1TWHJ

Rna polymerase ii complexed with 2'datp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 15
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1twhJ00
2EZHA 3S1NJ 5C44J 3HOZJ 5C3EJ 4A3KJ 4V2GA 2ME0A 3S17J 1MBGA 2XB5A 1MH4A 1ITYA 2NVTJ 2JMWA 3BT9A 3RKQA 5E3NA 2G0EA 2JK3A 3HOWJ 1JKPC 1QPIA 1JT6A 3BR5A 3BTJA 1W0TA 3S14J 3BQYA 4A3CJ 1ORKA 5FJ8J 1E3OC 3S16J 1F43A 3NARA 1XS9A 2O9LA 4D7NA 2D5VA 3VPRA 4Y7NJ 4AUXA 1ZR4A 4X1EA 1AKHA 2LVSA 5EG0A 2M9HA 5GPAA 2GLOA 2H1KA 2CJJA 2ECCA 3JRGA 1OJLA 1Y1WJ 1U78A 1B8IB 1VNDA 3JRAA 2GM4A 1JUPA 4MO7A 4M6VA 1JKQC 4DZPA 4S0HB 1FTTA 5M5XJ 3H3VK 2Y31A 3MN2A 1U9NA 4C3HJ 3Q0UA 2O8KA 1B72B 2K9NA 4FE7A 2DMTA 1IDZA 2R5YB 1GUUA 4RBOA 2EH3A 2X48A 3LSGA 1TWCJ 4IEJA 2VUMJ 3GTMJ 5GPCA 1PUFB 5FKMA 4XICA 4EEFG 4M3BA 3FK6A 1MBJA 4M3FA 4UUSB 1TWGJ 1A5JA 4X6AJ 3PM1A 1RKWA 1VI0A 3SDGA 2M8GX 2DMQA 3GTJJ 1X2NA 5DS9A 1FIPA 1F36A 5FKNA 4QSHA 2DMNA 5EG0B 3K7AJ 2R5YA 3OSFA 1RR7A 1LE8A 4UUSA 3BR0A 4A3GJ 1MBHA 2R5ZA 1H89C 1P7JA 1Z77A 3ZQHA 3QPSA 3BG9A 3H0GJ 1MSFC 1TWFJ 3JR9A 1RETA 1MH3A 5DTDA 4ABZA 1TC3C 3S1MJ 3K2AA 1LE8B 2CQXA 1ETXA 1SFOJ 1ETOA 1UMQA 2MW8A 3HB9A 2HOTA 1JKRC 4IHYA 4C3IJ 2N8GA 1ETQA 3BR6A 2M2EA 4BY7J 2DA5A 2P81A 2K9QA 2LFBA 3S15J 4A69C 5FKOA 3S2DJ 1MBFA 2JA5J 2AO9A 3G1LA 1O4XA 2R93J 4D5FA 3GTQJ 2JA8J 4CYCA 1JT0A 3OOUA 1ETVA 2NOGA 5C4XJ 2DJNA 2VKEA 1QRYA 1OFCX 4M3GA 4UUTA 4B3AA 5K7HA 2XPUA 5GP9A 5F04A 4DYQA 3G1MA 4JX6A 1ETWA 2I10A 4DYCA 1IJWC 2WV1A 1RPWA 1Q1VA 1WH5A 4MFDA 5IOZA 2YU9J 3QPLA 3ZOBA 1UHSA 2HQ5A 2JJ7A 1GDTA 4DZJA 2L7MP 4HNVA 5IYCJ 1IDYA 4D5CA 2E1OA 2R92J 1BW6A 3FKIJ 1GV5A 1LFBA 3WHBA 4DW6A 2NVXJ 1X2MA 4BY1J 1H8AC 3C2BA 1RKTA 3LNQA 2FQ4A 2OPTA 1DU0A 1LFUP 2XB0X 1B8IA 3ZQIA 2LP0A 3O8GA 3CMYA 2QF7A 4FE4A 2MG4A 4IHXA 2TCTA 2HOSA 2NVYJ 1DU6A 2DMUA 3S1RJ 1R9TJ 2CUEA 1FIAA 1GV2A 3SFIA 1D5YA 1HCRA 2EZIA 4XRSA 3GTOJ 3D1NI 3HGGA 2HDDA 3UKGA 5F27A 2DA6A 1JTYA 5HODA 1RESA 5FKKA 2ID6A 1CQTA 4JYKA 1ZKGA 1ZQ3P 2LTPA 2XSDC 1W0UA 4XRSG 2VI6A 3MVPA 2FD5A 4A93J 3BR2A 3HGYA 2COBA 1H88C 1JGGA 4M3DA 2MGQA 1ZTRA 2ME6A 1AU7A 1ETKA 1IUFA 1QVUA 1GVDA 3BG3A 1IRZA 1IGNA 4DYRA 2AHQA 5K7FA 1HDDC 2B63J 2L7FP 5EZHA 5IP7J 2H8RA 4M3EA 4FISA 2DMPA 2YS9A 2Y2ZA 2Y9YA 3BR3A 3FK7A 1BJZA 4B4CA 2KT0A 5EDNA 5M5WJ 1ETYA 3ZQGA 4J19A 5JLXA 3JRBA 1U8BA 4AYBN 2EZKA 1EF4A 2Y9ZA 5J3LA 3FISA 3JRIA 1NK2P 5IYBJ 2LK2A 2LLKA 2JA7J 4QIWN 1OCTC 4IHWA 2MSYA 4GFBA 4BBSJ 3JRFA 1T56A 5EGOB 1WGXA 3IV5A 2XGDA 3BR1A 1NTCA 2NVQJ 4I76A 3LSPA 1HOMA 1ZGWA 1APLC 1FEXA 3SJMA 5JLWA 1AKHB 3LOCA 2L7ZA 1VFCA 3BTLA 1A6IA 2YUSA 4XK4A 5F0HA 2RAEA 3OIOA 5M3MJ 3S1QJ 1JJ6C 2CU7A 1MBKA 3HOVJ 2M34A 1HF0A 2XPVA 4AC0A 2E19A 2DN0A 2E2JJ 3HOXJ 1ZK8A 3JRHA 2ID3A 2GBYA 1IG7A 1I6HJ 3DEWA 3Q3SA 3JRDA 5IYDJ 4A3JJ 3HOYJ 5J1UA 1I3QJ 5M3FJ 4MLOA 3A01A 2EQRA 2HXOA 2OF7A 3MKLA 5E3MA 3L1PA 3OSGA 3F0CA 1YRNB 2ELKA 1WH7A 2DA2A 3HBLA 4BKXA 5F1JA 3M4OJ 1S7EA 4QTRA 1JTXA 2HI3A 1ZR2A 3PO2J 2E2IJ 1QVTA 1FJLA 3RQIA 3NAUA 1SANA 4A3BJ 9ANTA 4LOCA 2HOAA 5EF6A 4BBRJ 3IH2A 1POGA 1JUSA 4C2MJ 3WHCA 1ENHA 3A01B 4A3EJ 3W6VA 2X6OA 3IH4A 3ZQFA 2LY9A 2R7ZJ 1JJ8C 1B72A 3GTKJ 3HOUJ 5IOYA 3ZQLA 1G2HA 1P7IA 2XGCA 1I50J 4FCYA 3TW6A 1AHDP 3GBGA 3E7LA 1HLVA 3CDLA 3BQZA 2Y0SN 4NDLA 1BW5A 5M5YJ 4A3IJ 3HDDA 1FTZA 1XG1A 5IP9J 4XIDA 1JKOC 2EBIA 1BA5A 5J1RA 4MIMA 2K40A 4JX4A 5BNGA 4CYCB 5F0FA 2PMZN 1MBEA 5EEAA 2LR8A 5EYRA 3B6AA 2CQQA 4Y52J 2ECBA 5IP6A 1K83J 3GTGJ 2O7OA 1VF9A 3TEDA 4A3DJ 2W48A 4B1RA 1K61A 1PUFA 3O8HA 5F0CA 2DA4A 2DA7A 2XPWA 2VPRA 2DTZA 1WPKA 4V2FA 3CCYA 3Q0VA 3LSRA 4FTHA 2ZB9A 4G12A 3RZDJ 3RZOJ 3TP3A 2KDZA 4A3LJ 2TRTA 3HEFA 3Q0WA 4I6ZA 1XC5A 4W97A 3HKZN 1WI3A 1GT0C 5FKLA 2R5ZB 1UG2A 3I4NJ 2WB1N 4A3FJ 3QQAA 3LSJA 2L9RA 2NS7A 2DA3A 1T33A 2QCOA 3BTCA 4L5EA 3GTPJ 5IPAA 5EGOA 3JRCA 3S2HJ 5E3OA 2CRGA 4D7MA 2WAQN 4W1UA 4A3MJ 2IEKA 2XRLA 3I4MJ 3TP0A 3G1OA 3GTLJ 2M0CA 2FX0A 2JN6A 1Y1VJ 5EZGA 1TWAJ 3A03A 4XRMA 2JA6J 5F08A 1YRNA 3CQZJ 4MFEA 1IC8A 3ZQCA 1Z0XA 3IH3A 5K7ZA 1MNMC 2IBDA 3BG5A 1X58A 2HYJA 1OCPA 3JREA 3DCFA 3B6CA 2LD5A 2R0QC 4JP0A 2X9DA 5FLVA 4JX5A 5J1YA 2FJ1A 2JWTA 4C3JJ 5C4JJ 4IHVA 3M3YJ 2NS8A 2K9SA 2VKVA 4RDUA 3TW7A 3PO3J 1HDPA 3HM5A 2CUFA 2EZLA 2L0KA 1NK3P 1U9OA 4BXXJ 3FIWA 2DA1A 1TWHJ 3A02A 1JUMA 2IAIA 3BTIA 2LKXA 1MSEC 1IV6A 2HXIA 2Y30A 1BL0A 5FLMJ 2XGEA 5E3LA 1WCMJ 2E2HJ
chains in the Genus database with same CATH superfamily
2M4KA 2PJPA 1F9NA 4ZJZA 2D1VA 2XAHA 4A3KJ 2R7SA 4RAYA 4V2GA 5LBQA 1O3SA 2XB5A 1ITYA 4MTEA 4WXCA 4GYGA 4H0EA 1XN7A 3L2WA 3M7GA 4XKWA 2JK3A 4IX7A 3HJEA 1JKPC 3CUOA 4BAYA 4HV5A 2A6EF 1J5YA 2OCCH 1KGSA 3OYBA 4A3CJ 1ORKA 3S16J 2Y48A 1B6AA 4U87A 1F43A 1LDDA 2PJRA 3WU2C 2D5VA 3HSRA 5CLSA 1XSVA 3D5SC 3IAM2 4OIQF 4AUXA 1AKHA 4X1EA 1WFXA 2KDOA 1X19A 2HFHA 2CUZA 2F2EA 2RQQA 5HLHA 1L3LA 3GFMA 1JUPA 4MO7A 2WWYA 2ZNZA 2MH9A 4ESJA 2ZXWH 2H6BA 2DODA 3GZ5A 3H3VK 3MN2A 4A0ZA 2K9NA 3HG9A 4HNUA 3HC7A 2R5YB 1GUUA 2IW5A 1LEBA 1QU3A 2VXZA 3LSGA 2B0LA 3BROA 3B73A 3T0YA 3TBIA 1PUFB 4XICA 3DPTA 2VN2A 2UV1A 1ZG3A 1MDMB 1FBQA 3K1PA 1MBJA 4UUSB 3M8EA 1RZ4A 3H0DA 3OYHA 3PM1A 1B9NA 1PJRA 2DMQA 1XGNA 4B47A 4S05A 1X2NA 3L2RA 1FIPA 2QSHX 4QSHA 1OLTA 1WVRA 3MFKA 2ZJQF 1GXQA 1MKMA 1Y0NA 3OSFA 1LE8A 3ECOA 4E6KG 1P7JA 3MQ0A 4PJMA 5A2QK 3RPUD 3BG9A 3L2QA 1MSFC 4KUMA 1W36C 5DTDA 2EFNA 4ABZA 1PP7U 1TC3C 1R1VA 4A12A 2KHMA 5KK1A 1ETOA 2IA0A 1UMQA 3HB9A 1SD4A 1JKRC 3ABTA 4IHYA 2UXXA 4G94A 4LGWA 3BR6A 2R7FA 3DLLF 2V79A 3MZ8A 5BS6A 5JHFA 1YO5C 5B3SH 1TTYA 3EETA 2W84A 4HV6A 2P5KA 4A69C 5LEJA 5FKOA 5JR3A 2R4GA 3S2DJ 1MBFA 1FOKA 4FHTA 3G1LA 4ZYHA 2OZUA 3WTWC 1VQ8I 3E1SA 2HR3A 4EATA 1VQLI 2C6YA 5C4XJ 2E5ZA 2V1UA 1P9QC 1R36A 3O3KA 3W6KB 2XGXA 4BQQA 3N05A 2F6CA 4B3AA 4XONA 5K7HA 5GP9A 2QA4I 4Q47A 1ETWA 2I10A 4HZFA 2WV1A 3KX2A 4KICA 3DTKA 5FO5A 3KETA 4MFDA 5IOZA 3KZIC 1QZYA 5BPIA 3QPLA 3ZOBA 2JJ7A 2HQ5A 4ZZLA 4D1QA 1KQ9A 1GDTA 2JSCA 3WGHA 4HNVA 4ZYGA 2V9KA 4D5CA 4EJOA 2QQAA 3OYIA 5D6FA 4ZYEA 3J7YJ 2Q0OA 2WBMA 3ZPLA 4KFCA 2NVXJ 1H8AC 3H3ZA 4Y33A 2OPTA 3SHFA 2HTSA 4CSWA 2M0MA 2KLOA 3RQ4A 1B8IA 2HNHA 3SZGA 2LP0A 3O8GA 2PN6A 2QF7A 4FE4A 3C2HA 4RGSA 5GTIC 2JUCA 3RTRA 1IAWA 2ISZA 5GTHC 1DU6A 2Y69H 1Z6RA 2B7EA 1Y56A 2VE9A 2FQ3A 1G3YA 1W5SA 1X4PA 2VASA 1WJCA 2WAQA 3A1YA 1FT9A 1HCRA 3CC4I 2JQ7A 3GTOJ 4RGXA 3VOEA 4NC8A 3ZXSA 3VYTB 3HPHA 1RESA 3BY6A 3NQOA 4JK1X 5L3DA 2ID6A 2BVLA 4HSTA 3LMMA 2LTPA 2GA2A 3E6DA 4N0BA 4E70A 4PSWA 4WXDA 1QQIA 1WRJA 3E5QA 2MGQA 3WU1B 3QU6A 3ZP5A 1ETKA 4U7DA 2JPBA 2Z99A 3TL4X 3COAC 4LLGF 2KRCA 1R4NB 1XGMA 4DYRA 1WZ2A 2E71A 5K7FA 2KIMA 3QRFF 2B63J 2ETHA 5J8CA 1SMTA 3I59B 1W4MA 1FOWA 1S9HA 1YYVA 4LB6B 2R7QA 3D5LA 2Y9YA 2JPCA 4GO1A 2K85A 4LIVA 3GFLA 4GGGA 1UCRA 3GF2A 3GMEA 5M5WJ 1ETYA 4YIRX 4X0GA 3JRBA 3K70C 4YRVA 1XGOA 3FDYA 4XORA 3FISA 4UVAA 4B48A 5IYBJ 3C2GA 2LK2A 1ERDA 1OCTC 4IHWA 1Z6TA 5EEGA 4KMUX 3ZN1A 5HDGA 3JRFA 1RIOH 3NEUA 1WGXA 3IV5A 4CCMA 5HNFA 4CCJA 3RIRA 3DEEA 4I76A 3J80Z 1EA3A 2YX7A 2JT1A 3MCZA 1WQ2A 4LG0B 4EJUA 1MDMA 3AG3H 1ZREA 2COMA 3BZKA 3M1CA 4BJ5C 1U5TB 2DDAA 5F0HA 5M3MJ 1ZLKA 2DBBA 2V7FA 2CU7A 4S04A 5JFRA 1VTNC 3CDHA 4P9FA 1ZGAA 1SFKA 5E8GA 3GUDA 3LSKA 2J5PA 1R00A 1X1PA 2LH9A 5AIQA 5KVRA 3TO9A 5K5RA 5B66C 3HOXJ 2MYSA 2GIVA 3PSIA 1IG7A 3JRDA 2K27A 4M74A 1I3QJ 3A01A 1KU9A 1XMXA 4EM2A 5E3MA 4HA8A 4BJTA 5EJCA 4OMZA 1TW2A 1QBJA 2E7WA 1WH7A 2YU3A 5E1XA 1EH8A 3M4OJ 1JTXA 3WG9A 2P6TA 4ETSA 4ENJA 4XOPA 1FJLA 1B1BA 2D2WA 2K4BA 3E6MA 3MEXA 1DPRA 2K3PA 3NAUA 1D1BA 4CCNA 3AAFA 3E5UA 3CP8A 4BBRJ 1LKXA 2A5WA 4NQWB 4A3EJ 3W6VA 1ENHA 3S8PA 1WSUA 3BPXA 3IHUA 2NVUB 3T1BA 2X6OA 3IH4A 3ZGKA 4AIKA 1ZHFA 2KIQA 2ICWG 2LY9A 4R8HA 3ZQFA 5DM6F 2GA1A 3ULQB 3HOUJ 1TQIA 4CYDA 2EV5A 1WJEA 3KP2A 3PFYA 3CC2I 2OBPA 1A35A 2IJLA 3EQLF 3GWZA 3KCCA 4GYIA 4UVBA 4EJWA 5ICCA 4Y17A 3TKYA 1F1ZA 1BI0A 5D5WB 5GADJ 1BW5A 5ED4A 1ZGJA 2DCEA 5E79C 2FNAA 4MTDA 1XG1A 2DFHA 2PEXA 4N4NB 5IP9J 2HOEA 3KIOA 3LWFA 4NB5A 1IXCA 2YR2A 3X2QH 4BYYA 4CA0A 4RB2C 1WJAA 3JAMZ 4MIMA 1XSXA 2L9NA 2DYRH 2CGPA 5BNGA 5FLXK 4IRGA 1V5EA 3V42A 2H27A 4ZTFA 2X1DA 2CQQA 4HLYA 4Y52J 2JVGA 2DT6A 5IP6A 2BZTA 3GTGJ 4GCVA 1VF9A 4DBQA 3TEDA 2W48A 4B1RA 3RYPA 1K61A 1PUFA 2DTRA 3LAPA 3S2WA 4BHBA 2DA7A 2J5OA 2QSGX 1OYYA 2F4OB 2DTZA 1U2WA 4V2FA 4G6TB 3IL2A 3LSRA 4FTHA 4IHTA 1J75A 3PFIA 4I09A 3FHZA 3OL3A 3TP3A 3RZOJ 3I53A 3HL2A 4M9XA 1D1AA 1E0EA 3DP7A 3QYBA 3I59A 2A07F 4XKVA 1W36D 3EPZA 4EM0B 4A3FJ 2V1XA 2A68F 5E1ZB 4HQEA 3S3MA 1H9TA 2L9RA 1W7PA 4B43A 2DA3A 3I58A 1T33A 4XR6A 3E6CC 2QCOA 3BTCA 3QP6A 1IRFA 2QGUA 3GTPJ 4IRIA 1W5CC 3VYRB 2E7XA 5E3OA 2HQRA 3BLYA 1YTYA 4IKFA 2WAQN 3RKXA 4UB8C 1LB2A 3DBRB 3LA7A 2ZC2A 3TP0A 3G1OA 4RB1A 3GTLJ 2DW4A 3C7JA 2LYCA 4OAZA 5EZGA 5HDNA 2F5FA 2JA6J 1MGTA 3L7WA 1YRNA 4XLHA 1S3JA 4YG2F 3OY9A 2JZYA 3IH3A 1KYWA 2VQHA 3IC7A 1XTAA 5KCMA 2O5RA 3H9QA 3HUGB 2E36A 2VC0A 5IT3A 3LSHA 1IZ1A 2L54A 4LIUA 2VXDA 4AIDA 4AU7A 3HKZA 4OIOF 5J1YA 5DCFA 5K5OA 3SFZA 4CH7A 2ESHA 5C4JJ 5E20A 3MKYB 4L5IA 3M3YJ 3CJNA 4RDUA 4KISA 1HQCA 1ON1A 1G4DA 3GLLA 1WI9A 2L0KA 1NK3P 2XUBA 1T08B 5DYMA 2QKLB 4HLXA 2FNPA 1Q1HA 1ZN2A 5DD8A 1OQYA 4L9VA 4RB3C 3OYEA 3K10A 3FXQA 1TWHJ 4I0BA 3BTIA 4XLFA 1FMVA 2DYSH 2X0LA 1L0OC 4YFXF 5BPDA 2DQLA 1IRXA 3CMAI 1FNNA 3GO5A 1A36A 2HXIA 2Y30A 5FLMJ 3F8BA 3D0SA 2E2HJ 4HF2A 3WTZA 2QM3A 2RNJA 2EZHA 2DLLA 4XKBA 4MGRA 3DLAA 3CMMA 4U7BA 4HDUA 5C3EJ 1R4MB 3S32A 1P4XA 1E3HA 1TP4A 3S17J 2ZBKA 4WWCA 1MH4A 1KONA 3DF8A 1I39A 2RVCA 3BT9A 4BNCA 2M4GA 3S14J 4HX8A 4CZZA 1R1UA 2FOKA 3BQYA 3EUHC 4CUGA 2HPIA 3WTVC 2F5EA 1HA8A 5JI6A 1E3OC 2X1CA 4XM3A 4DOZA 3NARA 1XS9A 2O9LA 1GLNA 2EJRA 3VYUB 2A61A 1I27A 3VPRA 1MIJA 2M30A 3NRVA 3PNYA 4Y7NJ 2FSWA 2LVSA 2BGCA 3QP5A 2HU9A 1AWCA 2CJJA 3DTIA 1LDJA 3RKYA 4AIHA 1OJLA 1Y1WJ 3WG7H 4KA4A 1U78A 4ASNA 2EILH 3QYEA 2GM4A 3GZNB 4M72A 2CH0A 4R1HA 1TQMA 2LRDA 3CO7C 3RSNA 3E5XA 2Y31A 1SFUA 3Q0UA 3AG4H 3NWTA 3ASNH 3OS1A 4EJTA 2G7HA 3T8RA 4QPQA 2DMTA 2HWVA 1TLHB 4RBOA 1X3ZB 2X48A 4BH9A 4F3QA 1TWCJ 4MQ9F 4G6QA 3JTHA 2DXIA 3R0AA 1WWXA 1SD7A 4RAFA 1FBSA 1ZELA 3FK6A 2W7NA 3CCUI 2LREA 1TWGJ 1A5JA 3PSFA 1YLFA 3RDIA 2PI0A 5DS9A 1F36A 3OR2C 1MJBA 1U6GA 3E3VA 4RLQA 2DFEA 2R5YA 3K4KA 4IOCF 2K86A 1YQAA 3P9KA 3K0LA 1MBHA 1H89C 2XASA 3QYFA 4B3XA 1TWFJ 3JR9A 4UV9A 3K2AA 2EINH 2QYOA 2CQXA 1ETXA 4FETA 3CO6C 1REPC 3FM5A 2IA1A 1DP7P 2HOTA 4IRHA 4C3IJ 2VOOA 1U5TA 4CGZA 3ZR8X 1ZLJA 3H9GA 4BY7J 3GLXA 3CUQB 3IUOA 3FXKA 2P7VB 4MQVA 1U8RA 1VQ5I 2XAFA 1TQPA 1BR1A 1T39A 4E7JA 3C3WA 5JVGF 1FWZA 2P4WA 2DPDA 2HVQA 2ZKZA 3J80K 1N25A 2A05A 3OYCA 3O6BB 4QPOA 4MEXF 1ETVA 3VDXA 2VKEA 2OJED 2VKDA 3BJOA 4BXFA 1QRYA 4N9HA 3K4LA 1TNTA 2XVCA 4DJAA 4ZTJA 1PDNC 3ROUA 4UY8I 1IJWC 4DYCA 3J7AO 1RPWA 3JSPA 1I1SA 4G6DA 3CESA 2YU9J 4RM2A 1UZCA 3ZCOA 4LLNA 3H92A 2ZXHA 1UHSA 3SZPA 2VQLA 4FQGA 2VT3A 4XLCA 3DPLC 3FXRA 1BW6A 1PVEA 2AQEA 1V3FA 3FKIJ 3H3UA 1GV5A 4AIJA 2IT0A 1LFBA 4RAGA 2GXGA 4DW6A 5J40A 2P5LC 2LKPA 3C2BA 1Z21A 1BOAA 3LNQA 2O03A 4FASD 1DU0A 3HZJA 2XB0X 4YIIA 4E7LA 1X1DA 2WV0A 4KT6A 1BI2A 4G7OF 1JGSA 4PJNA 4XSXF 5JVTA 5HNHA 2CYYA 5DCMA 1BBYA 2TCTA 3KFWX 2A6HF 2HOSA 1BIBA 3BDDA 3N97A 1R9TJ 1A6QA 1DGRM 2CW8A 2IGNA 3A4CA 1D5YA 3K2ZA 2EZIA 2IA2A 4LJZF 4XRSA 1PYVA 2A69F 2X6WA 3HGGA 4C9YA 2HDDA 3QOPA 5F27A 2W25A 5HODA 4A0XA 2KJBA 4A6EA 1CF7A 1T2KA 5DDGA 1ZKGA 4GRIA 1BN5A 2XSDC 1ZQ3P 1BC7C 3MVPA 4A93J 4M3DA 1DDNA 3HSEA 1AU7A 4OOIA 3PUFA 1GVDA 1ZAOA 5DV5A 3BG3A 3U21A 5D5XB 1VQMI 1IRZA 3H5NA 2XAJA 2EA4A 3IKTA 1W1WE 2M45A 2ZJ2A 4OU0A 5EZHA 1YFHA 3EUHA 2BYVE 1MZBA 3PUBA 1Z3YA 2DQRA 5LD2C 1IF1A 2X51A 2IGMA 2DOFA 3CCSI 3HYIA 3FK7A 3W3CA 1H0MA 2PMHA 1U8BA 5D5UB 2EZKA 1EF4A 5HLTA 5J3LA 2GXAA 3JRIA 1OCRH 2FUG2 2LLKA 2X4HA 2JA7J 4QIWN 3F21A 3OV8A 4RS8A 4KJZA 4EQQA 5LHGA 3FMQA 4PSXA 2RREA 3BR1A 2STTA 4NC7A 2DK8A 1O3RA 2NVQJ 3VFZA 2O3FA 2PQ8A 1APLC 3SJMA 1AKHB 5IY5H 2M3AA 2H94A 2LY2A 4BS9A 1VFCA 2PJRB 3CUQA 5KNLA 1YJ9I 1RNLA 3PQJA 1R5HA 3QPTA 4BU2A 1YJWI 1A6IA 2O8XA 1MD0A 3OIOA 1JJ6C 4XLAA 1MBKA 3HOVJ 4EVIA 1LEAA 2ESNA 5J4VA 5DUKA 2D45A 1K4SA 1HF0A 3ERMA 2ZMEC 2ACJA 1Y8RB 4ZH4F 2FE3A 1TT5B 4I02A 5ICGA 1YE9A 2EK5A 3I4PA 1ZK8A 4HDVA 2ID3A 3ZMUA 4XLNF 1I6HJ 3DEWA 3Q3SA 3KPHA 1W7PD 2GOMA 1IN6A 4HRIA 5J1UA 3BP8A 4IQ4A 2L4MA 1STZA 2QQ9A 2OF7A 3L1PA 1YRNB 3LSMA 2KKOA 3DKXA 4NUBA 3ONQA 1VZ0A 2X6YA 4HG2A 4BHPA 5H2FC 1VQ7I 4YELA 2QWWA 2A5YB 2HI3A 1ZR2A 3CCQI 1F5TA 2ZMEB 2HZDA 2PX9A 1JI8A 3RQIA 2BY1A 4P1WA 3EUKL 3WTTC 3BOQA 3RPUA 1SANA 4A3BJ 3TQNA 5EF6A 2LF7A 4G7ZF 3IH2A 3M8JA 3HOTA 3ZMSA 4E7IA 2W85A 3VEPA 3H1CA 1S8NA 2R7ZJ 1JJ8C 3BPVA 1OCCH 3L9FA 1RRJA 1B72A 3GTKJ 3LQRA 3ZQLA 1OISA 2XGCA 3KP4A 1AHDP 3GBGA 4P96A 3KE2A 3W2WA 3CJTB 3DFGA 2KJCA 3CF5F 2CV2A 5IT9Z 4A3IJ 5KHDA 2BY3A 2DOEA 1SEUA 1Y0UA 2XF5A 1R5ID 2WB1A 3V8LA 4PJJA 4IOAF 3H5AA 3QODA 4EGYA 4Y3OA 1HKSA 1JKOC 4RA2A 5FD6A 1FZPB 4AYBA 2V26A 3MZHA 2K40A 4JX4A 1FOYA 2K5CA 3EYIA 2W00A 2EIMH 1X4OA 2R7TA 2LR8A 5EYRA 3HRSA 2DFFA 2F4MB 3J7AY 2ECBA 3LFKA 5CKTA 3AG2H 4ZDOA 2Z3YA 3G2BA 2NNNA 3V8KA 5LHIA 3BG7A 3SDBA 3R61A 1F4KA 1YIOA 1PUEE 5E8IA 3KP7A 5H6QA 3M1EA 1HSTA 2DA4A 1UHWA 4BJ6C 2G9WA 1SC7A 3F8MA 2VPRA 3CLOA 4YFNF 4BDYA 1LJ9A 1MJ9A 1WPKA 3IWZA 4DGWB 1MMNA 3CCYA 3GCMA 1RR8C 1K78A 4G12A 1E2XA 2RV8A 5LGNA 2TRTA 3HEFA 3Q0WA 1XC5A 4W97A 1CF7B 2W82A 1YS7A 1WI3A 4BE0A 2UWMA 1KU7A 1UG0A 1XB4A 3IAS2 1HW2A 1UG2A 1USTA 2WB1N 2LF8A 3CZ6A 4E7SA 3J81K 2KIFA 2VT2A 4C2UA 1FBUA 3DBLB 2CFOA 3K1NA 3FXMA 5H6RA 2LOOA 3JRCA 2CRGA 4O3MA 1T38A 5ILSA 4W1UA 4RMNA 1LFPA 2DDBA 3IKVA 2IEKA 1S6LA 4CICA 3MWMA 4E7KA 4I7HA 4BQNA 1YOVB 3ZQ7A 2FX0A 2BHYA 2RDPA 3DWLE 3WE3A 3RKWA 1BI3A 4XRMA 1YS6A 5A2QZ 3CQZJ 1WHUA 1IC8A 1OCOH 4JOMA 4N9IA 1EKEA 3BG5A 4P5OA 2V6EA 4P9UA 3R0JA 5ICEA 3JREA 2FU4A 4LG3A 3O2PE 4IL6C 1QO0D 2RNGA 4NBQA 1H9GA 2BE5F 4JP0A 4L18B 1FYLA 1Z91A 2BXZA 2G7UA 4JX5A 1IXRC 1G3TA 1SFEA 2ZXJA 4IF4A 2FJ1A 2JWTA 4C3JJ 2EIJH 2O61A 2UXNA 2OC6A 5FB2A 1D1CA 2NS8A 2K9SA 3TW7A 3JCUC 1HDPA 2CUFA 2EZLA 3P5JA 2BHZA 1KQ8A 3D5RC 1U9OA 4BXXJ 2KRHA 2JRMA 1W5TA 1D8JA 4AM3A 2LC2A 3C1DA 3A02A 1JUMA 3UNGC 1FSHA 4ITVA 5ILVA 1BC8C 2OTLI 2XF7A 2FMYA 1D0ZA 2EFPA 3IWFA 3OYJA 4LK0F 2DMNA 5BOXA 5CVRA 5E3LA 1VQ9I 3VB2A 3CUQC 3S1NJ 2RC4A 3IRRA 3HOZJ 3JW4A 3I54A 1R71A 1TW3A 4UV8A 1MBGA 1TL8A 3TGNA 3K70D 3LA2A 3S3NA 2LMDA 4V19K 2KMUA 3RKQA 3LFUA 2G0EA 1JT6A 2XKOA 3BR5A 3BTJA 3KYLA 1W0TA 4XL9A 4LLLA 1S5LC 3I9V2 3W2VA 4PJLA 3CCRI 1U3EM 1V5FA 1RI7A 1WJFA 1QZZA 1R7JA 2CWEA 3WTYC 2LKSA 2GXBA 4CCLA 5EG0A 5GPAA 2H1KA 2ECCA 3DEUA 5K1YA 1O7LA 2IRFG 2WY7Q 4HQMA 3U2RA 2CSOA 3OS0A 1X1CA 2M87A 2MH2A 3PQKA 2BW3B 1XSDA 1JKQC 1A31A 3BJ6A 1FTTA 3L2CA 2FBIA 4C3HJ 1U9NA 1B72B 4Z2YA 2IXSA 5TRDA 1T0FC 3V7RA 4MHGA 1IDZA 2DT5A 2PLYA 2EH3A 4KITB 1O7FA 3K4NA 2VUMJ 3GTMJ 1VQKI 4XN0A 2CQ7A 1ZARA 1IV8A 3LSIA 4E7HA 4X6AJ 3GZ6A 1R6RA 1K6OA 4PDKA 5JHUA 3CCLI 3HTSB 5FKNA 1YW8A 5EG0B 5B5EC 3FBIB 1XD7A 3EUAA 2P5VA 2I8DA 2HGCA 1RR7A 2E1MC 2W24A 3BR0A 4A3GJ 2R5ZA 2KL4A 3ZQHA 1S72I 2OTJI 1T95A 2WADA 3H0GJ 3PL8A 1LNWA 3I0TA 3KP6A 2DJIA 5DD4A 2JSPA 1IW7F 1SVLA 2LBFA 3E6BA 2XHKA 1SFOJ 4EGZA 3LL7A 5CQEA 1I6XA 2N8GA 1ETQA 3F9KA 1WJDA 2P81A 2WAFA 3RCOA 3PNVA 4IZZA 2K02A 2LFBA 2VJIA 3S15J 1EH7A 3HRMA 3ISPA 3OYAA 2VONA 2DAOA 3CC7I 2JA5J 3ERED 1O4XA 2VIXA 4N4OB 2JA8J 1JHFA 2NOGA 1R22A 2DJNA 3GX4X 4HF0A 3W6JB 2WAEA 2ZXIA 1OFCX 4M3GA 3MKZA 4UUTA 2XPUA 3RI4A 3ZRGA 1P6RA 3EDPA 5F04A 3WODF 3OMYA 4JX6A 1FP1D 1Q1VA 1R23A 3HXLA 3I5UA 1MMSA 2XDVA 3DU5A 3F72A 2IS2A 4LFUA 4DZJA 2L7MP 1B9MA 1J09A 4PFPA 1IDYA 2QUFA 1XDUA 3BCAA 3OWTA 2BV6A 3OR1C 3P9IA 2XKPA 3WHBA 2Q1ZB 1X2MA 3REOA 1S7AA 3K4BA 3E0JB 4U0YA 2EV6A 1LFUP 2P0WA 2MLGA 3ZQIA 1HKQA 2IVMA 3L00A 4L0YB 4BEHA 3OYDA 2K7LA 4U0VA 1AOYA 2QLZA 4BXUA 2QVOA 5GAEJ 2Q2EB 3OYNA 2VL8A 4UVCA 2CUEA 4M6XA 3SFIA 2XAQA 4XBFA 2KPMA 4C30A 1T98A 1FMWA 1Y6IA 2HKOA 5CPRB 3D1NI 2FBKA 2A3SA 3UKGA 1EV7A 1MNEA 3HRTA 2BY0A 2DK5A 1J9IA 5FKKA 4JYKA 4RGUA 2QSFX 3K4JA 1I3AA 1W0UA 3ABKH 4XRSG 4J01A 1C0WA 3WTUC 4KT5C 1P2FA 3DBHB 2FD5A 3DQVC 2F4IA 5HS9A 3HGYA 4UB6C 5FRNA 2HVSA 2NNYA 1VQ4I 1YX3A 2ME6A 4A5NA 1IUFA 5CYVA 2ELJA 4ENNA 2VC1A 3FF5A 4M6YA 4AD9A 1IGNA 4UXNA 1X3UA 1XCVA 1X1AA 2AHQA 1LDKB 5ILUA 1Z3XA 2UUZA 4HW0A 3RJPA 3QWLA 2L7FP 5BMZA 5IP7J 2Z2SB 4BE2A 2H8RA 2OQGA 2XSJC 4KN4X 3TO7A 2CMPA 2QBYB 1BOBA 4DBRA 4FISA 4II3A 4A2UA 2HYFA 4PGHA 1YI2I 2ZSIB 3FXLA 2DMPA 2YS9A 2Y2ZA 1FP2A 3T5XA 1G8XA 4XRFA 1BJZA 2CW7A 2VB6A 5DM7F 4BE1A 5EDNA 4J19A 3ZQGA 4YFKF 2MC4A 2Z33A 2M7BA 2DU9A 1HW5A 1LUJB 1NK2P 2BOLA 4II2A 3HPGA 2MSYA 2WY8Q 2X1EA 1TBXA 2H09A 4GFBA 4BBSJ 5EGOB 2E60A 2XV4S 1XPXA 1IO2A 2KISA 2XGDA 4YIFA 1NTCA 2P6SA 1BJAA 4F52A 4BACA 4WX9A 2JA2A 5AIPA 1IXSB 1P92A 1SVMA 2BEOA 2Y0SA 4RM3A 3LSPA 1ZRDA 2GOXB 2AS5F 1HOMA 5JLWA 1V4RA 1UB9A 2L2OA 4LD5A 2EFQA 4EMSA 1HW1A 5LEKA 2GIZA 2IGKA 3LOCA 2IGOA 4F91B 2XIGA 3BTLA 2UZKA 4J00A 1UHMA 5J6XA 3I55I 4PK4A 5LFAA 3TOBA 1USSA 1EH6A 1XMAA 4HYEA 3S3OA 2XPVA 3SEZA 4AC0A 2F48A 2DN0A 4ON0A 4BHCA 2E2JJ 3JAMK 3AL0C 2GBYA 2DT7B 5B1AH 2VLAA 3CDIA 4HAMA 3VODA 1ZH5A 2OQRA 2VBYA 2QZ8A 3OSGA 4ZDLA 2FF4A 2E5NA 1ACIA 1KQ0A 2ELKA 3GEZA 1KA8A 3ABMH 5F1JA 4QTRA 1IN5A 2X6XA 3MKWB 5LGUA 2E2IJ 2Q2EA 1QVTA 1E17A 1SVOA 1IRGA 3GW2A 3I71A 2E1NA 2CQKA 3PIOF 2V1NA 4GXOA 1RUOA 9ANTA 2F5CA 1TNSA 4IJAA 1JUSA 4C2MJ 4B8XA 1FOXA 3DPUA 5CQGA 1YIJI 3QPHA 1OR7C 1OPCA 5IOYA 2HPMA 2L02A 1XX5A 4NHJA 1P7IA 5CVJA 2X85A 3DV8A 3TW6A 4CXFA 2HKXA 1K78B 3E7LA 1JE8A 3CDLA 3CLQA 3BQZA 1D8KA 2CS3A 2Y0SN 4NDLA 2XRNA 3UR3C 5M5YJ 1DUXC 3HDDA 1FTZA 4MEYF 5D8KB 4A0YA 4KIBA 3BCBA 1OCZH 4BL0B 5F1RA 2IPQX 1LVKA 2CG4A 2E1MB 2R7VA 1P4AA 3G3ZA 1Z67A 4HSRA 4BDZA 3V7CA 4BQAA 5F0FA 2PMZN 2XC7A 2HYGD 1ODDA 1MBEA 3KP5A 3FX3A 5EEAA 5CVVA 3B6AA 1V55H 1A04A 2L7KA 2OV7A 3VWBA 5FFXA 4BUPA 2O7OA 2LY1A 4WF2A 4ZC3A 1DP3A 2FXAA 4A3DJ 3M8FA 2LG4A 3O8HA 5F0CA 3P7NA 3SQNA 1S29A 4R79A 4ZZDA 4U0WA 2PMZA 4PZJA 3TDZC 1SMYF 1QZEA 3ABLH 3WGGA 3RZDJ 2BBYA 1GVJA 2KP6A 3KYCB 3HKZN 5FKLA 1N77A 2R5ZB 4IPAA 3QQAA 2V6CA 4WXHA 4CDGA 3RYRA 4BEHB 4I01A 1YITI 1YG2A 2D1HA 3KEYA 3U1DA 3SZTA 2F5VA 5HOOA 1MW7A 5IPAA 1WJBA 5EGOA 3S2HJ 3KZZA 3JSOA 3H35A 2EPFA 4L9JA 4D7MA 3ML6A 3HOSA 4A3MJ 2QQ8A 2V1DA 4ENMA 2NS0A 3CTAA 3ASOH 2JUGA 5HLIA 1B4AA 1VQPI 3A03A 1FX7A 4F93B 3WTXC 4OIRF 4MFEA 4Q48A 1OMIA 3ZQCA 3WE2A 5LGTA 1Z0XA 5K7ZA 3CCEI 2KIUA 2DI3A 1X58A 1R1TA 3ABUA 2VJJA 2MA3A 1QHGA 4HF1A 1NG7A 3DCFA 3B6CA 5FRMA 2LD5A 3K6GA 4OMYA 1D0YA 4KIGA 5F64A 5ICFA 4UHTA 1BI1A 2R7XA 3KLNA 2IS6A 2MD0A 1EJ9A 2VKVA 4Y15A 4QLCU 3PIPF 3F6VA 5BQTA 1R58A 5D5VB 5IT9K 4I99C 1QNTA 3MZYA 3Q9VA 4IO9F 2NXNB 4I0AA 2WA0A 4LB5A 2DA1A 2STWA 4L9TA 3G4SI 4D9JA 2JTVA 2IAIA 3FBNB 1B59A 2LKXA 2VQCA 5L3GA 4IVNA 2EFWA 4AVPA 3HHHA 3CCMI 1BL0A 3F23A 2XGEA 2Z16A 4RAZA 3OYGA 3IP4B 1T0FA 2R7RA 5C44J 4TV7A 2HQAA 1MMAA 1ZYRF 2VODA 2K4JA 2ME0A 3G6EI 3U9GA 3L2UA 2PBIA 2PMUA 2NVTJ 2ZNYA 4F92B 2L9SA 5AONA 4UNOA 2JMWA 1V5GA 5L3EA 1X3WB 3R60A 5E3NA 2BY2A 5D4RA 3HOWJ 2FRHA 4RLFA 1QPIA 2GAUA 4I2OA 5FJ8J 3DXJF 2M5WA 2QQBA 2OAZA 4D7NA 2DO7A 2FBHA 4CZCA 2Y0MA 4EJVA 3OYLA 1ZR4A 4WK8F 2YPRA 2M9HA 1OR7A 2GLOA 3JRGA 2QEXI 1KU2A 3OL4A 4L0ZB 3CCJI 4YEJA 1B8IB 1VNDA 3JRAA 1J7KA 2XAGA 4KYWA 4MNUA 4ZYAA 3KYDB 1R5GA 4M6VA 2RGVA 3BZCA 2FEZA 2LNBA 4DZPA 2NAZA 4KIFA 4S0HB 4B09A 5M5XJ 1MMGA 2BXYA 4RB0A 3HUGA 4ESBA 5LLQA 2O8KA 3DTEA 1MNDA 3S93A 4FE7A 4CHUA 2K3FA 1R49A 4FT8A 5L3FA 3EYYA 3AKZA 5DEQA 5ERIA 5E1WA 4C2TA 3MD2A 4ESFA 4IEJA 2DPUA 3V7SA 2QBYA 5GPCA 1MJAA 5FKMA 1D3YA 1I1GA 4EEFG 3T8TA 4M3BA 2B9SA 3Q9SA 3KEQA 4M3FA 2I5UA 3KLOA 2HDWA 4KN7X 1RKWA 1VI0A 3SDGA 2M8GX 2MC3A 3GTJJ 3R6SA 5L3BA 3ESWB 3P9CA 3K7AJ 2CFXA 4KDPA 3BC8A 4UUSA 2LBFB 2XF6A 3LQQA 4LK1F 1Z77A 5GAHJ 4IHSA 2K9LA 1V54H 4OWRB 3QPSA 5HS7A 1UELB 1D5VA 1RETA 1YW9A 1MH3A 2GWRA 1P4WA 3S1MJ 1SFXA 2NOJB 1LE8B 2LSOA 5LHHA 5H20A 5FFZA 2MW8A 2R7DA 2Z9OA 2M2EA 2LDUA 3GFJA 2DA5A 3WTSC 2K9QA 2VBXA 2EA2A 3FM3A 2VKHA 3GVAA 2CV0A 2KFDA 2MLKA 2GQQA 4G7HF 3PNTA 4L5JA 2R7WA 2AO9A 1K7AA 1DGWY 3BZ6A 2PFBA 1UAAA 1D0XA 2EB7A 2R93J 4D5FA 3GTQJ 3AFHA 1TZLA 3HTUA 4CYCA 1JT0A 2L01A 3OOUA 2XAUA 3MAJA 4DIQA 2NRAC 2EIKH 2CV1A 2YX4A 4QWQA 1T6SA 4M9ZA 1ZG1A 5J47A 4OINF 4DYQA 3W2AA 4M71A 3G1MA 3A0HC 4IXAA 4A5MA 2ZFUA 1WH5A 3ZN0A 2NYXA 1S7OA 2EFOA 2VBZA 4AWXB 4XLPF 3LSTA 3ZQQA 5IYCJ 2DFIA 3U1KA 2E1OA 2R92J 2FMLA 4IQJA 1TT0A 1WKMA 2MABA 4KNYA 2AXLA 4AVZA 2OD5A 2V9VA 4O6JA 5D4SA 1UFMA 5J4YA 1YW7A 4BY1J 1RKTA 3CF2A 2FQ4A 3K1MA 3K4CA 2P7CB 3K9TA 4NC6A 3Q5FA 2JVHA 1IN8A 3WGIA 3ELKA 4EM1A 3CMYA 1OYWA 2MG4A 2EV0A 2VOPA 2HDCA 2Z1DA 3M9AA 3NWSA 2L5QA 4IHXA 3HRUA 2NVYJ 2HQNA 2ZMEA 2DMUA 1BR2A 3CJRB 3S1RJ 2Y75A 1O3TA 2IS4A 1RC9A 1FIAA 1GV2A 2CW0F 3M07A 4HX7A 3V8JA 4RGRA 3DU6A 2L3DA 2DA6A 1JTYA 3TO6A 4PJ0C 2E34A 4DQ2A 3CMEI 4OIPF 3GYHX 2OUMA 1CQTA 3LAJA 3G73A 1SD6A 2BVMA 3KZYA 2VI6A 2XROA 5D6EA 4XQFA 3OOPA 3I3LA 1IUYA 3OYMA 3BR2A 1Y39A 2COBA 1H88C 1QPMA 5KAIC 1JGGA 4I98B 3F6OA 2OCEA 1ZTRA 3HIFA 3R4KA 2EWNA 2VQGA 5CVIA 4BGDA 1YHQI 1QVUA 4FX4A 1WJ5A 3ECHA 4ZYDA 2WC2A 1I5ZA 2QKMB 4F55A 2KQRA 1Z7LA 1HDDC 2HVRA 4U88A 2AQFA 1K4TA 3G71I 1N75A 1YX5A 2MFZA 2H1LA 1NG6A 5LRRA 4B44A 4D0PA 4M3EA 4HOBA 3FHNA 3ZMDA 1FYKA 2HEOA 1LPQA 3BR3A 5GAGJ 4H4KC 4OAYA 4B4CA 1W7PB 4K2EA 4XLEA 3QOEA 2L9VA 4G8XA 2KT0A 3BWGA 4Z6YA 5FGMA 3J7ZI 3FWEA 5JLXA 4AYBN 3V4GA 2ZFWA 3K4MA 3ZMZA 1SAXA 2Y9ZA 2V4JC 1VQNI 2MD5A 3OIQA 5TGTA 4Y4RA 5TJJA 1VQ6I 3L2VA 1PP8F 4UUVA 3AG1H 1OYIA 1BR4A 1T56A 1DPUA 2ZJPF 3F8CA 1ZGWA 1FEXA 3VSLA 1J0RA 1G6NA 3ZMVA 2V9PA 5DCMB 2AXTC 2HTJA 2L7ZA 1E3PA 1Z9CA 4LITA 1QGPA 3WU0A 3FXUA 4XN3A 3SEQA 1T8IA 2YUSA 4G9YA 3A2KA 2IS1A 3TMOA 3RPQA 4XK4A 2RAEA 3S1QJ 3LA3A 2YSRA 4XSZF 4NNJA 1ZRFA 2M34A 2E19A 2VPLA 2ZJRF 3CJQB 2ADUA 3VYSB 2L4AA 1JHHA 3K69A 2CQNA 3C18A 1QHHD 1BIAA 4CO8A 3QU3A 2TDXA 3JRHA 3E97A 1ZG5A 2HS5A 1FC3A 5IYDJ 1HSJA 4Y13A 3H36A 3H9JA 4A3JJ 3HOYJ 2VBWA 2F5DA 3BJAA 2VJ5A 3F3XA 2E1CA 5M3FJ 4MLOA 1LQ1A 3B02A 3FKJA 2EQRA 2A6TA 2HXOA 3MKLA 4JQFA 3F0CA 2QENA 4Q4ZF 3HHGA 2DOAA 3N4MA 1HC8A 2DA2A 2P8TA 3HBLA 4JBAA 4BKXA 5J8FA 1G59A 1S7EA 2KZVA 4KMFA 1JXSA 1O57A 3SXYA 2W4SA 3PO2J 1K79A 2M7AA 2E35A 5KAFC 5B1BH 1Y8QB 4LOCA 2HOAA 1M1EB 2W57A 1POGA 3F8NA 3FXOA 1XMKA 3A01B 3WHCA 1FYMA 1QA6A 5FROA 5E18F 4E7ZA 1IN4A 3SYTA 5DUIA 1G2HA 1I50J 4FCYA 1XGSA 1FPQA 2ZSHB 2GZWA 2H8WA 1HLVA 4O5VA 3VSKA 1J2XA 2VJ4A 3AL0B 1FLIA 3F8FA 3FXJA 3FZVA 4CCOA 4F7ZA 2RKHA 1IN7A 1HKTA 2M1BA 1KU3A 4XIDA 2EBIA 4PCQA 1U0JA 1BA5A 2KRFA 2OA4A 5J1RA 1NHAA 3F22A 2M8EA 2RQPA 2FOWA 4CYCB 1GHCA 5L3CA 3OS2A 3DKYA 1O3QA 5E17F 4PFOA 4BQOA 1SAUA 2H6CA 2O6GE 2FA5A 4ZDPA 1XCBA 4CCKA 1K83J 1NH3A 3L09A 4EV0A 3KP3A 5LRSA 1LVAA 2W1OA 4XOTA 1Z7UA 5CVUA 4ENKA 1N78A 3I64A 2XPWA 3TOAA 5EEHA 1ONVA 3HSFA 1DQUA 3Q0VA 2ELHA 2ZB9A 1Z1DA 5HLGA 4A3LJ 2KDZA 2WTEA 1BM9A 4M73A 4I6ZA 4A6DA 1AA7A 4E4HA 2CUJA 1X1BA 5HDKA 1OKRA 2ISYA 2ZO4A 4LG0A 3CD6I 1GT0C 4GDFA 2KZGA 3I4NJ 4HBLA 2RN7A 5HS8A 3LSJA 5FD5A 5D8LB 1G3WA 2NS7A 2IP2A 4FX0A 5CJ9A 1ZRCA 3OIPA 3CP2A 2OU2A 3PJRA 6PAXA 4HEA2 4HX4A 4L5EA 4DNCA 3GXOA 2O0YA 1SD5A 2ZCWA 2R7OA 3ZMTA 3OYKA 4L9NA 2R3SA 3IRQA 1FY7A 2XRLA 3I4MJ 3A0BC 4LMYA 1ON2A 4P55A 1U5TC 2M0CA 2JN6A 1Y1VJ 5K5QA 1TWAJ 2VE8A 3GFIA 4M9SA 5F08A 5FLXZ 2BW3A 1KZHA 4WCGA 1MNMC 2IBDA 3KEOA 5F6FA 3CCVI 1FSEA 1OCPA 2HYJA 3OYFA 1XDSA 2R0QC 4XMYA 2X9DA 3J81Z 5FLVA 3BG6A 4XKCA 4HNTA 1HXDA 3FMSA 5HVQC 3TDUC 4IHVA 4NQWA 1CGPA 2OZ6A 2JRTA 3DKWA 1UJ8A 1HBXG 4HPQA 3MMYB 4XNFA 2Q8KA 1YJNI 1RUNA 3PO3J 3HM5A 4PGGA 2R7UA 1MMDA 1GXPA 1G3SA 3QAHA 3FMRA 1KYZA 1VQOI 3FIWA 3H5RA 4Q5SF 1J59A 1K6YA 1ULYA 2PG4A 1Z05A 4PUSA 1MSEC 2HZTA 2K9MA 4ANJA 2CO5A 1IV6A 5TISC 2Z5UA 3I56I 2MBFA 3JTGA 1WCMJ
chains in the Genus database with same CATH topology
2EZHA 3S1NJ 5C44J 3HOZJ 5C3EJ 4A3KJ 4V2GA 2ME0A 3S17J 1MBGA 2XB5A 1MH4A 1ITYA 2NVTJ 2JMWA 3BT9A 3RKQA 5E3NA 2G0EA 2JK3A 3HOWJ 1JKPC 1QPIA 1JT6A 3BR5A 3BTJA 1W0TA 3S14J 3BQYA 4A3CJ 1ORKA 5FJ8J 1E3OC 3S16J 1F43A 3NARA 1XS9A 2O9LA 4D7NA 2D5VA 3VPRA 4Y7NJ 4AUXA 1ZR4A 4X1EA 1AKHA 2LVSA 5EG0A 2M9HA 5GPAA 2GLOA 2H1KA 2CJJA 2ECCA 3JRGA 1OJLA 1Y1WJ 1U78A 1B8IB 1VNDA 3JRAA 2GM4A 1JUPA 4MO7A 4M6VA 1JKQC 4DZPA 4S0HB 1FTTA 5M5XJ 3H3VK 2Y31A 3MN2A 1U9NA 4C3HJ 3Q0UA 2O8KA 1B72B 2K9NA 4FE7A 2DMTA 1IDZA 2R5YB 1GUUA 4RBOA 2EH3A 2X48A 3LSGA 1TWCJ 4IEJA 2VUMJ 3GTMJ 5GPCA 1PUFB 5FKMA 4XICA 4EEFG 4M3BA 3FK6A 1MBJA 4M3FA 4UUSB 1TWGJ 1A5JA 4X6AJ 3PM1A 1RKWA 1VI0A 3SDGA 2M8GX 2DMQA 3GTJJ 1X2NA 5DS9A 1FIPA 1F36A 5FKNA 4QSHA 2DMNA 5EG0B 3K7AJ 2R5YA 3OSFA 1RR7A 1LE8A 4UUSA 3BR0A 4A3GJ 1MBHA 2R5ZA 1H89C 1P7JA 1Z77A 3ZQHA 3QPSA 3BG9A 3H0GJ 1MSFC 1TWFJ 3JR9A 1RETA 1MH3A 5DTDA 4ABZA 1TC3C 3S1MJ 3K2AA 1LE8B 2CQXA 1ETXA 1SFOJ 1ETOA 1UMQA 2MW8A 3HB9A 2HOTA 1JKRC 4IHYA 4C3IJ 2N8GA 1ETQA 3BR6A 2M2EA 4BY7J 2DA5A 2P81A 2K9QA 2LFBA 3S15J 4A69C 5FKOA 3S2DJ 1MBFA 2JA5J 2AO9A 3G1LA 1O4XA 2R93J 4D5FA 3GTQJ 2JA8J 4CYCA 1JT0A 3OOUA 1ETVA 2NOGA 5C4XJ 2DJNA 2VKEA 1QRYA 1OFCX 4M3GA 4UUTA 4B3AA 5K7HA 2XPUA 5GP9A 5F04A 4DYQA 3G1MA 4JX6A 1ETWA 2I10A 4DYCA 1IJWC 2WV1A 1RPWA 1Q1VA 1WH5A 4MFDA 5IOZA 2YU9J 3QPLA 3ZOBA 1UHSA 2HQ5A 2JJ7A 1GDTA 4DZJA 2L7MP 4HNVA 5IYCJ 1IDYA 4D5CA 2E1OA 2R92J 1BW6A 3FKIJ 1GV5A 1LFBA 3WHBA 4DW6A 2NVXJ 1X2MA 4BY1J 1H8AC 3C2BA 1RKTA 3LNQA 2FQ4A 2OPTA 1DU0A 1LFUP 2XB0X 1B8IA 3ZQIA 2LP0A 3O8GA 3CMYA 2QF7A 4FE4A 2MG4A 4IHXA 2TCTA 2HOSA 2NVYJ 1DU6A 2DMUA 3S1RJ 1R9TJ 2CUEA 1FIAA 1GV2A 3SFIA 1D5YA 1HCRA 2EZIA 4XRSA 3GTOJ 3D1NI 3HGGA 2HDDA 3UKGA 5F27A 2DA6A 1JTYA 5HODA 1RESA 5FKKA 2ID6A 1CQTA 4JYKA 1ZKGA 1ZQ3P 2LTPA 2XSDC 1W0UA 4XRSG 2VI6A 3MVPA 2FD5A 4A93J 3BR2A 3HGYA 2COBA 1H88C 1JGGA 4M3DA 2MGQA 1ZTRA 2ME6A 1AU7A 1ETKA 1IUFA 1QVUA 1GVDA 3BG3A 1IRZA 1IGNA 4DYRA 2AHQA 5K7FA 1HDDC 2B63J 2L7FP 5EZHA 5IP7J 2H8RA 4M3EA 4FISA 2DMPA 2YS9A 2Y2ZA 2Y9YA 3BR3A 3FK7A 1BJZA 4B4CA 2KT0A 5EDNA 5M5WJ 1ETYA 3ZQGA 4J19A 5JLXA 3JRBA 1U8BA 4AYBN 2EZKA 1EF4A 2Y9ZA 5J3LA 3FISA 3JRIA 1NK2P 5IYBJ 2LK2A 2LLKA 2JA7J 4QIWN 1OCTC 4IHWA 2MSYA 4GFBA 4BBSJ 3JRFA 1T56A 5EGOB 1WGXA 3IV5A 2XGDA 3BR1A 1NTCA 2NVQJ 4I76A 3LSPA 1HOMA 1ZGWA 1APLC 1FEXA 3SJMA 5JLWA 1AKHB 3LOCA 2L7ZA 1VFCA 3BTLA 1A6IA 2YUSA 4XK4A 5F0HA 2RAEA 3OIOA 5M3MJ 3S1QJ 1JJ6C 2CU7A 1MBKA 3HOVJ 2M34A 1HF0A 2XPVA 4AC0A 2E19A 2DN0A 2E2JJ 3HOXJ 1ZK8A 3JRHA 2ID3A 2GBYA 1IG7A 1I6HJ 3DEWA 3Q3SA 3JRDA 5IYDJ 4A3JJ 3HOYJ 5J1UA 1I3QJ 5M3FJ 4MLOA 3A01A 2EQRA 2HXOA 2OF7A 3MKLA 5E3MA 3L1PA 3OSGA 3F0CA 1YRNB 2ELKA 1WH7A 2DA2A 3HBLA 4BKXA 5F1JA 3M4OJ 1S7EA 4QTRA 1JTXA 2HI3A 1ZR2A 3PO2J 2E2IJ 1QVTA 1FJLA 3RQIA 3NAUA 1SANA 4A3BJ 9ANTA 4LOCA 2HOAA 5EF6A 4BBRJ 3IH2A 1POGA 1JUSA 4C2MJ 3WHCA 1ENHA 3A01B 4A3EJ 3W6VA 2X6OA 3IH4A 3ZQFA 2LY9A 2R7ZJ 1JJ8C 1B72A 3GTKJ 3HOUJ 5IOYA 3ZQLA 1G2HA 1P7IA 2XGCA 1I50J 4FCYA 3TW6A 1AHDP 3GBGA 3E7LA 1HLVA 3CDLA 3BQZA 2Y0SN 4NDLA 1BW5A 5M5YJ 4A3IJ 3HDDA 1FTZA 1XG1A 5IP9J 4XIDA 1JKOC 2EBIA 1BA5A 5J1RA 4MIMA 2K40A 4JX4A 5BNGA 4CYCB 5F0FA 2PMZN 1MBEA 5EEAA 2LR8A 5EYRA 3B6AA 2CQQA 4Y52J 2ECBA 5IP6A 1K83J 3GTGJ 2O7OA 1VF9A 3TEDA 4A3DJ 2W48A 4B1RA 1K61A 1PUFA 3O8HA 5F0CA 2DA4A 2DA7A 2XPWA 2VPRA 2DTZA 1WPKA 4V2FA 3CCYA 3Q0VA 3LSRA 4FTHA 2ZB9A 4G12A 3RZDJ 3RZOJ 3TP3A 2KDZA 4A3LJ 2TRTA 3HEFA 3Q0WA 4I6ZA 1XC5A 4W97A 3HKZN 1WI3A 1GT0C 5FKLA 2R5ZB 1UG2A 3I4NJ 2WB1N 4A3FJ 3QQAA 3LSJA 2L9RA 2NS7A 2DA3A 1T33A 2QCOA 3BTCA 4L5EA 3GTPJ 5IPAA 5EGOA 3JRCA 3S2HJ 5E3OA 2CRGA 4D7MA 2WAQN 4W1UA 4A3MJ 2IEKA 2XRLA 3I4MJ 3TP0A 3G1OA 3GTLJ 2M0CA 2FX0A 2JN6A 1Y1VJ 5EZGA 1TWAJ 3A03A 4XRMA 2JA6J 5F08A 1YRNA 3CQZJ 4MFEA 1IC8A 3ZQCA 1Z0XA 3IH3A 5K7ZA 1MNMC 2IBDA 3BG5A 1X58A 2HYJA 1OCPA 3JREA 3DCFA 3B6CA 2LD5A 2R0QC 4JP0A 2X9DA 5FLVA 4JX5A 5J1YA 2FJ1A 2JWTA 4C3JJ 5C4JJ 4IHVA 3M3YJ 2NS8A 2K9SA 2VKVA 4RDUA 3TW7A 3PO3J 1HDPA 3HM5A 2CUFA 2EZLA 2L0KA 1NK3P 1U9OA 4BXXJ 3FIWA 2DA1A 1TWHJ 3A02A 1JUMA 2IAIA 3BTIA 2LKXA 1MSEC 1IV6A 2HXIA 2Y30A 1BL0A 5FLMJ 2XGEA 5E3LA 1WCMJ 2E2HJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZH A;  3S1N J;  5C44 J;  3HOZ J;  5C3E J;  4A3K J;  4V2G A;  2ME0 A;  3S17 J;  1MBG A;  2XB5 A;  1MH4 A;  1ITY A;  2NVT J;  2JMW A;  3BT9 A;  3RKQ A;  5E3N A;  2G0E A;  2JK3 A;  3HOW J;  1JKP C;  1QPI A;  1JT6 A;  3BR5 A;  3BTJ A;  1W0T A;  3S14 J;  3BQY A;  4A3C J;  1ORK A;  5FJ8 J;  1E3O C;  3S16 J;  1F43 A;  3NAR A;  1XS9 A;  2O9L A;  4D7N A;  2D5V A;  3VPR A;  4Y7N J;  4AUX A;  1ZR4 A;  4X1E A;  1AKH A;  2LVS A;  5EG0 A;  2M9H A;  5GPA A;  2GLO A;  2H1K A;  2CJJ A;  2ECC A;  3JRG A;  1OJL A;  1Y1W J;  1U78 A;  1B8I B;  1VND A;  3JRA A;  2GM4 A;  1JUP A;  4MO7 A;  4M6V A;  1JKQ C;  4DZP A;  4S0H B;  1FTT A;  5M5X J;  3H3V K;  2Y31 A;  3MN2 A;  1U9N A;  4C3H J;  3Q0U A;  2O8K A;  1B72 B;  2K9N A;  4FE7 A;  2DMT A;  1IDZ A;  2R5Y B;  1GUU A;  4RBO A;  2EH3 A;  2X48 A;  3LSG A;  1TWC J;  4IEJ A;  2VUM J;  3GTM J;  5GPC A;  1PUF B;  5FKM A;  4XIC A;  4EEF G;  4M3B A;  3FK6 A;  1MBJ A;  4M3F A;  4UUS B;  1TWG J;  1A5J A;  4X6A J;  3PM1 A;  1RKW A;  1VI0 A;  3SDG A;  2M8G X;  2DMQ A;  3GTJ J;  1X2N A;  5DS9 A;  1FIP A;  1F36 A;  5FKN A;  4QSH A;  2DMN A;  5EG0 B;  3K7A J;  2R5Y A;  3OSF A;  1RR7 A;  1LE8 A;  4UUS A;  3BR0 A;  4A3G J;  1MBH A;  2R5Z A;  1H89 C;  1P7J A;  1Z77 A;  3ZQH A;  3QPS A;  3BG9 A;  3H0G J;  1MSF C;  1TWF J;  3JR9 A;  1RET A;  1MH3 A;  5DTD A;  4ABZ A;  1TC3 C;  3S1M J;  3K2A A;  1LE8 B;  2CQX A;  1ETX A;  1SFO J;  1ETO A;  1UMQ A;  2MW8 A;  3HB9 A;  2HOT A;  1JKR C;  4IHY A;  4C3I J;  2N8G A;  1ETQ A;  3BR6 A;  2M2E A;  4BY7 J;  2DA5 A;  2P81 A;  2K9Q A;  2LFB A;  3S15 J;  4A69 C;  5FKO A;  3S2D J;  1MBF A;  2JA5 J;  2AO9 A;  3G1L A;  1O4X A;  2R93 J;  4D5F A;  3GTQ J;  2JA8 J;  4CYC A;  1JT0 A;  3OOU A;  1ETV A;  2NOG A;  5C4X J;  2DJN A;  2VKE A;  1QRY A;  1OFC X;  4M3G A;  4UUT A;  4B3A A;  5K7H A;  2XPU A;  5GP9 A;  5F04 A;  4DYQ A;  3G1M A;  4JX6 A;  1ETW A;  2I10 A;  4DYC A;  1IJW C;  2WV1 A;  1RPW A;  1Q1V A;  1WH5 A;  4MFD A;  5IOZ A;  2YU9 J;  3QPL A;  3ZOB A;  1UHS A;  2HQ5 A;  2JJ7 A;  1GDT A;  4DZJ A;  2L7M P;  4HNV A;  5IYC J;  1IDY A;  4D5C A;  2E1O A;  2R92 J;  1BW6 A;  3FKI J;  1GV5 A;  1LFB A;  3WHB A;  4DW6 A;  2NVX J;  1X2M A;  4BY1 J;  1H8A C;  3C2B A;  1RKT A;  3LNQ A;  2FQ4 A;  2OPT A;  1DU0 A;  1LFU P;  2XB0 X;  1B8I A;  3ZQI A;  2LP0 A;  3O8G A;  3CMY A;  2QF7 A;  4FE4 A;  2MG4 A;  4IHX A;  2TCT A;  2HOS A;  2NVY J;  1DU6 A;  2DMU A;  3S1R J;  1R9T J;  2CUE A;  1FIA A;  1GV2 A;  3SFI A;  1D5Y A;  1HCR A;  2EZI A;  4XRS A;  3GTO J;  3D1N I;  3HGG A;  2HDD A;  3UKG A;  5F27 A;  2DA6 A;  1JTY A;  5HOD A;  1RES A;  5FKK A;  2ID6 A;  1CQT A;  4JYK A;  1ZKG A;  1ZQ3 P;  2LTP A;  2XSD C;  1W0U A;  4XRS G;  2VI6 A;  3MVP A;  2FD5 A;  4A93 J;  3BR2 A;  3HGY A;  2COB A;  1H88 C;  1JGG A;  4M3D A;  2MGQ A;  1ZTR A;  2ME6 A;  1AU7 A;  1ETK A;  1IUF A;  1QVU A;  1GVD A;  3BG3 A;  1IRZ A;  1IGN A;  4DYR A;  2AHQ A;  5K7F A;  1HDD C;  2B63 J;  2L7F P;  5EZH A;  5IP7 J;  2H8R A;  4M3E A;  4FIS A;  2DMP A;  2YS9 A;  2Y2Z A;  2Y9Y A;  3BR3 A;  3FK7 A;  1BJZ A;  4B4C A;  2KT0 A;  5EDN A;  5M5W J;  1ETY A;  3ZQG A;  4J19 A;  5JLX A;  3JRB A;  1U8B A;  4AYB N;  2EZK A;  1EF4 A;  2Y9Z A;  5J3L A;  3FIS A;  3JRI A;  1NK2 P;  5IYB J;  2LK2 A;  2LLK A;  2JA7 J;  4QIW N;  1OCT C;  4IHW A;  2MSY A;  4GFB A;  4BBS J;  3JRF A;  1T56 A;  5EGO B;  1WGX A;  3IV5 A;  2XGD A;  3BR1 A;  1NTC A;  2NVQ J;  4I76 A;  3LSP A;  1HOM A;  1ZGW A;  1APL C;  1FEX A;  3SJM A;  5JLW A;  1AKH B;  3LOC A;  2L7Z A;  1VFC A;  3BTL A;  1A6I A;  2YUS A;  4XK4 A;  5F0H A;  2RAE A;  3OIO A;  5M3M J;  3S1Q J;  1JJ6 C;  2CU7 A;  1MBK A;  3HOV J;  2M34 A;  1HF0 A;  2XPV A;  4AC0 A;  2E19 A;  2DN0 A;  2E2J J;  3HOX J;  1ZK8 A;  3JRH A;  2ID3 A;  2GBY A;  1IG7 A;  1I6H J;  3DEW A;  3Q3S A;  3JRD A;  5IYD J;  4A3J J;  3HOY J;  5J1U A;  1I3Q J;  5M3F J;  4MLO A;  3A01 A;  2EQR A;  2HXO A;  2OF7 A;  3MKL A;  5E3M A;  3L1P A;  3OSG A;  3F0C A;  1YRN B;  2ELK A;  1WH7 A;  2DA2 A;  3HBL A;  4BKX A;  5F1J A;  3M4O J;  1S7E A;  4QTR A;  1JTX A;  2HI3 A;  1ZR2 A;  3PO2 J;  2E2I J;  1QVT A;  1FJL A;  3RQI A;  3NAU A;  1SAN A;  4A3B J;  9ANT A;  4LOC A;  2HOA A;  5EF6 A;  4BBR J;  3IH2 A;  1POG A;  1JUS A;  4C2M J;  3WHC A;  1ENH A;  3A01 B;  4A3E J;  3W6V A;  2X6O A;  3IH4 A;  3ZQF A;  2LY9 A;  2R7Z J;  1JJ8 C;  1B72 A;  3GTK J;  3HOU J;  5IOY A;  3ZQL A;  1G2H A;  1P7I A;  2XGC A;  1I50 J;  4FCY A;  3TW6 A;  1AHD P;  3GBG A;  3E7L A;  1HLV A;  3CDL A;  3BQZ A;  2Y0S N;  4NDL A;  1BW5 A;  5M5Y J;  4A3I J;  3HDD A;  1FTZ A;  1XG1 A;  5IP9 J;  4XID A;  1JKO C;  2EBI A;  1BA5 A;  5J1R A;  4MIM A;  2K40 A;  4JX4 A;  5BNG A;  4CYC B;  5F0F A;  2PMZ N;  1MBE A;  5EEA A;  2LR8 A;  5EYR A;  3B6A A;  2CQQ A;  4Y52 J;  2ECB A;  5IP6 A;  1K83 J;  3GTG J;  2O7O A;  1VF9 A;  3TED A;  4A3D J;  2W48 A;  4B1R A;  1K61 A;  1PUF A;  3O8H A;  5F0C A;  2DA4 A;  2DA7 A;  2XPW A;  2VPR A;  2DTZ A;  1WPK A;  4V2F A;  3CCY A;  3Q0V A;  3LSR A;  4FTH A;  2ZB9 A;  4G12 A;  3RZD J;  3RZO J;  3TP3 A;  2KDZ A;  4A3L J;  2TRT A;  3HEF A;  3Q0W A;  4I6Z A;  1XC5 A;  4W97 A;  3HKZ N;  1WI3 A;  1GT0 C;  5FKL A;  2R5Z B;  1UG2 A;  3I4N J;  2WB1 N;  4A3F J;  3QQA A;  3LSJ A;  2L9R A;  2NS7 A;  2DA3 A;  1T33 A;  2QCO A;  3BTC A;  4L5E A;  3GTP J;  5IPA A;  5EGO A;  3JRC A;  3S2H J;  5E3O A;  2CRG A;  4D7M A;  2WAQ N;  4W1U A;  4A3M J;  2IEK A;  2XRL A;  3I4M J;  3TP0 A;  3G1O A;  3GTL J;  2M0C A;  2FX0 A;  2JN6 A;  1Y1V J;  5EZG A;  1TWA J;  3A03 A;  4XRM A;  2JA6 J;  5F08 A;  1YRN A;  3CQZ J;  4MFE A;  1IC8 A;  3ZQC A;  1Z0X A;  3IH3 A;  5K7Z A;  1MNM C;  2IBD A;  3BG5 A;  1X58 A;  2HYJ A;  1OCP A;  3JRE A;  3DCF A;  3B6C A;  2LD5 A;  2R0Q C;  4JP0 A;  2X9D A;  5FLV A;  4JX5 A;  5J1Y A;  2FJ1 A;  2JWT A;  4C3J J;  5C4J J;  4IHV A;  3M3Y J;  2NS8 A;  2K9S A;  2VKV A;  4RDU A;  3TW7 A;  3PO3 J;  1HDP A;  3HM5 A;  2CUF A;  2EZL A;  2L0K A;  1NK3 P;  1U9O A;  4BXX J;  3FIW A;  2DA1 A;  1TWH J;  3A02 A;  1JUM A;  2IAI A;  3BTI A;  2LKX A;  1MSE C;  1IV6 A;  2HXI A;  2Y30 A;  1BL0 A;  5FLM J;  2XGE A;  5E3L A;  1WCM J;  2E2H J; 
#chains in the Genus database with same CATH topology
 2M4K A;  2PJP A;  1F9N A;  4ZJZ A;  2D1V A;  2XAH A;  4A3K J;  2R7S A;  4RAY A;  4V2G A;  5LBQ A;  1O3S A;  2XB5 A;  1ITY A;  4MTE A;  4WXC A;  4GYG A;  4H0E A;  1XN7 A;  3L2W A;  3M7G A;  4XKW A;  2JK3 A;  4IX7 A;  3HJE A;  1JKP C;  3CUO A;  4BAY A;  4HV5 A;  2A6E F;  1J5Y A;  2OCC H;  1KGS A;  3OYB A;  4A3C J;  1ORK A;  3S16 J;  2Y48 A;  1B6A A;  4U87 A;  1F43 A;  1LDD A;  2PJR A;  3WU2 C;  2D5V A;  3HSR A;  5CLS A;  1XSV A;  3D5S C;  3IAM 2;  4OIQ F;  4AUX A;  1AKH A;  4X1E A;  1WFX A;  2KDO A;  1X19 A;  2HFH A;  2CUZ A;  2F2E A;  2RQQ A;  5HLH A;  1L3L A;  3GFM A;  1JUP A;  4MO7 A;  2WWY A;  2ZNZ A;  2MH9 A;  4ESJ A;  2ZXW H;  2H6B A;  2DOD A;  3GZ5 A;  3H3V K;  3MN2 A;  4A0Z A;  2K9N A;  3HG9 A;  4HNU A;  3HC7 A;  2R5Y B;  1GUU A;  2IW5 A;  1LEB A;  1QU3 A;  2VXZ A;  3LSG A;  2B0L A;  3BRO A;  3B73 A;  3T0Y A;  3TBI A;  1PUF B;  4XIC A;  3DPT A;  2VN2 A;  2UV1 A;  1ZG3 A;  1MDM B;  1FBQ A;  3K1P A;  1MBJ A;  4UUS B;  3M8E A;  1RZ4 A;  3H0D A;  3OYH A;  3PM1 A;  1B9N A;  1PJR A;  2DMQ A;  1XGN A;  4B47 A;  4S05 A;  1X2N A;  3L2R A;  1FIP A;  2QSH X;  4QSH A;  1OLT A;  1WVR A;  3MFK A;  2ZJQ F;  1GXQ A;  1MKM A;  1Y0N A;  3OSF A;  1LE8 A;  3ECO A;  4E6K G;  1P7J A;  3MQ0 A;  4PJM A;  5A2Q K;  3RPU D;  3BG9 A;  3L2Q A;  1MSF C;  4KUM A;  1W36 C;  5DTD A;  2EFN A;  4ABZ A;  1PP7 U;  1TC3 C;  1R1V A;  4A12 A;  2KHM A;  5KK1 A;  1ETO A;  2IA0 A;  1UMQ A;  3HB9 A;  1SD4 A;  1JKR C;  3ABT A;  4IHY A;  2UXX A;  4G94 A;  4LGW A;  3BR6 A;  2R7F A;  3DLL F;  2V79 A;  3MZ8 A;  5BS6 A;  5JHF A;  1YO5 C;  5B3S H;  1TTY A;  3EET A;  2W84 A;  4HV6 A;  2P5K A;  4A69 C;  5LEJ A;  5FKO A;  5JR3 A;  2R4G A;  3S2D J;  1MBF A;  1FOK A;  4FHT A;  3G1L A;  4ZYH A;  2OZU A;  3WTW C;  1VQ8 I;  3E1S A;  2HR3 A;  4EAT A;  1VQL I;  2C6Y A;  5C4X J;  2E5Z A;  2V1U A;  1P9Q C;  1R36 A;  3O3K A;  3W6K B;  2XGX A;  4BQQ A;  3N05 A;  2F6C A;  4B3A A;  4XON A;  5K7H A;  5GP9 A;  2QA4 I;  4Q47 A;  1ETW A;  2I10 A;  4HZF A;  2WV1 A;  3KX2 A;  4KIC A;  3DTK A;  5FO5 A;  3KET A;  4MFD A;  5IOZ A;  3KZI C;  1QZY A;  5BPI A;  3QPL A;  3ZOB A;  2JJ7 A;  2HQ5 A;  4ZZL A;  4D1Q A;  1KQ9 A;  1GDT A;  2JSC A;  3WGH A;  4HNV A;  4ZYG A;  2V9K A;  4D5C A;  4EJO A;  2QQA A;  3OYI A;  5D6F A;  4ZYE A;  3J7Y J;  2Q0O A;  2WBM A;  3ZPL A;  4KFC A;  2NVX J;  1H8A C;  3H3Z A;  4Y33 A;  2OPT A;  3SHF A;  2HTS A;  4CSW A;  2M0M A;  2KLO A;  3RQ4 A;  1B8I A;  2HNH A;  3SZG A;  2LP0 A;  3O8G A;  2PN6 A;  2QF7 A;  4FE4 A;  3C2H A;  4RGS A;  5GTI C;  2JUC A;  3RTR A;  1IAW A;  2ISZ A;  5GTH C;  1DU6 A;  2Y69 H;  1Z6R A;  2B7E A;  1Y56 A;  2VE9 A;  2FQ3 A;  1G3Y A;  1W5S A;  1X4P A;  2VAS A;  1WJC A;  2WAQ A;  3A1Y A;  1FT9 A;  1HCR A;  3CC4 I;  2JQ7 A;  3GTO J;  4RGX A;  3VOE A;  4NC8 A;  3ZXS A;  3VYT B;  3HPH A;  1RES A;  3BY6 A;  3NQO A;  4JK1 X;  5L3D A;  2ID6 A;  2BVL A;  4HST A;  3LMM A;  2LTP A;  2GA2 A;  3E6D A;  4N0B A;  4E70 A;  4PSW A;  4WXD A;  1QQI A;  1WRJ A;  3E5Q A;  2MGQ A;  3WU1 B;  3QU6 A;  3ZP5 A;  1ETK A;  4U7D A;  2JPB A;  2Z99 A;  3TL4 X;  3COA C;  4LLG F;  2KRC A;  1R4N B;  1XGM A;  4DYR A;  1WZ2 A;  2E71 A;  5K7F A;  2KIM A;  3QRF F;  2B63 J;  2ETH A;  5J8C A;  1SMT A;  3I59 B;  1W4M A;  1FOW A;  1S9H A;  1YYV A;  4LB6 B;  2R7Q A;  3D5L A;  2Y9Y A;  2JPC A;  4GO1 A;  2K85 A;  4LIV A;  3GFL A;  4GGG A;  1UCR A;  3GF2 A;  3GME A;  5M5W J;  1ETY A;  4YIR X;  4X0G A;  3JRB A;  3K70 C;  4YRV A;  1XGO A;  3FDY A;  4XOR A;  3FIS A;  4UVA A;  4B48 A;  5IYB J;  3C2G A;  2LK2 A;  1ERD A;  1OCT C;  4IHW A;  1Z6T A;  5EEG A;  4KMU X;  3ZN1 A;  5HDG A;  3JRF A;  1RIO H;  3NEU A;  1WGX A;  3IV5 A;  4CCM A;  5HNF A;  4CCJ A;  3RIR A;  3DEE A;  4I76 A;  3J80 Z;  1EA3 A;  2YX7 A;  2JT1 A;  3MCZ A;  1WQ2 A;  4LG0 B;  4EJU A;  1MDM A;  3AG3 H;  1ZRE A;  2COM A;  3BZK A;  3M1C A;  4BJ5 C;  1U5T B;  2DDA A;  5F0H A;  5M3M J;  1ZLK A;  2DBB A;  2V7F A;  2CU7 A;  4S04 A;  5JFR A;  1VTN C;  3CDH A;  4P9F A;  1ZGA A;  1SFK A;  5E8G A;  3GUD A;  3LSK A;  2J5P A;  1R00 A;  1X1P A;  2LH9 A;  5AIQ A;  5KVR A;  3TO9 A;  5K5R A;  5B66 C;  3HOX J;  2MYS A;  2GIV A;  3PSI A;  1IG7 A;  3JRD A;  2K27 A;  4M74 A;  1I3Q J;  3A01 A;  1KU9 A;  1XMX A;  4EM2 A;  5E3M A;  4HA8 A;  4BJT A;  5EJC A;  4OMZ A;  1TW2 A;  1QBJ A;  2E7W A;  1WH7 A;  2YU3 A;  5E1X A;  1EH8 A;  3M4O J;  1JTX A;  3WG9 A;  2P6T A;  4ETS A;  4ENJ A;  4XOP A;  1FJL A;  1B1B A;  2D2W A;  2K4B A;  3E6M A;  3MEX A;  1DPR A;  2K3P A;  3NAU A;  1D1B A;  4CCN A;  3AAF A;  3E5U A;  3CP8 A;  4BBR J;  1LKX A;  2A5W A;  4NQW B;  4A3E J;  3W6V A;  1ENH A;  3S8P A;  1WSU A;  3BPX A;  3IHU A;  2NVU B;  3T1B A;  2X6O A;  3IH4 A;  3ZGK A;  4AIK A;  1ZHF A;  2KIQ A;  2ICW G;  2LY9 A;  4R8H A;  3ZQF A;  5DM6 F;  2GA1 A;  3ULQ B;  3HOU J;  1TQI A;  4CYD A;  2EV5 A;  1WJE A;  3KP2 A;  3PFY A;  3CC2 I;  2OBP A;  1A35 A;  2IJL A;  3EQL F;  3GWZ A;  3KCC A;  4GYI A;  4UVB A;  4EJW A;  5ICC A;  4Y17 A;  3TKY A;  1F1Z A;  1BI0 A;  5D5W B;  5GAD J;  1BW5 A;  5ED4 A;  1ZGJ A;  2DCE A;  5E79 C;  2FNA A;  4MTD A;  1XG1 A;  2DFH A;  2PEX A;  4N4N B;  5IP9 J;  2HOE A;  3KIO A;  3LWF A;  4NB5 A;  1IXC A;  2YR2 A;  3X2Q H;  4BYY A;  4CA0 A;  4RB2 C;  1WJA A;  3JAM Z;  4MIM A;  1XSX A;  2L9N A;  2DYR H;  2CGP A;  5BNG A;  5FLX K;  4IRG A;  1V5E A;  3V42 A;  2H27 A;  4ZTF A;  2X1D A;  2CQQ A;  4HLY A;  4Y52 J;  2JVG A;  2DT6 A;  5IP6 A;  2BZT A;  3GTG J;  4GCV A;  1VF9 A;  4DBQ A;  3TED A;  2W48 A;  4B1R A;  3RYP A;  1K61 A;  1PUF A;  2DTR A;  3LAP A;  3S2W A;  4BHB A;  2DA7 A;  2J5O A;  2QSG X;  1OYY A;  2F4O B;  2DTZ A;  1U2W A;  4V2F A;  4G6T B;  3IL2 A;  3LSR A;  4FTH A;  4IHT A;  1J75 A;  3PFI A;  4I09 A;  3FHZ A;  3OL3 A;  3TP3 A;  3RZO J;  3I53 A;  3HL2 A;  4M9X A;  1D1A A;  1E0E A;  3DP7 A;  3QYB A;  3I59 A;  2A07 F;  4XKV A;  1W36 D;  3EPZ A;  4EM0 B;  4A3F J;  2V1X A;  2A68 F;  5E1Z B;  4HQE A;  3S3M A;  1H9T A;  2L9R A;  1W7P A;  4B43 A;  2DA3 A;  3I58 A;  1T33 A;  4XR6 A;  3E6C C;  2QCO A;  3BTC A;  3QP6 A;  1IRF A;  2QGU A;  3GTP J;  4IRI A;  1W5C C;  3VYR B;  2E7X A;  5E3O A;  2HQR A;  3BLY A;  1YTY A;  4IKF A;  2WAQ N;  3RKX A;  4UB8 C;  1LB2 A;  3DBR B;  3LA7 A;  2ZC2 A;  3TP0 A;  3G1O A;  4RB1 A;  3GTL J;  2DW4 A;  3C7J A;  2LYC A;  4OAZ A;  5EZG A;  5HDN A;  2F5F A;  2JA6 J;  1MGT A;  3L7W A;  1YRN A;  4XLH A;  1S3J A;  4YG2 F;  3OY9 A;  2JZY A;  3IH3 A;  1KYW A;  2VQH A;  3IC7 A;  1XTA A;  5KCM A;  2O5R A;  3H9Q A;  3HUG B;  2E36 A;  2VC0 A;  5IT3 A;  3LSH A;  1IZ1 A;  2L54 A;  4LIU A;  2VXD A;  4AID A;  4AU7 A;  3HKZ A;  4OIO F;  5J1Y A;  5DCF A;  5K5O A;  3SFZ A;  4CH7 A;  2ESH A;  5C4J J;  5E20 A;  3MKY B;  4L5I A;  3M3Y J;  3CJN A;  4RDU A;  4KIS A;  1HQC A;  1ON1 A;  1G4D A;  3GLL A;  1WI9 A;  2L0K A;  1NK3 P;  2XUB A;  1T08 B;  5DYM A;  2QKL B;  4HLX A;  2FNP A;  1Q1H A;  1ZN2 A;  5DD8 A;  1OQY A;  4L9V A;  4RB3 C;  3OYE A;  3K10 A;  3FXQ A;  1TWH J;  4I0B A;  3BTI A;  4XLF A;  1FMV A;  2DYS H;  2X0L A;  1L0O C;  4YFX F;  5BPD A;  2DQL A;  1IRX A;  3CMA I;  1FNN A;  3GO5 A;  1A36 A;  2HXI A;  2Y30 A;  5FLM J;  3F8B A;  3D0S A;  2E2H J;  4HF2 A;  3WTZ A;  2QM3 A;  2RNJ A;  2EZH A;  2DLL A;  4XKB A;  4MGR A;  3DLA A;  3CMM A;  4U7B A;  4HDU A;  5C3E J;  1R4M B;  3S32 A;  1P4X A;  1E3H A;  1TP4 A;  3S17 J;  2ZBK A;  4WWC A;  1MH4 A;  1KON A;  3DF8 A;  1I39 A;  2RVC A;  3BT9 A;  4BNC A;  2M4G A;  3S14 J;  4HX8 A;  4CZZ A;  1R1U A;  2FOK A;  3BQY A;  3EUH C;  4CUG A;  2HPI A;  3WTV C;  2F5E A;  1HA8 A;  5JI6 A;  1E3O C;  2X1C A;  4XM3 A;  4DOZ A;  3NAR A;  1XS9 A;  2O9L A;  1GLN A;  2EJR A;  3VYU B;  2A61 A;  1I27 A;  3VPR A;  1MIJ A;  2M30 A;  3NRV A;  3PNY A;  4Y7N J;  2FSW A;  2LVS A;  2BGC A;  3QP5 A;  2HU9 A;  1AWC A;  2CJJ A;  3DTI A;  1LDJ A;  3RKY A;  4AIH A;  1OJL A;  1Y1W J;  3WG7 H;  4KA4 A;  1U78 A;  4ASN A;  2EIL H;  3QYE A;  2GM4 A;  3GZN B;  4M72 A;  2CH0 A;  4R1H A;  1TQM A;  2LRD A;  3CO7 C;  3RSN A;  3E5X A;  2Y31 A;  1SFU A;  3Q0U A;  3AG4 H;  3NWT A;  3ASN H;  3OS1 A;  4EJT A;  2G7H A;  3T8R A;  4QPQ A;  2DMT A;  2HWV A;  1TLH B;  4RBO A;  1X3Z B;  2X48 A;  4BH9 A;  4F3Q A;  1TWC J;  4MQ9 F;  4G6Q A;  3JTH A;  2DXI A;  3R0A A;  1WWX A;  1SD7 A;  4RAF A;  1FBS A;  1ZEL A;  3FK6 A;  2W7N A;  3CCU I;  2LRE A;  1TWG J;  1A5J A;  3PSF A;  1YLF A;  3RDI A;  2PI0 A;  5DS9 A;  1F36 A;  3OR2 C;  1MJB A;  1U6G A;  3E3V A;  4RLQ A;  2DFE A;  2R5Y A;  3K4K A;  4IOC F;  2K86 A;  1YQA A;  3P9K A;  3K0L A;  1MBH A;  1H89 C;  2XAS A;  3QYF A;  4B3X A;  1TWF J;  3JR9 A;  4UV9 A;  3K2A A;  2EIN H;  2QYO A;  2CQX A;  1ETX A;  4FET A;  3CO6 C;  1REP C;  3FM5 A;  2IA1 A;  1DP7 P;  2HOT A;  4IRH A;  4C3I J;  2VOO A;  1U5T A;  4CGZ A;  3ZR8 X;  1ZLJ A;  3H9G A;  4BY7 J;  3GLX A;  3CUQ B;  3IUO A;  3FXK A;  2P7V B;  4MQV A;  1U8R A;  1VQ5 I;  2XAF A;  1TQP A;  1BR1 A;  1T39 A;  4E7J A;  3C3W A;  5JVG F;  1FWZ A;  2P4W A;  2DPD A;  2HVQ A;  2ZKZ A;  3J80 K;  1N25 A;  2A05 A;  3OYC A;  3O6B B;  4QPO A;  4MEX F;  1ETV A;  3VDX A;  2VKE A;  2OJE D;  2VKD A;  3BJO A;  4BXF A;  1QRY A;  4N9H A;  3K4L A;  1TNT A;  2XVC A;  4DJA A;  4ZTJ A;  1PDN C;  3ROU A;  4UY8 I;  1IJW C;  4DYC A;  3J7A O;  1RPW A;  3JSP A;  1I1S A;  4G6D A;  3CES A;  2YU9 J;  4RM2 A;  1UZC A;  3ZCO A;  4LLN A;  3H92 A;  2ZXH A;  1UHS A;  3SZP A;  2VQL A;  4FQG A;  2VT3 A;  4XLC A;  3DPL C;  3FXR A;  1BW6 A;  1PVE A;  2AQE A;  1V3F A;  3FKI J;  3H3U A;  1GV5 A;  4AIJ A;  2IT0 A;  1LFB A;  4RAG A;  2GXG A;  4DW6 A;  5J40 A;  2P5L C;  2LKP A;  3C2B A;  1Z21 A;  1BOA A;  3LNQ A;  2O03 A;  4FAS D;  1DU0 A;  3HZJ A;  2XB0 X;  4YII A;  4E7L A;  1X1D A;  2WV0 A;  4KT6 A;  1BI2 A;  4G7O F;  1JGS A;  4PJN A;  4XSX F;  5JVT A;  5HNH A;  2CYY A;  5DCM A;  1BBY A;  2TCT A;  3KFW X;  2A6H F;  2HOS A;  1BIB A;  3BDD A;  3N97 A;  1R9T J;  1A6Q A;  1DGR M;  2CW8 A;  2IGN A;  3A4C A;  1D5Y A;  3K2Z A;  2EZI A;  2IA2 A;  4LJZ F;  4XRS A;  1PYV A;  2A69 F;  2X6W A;  3HGG A;  4C9Y A;  2HDD A;  3QOP A;  5F27 A;  2W25 A;  5HOD A;  4A0X A;  2KJB A;  4A6E A;  1CF7 A;  1T2K A;  5DDG A;  1ZKG A;  4GRI A;  1BN5 A;  2XSD C;  1ZQ3 P;  1BC7 C;  3MVP A;  4A93 J;  4M3D A;  1DDN A;  3HSE A;  1AU7 A;  4OOI A;  3PUF A;  1GVD A;  1ZAO A;  5DV5 A;  3BG3 A;  3U21 A;  5D5X B;  1VQM I;  1IRZ A;  3H5N A;  2XAJ A;  2EA4 A;  3IKT A;  1W1W E;  2M45 A;  2ZJ2 A;  4OU0 A;  5EZH A;  1YFH A;  3EUH A;  2BYV E;  1MZB A;  3PUB A;  1Z3Y A;  2DQR A;  5LD2 C;  1IF1 A;  2X51 A;  2IGM A;  2DOF A;  3CCS I;  3HYI A;  3FK7 A;  3W3C A;  1H0M A;  2PMH A;  1U8B A;  5D5U B;  2EZK A;  1EF4 A;  5HLT A;  5J3L A;  2GXA A;  3JRI A;  1OCR H;  2FUG 2;  2LLK A;  2X4H A;  2JA7 J;  4QIW N;  3F21 A;  3OV8 A;  4RS8 A;  4KJZ A;  4EQQ A;  5LHG A;  3FMQ A;  4PSX A;  2RRE A;  3BR1 A;  2STT A;  4NC7 A;  2DK8 A;  1O3R A;  2NVQ J;  3VFZ A;  2O3F A;  2PQ8 A;  1APL C;  3SJM A;  1AKH B;  5IY5 H;  2M3A A;  2H94 A;  2LY2 A;  4BS9 A;  1VFC A;  2PJR B;  3CUQ A;  5KNL A;  1YJ9 I;  1RNL A;  3PQJ A;  1R5H A;  3QPT A;  4BU2 A;  1YJW I;  1A6I A;  2O8X A;  1MD0 A;  3OIO A;  1JJ6 C;  4XLA A;  1MBK A;  3HOV J;  4EVI A;  1LEA A;  2ESN A;  5J4V A;  5DUK A;  2D45 A;  1K4S A;  1HF0 A;  3ERM A;  2ZME C;  2ACJ A;  1Y8R B;  4ZH4 F;  2FE3 A;  1TT5 B;  4I02 A;  5ICG A;  1YE9 A;  2EK5 A;  3I4P A;  1ZK8 A;  4HDV A;  2ID3 A;  3ZMU A;  4XLN F;  1I6H J;  3DEW A;  3Q3S A;  3KPH A;  1W7P D;  2GOM A;  1IN6 A;  4HRI A;  5J1U A;  3BP8 A;  4IQ4 A;  2L4M A;  1STZ A;  2QQ9 A;  2OF7 A;  3L1P A;  1YRN B;  3LSM A;  2KKO A;  3DKX A;  4NUB A;  3ONQ A;  1VZ0 A;  2X6Y A;  4HG2 A;  4BHP A;  5H2F C;  1VQ7 I;  4YEL A;  2QWW A;  2A5Y B;  2HI3 A;  1ZR2 A;  3CCQ I;  1F5T A;  2ZME B;  2HZD A;  2PX9 A;  1JI8 A;  3RQI A;  2BY1 A;  4P1W A;  3EUK L;  3WTT C;  3BOQ A;  3RPU A;  1SAN A;  4A3B J;  3TQN A;  5EF6 A;  2LF7 A;  4G7Z F;  3IH2 A;  3M8J A;  3HOT A;  3ZMS A;  4E7I A;  2W85 A;  3VEP A;  3H1C A;  1S8N A;  2R7Z J;  1JJ8 C;  3BPV A;  1OCC H;  3L9F A;  1RRJ A;  1B72 A;  3GTK J;  3LQR A;  3ZQL A;  1OIS A;  2XGC A;  3KP4 A;  1AHD P;  3GBG A;  4P96 A;  3KE2 A;  3W2W A;  3CJT B;  3DFG A;  2KJC A;  3CF5 F;  2CV2 A;  5IT9 Z;  4A3I J;  5KHD A;  2BY3 A;  2DOE A;  1SEU A;  1Y0U A;  2XF5 A;  1R5I D;  2WB1 A;  3V8L A;  4PJJ A;  4IOA F;  3H5A A;  3QOD A;  4EGY A;  4Y3O A;  1HKS A;  1JKO C;  4RA2 A;  5FD6 A;  1FZP B;  4AYB A;  2V26 A;  3MZH A;  2K40 A;  4JX4 A;  1FOY A;  2K5C A;  3EYI A;  2W00 A;  2EIM H;  1X4O A;  2R7T A;  2LR8 A;  5EYR A;  3HRS A;  2DFF A;  2F4M B;  3J7A Y;  2ECB A;  3LFK A;  5CKT A;  3AG2 H;  4ZDO A;  2Z3Y A;  3G2B A;  2NNN A;  3V8K A;  5LHI A;  3BG7 A;  3SDB A;  3R61 A;  1F4K A;  1YIO A;  1PUE E;  5E8I A;  3KP7 A;  5H6Q A;  3M1E A;  1HST A;  2DA4 A;  1UHW A;  4BJ6 C;  2G9W A;  1SC7 A;  3F8M A;  2VPR A;  3CLO A;  4YFN F;  4BDY A;  1LJ9 A;  1MJ9 A;  1WPK A;  3IWZ A;  4DGW B;  1MMN A;  3CCY A;  3GCM A;  1RR8 C;  1K78 A;  4G12 A;  1E2X A;  2RV8 A;  5LGN A;  2TRT A;  3HEF A;  3Q0W A;  1XC5 A;  4W97 A;  1CF7 B;  2W82 A;  1YS7 A;  1WI3 A;  4BE0 A;  2UWM A;  1KU7 A;  1UG0 A;  1XB4 A;  3IAS 2;  1HW2 A;  1UG2 A;  1UST A;  2WB1 N;  2LF8 A;  3CZ6 A;  4E7S A;  3J81 K;  2KIF A;  2VT2 A;  4C2U A;  1FBU A;  3DBL B;  2CFO A;  3K1N A;  3FXM A;  5H6R A;  2LOO A;  3JRC A;  2CRG A;  4O3M A;  1T38 A;  5ILS A;  4W1U A;  4RMN A;  1LFP A;  2DDB A;  3IKV A;  2IEK A;  1S6L A;  4CIC A;  3MWM A;  4E7K A;  4I7H A;  4BQN A;  1YOV B;  3ZQ7 A;  2FX0 A;  2BHY A;  2RDP A;  3DWL E;  3WE3 A;  3RKW A;  1BI3 A;  4XRM A;  1YS6 A;  5A2Q Z;  3CQZ J;  1WHU A;  1IC8 A;  1OCO H;  4JOM A;  4N9I A;  1EKE A;  3BG5 A;  4P5O A;  2V6E A;  4P9U A;  3R0J A;  5ICE A;  3JRE A;  2FU4 A;  4LG3 A;  3O2P E;  4IL6 C;  1QO0 D;  2RNG A;  4NBQ A;  1H9G A;  2BE5 F;  4JP0 A;  4L18 B;  1FYL A;  1Z91 A;  2BXZ A;  2G7U A;  4JX5 A;  1IXR C;  1G3T A;  1SFE A;  2ZXJ A;  4IF4 A;  2FJ1 A;  2JWT A;  4C3J J;  2EIJ H;  2O61 A;  2UXN A;  2OC6 A;  5FB2 A;  1D1C A;  2NS8 A;  2K9S A;  3TW7 A;  3JCU C;  1HDP A;  2CUF A;  2EZL A;  3P5J A;  2BHZ A;  1KQ8 A;  3D5R C;  1U9O A;  4BXX J;  2KRH A;  2JRM A;  1W5T A;  1D8J A;  4AM3 A;  2LC2 A;  3C1D A;  3A02 A;  1JUM A;  3UNG C;  1FSH A;  4ITV A;  5ILV A;  1BC8 C;  2OTL I;  2XF7 A;  2FMY A;  1D0Z A;  2EFP A;  3IWF A;  3OYJ A;  4LK0 F;  2DMN A;  5BOX A;  5CVR A;  5E3L A;  1VQ9 I;  3VB2 A;  3CUQ C;  3S1N J;  2RC4 A;  3IRR A;  3HOZ J;  3JW4 A;  3I54 A;  1R71 A;  1TW3 A;  4UV8 A;  1MBG A;  1TL8 A;  3TGN A;  3K70 D;  3LA2 A;  3S3N A;  2LMD A;  4V19 K;  2KMU A;  3RKQ A;  3LFU A;  2G0E A;  1JT6 A;  2XKO A;  3BR5 A;  3BTJ A;  3KYL A;  1W0T A;  4XL9 A;  4LLL A;  1S5L C;  3I9V 2;  3W2V A;  4PJL A;  3CCR I;  1U3E M;  1V5F A;  1RI7 A;  1WJF A;  1QZZ A;  1R7J A;  2CWE A;  3WTY C;  2LKS A;  2GXB A;  4CCL A;  5EG0 A;  5GPA A;  2H1K A;  2ECC A;  3DEU A;  5K1Y A;  1O7L A;  2IRF G;  2WY7 Q;  4HQM A;  3U2R A;  2CSO A;  3OS0 A;  1X1C A;  2M87 A;  2MH2 A;  3PQK A;  2BW3 B;  1XSD A;  1JKQ C;  1A31 A;  3BJ6 A;  1FTT A;  3L2C A;  2FBI A;  4C3H J;  1U9N A;  1B72 B;  4Z2Y A;  2IXS A;  5TRD A;  1T0F C;  3V7R A;  4MHG A;  1IDZ A;  2DT5 A;  2PLY A;  2EH3 A;  4KIT B;  1O7F A;  3K4N A;  2VUM J;  3GTM J;  1VQK I;  4XN0 A;  2CQ7 A;  1ZAR A;  1IV8 A;  3LSI A;  4E7H A;  4X6A J;  3GZ6 A;  1R6R A;  1K6O A;  4PDK A;  5JHU A;  3CCL I;  3HTS B;  5FKN A;  1YW8 A;  5EG0 B;  5B5E C;  3FBI B;  1XD7 A;  3EUA A;  2P5V A;  2I8D A;  2HGC A;  1RR7 A;  2E1M C;  2W24 A;  3BR0 A;  4A3G J;  2R5Z A;  2KL4 A;  3ZQH A;  1S72 I;  2OTJ I;  1T95 A;  2WAD A;  3H0G J;  3PL8 A;  1LNW A;  3I0T A;  3KP6 A;  2DJI A;  5DD4 A;  2JSP A;  1IW7 F;  1SVL A;  2LBF A;  3E6B A;  2XHK A;  1SFO J;  4EGZ A;  3LL7 A;  5CQE A;  1I6X A;  2N8G A;  1ETQ A;  3F9K A;  1WJD A;  2P81 A;  2WAF A;  3RCO A;  3PNV A;  4IZZ A;  2K02 A;  2LFB A;  2VJI A;  3S15 J;  1EH7 A;  3HRM A;  3ISP A;  3OYA A;  2VON A;  2DAO A;  3CC7 I;  2JA5 J;  3ERE D;  1O4X A;  2VIX A;  4N4O B;  2JA8 J;  1JHF A;  2NOG A;  1R22 A;  2DJN A;  3GX4 X;  4HF0 A;  3W6J B;  2WAE A;  2ZXI A;  1OFC X;  4M3G A;  3MKZ A;  4UUT A;  2XPU A;  3RI4 A;  3ZRG A;  1P6R A;  3EDP A;  5F04 A;  3WOD F;  3OMY A;  4JX6 A;  1FP1 D;  1Q1V A;  1R23 A;  3HXL A;  3I5U A;  1MMS A;  2XDV A;  3DU5 A;  3F72 A;  2IS2 A;  4LFU A;  4DZJ A;  2L7M P;  1B9M A;  1J09 A;  4PFP A;  1IDY A;  2QUF A;  1XDU A;  3BCA A;  3OWT A;  2BV6 A;  3OR1 C;  3P9I A;  2XKP A;  3WHB A;  2Q1Z B;  1X2M A;  3REO A;  1S7A A;  3K4B A;  3E0J B;  4U0Y A;  2EV6 A;  1LFU P;  2P0W A;  2MLG A;  3ZQI A;  1HKQ A;  2IVM A;  3L00 A;  4L0Y B;  4BEH A;  3OYD A;  2K7L A;  4U0V A;  1AOY A;  2QLZ A;  4BXU A;  2QVO A;  5GAE J;  2Q2E B;  3OYN A;  2VL8 A;  4UVC A;  2CUE A;  4M6X A;  3SFI A;  2XAQ A;  4XBF A;  2KPM A;  4C30 A;  1T98 A;  1FMW A;  1Y6I A;  2HKO A;  5CPR B;  3D1N I;  2FBK A;  2A3S A;  3UKG A;  1EV7 A;  1MNE A;  3HRT A;  2BY0 A;  2DK5 A;  1J9I A;  5FKK A;  4JYK A;  4RGU A;  2QSF X;  3K4J A;  1I3A A;  1W0U A;  3ABK H;  4XRS G;  4J01 A;  1C0W A;  3WTU C;  4KT5 C;  1P2F A;  3DBH B;  2FD5 A;  3DQV C;  2F4I A;  5HS9 A;  3HGY A;  4UB6 C;  5FRN A;  2HVS A;  2NNY A;  1VQ4 I;  1YX3 A;  2ME6 A;  4A5N A;  1IUF A;  5CYV A;  2ELJ A;  4ENN A;  2VC1 A;  3FF5 A;  4M6Y A;  4AD9 A;  1IGN A;  4UXN A;  1X3U A;  1XCV A;  1X1A A;  2AHQ A;  1LDK B;  5ILU A;  1Z3X A;  2UUZ A;  4HW0 A;  3RJP A;  3QWL A;  2L7F P;  5BMZ A;  5IP7 J;  2Z2S B;  4BE2 A;  2H8R A;  2OQG A;  2XSJ C;  4KN4 X;  3TO7 A;  2CMP A;  2QBY B;  1BOB A;  4DBR A;  4FIS A;  4II3 A;  4A2U A;  2HYF A;  4PGH A;  1YI2 I;  2ZSI B;  3FXL A;  2DMP A;  2YS9 A;  2Y2Z A;  1FP2 A;  3T5X A;  1G8X A;  4XRF A;  1BJZ A;  2CW7 A;  2VB6 A;  5DM7 F;  4BE1 A;  5EDN A;  4J19 A;  3ZQG A;  4YFK F;  2MC4 A;  2Z33 A;  2M7B A;  2DU9 A;  1HW5 A;  1LUJ B;  1NK2 P;  2BOL A;  4II2 A;  3HPG A;  2MSY A;  2WY8 Q;  2X1E A;  1TBX A;  2H09 A;  4GFB A;  4BBS J;  5EGO B;  2E60 A;  2XV4 S;  1XPX A;  1IO2 A;  2KIS A;  2XGD A;  4YIF A;  1NTC A;  2P6S A;  1BJA A;  4F52 A;  4BAC A;  4WX9 A;  2JA2 A;  5AIP A;  1IXS B;  1P92 A;  1SVM A;  2BEO A;  2Y0S A;  4RM3 A;  3LSP A;  1ZRD A;  2GOX B;  2AS5 F;  1HOM A;  5JLW A;  1V4R A;  1UB9 A;  2L2O A;  4LD5 A;  2EFQ A;  4EMS A;  1HW1 A;  5LEK A;  2GIZ A;  2IGK A;  3LOC A;  2IGO A;  4F91 B;  2XIG A;  3BTL A;  2UZK A;  4J00 A;  1UHM A;  5J6X A;  3I55 I;  4PK4 A;  5LFA A;  3TOB A;  1USS A;  1EH6 A;  1XMA A;  4HYE A;  3S3O A;  2XPV A;  3SEZ A;  4AC0 A;  2F48 A;  2DN0 A;  4ON0 A;  4BHC A;  2E2J J;  3JAM K;  3AL0 C;  2GBY A;  2DT7 B;  5B1A H;  2VLA A;  3CDI A;  4HAM A;  3VOD A;  1ZH5 A;  2OQR A;  2VBY A;  2QZ8 A;  3OSG A;  4ZDL A;  2FF4 A;  2E5N A;  1ACI A;  1KQ0 A;  2ELK A;  3GEZ A;  1KA8 A;  3ABM H;  5F1J A;  4QTR A;  1IN5 A;  2X6X A;  3MKW B;  5LGU A;  2E2I J;  2Q2E A;  1QVT A;  1E17 A;  1SVO A;  1IRG A;  3GW2 A;  3I71 A;  2E1N A;  2CQK A;  3PIO F;  2V1N A;  4GXO A;  1RUO A;  9ANT A;  2F5C A;  1TNS A;  4IJA A;  1JUS A;  4C2M J;  4B8X A;  1FOX A;  3DPU A;  5CQG A;  1YIJ I;  3QPH A;  1OR7 C;  1OPC A;  5IOY A;  2HPM A;  2L02 A;  1XX5 A;  4NHJ A;  1P7I A;  5CVJ A;  2X85 A;  3DV8 A;  3TW6 A;  4CXF A;  2HKX A;  1K78 B;  3E7L A;  1JE8 A;  3CDL A;  3CLQ A;  3BQZ A;  1D8K A;  2CS3 A;  2Y0S N;  4NDL A;  2XRN A;  3UR3 C;  5M5Y J;  1DUX C;  3HDD A;  1FTZ A;  4MEY F;  5D8K B;  4A0Y A;  4KIB A;  3BCB A;  1OCZ H;  4BL0 B;  5F1R A;  2IPQ X;  1LVK A;  2CG4 A;  2E1M B;  2R7V A;  1P4A A;  3G3Z A;  1Z67 A;  4HSR A;  4BDZ A;  3V7C A;  4BQA A;  5F0F A;  2PMZ N;  2XC7 A;  2HYG D;  1ODD A;  1MBE A;  3KP5 A;  3FX3 A;  5EEA A;  5CVV A;  3B6A A;  1V55 H;  1A04 A;  2L7K A;  2OV7 A;  3VWB A;  5FFX A;  4BUP A;  2O7O A;  2LY1 A;  4WF2 A;  4ZC3 A;  1DP3 A;  2FXA A;  4A3D J;  3M8F A;  2LG4 A;  3O8H A;  5F0C A;  3P7N A;  3SQN A;  1S29 A;  4R79 A;  4ZZD A;  4U0W A;  2PMZ A;  4PZJ A;  3TDZ C;  1SMY F;  1QZE A;  3ABL H;  3WGG A;  3RZD J;  2BBY A;  1GVJ A;  2KP6 A;  3KYC B;  3HKZ N;  5FKL A;  1N77 A;  2R5Z B;  4IPA A;  3QQA A;  2V6C A;  4WXH A;  4CDG A;  3RYR A;  4BEH B;  4I01 A;  1YIT I;  1YG2 A;  2D1H A;  3KEY A;  3U1D A;  3SZT A;  2F5V A;  5HOO A;  1MW7 A;  5IPA A;  1WJB A;  5EGO A;  3S2H J;  3KZZ A;  3JSO A;  3H35 A;  2EPF A;  4L9J A;  4D7M A;  3ML6 A;  3HOS A;  4A3M J;  2QQ8 A;  2V1D A;  4ENM A;  2NS0 A;  3CTA A;  3ASO H;  2JUG A;  5HLI A;  1B4A A;  1VQP I;  3A03 A;  1FX7 A;  4F93 B;  3WTX C;  4OIR F;  4MFE A;  4Q48 A;  1OMI A;  3ZQC A;  3WE2 A;  5LGT A;  1Z0X A;  5K7Z A;  3CCE I;  2KIU A;  2DI3 A;  1X58 A;  1R1T A;  3ABU A;  2VJJ A;  2MA3 A;  1QHG A;  4HF1 A;  1NG7 A;  3DCF A;  3B6C A;  5FRM A;  2LD5 A;  3K6G A;  4OMY A;  1D0Y A;  4KIG A;  5F64 A;  5ICF A;  4UHT A;  1BI1 A;  2R7X A;  3KLN A;  2IS6 A;  2MD0 A;  1EJ9 A;  2VKV A;  4Y15 A;  4QLC U;  3PIP F;  3F6V A;  5BQT A;  1R58 A;  5D5V B;  5IT9 K;  4I99 C;  1QNT A;  3MZY A;  3Q9V A;  4IO9 F;  2NXN B;  4I0A A;  2WA0 A;  4LB5 A;  2DA1 A;  2STW A;  4L9T A;  3G4S I;  4D9J A;  2JTV A;  2IAI A;  3FBN B;  1B59 A;  2LKX A;  2VQC A;  5L3G A;  4IVN A;  2EFW A;  4AVP A;  3HHH A;  3CCM I;  1BL0 A;  3F23 A;  2XGE A;  2Z16 A;  4RAZ A;  3OYG A;  3IP4 B;  1T0F A;  2R7R A;  5C44 J;  4TV7 A;  2HQA A;  1MMA A;  1ZYR F;  2VOD A;  2K4J A;  2ME0 A;  3G6E I;  3U9G A;  3L2U A;  2PBI A;  2PMU A;  2NVT J;  2ZNY A;  4F92 B;  2L9S A;  5AON A;  4UNO A;  2JMW A;  1V5G A;  5L3E A;  1X3W B;  3R60 A;  5E3N A;  2BY2 A;  5D4R A;  3HOW J;  2FRH A;  4RLF A;  1QPI A;  2GAU A;  4I2O A;  5FJ8 J;  3DXJ F;  2M5W A;  2QQB A;  2OAZ A;  4D7N A;  2DO7 A;  2FBH A;  4CZC A;  2Y0M A;  4EJV A;  3OYL A;  1ZR4 A;  4WK8 F;  2YPR A;  2M9H A;  1OR7 A;  2GLO A;  3JRG A;  2QEX I;  1KU2 A;  3OL4 A;  4L0Z B;  3CCJ I;  4YEJ A;  1B8I B;  1VND A;  3JRA A;  1J7K A;  2XAG A;  4KYW A;  4MNU A;  4ZYA A;  3KYD B;  1R5G A;  4M6V A;  2RGV A;  3BZC A;  2FEZ A;  2LNB A;  4DZP A;  2NAZ A;  4KIF A;  4S0H B;  4B09 A;  5M5X J;  1MMG A;  2BXY A;  4RB0 A;  3HUG A;  4ESB A;  5LLQ A;  2O8K A;  3DTE A;  1MND A;  3S93 A;  4FE7 A;  4CHU A;  2K3F A;  1R49 A;  4FT8 A;  5L3F A;  3EYY A;  3AKZ A;  5DEQ A;  5ERI A;  5E1W A;  4C2T A;  3MD2 A;  4ESF A;  4IEJ A;  2DPU A;  3V7S A;  2QBY A;  5GPC A;  1MJA A;  5FKM A;  1D3Y A;  1I1G A;  4EEF G;  3T8T A;  4M3B A;  2B9S A;  3Q9S A;  3KEQ A;  4M3F A;  2I5U A;  3KLO A;  2HDW A;  4KN7 X;  1RKW A;  1VI0 A;  3SDG A;  2M8G X;  2MC3 A;  3GTJ J;  3R6S A;  5L3B A;  3ESW B;  3P9C A;  3K7A J;  2CFX A;  4KDP A;  3BC8 A;  4UUS A;  2LBF B;  2XF6 A;  3LQQ A;  4LK1 F;  1Z77 A;  5GAH J;  4IHS A;  2K9L A;  1V54 H;  4OWR B;  3QPS A;  5HS7 A;  1UEL B;  1D5V A;  1RET A;  1YW9 A;  1MH3 A;  2GWR A;  1P4W A;  3S1M J;  1SFX A;  2NOJ B;  1LE8 B;  2LSO A;  5LHH A;  5H20 A;  5FFZ A;  2MW8 A;  2R7D A;  2Z9O A;  2M2E A;  2LDU A;  3GFJ A;  2DA5 A;  3WTS C;  2K9Q A;  2VBX A;  2EA2 A;  3FM3 A;  2VKH A;  3GVA A;  2CV0 A;  2KFD A;  2MLK A;  2GQQ A;  4G7H F;  3PNT A;  4L5J A;  2R7W A;  2AO9 A;  1K7A A;  1DGW Y;  3BZ6 A;  2PFB A;  1UAA A;  1D0X A;  2EB7 A;  2R93 J;  4D5F A;  3GTQ J;  3AFH A;  1TZL A;  3HTU A;  4CYC A;  1JT0 A;  2L01 A;  3OOU A;  2XAU A;  3MAJ A;  4DIQ A;  2NRA C;  2EIK H;  2CV1 A;  2YX4 A;  4QWQ A;  1T6S A;  4M9Z A;  1ZG1 A;  5J47 A;  4OIN F;  4DYQ A;  3W2A A;  4M71 A;  3G1M A;  3A0H C;  4IXA A;  4A5M A;  2ZFU A;  1WH5 A;  3ZN0 A;  2NYX A;  1S7O A;  2EFO A;  2VBZ A;  4AWX B;  4XLP F;  3LST A;  3ZQQ A;  5IYC J;  2DFI A;  3U1K A;  2E1O A;  2R92 J;  2FML A;  4IQJ A;  1TT0 A;  1WKM A;  2MAB A;  4KNY A;  2AXL A;  4AVZ A;  2OD5 A;  2V9V A;  4O6J A;  5D4S A;  1UFM A;  5J4Y A;  1YW7 A;  4BY1 J;  1RKT A;  3CF2 A;  2FQ4 A;  3K1M A;  3K4C A;  2P7C B;  3K9T A;  4NC6 A;  3Q5F A;  2JVH A;  1IN8 A;  3WGI A;  3ELK A;  4EM1 A;  3CMY A;  1OYW A;  2MG4 A;  2EV0 A;  2VOP A;  2HDC A;  2Z1D A;  3M9A A;  3NWS A;  2L5Q A;  4IHX A;  3HRU A;  2NVY J;  2HQN A;  2ZME A;  2DMU A;  1BR2 A;  3CJR B;  3S1R J;  2Y75 A;  1O3T A;  2IS4 A;  1RC9 A;  1FIA A;  1GV2 A;  2CW0 F;  3M07 A;  4HX7 A;  3V8J A;  4RGR A;  3DU6 A;  2L3D A;  2DA6 A;  1JTY A;  3TO6 A;  4PJ0 C;  2E34 A;  4DQ2 A;  3CME I;  4OIP F;  3GYH X;  2OUM A;  1CQT A;  3LAJ A;  3G73 A;  1SD6 A;  2BVM A;  3KZY A;  2VI6 A;  2XRO A;  5D6E A;  4XQF A;  3OOP A;  3I3L A;  1IUY A;  3OYM A;  3BR2 A;  1Y39 A;  2COB A;  1H88 C;  1QPM A;  5KAI C;  1JGG A;  4I98 B;  3F6O A;  2OCE A;  1ZTR A;  3HIF A;  3R4K A;  2EWN A;  2VQG A;  5CVI A;  4BGD A;  1YHQ I;  1QVU A;  4FX4 A;  1WJ5 A;  3ECH A;  4ZYD A;  2WC2 A;  1I5Z A;  2QKM B;  4F55 A;  2KQR A;  1Z7L A;  1HDD C;  2HVR A;  4U88 A;  2AQF A;  1K4T A;  3G71 I;  1N75 A;  1YX5 A;  2MFZ A;  2H1L A;  1NG6 A;  5LRR A;  4B44 A;  4D0P A;  4M3E A;  4HOB A;  3FHN A;  3ZMD A;  1FYK A;  2HEO A;  1LPQ A;  3BR3 A;  5GAG J;  4H4K C;  4OAY A;  4B4C A;  1W7P B;  4K2E A;  4XLE A;  3QOE A;  2L9V A;  4G8X A;  2KT0 A;  3BWG A;  4Z6Y A;  5FGM A;  3J7Z I;  3FWE A;  5JLX A;  4AYB N;  3V4G A;  2ZFW A;  3K4M A;  3ZMZ A;  1SAX A;  2Y9Z A;  2V4J C;  1VQN I;  2MD5 A;  3OIQ A;  5TGT A;  4Y4R A;  5TJJ A;  1VQ6 I;  3L2V A;  1PP8 F;  4UUV A;  3AG1 H;  1OYI A;  1BR4 A;  1T56 A;  1DPU A;  2ZJP F;  3F8C A;  1ZGW A;  1FEX A;  3VSL A;  1J0R A;  1G6N A;  3ZMV A;  2V9P A;  5DCM B;  2AXT C;  2HTJ A;  2L7Z A;  1E3P A;  1Z9C A;  4LIT A;  1QGP A;  3WU0 A;  3FXU A;  4XN3 A;  3SEQ A;  1T8I A;  2YUS A;  4G9Y A;  3A2K A;  2IS1 A;  3TMO A;  3RPQ A;  4XK4 A;  2RAE A;  3S1Q J;  3LA3 A;  2YSR A;  4XSZ F;  4NNJ A;  1ZRF A;  2M34 A;  2E19 A;  2VPL A;  2ZJR F;  3CJQ B;  2ADU A;  3VYS B;  2L4A A;  1JHH A;  3K69 A;  2CQN A;  3C18 A;  1QHH D;  1BIA A;  4CO8 A;  3QU3 A;  2TDX A;  3JRH A;  3E97 A;  1ZG5 A;  2HS5 A;  1FC3 A;  5IYD J;  1HSJ A;  4Y13 A;  3H36 A;  3H9J A;  4A3J J;  3HOY J;  2VBW A;  2F5D A;  3BJA A;  2VJ5 A;  3F3X A;  2E1C A;  5M3F J;  4MLO A;  1LQ1 A;  3B02 A;  3FKJ A;  2EQR A;  2A6T A;  2HXO A;  3MKL A;  4JQF A;  3F0C A;  2QEN A;  4Q4Z F;  3HHG A;  2DOA A;  3N4M A;  1HC8 A;  2DA2 A;  2P8T A;  3HBL A;  4JBA A;  4BKX A;  5J8F A;  1G59 A;  1S7E A;  2KZV A;  4KMF A;  1JXS A;  1O57 A;  3SXY A;  2W4S A;  3PO2 J;  1K79 A;  2M7A A;  2E35 A;  5KAF C;  5B1B H;  1Y8Q B;  4LOC A;  2HOA A;  1M1E B;  2W57 A;  1POG A;  3F8N A;  3FXO A;  1XMK A;  3A01 B;  3WHC A;  1FYM A;  1QA6 A;  5FRO A;  5E18 F;  4E7Z A;  1IN4 A;  3SYT A;  5DUI A;  1G2H A;  1I50 J;  4FCY A;  1XGS A;  1FPQ A;  2ZSH B;  2GZW A;  2H8W A;  1HLV A;  4O5V A;  3VSK A;  1J2X A;  2VJ4 A;  3AL0 B;  1FLI A;  3F8F A;  3FXJ A;  3FZV A;  4CCO A;  4F7Z A;  2RKH A;  1IN7 A;  1HKT A;  2M1B A;  1KU3 A;  4XID A;  2EBI A;  4PCQ A;  1U0J A;  1BA5 A;  2KRF A;  2OA4 A;  5J1R A;  1NHA A;  3F22 A;  2M8E A;  2RQP A;  2FOW A;  4CYC B;  1GHC A;  5L3C A;  3OS2 A;  3DKY A;  1O3Q A;  5E17 F;  4PFO A;  4BQO A;  1SAU A;  2H6C A;  2O6G E;  2FA5 A;  4ZDP A;  1XCB A;  4CCK A;  1K83 J;  1NH3 A;  3L09 A;  4EV0 A;  3KP3 A;  5LRS A;  1LVA A;  2W1O A;  4XOT A;  1Z7U A;  5CVU A;  4ENK A;  1N78 A;  3I64 A;  2XPW A;  3TOA A;  5EEH A;  1ONV A;  3HSF A;  1DQU A;  3Q0V A;  2ELH A;  2ZB9 A;  1Z1D A;  5HLG A;  4A3L J;  2KDZ A;  2WTE A;  1BM9 A;  4M73 A;  4I6Z A;  4A6D A;  1AA7 A;  4E4H A;  2CUJ A;  1X1B A;  5HDK A;  1OKR A;  2ISY A;  2ZO4 A;  4LG0 A;  3CD6 I;  1GT0 C;  4GDF A;  2KZG A;  3I4N J;  4HBL A;  2RN7 A;  5HS8 A;  3LSJ A;  5FD5 A;  5D8L B;  1G3W A;  2NS7 A;  2IP2 A;  4FX0 A;  5CJ9 A;  1ZRC A;  3OIP A;  3CP2 A;  2OU2 A;  3PJR A;  6PAX A;  4HEA 2;  4HX4 A;  4L5E A;  4DNC A;  3GXO A;  2O0Y A;  1SD5 A;  2ZCW A;  2R7O A;  3ZMT A;  3OYK A;  4L9N A;  2R3S A;  3IRQ A;  1FY7 A;  2XRL A;  3I4M J;  3A0B C;  4LMY A;  1ON2 A;  4P55 A;  1U5T C;  2M0C A;  2JN6 A;  1Y1V J;  5K5Q A;  1TWA J;  2VE8 A;  3GFI A;  4M9S A;  5F08 A;  5FLX Z;  2BW3 A;  1KZH A;  4WCG A;  1MNM C;  2IBD A;  3KEO A;  5F6F A;  3CCV I;  1FSE A;  1OCP A;  2HYJ A;  3OYF A;  1XDS A;  2R0Q C;  4XMY A;  2X9D A;  3J81 Z;  5FLV A;  3BG6 A;  4XKC A;  4HNT A;  1HXD A;  3FMS A;  5HVQ C;  3TDU C;  4IHV A;  4NQW A;  1CGP A;  2OZ6 A;  2JRT A;  3DKW A;  1UJ8 A;  1HBX G;  4HPQ A;  3MMY B;  4XNF A;  2Q8K A;  1YJN I;  1RUN A;  3PO3 J;  3HM5 A;  4PGG A;  2R7U A;  1MMD A;  1GXP A;  1G3S A;  3QAH A;  3FMR A;  1KYZ A;  1VQO I;  3FIW A;  3H5R A;  4Q5S F;  1J59 A;  1K6Y A;  1ULY A;  2PG4 A;  1Z05 A;  4PUS A;  1MSE C;  2HZT A;  2K9M A;  4ANJ A;  2CO5 A;  1IV6 A;  5TIS C;  2Z5U A;  3I56 I;  2MBF A;  3JTG A;  1WCM J; 
#chains in the Genus database with same CATH homology
 2EZH A;  3S1N J;  5C44 J;  3HOZ J;  5C3E J;  4A3K J;  4V2G A;  2ME0 A;  3S17 J;  1MBG A;  2XB5 A;  1MH4 A;  1ITY A;  2NVT J;  2JMW A;  3BT9 A;  3RKQ A;  5E3N A;  2G0E A;  2JK3 A;  3HOW J;  1JKP C;  1QPI A;  1JT6 A;  3BR5 A;  3BTJ A;  1W0T A;  3S14 J;  3BQY A;  4A3C J;  1ORK A;  5FJ8 J;  1E3O C;  3S16 J;  1F43 A;  3NAR A;  1XS9 A;  2O9L A;  4D7N A;  2D5V A;  3VPR A;  4Y7N J;  4AUX A;  1ZR4 A;  4X1E A;  1AKH A;  2LVS A;  5EG0 A;  2M9H A;  5GPA A;  2GLO A;  2H1K A;  2CJJ A;  2ECC A;  3JRG A;  1OJL A;  1Y1W J;  1U78 A;  1B8I B;  1VND A;  3JRA A;  2GM4 A;  1JUP A;  4MO7 A;  4M6V A;  1JKQ C;  4DZP A;  4S0H B;  1FTT A;  5M5X J;  3H3V K;  2Y31 A;  3MN2 A;  1U9N A;  4C3H J;  3Q0U A;  2O8K A;  1B72 B;  2K9N A;  4FE7 A;  2DMT A;  1IDZ A;  2R5Y B;  1GUU A;  4RBO A;  2EH3 A;  2X48 A;  3LSG A;  1TWC J;  4IEJ A;  2VUM J;  3GTM J;  5GPC A;  1PUF B;  5FKM A;  4XIC A;  4EEF G;  4M3B A;  3FK6 A;  1MBJ A;  4M3F A;  4UUS B;  1TWG J;  1A5J A;  4X6A J;  3PM1 A;  1RKW A;  1VI0 A;  3SDG A;  2M8G X;  2DMQ A;  3GTJ J;  1X2N A;  5DS9 A;  1FIP A;  1F36 A;  5FKN A;  4QSH A;  2DMN A;  5EG0 B;  3K7A J;  2R5Y A;  3OSF A;  1RR7 A;  1LE8 A;  4UUS A;  3BR0 A;  4A3G J;  1MBH A;  2R5Z A;  1H89 C;  1P7J A;  1Z77 A;  3ZQH A;  3QPS A;  3BG9 A;  3H0G J;  1MSF C;  1TWF J;  3JR9 A;  1RET A;  1MH3 A;  5DTD A;  4ABZ A;  1TC3 C;  3S1M J;  3K2A A;  1LE8 B;  2CQX A;  1ETX A;  1SFO J;  1ETO A;  1UMQ A;  2MW8 A;  3HB9 A;  2HOT A;  1JKR C;  4IHY A;  4C3I J;  2N8G A;  1ETQ A;  3BR6 A;  2M2E A;  4BY7 J;  2DA5 A;  2P81 A;  2K9Q A;  2LFB A;  3S15 J;  4A69 C;  5FKO A;  3S2D J;  1MBF A;  2JA5 J;  2AO9 A;  3G1L A;  1O4X A;  2R93 J;  4D5F A;  3GTQ J;  2JA8 J;  4CYC A;  1JT0 A;  3OOU A;  1ETV A;  2NOG A;  5C4X J;  2DJN A;  2VKE A;  1QRY A;  1OFC X;  4M3G A;  4UUT A;  4B3A A;  5K7H A;  2XPU A;  5GP9 A;  5F04 A;  4DYQ A;  3G1M A;  4JX6 A;  1ETW A;  2I10 A;  4DYC A;  1IJW C;  2WV1 A;  1RPW A;  1Q1V A;  1WH5 A;  4MFD A;  5IOZ A;  2YU9 J;  3QPL A;  3ZOB A;  1UHS A;  2HQ5 A;  2JJ7 A;  1GDT A;  4DZJ A;  2L7M P;  4HNV A;  5IYC J;  1IDY A;  4D5C A;  2E1O A;  2R92 J;  1BW6 A;  3FKI J;  1GV5 A;  1LFB A;  3WHB A;  4DW6 A;  2NVX J;  1X2M A;  4BY1 J;  1H8A C;  3C2B A;  1RKT A;  3LNQ A;  2FQ4 A;  2OPT A;  1DU0 A;  1LFU P;  2XB0 X;  1B8I A;  3ZQI A;  2LP0 A;  3O8G A;  3CMY A;  2QF7 A;  4FE4 A;  2MG4 A;  4IHX A;  2TCT A;  2HOS A;  2NVY J;  1DU6 A;  2DMU A;  3S1R J;  1R9T J;  2CUE A;  1FIA A;  1GV2 A;  3SFI A;  1D5Y A;  1HCR A;  2EZI A;  4XRS A;  3GTO J;  3D1N I;  3HGG A;  2HDD A;  3UKG A;  5F27 A;  2DA6 A;  1JTY A;  5HOD A;  1RES A;  5FKK A;  2ID6 A;  1CQT A;  4JYK A;  1ZKG A;  1ZQ3 P;  2LTP A;  2XSD C;  1W0U A;  4XRS G;  2VI6 A;  3MVP A;  2FD5 A;  4A93 J;  3BR2 A;  3HGY A;  2COB A;  1H88 C;  1JGG A;  4M3D A;  2MGQ A;  1ZTR A;  2ME6 A;  1AU7 A;  1ETK A;  1IUF A;  1QVU A;  1GVD A;  3BG3 A;  1IRZ A;  1IGN A;  4DYR A;  2AHQ A;  5K7F A;  1HDD C;  2B63 J;  2L7F P;  5EZH A;  5IP7 J;  2H8R A;  4M3E A;  4FIS A;  2DMP A;  2YS9 A;  2Y2Z A;  2Y9Y A;  3BR3 A;  3FK7 A;  1BJZ A;  4B4C A;  2KT0 A;  5EDN A;  5M5W J;  1ETY A;  3ZQG A;  4J19 A;  5JLX A;  3JRB A;  1U8B A;  4AYB N;  2EZK A;  1EF4 A;  2Y9Z A;  5J3L A;  3FIS A;  3JRI A;  1NK2 P;  5IYB J;  2LK2 A;  2LLK A;  2JA7 J;  4QIW N;  1OCT C;  4IHW A;  2MSY A;  4GFB A;  4BBS J;  3JRF A;  1T56 A;  5EGO B;  1WGX A;  3IV5 A;  2XGD A;  3BR1 A;  1NTC A;  2NVQ J;  4I76 A;  3LSP A;  1HOM A;  1ZGW A;  1APL C;  1FEX A;  3SJM A;  5JLW A;  1AKH B;  3LOC A;  2L7Z A;  1VFC A;  3BTL A;  1A6I A;  2YUS A;  4XK4 A;  5F0H A;  2RAE A;  3OIO A;  5M3M J;  3S1Q J;  1JJ6 C;  2CU7 A;  1MBK A;  3HOV J;  2M34 A;  1HF0 A;  2XPV A;  4AC0 A;  2E19 A;  2DN0 A;  2E2J J;  3HOX J;  1ZK8 A;  3JRH A;  2ID3 A;  2GBY A;  1IG7 A;  1I6H J;  3DEW A;  3Q3S A;  3JRD A;  5IYD J;  4A3J J;  3HOY J;  5J1U A;  1I3Q J;  5M3F J;  4MLO A;  3A01 A;  2EQR A;  2HXO A;  2OF7 A;  3MKL A;  5E3M A;  3L1P A;  3OSG A;  3F0C A;  1YRN B;  2ELK A;  1WH7 A;  2DA2 A;  3HBL A;  4BKX A;  5F1J A;  3M4O J;  1S7E A;  4QTR A;  1JTX A;  2HI3 A;  1ZR2 A;  3PO2 J;  2E2I J;  1QVT A;  1FJL A;  3RQI A;  3NAU A;  1SAN A;  4A3B J;  9ANT A;  4LOC A;  2HOA A;  5EF6 A;  4BBR J;  3IH2 A;  1POG A;  1JUS A;  4C2M J;  3WHC A;  1ENH A;  3A01 B;  4A3E J;  3W6V A;  2X6O A;  3IH4 A;  3ZQF A;  2LY9 A;  2R7Z J;  1JJ8 C;  1B72 A;  3GTK J;  3HOU J;  5IOY A;  3ZQL A;  1G2H A;  1P7I A;  2XGC A;  1I50 J;  4FCY A;  3TW6 A;  1AHD P;  3GBG A;  3E7L A;  1HLV A;  3CDL A;  3BQZ A;  2Y0S N;  4NDL A;  1BW5 A;  5M5Y J;  4A3I J;  3HDD A;  1FTZ A;  1XG1 A;  5IP9 J;  4XID A;  1JKO C;  2EBI A;  1BA5 A;  5J1R A;  4MIM A;  2K40 A;  4JX4 A;  5BNG A;  4CYC B;  5F0F A;  2PMZ N;  1MBE A;  5EEA A;  2LR8 A;  5EYR A;  3B6A A;  2CQQ A;  4Y52 J;  2ECB A;  5IP6 A;  1K83 J;  3GTG J;  2O7O A;  1VF9 A;  3TED A;  4A3D J;  2W48 A;  4B1R A;  1K61 A;  1PUF A;  3O8H A;  5F0C A;  2DA4 A;  2DA7 A;  2XPW A;  2VPR A;  2DTZ A;  1WPK A;  4V2F A;  3CCY A;  3Q0V A;  3LSR A;  4FTH A;  2ZB9 A;  4G12 A;  3RZD J;  3RZO J;  3TP3 A;  2KDZ A;  4A3L J;  2TRT A;  3HEF A;  3Q0W A;  4I6Z A;  1XC5 A;  4W97 A;  3HKZ N;  1WI3 A;  1GT0 C;  5FKL A;  2R5Z B;  1UG2 A;  3I4N J;  2WB1 N;  4A3F J;  3QQA A;  3LSJ A;  2L9R A;  2NS7 A;  2DA3 A;  1T33 A;  2QCO A;  3BTC A;  4L5E A;  3GTP J;  5IPA A;  5EGO A;  3JRC A;  3S2H J;  5E3O A;  2CRG A;  4D7M A;  2WAQ N;  4W1U A;  4A3M J;  2IEK A;  2XRL A;  3I4M J;  3TP0 A;  3G1O A;  3GTL J;  2M0C A;  2FX0 A;  2JN6 A;  1Y1V J;  5EZG A;  1TWA J;  3A03 A;  4XRM A;  2JA6 J;  5F08 A;  1YRN A;  3CQZ J;  4MFE A;  1IC8 A;  3ZQC A;  1Z0X A;  3IH3 A;  5K7Z A;  1MNM C;  2IBD A;  3BG5 A;  1X58 A;  2HYJ A;  1OCP A;  3JRE A;  3DCF A;  3B6C A;  2LD5 A;  2R0Q C;  4JP0 A;  2X9D A;  5FLV A;  4JX5 A;  5J1Y A;  2FJ1 A;  2JWT A;  4C3J J;  5C4J J;  4IHV A;  3M3Y J;  2NS8 A;  2K9S A;  2VKV A;  4RDU A;  3TW7 A;  3PO3 J;  1HDP A;  3HM5 A;  2CUF A;  2EZL A;  2L0K A;  1NK3 P;  1U9O A;  4BXX J;  3FIW A;  2DA1 A;  1TWH J;  3A02 A;  1JUM A;  2IAI A;  3BTI A;  2LKX A;  1MSE C;  1IV6 A;  2HXI A;  2Y30 A;  1BL0 A;  5FLM J;  2XGE A;  5E3L A;  1WCM J;  2E2H J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...