1TXRA

X-ray crystal structure of bestatin bound to aap
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Spectroscopic and X-ray Crystallographic Characterization of Bestatin Bound to the Aminopeptidase from Aeromonas (Vibrio) proteolytica.
pubmed doi rcsb
molecule tags Hydrolase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1txrA00
3B3CA 3H8GA 3KQZA 3IWWA 4OC4A 4PXBA 5LRJA 2NSMA 2V8GA 4EFDA 3D66A 1R3NA 3WABA 5LRKA 1BLLE 2AFZA 4P44A 2GLJA 2QJ8A 3KR4A 6CPAA 5LYLA 3IC1A 1ARMA 1BPNA 1LCPA 1TF9A 4OIWA 1Z2LA 4DUKA 1YLOA 3DLJA 3CT9A 1NSAA 3SI2A 2PJ2A 3NH5A 3K9TA 1Y7EA 1Z5RA 3D7FA 1HEEA 3NFZA 3HLPA 3D7DA 3PB4X 2ZOFA 3CPXA 1TF8A 3IIBA 3IO1A 4PXDA 2AFXA 1CP7A 2BCOA 2GLFA 4P6YA 1DTDA 4PXEA 3ISZA 3IEHA 3FH4A 4NGMA 4ZY1A 3BI0A 4MCQA 2O53A 4Q7AA 3TC8A 2PJ8A 1AMPA 4O23A 2ZENA 3B3WA 4OMEA 2IQ6A 4F8ZA 4MCPA 4F9UA 3SI1A 4H2KA 3FF3A 2RB7A 3PB8X 4IK2A 3L2NA 4A39A 5F09A 4R6TA 3WC6A 4NGQA 4A37A 3GLJA 3H8EA 1LOKA 4JZ0A 3MRUA 2F7VA 5JH9A 5IB9A 2ZEEA 1XFOA 1EE3P 4EMEA 1Z8LA 1LFWA 3CPAA 2Q43A 3HUVA 4OP4A 1CPSA 3B7IA 2PJ1A 2V8VA 3PBEA 2GREA 2PE3A 3LWUA 1FNOA 4UEZA 1QQ9A 5HVGA 3PB9X 2ZEPA 3KI9A 2ZEOA 5JM6A 1KWMA 1ARLA 1DE4C 3D67A 1TKJA 2EWBA 4OC1A 4R7MA 2POKA 3KL9A 3SJGA 4DJLA 4ZYQA 8CPAA 3BXMA 3S9MA 3H8FA 4OC2A 3NH4A 3WC5A 2ZELA 4MMOA 2ZEDA 4KSIA 3B3VA 4FBEA 4R8FA 2PCUA 1ZG9A 5DS0A 4MHZA 1CBXA 2CTBA 2JEWA 2NYQA 2XEFA 4NGRA 1YMEA 5LYIA 2AFOA 3WC7A 3PB7X 1BAVA 2PRQA 4B6ZA 5LYDA 3BI1A 3FEDA 4CPAA 3RBUA 2QVPA 1XRYA 2AFUA 2DEAA 3KASA 3T8WA 4UEEA 1ZG8A 4NJRA 1TXRA 2IMOA 1F57A 1ZLIA 4UIAA 3PFOA 1ZLHA 4WWVA 1TKHA 2GU2A 2PJAA 3GB0A 4A94A 1RTQA 3VARA 2XEIA 2XEGA 4W9YA 2JBJA 3D7GA 4BD9A 1IY7A 2F8HA 1VGYA 4PXCA 2PJ9A 4FAIA 4OC3A 4IAVA 4MXUA 5ELYA 3B3TA 4DYOA 3FVLA 5HVHA 4LQGA 3D68A 2PJCA 1Q7LA 4P45A 1CG2A 1LAPA 2RFHA 2WYRA 4P10A 3SJFA 3BHXA 2ZEHA 4NGSA 3D7HA 2PJ3A 4A38A 2JBKA 2C1CA 2ZEMA 3KZWA 4NGTA 1JQGA 5CPAA 3V38A 2PJBA 4FUUA 2Q4ZA 3IJ3A 4OC0A 3SI0A 4UEFA 4ZI6A 3RAMA 4ZY2A 4P4DA 4AXVA 1XJOA 2Q51A 2PIYA 3B3SA 1FT7A 1XBUA 1ELLP 2PJ4A 5I4MA 2OOTA 5CBMA 3VH9A 2CF4A 2IJZA 3VATA 2WZNA 4NGNA 1YW6A 4TWEA 2V8HA 2HC9A 2PJ0A 3KHZA 3CDXA 4TNUA 4FWUA 2PVWA 4X8IA 2AFMA 3NH8A 5D8NA 3PEIA 2PJ7A 3V7ZA 1CX8A 1XMBA 3ISXA 3SJEA 4RUHA 4JYWA 4WJBA 5J1QA 4MCRA 3K2KA 2I3CA 1ZG7A 3PBBA 2PJ6A 2EK8A 3KGQA 3PRTA 3IFEA 1UWYA 1LAMA 2ANPA 1YW4A 3RZAA 4ONWA 4K3NA 3D4UA 2V8DA 2ZEFA 4P4IA 2QYVA 1AYEA 3B35A 5K8OA 4MHNA 1VIXA 4OC5A 4PPZA 1LANA 4P4JA 4Z65A 1F2OA 1HDUA 1M4LA 2BOAA 4NJQA 2PIZA 4G1PA 4UIBA 4ZY0A 2XEJA 5THWA 4IHMA 4NGPA 4ZX8A 3FX6A 4OIDA 1F2PA 4MHPA 2PVVA 5LYFA 3QNVA 3JRUA 4YU9A 5D29A 2J9AA 3KQXA 1PCAA 3PFEA 1GYTA 3S9NA 4MCSA 1Y0YA 4F9VA 4MHYA 2O4HA 5K8PA 2ZEGA 3WT4A 3FECA 5K8MA 3PB6X 4MRIA 3KHXA 3TX8A 1QMUA 2V77A 4P4FA 2ABZA 7CPAA 3N5FA 4OKOA 4X3RA 2G9DA 3FEEA 2OR4A 1TKFA 4P4EA 2EK9A 3NA6A 4YWYA 3MN8A 2CIJA 2C6GA 2AFSA 3FJUA 3FMCA 2ZOGA 4P4BA 4ZX9A 4X2TA 4R76A 5HVFA 4UF4A 3I1UA 2CTCA 2C6CA 4NFRA 1IGBA 1VHEA 4EWTA 3LMSA 3B2YA 3SJXA 3DGVA 3KR5A 1CPXA 5LRGA 3GUXA 1OBRA 5HXDA 1ELMP 1Y0RA 1HDQA 4PQAA 5JGFA 1R43A 4GM5A 2VL1A 3S9LA 2FVGA 1YSJA 1PYTB 2HB6A 5K8NA 1VHOA 2PJ5A 2AFWA 2C6PA 1BPMA 2BO9A 1H8LA 1CP6A
chains in the Genus database with same CATH superfamily
2FCKA 3B3CA 2JDCA 4AVAA 4H6UA 5CNPA 3H8GA 1M44A 1YQEA 1ZO0A 2ZW4A 3IWWA 3KQZA 4OC4A 4HNYB 4PXBA 5LRJA 4A2ZA 2NSMA 3R96A 2V8GA 4HNXB 4A33A 4EFDA 3D66A 1R3NA 3B8GA 1M4DA 1PUAA 3W6XA 1L0CA 3WABA 1BLLE 2AFZA 3DR8A 4MY0A 3GIUA 1S60A 2B3VA 2GLJA 2QJ8A 3KR4A 4QUSA 6CPAA 2QIRA 2YNEA 4CRZB 5LYLA 5HH1A 3IC1A 1ARMA 1BPNA 4XPDB 1LCPA 1TF9A 4OIWA 4YFJA 1Z2LA 5F46A 3DNSA 4DUKA 4CAWA 1YLOA 3DLJA 3EFAA 1B6BA 2CY2A 3CT9A 4HNWB 1NSAA 3FBUA 4ZBGA 3S6KA 4OAEA 2R8VA 2WPXA 3SI2A 3TOAA 1YX0A 4B5PA 1P4NA 2PJ2A 1M1DA 2QECA 3NH5A 3K9TA 3CXQA 4K30A 4KVOE 4Q36A 1Y7EA 1Z5RA 3D7FA 4HPSA 1HEEA 3NFZA 1JWQA 2CNTA 2Z3LA 3PZJA 3HLPA 4H6ZA 2Q4YA 3D7DA 2Q44A 2G3AA 3PB4X 2P6FA 2ZOFA 3CPXA 1TF8A 3IIBA 3IO1A 4PXDA 4KLWA 4IF5A 3CXPA 2AFXA 4PK2A 1IICA 5A28A 1CP7A 4KS9A 4M6IA 5H84A 2BCOA 2GLFA 4LUAA 4P6YA 1DTDA 4PXEA 3EXNA 2CNSA 2X7BA 1YREA 2WPWA 3ISZA 3IEHA 3FH4A 2FSRA 3PP9A 1TIQA 4NGMA 4QB9A 4ZY1A 4R3KA 1Q2CA 3BI0A 4MCQA 3TO6A 1K4JA 4B5PB 2O53A 2WSAA 4Q7AA 3TC8A 2PJ8A 1AMPA 3FB3A 1AUGA 1VHSA 4MY3A 4O23A 2CNMA 2FE7A 2ZENA 3B3WA 2AJ6A 2Z3OA 4KUBA 4OMEA 2IQ6A 4GXHA 2ZXVA 4F8ZA 4MCPA 3SHPA 2GFQA 3R9FA 4F9UA 2J8NA 3SI1A 4H2KA 3FF3A 2RB7A 3PB8X 2BL1A 4IK2A 4J3GA 3L2NA 4A39A 5F09A 4R6TA 3EO4A 3P2HA 2KCWA 3WC6A 2A4NA 4NGQA 1KUXA 1Y9KA 4A37A 3GLJA 4KLVA 3H8EA 2P0WA 3R9GA 3T9YA 1LOKA 4JZ0A 1U6MA 2FXFA 3MRUA 4M3SA 1V0CA 2OZUA 4M85A 4EVYA 2F7VA 2PC1A 3R9EA 5I0CA 5JH9A 2GIVA 5IB9A 5KTAA 4FD7A 2ZEEA 1XFOA 1EE3P 1YR0A 4EMEA 1Z8LA 1LFWA 5AG6A 3EY5A 1BOBA 3CPAA 4L89A 4C7IA 3TT2A 4XPLA 2Q43A 4OLLA 3HUVA 2ZPAA 4KOYA 3F0AA 3P2FA 4OP4A 1MJAA 1CPSA 3B7IA 2PJ1A 3IGRA 2FS5A 4R87A 2V8VA 3F8KA 3PBEA 2GREA 2ZW5A 4E0AA 3R95A 4AVBA 2PE3A 3LWUA 1UFHA 1FNOA 2Q04A 4UEZA 1IYLA 1QQ9A 1IB1E 2OU2A 4MFZA 1I1DA 4CS0B 5HVGA 3PB9X 2ZEPA 1MJ9A 3D8PA 3KI9A 4II9A 3TCVA 2J8MA 2ZEOA 5JM6A 4PSXA 1KWMA 1ARLA 1X10A 4QBJA 1GHEA 3DR6A 1DE4C 3D67A 1QSMA 1TKJA 2EWBA 3R1KA 4OC1A 1NMTA 2POKA 3KL9A 4JJXA 4KOUA 4R7MA 2B4DA 3SJGA 4DJLA 4ZYQA 3BXMA 4MFPA 8CPAA 5KTDA 4A32A 3S9MA 2Q0YA 5G22A 3S6GA 4F6AA 2AE6A 4U9YA 4CAVA 1S7NA 2DPTA 3H8FA 4UBRA 3RYOA 4OC2A 2GANA 3NH4A 4JWPA 4MJ8A 3WC5A 2ZELA 4MMOA 2ZEDA 4F0YA 4KSIA 3C26A 3TOBA 4KVXA 2YNCC 5IB0A 4Y49C 3B3VA 4FBEA 4R8FA 2PCUA 1ZG9A 5DS0A 4MHZA 1YVKA 1CBXA 2CTBA 2JEWA 2NYQA 2XEFA 3JVNA 4NGRA 4RN7A 1YMEA 3BJ8A 5E96A 4UCMA 3FYNA 5H86A 5LYIA 2AFOA 2Q7SA 5C88A 3WC7A 3PB7X 5EMIA 5C82A 1BAVA 1J4JA 2PRQA 2B4DB 4B6ZA 1IOFA 2REEA 5LYDA 3BI1A 3FEDA 4CPAA 3RBUA 1IIDA 2QVPA 1A2ZA 3FRMA 3I9SA 5IX3A 1XRYA 2AFUA 4XPKA 2DEAA 3KASA 4A95A 3T8WA 2Z10A 4R57A 3TTHA 2EUIA 4UEEA 1IU8A 1ZG8A 2B3UA 2P6GA 4NJRA 4OADA 3ZZIA 2Z3MA 1CM0A 1TXRA 3GYAA 5ISVA 2G3TA 1KUYA 2IMOA 1F57A 1ZLIA 4UIAA 3LODA 4LQ6A 3PFOA 4MFLA 1ZLHA 4WWVA 1TKHA 2GU2A 1XE4A 2PJAA 3GB0A 1S7LA 3TE4A 1N71A 4C2YA 4A94A 4CAFA 3S6FA 1RTQA 4QVTA 3VARA 1QSNA 4NCZA 3TO7A 4PSWA 2PR8A 2XEIA 1S7KA 2Z3KA 4FD6A 2XEGA 4RS2A 2Q4VA 2Z11A 4UFXA 4W9YA 2JBJA 1YLEA 4KOSA 3D7GA 4BD9A 1IY7A 2F8HA 1VGYA 3FIXA 4IUSA 4B5OA 4C2ZA 4JXRA 4YRHA 4ORFA 4NF1A 4KOVA 2PJ9A 4PXCA 4FAIA 4F0XA 4U5YA 1KZFA 4OC3A 1XIXA 3A9LA 4MFJA 5F48A 1S7FA 4IAVA 4P44A 4MXUA 5AGEA 5ELYA 4C2XA 3B3TA 4XNHB 3FVLA 4XPDC 4DYOA 5HVHA 1S5KA 4LQGA 3D68A 2PJCA 1Q7LA 1Z4EA 4P45A 1CG2A 2YGWA 1LAPA 2RFHA 2WYRA 5F49A 4KORA 4P10A 3SJFA 3BHXA 3H5ZA 1S3ZA 2ZEHA 3QAHA 3H4QA 4KSAA 4NGSA 4MFKA 3D7HA 1CJWA 2PJ3A 4A38A 3JTKA 2JBKA 2C1CA 4A30A 4LX9A 1OZPA 5EBVA 1RXTA 2ZEMA 3EC4A 4M6HA 3KZWA 4NGTA 2VEZA 4CYQA 1JQGA 2BUEA 5CPAA 3G3SA 3V38A 2PJBA 4FUUA 2Q4ZA 2DPSA 3IJ3A 4UCPA 2EBJA 4OC0A 5DWMA 3GY9A 3RO0A 4U9ZA 5AG7A 3SI0A 2VI7A 1VKCA 3D3SA 4UEFA 4ZI6A 5IV0A 4MBUA 4PK3A 4ZY2A 3RAMA 4P4DA 4AG7A 4AXVA 1XJOA 2Q7BA 2Q51A 3BLNA 2PIYA 4AVCA 1RO5A 3IWGA 3B3SA 3I3GA 3QB8A 4RI1A 1FT7A 2PQ8A 2NMTA 1XBUA 1ELLP 2PJ4A 3S6HA 1Z8XA 5I4MA 2WUUA 2OOTA 4NEXA 2R7HA 5CBMA 2I00A 3VH9A 4H89A 2VBQA 4UWIA 2CF4A 3KKWA 2IJZA 2RC4A 5G21A 3V8IA 3VATA 1PU9A 2VZYA 3IU2A 2WZNA 4DNCA 1SQHA 4NGNA 1M4IA 1YW6A 4TWEA 2ARHA 5G20A 2R98A 3FXTA 2V8HA 2HC9A 1NE9A 2JEVA 2PJ0A 3JUWA 3KHZA 3CDXA 4TNUA 4FWUA 2PVWA 2ZW7A 2O28A 2HV2A 3F5BA 1I12A 2I79A 4X8IA 2AFMA 3UY5A 1P0HA 3NH8A 4BINA 2EO8A 5D8NA 4ZGYB 3GKRA 3PEIA 2PJ7A 3V7ZA 1CX8A 4JLYA 4B14A 1XMBA 3ISXA 3SJEA 4RUHA 4L8AA 2VXKA 3CXSA 3VWEA 5EC4A 4JYWA 4WJBA 5J1QA 4KVME 3ZJ0A 2VQYA 4KSFA 4UFWA 4MCRA 3K2KA 1IOIA 5FVJA 2PR1A 2I3CA 1ZG7A 4NSQA 4UA3A 2ZW6A 3LD2A 2D4PA 3PBBA 2PJ6A 2EK8A 3KGQA 3PRTA 4B10A 5G1ZA 2OH1A 3WR7A 5J8CA 3IFEA 2PSWA 4FD5A 4HKFA 1UWYA 1ON0A 5BWAB 1Q2YA 1LAMA 2ANPA 1YW4A 1BO4A 3RZAA 4ONWA 4K3NA 4BBHA 3D4UA 2V8DA 2ZEFA 1XEBA 2QYVA 4ONUA 1AYEA 4P4IA 3B35A 3N7ZA 4CGNA 4MHNA 2Z3NA 1VIXA 3T90A 4CGLA 5K8OA 4MFQA 1Z8TA 4OC5A 4PPZA 1IYKA 1LANA 4P4JA 4Z65A 1F2OA 1HDUA 1M4LA 2BOAA 5AG4A 2GE3A 5A27A 4NJQA 3D2MA 3DSBA 2PIZA 5LRKA 4G1PA 4M6GA 2P6EA 4UIBA 5JQ4A 2OZGA 4ZY0A 1MK4A 1Q2DA 2XEJA 4C7HA 1I21A 5THWA 1FY7A 3BJ7A 4IHMA 1YVOA 4KOTA 3DDDA 4A31A 1Z4RA 4CGMA 4NGPA 1QSRA 4YGOA 4CGOA 4ZX8A 3FX6A 4OIDA 4KZTA 5AG5A 1XOVA 5HMNA 2QMLA 3TO9A 1Z9UA 1F2PA 4MHPA 2HQYA 2PVVA 4E8OA 5LYFA 3QNVA 2F5IA 3JRUA 2EVNA 2YNDA 4YU9A 5D29A 4AG9A 2J9AA 3KQXA 2G0BA 1PCAA 2B4BA 1Z8WA 5GCNA 2VZZA 2B58A 3PFEA 4CYNA 2FIWA 2ODFA 1GYTA 3S9NA 4MCSA 4PV6A 1Y0YA 4F9VA 2Z3PA 2BSWA 4MHYA 2O4HA 5K8PA 2ZEGA 3WT4A 4UFVA 3FECA 5K8MA 3PB6X 4MRIA 2OB0A 4X5KA 3OWCA 2C27A 3SXOA 3KHXA 3TX8A 3LACA 3IWEA 1KUVA 1QMUA 4C68A 1YGHA 2REFA 5KTCA 4AB7A 2V77A 4P4FA 2ABZA 4B12A 3W91A 2FT0A 1XMTA 4NXYA 7CPAA 2YNCA 4I49A 4B11A 4B13A 3N5FA 4OKOA 2DXQA 4X3RA 2G9DA 3FEEA 2OR4A 3TFYA 1MJBA 1TKFA 4P4EA 2EK9A 5JPHA 2IL4A 1R57A 4QC6A 3W6SA 3VWDA 2J8RA 3NE7A 1YK3A 2PRBA 3E0KA 3NA6A 4YWYA 3MN8A 2CIJA 4CAEA 2C6GA 2AFSA 2R1IA 2PDOA 3FJUA 3FMCA 4KUAA 1WK4A 5J8FA 4XNHC 3MGDA 2ZOGA 4P4BA 4UWJA 2OZHA 1M4GA 3IU1A 4MI4A 4X2TA 2K5TA 4R76A 4ZX9A 4CYOA 3CZXA 1QSOA 4R9MA 2D4OA 5HVFA 4Y49B 1Y7RA 4UF4A 2FL4A 3K9UA 1WWZA 3I1UA 1QSTA 2B5GA 1NSLA 2CTCA 3FNCA 2C6CA 2HUZA 4E2AA 4MHDA 4NFRA 5F47A 1IGBA 1XF8A 4FD4A 1VHEA 1X12A 4EWTA 3LMSA 3B2YA 3SJXA 3DGVA 2JLMA 4CAXA 2FIAA 1CPXA 3G8WA 3KR5A 5LRGA 2ATRA 3QAYA 4KOXA 1Y9WA 3GUXA 1OBRA 4KOWA 2DF5A 5HXDA 1ELMP 2Z0ZA 4Q38A 4JD6A 1Y0RA 1HDQA 4PQAA 4BMHA 3RNZA 5JGFA 1R43A 4GM5A 2H5MA 2VL1A 1LRZA 3S9LA 2FVGA 1YSJA 2B5GB 1PYTB 4GS4A 2JDDA 4R3LA 5DWNA 2HB6A 5K8NA 3NE8A 2BEIA 1VHOA 3PGPA 2CXAA 4UCNA 1B87A 2PJ5A 2Y0MA 3SXNA 4JXQA 2AFWA 2C6PA 1BPMA 4CRYB 4CYPA 2BO9A 1H8LA 4CGPA 3D2PA 1CP6A
chains in the Genus database with same CATH topology
3B3CA 3H8GA 3KQZA 3IWWA 4OC4A 4PXBA 5LRJA 2NSMA 2V8GA 4EFDA 3D66A 1R3NA 3WABA 5LRKA 1BLLE 2AFZA 4P44A 2GLJA 2QJ8A 3KR4A 6CPAA 5LYLA 3IC1A 1ARMA 1BPNA 1LCPA 1TF9A 4OIWA 1Z2LA 4DUKA 1YLOA 3DLJA 3CT9A 1NSAA 3SI2A 2PJ2A 3NH5A 3K9TA 1Y7EA 1Z5RA 3D7FA 1HEEA 3NFZA 3HLPA 3D7DA 3PB4X 2ZOFA 3CPXA 1TF8A 3IIBA 3IO1A 4PXDA 2AFXA 1CP7A 2BCOA 2GLFA 4P6YA 1DTDA 4PXEA 3ISZA 3IEHA 3FH4A 4NGMA 4ZY1A 3BI0A 4MCQA 2O53A 4Q7AA 3TC8A 2PJ8A 1AMPA 4O23A 2ZENA 3B3WA 4OMEA 2IQ6A 4F8ZA 4MCPA 4F9UA 3SI1A 4H2KA 3FF3A 2RB7A 3PB8X 4IK2A 3L2NA 4A39A 5F09A 4R6TA 3WC6A 4NGQA 4A37A 3GLJA 3H8EA 1LOKA 4JZ0A 3MRUA 2F7VA 5JH9A 5IB9A 2ZEEA 1XFOA 1EE3P 4EMEA 1Z8LA 1LFWA 3CPAA 2Q43A 3HUVA 4OP4A 1CPSA 3B7IA 2PJ1A 2V8VA 3PBEA 2GREA 2PE3A 3LWUA 1FNOA 4UEZA 1QQ9A 5HVGA 3PB9X 2ZEPA 3KI9A 2ZEOA 5JM6A 1KWMA 1ARLA 1DE4C 3D67A 1TKJA 2EWBA 4OC1A 4R7MA 2POKA 3KL9A 3SJGA 4DJLA 4ZYQA 8CPAA 3BXMA 3S9MA 3H8FA 4OC2A 3NH4A 3WC5A 2ZELA 4MMOA 2ZEDA 4KSIA 3B3VA 4FBEA 4R8FA 2PCUA 1ZG9A 5DS0A 4MHZA 1CBXA 2CTBA 2JEWA 2NYQA 2XEFA 4NGRA 1YMEA 5LYIA 2AFOA 3WC7A 3PB7X 1BAVA 2PRQA 4B6ZA 5LYDA 3BI1A 3FEDA 4CPAA 3RBUA 2QVPA 1XRYA 2AFUA 2DEAA 3KASA 3T8WA 4UEEA 1ZG8A 4NJRA 1TXRA 2IMOA 1F57A 1ZLIA 4UIAA 3PFOA 1ZLHA 4WWVA 1TKHA 2GU2A 2PJAA 3GB0A 4A94A 1RTQA 3VARA 2XEIA 2XEGA 4W9YA 2JBJA 3D7GA 4BD9A 1IY7A 2F8HA 1VGYA 4PXCA 2PJ9A 4FAIA 4OC3A 4IAVA 4MXUA 5ELYA 3B3TA 4DYOA 3FVLA 5HVHA 4LQGA 3D68A 2PJCA 1Q7LA 4P45A 1CG2A 1LAPA 2RFHA 2WYRA 4P10A 3SJFA 3BHXA 2ZEHA 4NGSA 3D7HA 2PJ3A 4A38A 2JBKA 2C1CA 2ZEMA 3KZWA 4NGTA 1JQGA 5CPAA 3V38A 2PJBA 4FUUA 2Q4ZA 3IJ3A 4OC0A 3SI0A 4UEFA 4ZI6A 3RAMA 4ZY2A 4P4DA 4AXVA 1XJOA 2Q51A 2PIYA 3B3SA 1FT7A 1XBUA 1ELLP 2PJ4A 5I4MA 2OOTA 5CBMA 3VH9A 2CF4A 2IJZA 3VATA 2WZNA 4NGNA 1YW6A 4TWEA 2V8HA 2HC9A 2PJ0A 3KHZA 3CDXA 4TNUA 4FWUA 2PVWA 4X8IA 2AFMA 3NH8A 5D8NA 3PEIA 2PJ7A 3V7ZA 1CX8A 1XMBA 3ISXA 3SJEA 4RUHA 4JYWA 4WJBA 5J1QA 4MCRA 3K2KA 2I3CA 1ZG7A 3PBBA 2PJ6A 2EK8A 3KGQA 3PRTA 3IFEA 1UWYA 1LAMA 2ANPA 1YW4A 3RZAA 4ONWA 4K3NA 3D4UA 2V8DA 2ZEFA 4P4IA 2QYVA 1AYEA 3B35A 5K8OA 4MHNA 1VIXA 4OC5A 4PPZA 1LANA 4P4JA 4Z65A 1F2OA 1HDUA 1M4LA 2BOAA 4NJQA 2PIZA 4G1PA 4UIBA 4ZY0A 2XEJA 5THWA 4IHMA 4NGPA 4ZX8A 3FX6A 4OIDA 1F2PA 4MHPA 2PVVA 5LYFA 3QNVA 3JRUA 4YU9A 5D29A 2J9AA 3KQXA 1PCAA 3PFEA 1GYTA 3S9NA 4MCSA 1Y0YA 4F9VA 4MHYA 2O4HA 5K8PA 2ZEGA 3WT4A 3FECA 5K8MA 3PB6X 4MRIA 3KHXA 3TX8A 1QMUA 2V77A 4P4FA 2ABZA 7CPAA 3N5FA 4OKOA 4X3RA 2G9DA 3FEEA 2OR4A 1TKFA 4P4EA 2EK9A 3NA6A 4YWYA 3MN8A 2CIJA 2C6GA 2AFSA 3FJUA 3FMCA 2ZOGA 4P4BA 4ZX9A 4X2TA 4R76A 5HVFA 4UF4A 3I1UA 2CTCA 2C6CA 4NFRA 1IGBA 1VHEA 4EWTA 3LMSA 3B2YA 3SJXA 3DGVA 3KR5A 1CPXA 5LRGA 3GUXA 1OBRA 5HXDA 1ELMP 1Y0RA 1HDQA 4PQAA 5JGFA 1R43A 4GM5A 2VL1A 3S9LA 2FVGA 1YSJA 1PYTB 2HB6A 5K8NA 1VHOA 2PJ5A 2AFWA 2C6PA 1BPMA 2BO9A 1H8LA 1CP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B3C A;  3H8G A;  3KQZ A;  3IWW A;  4OC4 A;  4PXB A;  5LRJ A;  2NSM A;  2V8G A;  4EFD A;  3D66 A;  1R3N A;  3WAB A;  5LRK A;  1BLL E;  2AFZ A;  4P44 A;  2GLJ A;  2QJ8 A;  3KR4 A;  6CPA A;  5LYL A;  3IC1 A;  1ARM A;  1BPN A;  1LCP A;  1TF9 A;  4OIW A;  1Z2L A;  4DUK A;  1YLO A;  3DLJ A;  3CT9 A;  1NSA A;  3SI2 A;  2PJ2 A;  3NH5 A;  3K9T A;  1Y7E A;  1Z5R A;  3D7F A;  1HEE A;  3NFZ A;  3HLP A;  3D7D A;  3PB4 X;  2ZOF A;  3CPX A;  1TF8 A;  3IIB A;  3IO1 A;  4PXD A;  2AFX A;  1CP7 A;  2BCO A;  2GLF A;  4P6Y A;  1DTD A;  4PXE A;  3ISZ A;  3IEH A;  3FH4 A;  4NGM A;  4ZY1 A;  3BI0 A;  4MCQ A;  2O53 A;  4Q7A A;  3TC8 A;  2PJ8 A;  1AMP A;  4O23 A;  2ZEN A;  3B3W A;  4OME A;  2IQ6 A;  4F8Z A;  4MCP A;  4F9U A;  3SI1 A;  4H2K A;  3FF3 A;  2RB7 A;  3PB8 X;  4IK2 A;  3L2N A;  4A39 A;  5F09 A;  4R6T A;  3WC6 A;  4NGQ A;  4A37 A;  3GLJ A;  3H8E A;  1LOK A;  4JZ0 A;  3MRU A;  2F7V A;  5JH9 A;  5IB9 A;  2ZEE A;  1XFO A;  1EE3 P;  4EME A;  1Z8L A;  1LFW A;  3CPA A;  2Q43 A;  3HUV A;  4OP4 A;  1CPS A;  3B7I A;  2PJ1 A;  2V8V A;  3PBE A;  2GRE A;  2PE3 A;  3LWU A;  1FNO A;  4UEZ A;  1QQ9 A;  5HVG A;  3PB9 X;  2ZEP A;  3KI9 A;  2ZEO A;  5JM6 A;  1KWM A;  1ARL A;  1DE4 C;  3D67 A;  1TKJ A;  2EWB A;  4OC1 A;  4R7M A;  2POK A;  3KL9 A;  3SJG A;  4DJL A;  4ZYQ A;  8CPA A;  3BXM A;  3S9M A;  3H8F A;  4OC2 A;  3NH4 A;  3WC5 A;  2ZEL A;  4MMO A;  2ZED A;  4KSI A;  3B3V A;  4FBE A;  4R8F A;  2PCU A;  1ZG9 A;  5DS0 A;  4MHZ A;  1CBX A;  2CTB A;  2JEW A;  2NYQ A;  2XEF A;  4NGR A;  1YME A;  5LYI A;  2AFO A;  3WC7 A;  3PB7 X;  1BAV A;  2PRQ A;  4B6Z A;  5LYD A;  3BI1 A;  3FED A;  4CPA A;  3RBU A;  2QVP A;  1XRY A;  2AFU A;  2DEA A;  3KAS A;  3T8W A;  4UEE A;  1ZG8 A;  4NJR A;  1TXR A;  2IMO A;  1F57 A;  1ZLI A;  4UIA A;  3PFO A;  1ZLH A;  4WWV A;  1TKH A;  2GU2 A;  2PJA A;  3GB0 A;  4A94 A;  1RTQ A;  3VAR A;  2XEI A;  2XEG A;  4W9Y A;  2JBJ A;  3D7G A;  4BD9 A;  1IY7 A;  2F8H A;  1VGY A;  4PXC A;  2PJ9 A;  4FAI A;  4OC3 A;  4IAV A;  4MXU A;  5ELY A;  3B3T A;  4DYO A;  3FVL A;  5HVH A;  4LQG A;  3D68 A;  2PJC A;  1Q7L A;  4P45 A;  1CG2 A;  1LAP A;  2RFH A;  2WYR A;  4P10 A;  3SJF A;  3BHX A;  2ZEH A;  4NGS A;  3D7H A;  2PJ3 A;  4A38 A;  2JBK A;  2C1C A;  2ZEM A;  3KZW A;  4NGT A;  1JQG A;  5CPA A;  3V38 A;  2PJB A;  4FUU A;  2Q4Z A;  3IJ3 A;  4OC0 A;  3SI0 A;  4UEF A;  4ZI6 A;  3RAM A;  4ZY2 A;  4P4D A;  4AXV A;  1XJO A;  2Q51 A;  2PIY A;  3B3S A;  1FT7 A;  1XBU A;  1ELL P;  2PJ4 A;  5I4M A;  2OOT A;  5CBM A;  3VH9 A;  2CF4 A;  2IJZ A;  3VAT A;  2WZN A;  4NGN A;  1YW6 A;  4TWE A;  2V8H A;  2HC9 A;  2PJ0 A;  3KHZ A;  3CDX A;  4TNU A;  4FWU A;  2PVW A;  4X8I A;  2AFM A;  3NH8 A;  5D8N A;  3PEI A;  2PJ7 A;  3V7Z A;  1CX8 A;  1XMB A;  3ISX A;  3SJE A;  4RUH A;  4JYW A;  4WJB A;  5J1Q A;  4MCR A;  3K2K A;  2I3C A;  1ZG7 A;  3PBB A;  2PJ6 A;  2EK8 A;  3KGQ A;  3PRT A;  3IFE A;  1UWY A;  1LAM A;  2ANP A;  1YW4 A;  3RZA A;  4ONW A;  4K3N A;  3D4U A;  2V8D A;  2ZEF A;  4P4I A;  2QYV A;  1AYE A;  3B35 A;  5K8O A;  4MHN A;  1VIX A;  4OC5 A;  4PPZ A;  1LAN A;  4P4J A;  4Z65 A;  1F2O A;  1HDU A;  1M4L A;  2BOA A;  4NJQ A;  2PIZ A;  4G1P A;  4UIB A;  4ZY0 A;  2XEJ A;  5THW A;  4IHM A;  4NGP A;  4ZX8 A;  3FX6 A;  4OID A;  1F2P A;  4MHP A;  2PVV A;  5LYF A;  3QNV A;  3JRU A;  4YU9 A;  5D29 A;  2J9A A;  3KQX A;  1PCA A;  3PFE A;  1GYT A;  3S9N A;  4MCS A;  1Y0Y A;  4F9V A;  4MHY A;  2O4H A;  5K8P A;  2ZEG A;  3WT4 A;  3FEC A;  5K8M A;  3PB6 X;  4MRI A;  3KHX A;  3TX8 A;  1QMU A;  2V77 A;  4P4F A;  2ABZ A;  7CPA A;  3N5F A;  4OKO A;  4X3R A;  2G9D A;  3FEE A;  2OR4 A;  1TKF A;  4P4E A;  2EK9 A;  3NA6 A;  4YWY A;  3MN8 A;  2CIJ A;  2C6G A;  2AFS A;  3FJU A;  3FMC A;  2ZOG A;  4P4B A;  4ZX9 A;  4X2T A;  4R76 A;  5HVF A;  4UF4 A;  3I1U A;  2CTC A;  2C6C A;  4NFR A;  1IGB A;  1VHE A;  4EWT A;  3LMS A;  3B2Y A;  3SJX A;  3DGV A;  3KR5 A;  1CPX A;  5LRG A;  3GUX A;  1OBR A;  5HXD A;  1ELM P;  1Y0R A;  1HDQ A;  4PQA A;  5JGF A;  1R43 A;  4GM5 A;  2VL1 A;  3S9L A;  2FVG A;  1YSJ A;  1PYT B;  2HB6 A;  5K8N A;  1VHO A;  2PJ5 A;  2AFW A;  2C6P A;  1BPM A;  2BO9 A;  1H8L A;  1CP6 A; 
#chains in the Genus database with same CATH topology
 2FCK A;  3B3C A;  2JDC A;  4AVA A;  4H6U A;  5CNP A;  3H8G A;  1M44 A;  1YQE A;  1ZO0 A;  2ZW4 A;  3IWW A;  3KQZ A;  4OC4 A;  4HNY B;  4PXB A;  5LRJ A;  4A2Z A;  2NSM A;  3R96 A;  2V8G A;  4HNX B;  4A33 A;  4EFD A;  3D66 A;  1R3N A;  3B8G A;  1M4D A;  1PUA A;  3W6X A;  1L0C A;  3WAB A;  1BLL E;  2AFZ A;  3DR8 A;  4MY0 A;  3GIU A;  1S60 A;  2B3V A;  2GLJ A;  2QJ8 A;  3KR4 A;  4QUS A;  6CPA A;  2QIR A;  2YNE A;  4CRZ B;  5LYL A;  5HH1 A;  3IC1 A;  1ARM A;  1BPN A;  4XPD B;  1LCP A;  1TF9 A;  4OIW A;  4YFJ A;  1Z2L A;  5F46 A;  3DNS A;  4DUK A;  4CAW A;  1YLO A;  3DLJ A;  3EFA A;  1B6B A;  2CY2 A;  3CT9 A;  4HNW B;  1NSA A;  3FBU A;  4ZBG A;  3S6K A;  4OAE A;  2R8V A;  2WPX A;  3SI2 A;  3TOA A;  1YX0 A;  4B5P A;  1P4N A;  2PJ2 A;  1M1D A;  2QEC A;  3NH5 A;  3K9T A;  3CXQ A;  4K30 A;  4KVO E;  4Q36 A;  1Y7E A;  1Z5R A;  3D7F A;  4HPS A;  1HEE A;  3NFZ A;  1JWQ A;  2CNT A;  2Z3L A;  3PZJ A;  3HLP A;  4H6Z A;  2Q4Y A;  3D7D A;  2Q44 A;  2G3A A;  3PB4 X;  2P6F A;  2ZOF A;  3CPX A;  1TF8 A;  3IIB A;  3IO1 A;  4PXD A;  4KLW A;  4IF5 A;  3CXP A;  2AFX A;  4PK2 A;  1IIC A;  5A28 A;  1CP7 A;  4KS9 A;  4M6I A;  5H84 A;  2BCO A;  2GLF A;  4LUA A;  4P6Y A;  1DTD A;  4PXE A;  3EXN A;  2CNS A;  2X7B A;  1YRE A;  2WPW A;  3ISZ A;  3IEH A;  3FH4 A;  2FSR A;  3PP9 A;  1TIQ A;  4NGM A;  4QB9 A;  4ZY1 A;  4R3K A;  1Q2C A;  3BI0 A;  4MCQ A;  3TO6 A;  1K4J A;  4B5P B;  2O53 A;  2WSA A;  4Q7A A;  3TC8 A;  2PJ8 A;  1AMP A;  3FB3 A;  1AUG A;  1VHS A;  4MY3 A;  4O23 A;  2CNM A;  2FE7 A;  2ZEN A;  3B3W A;  2AJ6 A;  2Z3O A;  4KUB A;  4OME A;  2IQ6 A;  4GXH A;  2ZXV A;  4F8Z A;  4MCP A;  3SHP A;  2GFQ A;  3R9F A;  4F9U A;  2J8N A;  3SI1 A;  4H2K A;  3FF3 A;  2RB7 A;  3PB8 X;  2BL1 A;  4IK2 A;  4J3G A;  3L2N A;  4A39 A;  5F09 A;  4R6T A;  3EO4 A;  3P2H A;  2KCW A;  3WC6 A;  2A4N A;  4NGQ A;  1KUX A;  1Y9K A;  4A37 A;  3GLJ A;  4KLV A;  3H8E A;  2P0W A;  3R9G A;  3T9Y A;  1LOK A;  4JZ0 A;  1U6M A;  2FXF A;  3MRU A;  4M3S A;  1V0C A;  2OZU A;  4M85 A;  4EVY A;  2F7V A;  2PC1 A;  3R9E A;  5I0C A;  5JH9 A;  2GIV A;  5IB9 A;  5KTA A;  4FD7 A;  2ZEE A;  1XFO A;  1EE3 P;  1YR0 A;  4EME A;  1Z8L A;  1LFW A;  5AG6 A;  3EY5 A;  1BOB A;  3CPA A;  4L89 A;  4C7I A;  3TT2 A;  4XPL A;  2Q43 A;  4OLL A;  3HUV A;  2ZPA A;  4KOY A;  3F0A A;  3P2F A;  4OP4 A;  1MJA A;  1CPS A;  3B7I A;  2PJ1 A;  3IGR A;  2FS5 A;  4R87 A;  2V8V A;  3F8K A;  3PBE A;  2GRE A;  2ZW5 A;  4E0A A;  3R95 A;  4AVB A;  2PE3 A;  3LWU A;  1UFH A;  1FNO A;  2Q04 A;  4UEZ A;  1IYL A;  1QQ9 A;  1IB1 E;  2OU2 A;  4MFZ A;  1I1D A;  4CS0 B;  5HVG A;  3PB9 X;  2ZEP A;  1MJ9 A;  3D8P A;  3KI9 A;  4II9 A;  3TCV A;  2J8M A;  2ZEO A;  5JM6 A;  4PSX A;  1KWM A;  1ARL A;  1X10 A;  4QBJ A;  1GHE A;  3DR6 A;  1DE4 C;  3D67 A;  1QSM A;  1TKJ A;  2EWB A;  3R1K A;  4OC1 A;  1NMT A;  2POK A;  3KL9 A;  4JJX A;  4KOU A;  4R7M A;  2B4D A;  3SJG A;  4DJL A;  4ZYQ A;  3BXM A;  4MFP A;  8CPA A;  5KTD A;  4A32 A;  3S9M A;  2Q0Y A;  5G22 A;  3S6G A;  4F6A A;  2AE6 A;  4U9Y A;  4CAV A;  1S7N A;  2DPT A;  3H8F A;  4UBR A;  3RYO A;  4OC2 A;  2GAN A;  3NH4 A;  4JWP A;  4MJ8 A;  3WC5 A;  2ZEL A;  4MMO A;  2ZED A;  4F0Y A;  4KSI A;  3C26 A;  3TOB A;  4KVX A;  2YNC C;  5IB0 A;  4Y49 C;  3B3V A;  4FBE A;  4R8F A;  2PCU A;  1ZG9 A;  5DS0 A;  4MHZ A;  1YVK A;  1CBX A;  2CTB A;  2JEW A;  2NYQ A;  2XEF A;  3JVN A;  4NGR A;  4RN7 A;  1YME A;  3BJ8 A;  5E96 A;  4UCM A;  3FYN A;  5H86 A;  5LYI A;  2AFO A;  2Q7S A;  5C88 A;  3WC7 A;  3PB7 X;  5EMI A;  5C82 A;  1BAV A;  1J4J A;  2PRQ A;  2B4D B;  4B6Z A;  1IOF A;  2REE A;  5LYD A;  3BI1 A;  3FED A;  4CPA A;  3RBU A;  1IID A;  2QVP A;  1A2Z A;  3FRM A;  3I9S A;  5IX3 A;  1XRY A;  2AFU A;  4XPK A;  2DEA A;  3KAS A;  4A95 A;  3T8W A;  2Z10 A;  4R57 A;  3TTH A;  2EUI A;  4UEE A;  1IU8 A;  1ZG8 A;  2B3U A;  2P6G A;  4NJR A;  4OAD A;  3ZZI A;  2Z3M A;  1CM0 A;  1TXR A;  3GYA A;  5ISV A;  2G3T A;  1KUY A;  2IMO A;  1F57 A;  1ZLI A;  4UIA A;  3LOD A;  4LQ6 A;  3PFO A;  4MFL A;  1ZLH A;  4WWV A;  1TKH A;  2GU2 A;  1XE4 A;  2PJA A;  3GB0 A;  1S7L A;  3TE4 A;  1N71 A;  4C2Y A;  4A94 A;  4CAF A;  3S6F A;  1RTQ A;  4QVT A;  3VAR A;  1QSN A;  4NCZ A;  3TO7 A;  4PSW A;  2PR8 A;  2XEI A;  1S7K A;  2Z3K A;  4FD6 A;  2XEG A;  4RS2 A;  2Q4V A;  2Z11 A;  4UFX A;  4W9Y A;  2JBJ A;  1YLE A;  4KOS A;  3D7G A;  4BD9 A;  1IY7 A;  2F8H A;  1VGY A;  3FIX A;  4IUS A;  4B5O A;  4C2Z A;  4JXR A;  4YRH A;  4ORF A;  4NF1 A;  4KOV A;  2PJ9 A;  4PXC A;  4FAI A;  4F0X A;  4U5Y A;  1KZF A;  4OC3 A;  1XIX A;  3A9L A;  4MFJ A;  5F48 A;  1S7F A;  4IAV A;  4P44 A;  4MXU A;  5AGE A;  5ELY A;  4C2X A;  3B3T A;  4XNH B;  3FVL A;  4XPD C;  4DYO A;  5HVH A;  1S5K A;  4LQG A;  3D68 A;  2PJC A;  1Q7L A;  1Z4E A;  4P45 A;  1CG2 A;  2YGW A;  1LAP A;  2RFH A;  2WYR A;  5F49 A;  4KOR A;  4P10 A;  3SJF A;  3BHX A;  3H5Z A;  1S3Z A;  2ZEH A;  3QAH A;  3H4Q A;  4KSA A;  4NGS A;  4MFK A;  3D7H A;  1CJW A;  2PJ3 A;  4A38 A;  3JTK A;  2JBK A;  2C1C A;  4A30 A;  4LX9 A;  1OZP A;  5EBV A;  1RXT A;  2ZEM A;  3EC4 A;  4M6H A;  3KZW A;  4NGT A;  2VEZ A;  4CYQ A;  1JQG A;  2BUE A;  5CPA A;  3G3S A;  3V38 A;  2PJB A;  4FUU A;  2Q4Z A;  2DPS A;  3IJ3 A;  4UCP A;  2EBJ A;  4OC0 A;  5DWM A;  3GY9 A;  3RO0 A;  4U9Z A;  5AG7 A;  3SI0 A;  2VI7 A;  1VKC A;  3D3S A;  4UEF A;  4ZI6 A;  5IV0 A;  4MBU A;  4PK3 A;  4ZY2 A;  3RAM A;  4P4D A;  4AG7 A;  4AXV A;  1XJO A;  2Q7B A;  2Q51 A;  3BLN A;  2PIY A;  4AVC A;  1RO5 A;  3IWG A;  3B3S A;  3I3G A;  3QB8 A;  4RI1 A;  1FT7 A;  2PQ8 A;  2NMT A;  1XBU A;  1ELL P;  2PJ4 A;  3S6H A;  1Z8X A;  5I4M A;  2WUU A;  2OOT A;  4NEX A;  2R7H A;  5CBM A;  2I00 A;  3VH9 A;  4H89 A;  2VBQ A;  4UWI A;  2CF4 A;  3KKW A;  2IJZ A;  2RC4 A;  5G21 A;  3V8I A;  3VAT A;  1PU9 A;  2VZY A;  3IU2 A;  2WZN A;  4DNC A;  1SQH A;  4NGN A;  1M4I A;  1YW6 A;  4TWE A;  2ARH A;  5G20 A;  2R98 A;  3FXT A;  2V8H A;  2HC9 A;  1NE9 A;  2JEV A;  2PJ0 A;  3JUW A;  3KHZ A;  3CDX A;  4TNU A;  4FWU A;  2PVW A;  2ZW7 A;  2O28 A;  2HV2 A;  3F5B A;  1I12 A;  2I79 A;  4X8I A;  2AFM A;  3UY5 A;  1P0H A;  3NH8 A;  4BIN A;  2EO8 A;  5D8N A;  4ZGY B;  3GKR A;  3PEI A;  2PJ7 A;  3V7Z A;  1CX8 A;  4JLY A;  4B14 A;  1XMB A;  3ISX A;  3SJE A;  4RUH A;  4L8A A;  2VXK A;  3CXS A;  3VWE A;  5EC4 A;  4JYW A;  4WJB A;  5J1Q A;  4KVM E;  3ZJ0 A;  2VQY A;  4KSF A;  4UFW A;  4MCR A;  3K2K A;  1IOI A;  5FVJ A;  2PR1 A;  2I3C A;  1ZG7 A;  4NSQ A;  4UA3 A;  2ZW6 A;  3LD2 A;  2D4P A;  3PBB A;  2PJ6 A;  2EK8 A;  3KGQ A;  3PRT A;  4B10 A;  5G1Z A;  2OH1 A;  3WR7 A;  5J8C A;  3IFE A;  2PSW A;  4FD5 A;  4HKF A;  1UWY A;  1ON0 A;  5BWA B;  1Q2Y A;  1LAM A;  2ANP A;  1YW4 A;  1BO4 A;  3RZA A;  4ONW A;  4K3N A;  4BBH A;  3D4U A;  2V8D A;  2ZEF A;  1XEB A;  2QYV A;  4ONU A;  1AYE A;  4P4I A;  3B35 A;  3N7Z A;  4CGN A;  4MHN A;  2Z3N A;  1VIX A;  3T90 A;  4CGL A;  5K8O A;  4MFQ A;  1Z8T A;  4OC5 A;  4PPZ A;  1IYK A;  1LAN A;  4P4J A;  4Z65 A;  1F2O A;  1HDU A;  1M4L A;  2BOA A;  5AG4 A;  2GE3 A;  5A27 A;  4NJQ A;  3D2M A;  3DSB A;  2PIZ A;  5LRK A;  4G1P A;  4M6G A;  2P6E A;  4UIB A;  5JQ4 A;  2OZG A;  4ZY0 A;  1MK4 A;  1Q2D A;  2XEJ A;  4C7H A;  1I21 A;  5THW A;  1FY7 A;  3BJ7 A;  4IHM A;  1YVO A;  4KOT A;  3DDD A;  4A31 A;  1Z4R A;  4CGM A;  4NGP A;  1QSR A;  4YGO A;  4CGO A;  4ZX8 A;  3FX6 A;  4OID A;  4KZT A;  5AG5 A;  1XOV A;  5HMN A;  2QML A;  3TO9 A;  1Z9U A;  1F2P A;  4MHP A;  2HQY A;  2PVV A;  4E8O A;  5LYF A;  3QNV A;  2F5I A;  3JRU A;  2EVN A;  2YND A;  4YU9 A;  5D29 A;  4AG9 A;  2J9A A;  3KQX A;  2G0B A;  1PCA A;  2B4B A;  1Z8W A;  5GCN A;  2VZZ A;  2B58 A;  3PFE A;  4CYN A;  2FIW A;  2ODF A;  1GYT A;  3S9N A;  4MCS A;  4PV6 A;  1Y0Y A;  4F9V A;  2Z3P A;  2BSW A;  4MHY A;  2O4H A;  5K8P A;  2ZEG A;  3WT4 A;  4UFV A;  3FEC A;  5K8M A;  3PB6 X;  4MRI A;  2OB0 A;  4X5K A;  3OWC A;  2C27 A;  3SXO A;  3KHX A;  3TX8 A;  3LAC A;  3IWE A;  1KUV A;  1QMU A;  4C68 A;  1YGH A;  2REF A;  5KTC A;  4AB7 A;  2V77 A;  4P4F A;  2ABZ A;  4B12 A;  3W91 A;  2FT0 A;  1XMT A;  4NXY A;  7CPA A;  2YNC A;  4I49 A;  4B11 A;  4B13 A;  3N5F A;  4OKO A;  2DXQ A;  4X3R A;  2G9D A;  3FEE A;  2OR4 A;  3TFY A;  1MJB A;  1TKF A;  4P4E A;  2EK9 A;  5JPH A;  2IL4 A;  1R57 A;  4QC6 A;  3W6S A;  3VWD A;  2J8R A;  3NE7 A;  1YK3 A;  2PRB A;  3E0K A;  3NA6 A;  4YWY A;  3MN8 A;  2CIJ A;  4CAE A;  2C6G A;  2AFS A;  2R1I A;  2PDO A;  3FJU A;  3FMC A;  4KUA A;  1WK4 A;  5J8F A;  4XNH C;  3MGD A;  2ZOG A;  4P4B A;  4UWJ A;  2OZH A;  1M4G A;  3IU1 A;  4MI4 A;  4X2T A;  2K5T A;  4R76 A;  4ZX9 A;  4CYO A;  3CZX A;  1QSO A;  4R9M A;  2D4O A;  5HVF A;  4Y49 B;  1Y7R A;  4UF4 A;  2FL4 A;  3K9U A;  1WWZ A;  3I1U A;  1QST A;  2B5G A;  1NSL A;  2CTC A;  3FNC A;  2C6C A;  2HUZ A;  4E2A A;  4MHD A;  4NFR A;  5F47 A;  1IGB A;  1XF8 A;  4FD4 A;  1VHE A;  1X12 A;  4EWT A;  3LMS A;  3B2Y A;  3SJX A;  3DGV A;  2JLM A;  4CAX A;  2FIA A;  1CPX A;  3G8W A;  3KR5 A;  5LRG A;  2ATR A;  3QAY A;  4KOX A;  1Y9W A;  3GUX A;  1OBR A;  4KOW A;  2DF5 A;  5HXD A;  1ELM P;  2Z0Z A;  4Q38 A;  4JD6 A;  1Y0R A;  1HDQ A;  4PQA A;  4BMH A;  3RNZ A;  5JGF A;  1R43 A;  4GM5 A;  2H5M A;  2VL1 A;  1LRZ A;  3S9L A;  2FVG A;  1YSJ A;  2B5G B;  1PYT B;  4GS4 A;  2JDD A;  4R3L A;  5DWN A;  2HB6 A;  5K8N A;  3NE8 A;  2BEI A;  1VHO A;  3PGP A;  2CXA A;  4UCN A;  1B87 A;  2PJ5 A;  2Y0M A;  3SXN A;  4JXQ A;  2AFW A;  2C6P A;  1BPM A;  4CRY B;  4CYP A;  2BO9 A;  1H8L A;  4CGP A;  3D2P A;  1CP6 A; 
#chains in the Genus database with same CATH homology
 3B3C A;  3H8G A;  3KQZ A;  3IWW A;  4OC4 A;  4PXB A;  5LRJ A;  2NSM A;  2V8G A;  4EFD A;  3D66 A;  1R3N A;  3WAB A;  5LRK A;  1BLL E;  2AFZ A;  4P44 A;  2GLJ A;  2QJ8 A;  3KR4 A;  6CPA A;  5LYL A;  3IC1 A;  1ARM A;  1BPN A;  1LCP A;  1TF9 A;  4OIW A;  1Z2L A;  4DUK A;  1YLO A;  3DLJ A;  3CT9 A;  1NSA A;  3SI2 A;  2PJ2 A;  3NH5 A;  3K9T A;  1Y7E A;  1Z5R A;  3D7F A;  1HEE A;  3NFZ A;  3HLP A;  3D7D A;  3PB4 X;  2ZOF A;  3CPX A;  1TF8 A;  3IIB A;  3IO1 A;  4PXD A;  2AFX A;  1CP7 A;  2BCO A;  2GLF A;  4P6Y A;  1DTD A;  4PXE A;  3ISZ A;  3IEH A;  3FH4 A;  4NGM A;  4ZY1 A;  3BI0 A;  4MCQ A;  2O53 A;  4Q7A A;  3TC8 A;  2PJ8 A;  1AMP A;  4O23 A;  2ZEN A;  3B3W A;  4OME A;  2IQ6 A;  4F8Z A;  4MCP A;  4F9U A;  3SI1 A;  4H2K A;  3FF3 A;  2RB7 A;  3PB8 X;  4IK2 A;  3L2N A;  4A39 A;  5F09 A;  4R6T A;  3WC6 A;  4NGQ A;  4A37 A;  3GLJ A;  3H8E A;  1LOK A;  4JZ0 A;  3MRU A;  2F7V A;  5JH9 A;  5IB9 A;  2ZEE A;  1XFO A;  1EE3 P;  4EME A;  1Z8L A;  1LFW A;  3CPA A;  2Q43 A;  3HUV A;  4OP4 A;  1CPS A;  3B7I A;  2PJ1 A;  2V8V A;  3PBE A;  2GRE A;  2PE3 A;  3LWU A;  1FNO A;  4UEZ A;  1QQ9 A;  5HVG A;  3PB9 X;  2ZEP A;  3KI9 A;  2ZEO A;  5JM6 A;  1KWM A;  1ARL A;  1DE4 C;  3D67 A;  1TKJ A;  2EWB A;  4OC1 A;  4R7M A;  2POK A;  3KL9 A;  3SJG A;  4DJL A;  4ZYQ A;  8CPA A;  3BXM A;  3S9M A;  3H8F A;  4OC2 A;  3NH4 A;  3WC5 A;  2ZEL A;  4MMO A;  2ZED A;  4KSI A;  3B3V A;  4FBE A;  4R8F A;  2PCU A;  1ZG9 A;  5DS0 A;  4MHZ A;  1CBX A;  2CTB A;  2JEW A;  2NYQ A;  2XEF A;  4NGR A;  1YME A;  5LYI A;  2AFO A;  3WC7 A;  3PB7 X;  1BAV A;  2PRQ A;  4B6Z A;  5LYD A;  3BI1 A;  3FED A;  4CPA A;  3RBU A;  2QVP A;  1XRY A;  2AFU A;  2DEA A;  3KAS A;  3T8W A;  4UEE A;  1ZG8 A;  4NJR A;  1TXR A;  2IMO A;  1F57 A;  1ZLI A;  4UIA A;  3PFO A;  1ZLH A;  4WWV A;  1TKH A;  2GU2 A;  2PJA A;  3GB0 A;  4A94 A;  1RTQ A;  3VAR A;  2XEI A;  2XEG A;  4W9Y A;  2JBJ A;  3D7G A;  4BD9 A;  1IY7 A;  2F8H A;  1VGY A;  4PXC A;  2PJ9 A;  4FAI A;  4OC3 A;  4IAV A;  4MXU A;  5ELY A;  3B3T A;  4DYO A;  3FVL A;  5HVH A;  4LQG A;  3D68 A;  2PJC A;  1Q7L A;  4P45 A;  1CG2 A;  1LAP A;  2RFH A;  2WYR A;  4P10 A;  3SJF A;  3BHX A;  2ZEH A;  4NGS A;  3D7H A;  2PJ3 A;  4A38 A;  2JBK A;  2C1C A;  2ZEM A;  3KZW A;  4NGT A;  1JQG A;  5CPA A;  3V38 A;  2PJB A;  4FUU A;  2Q4Z A;  3IJ3 A;  4OC0 A;  3SI0 A;  4UEF A;  4ZI6 A;  3RAM A;  4ZY2 A;  4P4D A;  4AXV A;  1XJO A;  2Q51 A;  2PIY A;  3B3S A;  1FT7 A;  1XBU A;  1ELL P;  2PJ4 A;  5I4M A;  2OOT A;  5CBM A;  3VH9 A;  2CF4 A;  2IJZ A;  3VAT A;  2WZN A;  4NGN A;  1YW6 A;  4TWE A;  2V8H A;  2HC9 A;  2PJ0 A;  3KHZ A;  3CDX A;  4TNU A;  4FWU A;  2PVW A;  4X8I A;  2AFM A;  3NH8 A;  5D8N A;  3PEI A;  2PJ7 A;  3V7Z A;  1CX8 A;  1XMB A;  3ISX A;  3SJE A;  4RUH A;  4JYW A;  4WJB A;  5J1Q A;  4MCR A;  3K2K A;  2I3C A;  1ZG7 A;  3PBB A;  2PJ6 A;  2EK8 A;  3KGQ A;  3PRT A;  3IFE A;  1UWY A;  1LAM A;  2ANP A;  1YW4 A;  3RZA A;  4ONW A;  4K3N A;  3D4U A;  2V8D A;  2ZEF A;  4P4I A;  2QYV A;  1AYE A;  3B35 A;  5K8O A;  4MHN A;  1VIX A;  4OC5 A;  4PPZ A;  1LAN A;  4P4J A;  4Z65 A;  1F2O A;  1HDU A;  1M4L A;  2BOA A;  4NJQ A;  2PIZ A;  4G1P A;  4UIB A;  4ZY0 A;  2XEJ A;  5THW A;  4IHM A;  4NGP A;  4ZX8 A;  3FX6 A;  4OID A;  1F2P A;  4MHP A;  2PVV A;  5LYF A;  3QNV A;  3JRU A;  4YU9 A;  5D29 A;  2J9A A;  3KQX A;  1PCA A;  3PFE A;  1GYT A;  3S9N A;  4MCS A;  1Y0Y A;  4F9V A;  4MHY A;  2O4H A;  5K8P A;  2ZEG A;  3WT4 A;  3FEC A;  5K8M A;  3PB6 X;  4MRI A;  3KHX A;  3TX8 A;  1QMU A;  2V77 A;  4P4F A;  2ABZ A;  7CPA A;  3N5F A;  4OKO A;  4X3R A;  2G9D A;  3FEE A;  2OR4 A;  1TKF A;  4P4E A;  2EK9 A;  3NA6 A;  4YWY A;  3MN8 A;  2CIJ A;  2C6G A;  2AFS A;  3FJU A;  3FMC A;  2ZOG A;  4P4B A;  4ZX9 A;  4X2T A;  4R76 A;  5HVF A;  4UF4 A;  3I1U A;  2CTC A;  2C6C A;  4NFR A;  1IGB A;  1VHE A;  4EWT A;  3LMS A;  3B2Y A;  3SJX A;  3DGV A;  3KR5 A;  1CPX A;  5LRG A;  3GUX A;  1OBR A;  5HXD A;  1ELM P;  1Y0R A;  1HDQ A;  4PQA A;  5JGF A;  1R43 A;  4GM5 A;  2VL1 A;  3S9L A;  2FVG A;  1YSJ A;  1PYT B;  2HB6 A;  5K8N A;  1VHO A;  2PJ5 A;  2AFW A;  2C6P A;  1BPM A;  2BO9 A;  1H8L A;  1CP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...