1TXUA

Crystal structure of the vps9 domain of rabex-5
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
254
Chain Sequence
ETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab5 GDP/GTP exchange factor
publication title Structure, exchange determinants, and family-wide rab specificity of the tandem helical bundle and Vps9 domains of Rabex-5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 87
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01754 zf-A20 A20-like zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1txuA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1txuA02
4G01A 1TXUA 2EFEA 2EFDA 2EFHA 2EFCA 2OT3A 4N3ZA
chains in the Genus database with same CATH superfamily
2HSMA 5IJ5A 3EINA 3JRYA 5J4YA 5EVOA 1LBKA 4ISDA 1Y6EA 5B7CA 5A4WA 3W8SA 1A0FA 3HJMA 4Z69A 3SIUB 4K0GA 5ECLB 3UIVA 3P8WA 1YEWC 4G9HA 2HNLA 2V6KA 4GF0A 1BM0A 2Z8JA 4YQMA 5G5FA 4N0FD 1ML6A 4GDKB 5DJMA 2VO4A 2O5VA 3V08A 4RI7A 3EE2A 2BXHA 2KBZA 1ZL9A 4BL7A 1F3AA 3CX9A 3KJYA 1JNBA 4ZUXV 2ON7A 1M9AA 2C80A 1MD4A 3NVMA 3F6DA 4ZC6A 3IR4A 2XW0A 4CHSA 1GUMA 2R4VA 2O3EA 4MZWA 3Q74A 12GSA 2AAWA 4GTUA 1PL1A 3KM6A 4IJIA 1R5AA 4G0KA 4ZB6A 1PL2A 3LSZA 1HK1A 1SVOA 1SVLA 3IE3A 2AGHB 13GSA 4GG2A 4MF7A 5A34B 3KIKA 5IFOA 1I1IP 2F8FA 2BXAA 2VD1A 3LG6A 3W1SA 1GUKA 1GSFA 4L8EA 2GUTA 4LB9A 4N3ZA 5J41A 3LU8A 5HOZA 3KMOA 5BMUA 5EY6A 2LXTA 4EXJA 2HRKB 3NIVA 5DAKA 4JK4A 2VD0A 4GSNA 4MF5A 4L8UA 3GURA 1HNBA 2VCZA 1J7EA 3V09A 5DBYA 3G9KD 4IW1A 1MUSA 2WS2A 4YQVA 3TOTA 4F5VA 4WR4A 1AQVA 5J40A 1K0DA 1OE7A 5GSSA 1Z9HA 2EFDA 2XVUA 3H37A 1JLWA 4HZ2A 1FOUA 2BXPA 1EOGA 1MIVA 2LQIA 1B8XA 1VZSA 4MBEC 4PQIA 4F03A 5AIXA 1MTCA 2WW1A 4IQ1A 1H5WA 1LJRA 4AKXB 1EOHA 2X64A 2IL3A 2WB9A 1K0CA 4MPFA 5IIHA 2VDBA 1GNEA 3QAWA 4G10A 4ID0A 3VPQA 5LCZA 1K0OA 1YJ6A 1XWKA 4MDCA 5F06A 4LB2A 2WDUA 2PMTA 3RBTA 3ZFLA 3H3AA 2BXMA 1K0AA 1U3IA 2AHEA 2I30A 1N25A 3AY8A 4LUHA 1HNCA 5AGYA 3ERFA 3ZMLA 4GDFA 1MD3A 2WW3A 3O3TA 5IIXA 5ECMB 4HJ2A 4AGSA 4OR0A 4RI6A 4ZB7A 5GIPA 1FW1A 2I2ZA 3N9JA 4ACSA 4IW9A 1HA2A 3GX0A 4FQUA 4AKGA 3LXTA 4TOPA 5A34A 1E7CA 3CHXC 3GSTA 4GCIA 4BVXB 1BJ5A 4KH7A 4EE0A 3FR3A 4N0VA 1E7BA 1MM8A 4IELA 4F0BA 5AISA 4IVFA 3SIVB 1N5UA 4IKHA 3M8NA 2HRKA 4F5UA 4IS0A 3RGBC 6GSUA 5GINA 4ECCA 5EL8A 4GSTA 3FYGA 4TQ0A 1XWGA 2C8UA 2FHEA 3CWGA 2VUEA 3GTUA 9GSSA 4KAEA 2VCTA 4S1YA 6GSVA 2YDFA 3B9LA 3LU7A 4HZ4A 1LOTA 3GSSA 2O36A 1GTBA 1H9ZA 1RK4A 2IMKA 1TXUA 4HGMB 3V03A 4HOJA 5ELGA 18GSA 4ZB9A 2V36A 1HK3A 4ZBBA 4YQUA 3TOUA 8GSSA 4GLTA 3IK7A 4J2VA 3NVKA 3LU6A 2BXEA 1G6YA 2VKZG 2OACA 3A75A 5JCWA 5A5KA 1XW5A 1M9BA 3LJRA 3VQIA 2WJUA 1OE8A 2CAIA 3FR6A 4GSSA 4LMVA 3KTLA 3ICXA 3GUSA 2CVDA 11GSA 2FNOA 4G03A 4ZBAA 1G6WA 5D9XA 2WZSA 3JQZA 2Z8KA 1TW9A 3LQ7A 5ECPB 3G7IA 4KDXA 3MHHB 1B4PA 2CZ3A 3UAPA 3N5OA 2QHBA 1GLPA 1BG5A 5DALB 2E0XA 1E7HA 2GTUA 3MDKA 2OZBB 3M3MA 4Q5QA 2BXCA 4PHZC 1AO6A 4HI7A 3CSIA 3WHQA 4EMXA 4DHXB 2H1LA 3ZFBA 1PMTA 2YV7A 4BVXA 3ERGA 4C31B 2DBXA 4AKHA 4FIPB 4PUAA 3CRTA 5DCGA 4G0IA 4G0LA 1GSSA 5F0GA 3VPTA 5IQYA 3NVIA 1K3OA 2A2SA 2D2ZA 4MP4A 2C3QA 4KGIA 4W4UB 3BBYA 2LOQA 5D9TA 1FHEA 3KJLA 4KDYA 5GSTA 2YCDA 5DQFA 1M0UA 3R3EA 3FY7A 6GSXA 4LUFA 2GLRA 1BG1A 2GSQA 3I6AA 1OYJA 1BF5A 5J4UA 3FWBC 16GSA 4IGJA 1GTIA 4OMVA 6GSSA 2J9HA 4G01A 3TU3B 1PD21 3VURA 4EDYA 10GSA 4KDUA 1C72A 1KBNA 2C4JA 4L5OA 3Q19A 1NT2B 5FWGA 2QM6A 1TDIA 1VF3A 2PVQA 3IK9A 5ECHB 7GSSA 3I69A 3UBKA 4JEDA 2WVYA 4LA0A 3WD6A 3F63A 3QR6A 3M99C 2DC5A 4K0NA 1GSQA 5D9VA 1PKZA 2VCWA 5FUOA 3LYPA 5BPKA 3PGTA 4I9OA 4AKIA 2LXSA 5DALA 2BXBA 4ZBRA 2DG5A 3FNMA 2HQTA 4YAPA 5ECRB 1TF0A 3WHSA 4G04A 3VI7A 1YDKA 5D7GA 4DEJA 4ZB8A 2LJRA 2ON5A 2DYMA 5AN1A 3ECPA 4OFMA 4PI0C 5ECIB 3VI5A 2E0YA 5DDLA 4E68A 2AJEA 3IC8A 2WRTA 4I97A 4ZXGA 5J4VA 1SB0A 3SWLA 2DSAA 4DM0A 2GSTA 2UV8G 5GZZB 2XVQA 5ECQB 4ZCGA 2VCQA 5ECOB 5FT3A 4EC0A 4EDZA 3D0ZA 1AQWA 3H1NA 4O92A 2GSSA 2PGTA 4F5TA 4M70B 5JCUA 4KX4A 4L9QA 4BVYB 1DUGA 1PX7A 4JBBA 3B9MA 4E99A 1MA9A 1N2AA 1UA5A 2UZ8A 2BXKA 2WVXB 5AIVA 4PNGA 1K0MA 5J47A 1VF1A 2WVZA 1HK5A 4K2CA 2C3NA 4J2FA 3F6FA 4NHZA 3FRCA 3BPJA 2CA8A 4Q5NA 1EV4A 5KEJA 3M1GA 1PGTA 1VF4A 4K71A 5ECNB 4AI6A 4ECIA 2OA7A 1G7OA 1GNIA 5D73A 1GSUA 17GSA 1MUHA 1E78A 2ROHA 3M0FA 4PXOA 5A4VA 1O9XA 1Y1UA 4YAVA 4OTTA 2C3TA 2XVVA 4GDLB 2IMIA 3A73A 1PA3A 1KW2A 1LNSA 2LQHA 4NAXA 3CSJA 5J5NA 1GTUA 2GSRA 3DD3A 5G5EA 4E8HA 1KDXA 4HGKA 3U6VA 1TU7A 6GSWA 1GNJA 1GULA 4LMWA 1F2EA 2PERA 1JZRA 4WA6B 3P90A 1U88A 3NMUA 4FXYP 2CKXA 6GSTA 3KMNA 4F5SA 4BY9C 1M99A 1HNAA 4L5LA 3KXOA 1E6BA 5A1NB 2BXGA 1K0NA 1Q4JA 4G19A 2XVWA 5HFKA 3GQXA 2QMCA 2BXLA 19GSA 5D9WA 3VLNA 3SQJA 4QMKA 5A5HB 1YVLA 4OTUA 5ELAA 2HSNB 1TU8A 4BVYA 4MF6A 1K3LA 1HQOA 4PI2C 1OKTA 2BXFA 3QAVA 3GA9L 5ECSA 1K0BA 4OT2A 1V40A 2WVXA 5DJLA 1NHYA 3MAKA 22GSA 2CAQA 1E7FA 3UVHA 1PN9A 4PNFA 4OFNA 1YQ1A 1E7GA 2K0NA 3GH6A 2EFHA 3LFLA 2XSIA 1K3YA 4WR5A 6GSYA 3RFRC 4GDXA 2CZ2A 1IYIA 4ECBA 1EEMA 4IBPA 1MIWA 4TQ1A 3IBHA 3CRUA 2OADA 4N0UD 1VF2A 2GDRA 1SVMA 2XW1A 1B48A 2BXOA 2Z8IA 2NQOA 2DBUA 4ZBKA 5ID9A 1E7EA 4PGTA 2NNWA 2JL4A 1E7AA 4QQ7A 4KE3A 3FWCC 2AB6A 4ECJA 3HMJG 1AW9A 3GTUB 3L0HA 4PX1A 2BXQA 3TDLA 1JLVA 1KXPD 1GSDA 1USBA 3WYWA 1IYHA 3CSHA 1VFIA 2JUHA 3CBUA 5F07A 1EV9A 5A1NA 5F05A 1AQXA 2HSMB 3O76A 3UBLA 2DYOA 3C8EA 2DBWA 2VCXA 4ZBQA 1HK2A 2N5FA 4MK3A 2BXDA 2BXIA 1BYEA 4Z9OA 4O7HA 2A2RA 14GSA 2VCVA 5LD0A 1XW6A 3TGZA 4L9KA 3UARA 1S4BP 1BKEA 2PBJA 2R6KA 4NHWA 4Q5FA 4D7XA 5A5HA 1U87A 5IJEA 3PR8A 2OT3A 1GNWA 2HSNA 3PLAA 4E8EA 4W66A 2EFEA 1GTAA 3LXZA 5IJFA 1HK4A 1GSEA 4YH2A 4BL7B 2R3XA 1IJGA 2NTOA 4FJCB 2HRAA 2WW2A 5DQSA 3LYKA 2WW0A 4USSA 1E7IA 4PTSA 4FK5B 2EFCA 3VWXA 5A4UA 5ID7A 1AXDA 3FR9A 2VUFA 5FHIA 4MPGA 5ECKB 4KF9A 1GSYA 3QAGA 2BX8A 1ZGNA 4F0CA 1YKCA 3HKRA 4PQHA 5B5TA 1GLQA 1UORA 3MHSB 4Q5RA 4JZQA 1MIYA 4NAWB 2BXNA 4BKEA 4IQAA 20GSA 2XMOA 1F3BA 5F8BA 3PPUA 3ISOA 3GQUA 1PKWA 3ZMKA 3VK9A 4ZBDA 3Q18A 3WHRA 3DGQA 1YY7A 5BMUB 4KSMA 1BX9A 4IW2A 5GIOA 4PURA 1BAYA 3R2QA 2KWFA 5IIUA 1GUHA 4PO0A 5DAKB 4OFTA 5GHKA 1J78A 1PX6A 3HJOA 2R5GA 2YV9A 3G7JA 2F3MA 1V2AA 1GWCA
chains in the Genus database with same CATH topology
2HSMA 5IJ5A 3EINA 3JRYA 5J4YA 5EVOA 1LBKA 4ISDA 1Y6EA 5B7CA 5A4WA 3W8SA 1A0FA 3HJMA 4Z69A 3SIUB 4K0GA 5ECLB 3UIVA 3P8WA 4G9HA 2HNLA 2V6KA 4GF0A 1BM0A 2Z8JA 4YQMA 5G5FA 4N0FD 1ML6A 4GDKB 5DJMA 2VO4A 2O5VA 3V08A 4RI7A 3EE2A 2BXHA 2KBZA 1ZL9A 4BL7A 1F3AA 3CX9A 3KJYA 1JNBA 4ZUXV 2ON7A 1M9AA 2C80A 1MD4A 3NVMA 3F6DA 4ZC6A 3IR4A 2XW0A 4CHSA 1GUMA 2R4VA 4MZWA 3Q74A 12GSA 2AAWA 4GTUA 1PL1A 3KM6A 4IJIA 1R5AA 4G0KA 4ZB6A 1PL2A 3LSZA 1HK1A 1SVOA 1SVLA 3IE3A 13GSA 4GG2A 4MF7A 5A34B 3KIKA 5IFOA 2F8FA 2BXAA 2VD1A 3LG6A 3W1SA 1GUKA 1GSFA 4L8EA 4LB9A 4N3ZA 5J41A 3LU8A 5HOZA 3KMOA 5BMUA 5EY6A 4EXJA 2HRKB 3NIVA 5DAKA 4JK4A 2VD0A 4GSNA 4MF5A 4L8UA 3GURA 1HNBA 2VCZA 1J7EA 3V09A 5DBYA 3G9KD 4IW1A 2WS2A 4YQVA 3TOTA 4F5VA 4WR4A 1AQVA 5J40A 1K0DA 1OE7A 5GSSA 1Z9HA 2EFDA 2XVUA 3H37A 1JLWA 4HZ2A 1FOUA 2BXPA 1EOGA 1MIVA 4PQIA 1B8XA 1VZSA 4MBEC 4F03A 5AIXA 1MTCA 4IQ1A 1H5WA 1LJRA 4AKXB 1EOHA 2X64A 2IL3A 2WB9A 1K0CA 4MPFA 5IIHA 2VDBA 1GNEA 3QAWA 4G10A 4ID0A 3VPQA 5LCZA 1K0OA 1YJ6A 1XWKA 4MDCA 5F06A 4LB2A 2WDUA 2PMTA 3RBTA 3ZFLA 3H3AA 2BXMA 1K0AA 1U3IA 2AHEA 2I30A 1N25A 3AY8A 4LUHA 1HNCA 5AGYA 3ERFA 3ZMLA 4GDFA 1MD3A 3O3TA 5IIXA 5ECMB 4HJ2A 4AGSA 4OR0A 4RI6A 4ZB7A 5GIPA 1FW1A 2I2ZA 3N9JA 4ACSA 4IW9A 1HA2A 3GX0A 4FQUA 4AKGA 3LXTA 4TOPA 5A34A 1E7CA 3GSTA 4GCIA 4BVXB 1BJ5A 4KH7A 4EE0A 3FR3A 4N0VA 1E7BA 4IELA 4F0BA 5AISA 4IVFA 3SIVB 1N5UA 4IKHA 3M8NA 2HRKA 4F5UA 4IS0A 6GSUA 5GINA 4ECCA 5EL8A 4GSTA 3FYGA 4TQ0A 1XWGA 2C8UA 2FHEA 3CWGA 2VUEA 3GTUA 9GSSA 4KAEA 2VCTA 4S1YA 6GSVA 2YDFA 3B9LA 3LU7A 4HZ4A 1LOTA 3GSSA 1GTBA 1H9ZA 1RK4A 2IMKA 1TXUA 4HGMB 3V03A 4HOJA 5ELGA 18GSA 4ZB9A 2V36A 1HK3A 4ZBBA 4YQUA 3TOUA 8GSSA 4GLTA 3IK7A 4J2VA 3NVKA 3LU6A 2BXEA 1G6YA 2VKZG 2OACA 3A75A 5JCWA 5A5KA 1XW5A 1M9BA 3LJRA 3VQIA 2WJUA 1OE8A 2CAIA 3FR6A 4GSSA 4LMVA 3KTLA 3ICXA 3GUSA 2CVDA 11GSA 2FNOA 4G03A 4ZBAA 1G6WA 5D9XA 3JQZA 2Z8KA 1TW9A 3LQ7A 5ECPB 3G7IA 4KDXA 3MHHB 1B4PA 2CZ3A 3UAPA 3N5OA 2QHBA 1GLPA 1BG5A 5DALB 2E0XA 1E7HA 2GTUA 3MDKA 2OZBB 3M3MA 4Q5QA 2BXCA 1AO6A 4HI7A 3CSIA 3WHQA 4EMXA 4DHXB 2H1LA 3ZFBA 1PMTA 2YV7A 4BVXA 3ERGA 4C31B 2DBXA 4AKHA 4FIPB 4PUAA 3CRTA 5DCGA 4G0IA 4G0LA 1GSSA 5F0GA 3VPTA 5IQYA 3NVIA 1K3OA 2A2SA 2D2ZA 4MP4A 2C3QA 4KGIA 4W4UB 3BBYA 2LOQA 5D9TA 1FHEA 3KJLA 4KDYA 5GSTA 2YCDA 5DQFA 1M0UA 3R3EA 3FY7A 6GSXA 4LUFA 2GLRA 1BG1A 2GSQA 3I6AA 1OYJA 1BF5A 5J4UA 3FWBC 16GSA 4IGJA 1GTIA 4OMVA 6GSSA 2J9HA 4G01A 3TU3B 1PD21 3VURA 4EDYA 10GSA 4KDUA 1C72A 1KBNA 2C4JA 4L5OA 3Q19A 1NT2B 5FWGA 2QM6A 1TDIA 1VF3A 2PVQA 3IK9A 5ECHB 7GSSA 3I69A 3UBKA 4JEDA 4LA0A 3WD6A 3F63A 3QR6A 3M99C 2DC5A 4K0NA 1GSQA 5D9VA 1PKZA 2VCWA 5FUOA 3LYPA 5BPKA 3PGTA 4AKIA 5DALA 2BXBA 4ZBRA 2DG5A 3FNMA 2HQTA 4YAPA 5ECRB 1TF0A 3WHSA 4G04A 3VI7A 1YDKA 5D7GA 4DEJA 4ZB8A 2LJRA 2ON5A 2DYMA 5AN1A 4OFMA 5ECIB 3VI5A 2E0YA 5DDLA 4E68A 2AJEA 3IC8A 2WRTA 4I97A 4ZXGA 5J4VA 3SWLA 2DSAA 2GSTA 2UV8G 5GZZB 2XVQA 5ECQB 4ZCGA 2VCQA 5ECOB 5FT3A 4EC0A 4EDZA 3D0ZA 1AQWA 3H1NA 4O92A 2GSSA 2PGTA 4F5TA 4M70B 5JCUA 4KX4A 4L9QA 4BVYB 1DUGA 1PX7A 4JBBA 3B9MA 4E99A 1MA9A 1N2AA 1UA5A 2UZ8A 2BXKA 5AIVA 4PNGA 1K0MA 5J47A 1VF1A 1HK5A 4K2CA 2C3NA 4J2FA 3F6FA 4NHZA 3FRCA 2CA8A 4Q5NA 1EV4A 5KEJA 3M1GA 1PGTA 1VF4A 4K71A 5ECNB 4AI6A 4ECIA 2OA7A 1G7OA 1GNIA 5D73A 1GSUA 17GSA 1E78A 2ROHA 3M0FA 4PXOA 5A4VA 1O9XA 1Y1UA 4YAVA 4OTTA 2C3TA 2XVVA 4GDLB 2IMIA 3A73A 1PA3A 1KW2A 1LNSA 4NAXA 3CSJA 5J5NA 1GTUA 2GSRA 3DD3A 5G5EA 4E8HA 4HGKA 3U6VA 1TU7A 6GSWA 1GNJA 1GULA 4LMWA 1F2EA 2PERA 1JZRA 4WA6B 3P90A 1U88A 3NMUA 2CKXA 6GSTA 3KMNA 4F5SA 4BY9C 1M99A 1HNAA 4L5LA 3KXOA 1E6BA 5A1NB 2BXGA 1K0NA 1Q4JA 4G19A 2XVWA 5HFKA 3GQXA 2QMCA 2BXLA 19GSA 5D9WA 3VLNA 3SQJA 4QMKA 5A5HB 1YVLA 4OTUA 5ELAA 2HSNB 1TU8A 4BVYA 4MF6A 1K3LA 1HQOA 1OKTA 2BXFA 3QAVA 3GA9L 5ECSA 1K0BA 4OT2A 1V40A 5DJLA 1NHYA 3MAKA 22GSA 2CAQA 1E7FA 3UVHA 1PN9A 4PNFA 4OFNA 1YQ1A 1E7GA 3GH6A 2EFHA 3LFLA 2XSIA 1K3YA 4WR5A 6GSYA 4GDXA 2CZ2A 1IYIA 4ECBA 1EEMA 4IBPA 1MIWA 4TQ1A 3IBHA 3CRUA 2OADA 4N0UD 1VF2A 2GDRA 1SVMA 2XW1A 1B48A 2BXOA 2Z8IA 2NQOA 2DBUA 4ZBKA 5ID9A 1E7EA 4PGTA 2NNWA 2JL4A 1E7AA 4QQ7A 4KE3A 3FWCC 2AB6A 4ECJA 3HMJG 1AW9A 3GTUB 3L0HA 4PX1A 2BXQA 3TDLA 1JLVA 1KXPD 1GSDA 1USBA 3WYWA 1IYHA 3CSHA 1VFIA 2JUHA 3CBUA 5F07A 1EV9A 5A1NA 5F05A 1AQXA 2HSMB 3O76A 3UBLA 2DYOA 3C8EA 2DBWA 2VCXA 4ZBQA 1HK2A 2N5FA 4MK3A 2BXDA 2BXIA 1BYEA 4Z9OA 4O7HA 2A2RA 14GSA 2VCVA 5LD0A 1XW6A 3TGZA 4L9KA 3UARA 2PBJA 1BKEA 2R6KA 4NHWA 4Q5FA 5A5HA 1U87A 5IJEA 3PR8A 2OT3A 1GNWA 2HSNA 3PLAA 4E8EA 4W66A 2EFEA 1GTAA 3LXZA 5IJFA 1HK4A 1GSEA 4YH2A 4BL7B 2R3XA 1IJGA 2NTOA 4FJCB 2HRAA 5DQSA 3LYKA 4USSA 1E7IA 4PTSA 4FK5B 2EFCA 3VWXA 5A4UA 5ID7A 1AXDA 3FR9A 2VUFA 5FHIA 4MPGA 5ECKB 4KF9A 1GSYA 3QAGA 2BX8A 1ZGNA 4F0CA 1YKCA 3HKRA 4PQHA 5B5TA 1GLQA 1UORA 3MHSB 4Q5RA 4JZQA 1MIYA 4NAWB 2BXNA 4BKEA 4IQAA 20GSA 2XMOA 1F3BA 5F8BA 3PPUA 3ISOA 3GQUA 1PKWA 3ZMKA 3VK9A 4ZBDA 3Q18A 3WHRA 3DGQA 1YY7A 5BMUB 4KSMA 1BX9A 4IW2A 5GIOA 4PURA 1BAYA 3R2QA 5IIUA 1GUHA 4PO0A 5DAKB 4OFTA 5GHKA 1J78A 1PX6A 3HJOA 2R5GA 2YV9A 3G7JA 2F3MA 1V2AA 1GWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G01 A;  1TXU A;  2EFE A;  2EFD A;  2EFH A;  2EFC A;  2OT3 A;  4N3Z A; 
#chains in the Genus database with same CATH topology
 2HSM A;  5IJ5 A;  3EIN A;  3JRY A;  5J4Y A;  5EVO A;  1LBK A;  4ISD A;  1Y6E A;  5B7C A;  5A4W A;  3W8S A;  1A0F A;  3HJM A;  4Z69 A;  3SIU B;  4K0G A;  5ECL B;  3UIV A;  3P8W A;  1YEW C;  4G9H A;  2HNL A;  2V6K A;  4GF0 A;  1BM0 A;  2Z8J A;  4YQM A;  5G5F A;  4N0F D;  1ML6 A;  4GDK B;  5DJM A;  2VO4 A;  2O5V A;  3V08 A;  4RI7 A;  3EE2 A;  2BXH A;  2KBZ A;  1ZL9 A;  4BL7 A;  1F3A A;  3CX9 A;  3KJY A;  1JNB A;  4ZUX V;  2ON7 A;  1M9A A;  2C80 A;  1MD4 A;  3NVM A;  3F6D A;  4ZC6 A;  3IR4 A;  2XW0 A;  4CHS A;  1GUM A;  2R4V A;  2O3E A;  4MZW A;  3Q74 A;  12GS A;  2AAW A;  4GTU A;  1PL1 A;  3KM6 A;  4IJI A;  1R5A A;  4G0K A;  4ZB6 A;  1PL2 A;  3LSZ A;  1HK1 A;  1SVO A;  1SVL A;  3IE3 A;  2AGH B;  13GS A;  4GG2 A;  4MF7 A;  5A34 B;  3KIK A;  5IFO A;  1I1I P;  2F8F A;  2BXA A;  2VD1 A;  3LG6 A;  3W1S A;  1GUK A;  1GSF A;  4L8E A;  2GUT A;  4LB9 A;  4N3Z A;  5J41 A;  3LU8 A;  5HOZ A;  3KMO A;  5BMU A;  5EY6 A;  2LXT A;  4EXJ A;  2HRK B;  3NIV A;  5DAK A;  4JK4 A;  2VD0 A;  4GSN A;  4MF5 A;  4L8U A;  3GUR A;  1HNB A;  2VCZ A;  1J7E A;  3V09 A;  5DBY A;  3G9K D;  4IW1 A;  1MUS A;  2WS2 A;  4YQV A;  3TOT A;  4F5V A;  4WR4 A;  1AQV A;  5J40 A;  1K0D A;  1OE7 A;  5GSS A;  1Z9H A;  2EFD A;  2XVU A;  3H37 A;  1JLW A;  4HZ2 A;  1FOU A;  2BXP A;  1EOG A;  1MIV A;  2LQI A;  1B8X A;  1VZS A;  4MBE C;  4PQI A;  4F03 A;  5AIX A;  1MTC A;  2WW1 A;  4IQ1 A;  1H5W A;  1LJR A;  4AKX B;  1EOH A;  2X64 A;  2IL3 A;  2WB9 A;  1K0C A;  4MPF A;  5IIH A;  2VDB A;  1GNE A;  3QAW A;  4G10 A;  4ID0 A;  3VPQ A;  5LCZ A;  1K0O A;  1YJ6 A;  1XWK A;  4MDC A;  5F06 A;  4LB2 A;  2WDU A;  2PMT A;  3RBT A;  3ZFL A;  3H3A A;  2BXM A;  1K0A A;  1U3I A;  2AHE A;  2I30 A;  1N25 A;  3AY8 A;  4LUH A;  1HNC A;  5AGY A;  3ERF A;  3ZML A;  4GDF A;  1MD3 A;  2WW3 A;  3O3T A;  5IIX A;  5ECM B;  4HJ2 A;  4AGS A;  4OR0 A;  4RI6 A;  4ZB7 A;  5GIP A;  1FW1 A;  2I2Z A;  3N9J A;  4ACS A;  4IW9 A;  1HA2 A;  3GX0 A;  4FQU A;  4AKG A;  3LXT A;  4TOP A;  5A34 A;  1E7C A;  3CHX C;  3GST A;  4GCI A;  4BVX B;  1BJ5 A;  4KH7 A;  4EE0 A;  3FR3 A;  4N0V A;  1E7B A;  1MM8 A;  4IEL A;  4F0B A;  5AIS A;  4IVF A;  3SIV B;  1N5U A;  4IKH A;  3M8N A;  2HRK A;  4F5U A;  4IS0 A;  3RGB C;  6GSU A;  5GIN A;  4ECC A;  5EL8 A;  4GST A;  3FYG A;  4TQ0 A;  1XWG A;  2C8U A;  2FHE A;  3CWG A;  2VUE A;  3GTU A;  9GSS A;  4KAE A;  2VCT A;  4S1Y A;  6GSV A;  2YDF A;  3B9L A;  3LU7 A;  4HZ4 A;  1LOT A;  3GSS A;  2O36 A;  1GTB A;  1H9Z A;  1RK4 A;  2IMK A;  1TXU A;  4HGM B;  3V03 A;  4HOJ A;  5ELG A;  18GS A;  4ZB9 A;  2V36 A;  1HK3 A;  4ZBB A;  4YQU A;  3TOU A;  8GSS A;  4GLT A;  3IK7 A;  4J2V A;  3NVK A;  3LU6 A;  2BXE A;  1G6Y A;  2VKZ G;  2OAC A;  3A75 A;  5JCW A;  5A5K A;  1XW5 A;  1M9B A;  3LJR A;  3VQI A;  2WJU A;  1OE8 A;  2CAI A;  3FR6 A;  4GSS A;  4LMV A;  3KTL A;  3ICX A;  3GUS A;  2CVD A;  11GS A;  2FNO A;  4G03 A;  4ZBA A;  1G6W A;  5D9X A;  2WZS A;  3JQZ A;  2Z8K A;  1TW9 A;  3LQ7 A;  5ECP B;  3G7I A;  4KDX A;  3MHH B;  1B4P A;  2CZ3 A;  3UAP A;  3N5O A;  2QHB A;  1GLP A;  1BG5 A;  5DAL B;  2E0X A;  1E7H A;  2GTU A;  3MDK A;  2OZB B;  3M3M A;  4Q5Q A;  2BXC A;  4PHZ C;  1AO6 A;  4HI7 A;  3CSI A;  3WHQ A;  4EMX A;  4DHX B;  2H1L A;  3ZFB A;  1PMT A;  2YV7 A;  4BVX A;  3ERG A;  4C31 B;  2DBX A;  4AKH A;  4FIP B;  4PUA A;  3CRT A;  5DCG A;  4G0I A;  4G0L A;  1GSS A;  5F0G A;  3VPT A;  5IQY A;  3NVI A;  1K3O A;  2A2S A;  2D2Z A;  4MP4 A;  2C3Q A;  4KGI A;  4W4U B;  3BBY A;  2LOQ A;  5D9T A;  1FHE A;  3KJL A;  4KDY A;  5GST A;  2YCD A;  5DQF A;  1M0U A;  3R3E A;  3FY7 A;  6GSX A;  4LUF A;  2GLR A;  1BG1 A;  2GSQ A;  3I6A A;  1OYJ A;  1BF5 A;  5J4U A;  3FWB C;  16GS A;  4IGJ A;  1GTI A;  4OMV A;  6GSS A;  2J9H A;  4G01 A;  3TU3 B;  1PD2 1;  3VUR A;  4EDY A;  10GS A;  4KDU A;  1C72 A;  1KBN A;  2C4J A;  4L5O A;  3Q19 A;  1NT2 B;  5FWG A;  2QM6 A;  1TDI A;  1VF3 A;  2PVQ A;  3IK9 A;  5ECH B;  7GSS A;  3I69 A;  3UBK A;  4JED A;  2WVY A;  4LA0 A;  3WD6 A;  3F63 A;  3QR6 A;  3M99 C;  2DC5 A;  4K0N A;  1GSQ A;  5D9V A;  1PKZ A;  2VCW A;  5FUO A;  3LYP A;  5BPK A;  3PGT A;  4I9O A;  4AKI A;  2LXS A;  5DAL A;  2BXB A;  4ZBR A;  2DG5 A;  3FNM A;  2HQT A;  4YAP A;  5ECR B;  1TF0 A;  3WHS A;  4G04 A;  3VI7 A;  1YDK A;  5D7G A;  4DEJ A;  4ZB8 A;  2LJR A;  2ON5 A;  2DYM A;  5AN1 A;  3ECP A;  4OFM A;  4PI0 C;  5ECI B;  3VI5 A;  2E0Y A;  5DDL A;  4E68 A;  2AJE A;  3IC8 A;  2WRT A;  4I97 A;  4ZXG A;  5J4V A;  1SB0 A;  3SWL A;  2DSA A;  4DM0 A;  2GST A;  2UV8 G;  5GZZ B;  2XVQ A;  5ECQ B;  4ZCG A;  2VCQ A;  5ECO B;  5FT3 A;  4EC0 A;  4EDZ A;  3D0Z A;  1AQW A;  3H1N A;  4O92 A;  2GSS A;  2PGT A;  4F5T A;  4M70 B;  5JCU A;  4KX4 A;  4L9Q A;  4BVY B;  1DUG A;  1PX7 A;  4JBB A;  3B9M A;  4E99 A;  1MA9 A;  1N2A A;  1UA5 A;  2UZ8 A;  2BXK A;  2WVX B;  5AIV A;  4PNG A;  1K0M A;  5J47 A;  1VF1 A;  2WVZ A;  1HK5 A;  4K2C A;  2C3N A;  4J2F A;  3F6F A;  4NHZ A;  3FRC A;  3BPJ A;  2CA8 A;  4Q5N A;  1EV4 A;  5KEJ A;  3M1G A;  1PGT A;  1VF4 A;  4K71 A;  5ECN B;  4AI6 A;  4ECI A;  2OA7 A;  1G7O A;  1GNI A;  5D73 A;  1GSU A;  17GS A;  1MUH A;  1E78 A;  2ROH A;  3M0F A;  4PXO A;  5A4V A;  1O9X A;  1Y1U A;  4YAV A;  4OTT A;  2C3T A;  2XVV A;  4GDL B;  2IMI A;  3A73 A;  1PA3 A;  1KW2 A;  1LNS A;  2LQH A;  4NAX A;  3CSJ A;  5J5N A;  1GTU A;  2GSR A;  3DD3 A;  5G5E A;  4E8H A;  1KDX A;  4HGK A;  3U6V A;  1TU7 A;  6GSW A;  1GNJ A;  1GUL A;  4LMW A;  1F2E A;  2PER A;  1JZR A;  4WA6 B;  3P90 A;  1U88 A;  3NMU A;  4FXY P;  2CKX A;  6GST A;  3KMN A;  4F5S A;  4BY9 C;  1M99 A;  1HNA A;  4L5L A;  3KXO A;  1E6B A;  5A1N B;  2BXG A;  1K0N A;  1Q4J A;  4G19 A;  2XVW A;  5HFK A;  3GQX A;  2QMC A;  2BXL A;  19GS A;  5D9W A;  3VLN A;  3SQJ A;  4QMK A;  5A5H B;  1YVL A;  4OTU A;  5ELA A;  2HSN B;  1TU8 A;  4BVY A;  4MF6 A;  1K3L A;  1HQO A;  4PI2 C;  1OKT A;  2BXF A;  3QAV A;  3GA9 L;  5ECS A;  1K0B A;  4OT2 A;  1V40 A;  2WVX A;  5DJL A;  1NHY A;  3MAK A;  22GS A;  2CAQ A;  1E7F A;  3UVH A;  1PN9 A;  4PNF A;  4OFN A;  1YQ1 A;  1E7G A;  2K0N A;  3GH6 A;  2EFH A;  3LFL A;  2XSI A;  1K3Y A;  4WR5 A;  6GSY A;  3RFR C;  4GDX A;  2CZ2 A;  1IYI A;  4ECB A;  1EEM A;  4IBP A;  1MIW A;  4TQ1 A;  3IBH A;  3CRU A;  2OAD A;  4N0U D;  1VF2 A;  2GDR A;  1SVM A;  2XW1 A;  1B48 A;  2BXO A;  2Z8I A;  2NQO A;  2DBU A;  4ZBK A;  5ID9 A;  1E7E A;  4PGT A;  2NNW A;  2JL4 A;  1E7A A;  4QQ7 A;  4KE3 A;  3FWC C;  2AB6 A;  4ECJ A;  3HMJ G;  1AW9 A;  3GTU B;  3L0H A;  4PX1 A;  2BXQ A;  3TDL A;  1JLV A;  1KXP D;  1GSD A;  1USB A;  3WYW A;  1IYH A;  3CSH A;  1VFI A;  2JUH A;  3CBU A;  5F07 A;  1EV9 A;  5A1N A;  5F05 A;  1AQX A;  2HSM B;  3O76 A;  3UBL A;  2DYO A;  3C8E A;  2DBW A;  2VCX A;  4ZBQ A;  1HK2 A;  2N5F A;  4MK3 A;  2BXD A;  2BXI A;  1BYE A;  4Z9O A;  4O7H A;  2A2R A;  14GS A;  2VCV A;  5LD0 A;  1XW6 A;  3TGZ A;  4L9K A;  3UAR A;  1S4B P;  1BKE A;  2PBJ A;  2R6K A;  4NHW A;  4Q5F A;  4D7X A;  5A5H A;  1U87 A;  5IJE A;  3PR8 A;  2OT3 A;  1GNW A;  2HSN A;  3PLA A;  4E8E A;  4W66 A;  2EFE A;  1GTA A;  3LXZ A;  5IJF A;  1HK4 A;  1GSE A;  4YH2 A;  4BL7 B;  2R3X A;  1IJG A;  2NTO A;  4FJC B;  2HRA A;  2WW2 A;  5DQS A;  3LYK A;  2WW0 A;  4USS A;  1E7I A;  4PTS A;  4FK5 B;  2EFC A;  3VWX A;  5A4U A;  5ID7 A;  1AXD A;  3FR9 A;  2VUF A;  5FHI A;  4MPG A;  5ECK B;  4KF9 A;  1GSY A;  3QAG A;  2BX8 A;  1ZGN A;  4F0C A;  1YKC A;  3HKR A;  4PQH A;  5B5T A;  1GLQ A;  1UOR A;  3MHS B;  4Q5R A;  4JZQ A;  1MIY A;  4NAW B;  2BXN A;  4BKE A;  4IQA A;  20GS A;  2XMO A;  1F3B A;  5F8B A;  3PPU A;  3ISO A;  3GQU A;  1PKW A;  3ZMK A;  3VK9 A;  4ZBD A;  3Q18 A;  3WHR A;  3DGQ A;  1YY7 A;  5BMU B;  4KSM A;  1BX9 A;  4IW2 A;  5GIO A;  4PUR A;  1BAY A;  3R2Q A;  2KWF A;  5IIU A;  1GUH A;  4PO0 A;  5DAK B;  4OFT A;  5GHK A;  1J78 A;  1PX6 A;  3HJO A;  2R5G A;  2YV9 A;  3G7J A;  2F3M A;  1V2A A;  1GWC A; 
#chains in the Genus database with same CATH homology
 2HSM A;  5IJ5 A;  3EIN A;  3JRY A;  5J4Y A;  5EVO A;  1LBK A;  4ISD A;  1Y6E A;  5B7C A;  5A4W A;  3W8S A;  1A0F A;  3HJM A;  4Z69 A;  3SIU B;  4K0G A;  5ECL B;  3UIV A;  3P8W A;  4G9H A;  2HNL A;  2V6K A;  4GF0 A;  1BM0 A;  2Z8J A;  4YQM A;  5G5F A;  4N0F D;  1ML6 A;  4GDK B;  5DJM A;  2VO4 A;  2O5V A;  3V08 A;  4RI7 A;  3EE2 A;  2BXH A;  2KBZ A;  1ZL9 A;  4BL7 A;  1F3A A;  3CX9 A;  3KJY A;  1JNB A;  4ZUX V;  2ON7 A;  1M9A A;  2C80 A;  1MD4 A;  3NVM A;  3F6D A;  4ZC6 A;  3IR4 A;  2XW0 A;  4CHS A;  1GUM A;  2R4V A;  4MZW A;  3Q74 A;  12GS A;  2AAW A;  4GTU A;  1PL1 A;  3KM6 A;  4IJI A;  1R5A A;  4G0K A;  4ZB6 A;  1PL2 A;  3LSZ A;  1HK1 A;  1SVO A;  1SVL A;  3IE3 A;  13GS A;  4GG2 A;  4MF7 A;  5A34 B;  3KIK A;  5IFO A;  2F8F A;  2BXA A;  2VD1 A;  3LG6 A;  3W1S A;  1GUK A;  1GSF A;  4L8E A;  4LB9 A;  4N3Z A;  5J41 A;  3LU8 A;  5HOZ A;  3KMO A;  5BMU A;  5EY6 A;  4EXJ A;  2HRK B;  3NIV A;  5DAK A;  4JK4 A;  2VD0 A;  4GSN A;  4MF5 A;  4L8U A;  3GUR A;  1HNB A;  2VCZ A;  1J7E A;  3V09 A;  5DBY A;  3G9K D;  4IW1 A;  2WS2 A;  4YQV A;  3TOT A;  4F5V A;  4WR4 A;  1AQV A;  5J40 A;  1K0D A;  1OE7 A;  5GSS A;  1Z9H A;  2EFD A;  2XVU A;  3H37 A;  1JLW A;  4HZ2 A;  1FOU A;  2BXP A;  1EOG A;  1MIV A;  4PQI A;  1B8X A;  1VZS A;  4MBE C;  4F03 A;  5AIX A;  1MTC A;  4IQ1 A;  1H5W A;  1LJR A;  4AKX B;  1EOH A;  2X64 A;  2IL3 A;  2WB9 A;  1K0C A;  4MPF A;  5IIH A;  2VDB A;  1GNE A;  3QAW A;  4G10 A;  4ID0 A;  3VPQ A;  5LCZ A;  1K0O A;  1YJ6 A;  1XWK A;  4MDC A;  5F06 A;  4LB2 A;  2WDU A;  2PMT A;  3RBT A;  3ZFL A;  3H3A A;  2BXM A;  1K0A A;  1U3I A;  2AHE A;  2I30 A;  1N25 A;  3AY8 A;  4LUH A;  1HNC A;  5AGY A;  3ERF A;  3ZML A;  4GDF A;  1MD3 A;  3O3T A;  5IIX A;  5ECM B;  4HJ2 A;  4AGS A;  4OR0 A;  4RI6 A;  4ZB7 A;  5GIP A;  1FW1 A;  2I2Z A;  3N9J A;  4ACS A;  4IW9 A;  1HA2 A;  3GX0 A;  4FQU A;  4AKG A;  3LXT A;  4TOP A;  5A34 A;  1E7C A;  3GST A;  4GCI A;  4BVX B;  1BJ5 A;  4KH7 A;  4EE0 A;  3FR3 A;  4N0V A;  1E7B A;  4IEL A;  4F0B A;  5AIS A;  4IVF A;  3SIV B;  1N5U A;  4IKH A;  3M8N A;  2HRK A;  4F5U A;  4IS0 A;  6GSU A;  5GIN A;  4ECC A;  5EL8 A;  4GST A;  3FYG A;  4TQ0 A;  1XWG A;  2C8U A;  2FHE A;  3CWG A;  2VUE A;  3GTU A;  9GSS A;  4KAE A;  2VCT A;  4S1Y A;  6GSV A;  2YDF A;  3B9L A;  3LU7 A;  4HZ4 A;  1LOT A;  3GSS A;  1GTB A;  1H9Z A;  1RK4 A;  2IMK A;  1TXU A;  4HGM B;  3V03 A;  4HOJ A;  5ELG A;  18GS A;  4ZB9 A;  2V36 A;  1HK3 A;  4ZBB A;  4YQU A;  3TOU A;  8GSS A;  4GLT A;  3IK7 A;  4J2V A;  3NVK A;  3LU6 A;  2BXE A;  1G6Y A;  2VKZ G;  2OAC A;  3A75 A;  5JCW A;  5A5K A;  1XW5 A;  1M9B A;  3LJR A;  3VQI A;  2WJU A;  1OE8 A;  2CAI A;  3FR6 A;  4GSS A;  4LMV A;  3KTL A;  3ICX A;  3GUS A;  2CVD A;  11GS A;  2FNO A;  4G03 A;  4ZBA A;  1G6W A;  5D9X A;  3JQZ A;  2Z8K A;  1TW9 A;  3LQ7 A;  5ECP B;  3G7I A;  4KDX A;  3MHH B;  1B4P A;  2CZ3 A;  3UAP A;  3N5O A;  2QHB A;  1GLP A;  1BG5 A;  5DAL B;  2E0X A;  1E7H A;  2GTU A;  3MDK A;  2OZB B;  3M3M A;  4Q5Q A;  2BXC A;  1AO6 A;  4HI7 A;  3CSI A;  3WHQ A;  4EMX A;  4DHX B;  2H1L A;  3ZFB A;  1PMT A;  2YV7 A;  4BVX A;  3ERG A;  4C31 B;  2DBX A;  4AKH A;  4FIP B;  4PUA A;  3CRT A;  5DCG A;  4G0I A;  4G0L A;  1GSS A;  5F0G A;  3VPT A;  5IQY A;  3NVI A;  1K3O A;  2A2S A;  2D2Z A;  4MP4 A;  2C3Q A;  4KGI A;  4W4U B;  3BBY A;  2LOQ A;  5D9T A;  1FHE A;  3KJL A;  4KDY A;  5GST A;  2YCD A;  5DQF A;  1M0U A;  3R3E A;  3FY7 A;  6GSX A;  4LUF A;  2GLR A;  1BG1 A;  2GSQ A;  3I6A A;  1OYJ A;  1BF5 A;  5J4U A;  3FWB C;  16GS A;  4IGJ A;  1GTI A;  4OMV A;  6GSS A;  2J9H A;  4G01 A;  3TU3 B;  1PD2 1;  3VUR A;  4EDY A;  10GS A;  4KDU A;  1C72 A;  1KBN A;  2C4J A;  4L5O A;  3Q19 A;  1NT2 B;  5FWG A;  2QM6 A;  1TDI A;  1VF3 A;  2PVQ A;  3IK9 A;  5ECH B;  7GSS A;  3I69 A;  3UBK A;  4JED A;  4LA0 A;  3WD6 A;  3F63 A;  3QR6 A;  3M99 C;  2DC5 A;  4K0N A;  1GSQ A;  5D9V A;  1PKZ A;  2VCW A;  5FUO A;  3LYP A;  5BPK A;  3PGT A;  4AKI A;  5DAL A;  2BXB A;  4ZBR A;  2DG5 A;  3FNM A;  2HQT A;  4YAP A;  5ECR B;  1TF0 A;  3WHS A;  4G04 A;  3VI7 A;  1YDK A;  5D7G A;  4DEJ A;  4ZB8 A;  2LJR A;  2ON5 A;  2DYM A;  5AN1 A;  4OFM A;  5ECI B;  3VI5 A;  2E0Y A;  5DDL A;  4E68 A;  2AJE A;  3IC8 A;  2WRT A;  4I97 A;  4ZXG A;  5J4V A;  3SWL A;  2DSA A;  2GST A;  2UV8 G;  5GZZ B;  2XVQ A;  5ECQ B;  4ZCG A;  2VCQ A;  5ECO B;  5FT3 A;  4EC0 A;  4EDZ A;  3D0Z A;  1AQW A;  3H1N A;  4O92 A;  2GSS A;  2PGT A;  4F5T A;  4M70 B;  5JCU A;  4KX4 A;  4L9Q A;  4BVY B;  1DUG A;  1PX7 A;  4JBB A;  3B9M A;  4E99 A;  1MA9 A;  1N2A A;  1UA5 A;  2UZ8 A;  2BXK A;  5AIV A;  4PNG A;  1K0M A;  5J47 A;  1VF1 A;  1HK5 A;  4K2C A;  2C3N A;  4J2F A;  3F6F A;  4NHZ A;  3FRC A;  2CA8 A;  4Q5N A;  1EV4 A;  5KEJ A;  3M1G A;  1PGT A;  1VF4 A;  4K71 A;  5ECN B;  4AI6 A;  4ECI A;  2OA7 A;  1G7O A;  1GNI A;  5D73 A;  1GSU A;  17GS A;  1E78 A;  2ROH A;  3M0F A;  4PXO A;  5A4V A;  1O9X A;  1Y1U A;  4YAV A;  4OTT A;  2C3T A;  2XVV A;  4GDL B;  2IMI A;  3A73 A;  1PA3 A;  1KW2 A;  1LNS A;  4NAX A;  3CSJ A;  5J5N A;  1GTU A;  2GSR A;  3DD3 A;  5G5E A;  4E8H A;  4HGK A;  3U6V A;  1TU7 A;  6GSW A;  1GNJ A;  1GUL A;  4LMW A;  1F2E A;  2PER A;  1JZR A;  4WA6 B;  3P90 A;  1U88 A;  3NMU A;  2CKX A;  6GST A;  3KMN A;  4F5S A;  4BY9 C;  1M99 A;  1HNA A;  4L5L A;  3KXO A;  1E6B A;  5A1N B;  2BXG A;  1K0N A;  1Q4J A;  4G19 A;  2XVW A;  5HFK A;  3GQX A;  2QMC A;  2BXL A;  19GS A;  5D9W A;  3VLN A;  3SQJ A;  4QMK A;  5A5H B;  1YVL A;  4OTU A;  5ELA A;  2HSN B;  1TU8 A;  4BVY A;  4MF6 A;  1K3L A;  1HQO A;  1OKT A;  2BXF A;  3QAV A;  3GA9 L;  5ECS A;  1K0B A;  4OT2 A;  1V40 A;  5DJL A;  1NHY A;  3MAK A;  22GS A;  2CAQ A;  1E7F A;  3UVH A;  1PN9 A;  4PNF A;  4OFN A;  1YQ1 A;  1E7G A;  3GH6 A;  2EFH A;  3LFL A;  2XSI A;  1K3Y A;  4WR5 A;  6GSY A;  4GDX A;  2CZ2 A;  1IYI A;  4ECB A;  1EEM A;  4IBP A;  1MIW A;  4TQ1 A;  3IBH A;  3CRU A;  2OAD A;  4N0U D;  1VF2 A;  2GDR A;  1SVM A;  2XW1 A;  1B48 A;  2BXO A;  2Z8I A;  2NQO A;  2DBU A;  4ZBK A;  5ID9 A;  1E7E A;  4PGT A;  2NNW A;  2JL4 A;  1E7A A;  4QQ7 A;  4KE3 A;  3FWC C;  2AB6 A;  4ECJ A;  3HMJ G;  1AW9 A;  3GTU B;  3L0H A;  4PX1 A;  2BXQ A;  3TDL A;  1JLV A;  1KXP D;  1GSD A;  1USB A;  3WYW A;  1IYH A;  3CSH A;  1VFI A;  2JUH A;  3CBU A;  5F07 A;  1EV9 A;  5A1N A;  5F05 A;  1AQX A;  2HSM B;  3O76 A;  3UBL A;  2DYO A;  3C8E A;  2DBW A;  2VCX A;  4ZBQ A;  1HK2 A;  2N5F A;  4MK3 A;  2BXD A;  2BXI A;  1BYE A;  4Z9O A;  4O7H A;  2A2R A;  14GS A;  2VCV A;  5LD0 A;  1XW6 A;  3TGZ A;  4L9K A;  3UAR A;  2PBJ A;  1BKE A;  2R6K A;  4NHW A;  4Q5F A;  5A5H A;  1U87 A;  5IJE A;  3PR8 A;  2OT3 A;  1GNW A;  2HSN A;  3PLA A;  4E8E A;  4W66 A;  2EFE A;  1GTA A;  3LXZ A;  5IJF A;  1HK4 A;  1GSE A;  4YH2 A;  4BL7 B;  2R3X A;  1IJG A;  2NTO A;  4FJC B;  2HRA A;  5DQS A;  3LYK A;  4USS A;  1E7I A;  4PTS A;  4FK5 B;  2EFC A;  3VWX A;  5A4U A;  5ID7 A;  1AXD A;  3FR9 A;  2VUF A;  5FHI A;  4MPG A;  5ECK B;  4KF9 A;  1GSY A;  3QAG A;  2BX8 A;  1ZGN A;  4F0C A;  1YKC A;  3HKR A;  4PQH A;  5B5T A;  1GLQ A;  1UOR A;  3MHS B;  4Q5R A;  4JZQ A;  1MIY A;  4NAW B;  2BXN A;  4BKE A;  4IQA A;  20GS A;  2XMO A;  1F3B A;  5F8B A;  3PPU A;  3ISO A;  3GQU A;  1PKW A;  3ZMK A;  3VK9 A;  4ZBD A;  3Q18 A;  3WHR A;  3DGQ A;  1YY7 A;  5BMU B;  4KSM A;  1BX9 A;  4IW2 A;  5GIO A;  4PUR A;  1BAY A;  3R2Q A;  5IIU A;  1GUH A;  4PO0 A;  5DAK B;  4OFT A;  5GHK A;  1J78 A;  1PX6 A;  3HJO A;  2R5G A;  2YV9 A;  3G7J A;  2F3M A;  1V2A A;  1GWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...