1TX4B

Rho/rhogap/gdp(dot)alf4 complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
177
structure length
174
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVNSKDQFYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure at 1.65 A of RhoA and its GTPase-activating protein in complex with a transition-state analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex(gtpase activatn/proto-oncogene)
molecule keywords P50-RHOGAP
total genus 58
structure length 174
sequence length 177
ec nomenclature
pdb deposition date 1997-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1tx4B00
1FQJA 1NF3A 2YOHA 2BC9A 2R2AA 2RCNA 2DYKA 2WSSA 4DDVA 2R6CA 1NVUQ 5GJCA 1CU1A 3NBZC 1W49A 1G5TA 1XXHB 2JLWA 2EYQA 4B2PA 1JR6A 3LO5A 3Q7PA 2ANBA 1UBFA 1I4DD 2D2EA 3P32A 1Z0IA 4EQ6B 4JBYA 3QF7A 4EPTA 3NC1C 1GL7A 2HF9A 4Z1MD 1IN6A 1NBME 1Y63A 1X8JA 1JNYA 4BZXA 1N25A 2F6RA 2ZS7A 5G3ZA 1M34E 2OILA 1XEWX 3DZ8A 2EFEB 5AJWA 2ZUDA 3Q72A 2JLVA 1Z63A 2P0EA 2PX3A 3AKYA 3T61A 4D4LA 5KHOC 2OO7A 1T0JB 2WWFA 1KDTA 1UKYA 1WP9A 4NMMA 1IQPA 2Q0HA 2WBLC 4IOKA 4C0BA 4DWJA 1Z0JA 4RD0A 3HYTA 3CUEF 3UPUA 1PVOA 1CIPA 1P73A 1WBDA 3K8YA 4NHOA 2HLDD 3QEJA 3BE4A 1AS2A 3W6PA 2XJ4A 2GCNA 3HDTA 1ZM2A 3R9XA 4NL4H 5EXTA 3V4RA 5KYKA 2Q9BA 1YZKA 3EIQA 1QVAA 2JJ1A 4MA4A 2WJHA 1J8MF 4DIEA 5G53C 1QG4A 5EP3A 1BYIA 4HUQA 1E2NA 2ZSDA 4BRUA 2ZREA 1IN5A 4NU0A 4PAOA 2XGJA 2PZGA 4NH0A 4AKGA 4LYHA 2XTNA 1E2EA 3AVTA 2Q3FA 5DI3B 4LJ8A 4D80A 1D6JA 3K70C 2ZJ8A 2JLUA 2O8EB 3FHOA 3THWB 4LHVA 1LVGA 4CGZA 4N1AA 4C0LA 1R0WA 2G1JA 2JLYA 2P5SA 3T34A 4PPGA 4EPXA 3IQXA 1ZD1A 3A1TA 1E6CA 1CEEA 2HEIA 2QENA 5TB5A 4QBIA 2F1HA 2RMKA 4PPNA 2YVUA 2XB2A 1P3JA 1KI3A 4MUBA 1M74A 3IHLA 4IFEA 4EUNA 1WE2A 3GEEA 1CJVC 4LHYA 1Z0AA 3SDZA 4C0HA 4AI6A 4PAMA 3EWSA 2ZRFA 1AN0A 3RWMB 2D06A 4PPQA 4KODA 5JCZA 3CNNA 3H2YA 5DLQC 4LJ9A 4M22A 3NEYA 1J2JA 1JQLB 2JATA 4JIMA 1JR3D 3TW8B 2ODBA 1KSFX 2QTFA 4QBGB 3DOEA 1M7GA 3B6EA 4NCIA 4RZUA 3AP3A 4TQAA 1G7RA 1JB1A 4XTRA 5FFMA 3RHFA 1A1VA 1P9NA 4URUR 3THOA 2O8BB 1ZMXA 5IT5A 4Q47A 1RYHA 1KDRA 4IDQA 2ZSAA 1E2MA 3ZZTA 2IS6A 2QI9C 2AKYA 3NBYC 4DLUA 1HYQA 3CRW1 1XTIA 5G40A 1CULC 3IIJA 4HSEA 4TSFA 5LBIA 1YQTA 2IYQA 1KI1A 3FPAA 5TVKA 1NP6A 5AJZA 2HCJB 2RGXA 2Z6VA 3CBQA 1JQJC 3QBTA 4LRWA 4RZXA 2ZI4A 1W2HA 1VIAA 1GKUB 3LNCA 2V9PA 1W4BA 4FD2A 3E70C 1NNEA 2QPTA 3I8SA 3NHBA 1II9A 4HLUA 1GOTA 3B60A 4LYJA 1E79D 2WJGA 2VBCA 3ZIAA 2CHVA 4DCNA 1IAQA 1GITA 2XNSA 1P2SA 2WWHA 1D9XA 1GL9B 1PUIA 3AUXA 3LW7A 5FUWA 3U3OA 3PEWA 1G6OA 2ZS9A 1XEFA 4K8OA 2PJRA 3KKOA 2CVFA 2W6JA 2P6NA 4PC3A 4TQUS 2VO1A 3GJ6A 1DS6A 1PUJA 2OXRA 3KKQA 3MAAC 4KAXA 4EJSC 1U9IC 4F93B 2B92A 2G88A 1IJEA 1Z5ZA 1OXTA 3GMTA 5IRCD 1IXSB 1EGAA 1KMQA 1XZQA 1YZTA 2H1LA 5FPYA 4KHZA 3AF2A 1ZW6A 2ZEJA 2H5EA 5TARA 4A15A 2ZE7A 3KJEA 4J0QA 1IY2A 4DLXA 2ZJAA 2FF7A 2CLCX 3CIOA 4V02A 1R4AA 3D3QA 2H18A 4I1SA 4IOJA 5HE9A 1KNQA 1E9EA 1PZNA 3RRZA 1CLUA 3TSZA 4M1TA 2IBMA 2A3RA 4EDHA 2GCPA 1Z2AA 4Q7KA 4F7WA 1OH8A 1VYUA 2YHSA 1Q1EA 4FIDA 4KYUA 4OJKA 4PQFA 1M7HA 3BRWD 4G5OA 4QOSA 2BKEA 2Q9AA 1OXXK 4HLUC 2C04A 2FMXA 2E87A 3TR0A 4PSKA 1XNJA 1HQCA 4A0RA 3MD0A 4Q1DA 5AK0A 1TPZA 5H68A 5JRJA 3AKCA 2RGNC 2PMDA 3X1YA 5B64A 3EPHA 5FTLA 3QF4A 3CPEA 1Z0DA 3TUZC 3T1TA 1WBBA 4MKGA 1NG1A 1R0ZA 2ZR9A 3LH5A 1OIVA 4LC0A 4EPWA 4AD8A 1U2RA 3NBFA 1CXZA 4H1UA 1N5LA 2N1BA 1EG7A 2I1VB 1FNMA 3A4NA 3TQFA 2D7DA 4G5SA 2LWIA 1XJCA 2R44A 4S35A 4TMZA 1XB2A 4B75A 5ANRB 2DWOA 1TU4A 1NSTA 4IDNA 1Z0KA 521PA 3WBKA 3U7FB 4CEIA 4QFMA 3KB1A 4OKSA 4PANA 3L82B 2LKDA 1UKVY 4GT1A 1FZQA 4G5RA 4O2LA 4BASA 5E7IA 4DLRA 2BOVA 1SVLA 2QTVB 2AWNA 2DY1A 3W90A 4DXAA 4PO9A 4GNKA 5DO9A 1NVVQ 1OHHA 1OIWA 1T4GA 3TJZA 2YWGA 2YKGA 2WOOA 4LV5B 5DN6A 3CX7A 3K1JA 5F98A 1T6NA 2GZDA 2WKRA 1GWNA 1RE0A 1N6RA 3MUFA 3QPWA 3OZXA 4JBWA 2PT7A 5TMPA 1ZC4A 4TYQA 3GJ4A 3A6PC 1W5SA 4EKDA 2WHXA 1JAHA 3EARA 3GJ5A 3ICEA 4MGZR 1TAGA 2YYZA 2PMKA 2JLRA 3GEHA 4IXNA 4HDOB 3A1VA 3N2EA 1YHNA 4FXPA 4KO8A 5J4HA 1SKQA 2PZEA 2PJZA 2ZSEA 3EAQA 4XVQA 2JDIA 3B9PA 4NYIR 4W7SA 2J0UA 1E98A 1NMYA 3FFAA 4UNSA 2IA5A 1GRQA 721PA 1YR8A 2H7VA 1W44A 2NTYC 3NHAA 3SFZA 3C16C 5JLJA 2YOGA 4ITRC 1W4AA 3T1VA 1Z08A 2YWEA 4EPYA 5JSZA 5DI3A 1N6NA 1F48A 3QE0A 3U6BA 1OLOA 2V8OA 3THWA 1E2HA 2PL3A 4DLYA 3T12A 2GILA 3E1SA 3GFPA 3X2SA 3LQRA 2NO9A 2CDNA 1KSJA 4ZI3A 1DG1G 4GI7A 4RFSB 1KJZA 3FYHA 4PSAA 4BFTA 2A7QA 1MT0A 4NTZA 4URVR 3MRSA 2Q21A 2RGBA 3SOPA 1LY1A 1N6IA 5CLQA 4Q18A 2KB0A 2WMNB 4JL5A 4LWZA 1E1QA 1HEIA 2BMJA 2Z4SA 2WTUA 1UAAA 2IYUA 3K9GA 3LAWA 4KXFB 1Q1QA 3EA0A 4BFUA 1SVSA 3JZMA 2AFHE 1DAKA 1H8HD 4Q7LA 2WIAA 5LDDC 2QUZA 4D81A 621PA 1RYFA 5KSOA 4TL7A 4HI0E 3CB4A 3F3YA 3CRMA 3WYAA 1YZQA 1CKEA 2BDTA 4HZUA 1C9KA 3AP2A 3TSWA 5C2JB 2ZI6A 3M6AA 1NY5A 2O8DA 3LA6A 1W2GA 1ZU5A 3LXXA 1E0JA 1EFRD 1QVRA 1E99A 3CRVA 3R7WB 5FBQB 5K8LA 4GP6A 2QROA 4JLAA 2XZPA 3UMSA 4PFSA 2WWGA 1E1QD 1MR3F 2W6ID 5FUYA 4X8LA 3B82A 3RAPR 2BKUA 2XOKD 2AN9A 3IEUA 2IX3A 1ZP6A 1Q20A 2HV8A 5CIQA 1R8QA 1NN5A 1BIFA 2WAYA 3G82C 2ZU6A 4PZLA 2OAP1 4IFBA 1J7KA 4LX0A 5FTKA 2ZJZA 1XMIA 2Z43A 1E9RA 2C9OA 4Q02A 5FPKA 1LS6A 4OQFA 2V4ZA 4DLVA 2CLDX 1O3YA 2G77B 3UIEA 3ZQ6A 4JMPA 4AKIA 1P62B 3B1VA 4X8HA 2J41A 4C0QC 4ESVA 2OCPA 3DO6A 3EPJA 5A0FA 5EE0A 1G3QA 2GCOB 4A8JB 4HYYA 4FWIB 3RS3A 3H84A 3REFA 3S1AB 4BQSA 1H8ED 3WXMA 1OKKD 4IEEA 2ERXA 3RC8A 5CDFE 1RRFA 3PEYA 2XOKA 4BLSA 1TMKA 5EP1A 4ESHA 3RABA 1KTVA 4FMDF 4AWXA 5JBQA 4EJSA 4HAWA 2OV2A 1UBGA 3CONA 2QT1A 1X86B 3VU9B 3LLUA 2QRNA 5CDFA 2ZJBA 2QE7A 1G7SA 2ZRIA 4HZUB 1RRPA 5CM8B 3TAHA 1I2DA 3I3SR 5EE9A 1GNRA 2QT0A 4A2QA 2C78A 3MMPA 3U5ZB 2J7PA 1CJKC 1E2KA 2VP4A 4HAXA 3C5CA 3L2OB 4JLOA 4WXPA 3V9PA 5FL7D 4AY2A 3DPUA 3AVVA 1YKSA 3AM1A 1VPLA 2ZJ5A 1Y3AA 3KKMA 3IKJA 4HAZA 1KDOA 4L5BA 1D2EA 3IUYA 4JL8A 1JXMA 2JLSA 1G7TA 2KSQA 2VLIA 4TL9A 4B2IA 1GRNA 3GP8A 3L43A 4FW9A 3NWJA 1FX0B 3K0AB 4BFXA 5KTYA 1KO1A 4V0KA 1HT2E 5AR1A 3RSOA 1ZJ6A 1UADA 3GJ7A 3T35A 2EU8A 1FTNA 4AURA 2JLZA 1P7CA 1DEKA 3BBPA 4ACBA 4BPBA 2O8EA 2AR7A 4PHFA 4DDTA 1VKJA 1QHIA 5J47A 4B44A 4XIGS 1LB1B 1GZSA 4TMKA 4TT3D 3X1WA 4A8JA 4JT4A 4YC7A 3KTAA 3PCRB 4I81A 4BZPA 1VECA 4O2RA 4B33A 2IS1A 2HT6A 2RGCA 2FV8A 5C46F 1ZUIA 1TEXA 2BJVA 3KJHA 2BEJA 3PXGA 4BLQA 5CYPA 4FN5A 3MWLA 4JLVA 4IDPA 4CEHB 4JSYA 1XPOA 1GKYA 3B2EA 2XSZD 2GEVA 2VPPA 1VTKA 4HATA 1XCPA 4XJXA 2JASA 1YE8A 1FTSA 3FWYA 4U02A 3EC2A 2GZAA 2JDID 4JLBA 3SEAA 3FHCB 3GJ0A 2ZYWX 1E9SA 2JA1A 5AUQA 3ZS8A 4XWKA 3D6TB 4WZAE 1MO3A 1S8FA 3AVXA 1X1RA 4D2IA 4F4JA 3D31A 1E4VA 1S9DA 3U2QA 1OH7A 4RZ2A 5EUQB 4NYJQ 1W1WA 1N6PA 1Z3IX 3NVAA 1CJMA 3UK6A 3A1SA 3NIBA 2CK3D 5FBWB 4ZKEA 4C30A 3LVQE 3NTUA 1G9XA 5TDHA 1CR1A 4BLTA 3LDAA 4KV9A 2NO6A 4TLAA 2FSHA 4RKEA 3WHLA 4LCBA 5KPDA 1GM5A 3OESA 1JALA 1TTTA 1ZNYA 4M1MA 1F2TB 1AGPA 2XB4A 3BJIC 4W5WA 3PUZA 4A2PA 1EXMA 2VEDA 3T15A 2J45A 1XJQA 3EA5A 2EFDB 3DKPA 3WP0A 3PG5A 1SHKA 2JIZA 2OLJA 2W83A 3CX8A 1GVNB 5HTKA 1LTQA 2ONJA 4ZCMA 5GVSA 3UMFA 4HLDA 4M1OA 3MFYA 3B7GA 1VYVA 2FFBA 4XVUA 3TGPA 4C2TA 1U0HC 1RC8A 2J7KA 1E79A 2CHGA 4KYIB 5HZKA 2NO1A 2QA5A 4P4UA 5UKDA 2EFCB 3GJ8A 2ZIAA 5FUVA 3WYFA 2J87A 4TMWA 3ICQB 2FJUA 2GXSA 2FX3A 1DPFA 3OFNA 4I4LA 4LHXA 4PHTA 1VDZA 3AV0B 1NMXA 5LPNA 3I62A 2LKCA 4TSFD 4A1FA 3LWNA 2VHJA 2QRZA 3K0CC 4ZO4A 3CNLA 3PVSA 3A4LA 4A82A 1N6KA 1KY3A 1T0HB 4DB4A 4KVGA 5E4FA 3DM5A 3B5JA 4RVCA 3CM0A 4YONB 2VQSA 3A8TA 4JKYA 4UNQA 1KI9A 4Q03A 3U7HB 2ZSBA 5AUNB 4FCWA 4TYNA 4FMBB 1UDXA 1GAJA 1FW6A 3WRXC 1W47A 4GL2A 1SQ5A 4ZCLA 4EPVA 4DT1A 1WA5A 3CH4B 1MO6A 3W6OA 1XDBA 5BW8A 4OK3A 4NP6A 4LI0A 2O5VA 2GESA 2R65A 3WHKA 1MV5A 1FOEB 3KFXA 4HB0A 5F9FA 2AFIE 2O8CA 5H70A 2A5GA 2VP9A 1TQDA 3BH0A 2ZYUX 4II7A 1G8PA 2D62A 4LJ6A 4E09A 3LBNA 1R5OA 3V00A 3VR4A 3WBJA 4D0GA 3H1TA 3N2IA 2PH1A 3KUDA 1Q3TA 3PJRA 3LV8A 4KU4A 2Q6TA 3PUWA 5JJKA 3EZ2A 4XSGA 2MMGA 1IHUA 2QL6A 2X1VA 2ZANA 3GLGE 1MO5A 2IWRA 2ECKA 3M1IA 2OBNA 1XTQA 1Z6AA 2HJVA 5DE3A 2FU5C 1K8RA 1LS1A 3CF0A 2FGJA 1IY1A 3U6KA 3DMNA 2PBRA 3K9LA 5KU1A 4Q7JB 3U60B 1YR9A 2A2ZA 1KO5A 2FPKA 4JLDA 2A9KA 3IO3A 1H65A 4Q66C 3GFTA 4Q9KA 3QKRB 1G3RA 2ZJ2A 4A6PA 1US8A 2YJTD 1G17A 2O8DB 4RD2A 2B8TA 1RZ3A 2R8RA 1NKSA 1T9HA 1P72A 4PC2A 5C4MA 3IGFA 4JS0A 2VYFA 1EX6A 2QM7A 1IN4A 1MABA 4IRUB 4P32A 1D2NA 4TLCA 2IYYA 2IHYA 1DAIA 4M4SA 1NVVR 4RCYA 1JJVA 1OV4A 3RS7A 4BLPA 1V43A 4DBLC 2V3CC 5EXXA 2R62A 3X1ZA 2QZ4A 3KQKA 2VSFA 1Z2CA 3CZQA 5IHPA 2WVJA 4EIWA 1SZPA 3MSXA 2ZE5A 3O47A 4Q21A 3ZH9B 1TF5A 3KX2A 1E94E 3GLIA 3K70B 2AX4A 2HDNB 1SVMA 1CRPA 1SXJD 1HQYE 1ZCBA 3NEJA 1ZD8A 4UJ3A 1FMJA 1Z06A 1ONBA 3TNFA 2IF2A 4DCUA 5JI3E 1W36D 2IUUA 4JVNA 1JPJA 1W4RA 2NQ2C 3QBVA 5HCNA 1OXSC 2QMOA 4EJSB 1VG1A 1XD2B 5IK2D 3SQWA 2QEQA 1NMZA 5JRZA 4KLZA 2JJ1D 1T3HA 2ZITA 3T1QA 3MLEA 1AK2A 4IW3B 4RD6A 1G64A 4M1KA 5FOSA 5LD2C 1TL7C 2JJ8A 3ND9A 4RD3A 1F3OA 4QJ5A 1E9DA 3AGQA 3U7EB 1KI2A 3L0SA 3W6NA 4D82A 1D9ZA 1UFQA 3EZFA 4EAQA 1NL3A 2GHIA 1L2TA 3ZD6A 1ZAKA 3BGWA 2KWIA 4PC7A 4ILEA 1OKKA 4FWTA 1E69A 4LGMA 4XD7A 1H8EA 2RGAA 1XPRA 4NDZA 3T06B 5DI9A 3KXIA 1L8QA 3CWZA 4DSTA 2PLRA 3PEVA 2ZR0A 5M04A 4QGAA 3I1FA 4JL6A 2ZRBA 5HE8A 4LJAA 1N0UA 2ZRAA 1HV8A 3EC1A 4QGHA 1CR2A 4IOLA 5K8IA 1LW7A 3AGPA 2E1RA 2BBOA 1DO0A 4QRHA 4C4PA 3MWYW 1M1YE 4BGDA 3HP1A 3SJAA 3DL0A 4QL3A 1ETUA 1L7VC 3CF2A 1DE0A 1GUAA 1X8LA 4OK5A 5JI2E 3CRRA 1OJLA 4MKFA 5GJWC 4XWAA 4GP7A 1TU3A 4NCHA 4FMDB 1AJEA 2HXYA 3NBXX 1G20E 2EFGA 2HJGA 3VTKA 2BCGY 3QNUA 1XZPA 4NYIQ 2D2FA 4YMWA 3ND8A 2D7CA 4KFUA 1SKYB 4WBSA 1TEVA 3SC3A 4F91B 1EFRA 3I72A 4MRPA 4MRNA 1N6OA 4TMTA 4Q4HA 4Y0VA 1WQ1R 4B73A 4C2UA 1OPXA 4DHEA 2VH5R 2CL6X 2J9RA 3SJZA 4ZDJA 1P61B 1Q3HA 2ZS8A 4TWZA 3Q5DA 4A92A 1RPZA 2QPAA 3RANA 4GOKA 1JI0A 4OQLA 5L3QA 4B43A 1PLJA 2X8AA 2GRJA 4FMCF 4V0NA 4QXAA 1R5NA 2V7QD 3LXRA 4KSCA 2P67A 3BH7A 2G9NA 2ZROA 4AIIA 2ODWA 1E2GA 1TF2A 2BCJQ 4LBVA 3O8BA 1OB5A 1I4TD 1K5GA 3W8NA 1OH5A 2PLFA 4TZ0A 1YRAA 1X1SA 4TYWA 3UWOA 1HE1C 3IO5A 3JVVA 3TLXA 5BXQC 3FMIA 3BB3A 5JEEA 4LBYA 4KI0A 1G3IA 2OCAA 4QGFA 1FPMA 1R10A 1KYIA 1FX0A 1P6XA 1L4YA 2BWJA 3QKUA 4OI1A 2AWOA 4WAUA 4NYMR 4L9WA 1W36B 3G0HA 4YXWD 3QVUA 3RRMA 1Z47A 2AXPA 3DVLA 3EXAA 5HR5A 3JZAA 1OFIA 4B3CA 5K8TA 1A7JA 1E9FA 3BAFA 3E2IA 3ZS9A 3F5FA 3LW8A 3Q5EA 2YWHA 1UDWA 2RGGA 3EZ6A 3OIUA 1FP7A 3QKSA 3GQBA 1V5WA 2R6GA 4HLCA 3NDPA 4PZZA 1G8GA 2CVHA 4Q01A 3RS5A 1ZM3A 5B57C 5CITA 4US2R 4B3DA 2CE7A 4LYFA 4M1SA 4HB3A 1T3LA 3X1DA 3OE7A 2PEZA 2PEYA 3KXLA 4Q9LA 4CT4B 2AXNA 2QAGC 1G3MA 2XAUA 5EP2A 4PQRA 2GTPA 1RJ9B 1GIAA 4OHXA 3OEHA 2QMHA 2NOAA 2B21A 1E0KA 2WICA 1R0YA 5DH9A 5FOXA 5AUPB 3EPLA 1G8FA 2R6DA 2VP0A 3HWSA 5DN6D 1RIFA 1W0KA 3FB4A 2XXAB 5GJBA 4OHVA 3K09C 4MITA 3SYKA 3WP1B 1UBCA 1XTKA 2IYWA 2C99A 5J4LA 2YOFA 4NYMQ 5F2EA 2VHCA 1ZCAA 3VHXA 4M8NE 1CP2A 2ODNA 2P2LA 2PX0A 2QG6A 2RH5A 4DDWA 4C7OB 1ZIOA 1VG0B 1OFTA 1U0LA 2ZTSA 4NYJR 2AK3A 3VHLB 3QY0A 5B58C 4LUCA 4OI4A 4Q1AA 4DT1B 1SVIA 2OUKA 4DEYA 4CIDA 5FPSA 3OAAA 2G1KA 3IQWA 1TNDA 3SBEA 3VX4A 4JT2A 5FH9A 5L8VA 2P6RA 821PA 4Q5IA 4BEBA 4DLWA 1OYYA 2FNAA 4IVPA 4TQ9A 3UG7A 1AZSC 1COWA 4AYTA 2VF7A 1A5TA 4RZ3A 3DM9B 1KZ7B 1OSNA 3RLFA 5D3MA 4GPTA 4HB2A 4ZCIA 5CK5A 4B47A 4KCGA 5D3QA 3ZDQA 2IHBA 4EFMA 2WMOB 1W5TA 1TQ4A 4GZLA 1J99A 4L4UA 1YVDA 2B6HA 2CXXA 1ZNZA 2C96A 2WZQA 1COWD 1EFCA 2QAGA 2WWIA 1N5KA 3P4XA 4LY6A 4B76A 5C4GB 2CEAA 2WWXA 3QXHA 2GBLC 2CCKA 3FTQA 3CZPA 2CMKA 2D74A 3O8DA 1NRJB 2VP6A 1BS1A 4HDCA 3CLVA 4MGIR 3SYLA 3CR7A 4IDHA 2IXGA 1IJFA 4BLRA 3EX7C 1ESNA 1AKYA 1VIYA 4R2HA 2DFLA 5FBVB 1Z22A 4UJ5A 1XP8A 3HR8A 1XD2A 1ZUNB 4G5QA 4ZDWA 1CRQA 3AF1A 3VFDA 1YR7A 2KBEA 2Z5FA 3AQ4A 2V1XA 2J0QA 2ONKA 3C7KA 2Q3MA 2YV5A 2ZETA 4A8JC 1KSHA 1QHHA 4YQFA 1CR4A 5CYOA 4NCJA 5IF9A 4OQNA 1T3SA 5JWHA 2JEOA 3SZRA 2J0UB 2IYVA 3J81k 3W34A 2JLXA 4AKHA 5KO2A 3PENA 4LJ7A 2Z4RA 1KO8A 4MGKR 3IDQA 4BLOA 2GXQA 3BIFA 3NDBB 3GLHA 2O8CB 4OJQA 3B1WA 1N3BA 3RWOA 2AKAB 2FZ4A 2K5UA 4A4DA 2DWPA 2QSZA 2XITA 3ZIAD 1M7BA 1NN0A 4AYXA 2GETA 2UKDA 4FCVA 1Q22A 4RSGA 1IN7A 4M2LA 2BIFA 2A30A 1QG2A 2GBLA 1OXUA 4YMVA 2IK8A 1ESMA 1LFDB 3VNUA 4HAUA 4N0DA 1Q12A 3L0PA 2ZYVX 4AK9A 4QGGA 5J5CA 1YJ5A 5G3YA 1Z0FA 1RFLA 1OFUX 1GNPA 4KFSA 5DYGA 5FBRB 3K0SA 3Q7QA 3QJYA 1U99A 1JEEA 3ADBA 2QP9X 1O87A 4JYBA 4LC1A 1Z6YA 4XH9B 3VU9A 1ZINA 2CNWD 2OESA 4AG5A 3B1YA 1BYUA 3VR6A 4CW7A 1KKLA 2DFTA 5KDDA 1N5JA 3K53A 3TUIC 3A58B 5FL7A 3U3JA 2FEOA 4UXHA 2EWWA 3DHWC 1T8TA 2J7PD 2A5YB 1PV4A 4OL0A 2Q3HA 4NCNA 1XPUA 1WMSA 3THYA 2CCGA 1CS4C 2IXEA 2W2XA 4AKEA 4G0NA 4B32A 2F3TA 3H86A 3OEHD 5E95A 1YZNA 2D4HA 3AKDA 5EZ6B 4OQXA 3C15C 2DBYA 2ZAMA 1VCMA 2H57A 3FFBA 3WMGA 2YWFA 1QHSA 5CLLA 1AA9A 4OHYA 4JLJA 1E3MA 1XBTA 4TTQA 4WOPA 2FGKA 4JVMA 4I99A 3C4JA 1E9BA 1E2LA 3N70A 5CJ2A 4BFSA 2H92A 5AJYA 1HA3A 3PIRA 4PSVA 3PFIA 4I1VA 2IWHA 3SS8A 3ZLJA 3SQXA 4NBSA 1ZIPA 3F8TA 1RRCA 1F6BA 5AUOB 3VR2A 3LLMA 3MWJA 1W36C 3DKVA 5JJLA 2BEKA 1Z29A 2BMDA 3LBIA 4GFDA 4XVRA 1IBRA 3NG1A 2GJSA 4M1YA 1SXJC 4E07A 1E2QA 4F4IA 2HYDA 1EFTA 3FMOB 4MKIA 3VX3A 1KI6B 3W5JA 3WMFA 1Z6XA 2ZI3A 2XTMA 2BBWA 2SHKA 3RSLA 3U4QA 3VR3A 4V0ME 4RFVA 2QP3A 1U0JA 2CJWA 5A4JA 2YC2C 1EWRA 1QDEA 1XX6A 3DOFA 1TADA 5KUTA 5EZ5A 2CCJA 3TBKA 3P20A 1U90A 1G41A 5L3SA 4G1UC 2ZRLA 3SBDA 1T8UA 2Q9CA 3KKPA 3FKQA 1ODFA 4OBEA 1BMFD 1DVRA 2OLKA 2DR3A 2QGNA 4M0LA 1LV7A 1Z07A 4D4KA 2FSFA 1R8SA 4DUGD 1GL6A 1KK1A 3PR1A 1H8HA 3OIYA 3CW2A 2ZSFA 2LCFA 1SGWA 4NCKA 2WOJA 4KJZA 1R2QA 2C5LA 2WV9A 1ANKA 4V0OA 4B3FX 1CJUC 4DZZA 1NIJA 4PHGA 4BEJA 3FKSA 2V54A 3CNOA 1ZNWA 2OCYC 2IEZA 4JKIA 4IVRA 4BECA 1S4QA 4M9QA 2IYLD 4MYUA 4LV8B 3ONWA 1C4OA 1JEDA 4MQBA 3S1AA 3QF4B 3TR5A 1P2UA 4B2LA 3VR5A 2A5DA 4DKXA 4S2EA 2GAOA 1BOFA 1UPTA 3C8UA 4XTCS 5EE5B 3U4QB 1EFUA 2GEDA 2W0MA 5EUMA 1J70A 1IM2A 4Y0AA 2HT1A 1NLZA 2CJWB 4BRWA 4TMXA 3B78A 3EIHA 5DYIA 4C0KA 3CH5A 4ON9A 4A6XA 4Z8XA 4BWYA 2C2HA 1XEXB 4L15A 4A9AA 2XX3A 4G3XA 4FMCB 2VL7A 2AK2A 4L8GA 3ZZ0A 3AF4A 1XMJA 4URXR 3VKHA 1Q57A 1TUEA 5HPYB 3PEUA 2CE2X 2CL0X 1KMHB 4MYCA 4V03A 5BYKA 3R8FA 1GG2A 2A5JA 2J1LA 4K46A 2F43A 4NKRA 2V1UA 4DSNA 4D4JA 3ZVNA 5H8WA 2GK7A 1AGRA 2J59A 3QQ5A 1EK0A 4LOAA 5BN4A 3Q8XB 4U5XA 3TW4A 3WY9A 1OYWA 5J4YA 1FMLA 2OBLA 4UNNA 3QKTA 2G0TA 4JLMA 1T5LA 4R71A 3NXSA 5HZHA 5KOYA 3AKEA 3W3ZB 2REOA 4IJMA 4MGYR 1I2MA 2UZ3A 1U8AA 3R9WA 1VYTA 4RCZA 1Q0UA 4U7DA 3P26A 5FR2A 2KI5A 3ZQJA 3Q3JB 4K81B 1IXRC 4HDQB 3SNHA 1ZUHA 4H9GA 1IXZA 4JJZA 1XF9A 1XWIA 5JHGB 2ZRKA 1P75A 2HXSA 4YMUA 1I4LD 5EXSA 4ARZA 2DFNA 3DDCA 5L3RA 1JPNA 1HTWA 1W4CA 4DCVA 3QXJA 4QKQA 3SFVA 4EPRA 1KI4A 2G0NA 3R20A 1TUIA 3SI7A 1LNZA 3LVRE 3K9NA 1KJYA 2QAGB 1ZM4A 1QZXA 1NI3A 1PLLA 1UKZA 2TMKA 4IVQA 2ZUBA 1X3SA 1GKIA 4MRSA 4X8OA 1DADA 4HAVA 5DISB 3ZZUA 3QUSA 2O8FA 1XFAA 4QHTA 3FGNA 2N46A 5FL3A 2ZRPA 1KMHA 4QG7A 4CRWB 2IYZA 2W2VA 3BC1A 5FOTA 4AC9A 1ZBDA 1U81A 1J90A 3CRQA 2ZE6A 4UQOA 1G3UA 2KBFA 4I1UA 5TXGA 4QNRA 1ZM9A 3LD9A 2IT1A 2CHQA 3EW9A 3OIVA 4GSYA 4JVLA 1ZM7A 3SJBA 3O8CA 1NIPA 4IKEA 4DDUA 4DRZA 3AB3A 1D8TA 3KB2A 4TL8A 5EE3A 3OF5A 3OFND 2QM8A 1E2DA 2WPDD 2ZAOA 2OE2A 4P3YA 4PAQA 4UKDA 3EG5A 4B48A 3PUVA 4HUQB 5F3WB 3I8XA 1Z6TA 2UZIR 2GXAA 3EASA 3HYRA 2XJ9A 4XOIA 2GEUA 4M9XA 1G4AE 3QG1A 4DLTA 4RJLA 1GDDA 1KO4A 2F9MA 2GK6A 3UWKA 2ZI5A 3IEVA 1LF0A 4U00A 5KNDA 3OEED 1HURA 2JIZD 3GLFA 3DMDA 1P4SA 2ZR7A 4MH0R 1DELA 1QHXA 2RKOA 2W6JD 2JJ2D 1KK0A 4DJTA 3I5YA 2BHRA 2GF9A 4CEIB 4MDFA 3WNCA 3ADCA 3MG9A 1UBEA 4E5UA 2BV3A 4TYYA 3T5GA 1NG9A 2PT5A 4LZZA 4IEIA 1YU9A 1NJFA 2FEMA 3R9IA 1TF7A 5FUXA 3WNDA 1E32A 3EZ9A 2XNDA 2ANCA 4B6EA 4ERNA 2Z83A 5EQTA 3BERA 1K5DA 4P4TA 2GWHA 2DHRA 4LYAA 4CYMA 5CB6A 1QF9A 2CK3A 1MO4A 2QGZA 4KFRA 3K0FA 3A4MA 4W5HA 4FI3C 3I92A 4E03A 2GKSA 2P3SA 1YR6A 4JJKA 1R7RA 1KOFA 4YMTA 3QOFA 3P4YA 2QQEA 3IHWA 1SXJE 1N6LA 4LDJA 2ZRJA 4PXAA 4Z8YA 2KE5A 4JLNA 2GF0A 1C1YA 1ZVQA 2EYUA 2I4IA 3SU8A 2O0HA 4MUAA 3LX5A 1HT1E 1ZNXA 1HH4A 3QSYA 2AL7A 1IN8A 4ASUA 1MH1A 2ZRMA 2OCBA 2XNDD 3I73A 1MABB 1AS3A 4DEXA 4CEJB 3ADKA 4NZYA 5HKKA 3P1JA 4TLEA 1E2JA 1VMAA 1FUKA 2ZVPX 3PITA 4DB2A 1CTQA 5BN5A 1Z28A 5JCPA 2W58A 2WM9B 4LBZA 2QU8A 2J3EA 4KLNA 4ZDIA 2R6FA 2QPOA 4P4SB 1JAIA 1S96A 1OT3A 2ATVA 2ZRCA 1GNQA 3UG6A 3GJXC 5JS7A 5DIFA 2MSDB 4EQ6A 3GLIB 1CBUA 1NKTA 3VKGA 5KSPA 4BFVA 3ZVLA 3C5HA 3K09A 5JECA 5KNCA 3QPUA 1E0AA 2JAQA 4A36A 1P5ZB 5CM9C 2NMVA 1II8A 3BFKA 1GP2A 1G8YA 1DAHA 2NG1A 2VRWA 3LBHA 5HKKD 4E22A 2CBZA 2DFKB 2HUPA 5GVRA 2RGNA 1N6HA 4QBHA 3D8BA 2EW1A 4C0JA 2I3BA 3KJIA 1VHLA 4TTPA 4QM7A 4AYWA 2NO7A 1AKEA 2EQBA 5BWMA 5DNYB 5JWOA 5JWRA 2MSCB 3CO5A 4KITB 2RB4A 4JVSB 3QKRA 5IDVA 1US8B 4C9BA 2OZEA 4PC6A 1CF4A 2QBYB 3QI2A 2FWRA 2ORVA 5J4VA 3R7WA 5C18A 4FCTA 4NPHA 4HAYA 4F92B 4B3GA 3A37A 2OFXA 4MYTA 2H8KA 2HLDA 2VHQA 3HU3A 2ORIA 1RKBA 1G21E 2PZFA 1OFHA 1P2TA 4MYHA 4Q48A 2GA8A 1S3SA 1F2UB 1EFHA 4CVNA 1U94A 4C3ZA 2OSBA 3GEIA 1P9WA 221PA 1XTRA 2Y8EA 5LB4A 4PZYA 1SHZA 5CK4A 2ZM5A 1L4UA 4XWOA 4ACAA 2ZQ5A 3KKNA 4NONA 4WZBE 1UKEA 2GCOA 2D3WA 2BMEA 1F60A 2RHMA 3ASZA 4LHZA 4CDGA 2H17A 5AJVB 4Q4AB 3OEEA 1RW4A 4L9SA 3D7MA 5LB2A 2VSXA 4Z1MA 4YXWA 1SKYE 3TE6A 4D4MA 2ZXUA 4GRAA 1KNXA 2E9SA 2OFOA 5BQ5A 4GDFA 1T91A 2FSIA 2OHFA 3IBGA 1G1MA 1NN1A 5E3HA 1OIXA 5J4KA 2DB3A 2WPDA 4ZPXA 1M6NA 4JBXA 2FE4A 3MGCA 4LBWA 3RS4A 3I5XA 5CIWA 3ZGXA 3ETLA 2AD1A 4D25A 2OBMA 4HLQB 4LSGA 3RS0A 1ZD9A 3LRPA 3TUJC 1K6MA 1XEXA 1XRJA 1CJTC 4N0EA 3X1XA 1AM4D 1EESA 3MCAA 3F0TA 3RDPA 4QJ3A 3Q85A 1MRNA 1DTSA 5F9HA 2G6BA 2MSEB 3L0IB 4R9UC 1SULA 5DHAA 3PUXA 5FPHA 4KFTA 5SZIA 3CWQA 2BVNA 4M1WA 2GXUA 2V55B 4NE2A 421PA 5FPTA 4YDHB 1AZTA 4XSHA 2QORA 1S9HA 1II0A 2ERYA 5DHFA 4ABYA 8OHMA 1FP6A 4BFZA 3QEOA 2B8WA 3CKLA 4UNRA 3U3KA 3LFUA 2BM1A 1BH2A 3OHMA 1R5BA 4R98A 4BZQA 1GILA 3HR7A 3QIAA 5EE1A 4LJ5A 1UF9A 3DZDA 4R7ZA 1XTJA 3C41J 1Z83A 3W8RA 2C77A 4PR0A 2X19A 1X6VA 3GLGB 1W46A 4O0MA 4B3XA 1DG3A 2WWWA 4CEHA 2FZLA 3K70D 2B7BA 3CX6A 2ASEA 3QKSB 4D6PA 2C03A 2QQ0A 2FH5B 2X2EA 4OI0A 2WSMA 2PCLA 1IONA 3VAAA 5JSZB 4LHWA 2CLSA 5L3VA 1E2FA 2IYTA 2RAPA 4PC1A 4POAA 1Q44A 1VG8A 2IYSA 3FKSD 4UNPA 3GLFB 4Q9JA 1JBKA 3VQTA 1QHGA 1OXVA 3SYNA 4ZIRB 4YMSA 3AVYA 4Q00A 1E1RD 3FE2A 4HZIA 2W6IA 1ZRHA 1GRRA 5GADl 5L3QB 2GJ8A 3KQNA 4QNMA 3MJHA 5BYJA 1BMFA 3G5UA 5KDLA 1F5NA 4KBGA 4TLDA 1P60A 3LY5A 4XD7D 5C1BA 2IF0A 4Z51A 1E2IA 5SZKB 3JVUA 1TX4B 1S3GA 5H1YA 4Q9IA 1YRBA 5HCIA 1N5IA 4JSTA 2F1IA 2IS2A 1A2BA 1OHHD 1QHHB 2IS4A 3BFVA 1GFIA 1U98A 3THXA 5E7MA 3FMPB 1W7AA 1SVOA 1TQ2A 1E1RA 2P5TB 2GJ9A 4W5JA 1E9CA 2IUSA 2ZPTX 2WJYA 1SVKA 2BBTA 2RHDA 1JECA 1E0SA 3IIKA 2JLQA 5IK2A 2J0VA 4W9MC 2W0SA 3AEZA 1SXJA 3AUYA 1Q1ZA 1T5IA 1BO6A 1N2CE 3CR8A 4FINA 4KVAA 4LPSA 3W9YA 1XMSA 5E7JA 1XXHA 4WW0A 2REXB 1XCGB 1G18A 2OT3B 4BUJA 3ZVRA 1U8YA 4Q19A 3TQCA 2NPIA 3QXSA 1W48A 1NBMA 1KIMA 3AVOA 4B3BA 3BB4A 3WYGA 1G291 1S1CA 3E5HA 3BH6A 5FTJA 5AWFC 1E2PA 1UEJA 2AHOA 5EP4A 1EX7A 1DAFA 3L8YA 2ZJYA 4RFSA 3BS4A 4PTLA 3BD9A 2OXCA 2C98A 3DEFA 4B74A 4YLGA 3N5CA 3ZVMA 2R9VA 1AQYA 4I1OA 2JGNA 3U3RA 4EFLA 4OI2A 4P33A 3VMFA 2GAAA 4PQYA 4B35A 3BFXA 3SHWA 3GLFE 4MRRA 4DSUA 2QP4A 1G16A 4DUGA 5KNBA 2WIBA 1D5CA 5B30A 5CB8A 2FOLA 4TN1A 1QHNA 4AG6A 3K0FB 2F55A 4Q9HA 1G5RA 3B1ZA 2NZ8A 3AVPA 1ZU4A 3GPLA 1UJ2A 4LJYA 4GZMA 2RGEA 4P31A 4UXJA 5AJXA 3SN6A 4Z54A 3EPKA 5EJEA 3B1XA 1OH6A 4Q1FA 3RC3A 4Q1EA 1DAGA 2FN4A 5JS8A 3KQUA 3CPJB 4M9ZA 4URYR 1G7CA 2YC4C 1UEIA 2NO0A 3RVBA 3GLIE 1N0WA 1FFHA 1HUQA 1X8KA 2WKPA 3QPVA 2B7CA 3PUYA 1ELOA 1WXQA 4V0LA 4DCSA 3KQHA 1Z6GA 5FI0B 1W0JA 4WZ6A 2IXFA 4CEJA 4KSBA 5FOUA 2F1RA 4B34A 4HB4A 1G8HA 2L0XA 5JZVA 1YZGA 4X8MA 4TTRA 3TMKA 3LQQA 4P4SA 3R8CA 2VSOA 1RVDA 3K9HA 2FDCA 4A2WA 3KDSE 1XD8A 3B8HA 4TZ6A 2ZJOA 4HEJA 4D0LB 3ZYCA 4BFYA 2KJQA 3SR0A 3RNLA 2G3YA 1G4UR 3CF6R 3GJ3A 1KGDA 2QN6A 3TVDA 2VHTA 5KDOA 1II8B 2AD5A 4QBFA 4QJ4A 3RYTC 3L8ZA 2Z0MA 2I1QA 3I32A 1KDPA 1XMVA 2IUTA 2F7SA 2MMCA 1UM8A 3KFVA 1MRSA 1MKYA 4HUTA 4GBMA 1N0VC 3UMRA 3HPRA 2G83A 2ZRDA 4JLPA 2N42A 1XEWY 4PO8A 2YINC 5FR1A 1S1MA 1QBKC 2BM0A 1M8PA 2FA9A 3FVQA 4US1R 2F9LA 3NKVA 4ZI2A 4Q4HB 1FUUA 3U3MA 2WAXA 3WRYC 5LD2B 3T1OA 3BOSA 4GMDA 2ZI9A 3GD7A 1D2MA 3BWDD 4LJ4A 2ODEA 4M9SA 2FFQA 3NH6A 3QXCA 2IW3A 1XD9A 2IYXA 3OIWA 1WDTA 5DGXA 2V6IA 4B6FA 3KQLA 1Z8FA 2OEPA 1ZC3A 2ZUCA 2CNWA 1KI7A 2A5FA 2VHUA 1FQKA 2GJKA 1Q21A 1KK3A 1DAEA 2REBA 2J0SA 1OF1A 4PX9A 4DIDA 5JHHB 4B71A 4DSOA 3K0CA 3REGA 3EIEA 1U8ZA 3QVVA 1KKMA 1PLKA 4Q4LA 4M21A 4JYCA 4L16A 4ZV4A 2HYIC 2ZE8A 2A78A 3AF0A 5FOWA 4BE7B 3AVWA 5JJIA 2FSGA 1F2TA 1DARA 3BXZA 3TIFA 2XZOA 3AVUA 1KO7A 2ZRNA 4WVFA 2ZI7A 3KTAB 2YNMA 4URZR 4O3MA 4IDOA 3TRFA 2QY9A 4F38A 5BN3A 3AH8A 5EXPA 1EWQA 2XEXA 3MJRA 1YZLA 4TL6A 3BORA 2GVZC 4OHWA 4CF7A 1WF3A 2WJJA 1DAMA 2ZU0C 3PV0A 4US0R 1KAGA 3IBYA 3TH5A 2GDJA 2VP2A 5JFGA 3TVTA 2FG5A 4ASUD 3O8RA 3T5DA 2C9YA 3OAAD 4A0GA 4D0NA 3H4MA 1DBSA 1KI6A 1OB2A 2V6JA 5FTNA 2WKQA 1CR0A 4ZIRA 3CPHA 2ATXA 1NVWQ 2VA8A 2X77A 1PJRA 4YDSA 3GCGA 2HF8A 1NLYA 2CL7X 4DVGA 1NJGA 2EWVA 4CZ2A 1W0JD 2ZRHA 3P27A 3U44B 5TY0A 1RJ9A 1WRBA 2J46A 2IL1A 1AIPA 1XCMA 1FL9A 3KJGA 2NGRA 1DOAA 1E9AA 5L3SB 1XXHE 1WCV1 2NIPA 3KXKA 3NC0C 4LK2A 4UXIA 2QBYA 2O8BA 3WMEA 3FMFA 3HU1A 3THYB 1NVXQ 1FNNA 1W0KD 2FFHA 4MKHA 4DC9A 5ELXA 1AQUA 3M4YA 2C95A 2XXAA 4RKFA 2WJIA 3HU2A 5J40A 4QHSA 2C8VA 3QG5A 2PCJA 4LV6A 3L0OA 1P9RA 5G41A 1JR3A 4C0SA 3VNVA 4P0TA 4G01B 2DCUA 2EVWX 3RRYA 2F1JA 4G5GA 2FFAA 2O0JA 3BB1A 2VF8A 4GMXA 1F2UA 3K0AA 3GLHE 1RRGA 2NZJA 3OE7D 4RY2A 1XTSA 3RS2A 3ASYA 2JJ2A 4LPKA 1QRAA 3MWKA 1M2OB 3WNBA 2QSYA 1G6HA 1XJ0A 4TT3A 1GSIA 5FTMA 5GJVC 3W5IA 1TQ6A 4Q1BA 1SXJB 3HJNA 2XSZA 2O0KA 3QXXA 2QAJA 3VKWA 1NN3A 1SVWA 3AF3A 3GFOA 3K0EA 4Q4AA 2OFWA 3H0KA 1S2MA 1VG9B 2XTZA 1NBMD 5D3MB 1DO2A 2QMEA 1VHTA 2DWQA 2WSSD 4IHQA 1NLFA 4IXMA 4RD1A 1LF5A 1A4RA 1KJWA 4GOJA 3EWAA 1AS0A 4F4CA 3I4LA 1E96A 1QHYA 2HCBA 1KSGA 4MDEA 2O8FB 2GZHA 3ZJYA 5SZJA 3U44A 2FPMA 3V4FA 4R2IA 4WXRA 4TLBA 4TMVA 5JEDA 5KSYA 5KPJA 3FOZA 2OM2A 1VCOA 2BMFA 2YZ2A 3IILA 1JJ7A 3B13B 1A82A 3UXMA 1A2KC 3M0EA 3EZ7A 2BBSA 3IPXA 4PPFA 4URWR 1IOZA 2OAQ1 1B23P 5A5GA 3BK7A 1HE8B 2V7QA 3IPYA 4M53A 3SE0A 2F43B 2NPFA 3A1UA 1JXOA 4OYHA 1J8YF 2H16A 4Q1CA 5K8UA 2GVDC 2JCSA 2FPLA 3LX8A 4O25A 3FHTA 3AP1A 3I61A 2C9CA 4GOXA 6Q21A 1KZGB 1P2VA 4QHYA 1KK2A 2QE7D 3U7GA 3IIMA 1NSFA 4A0FA 3KL4A 5TV2A 3FDIA 4Q4JB 2ORWA 4ZDKA 1G19A 1OW3B 1R6BX 1G5PA 2ZYTX 4WIAA 3PQCA 3TKLA 2R6AA 2RGDA 3SJCA 2WJVA 4IOMA 4BFWA 1XU4A 3A36A 3GLGA 2QTHA 3QENA 3GLHB 4ARZB 3UATA 5B2ZA 2WWYA 4D26A 1KY2A 2J5XA 2W00A 5FOVA 3AVQA 1U9IA 2IC5A 3KUCA 3UANA 4JLKA 3ZD7A 1E4YA 3B9QA 2VIIA 4DLZA 2XZLA 4CT5A 2P65A 2GJAA 2VP5A 1YZUA 5FBLB 1HY3A 2IEYA 2ZRGA 3KZ1E 2W2TA 1JR3E 1S0UA 1VCIA 4QM6A 1KI8A 3TSOA 4V0MA 4N3NA 5KSZA 4C0AC 4DLSA 1B0UA 2O52A 2UVQA 1VCNA 4KBFA 1NY6A 2OG2A 3NH9A 2VTKA 3B85A 4OQMA 4PHHA 3Q9LA 3SHFA 1GTVA 5FI1B 2ZVQX 4JZKA 4C7OA 3TAUA 3U61B 5SZHB 4QC2A 2P6UA 4H1VA 1ZYUA 1KHTA 2BJWA 2F3RA 121PA 3ECCA 3W3AA 4DCTA 1MOZA 1Q1BA 3A1WA 3C14C 4MRVA 1KAOA 5P21A 4EFNA 4PO1A 1OE0A 2DPXA 3THXB 2EFHB 4A0HA 1R0XA 3RRNA 4Q4JA 2X2FA 3HPQA 3UKDA 2GNOA 2QMUA 3TK1A 5CJPA 4ZKDA 1WB9A 4Q7MB 2QNRA 4TYPA 4RD4A 5DSZA 4WA7A 1BKDR 4OHZA 3VR1A 4OK6A 5JMTA 2IYRA 3ADDA 1IY0A
chains in the Genus database with same CATH superfamily
2YOHA 2BC9A 5K3OA 1E7SA 2AOTB 4P98A 2C2XA 4XQ0A 3AU8A 2XVAA 5GJCA 2RHTA 2ZIWB 3R0QA 1XZMA 4R1QA 1G5TA 5C31A 1VGRA 2EYQA 2XW6A 3D8TA 4MRAA 2D1QA 2HSJA 4FILA 4EQ6B 2D2EA 2VSQA 4IICA 1RQXA 4JBYA 3S44A 5LP6B 4YJ2A 3NC1C 4C03A 1GL7A 5E3IA 5HWSA 1NBME 1MTOA 2OAEA 3MOSA 2FW8A 1CQZA 2G67A 1N25A 4A8HA 2BE9A 1DXHA 2ZP1A 4FK8A 4H6XA 1M34E 4QYSA 2GAJA 1XEWX 5DOZA 3QGMA 2PYDA 3FTPA 1XGKA 4YCMA 1L7OA 5KHOC 3IESA 3K8QA 1JEAA 1YJQA 4J3FA 3R5TA 1UKYA 4NMMA 3W5UA 4DILA 3JQ8B 1KAQA 2R6JA 4MR7A 4C0BA 4M0UA 4I7EA 4LWQA 1JA9A 1CQIA 2BZSA 2HSWA 3PQ4A 3R5HA 4XPIA 1XRQA 1XZLA 3UPUA 1D07A 3F9IA 4LRYA 2O59A 3K8YA 4F2HA 2HLDD 2HAEA 3MJEA 3OM1A 3SS9X 1A9QA 2O0LA 2XJ4A 3OZWA 3KPVA 1Z4JA 2GAFA 3HDTA 3OCUA 1YB4A 1ZM2A 1K8QA 5F1PA 1X7DA 2MYUA 1TZKA 2AOUA 2DPYA 3FSGA 3JQ9C 4YJHB 1K1EA 3URMA 1QVAA 1WDKA 5IJ0A 1QG4A 1SMKA 4KX3A 3QVOA 4KUHA 4BRUA 2ZSDA 1RKUA 1YL6A 3G2PA 3H97A 2JKZA 4NU0A 4DRYA 4BBJA 1RWNA 2W9XA 3GL9A 1CS0A 3FGPA 4LYHA 5F2OA 5C81A 4D8XA 4NBNA 4B82A 1E2EA 1G21B 1EKXA 3JATA 5CIYA 3OCZA 2Q3FA 2Y1LA 4E30A 3F73A 2JLUA 2Q3DA 4KE9A 3ZGVA 2Y2VA 2RH8A 3THWB 2YQZA 4EG7A 4JGBA 1LVGA 4NU8X 5IN4A 4EI9A 2CV1A 3LECA 4MLPA 4C0LA 3N0RA 5E6UA 4EELA 5TGZA 3T34A 2QTLA 3IQXA 1MRZA 1E6CA 4X20A 5FKJA 1R6UA 2O1SA 2X8WA 1XMOB 1VC2A 1MJNA 5TB5A 2F1HA 4PPNA 3G8BA 5FLEX 3WHIA 1JDVA 1VPTA 3V7YA 2J6HA 3TL3A 3C1OA 3GEEA 1EWVA 2QY6A 3ZGLA 2IQIA 1NM5C 3SDZA 2JAWA 3ILXA 2FSUA 4AI6A 4PAMA 5CTJA 1AN0A 1I14A 2SICE 4MUMA 1JKJB 4UVGA 4KODA 2K6GA 3T52A 2JGMA 4UHDA 1LC3A 4OX9Y 1YBHA 5SYNA 3VH3A 1J2JA 4NC9A 2HPAA 3IQZA 2BI8A 3EXEA 2YY6A 1ZJ5A 3E3MA 4Q24A 3VTZA 4MDHA 1WS6A 5EZQA 1F14A 4QBGB 4RZUA 2M6KA 4XTRA 1FXWF 2XCSB 1G7RA 3OKCA 2IIVA 3MTBA 5CPBA 4MV6A 4PVDA 3JALA 4LS3A 4EGFA 4RWEA 3G0CA 4URUR 1ULBA 2QIPA 5ITSA 1ZMXA 3IHKA 1U7UA 5IT5A 4Q47A 4QDZA 3WZLA 4WXHA 1ZWKA 1QU3A 3MCTA 2FMTA 2ZSAA 3CR3C 3HM9A 3QMMA 4IMPA 2HU7A 1LDGA 5JQGF 1KJNA 1XTIA 3O2NA 3K1TA 3V6MA 3WLFA 3D81A 5C4IA 2CHEA 4MVJG 1FLVA 4PV7A 1ZKMA 5SYMA 4KAJA 1O1YA 1YQTA 1WPGA 2IYQA 5LJIA 1USIA 1EA5A 2PMWB 3QLTA 4UUAA 5AJZA 2HCJB 3D0OA 2Z6VA 3ELBA 3QBTA 5BR4A 2ZI4A 4QYXA 5CMLA 1GKUB 1QBGA 2V9PA 3DDWA 4Q39A 2RHHA 1BXZA 1AKTA 2JKVA 3D1VA 3H42B 4ZQBA 2O2GA 5JC1A 4HLUA 5JOQA 2D0DA 1HZZA 1NJ2A 2RSLA 4EZBA 4HNAA 2CHUA 2Q5HA 4D96A 4DCNA 1GITA 3QEMA 2WWHA 1PUIA 3AUXA 2VJMB 3OX4A 5FUWA 1MVOA 3CEHA 1UT8A 4DY4A 1TU0A 2A92A 4Q7QA 4P8RA 5BSHA 4K8OA 4I4TA 4F85A 2CVFA 1U3CA 1EJBA 2E1PA 5H83A 1SD5A 4CN9A 4EX7A 2CD9A 2I3AA 1TXGA 1Z5WA 4KAXA 1FDUA 1IYZA 4F93B 2B92A 3ESRA 5KOJA 2R1ZA 1AKNA 1KH3A 1HK7A 4P4NA 4KQ9A 5FOQA 4XX0B 5IRCD 1PT7A 2GERA 1SA0B 2PSSA 4OHBA 2D5AA 4QUIA 1KMQA 3NIGB 3R0ZA 5FPYA 1RYEA 1WMBA 1EUZA 1EVIA 1IHOA 3AF2A 1PS8A 2ZEJA 3CFYA 4IILA 5DXFA 1K97A 1TA9A 5H0IA 5TC4A 4Y2XA 4DCJA 2ADMA 2WHEA 4E7PA 4WCFA 1ZVKA 1GUDA 4PG5A 2QTVA 3BE6A 5HKBA 2OD2A 3MT8A 4BX2A 1T2DA 2G72A 4WUVA 4I1SA 1LW6E 2QZZA 1PWEA 2QMZA 1AMNA 2VUTA 3HJUA 4DSZA 1H93A 1S8NA 1NW9B 2QQGA 3RGWS 2PRSA 5BUCA 4QVIA 4KNYA 4L02A 2ZIFA 4L72A 5AKKA 1JU4A 2DFDA 4M1TA 4EDHA 1WBJB 3DV0A 2QRKA 2YXBA 2BHSA 5AI9A 4CHTA 1VYUA 2WABA 2R1VB 4FIDA 4PQFA 1CZNA 1M7HA 3VC7A 2IDKA 1SUSA 4GLJA 3BEOA 2WQZA 1DCTA 1ABBA 2E87A 4B5KA 4PSKA 2D1TA 1JEQA 1M83A 1XNJA 1A5BB 3BWCA 5B3KA 3D4BA 3IH5A 3M6WA 3QHPA 3LP8A 3Q0EA 1PWZA 2I29A 5IHXA 1RLMA 4HH4A 4NECA 5BN1A 5A4FS 3A0RB 2CN1A 5BV8A 1PTKA 5JRJA 1C9NA 2RGNC 2PMDA 4JB0A 5LDGA 5B64A 1KZ6A 3G9TA 3TTWA 3N6RA 1L7NA 3QF4A 3WB1A 3T1TA 1Y3BE 2H4XA 3PUIA 2ZYSA 5FWYB 3JQFA 2G7MC 5H80A 3VAYA 4ZYWA 4AWBA 1XTUA 3O7MA 4O6VA 3NP9A 3DMGA 1TTQB 4MCAA 2OKGA 1FNMA 4QQ8A 2J30A 1CDZA 5ECDA 2R44A 4N9QA 3AHDA 3UHAA 4B75A 3GV0A 5ANRB 4PONA 3O75A 4OHOA 1I3MA 1SCQA 3TPFA 1DEAA 1NSTA 3GNQA 3GPBA 4J0EA 4IDNA 3W4JA 1FK8A 1MG0A 2CHFA 3KHUA 3LFTA 4YP0A 3WBKA 4DSAA 3GGGA 3TLZA 4IJQA 4QDOA 4AUEA 2I80A 5JATA 2LKDA 1YT5A 1DLIA 2XRZA 2D2VA 2HI0A 4B3DA 4H1WA 4G5RA 1RC0A 1V6CA 1GLVA 4ARAA 1CWUA 4BV9A 1DHTA 4BASA 3G23A 4KRFA 2VT6A 3U7QA 2PRYA 1RWXA 2X8LA 4GNKA 5DO9A 1KAEA 1E6MA 2FP3A 3E1GA 1T2VA 5J58A 3AF6A 1OAKA 1PG2A 2VBIA 3AEQB 3M1AA 3QA9A 1AURA 1ORVA 3TJZA 1PT8A 2YKGA 3KOUA 4LV5B 3W1VA 1CC1S 5DN6A 2OA0A 4C07A 2WKRA 1RE0A 1DO8A 4X6XA 1FS4A 1N6RA 5AKEA 5EJ2A 3OZXA 4ZJUA 4IEFB 3GRZA 3V8EA 5TMPA 3LXUX 4LZWA 4EKDA 4XB2A 4ZO7A 2OP0A 5HRAA 1LJ8A 4OO3A 3O92A 4IDAA 2Z5GA 3ZWOA 4YAJA 2AYXA 1K06A 3KPJA 9GPBA 1RJFA 2PMKA 3AY7A 4HXYA 4PYQA 1E5QA 3PHLA 5ADWA 4EKNB 2JLRA 4F4UA 3GEHA 5C9ZA 5LCXA 2HZ7A 3A1VA 3PC3A 4E5MA 2P7HA 5KKAA 1ZI6A 2RK4A 1E0DA 3GMIA 4NYIR 4RM3A 4KXVA 2QTAA 4XVQA 1E98A 1NMYA 4CM6A 1U1DA 5BWNA 721PA 4H31A 3CB2A 1UANA 2C2OA 1BA2A 3H6GA 3L05A 1W44A 5CPFA 1CUGA 3SFZA 3GW8A 9ABPA 1XNHA 2RONA 3L5OA 1NWCA 1XHFA 4ITRC 1W4AA 4MCJA 1M8JA 1Z2EA 3HDHA 5TS2A 3TLJA 4BGUA 4YAIA 1DWUA 1YR2A 2Q3LA 2YV3A 5AK5A 2A1TR 5JCOA 3U4MA 1Q95A 5AM4A 5BN5B 3WYBA 5DI3A 2AI1A 5LMUB 3ZJ5A 3QVXA 1F48A 3A1EA 1AHPA 3U6BA 4UOZA 2VTBB 1OLOA 1PZGA 2V8OA 1Y34E 2PL3A 1LCIA 3DCNA 5F1OA 3E0XA 3T12A 3E1SA 3VO8A 4FNGA 5I9SA 3UAZA 3X2SA 3MHPA 9LDTA 1J56A 5F3RA 3PWKA 2PH5A 4ZI3A 3BFPA 4I9NA 2P4UA 1CUDA 1OJ7A 1VB3A 5C37A 3EBLA 1MT0A 5JDCC 2OV4A 3DZIA 3HEBA 4URVR 1AQIA 1VPVA 2Q21A 2J85A 3LCRA 1X77A 2FZWA 3DZKA 4K03A 5IJXA 5K3CA 3G13A 2HO5A 3CIFA 1DEXA 3HWWA 3LHKA 3QBJA 4Q18A 4WY8A 4JWKA 5HYVA 2V5VA 2GK4A 3F2VA 1JZQA 1Y6RA 3EXHB 2YV1A 3U26A 1JE1A 2VYVD 3GP5A 4C5AA 4QBTA 1UAAA 1M1NA 2VDNB 1PR6A 4MGEA 4CV0A 4DARA 1LVUA 1USGA 3QLVC 3CE6A 2BHLA 4D5GA 1E9VA 2AFHE 1H8HD 2H2HA 4RVSA 5LDDC 1R3DA 4KGXA 1J1ZA 2QUZA 4V0SA 1RYFA 1TZCA 2G9UA 1IE3A 3EVEA 3HO6A 2XYVA 2XCRB 1XMQB 2E4UA 1KIAA 1NDHA 3IUBA 4HI0E 2R6ZA 4PFJA 3D7KA 4OGKA 5E7QA 1CKEA 3WYAA 4D97A 2BDTA 1C9KA 3AP2A 5DHTA 4GR9A 3I83A 3HXTA 4D92A 2O8DA 1FFWA 1W2GA 1ZU5A 3GDFA 1DJNA 2F4NA 2F67A 3CRVA 3R7WB 4BB6A 5K8LA 2IPNA 3FRHA 4JLAA 4K9NA 3ETNA 1CNMA 1FDTA 3OO0A 3CGGA 3IDSA 2R8OA 1A9YA 2W6ID 1TB4A 3L7JA 3MFQA 3B82A 2BKUA 4AECA 3IEUA 5B1DA 4D3YA 1AXRA 1FXWA 2HV8A 2JGIA 1BIFA 4JJ4A 3AVUA 1L5YA 2VHYA 2ZU6A 4RHCA 4A2CA 1RHMA 1L5FA 2YQ4A 3GDWA 3QWFA 4RNCA 2ZJZA 2JFFA 1E5XA 1XZJA 4F71A 5AICA 4NV3A 1E9RA 5FPKA 2UYYA 4OQFA 1SKAA 3CCFA 3CE9A 4NLLA 4OAOA 1O3YA 3ZQ6A 5HDQA 1ZEMA 2V7PA 1ZR4A 3EVNA 4AKIA 2BHNA 3OZFA 3QU2A 2AG5A 2R1UA 4GIBA 4ESVA 2OCPA 2RD2A 2QPLA 1D4FA 1G3QA 2GCOB 3EN0A 3KSDO 4R1OA 3QEKA 4HYYA 2EKBA 4AZWA 3RUAA 3WGLA 3QOYA 3NCTA 3Q7RA 4RXMA 1GARA 3REFA 2C82A 5K0SA 4EGSA 3RUCA 9MHTA 2BDUA 1EBFA 2V7VA 1KOGA 3M82A 3DW1X 3JARA 1FVXA 5BSMA 3D3EA 3DBVO 1KXZA 3H7IA 1TMKA 1U8CB 2NXCA 4JIGA 3H9UA 4FFWA 4Z7JA 2D1YA 5B6JA 3PTAA 5JAQA 2ZJ3A 1QPZA 4ZK6A 1J23A 5LJLA 3CONA 4EMUA 5CX4A 3ZYZA 3DD5A 3EZYA 5KJ1A 4X64B 5CDFA 2ZJBA 3O1HB 5ALYA 2EGUA 5BMVA 5CM8B 2ZRQA 2HLHA 3H17A 1GTL1 1SWVA 1QNLA 2PQ6A 1WB4A 1GNRA 1PNVA 3NJRA 3FTCA 2C78A 5EY5B 1CJKC 2IIBA 2WF8A 3OLVA 4JLOA 5GM2A 2IPAB 4IGKA 2FDRA 4HEQA 4WK0B 3V9PA 5DHRA 1YKSA 4NCBA 1JSLA 5EIAA 4L5BA 4CKWB 5CHYA 1B93A 4JL8A 4TL9A 2KSQA 2VLIA 3LCUA 2L69A 1MUUA 4FKZA 1JFFA 5FWXA 1QNFA 4DIFA 1Z25A 4OM8A 2ID7A 1FX0B 2Q8PA 1ADJA 1DV1A 5A1TA 3RSOA 5FRDA 1UAGA 3M49A 1NI4A 2DUUA 1E3WA 2V96A 2CNKA 3GJ7A 3FVVA 5GV7A 4PW0A 3NOXA 1KPHA 5U1PA 3DLHA 1C1HA 4YP5A 3QYJA 4F1WA 4MUXA 2R751 2O8EA 1JIUA 3AZQA 3C1TA 4PHFA 3GPCA 3UOGA 1KYYA 3WIUA 2LGJA 4XIGS 3VC2A 4CL2A 4NU5A 1VECA 2ACEA 5JS6A 1DIAA 3BXOA 2HT6A 2IS1A 4JX9A 4U1RA 2VG8A 4XGRA 6YASA 1KJ9A 4R05A 1RQ7A 4FN5A 4JLVA 5CYPA 5GONB 5C8DA 4AICA 1BD4A 2O8VA 1E5VA 1LSUA 1N3YA 1SC6A 2XE8A 4JOCA 4LYGA 3LK6A 1VTKA 1ZK3A 3V8MA 4KMOA 2C2KA 1C2TA 2VDVE 3O4RA 4I55A 3HN6A 3FYDA 1CFJA 2YHUA 2PXCA 3B3GA 2YVLA 3ICOA 5C80A 2C4VA 3E5NA 2Q5CA 2QU7A 2P9BA 4JLBA 3HBLA 3UAWA 5KYUB 5CT8A 1VZ2A 2Y6UA 1YASA 4KXQA 1GLGA 2Z2XA 3PXCX 3BKWA 3A9CA 1ZIDA 4JJ7A 4AM8A 3P0FA 1E9SA 3ZD8A 3NBMA 1B6GA 2GPNA 5ISMA 1EX9A 1NVTA 2I6TA 3QLUA 3ZS8A 4WLNA 4WZAE 3HHPA 2FR8A 1X1RA 5IKOA 3QHQA 1IZYA 1WV0A 3H1BA 4L76A 2O06A 3DBRB 4L85A 1OH7A 5TEVA 5I7UA 2GYYA 3M2PA 2NYRA 5EUQB 3K5HA 1P7ZA 1GUFA 2Z8ZA 3KYIB 5LVAA 1N6PA 3NVAA 1O9GA 3WMRA 1L4FA 3I0MA 4FDTA 3TLMA 4ZYTA 5IDXA 2D1SA 3W0LB 5K99A 4HH1A 1T6XA 1TUBB 1G9XA 1U5CA 3EZNA 4P2GA 3RK0A 2QJWA 2G17A 5GM1A 1FNBA 4MQ5A 4N0PA 1T2UA 3UAVA 3DAYA 3ZGYA 5BSGA 1U1EA 1KU0A 4JFRA 3Q2OA 1E1YA 2Q41A 1JALA 2YWXA 3IPRA 4QPJC 1OI3A 3L6UA 3DT8A 1F2TB 3THRA 5E9WA 3ETDA 5H5JA 2DETA 2JNWA 2HRBA 2XCQA 1EXMA 1ZOLA 1BHQ1 2Z04A 4ZP1A 1FFBA 2FSVA 1TJ3A 3UJHA 2X5XA 3DKPA 4IJKA 3WP0A 3PG5A 4G6ZA 2JIZA 2CYAA 1LNSA 2ABWA 2OLJA 1P1FA 3UXEA 1N7IA 3CC8A 3VNRA 4ZCMA 4GOOD 3UMFA 2YX1A 1BE1A 4YJ3F 2VAXA 3L8EA 2LW7A 2GM3A 3HKEB 3ZE7A 1U0HC 1RC8A 3UMCA 4KYIB 5CB4B 1AHNA 4C3VA 3KIPA 3PK0A 1AXGA 3L7NA 3RBZA 4U0KA 1Y4ZA 2EFCB 1C30B 2FJ0A 2HJ9A 3GJ8A 4HC4A 4MKRA 1NZDA 1TJNA 2IODA 5FUVA 2WSIA 3WYFA 3ICQB 1P0PA 2I7TA 5KVSA 2JFUA 4C04A 2IRWA 4JLUA 3LUAA 3V8QA 5JAPA 1ZA1A 3ZDFA 5KKNB 3L7IA 3AV0B 3UB3A 1CUBA 4OCZA 3WWZA 1V1RA 3OFSA 2LKCA 2AQKA 2XUHA 3SR4A 4TSFD 3GDOA 3MGGA 1NT2A 1NVAA 1KFJB 3K0CC 3CSUA 5ENZA 1JG2A 3A9RA 3CN7A 3EWIA 4KQCA 5ILGA 5E4FA 3OSUA 4N8SA 5BQOA 1I3CA 4IHKA 1R12A 1WHSA 5FTWA 1BTOA 3TDMA 3HGTA 2E2WA 4B83A 3H65A 1TA0A 2HQ1A 1WZCA 3SZGA 1R6XA 1UZMA 4M7PA 5M34A 2XUOA 2IYFA 2B2XA 1E5DA 4YONB 3ZWWA 4B3IA 4JKYA 3ETGA 4CMGA 1KI9A 2ECPA 4Q03A 4C06A 2NVUB 1IRXA 2POCA 1OX6A 3MJCA 1CERA 4FMBB 4GKAA 1D1PA 3R5XA 3REQB 3V7NA 3WFJA 1SQ5A 4M1ZA 4ZCLA 3WOHA 2HLPA 1QQAA 3CH4B 1M1UA 5D84A 2QRPA 2QRGA 1E18A 1NXWA 2Z08A 1E59A 3L1HA 4LI0A 3WHKA 3JWGA 1MV5A 1FOEB 2WILA 2C84A 1P5JA 2C9BA 2C1ZA 5H70A 3MCUA 3HKDB 2OHGA 5IP5A 4NOLA 3GLRA 3RSSA 4QJBA 1SU4A 4D41A 3Q8WA 3BH0A 4EM6A 3I1IA 1UFKA 4IO1A 2B8NA 1QG6A 1Z4NA 2F62A 2H1VA 3LBNA 5B6IA 2IBSA 5KNDD 2V7XA 5EG5A 4E08A 4D0GA 3H1TA 5KMGA 1SD1A 2A9QA 3KUDA 4L8WB 2O9JA 2Z2JA 3L49A 3UQZA 5AKJA 2AQ8A 5IPFA 4KU4A 3RVQA 3PUWA 3COVA 4PZ9A 4UARA 5AVQA 4J1NA 2QL6A 4LISA 1IZ9A 2ZANA 3CLKA 3VR6H 3WFIA 4CDMA 4HNTA 5JYDA 2FQ1A 2DU8A 3E5MA 3RSCA 5FPPA 2HJVA 3U40A 4L50A 3TTTA 3AZOA 1V25A 3K94A 3JAKA 2FU5C 1H0SA 1K8RA 2VBGA 1KAHA 2I66A 3CF0A 1Y1TA 1MOSA 3MJSA 5JFOA 2NTVA 5BSRA 2JKYA 3AEUA 2XI4A 3NVDA 4PU0A 4XQCA 4HDAA 3P0JA 1IWPB 1TO2E 2DTDA 2O2ZA 1T4MA 3OE4A 3UBTA 1RHUA 3DWEX 3LY7A 5KU1A 2O7RA 5IT4A 3WA7A 3HJRA 4ZQGA 1LRLA 1KO5A 2Z1NA 1AF7A 1HZZC 4DDMA 1IQUA 2A9KA 3GH3A 4K3UA 4Q66C 1P29A 2EQAA 3L4KA 1G3RA 2XBMA 4AG3A 5I7WA 1US8A 1VKRA 3NT4A 2O8DB 4RD2A 1PP4A 3NGXA 5DTQA 4YIHA 5KOIA 4G0WA 1KEUA 3T9BA 1JHQA 1B16A 2B0JA 1T9HA 1P72A 1UWVA 1VI2A 2FETA 3IGFA 4PC2A 5TMEA 3UEOA 2VYFA 5DYYA 2GCIA 2VPTA 3F2IA 1MABA 3RUPA 1N32B 1TCCA 4DR2B 4M4SA 1DAIA 4RCYA 1SBYA 3VYVA 4LJRA 1XR3A 1OV4A 4B6GA 4G4SO 4ENWA 4HDKA 3ZWCA 1EB8A 1XQVA 1V43A 4WKBA 1PNRA 2V3CC 3M4ZA 5IKXA 3H5TA 4QDXA 1TT5A 1VP3A 3HV2A 5AP9A 5TQVA 1U7TA 4D1YA 3X1ZA 3KQKA 5FTMA 3KR2A 1YMQA 3CZQA 5AKHA 1FYVA 1GQSA 3ILHA 3MSXA 3SSAA 4EUEA 2ZE5A 1WXEA 4Q21A 1G5QA 1B76A 5HS6A 4DR6B 3KX2A 5REQB 1N7JA 3QYFA 1M5TA 2AX4A 1EUDB 1CRPA 4PS1A 4DJFC 4RQTA 1SXJD 2JEYA 2WV7A 3OTHA 2WINI 1ZCBA 1TDJA 3NEJA 5TJ9A 4KE6A 4IZIA 1ZD8A 3VI4B 5DRTA 2QX9A 5B58T 3ZBTA 4UJ3A 1FMJA 4FOTA 4O5OA 1Z06A 3MIIA 4WK2B 5JI3E 4X97A 3HJAA 2C5HA 3CG4A 1NP7A 1V5FA 1XKTA 3UK0A 4QEZA 3ZV4A 4ZTBA 5CFNA 1O0CA 3DQZA 2QMOA 4H1TA 2WAOA 1GZVA 1VG1A 4TT8A 2P4HX 1QZTA 3TZBA 3HJFA 3RYIA 4ZCRA 4FZ3A 1UFRA 2G63A 3H5OA 1T3HA 3C24A 3ND6A 2VJDA 1ZK2A 2C8KA 2YJ5A 1O6CA 1QB7A 3LYAA 1AK2A 3ORHA 4MUKA 5FOSA 3JALB 2JARA 2PUVA 3GGSA 3ISJA 3ZNOA 4QJ5A 1J39A 1CQWA 1JNXX 1NOIA 3ZW9A 4H15A 2A7XA 4XYBA 4D82A 3D4OA 5BOSA 4KWTA 1O97D 1E7WA 1L2TA 3OD1A 4FP9A 1HSZA 1XVVA 3BF8A 4BN4A 1ZJJA 2HSGA 4JEMA 1AQLA 4KSYA 5DT9A 3ICVA 1UQUA 4CLXA 4XLTA 2OFFA 4E4TA 4UAUA 4ILEA 1KQ3A 4L74A 4Y9TA 4FWTA 1E69A 4LGMA 4UUMA 4DKJA 3KJFA 2VDLB 1MPTA 2RGAA 4LDNA 1XPRA 2RHLA 3T06B 4S2UA 2IU4A 3KXIA 1A5SB 3UICA 1GTRA 3CGWA 2WTNA 3KSBC 1EP3B 2BY4A 2PLRA 3H6HA 1OGJA 1NW7A 3PEVA 5ARBA 3O5AA 2GJ4A 2P9GA 1BQ3A 3DTVA 3KTDA 3QX8A 1CQPA 4Q37A 1V7QA 1N0UA 4LJAA 4QGHA 1QYWA 5T67A 2C5BA 3E03A 5LQDA 3KCNA 4BVGA 4QRHA 4F8YA 2ZTVA 1T9GS 3PVCA 2BPOA 3MWYW 4OOFA 4Z4EA 1XNGA 5JNUA 4FX5A 4QL3A 2WU4A 2V97A 5AVOA 3LCCA 3WL5A 1X8LA 4ENSA 3FYUC 4HHEA 5J2TF 2WIDA 4XWAA 1AGYA 5C8YA 3IBTA 1O6ZA 4M9CA 3RVKA 4FMDB 1TJ5A 2QUKA 4GC9A 2EFGA 4B4WA 2PUBA 2BMAA 1EIWA 4NYIQ 3SPXA 4OL9A 3WK5A 3LDHA 1LVHA 2D2FA 2AQHA 3PE4A 4RVNA 1FQWA 4D6XA 2Y77A 4WBSA 3VSDA 4F91B 5JG7A 1L4KA 2A1UB 3PZBA 5IUNC 4KNVA 1N6OA 4OB6A 2PXAA 4QXMA 5AI8A 5DW3A 4EUSA 2F8LA 4JY7A 3S2ZA 2PA0A 3G0DA 1KKUA 4D57A 2YXPX 1YC5A 4KLAA 1JF8A 3PX2A 3R3VA 3INTA 4ZDJA 1Q3HA 2QTTA 4LSWA 1J0AA 1SU7A 2H2AA 2XMPA 3GRRA 4ZU3A 1ULTA 4GOKA 5L3QA 4WKOA 5F77A 3VZRA 1H05A 1XRSB 2HXGA 4V0NA 3NBAA 4AZ0A 4B7UA 1CY6A 3NOQA 1HNXB 1T2NA 2WUGA 2P67A 4I3GA 4Q3LA 4XFKA 2R85A 3DNMA 2G9NA 3WGJA 4AIIA 4ZJZA 5AW1A 1LPSA 3O8BA 4LBVA 3NHWA 1K5GA 1WY7A 1E8MA 4KWCA 2PLFA 1KFBB 1OH5A 1YMVA 1X1SA 3JAWB 4TYWA 4E4YA 2C7QA 3B6IA 3IO5A 3BTOA 5LP1A 4EO7A 2ZQYA 3T9DA 2OHJA 4MR8A 4EAAA 5JEEA 4KI0A 2X15A 4QGFA 3W8FA 2IDJA 3UH0A 3VHXB 4BJ1A 4Z4IA 4M87A 4J43A 1P6XA 1QTQA 4ZRMA 5JZOA 2NSHA 5JVDF 4HFMA 2QW8A 3AZPA 4NYMR 5EIFA 1TZMA 2D3TA 3CSSA 2XCIA 3QVUA 3HCDA 2NVOA 1Z47A 3FTDA 3EXAA 4MV5A 5EZYF 1OCEA 4O2AF 4W82A 1OFIA 2D5LA 1X1DA 2YIVX 5KYWA 3ZS9A 1LLFA 4F2GA 2XMCA 1FBNA 3LW8A 4NBUA 1ZY2A 3VJLA 4L6AA 1XVAA 2BUAA 3QVWA 3ZZNA 1ZGHA 1E7RA 3OIUA 4YHBA 1TKCA 5IAOA 4C29A 1B14A 3O3OB 1QB8A 4TVSA 2R6GA 4QPCA 4FE7A 4IWNA 1YS6A 4OLJA 3G68A 1GQOA 3IRVA 4Q01A 1UPUA 1RPAA 1XXLA 2P5UA 3BXGA 1AV6A 1DCFA 4PX5A 1GN9A 3EZXA 3QWIA 4HXGA 4KNWA 2QSJA 3CZAA 1GGEA 1AGXA 3MMZA 3G3EA 3RH0A 3JASA 3GZTB 3X1DA 5CFLA 5HKLA 1QGDA 3KXLA 3QU9A 4CT4B 3GLKA 5EP2A 2ZIGA 4G8JA 3TYXA 3OMWA 1RAHA 1CZHA 1S2NA 2F3QA 2VQ3A 2YN0A 4OHXA 2G70A 3ODPA 3OEHA 3EEOA 5LA6A 2IHTA 3LUJA 3OMXA 4M8SA 3TOXA 4JXJA 1FUIA 3PC6A 5DH9A 1KQPA 2P6OA 2ZLBA 3LDFA 3VRHA 3HWSA 3ER9A 1RIFA 1T1SA 1W0KA 4FOPA 4MS1A 2XXAB 2YUTA 2QKYA 5CFRA 1N2CB 1XTKA 2JIQA 4BO9A 1PJSA 5J4LA 5CU7A 5F2EA 4LKOA 1HYGA 1QV6A 2QZJA 1JLHA 1RYYA 4Q3EA 2QG6A 2Q4BA 3WHPA 2ZFUA 3P9QA 4BNGA 1QIKA 4KTVE 3DTTA 4QZVA 1O7JA 4DCGA 4DT1B 5JNSA 5LQJA 4S04A 1WEKA 3X0DA 3OAAA 4EZIA 3VX4A 4NBWA 2Y1OA 2EBUA 3SBEA 4DLKA 4OHUA 4AS3A 5I9LA 3DHEA 2IEDA 5F9MA 2PX4A 3V2GA 4CTOA 2IZZA 1OYYA 2PKEA 3QEMB 3LQ2A 1PJCA 4PLZA 3ZLUA 1AZSC 4YV7A 2ZAYA 1YK1A 4F11A 2R3SA 5JVDA 1T13A 2HRDA 1PQ4A 4PGHA 4K28A 3DM9B 1A96A 1KZ7B 2UYGA 4OKNA 4YRCA 1ZZEA 3ZY6A 2Y2UA 4NAVA 5K4HA 3ZHQA 1TT5B 4N6NA 1PK7A 5D3QA 1RYDA 3ZHTA 1T2CA 5JC8A 3BMCA 3MW8A 1EFDN 5JMPA 3KZOA 3UJ3X 2W2QA 3NAQA 4EFMA 3CUSA 1W30A 4FGSA 1GPBA 4ESEA 3EG9B 4GZLA 2DPLA 3LT2A 4N5LA 2CXXA 1H5QA 4WNCA 2PMFA 1H4VB 3PUHA 2C96A 2JRCA 3RC2A 4PSCA 1COWD 3SAJA 1EVJA 3OX3A 3FWHA 3P4XA 1NFQA 3W2EA 4B76A 1U2QA 4KKXB 2CEAA 1HDXA 3UPTA 2CCKA 3O9MA 3FTQA 2WSBA 3CZPA 4MW2A 4ECEA 1EXWA 4HDCA 2V45A 1DRVA 3CLVA 4OLHA 5KTTA 3QE3A 1HX7A 1QE0A 5JH7F 4H7HA 1R0LA 2MTBA 1J2TA 2BZGA 3H8JA 1Z22A 4UJ5A 4ZO8A 2JD1A 2HH9A 2OHOA 3KQMA 1ZUNB 5AKXA 3MLBA 1E7YA 1EVLA 3WLPA 4TLLB 2AT1A 2VCHA 3DEIA 1UXJA 2J0QA 3GUUA 3JD2A 4FMPA 1HBJA 2ZETA 2R1VA 4FEGA 3WIDA 4ALKA 4KMSA 1ORDA 4EA6A 4BEVA 1CR4A 2PD3A 3D2CA 4XYEA 5CYOA 1FE8A 4OJYA 4NCJA 3A9TA 2VPQA 4KDCA 3WGHA 2AZXA 4UTPA 1PI3A 2Y71A 1QC5B 2WHRA 1C1XA 1SG0A 1JHZA 1SUBA 1A27A 3LYLA 4FFRA 4L5CA 3FRJA 2NSYA 4X54A 4FU0A 3UN1A 3W34A 4E51A 4F4FA 1KO8A 5KO2A 3TDKA 1ADCA 2X1MA 3BIFA 3LDGA 4GX1A 4LRTB 3BMNB 3B6ZA 3EHEA 4Y9SA 3ZWAA 5MGNA 3NLLA 1EM8A 4DWOA 5HSGA 3F7MA 2VRNA 4OJQA 3SX0A 5JSQA 2Y1GA 1B0PA 3HKDA 4IJ6A 5CT4A 5BXYA 3DYIA 3QK7A 2FZ4A 4KQHA 2BFCA 4GUAA 2DWPA 1G21A 1NN0A 4LYYA 2Z5LA 3DV9A 1I6KA 3JQ6A 5BRJA 3VPSA 2UKDA 2PGOA 4HQNA 4WCFC 1XALA 4RSGA 3U17A 4DBZA 3NOOA 2DHQA 1OXUA 3ERCA 4ZV9A 3K6SA 3ELYA 2VYCA 4RMNA 3QVLA 4Z5XA 4IHJF 3R77A 3VNUA 1SUWA 4XX1A 1UPBA 3I6QA 4KE7A 3UHOA 5J5CA 2ZWPA 4AK9A 4MWSA 1Y1SA 4WN9B 4BIMA 1Z5NA 2PAAA 2IHJA 2XQGA 1RFLA 3LIPA 4LKRA 4R1NA 4Y2QA 5TJHA 2PS0A 4CNQA 3D7RA 3Q7QA 4HOYA 5J5VA 1V0JA 3VYUB 1NBHA 5JU6A 5EEGA 3V8VA 3C4VA 2XYRA 1XO1A 1YUMA 1V7CA 4FSDA 3N7AA 1VMEA 4ZOAA 1O87A 4XLLA 1Z6YA 3ZWKA 2E85A 4XH9B 1ZINA 4L78A 1MIHA 4RVUA 3RSQA 3VR6A 3R6TA 3ZDZB 2V4UA 2GZ1A 4BNXA 2BUCA 2G40A 1DX9A 4ZN6A 2DFTA 2K87A 5KDDA 3VU0A 1N5JA 2W2KA 5IXJA 4XA8A 5FL7A 3MUNA 4ZZ1A 4RTLA 1AVTA 2ZB7A 1RU3A 1V8DA 3ZW7A 2WYOA 2Q3HA 3LYUA 4LYEA 4NCNA 5DTIA 3OICA 4DZRA 4Z9YA 3BZBA 2CCGA 1P1RA 2IZOA 2GWRA 1DKRA 3EA4A 4IJUA 4JX8A 2CBGA 1YZNA 3NAZA 1KFKB 4OQXA 1M9NA 3KOYA 1QFJA 4GXNA 4O2BA 2ZAMA 4KQIA 4OHRA 2UZ4A 1QFYA 2XZDA 3AFHA 4FD3A 3I42A 3B9RA 4FX2A 5GZ6A 3WMGA 1X7GA 5CLLA 3KPWA 3BE5A 4RBNA 3PFHA 1IXKA 4BBZA 4NXNB 4UUOA 1XBTA 2GFQA 1X9IA 3N8DA 4JVMA 3IAS1 3N70A 1I9GA 1P6UA 2XDWA 1WX1A 2AR9A 4MSUA 5AJYA 1HA3A 3AJAA 1N2BA 1F38A 1MB0A 3PIRA 1R9NA 4I1VA 4AAYA 3D4PA 1JDTA 3SMQA 1RRCA 4EHLA 5AW4A 4CYMA 4EQZA 1JLKA 4F9GA 5AUOB 3JU3A 3MWJA 1V47A 4EJ6A 5KNDH 2VJYA 1Z29A 1B0ZA 3G2MA 4OVKA 3LBIA 3RB8A 4EY5A 1MZPA 5JTUA 4E15A 3OPYI 1SQGA 1G98A 3L41A 4MR7B 1Q7CA 3EIXA 4MA5A 1FBTA 1IK6A 1A72A 5WRFA 1U3DA 3VNBA 2HYDA 3LT4A 1EFTA 1N2XA 3A9WA 3FMOB 3W5JA 1G2OA 4DTCA 3WMFA 4CQJA 1Z6XA 2ZI3A 1SXGA 4I50F 3IEKA 3RSLA 4DC1A 1BW9B 4GKKB 4RW0A 1W8IA 4V0ME 4RFVA 2QP3A 4KMMA 3WYDA 4QU8A 1GA1A 2CJWA 4JC8A 4DJDC 4WOCA 4EY8A 1J6UA 2QR2A 2YC2C 4BX0A 1XX6A 2Q2WA 4EHHA 1M2EA 5KUTA 3BXHA 3OE5A 5EZ5A 3ANXA 2XUQA 2FXIA 1N1GA 8AT1A 1JDJA 2KS6A 3HLTA 2PA3A 4TWIA 5KYXA 2VA9A 3KKPA 5LIRA 3DAHA 3MNFA 5BR1A 5DIZA 3JQCA 2QGNA 3NV9A 1SBNE 2WP0A 4FZ5A 1RRMA 3HXOA 5EHGA 3RF6A 4E32A 4O1MA 3DOJA 1U3VA 1H8HA 1FSFA 3FUUA 5PGMA 1I2ZA 1T24A 2ZSFA 4MVYA 4WUTA 1SGWA 5G0UA 1BVHA 4KJZA 2C5LA 2WV9A 4LECA 4AKSA 5JPCA 2R8YA 1VSUA 1IZ7A 1NIJA 2WJPA 2WIKA 4ZVKA 3DXFA 3VNSA 3V33A 2JA2A 5CLGA 2YV4A 1ADFA 1SHUX 4KPFC 1H2BA 1QJ4A 1GPAA 3DE2X 3WG9A 4B3MB 3EDYA 3DEKA 1R8XA 1AUPA 1WAMA 1NVKA 3GXBA 4MYUA 4ILKA 2J3KA 4OAQA 3PNPA 3T7JA 3S1AA 3SQMA 1UP4A 3ESYA 4BJ5A 3RTAA 4QXQA 5CBPB 4ZVOA 5F52A 1QQ6A 2J8ZA 1IBSA 2NUBA 2V7TA 3GEGA 3W2GA 4DKXA 1LPBB 2IOFK