1TXRA

X-ray crystal structure of bestatin bound to aap
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Spectroscopic and X-ray Crystallographic Characterization of Bestatin Bound to the Aminopeptidase from Aeromonas (Vibrio) proteolytica.
pubmed doi rcsb
molecule tags Hydrolase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1txrA00
2ZEHA 4LQGA 2WZNA 4YU9A 3FJUA 4BD9A 1JQGA 4F8ZA 1LCPA 4UEEA 3KZWA 3H8FA 3PFOA 1XRYA 2CTBA 4ONWA 3FEDA 3L2NA 1GYTA 1R3NA 2GU2A 2XEJA 4WJBA 2F8HA 3T8WA 1YSJA 1ELLP 1YW4A 1XMBA 2CF4A 3B3SA 2QYVA 3NH8A 1AMPA 4FWUA 2VL1A 1DTDA 5HVGA 1Z5RA 3FMCA 1XBUA 3NH4A 4EMEA 5JH9A 1TXRA 3KHXA 4NFRA 4YWYA 2ABZA 4ZYQA 1LOKA 4X3RA 3CT9A 3D7GA 4A38A 1F2PA 1FNOA 3V38A 4W9YA 4IAVA 2EK8A 3PFEA 4P4FA 3SJFA 3LMSA 4A39A 2PE3A 4GM5A 3B2YA 1HDUA 4PXDA 3IEHA 2XEGA 1DE4C 4MRIA 4UIBA 3GB0A 4JYWA 3SJXA 1VGYA 4Z65A 3QNVA 3K9TA 4ZI6A 2QJ8A 1Z8LA 1Y0RA 1VHOA 2ZENA 3DLJA 2QVPA 5F09A 1ELMP 2AFZA 3KASA 5JGFA 4MMOA 3NA6A 3CPAA 1BAVA 1CG2A 3HUVA 3IWWA 4OC4A 4TWEA 2NSMA 5J1QA 4FUUA 2CIJA 4P10A 4AXVA 4P4JA 3IC1A 2PJ9A 1BLLE 2PJ3A 3RAMA 3PB6X 2C6GA 4R7MA 2AFXA 4IHMA 4O23A 3FX6A 4TNUA 1CPSA 4MXUA 2Q43A 1VIXA 3HLPA 3KR5A 3SJEA 3KR4A 3ISZA 1TKHA 3KI9A 4NGQA 4OIDA 2I3CA 1HDQA 2PIZA 2PJ4A 4P4EA 4WWVA 4NGRA 3KHZA 5JM6A 3WT4A 3B3WA 2WYRA 4B6ZA 5DS0A 3MRUA 1LFWA 3PB8X 1Z2LA 4PPZA 3BHXA 4ZY2A 3PB9X 2AFUA 3D4UA 1QQ9A 2PJCA 3PB7X 5LYDA 4MCPA 1AYEA 4NGNA 3B35A 1CBXA 3PBEA 2O53A 3B3CA 2OR4A 2JBKA 4OC5A 4OC2A 1ZLIA 1TKFA 3PBBA 4KSIA 2PRQA 1F57A 4R6TA 2RFHA 4OC3A 3VH9A 3D7DA 1BPNA 4FAIA 4PXCA 2HB6A 5ELYA 2EWBA 5K8NA 1ARMA 2PJ5A 3IO1A 2V77A 5LRJA 1OBRA 3KL9A 7CPAA 2J9AA 2ZEOA 2G9DA 4OP4A 1LAMA 2PCUA 1Q7LA 2GREA 3WABA 3TC8A 4ZY1A 2PJBA 3KQXA 3K2KA 4MHPA 2IQ6A 4NGTA 3GLJA 4X8IA 2ZEEA 1PYTB 1TF9A 2IMOA 3WC7A 1IY7A 2PJAA 1PCAA 8CPAA 3B3VA 4DUKA 5CBMA 4MHYA 2GLJA 2ZEMA 4EFDA 1YW6A 3FF3A 4NGMA 1XJOA 2V8VA 3S9LA 3I1UA 3WC5A 4OC1A 3B3TA 3VARA 1YMEA 5HXDA 3GUXA 2O4HA 4F9UA 3PRTA 2Q4ZA 3SI0A 1Y0YA 2AFSA 4OIWA 4P4IA 1RTQA 2NYQA 4JZ0A 5D29A 4CPAA 5LYFA 2EK9A 2PJ2A 3D67A 1QMUA 2C1CA 1LAPA 1TF8A 4A37A 4UEFA 5HVFA 4UIAA 1ZG7A 1H8LA 3FEEA 4Q7AA 1ZG9A 2JEWA 2ZEDA 6CPAA 2C6PA 1ZLHA 2BOAA 5K8MA 1FT7A 3JRUA 2ZEGA 3RBUA 2PVVA 4UEZA 3VATA 1ZG8A 3D7FA 2XEFA 1ARLA 3PB4X 2V8DA 3NH5A 2PJ1A 4H2KA 5IB9A 2RB7A 1CP7A 2OOTA 4EWTA 3SJGA 2BO9A 4MCSA 3KQZA 4PXEA 1Y7EA 3D66A 1M4LA 1CX8A 2ZOFA 5LRKA 2AFMA 1NSAA 4NGSA 2V8HA 1EE3P 1YLOA 3BI1A 2HC9A 4R8FA 4MHNA 3KGQA 4R76A 3LWUA 3IJ3A 5K8OA 3MN8A 2XEIA 3ISXA 5LYIA 3CPXA 4MCRA 4X2TA 4P6YA 4G1PA 4UF4A 4FBEA 2PJ8A 4K3NA 1XFOA 4P4DA 3B7IA 4ZY0A 5I4MA 5D8NA 3DGVA 2PIYA 3RZAA 4NGPA 2DEAA 4P45A 2V8GA 4P44A 4NJRA 2C6CA 4NJQA 1LANA 1UWYA 3IIBA 3SI1A 3TX8A 1CPXA 2Q51A 4OC0A 4PQAA 2PJ0A 2AFWA 1CP6A 1HEEA 5CPAA 5LRGA 2F7VA 3BXMA 1KWMA 4A94A 4DJLA 4ZX8A 5LYLA 3SI2A 5HVHA 3NFZA 5K8PA 3PEIA 2PJ6A 3BI0A 2GLFA 3H8GA 3S9NA 2ZOGA 3CDXA 4PXBA 4OKOA 3N5FA 3H8EA 5THWA 3FECA 3WC6A 1R43A 4DYOA 4IK2A 3D68A 3D7HA 2CTCA 4RUHA 2IJZA 4ZX9A 4P4BA 4MCQA 4OMEA 2PJ7A 2ANPA 1BPMA 4MHZA 3V7ZA 2JBJA 2POKA 1F2OA 3FVLA 2PVWA 1IGBA 2ZEPA 2ZEFA 2AFOA 1VHEA 4F9VA 2ZELA 2BCOA 1TKJA 3FH4A 3IFEA 2FVGA 3S9MA
chains in the Genus database with same CATH superfamily
2ZEHA 1QSTA 4LQGA 2WZNA 4C7IA 4YU9A 3FJUA 4PK3A 4UFVA 2ZW5A 4BD9A 1JQGA 1Z4RA 1LCPA 4F8ZA 4UEEA 2BEIA 3KZWA 3H8FA 3PFOA 1IB1E 1XRYA 2CTBA 2Q4YA 4ONWA 4KOXA 3FEDA 4B5PA 3L2NA 4CGPA 4CYQA 1GYTA 1R3NA 2GU2A 2XEJA 4WJBA 2F8HA 3BJ7A 1YSJA 1ELLP 3T8WA 2K5TA 2IL4A 1YW4A 3H5ZA 1S7FA 3G8WA 3TO7A 1XMBA 1M4GA 2CF4A 3B3SA 2QYVA 1UFHA 3A9LA 3QAYA 1TIQA 1S7NA 3NH8A 3DDDA 4CGNA 1S5KA 1AMPA 1RO5A 5KTDA 4FWUA 2VL1A 4BINA 1GHEA 1DTDA 5HVGA 4KOYA 2FS5A 1Z5RA 3D8PA 3FMCA 3JTKA 1XBUA 3NH4A 4EMEA 5JH9A 1TXRA 3KHXA 4NFRA 4YWYA 4YGOA 4FD5A 4M3SA 2ABZA 1X12A 4F9VA 2VXKA 3R9EA 3T9YA 4KSFA 4ZYQA 2YNCA 3KKWA 1LOKA 2HUZA 4KOSA 3CT9A 3D7GA 4X3RA 4A38A 3CXQA 4B14A 1F2PA 1FNOA 2O28A 3V38A 3W6SA 4CAXA 2KCWA 2GANA 4W9YA 4IAVA 2EK8A 5A27A 3C26A 2I79A 1CJWA 3H4QA 3P2FA 5CNPA 3PFEA 4LX9A 3IU2A 4P4FA 4KUAA 3SJFA 4B12A 2P0WA 1PUAA 2FL4A 1OZPA 3LMSA 2PE3A 4GM5A 4A39A 3VWEA 2EBJA 3B2YA 5C82A 5F46A 4QB9A 1HDUA 4PXDA 3IEHA 2FSRA 2PDOA 4L89A 2PR8A 4H89A 2XEGA 2F5IA 1DE4C 4MRIA 4UIBA 2G3TA 3GB0A 4JYWA 3SJXA 1BO4A 4MFKA 1IU8A 1VGYA 2OZHA 4Z65A 3QNVA 4II9A 3K9TA 1P4NA 4PV6A 4ZI6A 3S6GA 2QJ8A 1Z8LA 1Y0RA 5F48A 4C68A 3I3GA 1IYLA 2PQ8A 4MY0A 1VHOA 4UFXA 3I9SA 2ZENA 3DLJA 2QVPA 1AUGA 5F09A 1K4JA 1WWZA 2DPTA 4CYNA 4QBJA 1I12A 1ELMP 2AFZA 3KASA 4KVXA 4MMOA 4CAWA 5JGFA 3PGPA 1NE9A 3NA6A 4JWPA 2WPWA 4Q38A 3CPAA 4UBRA 3ZJ0A 4DNCA 1BAVA 2P6GA 2HQYA 1CG2A 4CAFA 3HUVA 1Q2DA 1I1DA 3IWWA 4OC4A 4TWEA 2NSMA 2Z0ZA 5IB0A 3D3SA 5BWAB 4MHDA 5KTAA 5J1QA 4MBUA 4FUUA 4NEXA 2CIJA 5AG4A 2QIRA 1M4DA 4P10A 4UCMA 4AXVA 4P4JA 1A2ZA 3IC1A 2PJ9A 1BLLE 2PJ3A 3RAMA 4B11A 2Z3KA 4BBHA 3PB6X 2C6GA 4R7MA 2AFXA 4IHMA 1IOIA 4RS2A 4MI4A 4O23A 3FX6A 4TNUA 4EVYA 1CPSA 3RYOA 2R98A 4MXUA 2Q43A 1VIXA 2Q7SA 2CNSA 3HLPA 4H6UA 3KR5A 3SJEA 3KR4A 3ISZA 3DR6A 3R9FA 5F47A 1IIDA 1I21A 1TKHA 2R8VA 3D2PA 3KI9A 4NGQA 4OIDA 2I3CA 4GXHA 2ODFA 2PC1A 5ISVA 1HDQA 2DXQA 2C27A 2HV2A 2PJ4A 2PIZA 3BJ8A 4P4EA 4WWVA 4M6GA 2I00A 4NGRA 3PP9A 3KHZA 4A31A 1NMTA 3F5BA 5JM6A 3WT4A 3FYNA 1IYKA 3B3WA 4RN7A 2WYRA 5F49A 4B6ZA 5DS0A 3MRUA 1LFWA 1XEBA 4UA3A 3PB8X 1Z2LA 2VZZA 4M85A 4E0AA 1XOVA 4PPZA 3BHXA 3W91A 4ZY2A 4C7HA 4AG7A 4F0YA 3PB9X 4HPSA 5IX3A 3EFAA 2AFUA 3D4UA 1QQ9A 1YLEA 2YNEA 3B8GA 3R1KA 4KVOE 2PJCA 1J4JA 3PB7X 5G20A 5LYDA 4ZGYB 4MCPA 1KUXA 4MJ8A 4NXYA 1AYEA 2OZUA 2Z3MA 2Z10A 4M6HA 4NGNA 2R7HA 3B35A 1CBXA 1QSMA 1XF8A 1Y7RA 3PBEA 3CXPA 4GS4A 2G3AA 3OWCA 2VZYA 5EMIA 3TO6A 4BMHA 2OH1A 1YGHA 1QSNA 3GYAA 2O53A 5E96A 3B3CA 3RO0A 3CXSA 3QB8A 2OR4A 3F0AA 5I0CA 2JBKA 2AE6A 4F0XA 4Q36A 1X10A 2RC4A 2J8MA 4OC5A 4OC2A 1ZLIA 1TKFA 3PBBA 4KSIA 4A33A 2Q44A 1KZFA 2REEA 1ON0A 2B5GB 3ZZIA 2PRQA 1F57A 4MFZA 5JPHA 2YGWA 4CS0B 4R6TA 2RFHA 5AG7A 4OC3A 1S7KA 3TOAA 4E2AA 5C88A 4HNWB 3VH9A 1M4IA 3D7DA 3TT2A 3SXNA 5A28A 1BPNA 4JLYA 4I49A 4MY3A 4FAIA 1Z4EA 3MGDA 4PXCA 2HB6A 1YVKA 2GFQA 2EWBA 1ZO0A 5ELYA 5K8NA 5G22A 1S60A 2NMTA 4FD6A 4HKFA 2YNDA 3UY5A 2B4BA 5GCNA 2CY2A 1ARMA 1Q2CA 2JDCA 2PJ5A 4B5OA 4IF5A 3IO1A 2Q04A 4MFJA 2V77A 3IGRA 2ZW6A 3GIUA 4OAEA 2EO8A 3FIXA 5DWNA 3N7ZA 5LRJA 4IUSA 1OBRA 4AG9A 3KL9A 4RI1A 2Q4VA 7CPAA 1JWQA 2J9AA 2ZEOA 1MJAA 2G9DA 4OP4A 2P6FA 4UFWA 1YR0A 1LAMA 2PCUA 2Z11A 3R9GA 2J8RA 3NE7A 1XMTA 2QMLA 2CNMA 1MK4A 3FRMA 4ONUA 1S7LA 1Q7LA 2GREA 3WABA 2Z3PA 3TC8A 4ZY1A 4KZTA 3D2MA 4PSWA 4QC6A 1NSLA 4B13A 4U9ZA 2PJBA 4UWJA 3KQXA 2PSWA 3K2KA 4FD4A 1YQEA 2IQ6A 4MHPA 2OZGA 2ZXVA 3GLJA 2ZEEA 4NGTA 4X8IA 3S6HA 4B5PB 3R96A 1PYTB 1TF9A 2IMOA 3BLNA 4A32A 1BOBA 4KOVA 1YX0A 3T90A 4XPKA 4J3GA 3QAHA 3S6KA 3WC7A 1Z8XA 3PZJA 1IY7A 2PJAA 1PCAA 8CPAA 3B3VA 4KOUA 4DUKA 2ZW7A 1KUYA 5H84A 4CGMA 3TTHA 5CBMA 4MHYA 2CNTA 2GLJA 4OLLA 2ZEMA 2Z3OA 4EFDA 1YW6A 3FF3A 4NGMA 1XJOA 2V8VA 2GIVA 1L0CA 4UCPA 3S9LA 3I1UA 3WC5A 1S3ZA 2FCKA 3B3TA 4OC1A 3VARA 1YMEA 5HXDA 3GUXA 5EC4A 3SXOA 2WPXA 4KVME 2D4OA 4A30A 2O4HA 4XNHC 4F9UA 3PRTA 2ARHA 2Q4ZA 4NCZA 3SI0A 1IOFA 1Y0YA 1KUVA 2AFSA 4OIWA 1RTQA 2NYQA 4JZ0A 4P4IA 2CXAA 5D29A 2B58A 3IWEA 5DWMA 3TO9A 4CPAA 1Y9KA 5LYFA 2EK9A 4X5KA 2PJ2A 4L8AA 2B5GA 4FD7A 3D67A 2QECA 1QMUA 2YNCC 4CRZB 4KLWA 4AB7A 3R95A 3S6FA 4UCNA 5IV0A 2C1CA 1LAPA 1TF8A 3IU1A 4A37A 4UEFA 5HVFA 4H6ZA 1FY7A 2REFA 2ATRA 4YRHA 2BSWA 2JLMA 4ORFA 4UIAA 1ZG7A 3GKRA 4C2YA 1H8LA 3FEEA 4U9YA 4Q7AA 1ZG9A 2JEWA 2ZEDA 2JDDA 6CPAA 1VHSA 2C6PA 3W6XA 1MJ9A 2FE7A 1ZLHA 2B4DB 4OADA 4PSXA 1M1DA 2BOAA 5K8MA 2Q0YA 2B3VA 1FT7A 3JRUA 1Z9UA 1RXTA 2ZEGA 3RBUA 2PVVA 4QUSA 4UEZA 4U5YA 1ZG8A 3VATA 3D7FA 2XEFA 4MFLA 3RNZA 4KOTA 4ZBGA 5J8CA 4AVCA 1ARLA 1CM0A 3PB4X 3TFYA 4AVAA 2V8DA 1YK3A 2A4NA 3NH5A 2PJ1A 4H2KA 4CAVA 4M6IA 2FT0A 5IB9A 2RB7A 1CP7A 4C2ZA 2DPSA 3VWDA 2OB0A 4CRYB 1YREA 2EUIA 2FIAA 2OOTA 2PRBA 4EWTA 3SJGA 2BO9A 4MCSA 3FBUA 3KQZA 4PK2A 1XE4A 4PXEA 1Y7EA 3D66A 1M4LA 2AJ6A 4R9MA 2J8NA 2H5MA 3G3SA 1XIXA 1CX8A 2ZOFA 4LUAA 2VQYA 1B6BA 4CGOA 2AFMA 5LRKA 4KSAA 4E8OA 3CZXA 3FXTA 1NSAA 4UWIA 2D4PA 4NGSA 2V8HA 4QVTA 5H86A 3EY5A 4CGLA 4Y49B 5G21A 1EE3P 3E0KA 2Q7BA 4CAEA 4JD6A 1YLOA 3BI1A 2ZW4A 2HC9A 4NSQA 4R3LA 4R8FA 4MHNA 1VKCA 3KGQA 4NF1A 4Y49C 4R76A 3FB3A 3LWUA 1YVOA 2G0BA 3IJ3A 4AVBA 1M44A 5K8OA 1U6MA 3MN8A 5AG6A 2FIWA 2PR1A 2XEIA 3ISXA 2P6EA 2OU2A 5HH1A 4A95A 4MFQA 5LYIA 3CPXA 4F6AA 4KLVA 4MCRA 3LACA 4X2TA 4P6YA 1V0CA 4G1PA 4R3KA 2Z3NA 2B3UA 4UF4A 4KORA 1Y9WA 1MJBA 2X7BA 4HNXB 2PJ8A 4K30A 4FBEA 2BL1A 4A2ZA 4K3NA 3EO4A 1XFOA 4C2XA 3NE8A 4P4DA 3B7IA 4ZY0A 5I4MA 5D8NA 5J8FA 3LD2A 3LODA 3DGVA 2JEVA 2PIYA 2Y0MA 3RZAA 4NGPA 4KOWA 1N71A 2EVNA 2DEAA 4P45A 4CYPA 2V8GA 2B4DA 5AGEA 4P44A 4HNYB 4NJRA 2C6CA 4NJQA 3IWGA 1LANA 1UWYA 3IIBA 3SI1A 4XPDB 4MFPA 3TX8A 1PU9A 4B10A 1CPXA 2Q51A 4OC0A 4PQAA 2DF5A 2PJ0A 1P0HA 3F8KA 2AFWA 1IICA 2R1IA 4XNHB 1CP6A 3DR8A 4XPDC 1HEEA 1Z8WA 5CPAA 5LRGA 2F7VA 3BXMA 1KWMA 4A94A 1Z8TA 3DNSA 4JJXA 4ZX8A 4DJLA 1SQHA 3SI2A 1QSRA 5JQ4A 1R57A 5LYLA 3EC4A 3K9UA 5HVHA 1B87A 3NFZA 5K8PA 3PEIA 2WSAA 2PJ6A 1LRZA 3BI0A 2GLFA 3H8GA 3S9NA 2ZOGA 3CDXA 3V8IA 4LQ6A 2VBQA 4PXBA 3WR7A 4OKOA 4R87A 3N5FA 3H8EA 5AG5A 5THWA 3FECA 3WC6A 5EBVA 5KTCA 1R43A 3TE4A 4DYOA 4IK2A 4CYOA 3D68A 3EXNA 4YFJA 3D7HA 2CTCA 3JUWA 3FNCA 4JXRA 3SHPA 4RUHA 2IJZA 5HMNA 4ZX9A 2WUUA 4P4BA 4MCQA 4XPLA 4OMEA 2PJ7A 3TCVA 3DSBA 1QSOA 4R57A 2ANPA 4KS9A 1BPMA 4MHZA 3V7ZA 2JBJA 2Z3LA 3JVNA 2POKA 5FVJA 1F2OA 3FVLA 2PVWA 1IGBA 2VEZA 4KUBA 2BUEA 1Q2YA 3P2HA 2ZEPA 1WK4A 2AFOA 2ZEFA 1VHEA 3TOBA 2GE3A 2ZELA 2ZPAA 2BCOA 1TKJA 3FH4A 3IFEA 5G1ZA 2FVGA 3GY9A 4JXQA 3S9MA 2VI7A 2FXFA
chains in the Genus database with same CATH topology
2ZEHA 4LQGA 2WZNA 4YU9A 3FJUA 4BD9A 1JQGA 4F8ZA 1LCPA 4UEEA 3KZWA 3H8FA 3PFOA 1XRYA 2CTBA 4ONWA 3FEDA 3L2NA 1GYTA 1R3NA 2GU2A 2XEJA 4WJBA 2F8HA 3T8WA 1YSJA 1ELLP 1YW4A 1XMBA 2CF4A 3B3SA 2QYVA 3NH8A 1AMPA 4FWUA 2VL1A 1DTDA 5HVGA 1Z5RA 3FMCA 1XBUA 3NH4A 4EMEA 5JH9A 1TXRA 3KHXA 4NFRA 4YWYA 2ABZA 4ZYQA 1LOKA 4X3RA 3CT9A 3D7GA 4A38A 1F2PA 1FNOA 3V38A 4W9YA 4IAVA 2EK8A 3PFEA 4P4FA 3SJFA 3LMSA 4A39A 2PE3A 4GM5A 3B2YA 1HDUA 4PXDA 3IEHA 2XEGA 1DE4C 4MRIA 4UIBA 3GB0A 4JYWA 3SJXA 1VGYA 4Z65A 3QNVA 3K9TA 4ZI6A 2QJ8A 1Z8LA 1Y0RA 1VHOA 2ZENA 3DLJA 2QVPA 5F09A 1ELMP 2AFZA 3KASA 5JGFA 4MMOA 3NA6A 3CPAA 1BAVA 1CG2A 3HUVA 3IWWA 4OC4A 4TWEA 2NSMA 5J1QA 4FUUA 2CIJA 4P10A 4AXVA 4P4JA 3IC1A 2PJ9A 1BLLE 2PJ3A 3RAMA 3PB6X 2C6GA 4R7MA 2AFXA 4IHMA 4O23A 3FX6A 4TNUA 1CPSA 4MXUA 2Q43A 1VIXA 3HLPA 3KR5A 3SJEA 3KR4A 3ISZA 1TKHA 3KI9A 4NGQA 4OIDA 2I3CA 1HDQA 2PIZA 2PJ4A 4P4EA 4WWVA 4NGRA 3KHZA 5JM6A 3WT4A 3B3WA 2WYRA 4B6ZA 5DS0A 3MRUA 1LFWA 3PB8X 1Z2LA 4PPZA 3BHXA 4ZY2A 3PB9X 2AFUA 3D4UA 1QQ9A 2PJCA 3PB7X 5LYDA 4MCPA 1AYEA 4NGNA 3B35A 1CBXA 3PBEA 2O53A 3B3CA 2OR4A 2JBKA 4OC5A 4OC2A 1ZLIA 1TKFA 3PBBA 4KSIA 2PRQA 1F57A 4R6TA 2RFHA 4OC3A 3VH9A 3D7DA 1BPNA 4FAIA 4PXCA 2HB6A 5ELYA 2EWBA 5K8NA 1ARMA 2PJ5A 3IO1A 2V77A 5LRJA 1OBRA 3KL9A 7CPAA 2J9AA 2ZEOA 2G9DA 4OP4A 1LAMA 2PCUA 1Q7LA 2GREA 3WABA 3TC8A 4ZY1A 2PJBA 3KQXA 3K2KA 4MHPA 2IQ6A 4NGTA 3GLJA 4X8IA 2ZEEA 1PYTB 1TF9A 2IMOA 3WC7A 1IY7A 2PJAA 1PCAA 8CPAA 3B3VA 4DUKA 5CBMA 4MHYA 2GLJA 2ZEMA 4EFDA 1YW6A 3FF3A 4NGMA 1XJOA 2V8VA 3S9LA 3I1UA 3WC5A 4OC1A 3B3TA 3VARA 1YMEA 5HXDA 3GUXA 2O4HA 4F9UA 3PRTA 2Q4ZA 3SI0A 1Y0YA 2AFSA 4OIWA 4P4IA 1RTQA 2NYQA 4JZ0A 5D29A 4CPAA 5LYFA 2EK9A 2PJ2A 3D67A 1QMUA 2C1CA 1LAPA 1TF8A 4A37A 4UEFA 5HVFA 4UIAA 1ZG7A 1H8LA 3FEEA 4Q7AA 1ZG9A 2JEWA 2ZEDA 6CPAA 2C6PA 1ZLHA 2BOAA 5K8MA 1FT7A 3JRUA 2ZEGA 3RBUA 2PVVA 4UEZA 3VATA 1ZG8A 3D7FA 2XEFA 1ARLA 3PB4X 2V8DA 3NH5A 2PJ1A 4H2KA 5IB9A 2RB7A 1CP7A 2OOTA 4EWTA 3SJGA 2BO9A 4MCSA 3KQZA 4PXEA 1Y7EA 3D66A 1M4LA 1CX8A 2ZOFA 5LRKA 2AFMA 1NSAA 4NGSA 2V8HA 1EE3P 1YLOA 3BI1A 2HC9A 4R8FA 4MHNA 3KGQA 4R76A 3LWUA 3IJ3A 5K8OA 3MN8A 2XEIA 3ISXA 5LYIA 3CPXA 4MCRA 4X2TA 4P6YA 4G1PA 4UF4A 4FBEA 2PJ8A 4K3NA 1XFOA 4P4DA 3B7IA 4ZY0A 5I4MA 5D8NA 3DGVA 2PIYA 3RZAA 4NGPA 2DEAA 4P45A 2V8GA 4P44A 4NJRA 2C6CA 4NJQA 1LANA 1UWYA 3IIBA 3SI1A 3TX8A 1CPXA 2Q51A 4OC0A 4PQAA 2PJ0A 2AFWA 1CP6A 1HEEA 5CPAA 5LRGA 2F7VA 3BXMA 1KWMA 4A94A 4DJLA 4ZX8A 5LYLA 3SI2A 5HVHA 3NFZA 5K8PA 3PEIA 2PJ6A 3BI0A 2GLFA 3H8GA 3S9NA 2ZOGA 3CDXA 4PXBA 4OKOA 3N5FA 3H8EA 5THWA 3FECA 3WC6A 1R43A 4DYOA 4IK2A 3D68A 3D7HA 2CTCA 4RUHA 2IJZA 4ZX9A 4P4BA 4MCQA 4OMEA 2PJ7A 2ANPA 1BPMA 4MHZA 3V7ZA 2JBJA 2POKA 1F2OA 3FVLA 2PVWA 1IGBA 2ZEPA 2ZEFA 2AFOA 1VHEA 4F9VA 2ZELA 2BCOA 1TKJA 3FH4A 3IFEA 2FVGA 3S9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEH A;  4LQG A;  2WZN A;  4YU9 A;  3FJU A;  4BD9 A;  1JQG A;  4F8Z A;  1LCP A;  4UEE A;  3KZW A;  3H8F A;  3PFO A;  1XRY A;  2CTB A;  4ONW A;  3FED A;  3L2N A;  1GYT A;  1R3N A;  2GU2 A;  2XEJ A;  4WJB A;  2F8H A;  3T8W A;  1YSJ A;  1ELL P;  1YW4 A;  1XMB A;  2CF4 A;  3B3S A;  2QYV A;  3NH8 A;  1AMP A;  4FWU A;  2VL1 A;  1DTD A;  5HVG A;  1Z5R A;  3FMC A;  1XBU A;  3NH4 A;  4EME A;  5JH9 A;  1TXR A;  3KHX A;  4NFR A;  4YWY A;  2ABZ A;  4ZYQ A;  1LOK A;  4X3R A;  3CT9 A;  3D7G A;  4A38 A;  1F2P A;  1FNO A;  3V38 A;  4W9Y A;  4IAV A;  2EK8 A;  3PFE A;  4P4F A;  3SJF A;  3LMS A;  4A39 A;  2PE3 A;  4GM5 A;  3B2Y A;  1HDU A;  4PXD A;  3IEH A;  2XEG A;  1DE4 C;  4MRI A;  4UIB A;  3GB0 A;  4JYW A;  3SJX A;  1VGY A;  4Z65 A;  3QNV A;  3K9T A;  4ZI6 A;  2QJ8 A;  1Z8L A;  1Y0R A;  1VHO A;  2ZEN A;  3DLJ A;  2QVP A;  5F09 A;  1ELM P;  2AFZ A;  3KAS A;  5JGF A;  4MMO A;  3NA6 A;  3CPA A;  1BAV A;  1CG2 A;  3HUV A;  3IWW A;  4OC4 A;  4TWE A;  2NSM A;  5J1Q A;  4FUU A;  2CIJ A;  4P10 A;  4AXV A;  4P4J A;  3IC1 A;  2PJ9 A;  1BLL E;  2PJ3 A;  3RAM A;  3PB6 X;  2C6G A;  4R7M A;  2AFX A;  4IHM A;  4O23 A;  3FX6 A;  4TNU A;  1CPS A;  4MXU A;  2Q43 A;  1VIX A;  3HLP A;  3KR5 A;  3SJE A;  3KR4 A;  3ISZ A;  1TKH A;  3KI9 A;  4NGQ A;  4OID A;  2I3C A;  1HDQ A;  2PIZ A;  2PJ4 A;  4P4E A;  4WWV A;  4NGR A;  3KHZ A;  5JM6 A;  3WT4 A;  3B3W A;  2WYR A;  4B6Z A;  5DS0 A;  3MRU A;  1LFW A;  3PB8 X;  1Z2L A;  4PPZ A;  3BHX A;  4ZY2 A;  3PB9 X;  2AFU A;  3D4U A;  1QQ9 A;  2PJC A;  3PB7 X;  5LYD A;  4MCP A;  1AYE A;  4NGN A;  3B35 A;  1CBX A;  3PBE A;  2O53 A;  3B3C A;  2OR4 A;  2JBK A;  4OC5 A;  4OC2 A;  1ZLI A;  1TKF A;  3PBB A;  4KSI A;  2PRQ A;  1F57 A;  4R6T A;  2RFH A;  4OC3 A;  3VH9 A;  3D7D A;  1BPN A;  4FAI A;  4PXC A;  2HB6 A;  5ELY A;  2EWB A;  5K8N A;  1ARM A;  2PJ5 A;  3IO1 A;  2V77 A;  5LRJ A;  1OBR A;  3KL9 A;  7CPA A;  2J9A A;  2ZEO A;  2G9D A;  4OP4 A;  1LAM A;  2PCU A;  1Q7L A;  2GRE A;  3WAB A;  3TC8 A;  4ZY1 A;  2PJB A;  3KQX A;  3K2K A;  4MHP A;  2IQ6 A;  4NGT A;  3GLJ A;  4X8I A;  2ZEE A;  1PYT B;  1TF9 A;  2IMO A;  3WC7 A;  1IY7 A;  2PJA A;  1PCA A;  8CPA A;  3B3V A;  4DUK A;  5CBM A;  4MHY A;  2GLJ A;  2ZEM A;  4EFD A;  1YW6 A;  3FF3 A;  4NGM A;  1XJO A;  2V8V A;  3S9L A;  3I1U A;  3WC5 A;  4OC1 A;  3B3T A;  3VAR A;  1YME A;  5HXD A;  3GUX A;  2O4H A;  4F9U A;  3PRT A;  2Q4Z A;  3SI0 A;  1Y0Y A;  2AFS A;  4OIW A;  4P4I A;  1RTQ A;  2NYQ A;  4JZ0 A;  5D29 A;  4CPA A;  5LYF A;  2EK9 A;  2PJ2 A;  3D67 A;  1QMU A;  2C1C A;  1LAP A;  1TF8 A;  4A37 A;  4UEF A;  5HVF A;  4UIA A;  1ZG7 A;  1H8L A;  3FEE A;  4Q7A A;  1ZG9 A;  2JEW A;  2ZED A;  6CPA A;  2C6P A;  1ZLH A;  2BOA A;  5K8M A;  1FT7 A;  3JRU A;  2ZEG A;  3RBU A;  2PVV A;  4UEZ A;  3VAT A;  1ZG8 A;  3D7F A;  2XEF A;  1ARL A;  3PB4 X;  2V8D A;  3NH5 A;  2PJ1 A;  4H2K A;  5IB9 A;  2RB7 A;  1CP7 A;  2OOT A;  4EWT A;  3SJG A;  2BO9 A;  4MCS A;  3KQZ A;  4PXE A;  1Y7E A;  3D66 A;  1M4L A;  1CX8 A;  2ZOF A;  5LRK A;  2AFM A;  1NSA A;  4NGS A;  2V8H A;  1EE3 P;  1YLO A;  3BI1 A;  2HC9 A;  4R8F A;  4MHN A;  3KGQ A;  4R76 A;  3LWU A;  3IJ3 A;  5K8O A;  3MN8 A;  2XEI A;  3ISX A;  5LYI A;  3CPX A;  4MCR A;  4X2T A;  4P6Y A;  4G1P A;  4UF4 A;  4FBE A;  2PJ8 A;  4K3N A;  1XFO A;  4P4D A;  3B7I A;  4ZY0 A;  5I4M A;  5D8N A;  3DGV A;  2PIY A;  3RZA A;  4NGP A;  2DEA A;  4P45 A;  2V8G A;  4P44 A;  4NJR A;  2C6C A;  4NJQ A;  1LAN A;  1UWY A;  3IIB A;  3SI1 A;  3TX8 A;  1CPX A;  2Q51 A;  4OC0 A;  4PQA A;  2PJ0 A;  2AFW A;  1CP6 A;  1HEE A;  5CPA A;  5LRG A;  2F7V A;  3BXM A;  1KWM A;  4A94 A;  4DJL A;  4ZX8 A;  5LYL A;  3SI2 A;  5HVH A;  3NFZ A;  5K8P A;  3PEI A;  2PJ6 A;  3BI0 A;  2GLF A;  3H8G A;  3S9N A;  2ZOG A;  3CDX A;  4PXB A;  4OKO A;  3N5F A;  3H8E A;  5THW A;  3FEC A;  3WC6 A;  1R43 A;  4DYO A;  4IK2 A;  3D68 A;  3D7H A;  2CTC A;  4RUH A;  2IJZ A;  4ZX9 A;  4P4B A;  4MCQ A;  4OME A;  2PJ7 A;  2ANP A;  1BPM A;  4MHZ A;  3V7Z A;  2JBJ A;  2POK A;  1F2O A;  3FVL A;  2PVW A;  1IGB A;  2ZEP A;  2ZEF A;  2AFO A;  1VHE A;  4F9V A;  2ZEL A;  2BCO A;  1TKJ A;  3FH4 A;  3IFE A;  2FVG A;  3S9M A; 
#chains in the Genus database with same CATH topology
 2ZEH A;  1QST A;  4LQG A;  2WZN A;  4C7I A;  4YU9 A;  3FJU A;  4PK3 A;  4UFV A;  2ZW5 A;  4BD9 A;  1JQG A;  1Z4R A;  1LCP A;  4F8Z A;  4UEE A;  2BEI A;  3KZW A;  3H8F A;  3PFO A;  1IB1 E;  1XRY A;  2CTB A;  2Q4Y A;  4ONW A;  4KOX A;  3FED A;  4B5P A;  3L2N A;  4CGP A;  4CYQ A;  1GYT A;  1R3N A;  2GU2 A;  2XEJ A;  4WJB A;  2F8H A;  3BJ7 A;  1YSJ A;  1ELL P;  3T8W A;  2K5T A;  2IL4 A;  1YW4 A;  3H5Z A;  1S7F A;  3G8W A;  3TO7 A;  1XMB A;  1M4G A;  2CF4 A;  3B3S A;  2QYV A;  1UFH A;  3A9L A;  3QAY A;  1TIQ A;  1S7N A;  3NH8 A;  3DDD A;  4CGN A;  1S5K A;  1AMP A;  1RO5 A;  5KTD A;  4FWU A;  2VL1 A;  4BIN A;  1GHE A;  1DTD A;  5HVG A;  4KOY A;  2FS5 A;  1Z5R A;  3D8P A;  3FMC A;  3JTK A;  1XBU A;  3NH4 A;  4EME A;  5JH9 A;  1TXR A;  3KHX A;  4NFR A;  4YWY A;  4YGO A;  4FD5 A;  4M3S A;  2ABZ A;  1X12 A;  4F9V A;  2VXK A;  3R9E A;  3T9Y A;  4KSF A;  4ZYQ A;  2YNC A;  3KKW A;  1LOK A;  2HUZ A;  4KOS A;  3CT9 A;  3D7G A;  4X3R A;  4A38 A;  3CXQ A;  4B14 A;  1F2P A;  1FNO A;  2O28 A;  3V38 A;  3W6S A;  4CAX A;  2KCW A;  2GAN A;  4W9Y A;  4IAV A;  2EK8 A;  5A27 A;  3C26 A;  2I79 A;  1CJW A;  3H4Q A;  3P2F A;  5CNP A;  3PFE A;  4LX9 A;  3IU2 A;  4P4F A;  4KUA A;  3SJF A;  4B12 A;  2P0W A;  1PUA A;  2FL4 A;  1OZP A;  3LMS A;  2PE3 A;  4GM5 A;  4A39 A;  3VWE A;  2EBJ A;  3B2Y A;  5C82 A;  5F46 A;  4QB9 A;  1HDU A;  4PXD A;  3IEH A;  2FSR A;  2PDO A;  4L89 A;  2PR8 A;  4H89 A;  2XEG A;  2F5I A;  1DE4 C;  4MRI A;  4UIB A;  2G3T A;  3GB0 A;  4JYW A;  3SJX A;  1BO4 A;  4MFK A;  1IU8 A;  1VGY A;  2OZH A;  4Z65 A;  3QNV A;  4II9 A;  3K9T A;  1P4N A;  4PV6 A;  4ZI6 A;  3S6G A;  2QJ8 A;  1Z8L A;  1Y0R A;  5F48 A;  4C68 A;  3I3G A;  1IYL A;  2PQ8 A;  4MY0 A;  1VHO A;  4UFX A;  3I9S A;  2ZEN A;  3DLJ A;  2QVP A;  1AUG A;  5F09 A;  1K4J A;  1WWZ A;  2DPT A;  4CYN A;  4QBJ A;  1I12 A;  1ELM P;  2AFZ A;  3KAS A;  4KVX A;  4MMO A;  4CAW A;  5JGF A;  3PGP A;  1NE9 A;  3NA6 A;  4JWP A;  2WPW A;  4Q38 A;  3CPA A;  4UBR A;  3ZJ0 A;  4DNC A;  1BAV A;  2P6G A;  2HQY A;  1CG2 A;  4CAF A;  3HUV A;  1Q2D A;  1I1D A;  3IWW A;  4OC4 A;  4TWE A;  2NSM A;  2Z0Z A;  5IB0 A;  3D3S A;  5BWA B;  4MHD A;  5KTA A;  5J1Q A;  4MBU A;  4FUU A;  4NEX A;  2CIJ A;  5AG4 A;  2QIR A;  1M4D A;  4P10 A;  4UCM A;  4AXV A;  4P4J A;  1A2Z A;  3IC1 A;  2PJ9 A;  1BLL E;  2PJ3 A;  3RAM A;  4B11 A;  2Z3K A;  4BBH A;  3PB6 X;  2C6G A;  4R7M A;  2AFX A;  4IHM A;  1IOI A;  4RS2 A;  4MI4 A;  4O23 A;  3FX6 A;  4TNU A;  4EVY A;  1CPS A;  3RYO A;  2R98 A;  4MXU A;  2Q43 A;  1VIX A;  2Q7S A;  2CNS A;  3HLP A;  4H6U A;  3KR5 A;  3SJE A;  3KR4 A;  3ISZ A;  3DR6 A;  3R9F A;  5F47 A;  1IID A;  1I21 A;  1TKH A;  2R8V A;  3D2P A;  3KI9 A;  4NGQ A;  4OID A;  2I3C A;  4GXH A;  2ODF A;  2PC1 A;  5ISV A;  1HDQ A;  2DXQ A;  2C27 A;  2HV2 A;  2PJ4 A;  2PIZ A;  3BJ8 A;  4P4E A;  4WWV A;  4M6G A;  2I00 A;  4NGR A;  3PP9 A;  3KHZ A;  4A31 A;  1NMT A;  3F5B A;  5JM6 A;  3WT4 A;  3FYN A;  1IYK A;  3B3W A;  4RN7 A;  2WYR A;  5F49 A;  4B6Z A;  5DS0 A;  3MRU A;  1LFW A;  1XEB A;  4UA3 A;  3PB8 X;  1Z2L A;  2VZZ A;  4M85 A;  4E0A A;  1XOV A;  4PPZ A;  3BHX A;  3W91 A;  4ZY2 A;  4C7H A;  4AG7 A;  4F0Y A;  3PB9 X;  4HPS A;  5IX3 A;  3EFA A;  2AFU A;  3D4U A;  1QQ9 A;  1YLE A;  2YNE A;  3B8G A;  3R1K A;  4KVO E;  2PJC A;  1J4J A;  3PB7 X;  5G20 A;  5LYD A;  4ZGY B;  4MCP A;  1KUX A;  4MJ8 A;  4NXY A;  1AYE A;  2OZU A;  2Z3M A;  2Z10 A;  4M6H A;  4NGN A;  2R7H A;  3B35 A;  1CBX A;  1QSM A;  1XF8 A;  1Y7R A;  3PBE A;  3CXP A;  4GS4 A;  2G3A A;  3OWC A;  2VZY A;  5EMI A;  3TO6 A;  4BMH A;  2OH1 A;  1YGH A;  1QSN A;  3GYA A;  2O53 A;  5E96 A;  3B3C A;  3RO0 A;  3CXS A;  3QB8 A;  2OR4 A;  3F0A A;  5I0C A;  2JBK A;  2AE6 A;  4F0X A;  4Q36 A;  1X10 A;  2RC4 A;  2J8M A;  4OC5 A;  4OC2 A;  1ZLI A;  1TKF A;  3PBB A;  4KSI A;  4A33 A;  2Q44 A;  1KZF A;  2REE A;  1ON0 A;  2B5G B;  3ZZI A;  2PRQ A;  1F57 A;  4MFZ A;  5JPH A;  2YGW A;  4CS0 B;  4R6T A;  2RFH A;  5AG7 A;  4OC3 A;  1S7K A;  3TOA A;  4E2A A;  5C88 A;  4HNW B;  3VH9 A;  1M4I A;  3D7D A;  3TT2 A;  3SXN A;  5A28 A;  1BPN A;  4JLY A;  4I49 A;  4MY3 A;  4FAI A;  1Z4E A;  3MGD A;  4PXC A;  2HB6 A;  1YVK A;  2GFQ A;  2EWB A;  1ZO0 A;  5ELY A;  5K8N A;  5G22 A;  1S60 A;  2NMT A;  4FD6 A;  4HKF A;  2YND A;  3UY5 A;  2B4B A;  5GCN A;  2CY2 A;  1ARM A;  1Q2C A;  2JDC A;  2PJ5 A;  4B5O A;  4IF5 A;  3IO1 A;  2Q04 A;  4MFJ A;  2V77 A;  3IGR A;  2ZW6 A;  3GIU A;  4OAE A;  2EO8 A;  3FIX A;  5DWN A;  3N7Z A;  5LRJ A;  4IUS A;  1OBR A;  4AG9 A;  3KL9 A;  4RI1 A;  2Q4V A;  7CPA A;  1JWQ A;  2J9A A;  2ZEO A;  1MJA A;  2G9D A;  4OP4 A;  2P6F A;  4UFW A;  1YR0 A;  1LAM A;  2PCU A;  2Z11 A;  3R9G A;  2J8R A;  3NE7 A;  1XMT A;  2QML A;  2CNM A;  1MK4 A;  3FRM A;  4ONU A;  1S7L A;  1Q7L A;  2GRE A;  3WAB A;  2Z3P A;  3TC8 A;  4ZY1 A;  4KZT A;  3D2M A;  4PSW A;  4QC6 A;  1NSL A;  4B13 A;  4U9Z A;  2PJB A;  4UWJ A;  3KQX A;  2PSW A;  3K2K A;  4FD4 A;  1YQE A;  2IQ6 A;  4MHP A;  2OZG A;  2ZXV A;  3GLJ A;  2ZEE A;  4NGT A;  4X8I A;  3S6H A;  4B5P B;  3R96 A;  1PYT B;  1TF9 A;  2IMO A;  3BLN A;  4A32 A;  1BOB A;  4KOV A;  1YX0 A;  3T90 A;  4XPK A;  4J3G A;  3QAH A;  3S6K A;  3WC7 A;  1Z8X A;  3PZJ A;  1IY7 A;  2PJA A;  1PCA A;  8CPA A;  3B3V A;  4KOU A;  4DUK A;  2ZW7 A;  1KUY A;  5H84 A;  4CGM A;  3TTH A;  5CBM A;  4MHY A;  2CNT A;  2GLJ A;  4OLL A;  2ZEM A;  2Z3O A;  4EFD A;  1YW6 A;  3FF3 A;  4NGM A;  1XJO A;  2V8V A;  2GIV A;  1L0C A;  4UCP A;  3S9L A;  3I1U A;  3WC5 A;  1S3Z A;  2FCK A;  3B3T A;  4OC1 A;  3VAR A;  1YME A;  5HXD A;  3GUX A;  5EC4 A;  3SXO A;  2WPX A;  4KVM E;  2D4O A;  4A30 A;  2O4H A;  4XNH C;  4F9U A;  3PRT A;  2ARH A;  2Q4Z A;  4NCZ A;  3SI0 A;  1IOF A;  1Y0Y A;  1KUV A;  2AFS A;  4OIW A;  1RTQ A;  2NYQ A;  4JZ0 A;  4P4I A;  2CXA A;  5D29 A;  2B58 A;  3IWE A;  5DWM A;  3TO9 A;  4CPA A;  1Y9K A;  5LYF A;  2EK9 A;  4X5K A;  2PJ2 A;  4L8A A;  2B5G A;  4FD7 A;  3D67 A;  2QEC A;  1QMU A;  2YNC C;  4CRZ B;  4KLW A;  4AB7 A;  3R95 A;  3S6F A;  4UCN A;  5IV0 A;  2C1C A;  1LAP A;  1TF8 A;  3IU1 A;  4A37 A;  4UEF A;  5HVF A;  4H6Z A;  1FY7 A;  2REF A;  2ATR A;  4YRH A;  2BSW A;  2JLM A;  4ORF A;  4UIA A;  1ZG7 A;  3GKR A;  4C2Y A;  1H8L A;  3FEE A;  4U9Y A;  4Q7A A;  1ZG9 A;  2JEW A;  2ZED A;  2JDD A;  6CPA A;  1VHS A;  2C6P A;  3W6X A;  1MJ9 A;  2FE7 A;  1ZLH A;  2B4D B;  4OAD A;  4PSX A;  1M1D A;  2BOA A;  5K8M A;  2Q0Y A;  2B3V A;  1FT7 A;  3JRU A;  1Z9U A;  1RXT A;  2ZEG A;  3RBU A;  2PVV A;  4QUS A;  4UEZ A;  4U5Y A;  1ZG8 A;  3VAT A;  3D7F A;  2XEF A;  4MFL A;  3RNZ A;  4KOT A;  4ZBG A;  5J8C A;  4AVC A;  1ARL A;  1CM0 A;  3PB4 X;  3TFY A;  4AVA A;  2V8D A;  1YK3 A;  2A4N A;  3NH5 A;  2PJ1 A;  4H2K A;  4CAV A;  4M6I A;  2FT0 A;  5IB9 A;  2RB7 A;  1CP7 A;  4C2Z A;  2DPS A;  3VWD A;  2OB0 A;  4CRY B;  1YRE A;  2EUI A;  2FIA A;  2OOT A;  2PRB A;  4EWT A;  3SJG A;  2BO9 A;  4MCS A;  3FBU A;  3KQZ A;  4PK2 A;  1XE4 A;  4PXE A;  1Y7E A;  3D66 A;  1M4L A;  2AJ6 A;  4R9M A;  2J8N A;  2H5M A;  3G3S A;  1XIX A;  1CX8 A;  2ZOF A;  4LUA A;  2VQY A;  1B6B A;  4CGO A;  2AFM A;  5LRK A;  4KSA A;  4E8O A;  3CZX A;  3FXT A;  1NSA A;  4UWI A;  2D4P A;  4NGS A;  2V8H A;  4QVT A;  5H86 A;  3EY5 A;  4CGL A;  4Y49 B;  5G21 A;  1EE3 P;  3E0K A;  2Q7B A;  4CAE A;  4JD6 A;  1YLO A;  3BI1 A;  2ZW4 A;  2HC9 A;  4NSQ A;  4R3L A;  4R8F A;  4MHN A;  1VKC A;  3KGQ A;  4NF1 A;  4Y49 C;  4R76 A;  3FB3 A;  3LWU A;  1YVO A;  2G0B A;  3IJ3 A;  4AVB A;  1M44 A;  5K8O A;  1U6M A;  3MN8 A;  5AG6 A;  2FIW A;  2PR1 A;  2XEI A;  3ISX A;  2P6E A;  2OU2 A;  5HH1 A;  4A95 A;  4MFQ A;  5LYI A;  3CPX A;  4F6A A;  4KLV A;  4MCR A;  3LAC A;  4X2T A;  4P6Y A;  1V0C A;  4G1P A;  4R3K A;  2Z3N A;  2B3U A;  4UF4 A;  4KOR A;  1Y9W A;  1MJB A;  2X7B A;  4HNX B;  2PJ8 A;  4K30 A;  4FBE A;  2BL1 A;  4A2Z A;  4K3N A;  3EO4 A;  1XFO A;  4C2X A;  3NE8 A;  4P4D A;  3B7I A;  4ZY0 A;  5I4M A;  5D8N A;  5J8F A;  3LD2 A;  3LOD A;  3DGV A;  2JEV A;  2PIY A;  2Y0M A;  3RZA A;  4NGP A;  4KOW A;  1N71 A;  2EVN A;  2DEA A;  4P45 A;  4CYP A;  2V8G A;  2B4D A;  5AGE A;  4P44 A;  4HNY B;  4NJR A;  2C6C A;  4NJQ A;  3IWG A;  1LAN A;  1UWY A;  3IIB A;  3SI1 A;  4XPD B;  4MFP A;  3TX8 A;  1PU9 A;  4B10 A;  1CPX A;  2Q51 A;  4OC0 A;  4PQA A;  2DF5 A;  2PJ0 A;  1P0H A;  3F8K A;  2AFW A;  1IIC A;  2R1I A;  4XNH B;  1CP6 A;  3DR8 A;  4XPD C;  1HEE A;  1Z8W A;  5CPA A;  5LRG A;  2F7V A;  3BXM A;  1KWM A;  4A94 A;  1Z8T A;  3DNS A;  4JJX A;  4ZX8 A;  4DJL A;  1SQH A;  3SI2 A;  1QSR A;  5JQ4 A;  1R57 A;  5LYL A;  3EC4 A;  3K9U A;  5HVH A;  1B87 A;  3NFZ A;  5K8P A;  3PEI A;  2WSA A;  2PJ6 A;  1LRZ A;  3BI0 A;  2GLF A;  3H8G A;  3S9N A;  2ZOG A;  3CDX A;  3V8I A;  4LQ6 A;  2VBQ A;  4PXB A;  3WR7 A;  4OKO A;  4R87 A;  3N5F A;  3H8E A;  5AG5 A;  5THW A;  3FEC A;  3WC6 A;  5EBV A;  5KTC A;  1R43 A;  3TE4 A;  4DYO A;  4IK2 A;  4CYO A;  3D68 A;  3EXN A;  4YFJ A;  3D7H A;  2CTC A;  3JUW A;  3FNC A;  4JXR A;  3SHP A;  4RUH A;  2IJZ A;  5HMN A;  4ZX9 A;  2WUU A;  4P4B A;  4MCQ A;  4XPL A;  4OME A;  2PJ7 A;  3TCV A;  3DSB A;  1QSO A;  4R57 A;  2ANP A;  4KS9 A;  1BPM A;  4MHZ A;  3V7Z A;  2JBJ A;  2Z3L A;  3JVN A;  2POK A;  5FVJ A;  1F2O A;  3FVL A;  2PVW A;  1IGB A;  2VEZ A;  4KUB A;  2BUE A;  1Q2Y A;  3P2H A;  2ZEP A;  1WK4 A;  2AFO A;  2ZEF A;  1VHE A;  3TOB A;  2GE3 A;  2ZEL A;  2ZPA A;  2BCO A;  1TKJ A;  3FH4 A;  3IFE A;  5G1Z A;  2FVG A;  3GY9 A;  4JXQ A;  3S9M A;  2VI7 A;  2FXF A; 
#chains in the Genus database with same CATH homology
 2ZEH A;  4LQG A;  2WZN A;  4YU9 A;  3FJU A;  4BD9 A;  1JQG A;  4F8Z A;  1LCP A;  4UEE A;  3KZW A;  3H8F A;  3PFO A;  1XRY A;  2CTB A;  4ONW A;  3FED A;  3L2N A;  1GYT A;  1R3N A;  2GU2 A;  2XEJ A;  4WJB A;  2F8H A;  3T8W A;  1YSJ A;  1ELL P;  1YW4 A;  1XMB A;  2CF4 A;  3B3S A;  2QYV A;  3NH8 A;  1AMP A;  4FWU A;  2VL1 A;  1DTD A;  5HVG A;  1Z5R A;  3FMC A;  1XBU A;  3NH4 A;  4EME A;  5JH9 A;  1TXR A;  3KHX A;  4NFR A;  4YWY A;  2ABZ A;  4ZYQ A;  1LOK A;  4X3R A;  3CT9 A;  3D7G A;  4A38 A;  1F2P A;  1FNO A;  3V38 A;  4W9Y A;  4IAV A;  2EK8 A;  3PFE A;  4P4F A;  3SJF A;  3LMS A;  4A39 A;  2PE3 A;  4GM5 A;  3B2Y A;  1HDU A;  4PXD A;  3IEH A;  2XEG A;  1DE4 C;  4MRI A;  4UIB A;  3GB0 A;  4JYW A;  3SJX A;  1VGY A;  4Z65 A;  3QNV A;  3K9T A;  4ZI6 A;  2QJ8 A;  1Z8L A;  1Y0R A;  1VHO A;  2ZEN A;  3DLJ A;  2QVP A;  5F09 A;  1ELM P;  2AFZ A;  3KAS A;  5JGF A;  4MMO A;  3NA6 A;  3CPA A;  1BAV A;  1CG2 A;  3HUV A;  3IWW A;  4OC4 A;  4TWE A;  2NSM A;  5J1Q A;  4FUU A;  2CIJ A;  4P10 A;  4AXV A;  4P4J A;  3IC1 A;  2PJ9 A;  1BLL E;  2PJ3 A;  3RAM A;  3PB6 X;  2C6G A;  4R7M A;  2AFX A;  4IHM A;  4O23 A;  3FX6 A;  4TNU A;  1CPS A;  4MXU A;  2Q43 A;  1VIX A;  3HLP A;  3KR5 A;  3SJE A;  3KR4 A;  3ISZ A;  1TKH A;  3KI9 A;  4NGQ A;  4OID A;  2I3C A;  1HDQ A;  2PIZ A;  2PJ4 A;  4P4E A;  4WWV A;  4NGR A;  3KHZ A;  5JM6 A;  3WT4 A;  3B3W A;  2WYR A;  4B6Z A;  5DS0 A;  3MRU A;  1LFW A;  3PB8 X;  1Z2L A;  4PPZ A;  3BHX A;  4ZY2 A;  3PB9 X;  2AFU A;  3D4U A;  1QQ9 A;  2PJC A;  3PB7 X;  5LYD A;  4MCP A;  1AYE A;  4NGN A;  3B35 A;  1CBX A;  3PBE A;  2O53 A;  3B3C A;  2OR4 A;  2JBK A;  4OC5 A;  4OC2 A;  1ZLI A;  1TKF A;  3PBB A;  4KSI A;  2PRQ A;  1F57 A;  4R6T A;  2RFH A;  4OC3 A;  3VH9 A;  3D7D A;  1BPN A;  4FAI A;  4PXC A;  2HB6 A;  5ELY A;  2EWB A;  5K8N A;  1ARM A;  2PJ5 A;  3IO1 A;  2V77 A;  5LRJ A;  1OBR A;  3KL9 A;  7CPA A;  2J9A A;  2ZEO A;  2G9D A;  4OP4 A;  1LAM A;  2PCU A;  1Q7L A;  2GRE A;  3WAB A;  3TC8 A;  4ZY1 A;  2PJB A;  3KQX A;  3K2K A;  4MHP A;  2IQ6 A;  4NGT A;  3GLJ A;  4X8I A;  2ZEE A;  1PYT B;  1TF9 A;  2IMO A;  3WC7 A;  1IY7 A;  2PJA A;  1PCA A;  8CPA A;  3B3V A;  4DUK A;  5CBM A;  4MHY A;  2GLJ A;  2ZEM A;  4EFD A;  1YW6 A;  3FF3 A;  4NGM A;  1XJO A;  2V8V A;  3S9L A;  3I1U A;  3WC5 A;  4OC1 A;  3B3T A;  3VAR A;  1YME A;  5HXD A;  3GUX A;  2O4H A;  4F9U A;  3PRT A;  2Q4Z A;  3SI0 A;  1Y0Y A;  2AFS A;  4OIW A;  4P4I A;  1RTQ A;  2NYQ A;  4JZ0 A;  5D29 A;  4CPA A;  5LYF A;  2EK9 A;  2PJ2 A;  3D67 A;  1QMU A;  2C1C A;  1LAP A;  1TF8 A;  4A37 A;  4UEF A;  5HVF A;  4UIA A;  1ZG7 A;  1H8L A;  3FEE A;  4Q7A A;  1ZG9 A;  2JEW A;  2ZED A;  6CPA A;  2C6P A;  1ZLH A;  2BOA A;  5K8M A;  1FT7 A;  3JRU A;  2ZEG A;  3RBU A;  2PVV A;  4UEZ A;  3VAT A;  1ZG8 A;  3D7F A;  2XEF A;  1ARL A;  3PB4 X;  2V8D A;  3NH5 A;  2PJ1 A;  4H2K A;  5IB9 A;  2RB7 A;  1CP7 A;  2OOT A;  4EWT A;  3SJG A;  2BO9 A;  4MCS A;  3KQZ A;  4PXE A;  1Y7E A;  3D66 A;  1M4L A;  1CX8 A;  2ZOF A;  5LRK A;  2AFM A;  1NSA A;  4NGS A;  2V8H A;  1EE3 P;  1YLO A;  3BI1 A;  2HC9 A;  4R8F A;  4MHN A;  3KGQ A;  4R76 A;  3LWU A;  3IJ3 A;  5K8O A;  3MN8 A;  2XEI A;  3ISX A;  5LYI A;  3CPX A;  4MCR A;  4X2T A;  4P6Y A;  4G1P A;  4UF4 A;  4FBE A;  2PJ8 A;  4K3N A;  1XFO A;  4P4D A;  3B7I A;  4ZY0 A;  5I4M A;  5D8N A;  3DGV A;  2PIY A;  3RZA A;  4NGP A;  2DEA A;  4P45 A;  2V8G A;  4P44 A;  4NJR A;  2C6C A;  4NJQ A;  1LAN A;  1UWY A;  3IIB A;  3SI1 A;  3TX8 A;  1CPX A;  2Q51 A;  4OC0 A;  4PQA A;  2PJ0 A;  2AFW A;  1CP6 A;  1HEE A;  5CPA A;  5LRG A;  2F7V A;  3BXM A;  1KWM A;  4A94 A;  4DJL A;  4ZX8 A;  5LYL A;  3SI2 A;  5HVH A;  3NFZ A;  5K8P A;  3PEI A;  2PJ6 A;  3BI0 A;  2GLF A;  3H8G A;  3S9N A;  2ZOG A;  3CDX A;  4PXB A;  4OKO A;  3N5F A;  3H8E A;  5THW A;  3FEC A;  3WC6 A;  1R43 A;  4DYO A;  4IK2 A;  3D68 A;  3D7H A;  2CTC A;  4RUH A;  2IJZ A;  4ZX9 A;  4P4B A;  4MCQ A;  4OME A;  2PJ7 A;  2ANP A;  1BPM A;  4MHZ A;  3V7Z A;  2JBJ A;  2POK A;  1F2O A;  3FVL A;  2PVW A;  1IGB A;  2ZEP A;  2ZEF A;  2AFO A;  1VHE A;  4F9V A;  2ZEL A;  2BCO A;  1TKJ A;  3FH4 A;  3IFE A;  2FVG A;  3S9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...