1TWMA

Interleukin-1 beta mutant f146y
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
153
structure length
153
Chain Sequence
b'APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDYTMQFVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 beta
publication title Structural and energetic consequences of mutations in a solvated hydrophobic cavity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 28
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1twmA00
4KEKA 1HCEA 2E4MC 3A22A 3CA4A 4IZXA 1HIBA 2NM1A 2D20A 3VSZA 4EFRA 2I1BA 4I1EA 1J0SA 4QALA 5JMCA 3NBCA 5DUYA 2IWTB 4A7ZA 1HWMB 1K5VA 2XOAA 4A7YA 1PZZA 3ZXDA 2ET2A 3AKHA 1F31A 4G9MA 4GOVA 3V0AB 1V6XA 5EG6C 1DLLA 3HALA 3IM7A 4JAWA 5F90A 4ENDA 1ITBA 1EVTA 4FGFA 3WO2A 3HBWA 2F8XC 4KBBA 5FNXA 3SNVA 5DSSB 2Y9FA 3HMYA 2VSEA 5BP5A 2KKIA 3WINC 3OGGA 1FWUA 1V6UA 2FFUA 4LO3C 1FGAA 4ZBVB 3N7KA 3F62B 3HSMA 3RTJB 1IILA 1JT7A 4LO1C 1BFBA 2KLLA 3QYDA 4G6MA 2Y9GA 1FMMS 4LO0C 1Z2VA 5BOWA 3LLPA 4EFPA 3N7LA 1EPWA 1IOBA 3FJIA 4L4IA 4IY8A 3BRFA 4J2SA 3BRGC 1BLDA 4J23B 3CA1A 2VXTI 3O3QA 4G9NA 1ABRB 1Q03A 3FJCA 3OJVA 3BAOA 1HCDA 3OBRA 3VEQA 4ISRA 1TP0A 1JT5A 5BQUA 1JLYA 3O44A 2F2FC 1W3GA 1M2TB 4P0JA 3FFZA 1QQLA 3O4CA 3CA3A 2FDBM 4OWLA 3CA0A 1D0HA 1ISWA 4I1BA 1Q04A 1TFMB 3K1XA 4JPZA 3V0AA 3I2XA 3BAHA 4QBCA 3FJ9A 2VU9A 3BAUA 1S0FA 4JKQA 5EHAA 1JT4A 4OEEA 4ZKTB 4ZLBB 3H6RB 3I29B 3T8SA 1MD6A 4LO2C 4LO1A 1PWAA 4IYBA 3VSFA 1E0OA 3CU1B 2WRYA 4LO0A 3F1RA 41BIA 1PUMB 4OUJA 3BA4A 1PC8B 2Z49A 1VCLA 2P23A 4OW4A 3FJ8A 1WD3A 4X37A 4I4VA 2ESUA 2MC2A 4CJMA 2D7IA 4ZFYB 5FZZA 1DFCA 5EC5A 2D1ZA 1TIEA 5BXPA 1T4QA 1BFFA 4J2XA 4X39A 4X38A 1P63A 3FJFA 3O4AA 1FV2A 2HWMA 3WO3A 2AFGA 5BXRA 2VLCA 2YUGA 3RMYA 3PMEA 2GZBA 1IT0A 2MLLB 2RSTA 3FJJA 1T9FA 3FUQA 2VUAA 4IHZA 1UPSA 3R4SA 4ZA3B 4I6IA 4KEIA 3FJBA 1R8OA 2FO1A 3CAHA 2DRZA 1RG8A 1V6WA 2D43A 3A23A 3ZC8A 4I37A 4QO3A 5GAQA 4D8HA 4I3NA 1BA7A 3AZWA 4JRAA 3LTQA 3IM5A 3CA5A 5D61A 3O5WB 4I4QA 4OWJA 4D0ZA 2AQZA 1TOOA 3MPPG 3RSJA 3BRDA 4I96A 4ZGRB 3NJ5A 2R9KB 1AXMA 2ZQOA 3PHZA 3V0BB 3W9TA 3H6RA 3JUTA 2P39A 2X2TA 1QXMA 3WA1A 2NYYA 2BFHA 3Q7WA 1S0DA 1Z4SA 4A7KA 4I8MA 2HWAA 2DS0A 3AH2A 2MIBA 3OJMA 4II0A 2K43A 4OEGA 3OGFA 4X3AA 1RZOB 1FMZA 2E4MA 3VT1A 3I2AA 5FZYA 5E24E 1V6VA 1YYNA 2IHOA 4AN7B 3VT2A 1ISYA 2D24A 1HWPB 2DRYA 2KI6B 1BARA 1S0CA 4H9WA 1AFCA 4L4HA 3D7WB 3VUOA 1ISVA 1FN0A 3O4BA 2NP0A 1IHKA 4I7IA 1YXWA 3AKGA 1AVAC 3N0KA 4HA2A 3B9UA 3TC2A 1NUNA 1TWMA 1W3AA 1XZZA 3CRHA 4EEEB 1OQLB 1G9CA 4AN6A 1A8DA 1NZKA 3FJEA 21BIA 4XFSA 3S8KA 2Y9WC 1IRPA 5BXSA 4QKSA 1ISXA 1GGPB 1AVXB 1SR4C 2VSAA 4ZFUB 3BX1C 4G1RA 3ZXGA 1G9DA 2D7RA 1ISZA 2RQ9A 4I4RA 1FV3A 4JP0A 3WO4A 31BIA 3EF2A 5DVHA 3UJ4A 3WINA 3AH4A 5D62A 1HWNB 4J2KA 4LO3A 2Q3NB 3IAGC 1TWEA 4I2SA 2KH2A 1S0EA 4I4UA 4QKRA 1SZ6B 2J3PA 3V0BA 1G9BA 2KI4A 2HZ9A 2K8RA 4USOA 3AH1A 1W3FA 3BB2A 2X2SA 2Y9XE 1ILR1 5HPZA 1DJSB 5G00A 2ERMA 1I1BA 4IZEA 2QYIB 4LO8B 3ZX7A 4EKXB 3JRRA 3RTIB 1CE7B 3CA6A 1RY7A 4D0TA 2ZR1B 1JY0A 4I4PA 5BP5C 4IY9A 3IIRA 4FVVA 5BXTA 3UDAA 4KEJA 4GAIA 1PUUB 2Q9XA 1BFGA 4XFTA 2F2FA 3FJAA 4I0YA 3CQAA 3RMXA 4J2YA 7I1BA 3QR5A 2L5XA 3O49A 4I4SA 3BAGA 5FZUA 1DIWA 3BTAA 3WMUA 1EYLA 1Z0HA 1EV2A 4EFQA 4YOLA 3FJHA 3KMVA 3WMVA 4Q91A 5JLVA 4I4XA 4R6UB 4ISQA 3BA7A 1DQOA 2FGFA 2HW9A 3ZC9A 4LO2A 1HWOB 2K4AB 4Z8SB 3VWCA 3A07A 1AVWB 3R4UA 3HN1A 4G6JA 3CRGA 1DZCA 4OEFA 1XG6A 4QD2B 2WBCA 5BQUC 3OJ2A 3CRIA 2QN4A 1N4KA 5D63A 9ILBA 1M16A 1DZDA 3AZVA 5I1BA 3UD9A 1FQ9A 3VT0A 1DQGA 1QQKA 4P0KA 2RG9B 3P6JA 3FUOA 2ZQNA 1G82A 2Z48A 3FJDA 3BADA 4F83A 1Q1UA 1YTOA 3NBEA 4QD2C 3BA5A 2NVHA 4XFUA 1I1EA 1JLXA 4DCKC 2BEAA 3E8LC 1JTCA 2AXMA 1AF9A 3C9ZA 1AVUA 4LO7B 4JKXB 4ZFWB 3HOMA 1JT3A 4IQPA 4HR6C 1WBCA 1R8NA 6I1BA 3N7JA 1MC9A 4ZOTA 3IM6A 3N7MA 4QC4A 1L2HA 4I4OA 1ONKB 3H6QA 4LO7C 1WBAA 3P53A 4QBVA 3AKIA 3UJ0A 5BVPI 2D22A 2UUSA 2NTDA 2NZ9A 1DFQA 1II4A 4F34A 3NBNA 5F8WA 3POKA 3Q7YA 3PUBA 3UD7A 1G9AA 4KC3A 2LIQA 2VXRA 1BASA 2M49A 3BAVA 1YF8B 1IJTA 4Q9GA 4Z9WB 4TLPA 3MALA 3NBDA 3PG0A 5F8YA 3S8JA 2DREA 5B2HA 4HJJA 4Q9PA 3FJKA 1XHBA 4GAFA 2AAIB 5F8SA 1S0GA 4XKIA 5FNWA 4DENA 5DZUA 1WD4A 4GP0A 2D44A 3UD8A 3O4DA 3H6SE 4H04A 4DEPA 3A21A 1TTUA 4I4YA 4OWKA 1BLAA 4IONA 3Q7XA 2D23A 3P6IA 2GO2A 1XYFA 3AJ5A 3OBTA 1CVSA 4PC4A 3BAQA 4GP3A 4USPA 4JQ0A 4P6AA 1S0BA 2FFVA 1K5UA 3ILAA 8I1BA 3O4OA 1FWVA 1BFCA 1HKNA 4P0LA 1IRAX 4WBCA 3FGMA 4GOYA 4EB2B 1KNMA 1S0LA 1YBIA 3AKFA 2BEBA 1RMLA 1SR4A 3AJ6A 3V79C 1JQZA 2LIEA
chains in the Genus database with same CATH superfamily
4KEKA 1HCEA 2E4MC 3A22A 3CA4A 4IZXA 1HIBA 2NM1A 2D20A 3VSZA 4EFRA 2I1BA 4I1EA 1J0SA 4QALA 5JMCA 3NBCA 5DUYA 2IWTB 4A7ZA 1HWMB 1K5VA 2XOAA 4A7YA 1PZZA 3ZXDA 2ET2A 3AKHA 1F31A 4G9MA 4GOVA 3V0AB 1V6XA 5EG6C 1DLLA 3HALA 3IM7A 4JAWA 5F90A 4ENDA 1ITBA 1EVTA 4FGFA 3WO2A 3HBWA 2F8XC 4KBBA 5FNXA 3SNVA 5DSSB 2Y9FA 3HMYA 2VSEA 5BP5A 2KKIA 3WINC 3OGGA 1FWUA 1V6UA 2FFUA 4LO3C 1FGAA 4ZBVB 3N7KA 3F62B 3HSMA 3RTJB 1IILA 1JT7A 4LO1C 1BFBA 2KLLA 3QYDA 4G6MA 2Y9GA 1FMMS 4LO0C 1Z2VA 5BOWA 3LLPA 4EFPA 3N7LA 1EPWA 1IOBA 3FJIA 4L4IA 4IY8A 3BRFA 4J2SA 3BRGC 1BLDA 4J23B 3CA1A 2VXTI 3O3QA 4G9NA 1ABRB 1Q03A 3FJCA 3OJVA 3BAOA 1HCDA 3OBRA 3VEQA 4ISRA 1TP0A 1JT5A 5BQUA 1JLYA 3O44A 2F2FC 1W3GA 1M2TB 4P0JA 3FFZA 1QQLA 3O4CA 3CA3A 2FDBM 4OWLA 3CA0A 1D0HA 1ISWA 4I1BA 1Q04A 1TFMB 3K1XA 4JPZA 3V0AA 3I2XA 3BAHA 4QBCA 3FJ9A 2VU9A 3BAUA 4MZFB 1S0FA 4JKQA 5EHAA 1JT4A 4OEEA 4ZKTB 4ZLBB 3H6RB 3I29B 3T8SA 1MD6A 4LO2C 4LO1A 1PWAA 4IYBA 3VSFA 1E0OA 3CU1B 2WRYA 4LO0A 3F1RA 41BIA 1PUMB 4OUJA 4MZGB 3BA4A 1PC8B 2Z49A 1VCLA 2P23A 4OW4A 3FJ8A 1WD3A 4X37A 4I4VA 2ESUA 2MC2A 4CJMA 2D7IA 4ZFYB 5FZZA 1DFCA 5EC5A 2D1ZA 1TIEA 5BXPA 1T4QA 1BFFA 4J2XA 4X39A 4X38A 1P63A 3FJFA 3O4AA 1FV2A 2HWMA 3WO3A 2AFGA 5BXRA 2VLCA 2YUGA 3RMYA 3PMEA 2GZBA 1IT0A 2MLLB 2RSTA 3FJJA 1T9FA 3FUQA 2VUAA 4IHZA 1UPSA 3R4SA 4ZA3B 4I6IA 4KEIA 3FJBA 1R8OA 2FO1A 3CAHA 2DRZA 1RG8A 1V6WA 2D43A 3A23A 3ZC8A 4I37A 4QO3A 5GAQA 4D8HA 4I3NA 1BA7A 3AZWA 4JRAA 3LTQA 3IM5A 3CA5A 5D61A 3O5WB 4I4QA 4OWJA 4D0ZA 2AQZA 1TOOA 3MPPG 3RSJA 3BRDA 4I96A 4ZGRB 3NJ5A 2R9KB 1AXMA 2ZQOA 3PHZA 3V0BB 3W9TA 3H6RA 3JUTA 2P39A 2X2TA 1QXMA 3WA1A 2NYYA 2BFHA 3Q7WA 1S0DA 1Z4SA 4A7KA 4I8MA 2HWAA 2DS0A 3AH2A 2MIBA 3OJMA 4II0A 2K43A 4OEGA 3OGFA 4X3AA 1RZOB 1FMZA 2E4MA 3VT1A 3I2AA 5FZYA 5E24E 1V6VA 1YYNA 2IHOA 4AN7B 3VT2A 1ISYA 2D24A 1HWPB 2DRYA 2KI6B 1BARA 1S0CA 4H9WA 1AFCA 4L4HA 3D7WB 3VUOA 1ISVA 1FN0A 3O4BA 2NP0A 1IHKA 4I7IA 1YXWA 3AKGA 1AVAC 3N0KA 4HA2A 3B9UA 3TC2A 1NUNA 1TWMA 1W3AA 1XZZA 3CRHA 4EEEB 1OQLB 1G9CA 4AN6A 1A8DA 1NZKA 3FJEA 21BIA 4XFSA 3S8KA 2Y9WC 1IRPA 5BXSA 4QKSA 1ISXA 1GGPB 1AVXB 1SR4C 2VSAA 4ZFUB 3BX1C 4G1RA 3ZXGA 1G9DA 2D7RA 1ISZA 2RQ9A 4I4RA 1FV3A 4JP0A 3WO4A 31BIA 3EF2A 5DVHA 3UJ4A 3WINA 3AH4A 5D62A 1HWNB 4J2KA 4LO3A 2Q3NB 3IAGC 1TWEA 4I2SA 2KH2A 1S0EA 4I4UA 4QKRA 1SZ6B 2J3PA 3V0BA 1G9BA 2KI4A 2HZ9A 2K8RA 4USOA 3AH1A 1W3FA 3BB2A 2X2SA 2Y9XE 1ILR1 5HPZA 1DJSB 4UY4A 5G00A 2ERMA 1I1BA 4IZEA 2QYIB 4LO8B 3ZX7A 4EKXB 3JRRA 3RTIB 1CE7B 3CA6A 1RY7A 4D0TA 2ZR1B 1JY0A 4I4PA 5BP5C 4IY9A 3IIRA 4FVVA 5BXTA 3UDAA 4KEJA 4GAIA 1PUUB 2Q9XA 1BFGA 4XFTA 2F2FA 3FJAA 4I0YA 3CQAA 3RMXA 4J2YA 7I1BA 3QR5A 2L5XA 3O49A 4I4SA 3BAGA 5FZUA 1DIWA 3BTAA 3WMUA 1EYLA 1Z0HA 1EV2A 4EFQA 4YOLA 3FJHA 3KMVA 3WMVA 4Q91A 5JLVA 4I4XA 4R6UB 4ISQA 3BA7A 1DQOA 2FGFA 2HW9A 3ZC9A 4LO2A 1HWOB 2K4AB 4Z8SB 3VWCA 3A07A 1AVWB 3R4UA 3HN1A 4G6JA 3CRGA 1DZCA 4OEFA 1XG6A 4QD2B 2WBCA 5BQUC 3OJ2A 3CRIA 2QN4A 1N4KA 5D63A 9ILBA 1M16A 1DZDA 3AZVA 5I1BA 3UD9A 1FQ9A 3VT0A 1DQGA 1QQKA 4P0KA 2RG9B 4MZHA 3P6JA 3FUOA 2ZQNA 4H75A 1G82A 2Z48A 3FJDA 3BADA 4F83A 1Q1UA 1YTOA 3NBEA 4QD2C 3BA5A 2NVHA 4XFUA 1I1EA 1JLXA 4DCKC 2BEAA 3E8LC 1JTCA 2AXMA 1AF9A 3C9ZA 1AVUA 4LO7B 4JKXB 4ZFWB 3HOMA 1JT3A 4IQPA 4HR6C 1WBCA 1R8NA 6I1BA 3N7JA 1MC9A 4ZOTA 3IM6A 3N7MA 4QC4A 1L2HA 4I4OA 1ONKB 3H6QA 4LO7C 1WBAA 3P53A 4QBVA 3AKIA 3UJ0A 5BVPI 2D22A 2UUSA 2NTDA 2NZ9A 1DFQA 1II4A 4F34A 3NBNA 5F8WA 3POKA 3Q7YA 3PUBA 3UD7A 1G9AA 4KC3A 2LIQA 2VXRA 1BASA 2M49A 3BAVA 1YF8B 1IJTA 4Q9GA 4Z9WB 4TLPA 3MALA 3NBDA 3PG0A 5F8YA 3S8JA 2DREA 5B2HA 4HJJA 4Q9PA 3FJKA 1XHBA 4GAFA 2AAIB 5F8SA 1S0GA 4XKIA 5FNWA 4DENA 5DZUA 1WD4A 4GP0A 2D44A 3UD8A 3O4DA 3H6SE 4H04A 4DEPA 3A21A 1TTUA 4I4YA 4OWKA 1BLAA 4IONA 3Q7XA 2D23A 3P6IA 2GO2A 1XYFA 3AJ5A 3OBTA 1CVSA 4PC4A 3BAQA 2NS2A 4GP3A 4USPA 4JQ0A 4P6AA 1S0BA 2FFVA 1K5UA 3ILAA 8I1BA 3O4OA 1FWVA 1BFCA 1HKNA 4P0LA 1IRAX 4WBCA 3FGMA 4GOYA 4EB2B 1KNMA 1S0LA 1YBIA 3AKFA 2BEBA 1RMLA 1SR4A 3AJ6A 3V79C 1JQZA 2LIEA
chains in the Genus database with same CATH topology
4KEKA 1HCEA 2E4MC 3A22A 3CA4A 4IZXA 1HIBA 2NM1A 2D20A 3VSZA 4EFRA 2I1BA 4I1EA 1J0SA 4QALA 5JMCA 3NBCA 5DUYA 2IWTB 4A7ZA 1HWMB 1K5VA 2XOAA 4A7YA 1PZZA 3ZXDA 2ET2A 3AKHA 1F31A 4G9MA 4GOVA 3V0AB 1V6XA 5EG6C 1DLLA 3HALA 3IM7A 4JAWA 5F90A 4ENDA 1ITBA 1EVTA 4FGFA 3WO2A 3HBWA 2F8XC 4KBBA 5FNXA 3SNVA 5DSSB 2Y9FA 3HMYA 2VSEA 5BP5A 2KKIA 3WINC 3OGGA 1FWUA 1V6UA 2FFUA 4LO3C 1FGAA 4ZBVB 3N7KA 3F62B 3HSMA 3RTJB 1IILA 1JT7A 4LO1C 1BFBA 2KLLA 3QYDA 4G6MA 2Y9GA 1FMMS 4LO0C 1Z2VA 5BOWA 3LLPA 4EFPA 3N7LA 1EPWA 1IOBA 3FJIA 4L4IA 4IY8A 3BRFA 4J2SA 3BRGC 1BLDA 4J23B 3CA1A 2VXTI 3O3QA 4G9NA 1ABRB 1Q03A 3FJCA 3OJVA 3BAOA 1HCDA 3OBRA 3VEQA 4ISRA 1TP0A 1JT5A 5BQUA 1JLYA 3O44A 2F2FC 1W3GA 1M2TB 4P0JA 3FFZA 1QQLA 3O4CA 3CA3A 2FDBM 4OWLA 3CA0A 1D0HA 1ISWA 4I1BA 1Q04A 1TFMB 3K1XA 4JPZA 3V0AA 3I2XA 3BAHA 4QBCA 3FJ9A 2VU9A 3BAUA 4MZFB 1S0FA 4JKQA 5EHAA 1JT4A 4OEEA 4ZKTB 4ZLBB 3H6RB 3I29B 3T8SA 1MD6A 4LO2C 4LO1A 1PWAA 4IYBA 3VSFA 1E0OA 3CU1B 2WRYA 4LO0A 3F1RA 41BIA 1PUMB 4OUJA 4MZGB 3BA4A 1PC8B 2Z49A 1VCLA 2P23A 4OW4A 3FJ8A 1WD3A 4X37A 4I4VA 2ESUA 2MC2A 4CJMA 2D7IA 4ZFYB 5FZZA 1DFCA 5EC5A 2D1ZA 1TIEA 5BXPA 1T4QA 1BFFA 4J2XA 4X39A 4X38A 1P63A 3FJFA 3O4AA 1FV2A 2HWMA 3WO3A 2AFGA 5BXRA 2VLCA 2YUGA 3RMYA 3PMEA 2GZBA 1IT0A 2MLLB 2RSTA 3FJJA 1T9FA 3FUQA 2VUAA 4IHZA 1UPSA 3R4SA 4ZA3B 4I6IA 4KEIA 3FJBA 1R8OA 2FO1A 3CAHA 2DRZA 1RG8A 1V6WA 2D43A 3A23A 3ZC8A 4I37A 4QO3A 5GAQA 4D8HA 4I3NA 1BA7A 3AZWA 4JRAA 3LTQA 3IM5A 3CA5A 5D61A 3O5WB 4I4QA 4OWJA 4D0ZA 2AQZA 1TOOA 3MPPG 3RSJA 3BRDA 4I96A 4ZGRB 3NJ5A 2R9KB 1AXMA 2ZQOA 3PHZA 3V0BB 3W9TA 3H6RA 3JUTA 2P39A 2X2TA 1QXMA 3WA1A 2NYYA 2BFHA 3Q7WA 1S0DA 1Z4SA 4A7KA 4I8MA 2HWAA 2DS0A 3AH2A 2MIBA 3OJMA 4II0A 2K43A 4OEGA 3OGFA 4X3AA 1RZOB 1FMZA 2E4MA 3VT1A 3I2AA 5FZYA 5E24E 1V6VA 1YYNA 2IHOA 4AN7B 3VT2A 1ISYA 2D24A 1HWPB 2DRYA 2KI6B 1BARA 1S0CA 4H9WA 1AFCA 4L4HA 3D7WB 3VUOA 1ISVA 1FN0A 3O4BA 2NP0A 1IHKA 4I7IA 1YXWA 3AKGA 1AVAC 3N0KA 4HA2A 3B9UA 3TC2A 1NUNA 1TWMA 1W3AA 1XZZA 3CRHA 4EEEB 1OQLB 1G9CA 4AN6A 1A8DA 1NZKA 3FJEA 21BIA 4XFSA 3S8KA 2Y9WC 1IRPA 5BXSA 4QKSA 1ISXA 1GGPB 1AVXB 1SR4C 2VSAA 4ZFUB 3BX1C 4G1RA 3ZXGA 1G9DA 2D7RA 1ISZA 2RQ9A 4I4RA 1FV3A 4JP0A 3WO4A 31BIA 3EF2A 5DVHA 3UJ4A 3WINA 3AH4A 5D62A 1HWNB 4J2KA 4LO3A 2Q3NB 3IAGC 1TWEA 4I2SA 2KH2A 1S0EA 4I4UA 4QKRA 1SZ6B 2J3PA 3V0BA 1G9BA 2KI4A 2HZ9A 2K8RA 4USOA 3AH1A 1W3FA 3BB2A 2X2SA 2Y9XE 1ILR1 5HPZA 1DJSB 4UY4A 5G00A 2ERMA 1I1BA 4IZEA 2QYIB 4LO8B 3ZX7A 4EKXB 3JRRA 3RTIB 1CE7B 3CA6A 1RY7A 4D0TA 2ZR1B 1JY0A 4I4PA 5BP5C 4IY9A 3IIRA 4FVVA 5BXTA 3UDAA 4KEJA 4GAIA 1PUUB 2Q9XA 1BFGA 4XFTA 2F2FA 3FJAA 4I0YA 3CQAA 3RMXA 4J2YA 7I1BA 3QR5A 2L5XA 3O49A 4I4SA 3BAGA 5FZUA 1DIWA 3BTAA 3WMUA 1EYLA 1Z0HA 1EV2A 4EFQA 4YOLA 3FJHA 3KMVA 3WMVA 4Q91A 5JLVA 4I4XA 4R6UB 4ISQA 3BA7A 1DQOA 2FGFA 2HW9A 3ZC9A 4LO2A 1HWOB 2K4AB 4Z8SB 3VWCA 3A07A 1AVWB 3R4UA 3HN1A 4G6JA 3CRGA 1DZCA 4OEFA 1XG6A 4QD2B 2WBCA 5BQUC 3OJ2A 3CRIA 2QN4A 1N4KA 5D63A 9ILBA 1M16A 1DZDA 3AZVA 5I1BA 3UD9A 1FQ9A 3VT0A 1DQGA 1QQKA 4P0KA 2RG9B 4MZHA 3P6JA 3FUOA 2ZQNA 4H75A 1G82A 2Z48A 3FJDA 3BADA 4F83A 1Q1UA 1YTOA 3NBEA 4QD2C 3BA5A 2NVHA 4XFUA 1I1EA 1JLXA 4DCKC 2BEAA 3E8LC 1JTCA 2AXMA 1AF9A 3C9ZA 1AVUA 4LO7B 4JKXB 4ZFWB 3HOMA 1JT3A 4IQPA 4HR6C 1WBCA 1R8NA 6I1BA 3N7JA 1MC9A 4ZOTA 3IM6A 3N7MA 4QC4A 1L2HA 4I4OA 1ONKB 3H6QA 4LO7C 1WBAA 3P53A 4QBVA 3AKIA 3UJ0A 5BVPI 2D22A 2UUSA 2NTDA 2NZ9A 1DFQA 1II4A 4F34A 3NBNA 5F8WA 3POKA 3Q7YA 3PUBA 3UD7A 1G9AA 4KC3A 2LIQA 2VXRA 1BASA 2M49A 3BAVA 1YF8B 1IJTA 4Q9GA 4Z9WB 4TLPA 3MALA 3NBDA 3PG0A 5F8YA 3S8JA 2DREA 5B2HA 4HJJA 4Q9PA 3FJKA 1XHBA 4GAFA 2AAIB 5F8SA 1S0GA 4XKIA 5FNWA 4DENA 5DZUA 1WD4A 4GP0A 2D44A 3UD8A 3O4DA 3H6SE 4H04A 4DEPA 3A21A 1TTUA 4I4YA 4OWKA 1BLAA 4IONA 3Q7XA 2D23A 3P6IA 2GO2A 1XYFA 3AJ5A 3OBTA 1CVSA 4PC4A 3BAQA 2NS2A 4GP3A 4USPA 4JQ0A 4P6AA 1S0BA 2FFVA 1K5UA 3ILAA 8I1BA 3O4OA 1FWVA 1BFCA 1HKNA 4P0LA 1IRAX 4WBCA 3FGMA 4GOYA 4EB2B 1KNMA 1S0LA 1YBIA 3AKFA 2BEBA 1RMLA 1SR4A 3AJ6A 3V79C 1JQZA 2LIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KEK A;  1HCE A;  2E4M C;  3A22 A;  3CA4 A;  4IZX A;  1HIB A;  2NM1 A;  2D20 A;  3VSZ A;  4EFR A;  2I1B A;  4I1E A;  1J0S A;  4QAL A;  5JMC A;  3NBC A;  5DUY A;  2IWT B;  4A7Z A;  1HWM B;  1K5V A;  2XOA A;  4A7Y A;  1PZZ A;  3ZXD A;  2ET2 A;  3AKH A;  1F31 A;  4G9M A;  4GOV A;  3V0A B;  1V6X A;  5EG6 C;  1DLL A;  3HAL A;  3IM7 A;  4JAW A;  5F90 A;  4END A;  1ITB A;  1EVT A;  4FGF A;  3WO2 A;  3HBW A;  2F8X C;  4KBB A;  5FNX A;  3SNV A;  5DSS B;  2Y9F A;  3HMY A;  2VSE A;  5BP5 A;  2KKI A;  3WIN C;  3OGG A;  1FWU A;  1V6U A;  2FFU A;  4LO3 C;  1FGA A;  4ZBV B;  3N7K A;  3F62 B;  3HSM A;  3RTJ B;  1IIL A;  1JT7 A;  4LO1 C;  1BFB A;  2KLL A;  3QYD A;  4G6M A;  2Y9G A;  1FMM S;  4LO0 C;  1Z2V A;  5BOW A;  3LLP A;  4EFP A;  3N7L A;  1EPW A;  1IOB A;  3FJI A;  4L4I A;  4IY8 A;  3BRF A;  4J2S A;  3BRG C;  1BLD A;  4J23 B;  3CA1 A;  2VXT I;  3O3Q A;  4G9N A;  1ABR B;  1Q03 A;  3FJC A;  3OJV A;  3BAO A;  1HCD A;  3OBR A;  3VEQ A;  4ISR A;  1TP0 A;  1JT5 A;  5BQU A;  1JLY A;  3O44 A;  2F2F C;  1W3G A;  1M2T B;  4P0J A;  3FFZ A;  1QQL A;  3O4C A;  3CA3 A;  2FDB M;  4OWL A;  3CA0 A;  1D0H A;  1ISW A;  4I1B A;  1Q04 A;  1TFM B;  3K1X A;  4JPZ A;  3V0A A;  3I2X A;  3BAH A;  4QBC A;  3FJ9 A;  2VU9 A;  3BAU A;  1S0F A;  4JKQ A;  5EHA A;  1JT4 A;  4OEE A;  4ZKT B;  4ZLB B;  3H6R B;  3I29 B;  3T8S A;  1MD6 A;  4LO2 C;  4LO1 A;  1PWA A;  4IYB A;  3VSF A;  1E0O A;  3CU1 B;  2WRY A;  4LO0 A;  3F1R A;  41BI A;  1PUM B;  4OUJ A;  3BA4 A;  1PC8 B;  2Z49 A;  1VCL A;  2P23 A;  4OW4 A;  3FJ8 A;  1WD3 A;  4X37 A;  4I4V A;  2ESU A;  2MC2 A;  4CJM A;  2D7I A;  4ZFY B;  5FZZ A;  1DFC A;  5EC5 A;  2D1Z A;  1TIE A;  5BXP A;  1T4Q A;  1BFF A;  4J2X A;  4X39 A;  4X38 A;  1P63 A;  3FJF A;  3O4A A;  1FV2 A;  2HWM A;  3WO3 A;  2AFG A;  5BXR A;  2VLC A;  2YUG A;  3RMY A;  3PME A;  2GZB A;  1IT0 A;  2MLL B;  2RST A;  3FJJ A;  1T9F A;  3FUQ A;  2VUA A;  4IHZ A;  1UPS A;  3R4S A;  4ZA3 B;  4I6I A;  4KEI A;  3FJB A;  1R8O A;  2FO1 A;  3CAH A;  2DRZ A;  1RG8 A;  1V6W A;  2D43 A;  3A23 A;  3ZC8 A;  4I37 A;  4QO3 A;  5GAQ A;  4D8H A;  4I3N A;  1BA7 A;  3AZW A;  4JRA A;  3LTQ A;  3IM5 A;  3CA5 A;  5D61 A;  3O5W B;  4I4Q A;  4OWJ A;  4D0Z A;  2AQZ A;  1TOO A;  3MPP G;  3RSJ A;  3BRD A;  4I96 A;  4ZGR B;  3NJ5 A;  2R9K B;  1AXM A;  2ZQO A;  3PHZ A;  3V0B B;  3W9T A;  3H6R A;  3JUT A;  2P39 A;  2X2T A;  1QXM A;  3WA1 A;  2NYY A;  2BFH A;  3Q7W A;  1S0D A;  1Z4S A;  4A7K A;  4I8M A;  2HWA A;  2DS0 A;  3AH2 A;  2MIB A;  3OJM A;  4II0 A;  2K43 A;  4OEG A;  3OGF A;  4X3A A;  1RZO B;  1FMZ A;  2E4M A;  3VT1 A;  3I2A A;  5FZY A;  5E24 E;  1V6V A;  1YYN A;  2IHO A;  4AN7 B;  3VT2 A;  1ISY A;  2D24 A;  1HWP B;  2DRY A;  2KI6 B;  1BAR A;  1S0C A;  4H9W A;  1AFC A;  4L4H A;  3D7W B;  3VUO A;  1ISV A;  1FN0 A;  3O4B A;  2NP0 A;  1IHK A;  4I7I A;  1YXW A;  3AKG A;  1AVA C;  3N0K A;  4HA2 A;  3B9U A;  3TC2 A;  1NUN A;  1TWM A;  1W3A A;  1XZZ A;  3CRH A;  4EEE B;  1OQL B;  1G9C A;  4AN6 A;  1A8D A;  1NZK A;  3FJE A;  21BI A;  4XFS A;  3S8K A;  2Y9W C;  1IRP A;  5BXS A;  4QKS A;  1ISX A;  1GGP B;  1AVX B;  1SR4 C;  2VSA A;  4ZFU B;  3BX1 C;  4G1R A;  3ZXG A;  1G9D A;  2D7R A;  1ISZ A;  2RQ9 A;  4I4R A;  1FV3 A;  4JP0 A;  3WO4 A;  31BI A;  3EF2 A;  5DVH A;  3UJ4 A;  3WIN A;  3AH4 A;  5D62 A;  1HWN B;  4J2K A;  4LO3 A;  2Q3N B;  3IAG C;  1TWE A;  4I2S A;  2KH2 A;  1S0E A;  4I4U A;  4QKR A;  1SZ6 B;  2J3P A;  3V0B A;  1G9B A;  2KI4 A;  2HZ9 A;  2K8R A;  4USO A;  3AH1 A;  1W3F A;  3BB2 A;  2X2S A;  2Y9X E;  1ILR 1;  5HPZ A;  1DJS B;  5G00 A;  2ERM A;  1I1B A;  4IZE A;  2QYI B;  4LO8 B;  3ZX7 A;  4EKX B;  3JRR A;  3RTI B;  1CE7 B;  3CA6 A;  1RY7 A;  4D0T A;  2ZR1 B;  1JY0 A;  4I4P A;  5BP5 C;  4IY9 A;  3IIR A;  4FVV A;  5BXT A;  3UDA A;  4KEJ A;  4GAI A;  1PUU B;  2Q9X A;  1BFG A;  4XFT A;  2F2F A;  3FJA A;  4I0Y A;  3CQA A;  3RMX A;  4J2Y A;  7I1B A;  3QR5 A;  2L5X A;  3O49 A;  4I4S A;  3BAG A;  5FZU A;  1DIW A;  3BTA A;  3WMU A;  1EYL A;  1Z0H A;  1EV2 A;  4EFQ A;  4YOL A;  3FJH A;  3KMV A;  3WMV A;  4Q91 A;  5JLV A;  4I4X A;  4R6U B;  4ISQ A;  3BA7 A;  1DQO A;  2FGF A;  2HW9 A;  3ZC9 A;  4LO2 A;  1HWO B;  2K4A B;  4Z8S B;  3VWC A;  3A07 A;  1AVW B;  3R4U A;  3HN1 A;  4G6J A;  3CRG A;  1DZC A;  4OEF A;  1XG6 A;  4QD2 B;  2WBC A;  5BQU C;  3OJ2 A;  3CRI A;  2QN4 A;  1N4K A;  5D63 A;  9ILB A;  1M16 A;  1DZD A;  3AZV A;  5I1B A;  3UD9 A;  1FQ9 A;  3VT0 A;  1DQG A;  1QQK A;  4P0K A;  2RG9 B;  3P6J A;  3FUO A;  2ZQN A;  1G82 A;  2Z48 A;  3FJD A;  3BAD A;  4F83 A;  1Q1U A;  1YTO A;  3NBE A;  4QD2 C;  3BA5 A;  2NVH A;  4XFU A;  1I1E A;  1JLX A;  4DCK C;  2BEA A;  3E8L C;  1JTC A;  2AXM A;  1AF9 A;  3C9Z A;  1AVU A;  4LO7 B;  4JKX B;  4ZFW B;  3HOM A;  1JT3 A;  4IQP A;  4HR6 C;  1WBC A;  1R8N A;  6I1B A;  3N7J A;  1MC9 A;  4ZOT A;  3IM6 A;  3N7M A;  4QC4 A;  1L2H A;  4I4O A;  1ONK B;  3H6Q A;  4LO7 C;  1WBA A;  3P53 A;  4QBV A;  3AKI A;  3UJ0 A;  5BVP I;  2D22 A;  2UUS A;  2NTD A;  2NZ9 A;  1DFQ A;  1II4 A;  4F34 A;  3NBN A;  5F8W A;  3POK A;  3Q7Y A;  3PUB A;  3UD7 A;  1G9A A;  4KC3 A;  2LIQ A;  2VXR A;  1BAS A;  2M49 A;  3BAV A;  1YF8 B;  1IJT A;  4Q9G A;  4Z9W B;  4TLP A;  3MAL A;  3NBD A;  3PG0 A;  5F8Y A;  3S8J A;  2DRE A;  5B2H A;  4HJJ A;  4Q9P A;  3FJK A;  1XHB A;  4GAF A;  2AAI B;  5F8S A;  1S0G A;  4XKI A;  5FNW A;  4DEN A;  5DZU A;  1WD4 A;  4GP0 A;  2D44 A;  3UD8 A;  3O4D A;  3H6S E;  4H04 A;  4DEP A;  3A21 A;  1TTU A;  4I4Y A;  4OWK A;  1BLA A;  4ION A;  3Q7X A;  2D23 A;  3P6I A;  2GO2 A;  1XYF A;  3AJ5 A;  3OBT A;  1CVS A;  4PC4 A;  3BAQ A;  4GP3 A;  4USP A;  4JQ0 A;  4P6A A;  1S0B A;  2FFV A;  1K5U A;  3ILA A;  8I1B A;  3O4O A;  1FWV A;  1BFC A;  1HKN A;  4P0L A;  1IRA X;  4WBC A;  3FGM A;  4GOY A;  4EB2 B;  1KNM A;  1S0L A;  1YBI A;  3AKF A;  2BEB A;  1RML A;  1SR4 A;  3AJ6 A;  3V79 C;  1JQZ A;  2LIE A; 
#chains in the Genus database with same CATH topology
 4KEK A;  1HCE A;  2E4M C;  3A22 A;  3CA4 A;  4IZX A;  1HIB A;  2NM1 A;  2D20 A;  3VSZ A;  4EFR A;  2I1B A;  4I1E A;  1J0S A;  4QAL A;  5JMC A;  3NBC A;  5DUY A;  2IWT B;  4A7Z A;  1HWM B;  1K5V A;  2XOA A;  4A7Y A;  1PZZ A;  3ZXD A;  2ET2 A;  3AKH A;  1F31 A;  4G9M A;  4GOV A;  3V0A B;  1V6X A;  5EG6 C;  1DLL A;  3HAL A;  3IM7 A;  4JAW A;  5F90 A;  4END A;  1ITB A;  1EVT A;  4FGF A;  3WO2 A;  3HBW A;  2F8X C;  4KBB A;  5FNX A;  3SNV A;  5DSS B;  2Y9F A;  3HMY A;  2VSE A;  5BP5 A;  2KKI A;  3WIN C;  3OGG A;  1FWU A;  1V6U A;  2FFU A;  4LO3 C;  1FGA A;  4ZBV B;  3N7K A;  3F62 B;  3HSM A;  3RTJ B;  1IIL A;  1JT7 A;  4LO1 C;  1BFB A;  2KLL A;  3QYD A;  4G6M A;  2Y9G A;  1FMM S;  4LO0 C;  1Z2V A;  5BOW A;  3LLP A;  4EFP A;  3N7L A;  1EPW A;  1IOB A;  3FJI A;  4L4I A;  4IY8 A;  3BRF A;  4J2S A;  3BRG C;  1BLD A;  4J23 B;  3CA1 A;  2VXT I;  3O3Q A;  4G9N A;  1ABR B;  1Q03 A;  3FJC A;  3OJV A;  3BAO A;  1HCD A;  3OBR A;  3VEQ A;  4ISR A;  1TP0 A;  1JT5 A;  5BQU A;  1JLY A;  3O44 A;  2F2F C;  1W3G A;  1M2T B;  4P0J A;  3FFZ A;  1QQL A;  3O4C A;  3CA3 A;  2FDB M;  4OWL A;  3CA0 A;  1D0H A;  1ISW A;  4I1B A;  1Q04 A;  1TFM B;  3K1X A;  4JPZ A;  3V0A A;  3I2X A;  3BAH A;  4QBC A;  3FJ9 A;  2VU9 A;  3BAU A;  4MZF B;  1S0F A;  4JKQ A;  5EHA A;  1JT4 A;  4OEE A;  4ZKT B;  4ZLB B;  3H6R B;  3I29 B;  3T8S A;  1MD6 A;  4LO2 C;  4LO1 A;  1PWA A;  4IYB A;  3VSF A;  1E0O A;  3CU1 B;  2WRY A;  4LO0 A;  3F1R A;  41BI A;  1PUM B;  4OUJ A;  4MZG B;  3BA4 A;  1PC8 B;  2Z49 A;  1VCL A;  2P23 A;  4OW4 A;  3FJ8 A;  1WD3 A;  4X37 A;  4I4V A;  2ESU A;  2MC2 A;  4CJM A;  2D7I A;  4ZFY B;  5FZZ A;  1DFC A;  5EC5 A;  2D1Z A;  1TIE A;  5BXP A;  1T4Q A;  1BFF A;  4J2X A;  4X39 A;  4X38 A;  1P63 A;  3FJF A;  3O4A A;  1FV2 A;  2HWM A;  3WO3 A;  2AFG A;  5BXR A;  2VLC A;  2YUG A;  3RMY A;  3PME A;  2GZB A;  1IT0 A;  2MLL B;  2RST A;  3FJJ A;  1T9F A;  3FUQ A;  2VUA A;  4IHZ A;  1UPS A;  3R4S A;  4ZA3 B;  4I6I A;  4KEI A;  3FJB A;  1R8O A;  2FO1 A;  3CAH A;  2DRZ A;  1RG8 A;  1V6W A;  2D43 A;  3A23 A;  3ZC8 A;  4I37 A;  4QO3 A;  5GAQ A;  4D8H A;  4I3N A;  1BA7 A;  3AZW A;  4JRA A;  3LTQ A;  3IM5 A;  3CA5 A;  5D61 A;  3O5W B;  4I4Q A;  4OWJ A;  4D0Z A;  2AQZ A;  1TOO A;  3MPP G;  3RSJ A;  3BRD A;  4I96 A;  4ZGR B;  3NJ5 A;  2R9K B;  1AXM A;  2ZQO A;  3PHZ A;  3V0B B;  3W9T A;  3H6R A;  3JUT A;  2P39 A;  2X2T A;  1QXM A;  3WA1 A;  2NYY A;  2BFH A;  3Q7W A;  1S0D A;  1Z4S A;  4A7K A;  4I8M A;  2HWA A;  2DS0 A;  3AH2 A;  2MIB A;  3OJM A;  4II0 A;  2K43 A;  4OEG A;  3OGF A;  4X3A A;  1RZO B;  1FMZ A;  2E4M A;  3VT1 A;  3I2A A;  5FZY A;  5E24 E;  1V6V A;  1YYN A;  2IHO A;  4AN7 B;  3VT2 A;  1ISY A;  2D24 A;  1HWP B;  2DRY A;  2KI6 B;  1BAR A;  1S0C A;  4H9W A;  1AFC A;  4L4H A;  3D7W B;  3VUO A;  1ISV A;  1FN0 A;  3O4B A;  2NP0 A;  1IHK A;  4I7I A;  1YXW A;  3AKG A;  1AVA C;  3N0K A;  4HA2 A;  3B9U A;  3TC2 A;  1NUN A;  1TWM A;  1W3A A;  1XZZ A;  3CRH A;  4EEE B;  1OQL B;  1G9C A;  4AN6 A;  1A8D A;  1NZK A;  3FJE A;  21BI A;  4XFS A;  3S8K A;  2Y9W C;  1IRP A;  5BXS A;  4QKS A;  1ISX A;  1GGP B;  1AVX B;  1SR4 C;  2VSA A;  4ZFU B;  3BX1 C;  4G1R A;  3ZXG A;  1G9D A;  2D7R A;  1ISZ A;  2RQ9 A;  4I4R A;  1FV3 A;  4JP0 A;  3WO4 A;  31BI A;  3EF2 A;  5DVH A;  3UJ4 A;  3WIN A;  3AH4 A;  5D62 A;  1HWN B;  4J2K A;  4LO3 A;  2Q3N B;  3IAG C;  1TWE A;  4I2S A;  2KH2 A;  1S0E A;  4I4U A;  4QKR A;  1SZ6 B;  2J3P A;  3V0B A;  1G9B A;  2KI4 A;  2HZ9 A;  2K8R A;  4USO A;  3AH1 A;  1W3F A;  3BB2 A;  2X2S A;  2Y9X E;  1ILR 1;  5HPZ A;  1DJS B;  4UY4 A;  5G00 A;  2ERM A;  1I1B A;  4IZE A;  2QYI B;  4LO8 B;  3ZX7 A;  4EKX B;  3JRR A;  3RTI B;  1CE7 B;  3CA6 A;  1RY7 A;  4D0T A;  2ZR1 B;  1JY0 A;  4I4P A;  5BP5 C;  4IY9 A;  3IIR A;  4FVV A;  5BXT A;  3UDA A;  4KEJ A;  4GAI A;  1PUU B;  2Q9X A;  1BFG A;  4XFT A;  2F2F A;  3FJA A;  4I0Y A;  3CQA A;  3RMX A;  4J2Y A;  7I1B A;  3QR5 A;  2L5X A;  3O49 A;  4I4S A;  3BAG A;  5FZU A;  1DIW A;  3BTA A;  3WMU A;  1EYL A;  1Z0H A;  1EV2 A;  4EFQ A;  4YOL A;  3FJH A;  3KMV A;  3WMV A;  4Q91 A;  5JLV A;  4I4X A;  4R6U B;  4ISQ A;  3BA7 A;  1DQO A;  2FGF A;  2HW9 A;  3ZC9 A;  4LO2 A;  1HWO B;  2K4A B;  4Z8S B;  3VWC A;  3A07 A;  1AVW B;  3R4U A;  3HN1 A;  4G6J A;  3CRG A;  1DZC A;  4OEF A;  1XG6 A;  4QD2 B;  2WBC A;  5BQU C;  3OJ2 A;  3CRI A;  2QN4 A;  1N4K A;  5D63 A;  9ILB A;  1M16 A;  1DZD A;  3AZV A;  5I1B A;  3UD9 A;  1FQ9 A;  3VT0 A;  1DQG A;  1QQK A;  4P0K A;  2RG9 B;  4MZH A;  3P6J A;  3FUO A;  2ZQN A;  4H75 A;  1G82 A;  2Z48 A;  3FJD A;  3BAD A;  4F83 A;  1Q1U A;  1YTO A;  3NBE A;  4QD2 C;  3BA5 A;  2NVH A;  4XFU A;  1I1E A;  1JLX A;  4DCK C;  2BEA A;  3E8L C;  1JTC A;  2AXM A;  1AF9 A;  3C9Z A;  1AVU A;  4LO7 B;  4JKX B;  4ZFW B;  3HOM A;  1JT3 A;  4IQP A;  4HR6 C;  1WBC A;  1R8N A;  6I1B A;  3N7J A;  1MC9 A;  4ZOT A;  3IM6 A;  3N7M A;  4QC4 A;  1L2H A;  4I4O A;  1ONK B;  3H6Q A;  4LO7 C;  1WBA A;  3P53 A;  4QBV A;  3AKI A;  3UJ0 A;  5BVP I;  2D22 A;  2UUS A;  2NTD A;  2NZ9 A;  1DFQ A;  1II4 A;  4F34 A;  3NBN A;  5F8W A;  3POK A;  3Q7Y A;  3PUB A;  3UD7 A;  1G9A A;  4KC3 A;  2LIQ A;  2VXR A;  1BAS A;  2M49 A;  3BAV A;  1YF8 B;  1IJT A;  4Q9G A;  4Z9W B;  4TLP A;  3MAL A;  3NBD A;  3PG0 A;  5F8Y A;  3S8J A;  2DRE A;  5B2H A;  4HJJ A;  4Q9P A;  3FJK A;  1XHB A;  4GAF A;  2AAI B;  5F8S A;  1S0G A;  4XKI A;  5FNW A;  4DEN A;  5DZU A;  1WD4 A;  4GP0 A;  2D44 A;  3UD8 A;  3O4D A;  3H6S E;  4H04 A;  4DEP A;  3A21 A;  1TTU A;  4I4Y A;  4OWK A;  1BLA A;  4ION A;  3Q7X A;  2D23 A;  3P6I A;  2GO2 A;  1XYF A;  3AJ5 A;  3OBT A;  1CVS A;  4PC4 A;  3BAQ A;  2NS2 A;  4GP3 A;  4USP A;  4JQ0 A;  4P6A A;  1S0B A;  2FFV A;  1K5U A;  3ILA A;  8I1B A;  3O4O A;  1FWV A;  1BFC A;  1HKN A;  4P0L A;  1IRA X;  4WBC A;  3FGM A;  4GOY A;  4EB2 B;  1KNM A;  1S0L A;  1YBI A;  3AKF A;  2BEB A;  1RML A;  1SR4 A;  3AJ6 A;  3V79 C;  1JQZ A;  2LIE A; 
#chains in the Genus database with same CATH homology
 4KEK A;  1HCE A;  2E4M C;  3A22 A;  3CA4 A;  4IZX A;  1HIB A;  2NM1 A;  2D20 A;  3VSZ A;  4EFR A;  2I1B A;  4I1E A;  1J0S A;  4QAL A;  5JMC A;  3NBC A;  5DUY A;  2IWT B;  4A7Z A;  1HWM B;  1K5V A;  2XOA A;  4A7Y A;  1PZZ A;  3ZXD A;  2ET2 A;  3AKH A;  1F31 A;  4G9M A;  4GOV A;  3V0A B;  1V6X A;  5EG6 C;  1DLL A;  3HAL A;  3IM7 A;  4JAW A;  5F90 A;  4END A;  1ITB A;  1EVT A;  4FGF A;  3WO2 A;  3HBW A;  2F8X C;  4KBB A;  5FNX A;  3SNV A;  5DSS B;  2Y9F A;  3HMY A;  2VSE A;  5BP5 A;  2KKI A;  3WIN C;  3OGG A;  1FWU A;  1V6U A;  2FFU A;  4LO3 C;  1FGA A;  4ZBV B;  3N7K A;  3F62 B;  3HSM A;  3RTJ B;  1IIL A;  1JT7 A;  4LO1 C;  1BFB A;  2KLL A;  3QYD A;  4G6M A;  2Y9G A;  1FMM S;  4LO0 C;  1Z2V A;  5BOW A;  3LLP A;  4EFP A;  3N7L A;  1EPW A;  1IOB A;  3FJI A;  4L4I A;  4IY8 A;  3BRF A;  4J2S A;  3BRG C;  1BLD A;  4J23 B;  3CA1 A;  2VXT I;  3O3Q A;  4G9N A;  1ABR B;  1Q03 A;  3FJC A;  3OJV A;  3BAO A;  1HCD A;  3OBR A;  3VEQ A;  4ISR A;  1TP0 A;  1JT5 A;  5BQU A;  1JLY A;  3O44 A;  2F2F C;  1W3G A;  1M2T B;  4P0J A;  3FFZ A;  1QQL A;  3O4C A;  3CA3 A;  2FDB M;  4OWL A;  3CA0 A;  1D0H A;  1ISW A;  4I1B A;  1Q04 A;  1TFM B;  3K1X A;  4JPZ A;  3V0A A;  3I2X A;  3BAH A;  4QBC A;  3FJ9 A;  2VU9 A;  3BAU A;  4MZF B;  1S0F A;  4JKQ A;  5EHA A;  1JT4 A;  4OEE A;  4ZKT B;  4ZLB B;  3H6R B;  3I29 B;  3T8S A;  1MD6 A;  4LO2 C;  4LO1 A;  1PWA A;  4IYB A;  3VSF A;  1E0O A;  3CU1 B;  2WRY A;  4LO0 A;  3F1R A;  41BI A;  1PUM B;  4OUJ A;  4MZG B;  3BA4 A;  1PC8 B;  2Z49 A;  1VCL A;  2P23 A;  4OW4 A;  3FJ8 A;  1WD3 A;  4X37 A;  4I4V A;  2ESU A;  2MC2 A;  4CJM A;  2D7I A;  4ZFY B;  5FZZ A;  1DFC A;  5EC5 A;  2D1Z A;  1TIE A;  5BXP A;  1T4Q A;  1BFF A;  4J2X A;  4X39 A;  4X38 A;  1P63 A;  3FJF A;  3O4A A;  1FV2 A;  2HWM A;  3WO3 A;  2AFG A;  5BXR A;  2VLC A;  2YUG A;  3RMY A;  3PME A;  2GZB A;  1IT0 A;  2MLL B;  2RST A;  3FJJ A;  1T9F A;  3FUQ A;  2VUA A;  4IHZ A;  1UPS A;  3R4S A;  4ZA3 B;  4I6I A;  4KEI A;  3FJB A;  1R8O A;  2FO1 A;  3CAH A;  2DRZ A;  1RG8 A;  1V6W A;  2D43 A;  3A23 A;  3ZC8 A;  4I37 A;  4QO3 A;  5GAQ A;  4D8H A;  4I3N A;  1BA7 A;  3AZW A;  4JRA A;  3LTQ A;  3IM5 A;  3CA5 A;  5D61 A;  3O5W B;  4I4Q A;  4OWJ A;  4D0Z A;  2AQZ A;  1TOO A;  3MPP G;  3RSJ A;  3BRD A;  4I96 A;  4ZGR B;  3NJ5 A;  2R9K B;  1AXM A;  2ZQO A;  3PHZ A;  3V0B B;  3W9T A;  3H6R A;  3JUT A;  2P39 A;  2X2T A;  1QXM A;  3WA1 A;  2NYY A;  2BFH A;  3Q7W A;  1S0D A;  1Z4S A;  4A7K A;  4I8M A;  2HWA A;  2DS0 A;  3AH2 A;  2MIB A;  3OJM A;  4II0 A;  2K43 A;  4OEG A;  3OGF A;  4X3A A;  1RZO B;  1FMZ A;  2E4M A;  3VT1 A;  3I2A A;  5FZY A;  5E24 E;  1V6V A;  1YYN A;  2IHO A;  4AN7 B;  3VT2 A;  1ISY A;  2D24 A;  1HWP B;  2DRY A;  2KI6 B;  1BAR A;  1S0C A;  4H9W A;  1AFC A;  4L4H A;  3D7W B;  3VUO A;  1ISV A;  1FN0 A;  3O4B A;  2NP0 A;  1IHK A;  4I7I A;  1YXW A;  3AKG A;  1AVA C;  3N0K A;  4HA2 A;  3B9U A;  3TC2 A;  1NUN A;  1TWM A;  1W3A A;  1XZZ A;  3CRH A;  4EEE B;  1OQL B;  1G9C A;  4AN6 A;  1A8D A;  1NZK A;  3FJE A;  21BI A;  4XFS A;  3S8K A;  2Y9W C;  1IRP A;  5BXS A;  4QKS A;  1ISX A;  1GGP B;  1AVX B;  1SR4 C;  2VSA A;  4ZFU B;  3BX1 C;  4G1R A;  3ZXG A;  1G9D A;  2D7R A;  1ISZ A;  2RQ9 A;  4I4R A;  1FV3 A;  4JP0 A;  3WO4 A;  31BI A;  3EF2 A;  5DVH A;  3UJ4 A;  3WIN A;  3AH4 A;  5D62 A;  1HWN B;  4J2K A;  4LO3 A;  2Q3N B;  3IAG C;  1TWE A;  4I2S A;  2KH2 A;  1S0E A;  4I4U A;  4QKR A;  1SZ6 B;  2J3P A;  3V0B A;  1G9B A;  2KI4 A;  2HZ9 A;  2K8R A;  4USO A;  3AH1 A;  1W3F A;  3BB2 A;  2X2S A;  2Y9X E;  1ILR 1;  5HPZ A;  1DJS B;  4UY4 A;  5G00 A;  2ERM A;  1I1B A;  4IZE A;  2QYI B;  4LO8 B;  3ZX7 A;  4EKX B;  3JRR A;  3RTI B;  1CE7 B;  3CA6 A;  1RY7 A;  4D0T A;  2ZR1 B;  1JY0 A;  4I4P A;  5BP5 C;  4IY9 A;  3IIR A;  4FVV A;  5BXT A;  3UDA A;  4KEJ A;  4GAI A;  1PUU B;  2Q9X A;  1BFG A;  4XFT A;  2F2F A;  3FJA A;  4I0Y A;  3CQA A;  3RMX A;  4J2Y A;  7I1B A;  3QR5 A;  2L5X A;  3O49 A;  4I4S A;  3BAG A;  5FZU A;  1DIW A;  3BTA A;  3WMU A;  1EYL A;  1Z0H A;  1EV2 A;  4EFQ A;  4YOL A;  3FJH A;  3KMV A;  3WMV A;  4Q91 A;  5JLV A;  4I4X A;  4R6U B;  4ISQ A;  3BA7 A;  1DQO A;  2FGF A;  2HW9 A;  3ZC9 A;  4LO2 A;  1HWO B;  2K4A B;  4Z8S B;  3VWC A;  3A07 A;  1AVW B;  3R4U A;  3HN1 A;  4G6J A;  3CRG A;  1DZC A;  4OEF A;  1XG6 A;  4QD2 B;  2WBC A;  5BQU C;  3OJ2 A;  3CRI A;  2QN4 A;  1N4K A;  5D63 A;  9ILB A;  1M16 A;  1DZD A;  3AZV A;  5I1B A;  3UD9 A;  1FQ9 A;  3VT0 A;  1DQG A;  1QQK A;  4P0K A;  2RG9 B;  4MZH A;  3P6J A;  3FUO A;  2ZQN A;  4H75 A;  1G82 A;  2Z48 A;  3FJD A;  3BAD A;  4F83 A;  1Q1U A;  1YTO A;  3NBE A;  4QD2 C;  3BA5 A;  2NVH A;  4XFU A;  1I1E A;  1JLX A;  4DCK C;  2BEA A;  3E8L C;  1JTC A;  2AXM A;  1AF9 A;  3C9Z A;  1AVU A;  4LO7 B;  4JKX B;  4ZFW B;  3HOM A;  1JT3 A;  4IQP A;  4HR6 C;  1WBC A;  1R8N A;  6I1B A;  3N7J A;  1MC9 A;  4ZOT A;  3IM6 A;  3N7M A;  4QC4 A;  1L2H A;  4I4O A;  1ONK B;  3H6Q A;  4LO7 C;  1WBA A;  3P53 A;  4QBV A;  3AKI A;  3UJ0 A;  5BVP I;  2D22 A;  2UUS A;  2NTD A;  2NZ9 A;  1DFQ A;  1II4 A;  4F34 A;  3NBN A;  5F8W A;  3POK A;  3Q7Y A;  3PUB A;  3UD7 A;  1G9A A;  4KC3 A;  2LIQ A;  2VXR A;  1BAS A;  2M49 A;  3BAV A;  1YF8 B;  1IJT A;  4Q9G A;  4Z9W B;  4TLP A;  3MAL A;  3NBD A;  3PG0 A;  5F8Y A;  3S8J A;  2DRE A;  5B2H A;  4HJJ A;  4Q9P A;  3FJK A;  1XHB A;  4GAF A;  2AAI B;  5F8S A;  1S0G A;  4XKI A;  5FNW A;  4DEN A;  5DZU A;  1WD4 A;  4GP0 A;  2D44 A;  3UD8 A;  3O4D A;  3H6S E;  4H04 A;  4DEP A;  3A21 A;  1TTU A;  4I4Y A;  4OWK A;  1BLA A;  4ION A;  3Q7X A;  2D23 A;  3P6I A;  2GO2 A;  1XYF A;  3AJ5 A;  3OBT A;  1CVS A;  4PC4 A;  3BAQ A;  2NS2 A;  4GP3 A;  4USP A;  4JQ0 A;  4P6A A;  1S0B A;  2FFV A;  1K5U A;  3ILA A;  8I1B A;  3O4O A;  1FWV A;  1BFC A;  1HKN A;  4P0L A;  1IRA X;  4WBC A;  3FGM A;  4GOY A;  4EB2 B;  1KNM A;  1S0L A;  1YBI A;  3AKF A;  2BEB A;  1RML A;  1SR4 A;  3AJ6 A;  3V79 C;  1JQZ A;  2LIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...