY A;  3H9J A;  1KU7 A;  5DV5 A;  1I6X A;  3WTY C;  3HOT A;  4FET A;  2CUZ A;  5HOD A;  3M1E A;  1VND A;  1G6N A;  1YIJ I;  3MZH A;  5F0C A;  3WTX C;  2COM A;  3AG1 H;  2OTL I;  1NG6 A;  4L9V A;  2DQR A;  4EJO A;  3W2V A;  2L4A A;  2M5W A;  3KYD B;  1KA8 A;  1TNS A;  2HR3 A;  3RPQ A;  3RKQ A;  2IP2 A;  3O8G A;  1QZY A;  1FP1 D;  3KLN A;  5JLW A;  3E6D A;  3TOB A;  5EEG A;  1A04 A;  4LB5 A;  1FNN A;  1E3P A;  4CZC A;  5KHD A;  2UV1 A;  3OYG A;  3WHC A;  1U8R A;  3RI4 A;  3CJQ B;  3JCU C;  3ZN1 A;  1BW5 A;  2ZXJ A;  1YOV B;  3OOP A;  3ZMZ A;  1ON1 A;  5IP9 J;  2XAG A;  1MBJ A;  3QOD A;  2LRE A;  4HG2 A;  2PI0 A;  3TOA A;  4BHP A;  5M3M J;  1Y0N A;  2VPL A;  3LSK A;  1WH7 A;  5AIQ A;  2EB7 A;  3DEU A;  1SMT A;  2CFO A;  1A36 A;  3D1N I;  3V7C A;  2RC4 A;  3J7Y J;  2M4K A;  4H0E A;  2NRA C;  1Z6R A;  3HKZ N;  2EPF A;  3CC2 I;  3RCO A;  3ZQL A;  4Z6Y A;  5FB2 A;  3PIO F;  4UUT A;  5EGO A;  1QZZ A;  4C2U A;  2R7R A;  1K7A A;  1I1S A;  1WI3 A;  4XL9 A;  2Z2S B;  4G6D A;  2JN6 A;  4CYD A;  4NNJ A;  2O8K A;  3W2A A;  5A2Q Z;  2ISY A;  3U1K A;  5IP6 A;  1EA3 A;  5DUI A;  2EV6 A;  3BTC A;  2HTJ A;  2I10 A;  2LY9 A;  3ASO H;  1MSE C;  4XM3 A;  1MBH A;  2DMN A;  2W24 A;  4RMN A;  1P9Q C;  1TW2 A;  1QNT A;  2I5U A;  3IKV A;  4ZDO A;  2BOL A;  2AQF A;  3KYC B;  2HVS A;  2NXN B;  1WZ2 A;  2BW3 B;  2DOA A;  2F4M B;  3H0G J;  2LTP A;  2VUM J;  3IL2 A;  3S1N J;  2NNN A;  1IRZ A;  1H88 C;  2LBF A;  2CJJ A;  1XX5 A;  2VBW A;  4I7H A;  1WKM A;  1IXS B;  3M8J A;  4AIJ A;  1ACI A;  4M72 A;  1UB9 A;  2ZME C;  1EKE A;  3D5R C;  5HS7 A;  4XLP F;  6PAX A;  4I2O A;  1K79 A;  1WCM J;  2X51 A;  4HPQ A;  2R7F A;  2ME0 A;  1USS A;  3QRF F;  1H9T A;  3JRH A;  1LFB A;  3FBN B;  3GXO A;  4Y13 A;  1B72 B;  3ZR8 X;  4PK4 A;  4YIF A;  3A01 B;  2VT3 A;  1BI1 A;  2DTZ A;  3HOU J;  5ED4 A;  2CUE A;  2K86 A;  4DIQ A;  2OF7 A;  3HRT A;  1QPI A;  5ICF A;  5A2Q K;  2Y75 A;  2E19 A;  1D0X A;  5JR3 A;  4C2T A;  2EV5 A;  2FBH A;  2FEZ A;  3X2Q H;  2HZD A;  1BR4 A;  4C3J J;  2K27 A;  1LDJ A;  3EPZ A;  4HOB A;  3GX4 X;  2ZJQ F;  4AVZ A;  4ZTF A;  4HQE A;  3GTP J;  2ZJP F;  2VJJ A;  1W7P D;  2ELJ A;  1W4M A;  5EG0 A;  3JR9 A;  5IPA A;  2HVR A;  4BGD A;  1K4S A;  2B7E A;  2CQN A;  2KJC A;  1R1T A;  2P6T A;  1R36 A;  4IHS A;  3OYM A;  1UG2 A;  3FXK A;  4IVN A;  5B5E C;  4IL6 C;  4F91 B;  3G73 A;  4XRS A;  2ZB9 A;  3OS1 A;  4W1U A;  4ESJ A;  3K2A A;  2V6C A;  3OR1 C;  2JVH A;  3K1P A;  5L3F A;  1RET A;  5FD6 A;  1OFC X;  2F4I A;  3HSE A;  3K9T A;  3A02 A;  4BEH A;  2DPU A;  2LKX A;  2HQ5 A;  4F52 A;  3WGH A;  3H5A A;  4RS8 A;  1IAW A;  4D9J A;  2FRH A;  5HDK A;  2HDC A;  1VQ5 I;  2G9W A;  3K7A J;  3J7Z I;  3V42 A;  1IJW C;  4A3B J;  3GWZ A;  4CXF A;  3ISP A;  1NHA A;  2GM4 A;  2MGQ A;  4A12 A;  2P7C B;  4XN3 A;  2F5D A;  1VQM I;  1RR8 C;  1MJA A;  1XTA A;  3MKZ A;  3DKW A;  4BE2 A;  3P9C A;  3CUQ C;  3EDP A;  2LMD A;  2CSO A;  4E70 A;  1JJ6 C;  2JRT A;  1J2X A;  2VC0 A;  4U88 A;  2XF7 A;  3EUK L;  4P96 A;  3C2G A;  2DAO A;  2HKO A;  1HW5 A;  3I55 I;  1MMG A;  4KJZ A;  3E6B A;  3ZMT A;  2MG4 A;  2L7K A;  4KIC A;  1P2F A;  2O8X A;  1V55 H;  4D1Q A;  4AID A;  4F92 B;  4Q4Z F;  1QU3 A;  3N4M A;  2M2E A;  1UHS A;  4PJ0 C;  2NAZ A;  1VQ7 I;  3P5J A;  5H6R A;  1WGX A;  5E3M A;  2NOG A;  2GA1 A;  4A6D A;  3H9Q A;  1PJR A;  1ENH A;  2LF8 A;  5LEJ A;  2CFX A;  2VKH A;  4RB0 A;  3CCV I;  1GDT A;  5FLV A;  1S3J A;  2F5V A;  2EA2 A;  1OR7 C;  2MBF A;  3LSH A;  3QOE A;  4QPO A;  3LNQ A;  4BDZ A;  1YE9 A;  2QZ8 A;  4EJW A;  2VI6 A;  1XGM A;  2QEN A;  3H1C A;  5DEQ A;  1TNT A;  1WVR A;  1ETX A;  4EQQ A;  3JAM Z;  2L9R A;  3DTE A;  3W2W A;  1CGP A;  3WTU C;  3E5Q A;  2EFP A;  4LK1 F;  4HSR A;  1FSH A;  3S17 J;  5JI6 A;  3KP2 A;  3KIO A;  3AG3 H;  3CCQ I;  3ZQ7 A;  2QSH X;  2E7W A;  4I6Z A;  2IEK A;  5JLX A;  3OMY A;  2XPW A;  1BR2 A;  2DJN A;  2HEO A;  1RKT A;  3TMO A;  2UXX A;  2MLK A;  3F8B A;  3HUG A;  3T0Y A;  2O6G E;  4CZZ A;  2WBM A;  1WJF A;  3C2B A;  1F9N A;  1GXP A;  4I98 B;  5KAI C;  4XQF A;  2WAE A;  5J1R A;  1XCV A;  1MBK A;  3ULQ B;  2UZK A;  3DV8 A;  4G8X A;  2O3F A;  2VLA A;  1E3O C;  4HDV A;  1EJ9 A;  2Q1Z B;  1A35 A;  4L9T A;  4A3K J;  3S1R J;  1WPK A;  5CQE A;  1YYV A;  2RQQ A;  3RQ4 A;  2RRE A;  2VKD A;  2R7T A;  1YW8 A;  2XRN A;  5IOY A;  1LFU P;  4GFB A;  3ZPL A;  1P7J A;  1ZLJ A;  1VZ0 A;  2HDW A;  3HRU A;  4E7S A;  2E2H J;  1I50 J;  3BG3 A;  3KZY A;  4A69 C;  3OIP A;  3QU6 A;  5HVQ C;  2FUG 2;  2LKP A;  4UV9 A;  1JKR C;  1H8A C;  3GEZ A;  3GME A;  1HKS A;  2FNP A;  3I0T A;  3LL7 A;  4M3G A;  2LOO A;  3GBG A;  3GLX A;  4UVC A;  3IKT A;  3S1Q J;  3E3V A;  4XLA A;  4YEJ A;  4XNF A;  4KUM A;  2FF4 A;  3W3C A;  2ZJR F;  4OMZ A;  4IXA A;  4GYG A;  1D8K A;  2X4H A;  5TGT A;  2ELH A;  5HDG A;  5FKO A;  1YFH A;  2CRG A;  4L18 B;  1MGT A;  5BOX A;  1S7A A;  3EET A;  2QWW A;  3RZD J;  2RV8 A;  5J4V A;  1R6R A;  4FQG A;  1LUJ B;  1X1A A;  2CUF A;  2DOD A;  4U87 A;  1GVJ A;  5JFR A;  2DDA A;  3Q9V A;  1D5V A;  2CQK A;  4KN4 X;  1YW9 A;  2BYV E;  2P5V A;  2AO9 A;  2ZCW A;  5FFZ A;  3QU3 A;  3DKX A;  3TQN A;  2IRF G;  1R4N B;  3CTA A;  5F64 A;  5E18 F;  3WTV C;  3FWE A;  1K78 B;  3GZN B;  3RPU D;  3Q0U A;  2XAH A;  4PUS A;  4GO1 A;  4KIB A;  2M0M A;  2P81 A;  2FMY A;  2RAE A;  1W36 C;  2M0C A;  3IV5 A;  1X3W B;  2MC4 A;  5IOZ A;  4BXX J;  3LSG A;  4JK1 X;  3Q3S A;  4HV5 A;  1JTY A;  2UXN A;  1O7F A;  3KP3 A;  2DFF A;  4CCN A;  4CCK A;  5EEA A;  3VYS B;  4NHJ A;  2ICW G;  2IT0 A;  2BGC A;  2CH0 A;  1YJW I;  1ZG1 A;  3S2H J;  1XMA A;  2R7Z J;  5GAD J;  2IJL A;  1T95 A;  4MQ9 F;  4DYQ A;  3IRR A;  4M71 A;  2H6C A;  4TV7 A;  1T39 A;  2KRF A;  2DO7 A;  5KCM A;  2HOT A;  2GOX B;  3QP6 A;  4IRH A;  3COA C;  2VKV A;  1SFO J;  1XS9 A;  2Y69 H;  1SD4 A;  2BY2 A;  4XRF A;  4GXO A;  2PMZ A;  1OCP A;  3U9G A;  2MSY A;  2LF7 A;  1FIP A;  2GQQ A;  3WHB A;  5ICG A;  1VQ8 I;  1G8X A;  5FLX Z;  4M6V A;  4BE0 A;  2JA7 J;  2OV7 A;  3K4N A;  4CHU A;  4E6K G;  3LA3 A;  2V26 A;  5F1J A;  3FF5 A;  2M45 A;  3TGN A;  3HSR A;  3CF5 F;  1FYL A;  1BIA A;  3ZQI A;  4BAC A;  3F22 A;  2E5N A;  1ZG3 A;  3ZMD A;  1YX5 A;  4LJZ F;  3OV8 A;  5L3C A;  2KQR A;  4KMF A;  1WJA A;  2LP0 A;  1VTN C;  5CVV A;  4E7H A;  4Q47 A;  3AKZ A;  4HZF A;  2X1E A;  1C0W A;  4HEA 2;  4HQM A;  1EF4 A;  3RIR A;  2GXG A;  3SQN A;  5BS6 A;  2L7Z A;  3FM5 A;  5DDG A;  1ETO A;  4NB5 A;  1IV8 A;  4K2E A;  4D7M A;  1U5T A;  3LFU A;  1KU2 A;  5TIS C;  1QRY A;  2FML A;  3ZMU A;  2L7M P;  3O6B B;  3IAS 2;  1WH5 A;  2OAZ A;  2VAS A;  3CCS I;  3KLO A;  5FLX K;  3FXO A;  1GVD A;  1XDS A;  4Y17 A;  2NVT J;  4XIC A;  1VFC A;  1IDY A;  4FX4 A;  1IN7 A;  2OCC H;  1W5T A;  1OKR A;  1HA8 A;  4UB6 C;  2E2J J;  1PUF B;  2W57 A;  3E5X A;  5TRD A;  1P4A A;  4F7Z A;  4UUS B;  2OZU A;  3K6G A;  3HZJ A;  4M3B A;  3IUO A;  4H4K C;  2HOA A;  4LG3 A;  2Y0S A;  4OAZ A;  4XLE A;  5LGN A;  5CJ9 A;  4R8H A;  2JMW A;  2ZFW A;  4N4O B;  1UG0 A;  3JRC A;  2BZT A;  3VYR B;  4XLN F;  1XPX A;  3O8H A;  1V5E A;  3QYB A;  1IXC A;  3LA7 A;  5J8F A;  2Z16 A;  2O61 A;  4HX7 A;  1GV5 A;  1ZR4 A;  1UZC A;  4M3E A;  1UJ8 A;  1SVL A;  4P9U A;  2H94 A;  2L54 A;  3OYK A;  2JJ7 A;  5IT3 A;  1TWH J;  1X1B A;  3CLQ A;  3F8M A;  2VXD A;  5BQT A;  3WTS C;  5J47 A;  1K83 J;  2Z3Y A;  1T2K A;  2WY8 Q;  2F5F A;  4UY8 I;  2DN0 A;  4XR6 A;  4B43 A;  4PJL A;  2DA2 A;  4XK4 A;  4HX8 A;  1YIT I;  4YG2 F;  1BL0 A;  4FE4 A;  3LFK A;  1TQM A;  1LE8 A;  1POG A;  2RDP A;  2PMZ N;  3R60 A;  1X3U A;  5K7Z A;  1MH3 A;  2FOK A;  2IS1 A;  1FBU A;  1ZQ3 P;  5C4X J;  4AYB A;  5K1Y A;  2EQR A;  2XB5 A;  4WWC A;  4S05 A;  3ZMV A;  4GYI A;  4MFD A;  5DD8 A;  3DQV C;  4BY1 J;  4CCJ A;  5DM7 F;  1Y56 A;  4BNC A;  4GDF A;  2BY3 A;  4EVI A;  4HLX A;  3CO6 C;  4IHW A;  3CUO A;  2STW A;  2DXI A;  4EJU A;  3PNV A;  3KX2 A;  3VYU B;  1MMS A;  1D8J A;  3JSP A;  1IZ1 A;  1G59 A;  3TW7 A;  2QBY B;  3BRO A;  1F5T A;  2VJI A;  4RAY A;  3OYE A;  5E8G A;  1DPR A;  1IC8 A;  4ON0 A;  1IRF A;  3CLO A;  3GW2 A;  2XRL A;  3QPS A;  3TL4 X;  2HPM A;  1D0Y A;  4MGR A;  4NQW B;  2R4G A;  5E3L A;  4ZDP A;  1BR1 A;  4CGZ A;  5DCM B;  1PDN C;  3ESW B;  3TO7 A;  1WJC A;  3R0A A;  1PVE A;  2DA6 A;  1HXD A;  1X58 A;  3BY6 A;  3KE2 A;  4HNT A;  1ONV A;  4XOR A;  4V19 K;  5K5O A;  4HLY A;  4S04 A;  2V9P A;  1FTZ A;  3ABK H;  2X1D A;  2QCO A;  3RJP A;  1K6O A;  3GYH X;  4R1H A;  4ENN A;  1MMN A;  2V1N A;  1T6S A;  4FTH A;  1U6G A;  3MAJ A;  1NK3 P;  2D5V A;  3KZZ A;  4HDU A;  2JQ7 A;  1ODD A;  3C18 A;  2HXO A;  3PSI A;  3I59 A;  2VQC A;  1DUX C;  3OWT A;  2BHZ A;  2MYS A;  4D5F A;  3EUH C;  3BTI A;  1N77 A;  2STT A;  5D8L B;  5IT9 K;  2OU2 A;  3BWG A;  1FX7 A;  4CSW A;  2D1V A;  3WE3 A;  4DOZ A;  4ENK A;  4HF0 A;  3CZ6 A;  1VQ4 I;  2VOP A;  3K1N A;  1I39 A;  2BBY A;  2QSF X;  1A5J A;  2TCT A;  2G7U A;  2LY1 A;  4ENM A;  1MDM B;  1UEL B;  1STZ A;  2XDV A;  1XMX A;  2V1X A;  1AHD P;  1OYW A;  4A3G J;  2OQG A;  3H9G A;  3T8T A;  1XSV A;  1FY7 A;  2Y31 A;  4BYY A;  5E1W A;  3I71 A;  1IN6 A;  3ZN0 A;  2VN2 A;  1YS7 A;  3E0J B;  3K10 A;  3SZG A;  5HNH A;  4ZZL A;  1VQL I;  2DQL A;  2X0L A;  3JRI A;  2GAU A;  5J1Y A;  4LIV A;  2A68 F;  3FXQ A;  2QLZ A;  1JT0 A;  1OQY A;  2VQG A;  3S93 A;  1J59 A;  2UUZ A;  3PFY A;  2QKL B;  3MWM A;  2R3S A;  5LRS A;  3S15 J;  3QYF A;  1ULY A;  2XF5 A;  4RLQ A;  4CH7 A;  1Y8R B;  1RUO A;  1KYW A;  4XBF A;  2W7N A;  1X1P A;  4BHB A;  3CQZ J;  2GZW A;  2K9M A;  2PG4 A;  2P6S A;  4G9Y A;  3MZY A;  4RB2 C;  2C6Y A;  2QQB A;  1YS6 A;  3J80 K;  1Y6I A;  1IG7 A;  1DGW Y;  2KZG A;  3F9K A;  2XSD C;  4U7B A;  3GTJ J;  3DLA A;  4A93 J;  1SAN A;  2XPV A;  4B8X A;  2RKH A;  2PBI A;  1OYI A;  1Z7L A;  4HST A;  3L2V A;  3F6V A;  2RQP A;  2VPR A;  3KZI C;  3FX3 A;  4XKB A;  1SFU A;  4L9J A;  4WF2 A;  1E3H A;  3HRM A;  1ON2 A;  1LEA A;  3S3M A;  3CC4 I;  1FPQ A;  4A2U A;  2IS4 A;  1ETK A;  5M5X J;  3F8N A;  2HS5 A;  3RKY A;  4YFK F;  4O6J A;  2RNG A;  2P8T A;  3BR1 A;  1R1U A;  1JI8 A;  3V4G A;  2XKP A;  2Z5U A;  5EGO B;  2CW0 F;  3DEW A;  5F04 A;  1OCT C;  2QKM B;  3BJA A;  3ABU A;  5LBQ A;  4BDY A;  1ZGJ A;  2HU9 A;  3HB9 A;  1SMY F;  3ABT A;  1F1Z A;  3S2D J;  1D1B A;  1WHU A;  1BBY A;  4IZZ A;  1MND A;  4XSZ F;  2WV1 A;  1AKH A;  4QWQ A;  5M5Y J;  3J81 K;  4JX5 A;  1TW3 A;  2IXS A;  3K4B A;  1QVU A;  1YW7 A;  3M8F A;  2CU7 A;  3PO3 J;  1KYZ A;  2JA2 A;  2XHK A;  3RYP A;  1BJA A;  3B6C A;  4P5O A;  1YO5 C;  1B8I A;  3IC7 A;  1L0O C;  1IO2 A;  4UUV A;  2MA3 A;  1OJL A;  4Y15 A;  1X19 A;  1MSF C;  2K9L A;  4IOC F;  3E97 A;  5EF6 A;  3G1L A;  1UST A;  2LBF B;  1J75 A;  4MTE A;  5CQG A;  1Y1V J;  4G7O F;  1OIS A;  5GAH J;  4B09 A;  2H8W A;  2XGX A;  2L2O A;  3IHU A;  1T38 A;  1QHH D;  4RAF A;  2Y9Z A;  4UB8 C;  4XSX F;  3D0S A;  1XSD A;  4CCM A;  4ZYA A;  2FBI A;  1IV6 A;  3J7A Y;  3OYN A;  1K4T A;  3JRG A;  3DWL E;  2X6W A;  2DMQ A;  2EFW A;  4XLF A;  4M74 A;  1MBG A;  1B8I B;  1WI9 A;  3H92 A;  1X2N A;  2PX9 A;  1UMQ A;  5FD5 A;  1V3F A;  4DQ2 A;  2CW7 A;  4C3H J;  3OYL A;  1ZRE A;  1UHM A;  3BQY A;  3HC7 A;  1RZ4 A;  4A3E J;  3CJN A;  2GA2 A;  1E17 A;  2A5Y B;  1JE8 A;  4I02 A;  2VQL A;  4PFP A;  3BQZ A;  5GAG J;  4LLN A;  5DM6 F;  4O5V A;  2MAB A;  3IH3 A;  4D5C A;  2VJ5 A;  3I54 A;  1MMD A;  5J6X A;  4KFC A;  5F0H A;  3DEE A;  3CDL A;  3PNT A;  3QWL A;  1JUP A;  3ERM A;  3EYY A;  2EBI A;  2XPU A;  2YX4 A;  3V8L A;  3ZQH A;  1G3T A;  5EG0 B;  4IF4 A;  2XUB A;  1Q1H A;  1KQ0 A;  2K5C A;  5L3G A;  4ZYE A;  1BI0 A;  1NTC A;  3S3N A;  4IHX A;  2KLO A;  3C2H A;  2R7W A;  3C1D A;  3CUQ A;  1SD6 A;  3TDZ C;  3GTG J;  1U2W A;  2EIK H;  1HQC A;  1I3A A;  2CO5 A;  1CF7 A;  2IGO A;  2V6E A;  2LRD A;  2RN7 A;  3K1M A;  2VON A;  3GTK J;  1J9I A;  4BEH B;  4AUX A;  3DKY A;  4KIF A;  2DI3 A;  4ENJ A;  3E7L A;  3MQ0 A;  1T33 A;  2K9S A;  4PZJ A;  3DU5 A;  2WAD A;  3W6V A;  3PIP F;  4X1E A;  2FX0 A;  2LR8 A;  2X6O A;  2IS6 A;  3KET A;  1OPC A;  2XGC A;  3W6K B;  2YU9 J;  3LSI A;  4Q5S F;  3CDI A;  1SVM A;  2HKX A;  3M9A A;  2Y0M A;  1KZH A;  1Y1W J;  3PSF A;  5GPA A;  3FKJ A;  2ZNY A;  1R4M B;  4QPQ A;  2DK8 A;  3F6O A;  4AIH A;  2COB A;  2J5P A;  3OYH A;  3MN2 A;  3M07 A;  1IF1 A;  1R7J A;  4RBO A;  1OR7 A;  4C30 A;  2FA5 A;  1KQ9 A;  2F6C A;  2JA5 J;  2IGK A;  3S14 J;  3SEZ A;  1GUU A;  2E60 A;  3BZK A;  1A6Q A;  1K61 A;  2H8R A;  3DBH B;  2HFH A;  2DT6 A;  2IA1 A;  1I1G A;  3L2U A;  3UKG A;  4WXH A;  5FKK A;  4QIW N;  2Z1D A;  1O3Q A;  1GHC A;  2EIN H;  3H35 A;  4LIT A;  2LH9 A;  4BUP A;  4X6A J;  2M8G X;  1IXR C;  3JRE A;  3QQA A;  2ZSI B;  2EFQ A;  1WWX A;  1R00 A;  2DOF A;  2DBB A;  5FFX A;  1LNW A;  1ETV A;  1H89 C;  3C7J A;  4CA0 A;  2KZV A;  1RNL A;  1U78 A;  3FZV A;  4FHT A;  2FXA A;  2PEX A;  3MKY B;  4JP0 A;  4RAZ A;  1YLF A;  5D5W B;  1IN8 A;  2DA3 A;  1A6I A;  3ZOB A;  1G4D A;  2Z33 A;  2XAU A;  2W25 A;  4IHV A;  2CQX A;  1ZHF A;  1OCR H;  4BJ5 C;  3OYD A;  4B44 A;  2XGE A;  3CMY A;  2HI3 A;  2XKO A;  1LDD A;  2CV0 A;  5M5W J;  3P7N A;  1R1V A;  2OD5 A;  3FXR A;  1HW2 A;  2HZT A;  4RGR A;  2FSW A;  3HUG B;  2R7O A;  3KEY A;  4DNC A;  5HLT A;  1MD0 A;  3GLL A;  1LPQ A;  5H6Q A;  5B66 C;  2OTJ I;  4G6T B;  2HOS A;  2E1C A;  3ELK A;  4FX0 A;  3I58 A;  4JYK A;  4BS9 A;  2QF7 A;  3T1B A;  2B63 J;  4RB3 C;  4XRM A;  3OSF A;  2GLO A;  1ZYR F;  4I0B A;  4AVP A;  2JK3 A;  2X1C A;  1O3T A;  4BY7 J;  3MFK A;  3OIO A;  3I4P A;  3CCR I;  1BN5 A;  1YTY A;  3BG5 A;  2QQ9 A;  5L3D A;  1S7O A;  1FYK A;  1RC9 A;  4AWX B;  5FRO A;  3FXU A;  1Y8Q B;  5K7H A;  1FSE A;  2RGV A;  1YJN I;  2QEX I;  2R5Z A;  2EWN A;  2TRT A;  1SEU A;  2F4O B;  3WE2 A;  3HHG A;  3BC8 A;  3SZP A;  1XGN A;  1TWG J;  2WY7 Q;  4OAY A;  1BM9 A;  2WWY A;  2PQ8 A;  2G7H A;  3HOV J;  5E20 A;  3B6A A;  3CP2 A;  4N9I A;  3REO A;  3LSR A;  2CV2 A;  1UAA A;  3HSF A;  2A6T A;  5CKT A;  3FK7 A;  2E1O A;  2AXT C;  3LWF A;  3HTU A;  2IGM A;  4XKV A;  2PJR A;  3PNY A;  5L3E A;  4MFE A;  3JSO A;  3GCM A;  3VPR A;  2A3S A;  3S2W A;  2NS0 A;  2VOD A;  1R58 A;  3F72 A;  3OS0 A;  3R6S A;  3IP4 B;  5JHU A;  1VI0 A;  4XLH A;  1SD7 A;  4LIU A;  1K6Y A;  4E7I A;  4XKC A;  3I3L A;  2VOO A;  2R5Z B;  2L0K A;  3I53 A;  4Z2Y A;  1R5I D;  1FP2 A;  3GZ5 A;  2MLG A;  2VC1 A;  4EGY A;  3HHH A;  4DZP A;  2Q2E A;  4UVA A;  5E79 C;  1YG2 A;  5EZG A;  2ACJ A;  1VQ9 I;  5JVG F;  5J8C A;  2CG4 A;  4L5J A;  4V2F A;  2ZXI A;  1ERD A;  1S72 I;  1PP7 U;  4MIM A;  4ZH4 F;  4ZYH A;  2D45 A;  2PFB A;  2IGN A;  2X85 A;  2CGP A;  4CIC A;  1V5G A;  3E1S A;  3HBL A;  3GZ6 A;  3FXL A;  1YRN A;  2P5L C;  2V1D A;  3JRB A;  3B73 A;  4BQO A;  1F43 A;  2ADU A;  2FD5 A;  4G7H F;  3EQL F;  1AA7 A;  3K4L A;  1R9T J;  3HPG A;  4MEY F;  3MVP A;  1T0F C;  3OL3 A;  4BQQ A;  1IRX A;  4CO8 A;  2IA2 A;  4A5M A;  1TWC J;  2KMU A;  3BG9 A;  1U8B A;  1RRJ A;  3DXJ F;  2QSG X;  1TQI A;  5H2F C;  3HOY J;  4BBR J;  2Q2E B;  4X0G A;  2W00 A;  1VQP I;  2NS7 A;  1P92 A;  1FMV A;  3TO6 A;  1VF9 A;  4ZYD A;  4UXN A;  2M34 A;  1R71 A;  2ZJ2 A;  3T5X A;  2HTS A;  5D6F A;  5EYR A;  3FMR A;  1YRN B;  2GIZ A;  3LQR A;  2DFE A;  4RAG A;  1TBX A;  2VL8 A;  3RDI A;  1Y0U A;  3LSJ A;  4I01 A;  1KQ8 A;  2K3P A;  2EZI A;  2KKO A;  2XV4 S;  1UHW A;  5ERI A;  4RGX A;  3BP8 A;  3QOP A;  4XOT A;  2M30 A;  3I56 I;  5CPR B;  5D4R A;  5B1A H;  1ZAR A;  4E4H A;  1XN7 A;  2VE8 A;  3CCY A;  4E7L A;  5IYB J;  1HCR A;  5GP9 A;  3SXY A;  1RKW A;  2XGD A;  4KT5 C;  1IGN A;  4PGG A;  1B9M A;  3A4C A;  4NC8 A;  1MMA A;  4PSW A;  2X6Y A;  2F48 A;  2MW8 A;  3OYI A;  3KEO A;  1QVT A;  3WU2 C;  5GTH C;  2R7X A;  5TJJ A;  1D1A A;  4PGH A;  3Q5F A;  5D5U B;  4U7D A;  2P5K A;  3K0L A;  4UVB A;  1S6L A;  3VDX A;  2ZSH B;  2MD0 A;  1MNE A;  3GFJ A;  4MEX F;  3RSN A;  2G0E A;  1F4K A;  2YX7 A;  9ANT A;  4Y3O A;  4P55 A;  3OYB A;  2BEO A;  1JKQ C;  2VBY A;  1LVA A;  5J1U A;  2R93 J;  2EJR A;  2QVO A;  3AG2 H;  4EM0 B;  4QTR A;  3CJR B;  5KNL A;  3MMY B;  3DCF A;  1W5S A;  5HLG A;  2XAS A;  4A3F J;  2AXL A;  5H20 A;  4FT8 A;  4LGW A;  1LEB A;  1PUE E;  2W82 A;  1ZRF A;  4XLC A;  4EEF G;  2KPM A;  4ANJ A;  1Z9C A;  2DMT A;  3M7G A;  1B4A A;  4EGZ A;  5DD4 A;  2LD5 A;  1LFP A;  3ML6 A;  3GVA A;  1OYY A;  2DCE A;  4HX4 A;  2E1M B;  2R92 J;  1X1D A;  1U5T B;  3KP6 A;  5IY5 H;  1ETW A;  4XRS G;  3HOS A;  1MBF A;  1IN4 A;  3BZ6 A;  4Y52 J;  1MH4 A;  3L1P A;  2M7A A;  2F5E A;  2CMP A;  1VQN I;  2HYF A;  5EEH A;  1GT0 C;  3VSL A;  4UNO A;  4A3D J;  2IAI A;  1KU3 A;  2A05 A;  2V9K A;  2R5Y A;  3L2Q A;  3O2P E;  4F93 B;  2ME6 A;  3M3Y J;  3WGI A;  1I27 A;  2CV1 A;  1RR7 A;  1J7K A;  1APL C;  3E5U A;  3WTZ A;  3PL8 A;  4GRI A;  3QP5 A;  4PDK A;  2L9N A;  3Q0W A;  3PUF A;  4IKF A;  4AM3 A;  3BOQ A;  3BJ6 A;  2RNJ A;  1PYV A;  4A3J J;  3UR3 C;  2R0Q C;  1MJ9 A;  3DF8 A;  3CME I;  4OIN F;  3GO5 A;  2DDB A;  2VJ4 A;  1W7P A;  2J5O A;  1WJB A;  1Q1V A;  3V7S A;  4DBQ A;  1XG1 A;  2PJP A;  3H0D A;  3CF2 A;  4N4N B;  1SFE A;  5F6F A;  5FJ8 J;  2O5R A;  5F08 A;  2BHY A;  4M9X A;  3MKW B;  1GLN A;  3H5N A;  2XC7 A;  2X9D A;  4MHG A;  2MH9 A;  4AD9 A;  4RGS A;  4Y4R A;  4C9Y A;  1XDU A;  1OCC H;  2VT2 A;  4FAS D;  2ZXW H;  2KIU A;  3MEX A;  4QLC U;  2JVG A;  5LGU A;  3J7A O;  1IUY A;  2X6X A;  3I4M J;  1F36 A;  3JW4 A;  3G1M A;  2QQ8 A;  1R5G A;  3IWF A;  2DA1 A;  5IT9 Z;  4S0H B;  2JA8 J;  4BKX A;  1LE8 B;  5IYD J;  4A3C J;  5B3S H;  3JRA A;  5DS9 A;  1QO0 D;  2K9N A;  4HNV A;  1W7P B;  2DLL A;  2JPC A;  1T8I A;  3TO9 A;  4KIT B;  2ZO4 A;  1ZGA A;  2E1N A;  2W85 A;  2RVC A;  3W6J B;  3HKZ A;  4NC6 A;  4LG0 A;  2Q8K A;  2DA7 A;  2KRC A;  5E1Z B;  3L7W A;  4RA2 A;  2DMP A;  5LD2 C;  4PJM A;  4CYC A;  1LQ1 A;  3MZ8 A;  2V1U A;  1B9N A;  1X1C A;  3G1O A;  5FO5 A;  5GTI C;  4J01 A;  1J5Y A;  2ZXH A;  3F23 A;  2Z9O A;  1W36 D;  2JUG A;  4A0Z A;  3BDD A;  5JVT A;  3BCA A;  2BY0 A;  1FBS A;  5EZH A;  4YRV A;  4BQN A;  4WK8 F;  2WA0 A;  4L5I A;  2LC2 A;  3GTL J;  4MTD A;  4NC7 A;  3NAR A;  3AL0 B;  3L9F A;  1IDZ A;  4I99 C;  3TKY A;  3WU1 B;  3BPV A;  1I5Z A;  3I4N J;  2K40 A;  2Y0S N;  3GF2 A;  3BLY A;  3FHN A;  1HBX G;  2BXY A;  2ESH A;  4CYC B;  2BE5 F;  2HDD A;  2YU3 A;  2GXB A;  3M4O J;  2DA4 A;  5FRN A;  4G6Q A;  3VYT B;  3J80 Z;  4KYW A;  1HF0 A;  1BOB A;  1ITY A;  3PQJ A;  2HQA A;  1N78 A;  1T56 A;  1B59 A;  4B3X A;  1S9H A;  5ILV A;  4BXU A;  1OCO H;  2E2I J;  1KGS A;  1NG7 A;  1W1W E;  5FKN A;  4CCL A;  1ZG5 A;  4BAY A;  4HA8 A;  4W97 A;  1MIJ A;  3GTQ J;  3JTH A;  2D1H A;  2H09 A;  2JUC A;  3CC7 I;  3I59 B;  1O3S A;  3K69 A;  5DTD A;  4MO7 A;  2HPI A;  1FOY A;  2LNB A;  4EM2 A;  2VE9 A;  1I3Q J;  3H5R A;  5CVI A;  2E36 A;  1A31 A;  2QGU A;  1O3R A;  2YPR A;  3NWT A;  1FT9 A;  2L3D A;  4BJ6 C;  3TP3 A;  3PM1 A;  2XSJ C;  3CJT B;  1OMI A;  4YII A;  5M3F J;  4LOC A;  2E5Z A;  3A0H C;  5LGT A;  4KT6 A;  2WB1 A;  3SHF A;  1W0U A;  3OY9 A;  1R23 A;  2E7X A;  3FIS A;  3ZXS A;  2GOM A;  2FNA A;  4E7J A;  5E8I A;  4MNU A;  3I5U A;  4N9H A;  5K7F A;  3CCU I;  2HVQ A;  2EH3 A;  4LLL A;  3LAP A;  3CDH A;  1NH3 A;  3JRF A;  4AYB N;  3CMM A;  2VBX A;  3J81 Z;  2KT0 A;  2DU9 A;  1WFX A;  1DDN A;  3FM3 A;  1PP8 F;  3IH4 A;  1BC7 C;  1FOK A;  3ZQG A;  1FZP B;  3GTM J;  1RES A;  2F2E A;  2DA5 A;  3ZCO A;  1SFK A;  1IRG A;  1XD7 A;  4QSH A;  5BPI A;  1JGS A;  2FBK A;  2WC2 A;  5ILS A;  1AOY A;  4OIP F;  4JX4 A;  3NEU A;  1BA5 A;  3VFZ A;  3H3V K;  3SYT A;  3VWB A;  1VQK I;  3R0J A;  2MH2 A;  2DYR H;  3OIQ A;  1WJE A;  2BW3 A;  1U3E M;  3HDD A;  3GTO J;  3LAJ A;  2KDO A;  2R7D A;  2DJI A;  2A6H F;  4LMY A;  2DMU A;  4ESF A;  3D5S C;  3DFG A;  1Z3X A;  2X48 A;  3DU6 A;  5LHH A;  3E6M A;  4P1W A;  2K3F A;  5FLM J;  2P0W A;  5ICE A;  1O7L A;  1TZL A;  4JBA A;  4HF2 A;  2H27 A;  3E6C C;  1S8N A;  1LKX A;  2ZME A;  4AC0 A;  2ISZ A;  1RPW A;  4J19 A;  1GV2 A;  3DPU A;  5CYV A;  3TBI A;  4ZJZ A;  3CCL I;  1B72 A;  3R61 A;  5BNG A;  2ID6 A;  4LLG F;  3A01 A;  4ZZD A;  5E3N A;  4EJT A;  2VIX A;  4RB1 A;  3HIF A;  1IN5 A;  1V5F A;  2XIG A;  1VQ6 I;  4IHT A;  2L5Q A;  3BJO A;  4HYE A;  3OYC A;  3K70 C;  3TW6 A;  1FOX A;  2CQ7 A;  2L01 A;  2QQA A;  1ZAO A;  3MD2 A;  1P4W A;  3T8R A;  5EDN A;  3KEQ A;  1ZRD A;  2L02 A;  1BIB A;  3OOU A;  5J40 A;  1IUF A;  2DPD A;  1JUS A;  4WXC A;  1TT0 A;  2R7S A;  1ZEL A;  1HST A;  3EUA A;  2XF6 A;  2WTE A;  1XGO A;  3HJE A;  5CLS A;  1D3Y A;  2ZME B;  3U2R A;  5C4J J;  4M9Z A;  4DZJ A;  3RPU A;  1AKH B;  2H6B A;  2W4S A;  1JKO C;  1X4O A;  2UWM A;  1DPU A;  1X2M A;  1MJB A;  2R7V A;  1TT5 B;  2FQ3 A;  4DGW B;  1B1B A;  5HLH A;  2LK2 A;  3DPT A;  2I8D A; 
#chains in the Genus database with same CATH homology
 1BJZ A;  1W0T A;  1HDD C;  4I76 A;  4B3A A;  2HOS A;  4A3L J;  1EF4 A;  2L7Z A;  3BR6 A;  3OSG A;  3FKI J;  1ETO A;  3SJM A;  2GBY A;  4JYK A;  2QF7 A;  4Y7N J;  4D7M A;  2B63 J;  4XRM A;  3OSF A;  2WB1 N;  2GLO A;  1QRY A;  2JK3 A;  4BY7 J;  2L7M P;  3OIO A;  5HOD A;  1VND A;  1WH5 A;  3BG5 A;  5F0C A;  3HOW J;  1ZKG A;  1GVD A;  2ECC A;  2NVT J;  4XIC A;  5K7H A;  1VFC A;  1IDY A;  3SDG A;  1JGG A;  4M3D A;  2R5Z A;  3RKQ A;  2TRT A;  3O8G A;  2E2J J;  1PUF B;  5JLW A;  2VKE A;  1JUM A;  4UUS B;  1TWG J;  1CQT A;  2EZK A;  4M3B A;  2HOA A;  3HOV J;  3B6A A;  3LSR A;  3WHC A;  1JTX A;  2E1O A;  2JMW A;  3FK7 A;  3JRC A;  1BW5 A;  4MFE A;  3VPR A;  3O8H A;  5IP9 J;  1MBJ A;  1MNM C;  1VI0 A;  3Q0V A;  1GV5 A;  5M3M J;  1ZR4 A;  2R5Z B;  2L0K A;  4M3E A;  3LSP A;  1FIA A;  1WH7 A;  2JJ7 A;  1TWH J;  4V2G A;  3D1N I;  1S7E A;  4DZP A;  1K83 J;  5EZG A;  1I6H J;  4V2F A;  3BR0 A;  2DN0 A;  3HKZ N;  3ZQL A;  4M3F A;  2DA2 A;  4XK4 A;  4FCY A;  4MIM A;  1BL0 A;  4JX6 A;  4UUT A;  4FE4 A;  5EGO A;  1LE8 A;  1POG A;  2PMZ N;  4XID A;  3HBL A;  1WI3 A;  1YRN A;  4A3I J;  5K7Z A;  1MH3 A;  3JRB A;  2O7O A;  1F43 A;  5C3E J;  2FD5 A;  2JN6 A;  2O8K A;  1ZQ3 P;  5C4X J;  5IP6 A;  1R9T J;  3MVP A;  2EQR A;  4B4C A;  2XB5 A;  3BTC A;  2KDZ A;  2I10 A;  2LY9 A;  1TWC J;  4MFD A;  5IYC J;  1MSE C;  3BG9 A;  1MBH A;  2DMN A;  1U8B A;  4BY1 J;  3HOY J;  4BBR J;  1AU7 A;  3HEF A;  2NS7 A;  4IHW A;  2VUM J;  3H0G J;  2LTP A;  3S1N J;  1IRZ A;  1BW6 A;  5J3L A;  2YUS A;  1VF9 A;  2NVX J;  1H88 C;  2M34 A;  3LOC A;  2LLK A;  3TW7 A;  1ZK8 A;  2CJJ A;  4B1R A;  5EYR A;  1YRN B;  1IC8 A;  3BTL A;  3FK6 A;  1JJ8 C;  1WCM J;  2XRL A;  3LSJ A;  3QPS A;  2HXI A;  2EZI A;  1FJL A;  5E3L A;  3HOX J;  2ME0 A;  3JRH A;  1LFB A;  4L5E A;  3S1M J;  1B72 B;  3CCY A;  1HCR A;  5IYB J;  3A01 B;  3IH2 A;  5GP9 A;  2DA6 A;  2DTZ A;  1X58 A;  3HOU J;  2CUE A;  1RKW A;  2OF7 A;  2XGD A;  1IGN A;  1QPI A;  1TWF J;  4FIS A;  2EZL A;  1FTZ A;  2E19 A;  2MW8 A;  2H1K A;  1QVT A;  2QCO A;  3JRD A;  4FTH A;  4C3J J;  4A3M J;  1NK3 P;  2D5V A;  3HM5 A;  4DW6 A;  2HXO A;  3GTP J;  1ZR2 A;  2G0E A;  4D5F A;  9ANT A;  3BTI A;  1JKQ C;  5GPC A;  5EG0 A;  3JR9 A;  5IPA A;  5J1U A;  2R93 J;  1HOM A;  1D5Y A;  3ZQC A;  4QTR A;  1UG2 A;  2YS9 A;  3DCF A;  4A3F J;  1ZTR A;  2LFB A;  1A5J A;  2TCT A;  2L7F P;  4EEF G;  4XRS A;  2ZB9 A;  1FEX A;  4W1U A;  3K2A A;  2DMT A;  1AHD P;  4A3G J;  2LD5 A;  3RQI A;  1RET A;  2Y31 A;  1OFC X;  5IP7 J;  3A02 A;  2LKX A;  2HQ5 A;  3TP0 A;  2R92 J;  1ETW A;  4XRS G;  3NAU A;  1MBF A;  3JRI A;  3SFI A;  4Y52 J;  5J1Y A;  1MH4 A;  1U9O A;  3BT9 A;  3K7A J;  3L1P A;  1JT0 A;  1GT0 C;  1IJW C;  4A3B J;  2ID3 A;  3MKL A;  4DYC A;  4A3D J;  2IAI A;  2ELK A;  2NS8 A;  2R5Y A;  2GM4 A;  2MGQ A;  3S15 J;  2ME6 A;  3M3Y J;  1FTT A;  1RR7 A;  2Y2Z A;  3HGG A;  1APL C;  5FKL A;  4C2M J;  1JJ6 C;  3CQZ J;  3HGY A;  3Q0W A;  1G2H A;  4A3J J;  1IG7 A;  2O9L A;  2NVQ J;  2R0Q C;  2CQQ A;  2XSD C;  3GTJ J;  2HYJ A;  4A93 J;  1SAN A;  2MG4 A;  2XPV A;  4FE7 A;  4RDU A;  1O4X A;  3QPL A;  2M2E A;  1UHS A;  1Q1V A;  1WGX A;  1XG1 A;  5E3M A;  2NOG A;  1TC3 C;  5FJ8 J;  2VPR A;  5F08 A;  1ENH A;  2X9D A;  4BBS J;  1GDT A;  3RZO J;  5FLV A;  1Z77 A;  5C44 J;  1ETK A;  5M5X J;  3LNQ A;  2VI6 A;  3S16 J;  3BR1 A;  3I4M J;  1F36 A;  4DYR A;  4NDL A;  3G1M A;  2DA1 A;  2W48 A;  1ETX A;  4S0H B;  2JA8 J;  2L9R A;  5EGO B;  4BKX A;  3DEW A;  1LE8 B;  5F04 A;  4A3C J;  1OCT C;  5IYD J;  3JRA A;  5DS9 A;  2AHQ A;  2K9N A;  3HB9 A;  4HNV A;  3S17 J;  3PO2 J;  3S2D J;  4I6Z A;  2IBD A;  2IEK A;  5JLX A;  2WV1 A;  2XPW A;  1AKH A;  5FKM A;  2DA7 A;  2DJN A;  5M5Y J;  4G12 A;  4JX5 A;  2DMP A;  5F27 A;  1QVU A;  1RKT A;  2CU7 A;  3PO3 J;  3F0C A;  4CYC A;  3B6C A;  3C2B A;  3G1O A;  1B8I A;  1JT6 A;  1DU0 A;  1OJL A;  5J1R A;  1MSF C;  1MBK A;  5EF6 A;  3G1L A;  3HOZ J;  5EZH A;  1E3O C;  1Y1V J;  3GTL J;  4A3K J;  3S1R J;  1WPK A;  3NAR A;  2JA6 J;  1IDZ A;  3A03 A;  2Y9Z A;  1LFU P;  5IOY A;  4GFB A;  3I4N J;  1ORK A;  2K40 A;  2Y0S N;  1IV6 A;  3FIW A;  1P7J A;  2HDD A;  4CYC B;  3JRG A;  3M4O J;  2DA4 A;  2DMQ A;  1PUF A;  2ECB A;  2E2H J;  1MBG A;  1B8I B;  1I50 J;  3BG3 A;  4A69 C;  4UUS A;  1X2N A;  1JKR C;  1HF0 A;  1UMQ A;  1ITY A;  1H8A C;  3BR2 A;  1HLV A;  1T56 A;  4C3H J;  3BQY A;  1HDP A;  4A3E J;  2E2I J;  4M3G A;  5FKN A;  3GBG A;  3BQZ A;  4W97 A;  3IH3 A;  4D5C A;  1DU6 A;  3GTQ J;  4IHY A;  4MLO A;  5F0H A;  3CDL A;  5DTD A;  3S1Q J;  4MO7 A;  1JUP A;  1I3Q J;  2EBI A;  2XPU A;  3ZQH A;  5EG0 B;  3TP3 A;  3PM1 A;  5FKO A;  2CRG A;  3ZQF A;  4LOC A;  5M3F J;  1W0U A;  3FIS A;  1NTC A;  3RZD J;  4IHX A;  2CUF A;  5K7F A;  1ZGW A;  2EH3 A;  4C3I J;  3GTG J;  3JRF A;  4AYB N;  3BR3 A;  2AO9 A;  3GTK J;  4AUX A;  3E7L A;  2KT0 A;  1T33 A;  4IEJ A;  2K9S A;  4D7N A;  3W6V A;  4X1E A;  3IH4 A;  2FX0 A;  2LR8 A;  3ZQG A;  2X6O A;  2Y30 A;  2YU9 J;  2XGC A;  1RES A;  3GTM J;  1ETY A;  5F0F A;  2DA5 A;  3Q0U A;  5E3O A;  4QSH A;  1XC5 A;  1Y1W J;  5GPA A;  2P81 A;  2OPT A;  4JX4 A;  1BA5 A;  3H3V K;  2R5Y B;  2FJ1 A;  2RAE A;  2COB A;  2M0C A;  3IV5 A;  3BTJ A;  3MN2 A;  5IOZ A;  2K9Q A;  4BXX J;  3LSG A;  1U9N A;  4RBO A;  3HDD A;  3GTO J;  3Q3S A;  1JTY A;  2JA5 J;  3S14 J;  1MBE A;  5EEA A;  1GUU A;  2DMU A;  1K61 A;  2WAQ N;  2X48 A;  2H8R A;  3S2H J;  2R7Z J;  5FLM J;  2JWT A;  3UKG A;  5FKK A;  3TED A;  4QIW N;  1P7I A;  4DYQ A;  4AC0 A;  4X6A J;  1RPW A;  4J19 A;  2HOT A;  1GV2 A;  2M8G X;  3JRE A;  3QQA A;  2VKV A;  1SFO J;  1XS9 A;  5BNG A;  1B72 A;  2ID6 A;  3A01 A;  5E3N A;  1OCP A;  1NK2 P;  2MSY A;  1H89 C;  1ETV A;  1FIP A;  3WHB A;  2FQ4 A;  2Y9Y A;  3TW6 A;  3BR5 A;  4ABZ A;  4M6V A;  1U78 A;  5EDN A;  2JA7 J;  4JP0 A;  3OOU A;  1ETQ A;  1IUF A;  1JUS A;  1TWA J;  1A6I A;  2DA3 A;  3ZOB A;  2EZH A;  5F1J A;  1JKP C;  4IHV A;  3ZQI A;  2CQX A;  2LVS A;  5C4J J;  1Z0X A;  2XB0 X;  2XGE A;  3CMY A;  2HI3 A;  4DZJ A;  1AKH B;  5M5W J;  2M9H A;  1JKO C;  2N8G A;  2LP0 A;  1X2M A;  2NVY J;  2LK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...