1TXRA

X-ray crystal structure of bestatin bound to aap
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spectroscopic and X-ray Crystallographic Characterization of Bestatin Bound to the Aminopeptidase from Aeromonas (Vibrio) proteolytica.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1txrA00
4ZY2A 4OIWA 5LYIA 4OC1A 3RBUA 3FX6A 1BPNA 4W9YA 1HDUA 3S9LA 2XEFA 4PXCA 5JH9A 3NH5A 3B3VA 3FVLA 1R43A 3DGVA 2DEAA 1PYTB 4H2KA 2O4HA 4P4IA 3LWUA 4MHZA 4Q7AA 4UIBA 1BLLE 3V7ZA 1QMUA 6CPAA 3FEDA 4P10A 4ZI6A 4P4FA 4A37A 2G9DA 2ZEGA 2PJ6A 1GYTA 3D68A 1IGBA 3JRUA 1FNOA 2VL1A 4NGNA 2F8HA 4DJLA 2PJ2A 3D7DA 3VARA 4OC0A 3T8WA 1Z2LA 2Q51A 3D66A 1Q7LA 4FBEA 2AFOA 1ELLP 2ZEDA 4FUUA 4DYOA 5ELYA 3SJFA 5K8MA 3ISZA 2QVPA 5F09A 1R3NA 4ZY0A 3B2YA 3FJUA 3IFEA 3TX8A 2ZEPA 3MRUA 5LRGA 3PB8X 1XFOA 2EWBA 4MRIA 4OP4A 4IK2A 3KR4A 3S9NA 3ISXA 4MHYA 2BO9A 1CPXA 4TWEA 4TNUA 2PVVA 1LCPA 4PXBA 3KASA 3DLJA 4RUHA 2O53A 2C6CA 2PJ7A 1HDQA 3BXMA 4UEZA 4MXUA 3CT9A 4IHMA 3KL9A 4P4JA 3SI2A 1VIXA 3IIBA 2PJBA 3V38A 3D4UA 2CTCA 2J9AA 5CPAA 3VH9A 4LQGA 4NGPA 4OC4A 3KR5A 4A39A 2AFWA 4IAVA 4OKOA 2XEIA 7CPAA 4K3NA 4A94A 1KWMA 4NGSA 3RAMA 3PBEA 2QJ8A 4UEEA 1OBRA 4KSIA 4MCPA 1IY7A 2PJ4A 3NFZA 4WJBA 3FF3A 2ZOGA 1H8LA 3RZAA 2FVGA 1ZG8A 3PB4X 4P45A 4A38A 4F9UA 1UWYA 4MMOA 4PPZA 3IJ3A 3FMCA 2XEJA 5LRKA 5K8OA 3K9TA 5IB9A 2PJ5A 1ELMP 2C1CA 2PIZA 1RTQA 3GUXA 1AMPA 3BHXA 2IMOA 2V77A 3B3CA 3B7IA 2PJ9A 2NSMA 2WZNA 3QNVA 3IC1A 4P4BA 3KHXA 3PB9X 4AXVA 4ONWA 2AFSA 1LFWA 5CBMA 5LYFA 1F2PA 3KQXA 3CPXA 2XEGA 2ZOFA 3KGQA 1FT7A 1Z8LA 2PRQA 2BCOA 3B3TA 2ZEEA 3H8FA 4ZY1A 2EK9A 1F2OA 4Z65A 2PJ0A 8CPAA 4YU9A 3B3WA 4OC5A 1ZLIA 3SJXA 1YW6A 2F7VA 5THWA 2GLFA 3IWWA 4UEFA 5DS0A 5HVHA 5LYDA 4YWYA 3H8EA 5JGFA 3BI0A 1EE3P 2PVWA 3PFEA 4MHPA 2EK8A 4MCQA 2IQ6A 4GM5A 2OOTA 2PJ1A 4P44A 2OR4A 4MHNA 4O23A 4CPAA 3WT4A 2CIJA 4NJRA 4WWVA 4NFRA 1ZG7A 2ZEHA 4NGRA 2V8GA 4NGTA 4R76A 4P4EA 3S9MA 1TKJA 1CG2A 4OIDA 3FECA 2C6GA 2AFUA 1LOKA 3KQZA 2POKA 2C6PA 2PJAA 2JEWA 3IEHA 1Y0YA 4JZ0A 2ABZA 3WABA 2PCUA 4X2TA 2PJCA 4NGQA 4OC3A 1CBXA 2GU2A 4G1PA 5HVFA 2V8DA 1LANA 1XMBA 2ANPA 3KHZA 3L2NA 1VHEA 3GLJA 3PB7X 1CP7A 1BAVA 5LYLA 4EMEA 2RFHA 5K8NA 3B3SA 1CPSA 1VGYA 4DUKA 4NJQA 2JBKA 1M4LA 1LAMA 1TF8A 3TC8A 1TKHA 2PJ3A 2ZEFA 3PRTA 2AFMA 4PXEA 2BOAA 4ZX8A 1TXRA 1DE4C 4R8FA 3SJGA 4FWUA 3LMSA 4P4DA 5D29A 4UF4A 5HVGA 1BPMA 2CTBA 4FAIA 3NH8A 1CP6A 3KZWA 4NGMA 4PQAA 2Q43A 1Y0RA 1ARMA 3PB6X 3NA6A 1YW4A 3CDXA 3PBBA 1XBUA 4PXDA 3IO1A 1AYEA 3D7HA 5D8NA 2ZEOA 3D7GA 1DTDA 1ZLHA 3CPAA 3H8GA 3WC7A 2V8HA 1CX8A 2HB6A 5I4MA 1ARLA 1Y7EA 2PJ8A 5JM6A 1HEEA 1YSJA 2PIYA 3D67A 3BI1A 4ZYQA 2ZELA 5J1QA 2IJZA 4OC2A 2CF4A 3GB0A 3SI0A 2RB7A 3KI9A 2V8VA 1VHOA 3VATA 2HC9A 3WC6A 4MCSA 2PE3A 1TF9A 4B6ZA 2ZEMA 2ZENA 3FH4A 5LRJA 4MCRA 1XRYA 3FEEA 1Z5RA 2GREA 1YMEA 3N5FA 3HLPA 3HUVA 1NSAA 2JBJA 1PCAA 4OMEA 4F8ZA 4F9VA 1LAPA 4P6YA 4EWTA 1ZG9A 4UIAA 1TKFA 3WC5A 2NYQA 3K2KA 3PFOA 5K8PA 3I1UA 2Q4ZA 4EFDA 2I3CA 3MN8A 1QQ9A 2AFXA 2AFZA 5HXDA 1JQGA 4X8IA 4R7MA 2WYRA 4R6TA 3SI1A 3NH4A 1YLOA 4X3RA 2QYVA 3D7FA 3B35A 4BD9A 1F57A 1XJOA 4ZX9A 3SJEA 3PEIA 2GLJA 4JYWA
chains in the Genus database with same CATH superfamily
4J3GA 4HPSA 1BO4A 3F5BA 3FIXA 4OIWA 4ZY2A 5LYIA 4OC1A 3RBUA 2PC1A 2KCWA 3FX6A 1BPNA 3G8WA 4XPKA 3IWEA 4KVXA 3D8PA 3LD2A 4W9YA 1XE4A 2BEIA 4CAEA 1HDUA 2ODFA 5J8FA 2QIRA 1Z9UA 4AG9A 3S9LA 1NMTA 2XEFA 2PR1A 4PXCA 5JH9A 4HNXB 3NH5A 3S6HA 3B3VA 1M44A 3FVLA 4X5KA 1R43A 4YFJA 3DGVA 1V0CA 2B4DB 4K30A 4OLLA 2DEAA 1PYTB 2G3AA 3QAHA 4MHDA 3TT2A 4H2KA 2O4HA 3TO7A 2VBQA 4KOSA 3LWUA 4MHZA 4P4IA 4Q7AA 4XNHC 4UIBA 1BLLE 3V7ZA 1QMUA 1KUVA 1KUYA 6CPAA 3FEDA 3I3GA 4P10A 5H86A 3SHPA 4B5PB 2YNDA 4ZI6A 2FT0A 1CJWA 4CGMA 4AVAA 3EO4A 4PSXA 4P4FA 4A95A 4A37A 5HMNA 2G9DA 2ZEGA 2PJ6A 1GYTA 3D68A 1IGBA 3JRUA 1YR0A 3W6XA 4IUSA 1FNOA 2VL1A 2Z10A 5EMIA 4NGNA 2B3UA 2F8HA 1YGHA 4AVBA 1B6BA 3R9GA 4DJLA 3TTHA 2G3TA 2D4PA 3TO6A 2PJ2A 2B58A 3D7DA 3VARA 5IX3A 4OC0A 3CXSA 2IL4A 3PZJA 1ZO0A 3ZZIA 4MY3A 4LX9A 3T8WA 4QVTA 1Z2LA 2Q7SA 2Q51A 3N7ZA 3NE7A 5IV0A 4R87A 2Q4VA 1YQEA 3D66A 4MBUA 1Q7LA 4FBEA 2VZYA 2K5TA 3WR7A 2AFOA 1YX0A 3VWEA 1ELLP 5DWNA 3R1KA 2ZEDA 5JPHA 4B5OA 5ISVA 4FUUA 4UCMA 5F47A 4DYOA 5ELYA 1UFHA 3SJFA 5K8MA 4II9A 3ISZA 2FIAA 2QVPA 4U9YA 5F09A 1R3NA 4ZY0A 3B2YA 4UBRA 3JUWA 4DNCA 1I1DA 3FJUA 3IFEA 3TX8A 2ZEPA 3MRUA 5LRGA 4KUAA 3PB8X 1WK4A 4JD6A 3DR6A 4KSAA 1XFOA 4RI1A 2ZW6A 4CYQA 2A4NA 3MGDA 4KVOE 2EWBA 4MRIA 4F0YA 3UY5A 1YK3A 4U9ZA 3JTKA 4IK2A 4OP4A 2FE7A 3KR4A 3S9NA 3ISXA 4MHYA 3NE8A 4XPDC 3LODA 2J8NA 4CAXA 2BO9A 1CPXA 4ORFA 3SXNA 4TWEA 3VWDA 4TNUA 1XOVA 2PDOA 5BWAB 2PVVA 3EXNA 3E0KA 1KUXA 1LCPA 4FD6A 2R7HA 4PXBA 3FRMA 3KASA 3DLJA 2OZUA 4UFXA 4RUHA 2ATRA 2O53A 4FD5A 2C6CA 2PJ7A 2JDCA 1HDQA 1QSTA 3BXMA 4UEZA 1MJ9A 4MXUA 3EFAA 2Q0YA 2BUEA 3CT9A 4IHMA 3KL9A 1S5KA 4PK3A 4P4JA 3SI2A 1Y9KA 2OZGA 3EY5A 1VIXA 3R95A 1YLEA 4R9MA 3IIBA 2PJBA 3V38A 3D4UA 3DDDA 2CTCA 2J9AA 4AB7A 4CGLA 4UFWA 5CPAA 3VH9A 4YRHA 1Q2YA 5G1ZA 4AG7A 4LQGA 4NGPA 3W91A 5JQ4A 2EO8A 5I0CA 4OC4A 4UCNA 3KR5A 4UFVA 4A39A 2YGWA 2AFWA 4IAVA 2DF5A 2H5MA 3FXTA 5KTDA 4M6HA 4OKOA 2XEIA 1Z8XA 2PSWA 1XEBA 2QMLA 2YNCC 3GIUA 4K3NA 2QECA 4KSFA 4A94A 1KWMA 2Z3LA 4BBHA 3H5ZA 4NGSA 4C7HA 3RAMA 3PBEA 2QJ8A 4NF1A 4UEEA 3TOAA 3R9FA 5KTCA 1Q2DA 4C2YA 1OBRA 3F0AA 4KSIA 2P0WA 2PJ4A 1IY7A 4MCPA 4JYWA 2DPTA 3NFZA 4MFLA 4KOXA 5F48A 2REEA 2ZXVA 4KZTA 4WJBA 4FD4A 2B3VA 3FF3A 4C7IA 4I49A 5C82A 1S7LA 5GCNA 1K4JA 2ZOGA 1P4NA 4LQ6A 1H8LA 4R3KA 3RZAA 3IU2A 2FVGA 1ZG8A 3PB4X 4P45A 2PQ8A 4A38A 1JWQA 4F9UA 3JVNA 2FS5A 2GFQA 1UWYA 4C2XA 4MMOA 3V8IA 1Q2CA 1S3ZA 3G3SA 3GKRA 4PPZA 3IJ3A 4M6IA 4MI4A 3F8KA 3FMCA 2XEJA 5LRKA 2OB0A 5K8OA 3K9TA 4MY0A 1M4DA 5IB9A 2PJ5A 1ELMP 2C1CA 4C2ZA 2PIZA 1RTQA 1IU8A 3GY9A 1Z8TA 4CGPA 3GUXA 1AMPA 3BHXA 4NCZA 2IMOA 5EBVA 4A2ZA 2V77A 4GXHA 1IICA 3B3CA 3B7IA 4KUBA 2Q44A 4CYOA 2PJ9A 2NSMA 2WZNA 2Z0ZA 3QNVA 1RXTA 3W6SA 5C88A 2FCKA 4Y49C 2FSRA 3IC1A 3KHXA 4P4BA 1AUGA 1P0HA 4CAWA 3PB9X 4AXVA 4ONWA 4H89A 2AFSA 5DWMA 3S6GA 2WUUA 4KOVA 1LFWA 1XF8A 5CBMA 5LYFA 1F2PA 3KQXA 3CPXA 3T9YA 3BJ8A 2REFA 2XEGA 2ZOFA 3KGQA 1FT7A 4B13A 1IIDA 1LRZA 1Z8LA 1VKCA 2PRQA 2BCOA 2R1IA 3A9LA 2ZEEA 3B3TA 3BJ7A 2EK9A 3H8FA 2ZPAA 4Q36A 4CGOA 4ZY1A 1F2OA 4Z65A 3SXOA 2BSWA 2VXKA 2PJ0A 5IB0A 4CPAA 8CPAA 4CAVA 3I9SA 3FNCA 3B3WA 4YU9A 1ZLIA 4OC5A 3SJXA 4F6AA 1YW6A 2F7VA 2PR8A 2Q4YA 3TCVA 5THWA 2GLFA 3IWWA 3DR8A 4UEFA 4UCPA 5DS0A 4ZBGA 1B87A 3D3SA 1I21A 3KKWA 5LYDA 3K9UA 3H8EA 4YWYA 5HVHA 2FXFA 5JGFA 1M1DA 1IOIA 1QSRA 1XIXA 2GANA 1NSLA 2O28A 3D2PA 3BI0A 1EE3P 5E96A 4CYPA 4B5PA 3P2FA 2J8MA 2PVWA 3PFEA 4HNWB 4L8AA 4MHPA 2EK8A 5AGEA 4MCQA 2IQ6A 3RNZA 3H4QA 2CNMA 4GM5A 5G22A 1IYLA 3IWGA 2PJ1A 3C26A 4P44A 4Y49B 3FBUA 2OOTA 2OR4A 4MHNA 4O23A 4MJ8A 4NXYA 5CNPA 2CIJA 4NJRA 4WWVA 2Q7BA 3WT4A 1L0CA 4HKFA 4JWPA 4NFRA 1ZG7A 2ZEHA 4NGRA 2Z3OA 2Q04A 1MJAA 2V8GA 2EUIA 2G0BA 1TIQA 4NGTA 4CRZB 4R76A 4P4EA 3S9MA 4UWJA 3TO9A 1TKJA 1CG2A 4KORA 4RS2A 2ZW7A 3BLNA 2VEZA 4OIDA 3FECA 2C6GA 2AFUA 2WSAA 4CS0B 1LOKA 4PSWA 5G20A 2NMTA 3KQZA 4YGOA 2POKA 3IU1A 1YVKA 2CNSA 3IGRA 3CXPA 2C6PA 2PJAA 2JEWA 4MFPA 2JDDA 2Z11A 3IEHA 1Y0YA 4JZ0A 2ABZA 3WABA 2PCUA 4X2TA 2PJCA 4NGQA 4OC3A 7CPAA 1CBXA 1YREA 4M3SA 2GU2A 4G1PA 1IYKA 5HVFA 2V8DA 1LANA 4B12A 1XMBA 2ANPA 2PRBA 3KHZA 3L2NA 1VHEA 2AJ6A 2VQYA 3GLJA 4NSQA 3PB7X 4KLVA 3R96A 3T90A 1CP7A 1BAVA 1PUAA 1WWZA 5LYLA 4RN7A 3S6KA 4EMEA 2RFHA 4A33A 4A30A 5K8NA 5A28A 5F49A 4CYNA 3TOBA 1VHSA 1YVOA 1ON0A 3B3SA 3QB8A 4MFZA 1CPSA 1VGYA 3RO0A 4DUKA 4NJQA 2JBKA 1M4LA 1LAMA 1TF8A 3TC8A 1TKHA 2PJ3A 1Z8WA 2AE6A 2ZEFA 3PRTA 1R57A 4L89A 4XPLA 2AFMA 4PXEA 2BOAA 4ZX8A 1TXRA 1DE4C 1OZPA 2CY2A 2ARHA 4R8FA 1Y9WA 3SJGA 4FWUA 5J8CA 4MFJA 3CXQA 3DSBA 2C27A 2F5IA 2HV2A 4JJXA 3LMSA 3QAYA 4P4DA 3B8GA 2OU2A 4QBJA 5D29A 4UF4A 2ZW4A 4B11A 2R8VA 3LACA 5HVGA 1BPMA 2CTBA 1MK4A 4UWIA 4LUAA 4FAIA 5A27A 5H84A 1CP6A 2BL1A 4B14A 5HH1A 3KZWA 4R57A 1QSNA 1FY7A 4NGMA 4PQAA 2Q43A 1Y0RA 4R3LA 4AVCA 1ARMA 4C68A 1M4GA 1PU9A 3PB6X 1IB1E 2Z3MA 3NA6A 4A32A 1YW4A 1MJBA 3CDXA 4PV6A 4BMHA 3D2MA 3PBBA 4EVYA 2OH1A 4KVME 1Y7RA 4OADA 4B10A 1XBUA 2Z3PA 4PXDA 4XPDB 3IO1A 1AYEA 3D7HA 5D8NA 2ZEOA 3D7GA 1J4JA 4KOTA 1DTDA 1ZLHA 4JLYA 3CPAA 5KTAA 3H8GA 4CGNA 1Z4RA 3WC7A 2V8HA 3EC4A 4QUSA 1CX8A 1U6MA 1QSMA 2HB6A 3RYOA 5I4MA 4E0AA 1ARLA 1Y7EA 2PJ8A 5FVJA 5JM6A 1CM0A 1HEEA 2J8RA 1YSJA 2PIYA 3D67A 2B4DA 4GS4A 2B5GB 3BI1A 4JXRA 4ZYQA 2ZELA 5J1QA 2CXAA 4ZGYB 3ZJ0A 4OAEA 1Z4EA 2IJZA 4OC2A 2EVNA 4A31A 4MFQA 4HNYB 2CF4A 4CAFA 3GB0A 3DNSA 3SI0A 1NE9A 2RB7A 3KI9A 2V8VA 1VHOA 3VATA 4M6GA 1S7FA 2HC9A 2D4OA 2R98A 4MCSA 3WC6A 2DXQA 2P6FA 2I00A 2PE3A 4UA3A 1TF9A 3TE4A 2I79A 3FYNA 3OWCA 2ZW5A 4E8OA 2FIWA 4B6ZA 3FB3A 2ZEMA 2ZENA 4QB9A 3FH4A 2WPXA 4KOUA 1X12A 4CRYB 5LRJA 4MCRA 1X10A 4PK2A 1XRYA 4KOYA 3FEEA 3PP9A 1Z5RA 1SQHA 2P6GA 4ONUA 2GREA 1YMEA 2X7BA 3HLPA 3N5FA 4E2AA 1BOBA 1XMTA 2GIVA 3HUVA 2WPWA 3PGPA 1NSAA 1KZFA 2JBJA 1A2ZA 1PCAA 2EBJA 4JXQA 4KOWA 4NEXA 4OMEA 2Z3NA 4F8ZA 4F9VA 1LAPA 1N71A 2YNEA 2Z3KA 2HQYA 1M4IA 4KLWA 4P6YA 4EWTA 1ZG9A 4UIAA 4XNHB 1TKFA 4QC6A 3WC5A 2NYQA 3K2KA 3PFOA 5AG4A 4H6UA 2OZHA 1RO5A 5EC4A 2B4BA 2RC4A 1QSOA 3I1UA 5K8PA 4KS9A 2Q4ZA 4EFDA 1GHEA 1I12A 2I3CA 2Y0MA 4U5YA 4FD7A 2YNCA 3MN8A 1QQ9A 2AFXA 2DPSA 2JLMA 2AFZA 4Q38A 5AG6A 1IOFA 5HXDA 3GYAA 1JQGA 4X8IA 5F46A 5AG7A 2JEVA 4R7MA 2VI7A 2WYRA 2HUZA 4BINA 4R6TA 3SI1A 3NH4A 1YLOA 4H6ZA 4X3RA 2GE3A 2QYVA 3TFYA 3CZXA 1S7NA 2VZZA 3D7FA 3B35A 2B5GA 5AG5A 4BD9A 2FL4A 5G21A 1S60A 1F57A 4MFKA 1XJOA 1S7KA 2P6EA 3R9EA 4ZX9A 4M85A 3S6FA 3SJEA 4F0XA 2CNTA 3PEIA 3P2HA 4IF5A 2GLJA 3NH8A
chains in the Genus database with same CATH topology
4ZY2A 4OIWA 5LYIA 4OC1A 3RBUA 3FX6A 1BPNA 4W9YA 1HDUA 3S9LA 2XEFA 4PXCA 5JH9A 3NH5A 3B3VA 3FVLA 1R43A 3DGVA 2DEAA 1PYTB 4H2KA 2O4HA 4P4IA 3LWUA 4MHZA 4Q7AA 4UIBA 1BLLE 3V7ZA 1QMUA 6CPAA 3FEDA 4P10A 4ZI6A 4P4FA 4A37A 2G9DA 2ZEGA 2PJ6A 1GYTA 3D68A 1IGBA 3JRUA 1FNOA 2VL1A 4NGNA 2F8HA 4DJLA 2PJ2A 3D7DA 3VARA 4OC0A 3T8WA 1Z2LA 2Q51A 3D66A 1Q7LA 4FBEA 2AFOA 1ELLP 2ZEDA 4FUUA 4DYOA 5ELYA 3SJFA 5K8MA 3ISZA 2QVPA 5F09A 1R3NA 4ZY0A 3B2YA 3FJUA 3IFEA 3TX8A 2ZEPA 3MRUA 5LRGA 3PB8X 1XFOA 2EWBA 4MRIA 4OP4A 4IK2A 3KR4A 3S9NA 3ISXA 4MHYA 2BO9A 1CPXA 4TWEA 4TNUA 2PVVA 1LCPA 4PXBA 3KASA 3DLJA 4RUHA 2O53A 2C6CA 2PJ7A 1HDQA 3BXMA 4UEZA 4MXUA 3CT9A 4IHMA 3KL9A 4P4JA 3SI2A 1VIXA 3IIBA 2PJBA 3V38A 3D4UA 2CTCA 2J9AA 5CPAA 3VH9A 4LQGA 4NGPA 4OC4A 3KR5A 4A39A 2AFWA 4IAVA 4OKOA 2XEIA 7CPAA 4K3NA 4A94A 1KWMA 4NGSA 3RAMA 3PBEA 2QJ8A 4UEEA 1OBRA 4KSIA 4MCPA 1IY7A 2PJ4A 3NFZA 4WJBA 3FF3A 2ZOGA 1H8LA 3RZAA 2FVGA 1ZG8A 3PB4X 4P45A 4A38A 4F9UA 1UWYA 4MMOA 4PPZA 3IJ3A 3FMCA 2XEJA 5LRKA 5K8OA 3K9TA 5IB9A 2PJ5A 1ELMP 2C1CA 2PIZA 1RTQA 3GUXA 1AMPA 3BHXA 2IMOA 2V77A 3B3CA 3B7IA 2PJ9A 2NSMA 2WZNA 3QNVA 3IC1A 4P4BA 3KHXA 3PB9X 4AXVA 4ONWA 2AFSA 1LFWA 5CBMA 5LYFA 1F2PA 3KQXA 3CPXA 2XEGA 2ZOFA 3KGQA 1FT7A 1Z8LA 2PRQA 2BCOA 3B3TA 2ZEEA 3H8FA 4ZY1A 2EK9A 1F2OA 4Z65A 2PJ0A 8CPAA 4YU9A 3B3WA 4OC5A 1ZLIA 3SJXA 1YW6A 2F7VA 5THWA 2GLFA 3IWWA 4UEFA 5DS0A 5HVHA 5LYDA 4YWYA 3H8EA 5JGFA 3BI0A 1EE3P 2PVWA 3PFEA 4MHPA 2EK8A 4MCQA 2IQ6A 4GM5A 2OOTA 2PJ1A 4P44A 2OR4A 4MHNA 4O23A 4CPAA 3WT4A 2CIJA 4NJRA 4WWVA 4NFRA 1ZG7A 2ZEHA 4NGRA 2V8GA 4NGTA 4R76A 4P4EA 3S9MA 1TKJA 1CG2A 4OIDA 3FECA 2C6GA 2AFUA 1LOKA 3KQZA 2POKA 2C6PA 2PJAA 2JEWA 3IEHA 1Y0YA 4JZ0A 2ABZA 3WABA 2PCUA 4X2TA 2PJCA 4NGQA 4OC3A 1CBXA 2GU2A 4G1PA 5HVFA 2V8DA 1LANA 1XMBA 2ANPA 3KHZA 3L2NA 1VHEA 3GLJA 3PB7X 1CP7A 1BAVA 5LYLA 4EMEA 2RFHA 5K8NA 3B3SA 1CPSA 1VGYA 4DUKA 4NJQA 2JBKA 1M4LA 1LAMA 1TF8A 3TC8A 1TKHA 2PJ3A 2ZEFA 3PRTA 2AFMA 4PXEA 2BOAA 4ZX8A 1TXRA 1DE4C 4R8FA 3SJGA 4FWUA 3LMSA 4P4DA 5D29A 4UF4A 5HVGA 1BPMA 2CTBA 4FAIA 3NH8A 1CP6A 3KZWA 4NGMA 4PQAA 2Q43A 1Y0RA 1ARMA 3PB6X 3NA6A 1YW4A 3CDXA 3PBBA 1XBUA 4PXDA 3IO1A 1AYEA 3D7HA 5D8NA 2ZEOA 3D7GA 1DTDA 1ZLHA 3CPAA 3H8GA 3WC7A 2V8HA 1CX8A 2HB6A 5I4MA 1ARLA 1Y7EA 2PJ8A 5JM6A 1HEEA 1YSJA 2PIYA 3D67A 3BI1A 4ZYQA 2ZELA 5J1QA 2IJZA 4OC2A 2CF4A 3GB0A 3SI0A 2RB7A 3KI9A 2V8VA 1VHOA 3VATA 2HC9A 3WC6A 4MCSA 2PE3A 1TF9A 4B6ZA 2ZEMA 2ZENA 3FH4A 5LRJA 4MCRA 1XRYA 3FEEA 1Z5RA 2GREA 1YMEA 3N5FA 3HLPA 3HUVA 1NSAA 2JBJA 1PCAA 4OMEA 4F8ZA 4F9VA 1LAPA 4P6YA 4EWTA 1ZG9A 4UIAA 1TKFA 3WC5A 2NYQA 3K2KA 3PFOA 5K8PA 3I1UA 2Q4ZA 4EFDA 2I3CA 3MN8A 1QQ9A 2AFXA 2AFZA 5HXDA 1JQGA 4X8IA 4R7MA 2WYRA 4R6TA 3SI1A 3NH4A 1YLOA 4X3RA 2QYVA 3D7FA 3B35A 4BD9A 1F57A 1XJOA 4ZX9A 3SJEA 3PEIA 2GLJA 4JYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZY2 A;  4OIW A;  5LYI A;  4OC1 A;  3RBU A;  3FX6 A;  1BPN A;  4W9Y A;  1HDU A;  3S9L A;  2XEF A;  4PXC A;  5JH9 A;  3NH5 A;  3B3V A;  3FVL A;  1R43 A;  3DGV A;  2DEA A;  1PYT B;  4H2K A;  2O4H A;  4P4I A;  3LWU A;  4MHZ A;  4Q7A A;  4UIB A;  1BLL E;  3V7Z A;  1QMU A;  6CPA A;  3FED A;  4P10 A;  4ZI6 A;  4P4F A;  4A37 A;  2G9D A;  2ZEG A;  2PJ6 A;  1GYT A;  3D68 A;  1IGB A;  3JRU A;  1FNO A;  2VL1 A;  4NGN A;  2F8H A;  4DJL A;  2PJ2 A;  3D7D A;  3VAR A;  4OC0 A;  3T8W A;  1Z2L A;  2Q51 A;  3D66 A;  1Q7L A;  4FBE A;  2AFO A;  1ELL P;  2ZED A;  4FUU A;  4DYO A;  5ELY A;  3SJF A;  5K8M A;  3ISZ A;  2QVP A;  5F09 A;  1R3N A;  4ZY0 A;  3B2Y A;  3FJU A;  3IFE A;  3TX8 A;  2ZEP A;  3MRU A;  5LRG A;  3PB8 X;  1XFO A;  2EWB A;  4MRI A;  4OP4 A;  4IK2 A;  3KR4 A;  3S9N A;  3ISX A;  4MHY A;  2BO9 A;  1CPX A;  4TWE A;  4TNU A;  2PVV A;  1LCP A;  4PXB A;  3KAS A;  3DLJ A;  4RUH A;  2O53 A;  2C6C A;  2PJ7 A;  1HDQ A;  3BXM A;  4UEZ A;  4MXU A;  3CT9 A;  4IHM A;  3KL9 A;  4P4J A;  3SI2 A;  1VIX A;  3IIB A;  2PJB A;  3V38 A;  3D4U A;  2CTC A;  2J9A A;  5CPA A;  3VH9 A;  4LQG A;  4NGP A;  4OC4 A;  3KR5 A;  4A39 A;  2AFW A;  4IAV A;  4OKO A;  2XEI A;  7CPA A;  4K3N A;  4A94 A;  1KWM A;  4NGS A;  3RAM A;  3PBE A;  2QJ8 A;  4UEE A;  1OBR A;  4KSI A;  4MCP A;  1IY7 A;  2PJ4 A;  3NFZ A;  4WJB A;  3FF3 A;  2ZOG A;  1H8L A;  3RZA A;  2FVG A;  1ZG8 A;  3PB4 X;  4P45 A;  4A38 A;  4F9U A;  1UWY A;  4MMO A;  4PPZ A;  3IJ3 A;  3FMC A;  2XEJ A;  5LRK A;  5K8O A;  3K9T A;  5IB9 A;  2PJ5 A;  1ELM P;  2C1C A;  2PIZ A;  1RTQ A;  3GUX A;  1AMP A;  3BHX A;  2IMO A;  2V77 A;  3B3C A;  3B7I A;  2PJ9 A;  2NSM A;  2WZN A;  3QNV A;  3IC1 A;  4P4B A;  3KHX A;  3PB9 X;  4AXV A;  4ONW A;  2AFS A;  1LFW A;  5CBM A;  5LYF A;  1F2P A;  3KQX A;  3CPX A;  2XEG A;  2ZOF A;  3KGQ A;  1FT7 A;  1Z8L A;  2PRQ A;  2BCO A;  3B3T A;  2ZEE A;  3H8F A;  4ZY1 A;  2EK9 A;  1F2O A;  4Z65 A;  2PJ0 A;  8CPA A;  4YU9 A;  3B3W A;  4OC5 A;  1ZLI A;  3SJX A;  1YW6 A;  2F7V A;  5THW A;  2GLF A;  3IWW A;  4UEF A;  5DS0 A;  5HVH A;  5LYD A;  4YWY A;  3H8E A;  5JGF A;  3BI0 A;  1EE3 P;  2PVW A;  3PFE A;  4MHP A;  2EK8 A;  4MCQ A;  2IQ6 A;  4GM5 A;  2OOT A;  2PJ1 A;  4P44 A;  2OR4 A;  4MHN A;  4O23 A;  4CPA A;  3WT4 A;  2CIJ A;  4NJR A;  4WWV A;  4NFR A;  1ZG7 A;  2ZEH A;  4NGR A;  2V8G A;  4NGT A;  4R76 A;  4P4E A;  3S9M A;  1TKJ A;  1CG2 A;  4OID A;  3FEC A;  2C6G A;  2AFU A;  1LOK A;  3KQZ A;  2POK A;  2C6P A;  2PJA A;  2JEW A;  3IEH A;  1Y0Y A;  4JZ0 A;  2ABZ A;  3WAB A;  2PCU A;  4X2T A;  2PJC A;  4NGQ A;  4OC3 A;  1CBX A;  2GU2 A;  4G1P A;  5HVF A;  2V8D A;  1LAN A;  1XMB A;  2ANP A;  3KHZ A;  3L2N A;  1VHE A;  3GLJ A;  3PB7 X;  1CP7 A;  1BAV A;  5LYL A;  4EME A;  2RFH A;  5K8N A;  3B3S A;  1CPS A;  1VGY A;  4DUK A;  4NJQ A;  2JBK A;  1M4L A;  1LAM A;  1TF8 A;  3TC8 A;  1TKH A;  2PJ3 A;  2ZEF A;  3PRT A;  2AFM A;  4PXE A;  2BOA A;  4ZX8 A;  1TXR A;  1DE4 C;  4R8F A;  3SJG A;  4FWU A;  3LMS A;  4P4D A;  5D29 A;  4UF4 A;  5HVG A;  1BPM A;  2CTB A;  4FAI A;  3NH8 A;  1CP6 A;  3KZW A;  4NGM A;  4PQA A;  2Q43 A;  1Y0R A;  1ARM A;  3PB6 X;  3NA6 A;  1YW4 A;  3CDX A;  3PBB A;  1XBU A;  4PXD A;  3IO1 A;  1AYE A;  3D7H A;  5D8N A;  2ZEO A;  3D7G A;  1DTD A;  1ZLH A;  3CPA A;  3H8G A;  3WC7 A;  2V8H A;  1CX8 A;  2HB6 A;  5I4M A;  1ARL A;  1Y7E A;  2PJ8 A;  5JM6 A;  1HEE A;  1YSJ A;  2PIY A;  3D67 A;  3BI1 A;  4ZYQ A;  2ZEL A;  5J1Q A;  2IJZ A;  4OC2 A;  2CF4 A;  3GB0 A;  3SI0 A;  2RB7 A;  3KI9 A;  2V8V A;  1VHO A;  3VAT A;  2HC9 A;  3WC6 A;  4MCS A;  2PE3 A;  1TF9 A;  4B6Z A;  2ZEM A;  2ZEN A;  3FH4 A;  5LRJ A;  4MCR A;  1XRY A;  3FEE A;  1Z5R A;  2GRE A;  1YME A;  3N5F A;  3HLP A;  3HUV A;  1NSA A;  2JBJ A;  1PCA A;  4OME A;  4F8Z A;  4F9V A;  1LAP A;  4P6Y A;  4EWT A;  1ZG9 A;  4UIA A;  1TKF A;  3WC5 A;  2NYQ A;  3K2K A;  3PFO A;  5K8P A;  3I1U A;  2Q4Z A;  4EFD A;  2I3C A;  3MN8 A;  1QQ9 A;  2AFX A;  2AFZ A;  5HXD A;  1JQG A;  4X8I A;  4R7M A;  2WYR A;  4R6T A;  3SI1 A;  3NH4 A;  1YLO A;  4X3R A;  2QYV A;  3D7F A;  3B35 A;  4BD9 A;  1F57 A;  1XJO A;  4ZX9 A;  3SJE A;  3PEI A;  2GLJ A;  4JYW A; 
#chains in the Genus database with same CATH topology
 4J3G A;  4HPS A;  1BO4 A;  3F5B A;  3FIX A;  4OIW A;  4ZY2 A;  5LYI A;  4OC1 A;  3RBU A;  2PC1 A;  2KCW A;  3FX6 A;  1BPN A;  3G8W A;  4XPK A;  3IWE A;  4KVX A;  3D8P A;  3LD2 A;  4W9Y A;  1XE4 A;  2BEI A;  4CAE A;  1HDU A;  2ODF A;  5J8F A;  2QIR A;  1Z9U A;  4AG9 A;  3S9L A;  1NMT A;  2XEF A;  2PR1 A;  4PXC A;  5JH9 A;  4HNX B;  3NH5 A;  3S6H A;  3B3V A;  1M44 A;  3FVL A;  4X5K A;  1R43 A;  4YFJ A;  3DGV A;  1V0C A;  2B4D B;  4K30 A;  4OLL A;  2DEA A;  1PYT B;  2G3A A;  3QAH A;  4MHD A;  3TT2 A;  4H2K A;  2O4H A;  3TO7 A;  2VBQ A;  4KOS A;  3LWU A;  4MHZ A;  4P4I A;  4Q7A A;  4XNH C;  4UIB A;  1BLL E;  3V7Z A;  1QMU A;  1KUV A;  1KUY A;  6CPA A;  3FED A;  3I3G A;  4P10 A;  5H86 A;  3SHP A;  4B5P B;  2YND A;  4ZI6 A;  2FT0 A;  1CJW A;  4CGM A;  4AVA A;  3EO4 A;  4PSX A;  4P4F A;  4A95 A;  4A37 A;  5HMN A;  2G9D A;  2ZEG A;  2PJ6 A;  1GYT A;  3D68 A;  1IGB A;  3JRU A;  1YR0 A;  3W6X A;  4IUS A;  1FNO A;  2VL1 A;  2Z10 A;  5EMI A;  4NGN A;  2B3U A;  2F8H A;  1YGH A;  4AVB A;  1B6B A;  3R9G A;  4DJL A;  3TTH A;  2G3T A;  2D4P A;  3TO6 A;  2PJ2 A;  2B58 A;  3D7D A;  3VAR A;  5IX3 A;  4OC0 A;  3CXS A;  2IL4 A;  3PZJ A;  1ZO0 A;  3ZZI A;  4MY3 A;  4LX9 A;  3T8W A;  4QVT A;  1Z2L A;  2Q7S A;  2Q51 A;  3N7Z A;  3NE7 A;  5IV0 A;  4R87 A;  2Q4V A;  1YQE A;  3D66 A;  4MBU A;  1Q7L A;  4FBE A;  2VZY A;  2K5T A;  3WR7 A;  2AFO A;  1YX0 A;  3VWE A;  1ELL P;  5DWN A;  3R1K A;  2ZED A;  5JPH A;  4B5O A;  5ISV A;  4FUU A;  4UCM A;  5F47 A;  4DYO A;  5ELY A;  1UFH A;  3SJF A;  5K8M A;  4II9 A;  3ISZ A;  2FIA A;  2QVP A;  4U9Y A;  5F09 A;  1R3N A;  4ZY0 A;  3B2Y A;  4UBR A;  3JUW A;  4DNC A;  1I1D A;  3FJU A;  3IFE A;  3TX8 A;  2ZEP A;  3MRU A;  5LRG A;  4KUA A;  3PB8 X;  1WK4 A;  4JD6 A;  3DR6 A;  4KSA A;  1XFO A;  4RI1 A;  2ZW6 A;  4CYQ A;  2A4N A;  3MGD A;  4KVO E;  2EWB A;  4MRI A;  4F0Y A;  3UY5 A;  1YK3 A;  4U9Z A;  3JTK A;  4IK2 A;  4OP4 A;  2FE7 A;  3KR4 A;  3S9N A;  3ISX A;  4MHY A;  3NE8 A;  4XPD C;  3LOD A;  2J8N A;  4CAX A;  2BO9 A;  1CPX A;  4ORF A;  3SXN A;  4TWE A;  3VWD A;  4TNU A;  1XOV A;  2PDO A;  5BWA B;  2PVV A;  3EXN A;  3E0K A;  1KUX A;  1LCP A;  4FD6 A;  2R7H A;  4PXB A;  3FRM A;  3KAS A;  3DLJ A;  2OZU A;  4UFX A;  4RUH A;  2ATR A;  2O53 A;  4FD5 A;  2C6C A;  2PJ7 A;  2JDC A;  1HDQ A;  1QST A;  3BXM A;  4UEZ A;  1MJ9 A;  4MXU A;  3EFA A;  2Q0Y A;  2BUE A;  3CT9 A;  4IHM A;  3KL9 A;  1S5K A;  4PK3 A;  4P4J A;  3SI2 A;  1Y9K A;  2OZG A;  3EY5 A;  1VIX A;  3R95 A;  1YLE A;  4R9M A;  3IIB A;  2PJB A;  3V38 A;  3D4U A;  3DDD A;  2CTC A;  2J9A A;  4AB7 A;  4CGL A;  4UFW A;  5CPA A;  3VH9 A;  4YRH A;  1Q2Y A;  5G1Z A;  4AG7 A;  4LQG A;  4NGP A;  3W91 A;  5JQ4 A;  2EO8 A;  5I0C A;  4OC4 A;  4UCN A;  3KR5 A;  4UFV A;  4A39 A;  2YGW A;  2AFW A;  4IAV A;  2DF5 A;  2H5M A;  3FXT A;  5KTD A;  4M6H A;  4OKO A;  2XEI A;  1Z8X A;  2PSW A;  1XEB A;  2QML A;  2YNC C;  3GIU A;  4K3N A;  2QEC A;  4KSF A;  4A94 A;  1KWM A;  2Z3L A;  4BBH A;  3H5Z A;  4NGS A;  4C7H A;  3RAM A;  3PBE A;  2QJ8 A;  4NF1 A;  4UEE A;  3TOA A;  3R9F A;  5KTC A;  1Q2D A;  4C2Y A;  1OBR A;  3F0A A;  4KSI A;  2P0W A;  2PJ4 A;  1IY7 A;  4MCP A;  4JYW A;  2DPT A;  3NFZ A;  4MFL A;  4KOX A;  5F48 A;  2REE A;  2ZXV A;  4KZT A;  4WJB A;  4FD4 A;  2B3V A;  3FF3 A;  4C7I A;  4I49 A;  5C82 A;  1S7L A;  5GCN A;  1K4J A;  2ZOG A;  1P4N A;  4LQ6 A;  1H8L A;  4R3K A;  3RZA A;  3IU2 A;  2FVG A;  1ZG8 A;  3PB4 X;  4P45 A;  2PQ8 A;  4A38 A;  1JWQ A;  4F9U A;  3JVN A;  2FS5 A;  2GFQ A;  1UWY A;  4C2X A;  4MMO A;  3V8I A;  1Q2C A;  1S3Z A;  3G3S A;  3GKR A;  4PPZ A;  3IJ3 A;  4M6I A;  4MI4 A;  3F8K A;  3FMC A;  2XEJ A;  5LRK A;  2OB0 A;  5K8O A;  3K9T A;  4MY0 A;  1M4D A;  5IB9 A;  2PJ5 A;  1ELM P;  2C1C A;  4C2Z A;  2PIZ A;  1RTQ A;  1IU8 A;  3GY9 A;  1Z8T A;  4CGP A;  3GUX A;  1AMP A;  3BHX A;  4NCZ A;  2IMO A;  5EBV A;  4A2Z A;  2V77 A;  4GXH A;  1IIC A;  3B3C A;  3B7I A;  4KUB A;  2Q44 A;  4CYO A;  2PJ9 A;  2NSM A;  2WZN A;  2Z0Z A;  3QNV A;  1RXT A;  3W6S A;  5C88 A;  2FCK A;  4Y49 C;  2FSR A;  3IC1 A;  3KHX A;  4P4B A;  1AUG A;  1P0H A;  4CAW A;  3PB9 X;  4AXV A;  4ONW A;  4H89 A;  2AFS A;  5DWM A;  3S6G A;  2WUU A;  4KOV A;  1LFW A;  1XF8 A;  5CBM A;  5LYF A;  1F2P A;  3KQX A;  3CPX A;  3T9Y A;  3BJ8 A;  2REF A;  2XEG A;  2ZOF A;  3KGQ A;  1FT7 A;  4B13 A;  1IID A;  1LRZ A;  1Z8L A;  1VKC A;  2PRQ A;  2BCO A;  2R1I A;  3A9L A;  2ZEE A;  3B3T A;  3BJ7 A;  2EK9 A;  3H8F A;  2ZPA A;  4Q36 A;  4CGO A;  4ZY1 A;  1F2O A;  4Z65 A;  3SXO A;  2BSW A;  2VXK A;  2PJ0 A;  5IB0 A;  4CPA A;  8CPA A;  4CAV A;  3I9S A;  3FNC A;  3B3W A;  4YU9 A;  1ZLI A;  4OC5 A;  3SJX A;  4F6A A;  1YW6 A;  2F7V A;  2PR8 A;  2Q4Y A;  3TCV A;  5THW A;  2GLF A;  3IWW A;  3DR8 A;  4UEF A;  4UCP A;  5DS0 A;  4ZBG A;  1B87 A;  3D3S A;  1I21 A;  3KKW A;  5LYD A;  3K9U A;  3H8E A;  4YWY A;  5HVH A;  2FXF A;  5JGF A;  1M1D A;  1IOI A;  1QSR A;  1XIX A;  2GAN A;  1NSL A;  2O28 A;  3D2P A;  3BI0 A;  1EE3 P;  5E96 A;  4CYP A;  4B5P A;  3P2F A;  2J8M A;  2PVW A;  3PFE A;  4HNW B;  4L8A A;  4MHP A;  2EK8 A;  5AGE A;  4MCQ A;  2IQ6 A;  3RNZ A;  3H4Q A;  2CNM A;  4GM5 A;  5G22 A;  1IYL A;  3IWG A;  2PJ1 A;  3C26 A;  4P44 A;  4Y49 B;  3FBU A;  2OOT A;  2OR4 A;  4MHN A;  4O23 A;  4MJ8 A;  4NXY A;  5CNP A;  2CIJ A;  4NJR A;  4WWV A;  2Q7B A;  3WT4 A;  1L0C A;  4HKF A;  4JWP A;  4NFR A;  1ZG7 A;  2ZEH A;  4NGR A;  2Z3O A;  2Q04 A;  1MJA A;  2V8G A;  2EUI A;  2G0B A;  1TIQ A;  4NGT A;  4CRZ B;  4R76 A;  4P4E A;  3S9M A;  4UWJ A;  3TO9 A;  1TKJ A;  1CG2 A;  4KOR A;  4RS2 A;  2ZW7 A;  3BLN A;  2VEZ A;  4OID A;  3FEC A;  2C6G A;  2AFU A;  2WSA A;  4CS0 B;  1LOK A;  4PSW A;  5G20 A;  2NMT A;  3KQZ A;  4YGO A;  2POK A;  3IU1 A;  1YVK A;  2CNS A;  3IGR A;  3CXP A;  2C6P A;  2PJA A;  2JEW A;  4MFP A;  2JDD A;  2Z11 A;  3IEH A;  1Y0Y A;  4JZ0 A;  2ABZ A;  3WAB A;  2PCU A;  4X2T A;  2PJC A;  4NGQ A;  4OC3 A;  7CPA A;  1CBX A;  1YRE A;  4M3S A;  2GU2 A;  4G1P A;  1IYK A;  5HVF A;  2V8D A;  1LAN A;  4B12 A;  1XMB A;  2ANP A;  2PRB A;  3KHZ A;  3L2N A;  1VHE A;  2AJ6 A;  2VQY A;  3GLJ A;  4NSQ A;  3PB7 X;  4KLV A;  3R96 A;  3T90 A;  1CP7 A;  1BAV A;  1PUA A;  1WWZ A;  5LYL A;  4RN7 A;  3S6K A;  4EME A;  2RFH A;  4A33 A;  4A30 A;  5K8N A;  5A28 A;  5F49 A;  4CYN A;  3TOB A;  1VHS A;  1YVO A;  1ON0 A;  3B3S A;  3QB8 A;  4MFZ A;  1CPS A;  1VGY A;  3RO0 A;  4DUK A;  4NJQ A;  2JBK A;  1M4L A;  1LAM A;  1TF8 A;  3TC8 A;  1TKH A;  2PJ3 A;  1Z8W A;  2AE6 A;  2ZEF A;  3PRT A;  1R57 A;  4L89 A;  4XPL A;  2AFM A;  4PXE A;  2BOA A;  4ZX8 A;  1TXR A;  1DE4 C;  1OZP A;  2CY2 A;  2ARH A;  4R8F A;  1Y9W A;  3SJG A;  4FWU A;  5J8C A;  4MFJ A;  3CXQ A;  3DSB A;  2C27 A;  2F5I A;  2HV2 A;  4JJX A;  3LMS A;  3QAY A;  4P4D A;  3B8G A;  2OU2 A;  4QBJ A;  5D29 A;  4UF4 A;  2ZW4 A;  4B11 A;  2R8V A;  3LAC A;  5HVG A;  1BPM A;  2CTB A;  1MK4 A;  4UWI A;  4LUA A;  4FAI A;  5A27 A;  5H84 A;  1CP6 A;  2BL1 A;  4B14 A;  5HH1 A;  3KZW A;  4R57 A;  1QSN A;  1FY7 A;  4NGM A;  4PQA A;  2Q43 A;  1Y0R A;  4R3L A;  4AVC A;  1ARM A;  4C68 A;  1M4G A;  1PU9 A;  3PB6 X;  1IB1 E;  2Z3M A;  3NA6 A;  4A32 A;  1YW4 A;  1MJB A;  3CDX A;  4PV6 A;  4BMH A;  3D2M A;  3PBB A;  4EVY A;  2OH1 A;  4KVM E;  1Y7R A;  4OAD A;  4B10 A;  1XBU A;  2Z3P A;  4PXD A;  4XPD B;  3IO1 A;  1AYE A;  3D7H A;  5D8N A;  2ZEO A;  3D7G A;  1J4J A;  4KOT A;  1DTD A;  1ZLH A;  4JLY A;  3CPA A;  5KTA A;  3H8G A;  4CGN A;  1Z4R A;  3WC7 A;  2V8H A;  3EC4 A;  4QUS A;  1CX8 A;  1U6M A;  1QSM A;  2HB6 A;  3RYO A;  5I4M A;  4E0A A;  1ARL A;  1Y7E A;  2PJ8 A;  5FVJ A;  5JM6 A;  1CM0 A;  1HEE A;  2J8R A;  1YSJ A;  2PIY A;  3D67 A;  2B4D A;  4GS4 A;  2B5G B;  3BI1 A;  4JXR A;  4ZYQ A;  2ZEL A;  5J1Q A;  2CXA A;  4ZGY B;  3ZJ0 A;  4OAE A;  1Z4E A;  2IJZ A;  4OC2 A;  2EVN A;  4A31 A;  4MFQ A;  4HNY B;  2CF4 A;  4CAF A;  3GB0 A;  3DNS A;  3SI0 A;  1NE9 A;  2RB7 A;  3KI9 A;  2V8V A;  1VHO A;  3VAT A;  4M6G A;  1S7F A;  2HC9 A;  2D4O A;  2R98 A;  4MCS A;  3WC6 A;  2DXQ A;  2P6F A;  2I00 A;  2PE3 A;  4UA3 A;  1TF9 A;  3TE4 A;  2I79 A;  3FYN A;  3OWC A;  2ZW5 A;  4E8O A;  2FIW A;  4B6Z A;  3FB3 A;  2ZEM A;  2ZEN A;  4QB9 A;  3FH4 A;  2WPX A;  4KOU A;  1X12 A;  4CRY B;  5LRJ A;  4MCR A;  1X10 A;  4PK2 A;  1XRY A;  4KOY A;  3FEE A;  3PP9 A;  1Z5R A;  1SQH A;  2P6G A;  4ONU A;  2GRE A;  1YME A;  2X7B A;  3HLP A;  3N5F A;  4E2A A;  1BOB A;  1XMT A;  2GIV A;  3HUV A;  2WPW A;  3PGP A;  1NSA A;  1KZF A;  2JBJ A;  1A2Z A;  1PCA A;  2EBJ A;  4JXQ A;  4KOW A;  4NEX A;  4OME A;  2Z3N A;  4F8Z A;  4F9V A;  1LAP A;  1N71 A;  2YNE A;  2Z3K A;  2HQY A;  1M4I A;  4KLW A;  4P6Y A;  4EWT A;  1ZG9 A;  4UIA A;  4XNH B;  1TKF A;  4QC6 A;  3WC5 A;  2NYQ A;  3K2K A;  3PFO A;  5AG4 A;  4H6U A;  2OZH A;  1RO5 A;  5EC4 A;  2B4B A;  2RC4 A;  1QSO A;  3I1U A;  5K8P A;  4KS9 A;  2Q4Z A;  4EFD A;  1GHE A;  1I12 A;  2I3C A;  2Y0M A;  4U5Y A;  4FD7 A;  2YNC A;  3MN8 A;  1QQ9 A;  2AFX A;  2DPS A;  2JLM A;  2AFZ A;  4Q38 A;  5AG6 A;  1IOF A;  5HXD A;  3GYA A;  1JQG A;  4X8I A;  5F46 A;  5AG7 A;  2JEV A;  4R7M A;  2VI7 A;  2WYR A;  2HUZ A;  4BIN A;  4R6T A;  3SI1 A;  3NH4 A;  1YLO A;  4H6Z A;  4X3R A;  2GE3 A;  2QYV A;  3TFY A;  3CZX A;  1S7N A;  2VZZ A;  3D7F A;  3B35 A;  2B5G A;  5AG5 A;  4BD9 A;  2FL4 A;  5G21 A;  1S60 A;  1F57 A;  4MFK A;  1XJO A;  1S7K A;  2P6E A;  3R9E A;  4ZX9 A;  4M85 A;  3S6F A;  3SJE A;  4F0X A;  2CNT A;  3PEI A;  3P2H A;  4IF5 A;  2GLJ A;  3NH8 A; 
#chains in the Genus database with same CATH homology
 4ZY2 A;  4OIW A;  5LYI A;  4OC1 A;  3RBU A;  3FX6 A;  1BPN A;  4W9Y A;  1HDU A;  3S9L A;  2XEF A;  4PXC A;  5JH9 A;  3NH5 A;  3B3V A;  3FVL A;  1R43 A;  3DGV A;  2DEA A;  1PYT B;  4H2K A;  2O4H A;  4P4I A;  3LWU A;  4MHZ A;  4Q7A A;  4UIB A;  1BLL E;  3V7Z A;  1QMU A;  6CPA A;  3FED A;  4P10 A;  4ZI6 A;  4P4F A;  4A37 A;  2G9D A;  2ZEG A;  2PJ6 A;  1GYT A;  3D68 A;  1IGB A;  3JRU A;  1FNO A;  2VL1 A;  4NGN A;  2F8H A;  4DJL A;  2PJ2 A;  3D7D A;  3VAR A;  4OC0 A;  3T8W A;  1Z2L A;  2Q51 A;  3D66 A;  1Q7L A;  4FBE A;  2AFO A;  1ELL P;  2ZED A;  4FUU A;  4DYO A;  5ELY A;  3SJF A;  5K8M A;  3ISZ A;  2QVP A;  5F09 A;  1R3N A;  4ZY0 A;  3B2Y A;  3FJU A;  3IFE A;  3TX8 A;  2ZEP A;  3MRU A;  5LRG A;  3PB8 X;  1XFO A;  2EWB A;  4MRI A;  4OP4 A;  4IK2 A;  3KR4 A;  3S9N A;  3ISX A;  4MHY A;  2BO9 A;  1CPX A;  4TWE A;  4TNU A;  2PVV A;  1LCP A;  4PXB A;  3KAS A;  3DLJ A;  4RUH A;  2O53 A;  2C6C A;  2PJ7 A;  1HDQ A;  3BXM A;  4UEZ A;  4MXU A;  3CT9 A;  4IHM A;  3KL9 A;  4P4J A;  3SI2 A;  1VIX A;  3IIB A;  2PJB A;  3V38 A;  3D4U A;  2CTC A;  2J9A A;  5CPA A;  3VH9 A;  4LQG A;  4NGP A;  4OC4 A;  3KR5 A;  4A39 A;  2AFW A;  4IAV A;  4OKO A;  2XEI A;  7CPA A;  4K3N A;  4A94 A;  1KWM A;  4NGS A;  3RAM A;  3PBE A;  2QJ8 A;  4UEE A;  1OBR A;  4KSI A;  4MCP A;  1IY7 A;  2PJ4 A;  3NFZ A;  4WJB A;  3FF3 A;  2ZOG A;  1H8L A;  3RZA A;  2FVG A;  1ZG8 A;  3PB4 X;  4P45 A;  4A38 A;  4F9U A;  1UWY A;  4MMO A;  4PPZ A;  3IJ3 A;  3FMC A;  2XEJ A;  5LRK A;  5K8O A;  3K9T A;  5IB9 A;  2PJ5 A;  1ELM P;  2C1C A;  2PIZ A;  1RTQ A;  3GUX A;  1AMP A;  3BHX A;  2IMO A;  2V77 A;  3B3C A;  3B7I A;  2PJ9 A;  2NSM A;  2WZN A;  3QNV A;  3IC1 A;  4P4B A;  3KHX A;  3PB9 X;  4AXV A;  4ONW A;  2AFS A;  1LFW A;  5CBM A;  5LYF A;  1F2P A;  3KQX A;  3CPX A;  2XEG A;  2ZOF A;  3KGQ A;  1FT7 A;  1Z8L A;  2PRQ A;  2BCO A;  3B3T A;  2ZEE A;  3H8F A;  4ZY1 A;  2EK9 A;  1F2O A;  4Z65 A;  2PJ0 A;  8CPA A;  4YU9 A;  3B3W A;  4OC5 A;  1ZLI A;  3SJX A;  1YW6 A;  2F7V A;  5THW A;  2GLF A;  3IWW A;  4UEF A;  5DS0 A;  5HVH A;  5LYD A;  4YWY A;  3H8E A;  5JGF A;  3BI0 A;  1EE3 P;  2PVW A;  3PFE A;  4MHP A;  2EK8 A;  4MCQ A;  2IQ6 A;  4GM5 A;  2OOT A;  2PJ1 A;  4P44 A;  2OR4 A;  4MHN A;  4O23 A;  4CPA A;  3WT4 A;  2CIJ A;  4NJR A;  4WWV A;  4NFR A;  1ZG7 A;  2ZEH A;  4NGR A;  2V8G A;  4NGT A;  4R76 A;  4P4E A;  3S9M A;  1TKJ A;  1CG2 A;  4OID A;  3FEC A;  2C6G A;  2AFU A;  1LOK A;  3KQZ A;  2POK A;  2C6P A;  2PJA A;  2JEW A;  3IEH A;  1Y0Y A;  4JZ0 A;  2ABZ A;  3WAB A;  2PCU A;  4X2T A;  2PJC A;  4NGQ A;  4OC3 A;  1CBX A;  2GU2 A;  4G1P A;  5HVF A;  2V8D A;  1LAN A;  1XMB A;  2ANP A;  3KHZ A;  3L2N A;  1VHE A;  3GLJ A;  3PB7 X;  1CP7 A;  1BAV A;  5LYL A;  4EME A;  2RFH A;  5K8N A;  3B3S A;  1CPS A;  1VGY A;  4DUK A;  4NJQ A;  2JBK A;  1M4L A;  1LAM A;  1TF8 A;  3TC8 A;  1TKH A;  2PJ3 A;  2ZEF A;  3PRT A;  2AFM A;  4PXE A;  2BOA A;  4ZX8 A;  1TXR A;  1DE4 C;  4R8F A;  3SJG A;  4FWU A;  3LMS A;  4P4D A;  5D29 A;  4UF4 A;  5HVG A;  1BPM A;  2CTB A;  4FAI A;  3NH8 A;  1CP6 A;  3KZW A;  4NGM A;  4PQA A;  2Q43 A;  1Y0R A;  1ARM A;  3PB6 X;  3NA6 A;  1YW4 A;  3CDX A;  3PBB A;  1XBU A;  4PXD A;  3IO1 A;  1AYE A;  3D7H A;  5D8N A;  2ZEO A;  3D7G A;  1DTD A;  1ZLH A;  3CPA A;  3H8G A;  3WC7 A;  2V8H A;  1CX8 A;  2HB6 A;  5I4M A;  1ARL A;  1Y7E A;  2PJ8 A;  5JM6 A;  1HEE A;  1YSJ A;  2PIY A;  3D67 A;  3BI1 A;  4ZYQ A;  2ZEL A;  5J1Q A;  2IJZ A;  4OC2 A;  2CF4 A;  3GB0 A;  3SI0 A;  2RB7 A;  3KI9 A;  2V8V A;  1VHO A;  3VAT A;  2HC9 A;  3WC6 A;  4MCS A;  2PE3 A;  1TF9 A;  4B6Z A;  2ZEM A;  2ZEN A;  3FH4 A;  5LRJ A;  4MCR A;  1XRY A;  3FEE A;  1Z5R A;  2GRE A;  1YME A;  3N5F A;  3HLP A;  3HUV A;  1NSA A;  2JBJ A;  1PCA A;  4OME A;  4F8Z A;  4F9V A;  1LAP A;  4P6Y A;  4EWT A;  1ZG9 A;  4UIA A;  1TKF A;  3WC5 A;  2NYQ A;  3K2K A;  3PFO A;  5K8P A;  3I1U A;  2Q4Z A;  4EFD A;  2I3C A;  3MN8 A;  1QQ9 A;  2AFX A;  2AFZ A;  5HXD A;  1JQG A;  4X8I A;  4R7M A;  2WYR A;  4R6T A;  3SI1 A;  3NH4 A;  1YLO A;  4X3R A;  2QYV A;  3D7F A;  3B35 A;  4BD9 A;  1F57 A;  1XJO A;  4ZX9 A;  3SJE A;  3PEI A;  2GLJ A;  4JYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...