1TXRA

X-ray crystal structure of bestatin bound to aap
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spectroscopic and X-ray Crystallographic Characterization of Bestatin Bound to the Aminopeptidase from Aeromonas (Vibrio) proteolytica.
pubmed doi rcsb
molecule keywords Bacterial leucyl aminopeptidase
molecule tags Hydrolase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1txrA00
4UEZA 2NYQA 1CP6A 4WWVA 5J1QA 1TKJA 3FECA 1YSJA 3QNVA 8CPAA 3VARA 2PJ0A 1IY7A 2ZENA 4WJBA 2HC9A 2GLJA 2BCOA 5HVHA 4FBEA 2PJ9A 4OC1A 1OBRA 1LANA 1DE4C 3K2KA 4IHMA 4OC2A 4F9UA 4P4JA 1Z2LA 5HXDA 4P4BA 3N5FA 1ZLIA 5LRKA 2DEAA 2PJCA 2RB7A 5LRGA 4MHYA 1VGYA 3HUVA 4W9YA 1ZG9A 1AYEA 5LRJA 5K8NA 4B6ZA 4OKOA 1TKFA 5ELYA 4JYWA 3PB7X 4OC0A 3TC8A 4FUUA 3GUXA 3T8WA 2AFUA 1FNOA 4YWYA 2ZEPA 1Z8LA 2V77A 2ZEFA 3B2YA 1XFOA 2NSMA 4NGPA 2ZELA 3PEIA 4ZX8A 5JGFA 4MRIA 3FF3A 3D68A 1XMBA 1CP7A 2OR4A 3B3WA 4FWUA 3PBEA 4NGTA 2PJBA 4NGMA 4PXCA 3SJEA 2VL1A 2PIZA 3B3VA 3DLJA 4DUKA 3MRUA 1F2OA 2O53A 2V8GA 3K9TA 3VH9A 4PPZA 4MCPA 1HDQA 4TNUA 2BOAA 2O4HA 2PJ3A 3KQXA 5IB9A 1CX8A 5JH9A 3CDXA 1R43A 2WYRA 1TF9A 4UF4A 1Y0YA 5LYIA 4P4FA 3TX8A 5I4MA 4LQGA 3IEHA 2PJ5A 4ZYQA 2ZOFA 2PCUA 3NA6A 3KI9A 4X8IA 4MHPA 4OC5A 3RZAA 3DGVA 3IWWA 4P44A 1XJOA 4JZ0A 3LMSA 2ZOGA 2V8DA 1QQ9A 3KR5A 4KSIA 4EMEA 3D67A 2Q51A 1CBXA 2WZNA 4MXUA 3IJ3A 4ZX9A 3RBUA 3NFZA 1FT7A 4P6YA 3PFEA 1RTQA 2J9AA 1CG2A 3GLJA 4RUHA 3WC7A 5K8OA 3WT4A 3BHXA 1Y0RA 2ZEEA 4R6TA 4R76A 5F09A 3H8GA 3B3CA 2XEIA 3IFEA 2AFWA 4PXDA 2XEJA 4MCRA 5CBMA 3D7FA 4ZY2A 3KASA 5K8MA 2AFXA 1YLOA 2F8HA 3L2NA 3FX6A 2C6CA 4CPAA 2QVPA 4TWEA 3JRUA 1TKHA 2PJ1A 3BI0A 2C1CA 4PXEA 4YU9A 2GU2A 2V8VA 4GM5A 5THWA 3H8EA 1BPNA 2IMOA 3IC1A 2IQ6A 4R7MA 4MMOA 3V38A 2FVGA 4FAIA 4MCSA 4ZY0A 3KZWA 3KR4A 1XRYA 3SJFA 2Q4ZA 1QMUA 2BO9A 3KL9A 4EFDA 5JM6A 2EWBA 2RFHA 1ZLHA 1YW6A 4ONWA 5CPAA 1VHEA 2XEFA 1H8LA 2XEGA 1ARMA 1LFWA 4NJQA 2I3CA 1ELMP 1BLLE 3IO1A 2CF4A 4NJRA 3KQZA 3IIBA 3PB6X 3PB4X 2PJ8A 3FEEA 3SJXA 4NGRA 1GYTA 1F57A 2PE3A 2CIJA 4MCQA 1ZG8A 3S9LA 3D7GA 3SJGA 1EE3P 3MN8A 4IK2A 1VHOA 4IAVA 2F7VA 4BD9A 2PJ4A 3S9MA 2GLFA 3SI1A 2AFOA 4UIBA 2PJ2A 4P10A 2POKA 3PFOA 4ZI6A 4ZY1A 4OP4A 4G1PA 5D8NA 2C6GA 1ARLA 1LAPA 2PJ7A 3NH5A 4F9VA 2V8HA 1UWYA 4NGNA 3FH4A 5HVGA 3D7DA 2ABZA 3KHXA 2AFZA 3NH4A 4A39A 4UEFA 2QJ8A 3PBBA 2ZEOA 4OMEA 3B3TA 1HDUA 3FVLA 3NH8A 4OC4A 2GREA 2C6PA 2ZEGA 4DYOA 3SI2A 4A38A 3CT9A 3GB0A 1LOKA 4OC3A 1Y7EA 3HLPA 4UIAA 4X2TA 1BAVA 2PJAA 3BXMA 4X3RA 1HEEA 2CTCA 3VATA 3PRTA 2AFSA 1YMEA 4R8FA 1KWMA 1DTDA 4P4IA 1CPSA 4A37A 1LCPA 2ZEHA 4MHZA 3H8FA 3KGQA 3PB9X 3PB8X 3ISXA 3SI0A 1M4LA 4F8ZA 4AXVA 2QYVA 4NGQA 3B35A 3V7ZA 2PIYA 1Z5RA 4P4DA 1AMPA 2JBJA 4Z65A 1PYTB 4A94A 4NFRA 4PXBA 1YW4A 4OIDA 3D66A 5LYDA 2EK8A 1BPMA 1ELLP 1ZG7A 4Q7AA 2EK9A 4UEEA 2G9DA 2IJZA 1NSAA 3D7HA 1VIXA 7CPAA 6CPAA 4PQAA 1TF8A 1XBUA 1PCAA 2JEWA 2HB6A 5LYLA 4P4EA 2Q43A 3FJUA 2JBKA 1JQGA 2PVWA 1F2PA 3WC6A 4O23A 3CPXA 5D29A 3BI1A 4DJLA 1CPXA 3WC5A 4OIWA 3B3SA 4EWTA 1R3NA 3I1UA 1IGBA 3KHZA 3D4UA 3B7IA 3RAMA 2ZEMA 5LYFA 4H2KA 2CTBA 4K3NA 3CPAA 5HVFA 4NGSA 4P45A 1TXRA 3FEDA 2OOTA 1Q7LA 5DS0A 5K8PA 3WABA 2ZEDA 2AFMA 2PRQA 2PVVA 2ANPA 3LWUA 3ISZA 4MHNA 3S9NA 2PJ6A 1LAMA 3FMCA
chains in the Genus database with same CATH superfamily
2J8NA 4UEZA 2YNCC 4AG9A 2PC1A 2NYQA 1CP6A 3W6XA 2REEA 4WWVA 4MBUA 5J1QA 3EO4A 1TKJA 3FECA 1YSJA 4ZBGA 3QNVA 8CPAA 2RC4A 3VARA 2PJ0A 1IY7A 2P6FA 2ZENA 4PSXA 5HMNA 4WJBA 1JWQA 2HC9A 2GLJA 1MJBA 2BCOA 3CXQA 5HVHA 2YGWA 4B14A 5AGEA 3UY5A 1BO4A 5G22A 4FBEA 3FYNA 4KSFA 4MFPA 2PJ9A 4XPDB 4OC1A 1Y7RA 4CGNA 1OBRA 3MGDA 4F6AA 4KOUA 1SQHA 1LANA 1DE4C 2FXFA 3K2KA 4A31A 4UCNA 4IHMA 4OC2A 4F9UA 4CAXA 4P4JA 1Z2LA 1IICA 3EFAA 4CAVA 5HXDA 4KOVA 4P4BA 3N5FA 5HH1A 2VBQA 3FNCA 2B4DB 1ZLIA 4I49A 5LRKA 4GS4A 2DEAA 2PJCA 2RB7A 4OAEA 1WK4A 4PK2A 5LRGA 3CXSA 4MHYA 5GCNA 1VGYA 3HUVA 4NSQA 4W9YA 1M44A 2VZYA 3PP9A 1ZG9A 3PZJA 1AYEA 2FS5A 3R9EA 5LRJA 5K8NA 4AVCA 3TFYA 2EBJA 4B6ZA 4OKOA 4KUAA 2CNSA 1TKFA 4R9MA 4YFJA 4Y49C 4UCPA 5ELYA 1VKCA 4JYWA 1FY7A 3PB7X 4OC0A 4UBRA 3TC8A 2JDCA 4FUUA 3GUXA 4KVME 3T8WA 2AFUA 1FNOA 3LD2A 4YWYA 3CXPA 2B3VA 2ZEPA 1Z8LA 1B87A 1CJWA 2V77A 5EC4A 3IWEA 4KVXA 2ZEFA 3NE7A 4R57A 3B2YA 2Z3MA 4M85A 1XFOA 2NSMA 4NGPA 2ZELA 3PEIA 4H6UA 3TT2A 1CM0A 1S7KA 4K30A 3DNSA 4PSWA 4ZX8A 4XPLA 5JGFA 4KLWA 4MRIA 1I1DA 3FF3A 1TIQA 3D68A 3RYOA 1AUGA 3EY5A 4C2XA 1XMBA 1CP7A 2OR4A 2GFQA 2R8VA 3B3WA 1M4IA 3FB3A 3PBEA 3D3SA 4FWUA 4MY0A 4NGTA 2PJBA 2Q7BA 4NGMA 4AVAA 4B5OA 3S6HA 4PXCA 3SJEA 2VL1A 4QVTA 2FT0A 2PIZA 5J8CA 3S6GA 3B3VA 1RXTA 3DLJA 2IL4A 4RI1A 4MFLA 4DUKA 5IX3A 3MRUA 1Z8XA 1F2OA 5EBVA 2EO8A 2O53A 2V8GA 3K9TA 4F0XA 3VH9A 3D8PA 4PPZA 3PGPA 4MCPA 3RO0A 1HDQA 4TNUA 4YGOA 2BOAA 2O4HA 2PJ3A 3KQXA 4U9YA 2ODFA 5FVJA 4U9ZA 5IB9A 1CX8A 3FRMA 1S7NA 5JH9A 2B5GB 3CDXA 1R43A 2WYRA 4XNHC 1TF9A 4UF4A 4C7IA 5JQ4A 2DXQA 4B5PA 1Y0YA 5LYIA 4MY3A 4P4FA 3TX8A 4CGMA 5I4MA 1ON0A 3QB8A 4LQGA 3IEHA 1UFHA 2JLMA 1KUYA 2PJ5A 4ZYQA 2PQ8A 1NSLA 2D4OA 2PCUA 2ZOFA 3NA6A 4A30A 3KI9A 4X8IA 4MHPA 2G3AA 3CZXA 3E0KA 4L89A 4OC5A 3DGVA 3RZAA 3IWWA 4B12A 4P44A 1S60A 3V8IA 2Z3LA 1XJOA 3B8GA 4JZ0A 4CAFA 3LMSA 5JPHA 1R57A 1M4GA 2ZOGA 2V8DA 1IYLA 3IWGA 2GIVA 1QQ9A 3KR5A 4KSIA 4EMEA 3D67A 2ARHA 1CBXA 2Q51A 4E8OA 1S7FA 1RO5A 2FIWA 2WZNA 4MXUA 1S7LA 2OZUA 3IJ3A 4NXYA 3S6KA 3I9SA 2BL1A 4ZX9A 2F5IA 3RBUA 3NFZA 1FT7A 4P6YA 4M3SA 3PFEA 4KZTA 3BJ8A 1RTQA 2J9AA 5KTAA 3D2PA 1CG2A 1QSNA 2HV2A 3GLJA 4CGOA 4LUAA 4RUHA 3WC7A 1YX0A 5K8OA 4XPKA 2J8RA 4HPSA 4KOXA 3D2MA 3WT4A 5G1ZA 2DPSA 2I79A 2QMLA 3A9LA 4UCMA 3BHXA 1Y0RA 2ZEEA 4DNCA 3F8KA 4R6TA 2R1IA 3IU2A 4R76A 5F09A 3H8GA 3BJ7A 4JXQA 4BMHA 4F0YA 3B3CA 2YNEA 2XEIA 4B11A 3GY9A 2BUEA 3IFEA 2FCKA 5G21A 4HKFA 5G20A 4BBHA 2AFWA 4PXDA 5AG6A 2Q4VA 2XEJA 4B10A 4MCRA 1J4JA 5CBMA 3D7FA 4ZY2A 3TE4A 2Y0MA 3KASA 4H6ZA 5K8MA 2AFXA 1YLOA 1YR0A 2F8HA 3FX6A 3L2NA 2C6CA 3QAHA 3R1KA 4CPAA 4QB9A 2QVPA 4X5KA 4TWEA 3JRUA 2BEIA 2ZW6A 3GYAA 1QSTA 1TKHA 1XMTA 4M6GA 2PJ1A 5E96A 3BI0A 2Q04A 3I3GA 2C1CA 4PXEA 4YU9A 2GU2A 1XEBA 2B4BA 2V8VA 3H5ZA 4GM5A 4OADA 3T90A 2EVNA 5THWA 3H8EA 1BPNA 2IMOA 2CY2A 3IC1A 3DSBA 2BSWA 2IQ6A 4JXRA 4R7MA 4RS2A 4UFVA 4MMOA 3S6FA 3V38A 2QECA 2DF5A 2FVGA 4FAIA 4MCSA 4ZY0A 3KZWA 3KR4A 4MHDA 1IU8A 1XRYA 2Z3NA 3SJFA 2Q4ZA 2ZXVA 1QMUA 1VHSA 4J3GA 2BO9A 3JVNA 4MFQA 4OLLA 4CYQA 3KL9A 4EFDA 5JM6A 3SXOA 2EWBA 1MK4A 2RFHA 3EC4A 4CAWA 1ZLHA 1YW6A 4ONWA 3G3SA 4QC6A 4CS0B 4C2YA 5CPAA 5KTCA 1VHEA 2XEFA 1H8LA 2XEGA 1ARMA 1LFWA 4IUSA 4NJQA 4CRZB 5BWAB 5DWMA 4JD6A 1Q2DA 4A95A 2I3CA 1ELMP 1BLLE 3IO1A 2CF4A 4NJRA 2R7HA 1GHEA 1XOVA 3K9UA 3KQZA 2B4DA 3IIBA 5C82A 3PB6X 2VQYA 1WWZA 3PB4X 2PJ8A 2YNDA 3FEEA 1LRZA 3FXTA 1P4NA 4LX9A 3SJXA 4NGRA 3ZZIA 1YVKA 3TO9A 1Y9WA 2VXKA 1GYTA 1F57A 1YREA 2Q0YA 2PE3A 3TOAA 2FSRA 2CIJA 4MCQA 1ZG8A 2O28A 4NCZA 2ZW5A 4A32A 3D7GA 3SJGA 3S9LA 1EE3P 1IB1E 3MN8A 3ZJ0A 1IOIA 4IK2A 1VHOA 4IAVA 2F7VA 2JDDA 4Y49B 4CAEA 4BD9A 1KUVA 4MFZA 1U6MA 3VWEA 2PJ4A 3C26A 3GIUA 4ONUA 2GLFA 3S9MA 4CRYB 4CYOA 1Z8WA 2Z3KA 5AG4A 3JUWA 2QIRA 5KTDA 4A33A 3SI1A 4KOYA 4AB7A 2AFOA 4UIBA 1QSOA 4FD5A 2Z3PA 1N71A 1PU9A 2G0BA 2PJ2A 4M6IA 4P10A 1K4JA 2WPWA 2P6GA 2POKA 3PFOA 4ZI6A 4ZY1A 2Z0ZA 4OP4A 4G1PA 5H84A 4FD7A 1NMTA 4M6HA 5D8NA 2C6GA 1ARLA 1LAPA 2PJ7A 4XPDC 3NH5A 4F9VA 1QSMA 2V8HA 2Z10A 1A2ZA 1UWYA 3JTKA 1Y9KA 2HUZA 3F5BA 3R9GA 4C7HA 5A28A 4NGNA 3FH4A 5HVGA 3D7DA 2CXAA 3W6SA 2K5TA 5CNPA 5AG7A 2ABZA 3IU1A 4BINA 2J8MA 2AFZA 3KHXA 3EXNA 3NH4A 2FE7A 2WUUA 4KSAA 4A39A 1S3ZA 2REFA 4UEFA 4R87A 2OH1A 2CNMA 2QJ8A 1YK3A 1YGHA 2ZPAA 3PBBA 2KCWA 2ZEOA 3OWCA 4UA3A 2B3UA 4L8AA 4OMEA 3B3TA 1HDUA 2PRBA 3H4QA 1XF8A 2OZGA 2B5GA 2H5MA 3FVLA 3W91A 2P6EA 3TOBA 3WR7A 5IB0A 4C68A 3NH8A 4OC4A 2GREA 2C6PA 4KUBA 2ZW4A 2ZEGA 2Z11A 3F0AA 4DYOA 4XNHB 3SHPA 3SI2A 2Q44A 4A38A 3CT9A 2AE6A 1LOKA 3GB0A 4OC3A 1Y7EA 3HLPA 4UIAA 1Z9UA 3QAYA 4UFXA 4CYNA 4PV6A 4X2TA 4MI4A 1BAVA 1NE9A 2PJAA 4CGLA 3BXMA 4MFKA 4X3RA 2C27A 1HEEA 1QSRA 2CTCA 5J8FA 3VATA 4CGPA 3PRTA 2OZHA 4UWIA 2AFSA 1YMEA 3BLNA 4R8FA 4AG7A 1KWMA 3P2FA 1XIXA 2B58A 1DTDA 2G3TA 4P4IA 1CPSA 2CNTA 4A37A 5F48A 5H86A 1LCPA 1X12A 2ZEHA 2HQYA 4KORA 3H8FA 3KGQA 3PB9X 3PB8X 4MHZA 3ISXA 3SI0A 4LQ6A 1M4LA 4R3LA 4F8ZA 4AXVA 2D4PA 2QYVA 3DR8A 4NGQA 4KOWA 4MJ8A 4EVYA 1MJ9A 3P2HA 2WSAA 4HNXB 1M1DA 3B35A 3V7ZA 2PIYA 1Z5RA 3TO6A 4P4DA 1AMPA 3FIXA 2JBJA 1PUAA 2AJ6A 4Z65A 1PYTB 2P0WA 4A94A 2FL4A 2Z3OA 4JWPA 4NFRA 2JEVA 2Q4YA 2VZZA 4PXBA 4QBJA 1YW4A 4OIDA 4B13A 2I00A 3TO7A 3D66A 4FD6A 5F49A 1ZO0A 4E0AA 5IV0A 5LYDA 1IYKA 2PDOA 3LACA 2EK8A 3DR6A 1BPMA 1ELLP 1YQEA 1ZG7A 3N7ZA 4Q7AA 2GANA 2EK9A 4UEEA 2G9DA 2IJZA 1NSAA 3D7HA 4MFJA 2ZW7A 1XE4A 1OZPA 4UFWA 4KVOE 5ISVA 3IGRA 4AVBA 1VIXA 7CPAA 3TCVA 4B5PB 6CPAA 2ATRA 4HNWB 2DPTA 4PK3A 4PQAA 1KUXA 1TF8A 1XBUA 1PCAA 2JEWA 1IIDA 1Z4RA 3VWDA 1Z4EA 4FD4A 2HB6A 5LYLA 4P4EA 1S5KA 4H89A 1X10A 2OB0A 4JLYA 4ORFA 2Q43A 3FJUA 2JBKA 2YNCA 2OU2A 1JQGA 4KOSA 2PVWA 1F2PA 3LODA 4UWJA 4YRHA 3WC6A 4ZGYB 4O23A 3CPXA 5D29A 4HNYB 5C88A 2PSWA 1YVOA 4C2ZA 2NMTA 3R96A 3R95A 3BI1A 3T9YA 5F46A 4DJLA 2VI7A 3RNZA 5AG5A 1CPXA 3WC5A 5F47A 3FBUA 4OIWA 4Q36A 2PR1A 3GKRA 3B3SA 4EWTA 1R3NA 3NE8A 1B6BA 1YLEA 3I1UA 1IGBA 3KHZA 3D4UA 4E2AA 3B7IA 3RAMA 2ZEMA 3TTHA 2VEZA 5LYFA 5I0CA 1MJAA 1I21A 4II9A 4RN7A 1KZFA 1Q2CA 1I12A 4H2KA 2CTBA 5EMIA 2GE3A 4K3NA 4U5YA 3CPAA 5HVFA 4NGSA 5A27A 3KKWA 5DWNA 4CYPA 4NF1A 4P45A 4QUSA 1M4DA 1P0HA 1TXRA 3SXNA 2X7BA 3FEDA 2OOTA 4A2ZA 4KS9A 1Q7LA 3DDDA 1Z8TA 2A4NA 2EUIA 4Q38A 5DS0A 2FIAA 3WABA 5K8PA 1BOBA 1L0CA 2R98A 4GXHA 2ZEDA 3G8WA 2AFMA 4NEXA 2PR8A 2PRQA 2PVVA 2ANPA 4R3KA 3LWUA 3ISZA 4MHNA 2Q7SA 3S9NA 2PJ6A 1LAMA 2WPXA 4KLVA 1Q2YA 4IF5A 4JJXA 4KOTA 3FMCA 1IOFA 1V0CA 3R9FA
chains in the Genus database with same CATH topology
4UEZA 2NYQA 1CP6A 4WWVA 5J1QA 1TKJA 3FECA 1YSJA 3QNVA 8CPAA 3VARA 2PJ0A 1IY7A 2ZENA 4WJBA 2HC9A 2GLJA 2BCOA 5HVHA 4FBEA 2PJ9A 4OC1A 1OBRA 1LANA 1DE4C 3K2KA 4IHMA 4OC2A 4F9UA 4P4JA 1Z2LA 5HXDA 4P4BA 3N5FA 1ZLIA 5LRKA 2DEAA 2PJCA 2RB7A 5LRGA 4MHYA 1VGYA 3HUVA 4W9YA 1ZG9A 1AYEA 5LRJA 5K8NA 4B6ZA 4OKOA 1TKFA 5ELYA 4JYWA 3PB7X 4OC0A 3TC8A 4FUUA 3GUXA 3T8WA 2AFUA 1FNOA 4YWYA 2ZEPA 1Z8LA 2V77A 2ZEFA 3B2YA 1XFOA 2NSMA 4NGPA 2ZELA 3PEIA 4ZX8A 5JGFA 4MRIA 3FF3A 3D68A 1XMBA 1CP7A 2OR4A 3B3WA 4FWUA 3PBEA 4NGTA 2PJBA 4NGMA 4PXCA 3SJEA 2VL1A 2PIZA 3B3VA 3DLJA 4DUKA 3MRUA 1F2OA 2O53A 2V8GA 3K9TA 3VH9A 4PPZA 4MCPA 1HDQA 4TNUA 2BOAA 2O4HA 2PJ3A 3KQXA 5IB9A 1CX8A 5JH9A 3CDXA 1R43A 2WYRA 1TF9A 4UF4A 1Y0YA 5LYIA 4P4FA 3TX8A 5I4MA 4LQGA 3IEHA 2PJ5A 4ZYQA 2ZOFA 2PCUA 3NA6A 3KI9A 4X8IA 4MHPA 4OC5A 3RZAA 3DGVA 3IWWA 4P44A 1XJOA 4JZ0A 3LMSA 2ZOGA 2V8DA 1QQ9A 3KR5A 4KSIA 4EMEA 3D67A 2Q51A 1CBXA 2WZNA 4MXUA 3IJ3A 4ZX9A 3RBUA 3NFZA 1FT7A 4P6YA 3PFEA 1RTQA 2J9AA 1CG2A 3GLJA 4RUHA 3WC7A 5K8OA 3WT4A 3BHXA 1Y0RA 2ZEEA 4R6TA 4R76A 5F09A 3H8GA 3B3CA 2XEIA 3IFEA 2AFWA 4PXDA 2XEJA 4MCRA 5CBMA 3D7FA 4ZY2A 3KASA 5K8MA 2AFXA 1YLOA 2F8HA 3L2NA 3FX6A 2C6CA 4CPAA 2QVPA 4TWEA 3JRUA 1TKHA 2PJ1A 3BI0A 2C1CA 4PXEA 4YU9A 2GU2A 2V8VA 4GM5A 5THWA 3H8EA 1BPNA 2IMOA 3IC1A 2IQ6A 4R7MA 4MMOA 3V38A 2FVGA 4FAIA 4MCSA 4ZY0A 3KZWA 3KR4A 1XRYA 3SJFA 2Q4ZA 1QMUA 2BO9A 3KL9A 4EFDA 5JM6A 2EWBA 2RFHA 1ZLHA 1YW6A 4ONWA 5CPAA 1VHEA 2XEFA 1H8LA 2XEGA 1ARMA 1LFWA 4NJQA 2I3CA 1ELMP 1BLLE 3IO1A 2CF4A 4NJRA 3KQZA 3IIBA 3PB6X 3PB4X 2PJ8A 3FEEA 3SJXA 4NGRA 1GYTA 1F57A 2PE3A 2CIJA 4MCQA 1ZG8A 3S9LA 3D7GA 3SJGA 1EE3P 3MN8A 4IK2A 1VHOA 4IAVA 2F7VA 4BD9A 2PJ4A 3S9MA 2GLFA 3SI1A 2AFOA 4UIBA 2PJ2A 4P10A 2POKA 3PFOA 4ZI6A 4ZY1A 4OP4A 4G1PA 5D8NA 2C6GA 1ARLA 1LAPA 2PJ7A 3NH5A 4F9VA 2V8HA 1UWYA 4NGNA 3FH4A 5HVGA 3D7DA 2ABZA 3KHXA 2AFZA 3NH4A 4A39A 4UEFA 2QJ8A 3PBBA 2ZEOA 4OMEA 3B3TA 1HDUA 3FVLA 3NH8A 4OC4A 2GREA 2C6PA 2ZEGA 4DYOA 3SI2A 4A38A 3CT9A 3GB0A 1LOKA 4OC3A 1Y7EA 3HLPA 4UIAA 4X2TA 1BAVA 2PJAA 3BXMA 4X3RA 1HEEA 2CTCA 3VATA 3PRTA 2AFSA 1YMEA 4R8FA 1KWMA 1DTDA 4P4IA 1CPSA 4A37A 1LCPA 2ZEHA 4MHZA 3H8FA 3KGQA 3PB9X 3PB8X 3ISXA 3SI0A 1M4LA 4F8ZA 4AXVA 2QYVA 4NGQA 3B35A 3V7ZA 2PIYA 1Z5RA 4P4DA 1AMPA 2JBJA 4Z65A 1PYTB 4A94A 4NFRA 4PXBA 1YW4A 4OIDA 3D66A 5LYDA 2EK8A 1BPMA 1ELLP 1ZG7A 4Q7AA 2EK9A 4UEEA 2G9DA 2IJZA 1NSAA 3D7HA 1VIXA 7CPAA 6CPAA 4PQAA 1TF8A 1XBUA 1PCAA 2JEWA 2HB6A 5LYLA 4P4EA 2Q43A 3FJUA 2JBKA 1JQGA 2PVWA 1F2PA 3WC6A 4O23A 3CPXA 5D29A 3BI1A 4DJLA 1CPXA 3WC5A 4OIWA 3B3SA 4EWTA 1R3NA 3I1UA 1IGBA 3KHZA 3D4UA 3B7IA 3RAMA 2ZEMA 5LYFA 4H2KA 2CTBA 4K3NA 3CPAA 5HVFA 4NGSA 4P45A 1TXRA 3FEDA 2OOTA 1Q7LA 5DS0A 5K8PA 3WABA 2ZEDA 2AFMA 2PRQA 2PVVA 2ANPA 3LWUA 3ISZA 4MHNA 3S9NA 2PJ6A 1LAMA 3FMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UEZ A;  2NYQ A;  1CP6 A;  4WWV A;  5J1Q A;  1TKJ A;  3FEC A;  1YSJ A;  3QNV A;  8CPA A;  3VAR A;  2PJ0 A;  1IY7 A;  2ZEN A;  4WJB A;  2HC9 A;  2GLJ A;  2BCO A;  5HVH A;  4FBE A;  2PJ9 A;  4OC1 A;  1OBR A;  1LAN A;  1DE4 C;  3K2K A;  4IHM A;  4OC2 A;  4F9U A;  4P4J A;  1Z2L A;  5HXD A;  4P4B A;  3N5F A;  1ZLI A;  5LRK A;  2DEA A;  2PJC A;  2RB7 A;  5LRG A;  4MHY A;  1VGY A;  3HUV A;  4W9Y A;  1ZG9 A;  1AYE A;  5LRJ A;  5K8N A;  4B6Z A;  4OKO A;  1TKF A;  5ELY A;  4JYW A;  3PB7 X;  4OC0 A;  3TC8 A;  4FUU A;  3GUX A;  3T8W A;  2AFU A;  1FNO A;  4YWY A;  2ZEP A;  1Z8L A;  2V77 A;  2ZEF A;  3B2Y A;  1XFO A;  2NSM A;  4NGP A;  2ZEL A;  3PEI A;  4ZX8 A;  5JGF A;  4MRI A;  3FF3 A;  3D68 A;  1XMB A;  1CP7 A;  2OR4 A;  3B3W A;  4FWU A;  3PBE A;  4NGT A;  2PJB A;  4NGM A;  4PXC A;  3SJE A;  2VL1 A;  2PIZ A;  3B3V A;  3DLJ A;  4DUK A;  3MRU A;  1F2O A;  2O53 A;  2V8G A;  3K9T A;  3VH9 A;  4PPZ A;  4MCP A;  1HDQ A;  4TNU A;  2BOA A;  2O4H A;  2PJ3 A;  3KQX A;  5IB9 A;  1CX8 A;  5JH9 A;  3CDX A;  1R43 A;  2WYR A;  1TF9 A;  4UF4 A;  1Y0Y A;  5LYI A;  4P4F A;  3TX8 A;  5I4M A;  4LQG A;  3IEH A;  2PJ5 A;  4ZYQ A;  2ZOF A;  2PCU A;  3NA6 A;  3KI9 A;  4X8I A;  4MHP A;  4OC5 A;  3RZA A;  3DGV A;  3IWW A;  4P44 A;  1XJO A;  4JZ0 A;  3LMS A;  2ZOG A;  2V8D A;  1QQ9 A;  3KR5 A;  4KSI A;  4EME A;  3D67 A;  2Q51 A;  1CBX A;  2WZN A;  4MXU A;  3IJ3 A;  4ZX9 A;  3RBU A;  3NFZ A;  1FT7 A;  4P6Y A;  3PFE A;  1RTQ A;  2J9A A;  1CG2 A;  3GLJ A;  4RUH A;  3WC7 A;  5K8O A;  3WT4 A;  3BHX A;  1Y0R A;  2ZEE A;  4R6T A;  4R76 A;  5F09 A;  3H8G A;  3B3C A;  2XEI A;  3IFE A;  2AFW A;  4PXD A;  2XEJ A;  4MCR A;  5CBM A;  3D7F A;  4ZY2 A;  3KAS A;  5K8M A;  2AFX A;  1YLO A;  2F8H A;  3L2N A;  3FX6 A;  2C6C A;  4CPA A;  2QVP A;  4TWE A;  3JRU A;  1TKH A;  2PJ1 A;  3BI0 A;  2C1C A;  4PXE A;  4YU9 A;  2GU2 A;  2V8V A;  4GM5 A;  5THW A;  3H8E A;  1BPN A;  2IMO A;  3IC1 A;  2IQ6 A;  4R7M A;  4MMO A;  3V38 A;  2FVG A;  4FAI A;  4MCS A;  4ZY0 A;  3KZW A;  3KR4 A;  1XRY A;  3SJF A;  2Q4Z A;  1QMU A;  2BO9 A;  3KL9 A;  4EFD A;  5JM6 A;  2EWB A;  2RFH A;  1ZLH A;  1YW6 A;  4ONW A;  5CPA A;  1VHE A;  2XEF A;  1H8L A;  2XEG A;  1ARM A;  1LFW A;  4NJQ A;  2I3C A;  1ELM P;  1BLL E;  3IO1 A;  2CF4 A;  4NJR A;  3KQZ A;  3IIB A;  3PB6 X;  3PB4 X;  2PJ8 A;  3FEE A;  3SJX A;  4NGR A;  1GYT A;  1F57 A;  2PE3 A;  2CIJ A;  4MCQ A;  1ZG8 A;  3S9L A;  3D7G A;  3SJG A;  1EE3 P;  3MN8 A;  4IK2 A;  1VHO A;  4IAV A;  2F7V A;  4BD9 A;  2PJ4 A;  3S9M A;  2GLF A;  3SI1 A;  2AFO A;  4UIB A;  2PJ2 A;  4P10 A;  2POK A;  3PFO A;  4ZI6 A;  4ZY1 A;  4OP4 A;  4G1P A;  5D8N A;  2C6G A;  1ARL A;  1LAP A;  2PJ7 A;  3NH5 A;  4F9V A;  2V8H A;  1UWY A;  4NGN A;  3FH4 A;  5HVG A;  3D7D A;  2ABZ A;  3KHX A;  2AFZ A;  3NH4 A;  4A39 A;  4UEF A;  2QJ8 A;  3PBB A;  2ZEO A;  4OME A;  3B3T A;  1HDU A;  3FVL A;  3NH8 A;  4OC4 A;  2GRE A;  2C6P A;  2ZEG A;  4DYO A;  3SI2 A;  4A38 A;  3CT9 A;  3GB0 A;  1LOK A;  4OC3 A;  1Y7E A;  3HLP A;  4UIA A;  4X2T A;  1BAV A;  2PJA A;  3BXM A;  4X3R A;  1HEE A;  2CTC A;  3VAT A;  3PRT A;  2AFS A;  1YME A;  4R8F A;  1KWM A;  1DTD A;  4P4I A;  1CPS A;  4A37 A;  1LCP A;  2ZEH A;  4MHZ A;  3H8F A;  3KGQ A;  3PB9 X;  3PB8 X;  3ISX A;  3SI0 A;  1M4L A;  4F8Z A;  4AXV A;  2QYV A;  4NGQ A;  3B35 A;  3V7Z A;  2PIY A;  1Z5R A;  4P4D A;  1AMP A;  2JBJ A;  4Z65 A;  1PYT B;  4A94 A;  4NFR A;  4PXB A;  1YW4 A;  4OID A;  3D66 A;  5LYD A;  2EK8 A;  1BPM A;  1ELL P;  1ZG7 A;  4Q7A A;  2EK9 A;  4UEE A;  2G9D A;  2IJZ A;  1NSA A;  3D7H A;  1VIX A;  7CPA A;  6CPA A;  4PQA A;  1TF8 A;  1XBU A;  1PCA A;  2JEW A;  2HB6 A;  5LYL A;  4P4E A;  2Q43 A;  3FJU A;  2JBK A;  1JQG A;  2PVW A;  1F2P A;  3WC6 A;  4O23 A;  3CPX A;  5D29 A;  3BI1 A;  4DJL A;  1CPX A;  3WC5 A;  4OIW A;  3B3S A;  4EWT A;  1R3N A;  3I1U A;  1IGB A;  3KHZ A;  3D4U A;  3B7I A;  3RAM A;  2ZEM A;  5LYF A;  4H2K A;  2CTB A;  4K3N A;  3CPA A;  5HVF A;  4NGS A;  4P45 A;  1TXR A;  3FED A;  2OOT A;  1Q7L A;  5DS0 A;  5K8P A;  3WAB A;  2ZED A;  2AFM A;  2PRQ A;  2PVV A;  2ANP A;  3LWU A;  3ISZ A;  4MHN A;  3S9N A;  2PJ6 A;  1LAM A;  3FMC A; 
#chains in the Genus database with same CATH topology
 2J8N A;  4UEZ A;  2YNC C;  4AG9 A;  2PC1 A;  2NYQ A;  1CP6 A;  3W6X A;  2REE A;  4WWV A;  4MBU A;  5J1Q A;  3EO4 A;  1TKJ A;  3FEC A;  1YSJ A;  4ZBG A;  3QNV A;  8CPA A;  2RC4 A;  3VAR A;  2PJ0 A;  1IY7 A;  2P6F A;  2ZEN A;  4PSX A;  5HMN A;  4WJB A;  1JWQ A;  2HC9 A;  2GLJ A;  1MJB A;  2BCO A;  3CXQ A;  5HVH A;  2YGW A;  4B14 A;  5AGE A;  3UY5 A;  1BO4 A;  5G22 A;  4FBE A;  3FYN A;  4KSF A;  4MFP A;  2PJ9 A;  4XPD B;  4OC1 A;  1Y7R A;  4CGN A;  1OBR A;  3MGD A;  4F6A A;  4KOU A;  1SQH A;  1LAN A;  1DE4 C;  2FXF A;  3K2K A;  4A31 A;  4UCN A;  4IHM A;  4OC2 A;  4F9U A;  4CAX A;  4P4J A;  1Z2L A;  1IIC A;  3EFA A;  4CAV A;  5HXD A;  4KOV A;  4P4B A;  3N5F A;  5HH1 A;  2VBQ A;  3FNC A;  2B4D B;  1ZLI A;  4I49 A;  5LRK A;  4GS4 A;  2DEA A;  2PJC A;  2RB7 A;  4OAE A;  1WK4 A;  4PK2 A;  5LRG A;  3CXS A;  4MHY A;  5GCN A;  1VGY A;  3HUV A;  4NSQ A;  4W9Y A;  1M44 A;  2VZY A;  3PP9 A;  1ZG9 A;  3PZJ A;  1AYE A;  2FS5 A;  3R9E A;  5LRJ A;  5K8N A;  4AVC A;  3TFY A;  2EBJ A;  4B6Z A;  4OKO A;  4KUA A;  2CNS A;  1TKF A;  4R9M A;  4YFJ A;  4Y49 C;  4UCP A;  5ELY A;  1VKC A;  4JYW A;  1FY7 A;  3PB7 X;  4OC0 A;  4UBR A;  3TC8 A;  2JDC A;  4FUU A;  3GUX A;  4KVM E;  3T8W A;  2AFU A;  1FNO A;  3LD2 A;  4YWY A;  3CXP A;  2B3V A;  2ZEP A;  1Z8L A;  1B87 A;  1CJW A;  2V77 A;  5EC4 A;  3IWE A;  4KVX A;  2ZEF A;  3NE7 A;  4R57 A;  3B2Y A;  2Z3M A;  4M85 A;  1XFO A;  2NSM A;  4NGP A;  2ZEL A;  3PEI A;  4H6U A;  3TT2 A;  1CM0 A;  1S7K A;  4K30 A;  3DNS A;  4PSW A;  4ZX8 A;  4XPL A;  5JGF A;  4KLW A;  4MRI A;  1I1D A;  3FF3 A;  1TIQ A;  3D68 A;  3RYO A;  1AUG A;  3EY5 A;  4C2X A;  1XMB A;  1CP7 A;  2OR4 A;  2GFQ A;  2R8V A;  3B3W A;  1M4I A;  3FB3 A;  3PBE A;  3D3S A;  4FWU A;  4MY0 A;  4NGT A;  2PJB A;  2Q7B A;  4NGM A;  4AVA A;  4B5O A;  3S6H A;  4PXC A;  3SJE A;  2VL1 A;  4QVT A;  2FT0 A;  2PIZ A;  5J8C A;  3S6G A;  3B3V A;  1RXT A;  3DLJ A;  2IL4 A;  4RI1 A;  4MFL A;  4DUK A;  5IX3 A;  3MRU A;  1Z8X A;  1F2O A;  5EBV A;  2EO8 A;  2O53 A;  2V8G A;  3K9T A;  4F0X A;  3VH9 A;  3D8P A;  4PPZ A;  3PGP A;  4MCP A;  3RO0 A;  1HDQ A;  4TNU A;  4YGO A;  2BOA A;  2O4H A;  2PJ3 A;  3KQX A;  4U9Y A;  2ODF A;  5FVJ A;  4U9Z A;  5IB9 A;  1CX8 A;  3FRM A;  1S7N A;  5JH9 A;  2B5G B;  3CDX A;  1R43 A;  2WYR A;  4XNH C;  1TF9 A;  4UF4 A;  4C7I A;  5JQ4 A;  2DXQ A;  4B5P A;  1Y0Y A;  5LYI A;  4MY3 A;  4P4F A;  3TX8 A;  4CGM A;  5I4M A;  1ON0 A;  3QB8 A;  4LQG A;  3IEH A;  1UFH A;  2JLM A;  1KUY A;  2PJ5 A;  4ZYQ A;  2PQ8 A;  1NSL A;  2D4O A;  2PCU A;  2ZOF A;  3NA6 A;  4A30 A;  3KI9 A;  4X8I A;  4MHP A;  2G3A A;  3CZX A;  3E0K A;  4L89 A;  4OC5 A;  3DGV A;  3RZA A;  3IWW A;  4B12 A;  4P44 A;  1S60 A;  3V8I A;  2Z3L A;  1XJO A;  3B8G A;  4JZ0 A;  4CAF A;  3LMS A;  5JPH A;  1R57 A;  1M4G A;  2ZOG A;  2V8D A;  1IYL A;  3IWG A;  2GIV A;  1QQ9 A;  3KR5 A;  4KSI A;  4EME A;  3D67 A;  2ARH A;  1CBX A;  2Q51 A;  4E8O A;  1S7F A;  1RO5 A;  2FIW A;  2WZN A;  4MXU A;  1S7L A;  2OZU A;  3IJ3 A;  4NXY A;  3S6K A;  3I9S A;  2BL1 A;  4ZX9 A;  2F5I A;  3RBU A;  3NFZ A;  1FT7 A;  4P6Y A;  4M3S A;  3PFE A;  4KZT A;  3BJ8 A;  1RTQ A;  2J9A A;  5KTA A;  3D2P A;  1CG2 A;  1QSN A;  2HV2 A;  3GLJ A;  4CGO A;  4LUA A;  4RUH A;  3WC7 A;  1YX0 A;  5K8O A;  4XPK A;  2J8R A;  4HPS A;  4KOX A;  3D2M A;  3WT4 A;  5G1Z A;  2DPS A;  2I79 A;  2QML A;  3A9L A;  4UCM A;  3BHX A;  1Y0R A;  2ZEE A;  4DNC A;  3F8K A;  4R6T A;  2R1I A;  3IU2 A;  4R76 A;  5F09 A;  3H8G A;  3BJ7 A;  4JXQ A;  4BMH A;  4F0Y A;  3B3C A;  2YNE A;  2XEI A;  4B11 A;  3GY9 A;  2BUE A;  3IFE A;  2FCK A;  5G21 A;  4HKF A;  5G20 A;  4BBH A;  2AFW A;  4PXD A;  5AG6 A;  2Q4V A;  2XEJ A;  4B10 A;  4MCR A;  1J4J A;  5CBM A;  3D7F A;  4ZY2 A;  3TE4 A;  2Y0M A;  3KAS A;  4H6Z A;  5K8M A;  2AFX A;  1YLO A;  1YR0 A;  2F8H A;  3FX6 A;  3L2N A;  2C6C A;  3QAH A;  3R1K A;  4CPA A;  4QB9 A;  2QVP A;  4X5K A;  4TWE A;  3JRU A;  2BEI A;  2ZW6 A;  3GYA A;  1QST A;  1TKH A;  1XMT A;  4M6G A;  2PJ1 A;  5E96 A;  3BI0 A;  2Q04 A;  3I3G A;  2C1C A;  4PXE A;  4YU9 A;  2GU2 A;  1XEB A;  2B4B A;  2V8V A;  3H5Z A;  4GM5 A;  4OAD A;  3T90 A;  2EVN A;  5THW A;  3H8E A;  1BPN A;  2IMO A;  2CY2 A;  3IC1 A;  3DSB A;  2BSW A;  2IQ6 A;  4JXR A;  4R7M A;  4RS2 A;  4UFV A;  4MMO A;  3S6F A;  3V38 A;  2QEC A;  2DF5 A;  2FVG A;  4FAI A;  4MCS A;  4ZY0 A;  3KZW A;  3KR4 A;  4MHD A;  1IU8 A;  1XRY A;  2Z3N A;  3SJF A;  2Q4Z A;  2ZXV A;  1QMU A;  1VHS A;  4J3G A;  2BO9 A;  3JVN A;  4MFQ A;  4OLL A;  4CYQ A;  3KL9 A;  4EFD A;  5JM6 A;  3SXO A;  2EWB A;  1MK4 A;  2RFH A;  3EC4 A;  4CAW A;  1ZLH A;  1YW6 A;  4ONW A;  3G3S A;  4QC6 A;  4CS0 B;  4C2Y A;  5CPA A;  5KTC A;  1VHE A;  2XEF A;  1H8L A;  2XEG A;  1ARM A;  1LFW A;  4IUS A;  4NJQ A;  4CRZ B;  5BWA B;  5DWM A;  4JD6 A;  1Q2D A;  4A95 A;  2I3C A;  1ELM P;  1BLL E;  3IO1 A;  2CF4 A;  4NJR A;  2R7H A;  1GHE A;  1XOV A;  3K9U A;  3KQZ A;  2B4D A;  3IIB A;  5C82 A;  3PB6 X;  2VQY A;  1WWZ A;  3PB4 X;  2PJ8 A;  2YND A;  3FEE A;  1LRZ A;  3FXT A;  1P4N A;  4LX9 A;  3SJX A;  4NGR A;  3ZZI A;  1YVK A;  3TO9 A;  1Y9W A;  2VXK A;  1GYT A;  1F57 A;  1YRE A;  2Q0Y A;  2PE3 A;  3TOA A;  2FSR A;  2CIJ A;  4MCQ A;  1ZG8 A;  2O28 A;  4NCZ A;  2ZW5 A;  4A32 A;  3D7G A;  3SJG A;  3S9L A;  1EE3 P;  1IB1 E;  3MN8 A;  3ZJ0 A;  1IOI A;  4IK2 A;  1VHO A;  4IAV A;  2F7V A;  2JDD A;  4Y49 B;  4CAE A;  4BD9 A;  1KUV A;  4MFZ A;  1U6M A;  3VWE A;  2PJ4 A;  3C26 A;  3GIU A;  4ONU A;  2GLF A;  3S9M A;  4CRY B;  4CYO A;  1Z8W A;  2Z3K A;  5AG4 A;  3JUW A;  2QIR A;  5KTD A;  4A33 A;  3SI1 A;  4KOY A;  4AB7 A;  2AFO A;  4UIB A;  1QSO A;  4FD5 A;  2Z3P A;  1N71 A;  1PU9 A;  2G0B A;  2PJ2 A;  4M6I A;  4P10 A;  1K4J A;  2WPW A;  2P6G A;  2POK A;  3PFO A;  4ZI6 A;  4ZY1 A;  2Z0Z A;  4OP4 A;  4G1P A;  5H84 A;  4FD7 A;  1NMT A;  4M6H A;  5D8N A;  2C6G A;  1ARL A;  1LAP A;  2PJ7 A;  4XPD C;  3NH5 A;  4F9V A;  1QSM A;  2V8H A;  2Z10 A;  1A2Z A;  1UWY A;  3JTK A;  1Y9K A;  2HUZ A;  3F5B A;  3R9G A;  4C7H A;  5A28 A;  4NGN A;  3FH4 A;  5HVG A;  3D7D A;  2CXA A;  3W6S A;  2K5T A;  5CNP A;  5AG7 A;  2ABZ A;  3IU1 A;  4BIN A;  2J8M A;  2AFZ A;  3KHX A;  3EXN A;  3NH4 A;  2FE7 A;  2WUU A;  4KSA A;  4A39 A;  1S3Z A;  2REF A;  4UEF A;  4R87 A;  2OH1 A;  2CNM A;  2QJ8 A;  1YK3 A;  1YGH A;  2ZPA A;  3PBB A;  2KCW A;  2ZEO A;  3OWC A;  4UA3 A;  2B3U A;  4L8A A;  4OME A;  3B3T A;  1HDU A;  2PRB A;  3H4Q A;  1XF8 A;  2OZG A;  2B5G A;  2H5M A;  3FVL A;  3W91 A;  2P6E A;  3TOB A;  3WR7 A;  5IB0 A;  4C68 A;  3NH8 A;  4OC4 A;  2GRE A;  2C6P A;  4KUB A;  2ZW4 A;  2ZEG A;  2Z11 A;  3F0A A;  4DYO A;  4XNH B;  3SHP A;  3SI2 A;  2Q44 A;  4A38 A;  3CT9 A;  2AE6 A;  1LOK A;  3GB0 A;  4OC3 A;  1Y7E A;  3HLP A;  4UIA A;  1Z9U A;  3QAY A;  4UFX A;  4CYN A;  4PV6 A;  4X2T A;  4MI4 A;  1BAV A;  1NE9 A;  2PJA A;  4CGL A;  3BXM A;  4MFK A;  4X3R A;  2C27 A;  1HEE A;  1QSR A;  2CTC A;  5J8F A;  3VAT A;  4CGP A;  3PRT A;  2OZH A;  4UWI A;  2AFS A;  1YME A;  3BLN A;  4R8F A;  4AG7 A;  1KWM A;  3P2F A;  1XIX A;  2B58 A;  1DTD A;  2G3T A;  4P4I A;  1CPS A;  2CNT A;  4A37 A;  5F48 A;  5H86 A;  1LCP A;  1X12 A;  2ZEH A;  2HQY A;  4KOR A;  3H8F A;  3KGQ A;  3PB9 X;  3PB8 X;  4MHZ A;  3ISX A;  3SI0 A;  4LQ6 A;  1M4L A;  4R3L A;  4F8Z A;  4AXV A;  2D4P A;  2QYV A;  3DR8 A;  4NGQ A;  4KOW A;  4MJ8 A;  4EVY A;  1MJ9 A;  3P2H A;  2WSA A;  4HNX B;  1M1D A;  3B35 A;  3V7Z A;  2PIY A;  1Z5R A;  3TO6 A;  4P4D A;  1AMP A;  3FIX A;  2JBJ A;  1PUA A;  2AJ6 A;  4Z65 A;  1PYT B;  2P0W A;  4A94 A;  2FL4 A;  2Z3O A;  4JWP A;  4NFR A;  2JEV A;  2Q4Y A;  2VZZ A;  4PXB A;  4QBJ A;  1YW4 A;  4OID A;  4B13 A;  2I00 A;  3TO7 A;  3D66 A;  4FD6 A;  5F49 A;  1ZO0 A;  4E0A A;  5IV0 A;  5LYD A;  1IYK A;  2PDO A;  3LAC A;  2EK8 A;  3DR6 A;  1BPM A;  1ELL P;  1YQE A;  1ZG7 A;  3N7Z A;  4Q7A A;  2GAN A;  2EK9 A;  4UEE A;  2G9D A;  2IJZ A;  1NSA A;  3D7H A;  4MFJ A;  2ZW7 A;  1XE4 A;  1OZP A;  4UFW A;  4KVO E;  5ISV A;  3IGR A;  4AVB A;  1VIX A;  7CPA A;  3TCV A;  4B5P B;  6CPA A;  2ATR A;  4HNW B;  2DPT A;  4PK3 A;  4PQA A;  1KUX A;  1TF8 A;  1XBU A;  1PCA A;  2JEW A;  1IID A;  1Z4R A;  3VWD A;  1Z4E A;  4FD4 A;  2HB6 A;  5LYL A;  4P4E A;  1S5K A;  4H89 A;  1X10 A;  2OB0 A;  4JLY A;  4ORF A;  2Q43 A;  3FJU A;  2JBK A;  2YNC A;  2OU2 A;  1JQG A;  4KOS A;  2PVW A;  1F2P A;  3LOD A;  4UWJ A;  4YRH A;  3WC6 A;  4ZGY B;  4O23 A;  3CPX A;  5D29 A;  4HNY B;  5C88 A;  2PSW A;  1YVO A;  4C2Z A;  2NMT A;  3R96 A;  3R95 A;  3BI1 A;  3T9Y A;  5F46 A;  4DJL A;  2VI7 A;  3RNZ A;  5AG5 A;  1CPX A;  3WC5 A;  5F47 A;  3FBU A;  4OIW A;  4Q36 A;  2PR1 A;  3GKR A;  3B3S A;  4EWT A;  1R3N A;  3NE8 A;  1B6B A;  1YLE A;  3I1U A;  1IGB A;  3KHZ A;  3D4U A;  4E2A A;  3B7I A;  3RAM A;  2ZEM A;  3TTH A;  2VEZ A;  5LYF A;  5I0C A;  1MJA A;  1I21 A;  4II9 A;  4RN7 A;  1KZF A;  1Q2C A;  1I12 A;  4H2K A;  2CTB A;  5EMI A;  2GE3 A;  4K3N A;  4U5Y A;  3CPA A;  5HVF A;  4NGS A;  5A27 A;  3KKW A;  5DWN A;  4CYP A;  4NF1 A;  4P45 A;  4QUS A;  1M4D A;  1P0H A;  1TXR A;  3SXN A;  2X7B A;  3FED A;  2OOT A;  4A2Z A;  4KS9 A;  1Q7L A;  3DDD A;  1Z8T A;  2A4N A;  2EUI A;  4Q38 A;  5DS0 A;  2FIA A;  3WAB A;  5K8P A;  1BOB A;  1L0C A;  2R98 A;  4GXH A;  2ZED A;  3G8W A;  2AFM A;  4NEX A;  2PR8 A;  2PRQ A;  2PVV A;  2ANP A;  4R3K A;  3LWU A;  3ISZ A;  4MHN A;  2Q7S A;  3S9N A;  2PJ6 A;  1LAM A;  2WPX A;  4KLV A;  1Q2Y A;  4IF5 A;  4JJX A;  4KOT A;  3FMC A;  1IOF A;  1V0C A;  3R9F A; 
#chains in the Genus database with same CATH homology
 4UEZ A;  2NYQ A;  1CP6 A;  4WWV A;  5J1Q A;  1TKJ A;  3FEC A;  1YSJ A;  3QNV A;  8CPA A;  3VAR A;  2PJ0 A;  1IY7 A;  2ZEN A;  4WJB A;  2HC9 A;  2GLJ A;  2BCO A;  5HVH A;  4FBE A;  2PJ9 A;  4OC1 A;  1OBR A;  1LAN A;  1DE4 C;  3K2K A;  4IHM A;  4OC2 A;  4F9U A;  4P4J A;  1Z2L A;  5HXD A;  4P4B A;  3N5F A;  1ZLI A;  5LRK A;  2DEA A;  2PJC A;  2RB7 A;  5LRG A;  4MHY A;  1VGY A;  3HUV A;  4W9Y A;  1ZG9 A;  1AYE A;  5LRJ A;  5K8N A;  4B6Z A;  4OKO A;  1TKF A;  5ELY A;  4JYW A;  3PB7 X;  4OC0 A;  3TC8 A;  4FUU A;  3GUX A;  3T8W A;  2AFU A;  1FNO A;  4YWY A;  2ZEP A;  1Z8L A;  2V77 A;  2ZEF A;  3B2Y A;  1XFO A;  2NSM A;  4NGP A;  2ZEL A;  3PEI A;  4ZX8 A;  5JGF A;  4MRI A;  3FF3 A;  3D68 A;  1XMB A;  1CP7 A;  2OR4 A;  3B3W A;  4FWU A;  3PBE A;  4NGT A;  2PJB A;  4NGM A;  4PXC A;  3SJE A;  2VL1 A;  2PIZ A;  3B3V A;  3DLJ A;  4DUK A;  3MRU A;  1F2O A;  2O53 A;  2V8G A;  3K9T A;  3VH9 A;  4PPZ A;  4MCP A;  1HDQ A;  4TNU A;  2BOA A;  2O4H A;  2PJ3 A;  3KQX A;  5IB9 A;  1CX8 A;  5JH9 A;  3CDX A;  1R43 A;  2WYR A;  1TF9 A;  4UF4 A;  1Y0Y A;  5LYI A;  4P4F A;  3TX8 A;  5I4M A;  4LQG A;  3IEH A;  2PJ5 A;  4ZYQ A;  2ZOF A;  2PCU A;  3NA6 A;  3KI9 A;  4X8I A;  4MHP A;  4OC5 A;  3RZA A;  3DGV A;  3IWW A;  4P44 A;  1XJO A;  4JZ0 A;  3LMS A;  2ZOG A;  2V8D A;  1QQ9 A;  3KR5 A;  4KSI A;  4EME A;  3D67 A;  2Q51 A;  1CBX A;  2WZN A;  4MXU A;  3IJ3 A;  4ZX9 A;  3RBU A;  3NFZ A;  1FT7 A;  4P6Y A;  3PFE A;  1RTQ A;  2J9A A;  1CG2 A;  3GLJ A;  4RUH A;  3WC7 A;  5K8O A;  3WT4 A;  3BHX A;  1Y0R A;  2ZEE A;  4R6T A;  4R76 A;  5F09 A;  3H8G A;  3B3C A;  2XEI A;  3IFE A;  2AFW A;  4PXD A;  2XEJ A;  4MCR A;  5CBM A;  3D7F A;  4ZY2 A;  3KAS A;  5K8M A;  2AFX A;  1YLO A;  2F8H A;  3L2N A;  3FX6 A;  2C6C A;  4CPA A;  2QVP A;  4TWE A;  3JRU A;  1TKH A;  2PJ1 A;  3BI0 A;  2C1C A;  4PXE A;  4YU9 A;  2GU2 A;  2V8V A;  4GM5 A;  5THW A;  3H8E A;  1BPN A;  2IMO A;  3IC1 A;  2IQ6 A;  4R7M A;  4MMO A;  3V38 A;  2FVG A;  4FAI A;  4MCS A;  4ZY0 A;  3KZW A;  3KR4 A;  1XRY A;  3SJF A;  2Q4Z A;  1QMU A;  2BO9 A;  3KL9 A;  4EFD A;  5JM6 A;  2EWB A;  2RFH A;  1ZLH A;  1YW6 A;  4ONW A;  5CPA A;  1VHE A;  2XEF A;  1H8L A;  2XEG A;  1ARM A;  1LFW A;  4NJQ A;  2I3C A;  1ELM P;  1BLL E;  3IO1 A;  2CF4 A;  4NJR A;  3KQZ A;  3IIB A;  3PB6 X;  3PB4 X;  2PJ8 A;  3FEE A;  3SJX A;  4NGR A;  1GYT A;  1F57 A;  2PE3 A;  2CIJ A;  4MCQ A;  1ZG8 A;  3S9L A;  3D7G A;  3SJG A;  1EE3 P;  3MN8 A;  4IK2 A;  1VHO A;  4IAV A;  2F7V A;  4BD9 A;  2PJ4 A;  3S9M A;  2GLF A;  3SI1 A;  2AFO A;  4UIB A;  2PJ2 A;  4P10 A;  2POK A;  3PFO A;  4ZI6 A;  4ZY1 A;  4OP4 A;  4G1P A;  5D8N A;  2C6G A;  1ARL A;  1LAP A;  2PJ7 A;  3NH5 A;  4F9V A;  2V8H A;  1UWY A;  4NGN A;  3FH4 A;  5HVG A;  3D7D A;  2ABZ A;  3KHX A;  2AFZ A;  3NH4 A;  4A39 A;  4UEF A;  2QJ8 A;  3PBB A;  2ZEO A;  4OME A;  3B3T A;  1HDU A;  3FVL A;  3NH8 A;  4OC4 A;  2GRE A;  2C6P A;  2ZEG A;  4DYO A;  3SI2 A;  4A38 A;  3CT9 A;  3GB0 A;  1LOK A;  4OC3 A;  1Y7E A;  3HLP A;  4UIA A;  4X2T A;  1BAV A;  2PJA A;  3BXM A;  4X3R A;  1HEE A;  2CTC A;  3VAT A;  3PRT A;  2AFS A;  1YME A;  4R8F A;  1KWM A;  1DTD A;  4P4I A;  1CPS A;  4A37 A;  1LCP A;  2ZEH A;  4MHZ A;  3H8F A;  3KGQ A;  3PB9 X;  3PB8 X;  3ISX A;  3SI0 A;  1M4L A;  4F8Z A;  4AXV A;  2QYV A;  4NGQ A;  3B35 A;  3V7Z A;  2PIY A;  1Z5R A;  4P4D A;  1AMP A;  2JBJ A;  4Z65 A;  1PYT B;  4A94 A;  4NFR A;  4PXB A;  1YW4 A;  4OID A;  3D66 A;  5LYD A;  2EK8 A;  1BPM A;  1ELL P;  1ZG7 A;  4Q7A A;  2EK9 A;  4UEE A;  2G9D A;  2IJZ A;  1NSA A;  3D7H A;  1VIX A;  7CPA A;  6CPA A;  4PQA A;  1TF8 A;  1XBU A;  1PCA A;  2JEW A;  2HB6 A;  5LYL A;  4P4E A;  2Q43 A;  3FJU A;  2JBK A;  1JQG A;  2PVW A;  1F2P A;  3WC6 A;  4O23 A;  3CPX A;  5D29 A;  3BI1 A;  4DJL A;  1CPX A;  3WC5 A;  4OIW A;  3B3S A;  4EWT A;  1R3N A;  3I1U A;  1IGB A;  3KHZ A;  3D4U A;  3B7I A;  3RAM A;  2ZEM A;  5LYF A;  4H2K A;  2CTB A;  4K3N A;  3CPA A;  5HVF A;  4NGS A;  4P45 A;  1TXR A;  3FED A;  2OOT A;  1Q7L A;  5DS0 A;  5K8P A;  3WAB A;  2ZED A;  2AFM A;  2PRQ A;  2PVV A;  2ANP A;  3LWU A;  3ISZ A;  4MHN A;  3S9N A;  2PJ6 A;  1LAM A;  3FMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...