1TXUA

Crystal structure of the vps9 domain of rabex-5
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
254
Chain Sequence
b'ETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rab5 GDP/GTP exchange factor
publication title Structure, exchange determinants, and family-wide rab specificity of the tandem helical bundle and Vps9 domains of Rabex-5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 87
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01754 zf-A20 A20-like zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.120 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 1txuA01
1.20.1050.80 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1txuA02
2EFCA 1TXUA 2EFHA 4G01A 4N3ZA 2OT3A 2EFDA 2EFEA
chains in the Genus database with same CATH superfamily
3DD3A 5LD0A 3UVHA 4F03A 2PERA 5JCWA 3LJRA 1RK4A 1HK1A 4L5LA 5ECSA 1DUGA 1TXUA 3NMUA 5F8BA 4ZBAA 1PL2A 5IJFA 4NAWB 4I97A 1LNSA 1E78A 2HSMA 4IW9A 4PI2C 3QAWA 4QQ7A 4F5SA 5IIHA 3FY7A 2R5GA 5ID7A 4MF7A 4LB9A 1N25A 1MIYA 1HK5A 9GSSA 5ECIB 1G6YA 1HA2A 18GSA 3PR8A 3VURA 5DQSA 1XW5A 2FNOA 4HGKA 1KBNA 5F07A 3KJYA 1J7EA 1HK3A 4Q5QA 4EXJA 3TDLA 4OFNA 5J4VA 2PGTA 3LYKA 2HSNA 2YCDA 5ECQB 3I69A 2LQHA 1E7HA 4KF9A 4ECCA 4AI6A 3R2QA 2AJEA 1C72A 4EDZA 4IBPA 2AAWA 3BPJA 3W8SA 5IFOA 1MIVA 4K0NA 4KE3A 1U87A 5ELAA 4ZB7A 2XMOA 2Z8JA 4IW1A 2GSQA 4G0IA 4JEDA 2YV9A 1XW6A 5J4UA 3VI7A 2VUEA 3SIUB 2PBJA 5AIXA 1TU8A 3PGTA 3Q18A 5DJMA 3M3MA 4F0BA 5LCZA 2AGHB 3LXZA 3KM6A 3HKRA 3W1SA 4MZWA 4GG2A 1BF5A 2WVXA 3HJMA 1MUSA 4PTSA 2PVQA 4BVYA 2CAQA 3N5OA 2WW0A 4ZCGA 1Z9HA 4AGSA 2WW3A 2VDBA 4E8HA 1FW1A 2EFDA 4L9KA 1K3YA 3VI5A 4GDKB 6GSSA 2EFEA 3B9LA 3MAKA 1AXDA 3D0ZA 2VUFA 3CRTA 4F5TA 2GUTA 3CWGA 3GX0A 4FJCB 1GSSA 4K0GA 3M0FA 5ID9A 5G5EA 2AHEA 1K0NA 3ZMKA 2CKXA 1IYHA 2BXGA 2BXKA 5B5TA 4MK3A 3TU3B 4BL7B 1K0AA 3IK9A 3SIVB 3UARA 5GSSA 4G0LA 4Q5RA 1GTIA 4MP4A 4ECBA 1YEWC 3IE3A 4IGJA 3NIVA 1VF4A 3Q74A 2GSSA 3FWBC 4MPGA 1YY7A 3CSIA 2CAIA 2C8UA 2HRKB 1K3LA 4G10A 1GSUA 5A4VA 2DBXA 1MUHA 2PMTA 4GDLB 2O36A 3FR9A 3M8NA 8GSSA 4FQUA 1PGTA 5DDLA 2O3EA 3VPQA 4YQVA 4MPFA 4N0VA 2BXMA 4W4UB 1S4BP 3IK7A 4PHZC 4I9OA 3FWCC 1HNAA 5IQYA 4HI7A 2NNWA 2GSTA 2I2ZA 3GQUA 4G19A 5ECPB 4Z9OA 1E7IA 4YH2A 3V08A 1H9ZA 2ON5A 1M99A 3U6VA 4L8EA 1BAYA 3MHHB 1O9XA 1SVLA 1H5WA 2LXSA 3GH6A 2DYOA 4WR4A 4EDYA 4MF6A 2BXLA 3ECPA 5FWGA 1R5AA 5J41A 2V36A 3WHRA 5GIOA 2DYMA 4GSNA 4G03A 2V6KA 4PUAA 1VZSA 1USBA 3R3EA 4N0UD 4IQAA 3LG6A 2C3QA 1OE8A 3WD6A 5DALB 4ZB6A 3FNMA 2XW1A 2R6KA 5DQFA 1N2AA 3EE2A 3ZMLA 3AY8A 3B9MA 14GSA 5ECRB 2JUHA 1MM8A 1V40A 1ZL9A 3JQZA 1V2AA 3H1NA 1GUHA 4IQ1A 2BXNA 4RI6A 1PD21 5AISA 5ECKB 4GF0A 3H37A 1YVLA 2XSIA 3FRCA 4CHSA 2C4JA 1SVOA 1E7AA 3QR6A 1GTBA 4NHZA 1E7CA 4EMXA 2BXQA 4OT2A 1GLQA 1K0MA 4ZBDA 2CVDA 4M70B 3JRYA 5D9VA 2BXPA 4PURA 5A4UA 4AKHA 3LU8A 4GDFA 1G6WA 1N5UA 3H3AA 1U88A 4J2VA 2C3NA 2C3TA 3KMNA 3LFLA 2VCWA 2H1LA 2UZ8A 4KDYA 5FT3A 3GURA 4G04A 3QAVA 1A0FA 2XVQA 1EOGA 4PO0A 4W66A 1GTAA 4KAEA 4OTTA 2XVWA 2EFCA 2VCTA 3KMOA 3KXOA 1B4PA 3WHSA 1PA3A 4LMWA 1E7GA 1AQVA 4KGIA 5F06A 1KW2A 2AB6A 2QMCA 2QM6A 1GSFA 1AO6A 2CZ3A 4E99A 4MBEC 6GSWA 5J47A 1HQOA 3I6AA 3UBLA 4BL7A 2WS2A 3BBYA 4F0CA 1BJ5A 4LB2A 4L8UA 1F3AA 5FHIA 3UIVA 4ZBRA 4FK5B 5D7GA 4PGTA 1J78A 5FUOA 4RI7A 2IMIA 2XVUA 2HRKA 3GSSA 2OZBB 2OADA 5A5HB 2VD1A 4EC0A 5F05A 3HMJG 1NT2B 2CZ2A 4JK4A 1GUKA 5EVOA 3F63A 1JZRA 4BKEA 4N0FD 3ERFA 1E7EA 3SQJA 2HQTA 2WVZA 1ZGNA 4OFMA 1TU7A 2QHBA 5ECLB 2R4VA 4L5OA 4GDXA 5ECNB 6GSUA 3LU7A 1YDKA 4AKIA 5IJEA 3M1GA 22GSA 4NHWA 1BX9A 4YAPA 3KIKA 2VCVA 1K3OA 1PX7A 1JLVA 4HGMB 1EV4A 4ZBKA 1U3IA 2DC5A 2E0XA 4L9QA 4LUFA 2A2SA 1GNJA 1M9BA 4GSSA 3PPUA 4Q5FA 1HNBA 5BMUA 2YDFA 4FXYP 1E6BA 2GSRA 20GSA 5ECMB 4F5VA 4PQHA 3IC8A 2WB9A 4Z69A 3V03A 4MDCA 5GZZB 5D9TA 3RGBC 1MIWA 1OKTA 1B8XA 4LA0A 3G7IA 3FR6A 5DALA 5B7CA 4YQUA 4EE0A 1TW9A 1BYEA 1GNWA 3KTLA 3FYGA 3ZFLA 4HOJA 5J5NA 3F6FA 4E68A 2WDUA 2OACA 6GSVA 4G9HA 4MF5A 3RFRC 4KX4A 2NQOA 1UORA 4IVFA 4JBBA 3SWLA 3ISOA 1YJ6A 4DM0A 1AQXA 4FIPB 5BMUB 5BPKA 3ERGA 3VLNA 3TGZA 2VCQA 4PXOA 5EL8A 1K0OA 4ZUXV 2BXCA 5GINA 1MD4A 3ZFBA 4IJIA 1MD3A 1E7BA 1B48A 4ZXGA 4JZQA 2EFHA 2LJRA 2NTOA 2XVVA 5DJLA 5J40A 1SVMA 4ECIA 1PKWA 2ROHA 4ID0A 4Q5NA 2GTUA 1YKCA 1FOUA 4F5UA 1PL1A 2D2ZA 1GTUA 2VO4A 2BXBA 5AGYA 2WZSA 2BXHA 4KDUA 3CSJA 3P8WA 3GTUB 5IJ5A 2A2RA 4DHXB 4ZBQA 1TF0A 5A1NB 2F8FA 1LJRA 1IJGA 4IELA 1MA9A 4GLTA 5KEJA 2HRAA 2BXDA 1Y6EA 3VK9A 5J4YA 4QMKA 2J9HA 3O76A 2WVYA 1K0CA 4AKGA 1I1IP 3A73A 4C31B 1GULA 1Q4JA 3NVKA 2IL3A 2BXFA 3IR4A 5A34B 1GSYA 5A5KA 1VF1A 2XW0A 1BG5A 3VQIA 3NVIA 2YV7A 2LOQA 3LSZA 1VFIA 2K0NA 5A5HA 3A75A 3KJLA 4TQ1A 1PN9A 4HZ2A 4PQIA 1IYIA 1VF2A 1LBKA 5D73A 1GWCA 5DAKB 3WYWA 1GLPA 3GSTA 1UA5A 3GQXA 3P90A 4PNFA 4BVXB 2BXOA 2DG5A 2VCXA 1GUMA 4HJ2A 1ML6A 1EOHA 5GSTA 4G0KA 2WRTA 4ECJA 2N5FA 1HK4A 2LXTA 2KWFA 2O5VA 2C80A 4IS0A 5A4WA 2ON7A 5G5FA 4K71A 5ECHB 2FHEA 5HOZA 4ISDA 3LU6A 3VWXA 5AN1A 4PNGA 4G01A 5DBYA 1AQWA 2HSMB 3HJOA 3QAGA 2GLRA 4GTUA 4WR5A 1GSQA 4IW2A 1E7FA 1BG1A 2HNLA 4O7HA 6GSYA 11GSA 3GA9L 2Z8KA 16GSA 2UV8G 3Q19A 5IIXA 5HFKA 1KDXA 4E8EA 1FHEA 5GIPA 3EINA 1XWGA 5ELGA 1M9AA 2VKZG 4LMVA 4WA6B 1OYJA 3FR3A 4OFTA 2OT3A 2HSNB 4KDXA 2R3XA 3IBHA 4NAXA 5ECOB 2VCZA 3TOUA 4AKXB 3CBUA 2BXIA 17GSA 4PX1A 4ZC6A 5EY6A 4ZBBA 2F3MA 3NVMA 3CX9A 4TOPA 5AIVA 3ICXA 1Y1UA 4OTUA 4OR0A 6GSXA 3M99C 1PMTA 3CHXC 3LXTA 2DBUA 5IIUA 4GSTA 4USSA 1K0DA 4KH7A 1F2EA 1GSDA 1K0BA 2BX8A 5GHKA 1KXPD 4BY9C 2GDRA 4DEJA 3UAPA 1AW9A 2WVXB 1NHYA 3V09A 3G9KD 3GUSA 5D9WA 2DBWA 4YQMA 4N3ZA 4BVYB 1GNEA 10GSA 2WW1A 1F3BA 4ZB9A 4PI0C 1HNCA 1EEMA 13GSA 5JCUA 1SB0A 1VF3A 2DSAA 4ACSA 3G7JA 3TOTA 2OA7A 1GNIA 1BM0A 3WHQA 3GTUA 5A1NA 3C8EA 3PLAA 1G7OA 4ZB8A 4K2CA 1LOTA 3L0HA 1HK2A 7GSSA 4KSMA 2BXEA 19GSA 3LQ7A 3F6DA 3MHSB 1XWKA 5DCGA 4OMVA 1PX6A 3CRUA 3VPTA 2X64A 3RBTA 5A34A 1MTCA 6GSTA 2E0YA 2VD0A 1TDIA 1JLWA 1JNBA 2KBZA 2BXAA 2I30A 12GSA 2CA8A 2LQIA 3O3TA 3LYPA 4GCIA 4TQ0A 1GSEA 1YQ1A 1OE7A 2WJUA 1BKEA 3CSHA 4LUHA 4HZ4A 4J2FA 1PKZA 5DAKA 3N9JA 4IKHA 4S1YA 2IMKA 4BVXA 2WW2A 4O92A 2JL4A 5D9XA 5F0GA 2Z8IA 1EV9A 3DGQA 3UBKA 4YAVA 1M0UA 3MDKA 4D7XA
chains in the Genus database with same CATH topology
3DD3A 5LD0A 3UVHA 4F03A 2PERA 5JCWA 3LJRA 1RK4A 1HK1A 4L5LA 5ECSA 1DUGA 1TXUA 3NMUA 5F8BA 4ZBAA 1PL2A 5IJFA 4NAWB 4I97A 1LNSA 1E78A 2HSMA 4IW9A 3QAWA 4QQ7A 4F5SA 5IIHA 3FY7A 2R5GA 5ID7A 4MF7A 4LB9A 1N25A 1MIYA 1HK5A 9GSSA 5ECIB 1G6YA 1HA2A 18GSA 3PR8A 3VURA 5DQSA 1XW5A 2FNOA 4HGKA 1KBNA 5F07A 3KJYA 1J7EA 1HK3A 4Q5QA 4EXJA 3TDLA 4OFNA 5J4VA 2PGTA 3LYKA 2HSNA 2YCDA 5ECQB 3I69A 4ECCA 1E7HA 4KF9A 4AI6A 3R2QA 2AJEA 1C72A 4EDZA 4IBPA 2AAWA 3W8SA 5IFOA 1MIVA 4K0NA 4KE3A 1U87A 5ELAA 4ZB7A 2XMOA 2Z8JA 4IW1A 2GSQA 4G0IA 4JEDA 2YV9A 1XW6A 5J4UA 3VI7A 2VUEA 3SIUB 2PBJA 5AIXA 1TU8A 3PGTA 3Q18A 5DJMA 3M3MA 4F0BA 5LCZA 3LXZA 3KM6A 3HKRA 3W1SA 4MZWA 4GG2A 1BF5A 3HJMA 4PTSA 2PVQA 4BVYA 2CAQA 3N5OA 4ZCGA 1Z9HA 4AGSA 2VDBA 4E8HA 1FW1A 2EFDA 4L9KA 1K3YA 3VI5A 4GDKB 6GSSA 2EFEA 3B9LA 3MAKA 1AXDA 3D0ZA 2VUFA 3CRTA 4F5TA 3CWGA 3GX0A 4FJCB 1GSSA 4K0GA 3M0FA 5ID9A 5G5EA 2AHEA 1K0NA 3ZMKA 2CKXA 1IYHA 2BXGA 2BXKA 5B5TA 4MK3A 3TU3B 4BL7B 1K0AA 3IK9A 3SIVB 3UARA 5GSSA 4G0LA 4Q5RA 1GTIA 4MP4A 4ECBA 3IE3A 4IGJA 3NIVA 1VF4A 3Q74A 2GSSA 3FWBC 4MPGA 1YY7A 3CSIA 2CAIA 2C8UA 2HRKB 1K3LA 4G10A 1GSUA 5A4VA 2DBXA 2PMTA 4GDLB 3FR9A 3M8NA 8GSSA 4FQUA 1PGTA 5DDLA 3VPQA 4YQVA 4MPFA 4N0VA 2BXMA 4W4UB 3IK7A 3FWCC 1HNAA 5IQYA 4HI7A 2NNWA 2GSTA 2I2ZA 3GQUA 4G19A 5ECPB 4Z9OA 1E7IA 4YH2A 3V08A 1H9ZA 2ON5A 1M99A 3U6VA 4L8EA 1BAYA 3MHHB 1O9XA 1SVLA 1H5WA 3GH6A 4WR4A 2DYOA 4EDYA 4MF6A 2BXLA 5FWGA 1R5AA 5J41A 2V36A 3WHRA 5GIOA 2DYMA 4GSNA 4G03A 2V6KA 4PUAA 1VZSA 1USBA 3R3EA 4N0UD 4IQAA 3LG6A 2C3QA 1OE8A 3WD6A 5DALB 4ZB6A 3FNMA 2XW1A 2R6KA 5DQFA 1N2AA 3EE2A 3ZMLA 3AY8A 3B9MA 14GSA 5ECRB 2JUHA 1V40A 1ZL9A 5AISA 3JQZA 1V2AA 3H1NA 1GUHA 4IQ1A 2BXNA 4RI6A 1PD21 5ECKB 4GF0A 3H37A 1YVLA 2XSIA 3FRCA 4CHSA 2C4JA 1SVOA 1E7AA 3QR6A 1GTBA 4NHZA 1E7CA 4EMXA 2BXQA 4OT2A 1GLQA 1K0MA 4ZBDA 2CVDA 4M70B 3JRYA 5D9VA 2BXPA 4PURA 5A4UA 4AKHA 3LU8A 4GDFA 1G6WA 1N5UA 3H3AA 1U88A 4J2VA 2C3NA 2C3TA 3KMNA 3LFLA 2VCWA 2H1LA 2UZ8A 4KDYA 5FT3A 3GURA 4G04A 3QAVA 1A0FA 2XVQA 1EOGA 4PO0A 4W66A 1GTAA 4KAEA 4OTTA 2XVWA 2EFCA 2VCTA 3KMOA 3KXOA 1B4PA 3WHSA 1PA3A 4LMWA 1E7GA 1AQVA 4KGIA 5F06A 1KW2A 2AB6A 2QMCA 2QM6A 1GSFA 1AO6A 2CZ3A 4E99A 4MBEC 6GSWA 5J47A 1HQOA 3I6AA 3UBLA 4BL7A 2WS2A 3BBYA 4F0CA 1BJ5A 4LB2A 4L8UA 1F3AA 5FHIA 3UIVA 4ZBRA 4FK5B 5D7GA 4PGTA 1J78A 5FUOA 4RI7A 2IMIA 2XVUA 2HRKA 3GSSA 2OZBB 2OADA 5A5HB 2VD1A 4EC0A 5F05A 3HMJG 1NT2B 2CZ2A 4JK4A 1GUKA 5EVOA 3F63A 1JZRA 4BKEA 4N0FD 3ERFA 1E7EA 3SQJA 2HQTA 1ZGNA 4OFMA 1TU7A 2QHBA 5ECLB 2R4VA 4L5OA 4GDXA 5ECNB 6GSUA 3LU7A 1YDKA 4AKIA 5IJEA 3M1GA 22GSA 4NHWA 1BX9A 4YAPA 3KIKA 2VCVA 1K3OA 1PX7A 1JLVA 4HGMB 1EV4A 4ZBKA 1U3IA 2DC5A 2E0XA 4L9QA 4LUFA 2A2SA 1GNJA 1M9BA 4GSSA 3PPUA 4Q5FA 1HNBA 5BMUA 2YDFA 1E6BA 2GSRA 20GSA 5ECMB 4F5VA 4PQHA 3IC8A 2WB9A 4Z69A 3V03A 4MDCA 5GZZB 5D9TA 1MIWA 1OKTA 1B8XA 4LA0A 3G7IA 3FR6A 5DALA 5B7CA 4YQUA 4EE0A 1TW9A 1BYEA 1GNWA 3KTLA 3FYGA 3ZFLA 4HOJA 5J5NA 3F6FA 4E68A 2WDUA 2OACA 6GSVA 4G9HA 4MF5A 4KX4A 2NQOA 1UORA 4IVFA 4JBBA 3SWLA 3ISOA 1YJ6A 1AQXA 4FIPB 5BMUB 5BPKA 3ERGA 3VLNA 3TGZA 2VCQA 4PXOA 5EL8A 1K0OA 4ZUXV 2BXCA 5GINA 1MD4A 3ZFBA 4IJIA 1MD3A 1E7BA 1B48A 4ZXGA 4JZQA 2EFHA 2LJRA 2NTOA 2XVVA 5DJLA 5J40A 1SVMA 4ECIA 1PKWA 2ROHA 4ID0A 4Q5NA 2GTUA 1YKCA 1FOUA 4F5UA 1PL1A 2D2ZA 1GTUA 2VO4A 2BXBA 5AGYA 4KDUA 2BXHA 3CSJA 3P8WA 3GTUB 5IJ5A 2A2RA 4DHXB 4ZBQA 1TF0A 5A1NB 2F8FA 1LJRA 1IJGA 4IELA 1MA9A 4GLTA 5KEJA 2HRAA 2BXDA 1Y6EA 3VK9A 5J4YA 4QMKA 2J9HA 3O76A 1K0CA 4AKGA 3A73A 4C31B 1GULA 1Q4JA 3NVKA 2IL3A 2BXFA 3IR4A 5A34B 1GSYA 5A5KA 1VF1A 2XW0A 1BG5A 3VQIA 3NVIA 2YV7A 2LOQA 3LSZA 1VFIA 5A5HA 3A75A 3KJLA 4TQ1A 1PN9A 4HZ2A 4PQIA 1IYIA 1VF2A 1LBKA 5D73A 1GWCA 5DAKB 3WYWA 1GLPA 3GSTA 1UA5A 3GQXA 3P90A 4PNFA 4BVXB 2BXOA 2DG5A 2VCXA 1GUMA 4HJ2A 1ML6A 1EOHA 5GSTA 4G0KA 2WRTA 4ECJA 2N5FA 1HK4A 2O5VA 2C80A 4IS0A 5A4WA 2ON7A 5G5FA 4K71A 5ECHB 2FHEA 5HOZA 4ISDA 3LU6A 3VWXA 5AN1A 4PNGA 4G01A 5DBYA 1AQWA 2HSMB 3HJOA 3QAGA 2GLRA 4GTUA 4WR5A 1GSQA 4IW2A 1E7FA 1BG1A 2HNLA 4O7HA 6GSYA 11GSA 3GA9L 2Z8KA 16GSA 2UV8G 3Q19A 5IIXA 5HFKA 4E8EA 1FHEA 5GIPA 3EINA 1XWGA 5ELGA 1M9AA 2VKZG 4LMVA 4WA6B 1OYJA 3FR3A 4OFTA 2OT3A 2HSNB 4KDXA 2R3XA 3IBHA 4NAXA 5ECOB 2VCZA 3TOUA 4AKXB 3CBUA 2BXIA 17GSA 4PX1A 4ZC6A 5EY6A 4ZBBA 2F3MA 3NVMA 3CX9A 4TOPA 5AIVA 3ICXA 1Y1UA 4OTUA 4OR0A 6GSXA 3M99C 1PMTA 3LXTA 2DBUA 5IIUA 4GSTA 4USSA 1K0DA 4KH7A 1F2EA 1GSDA 1K0BA 2BX8A 5GHKA 1KXPD 4BY9C 2GDRA 4DEJA 3UAPA 1AW9A 1NHYA 3V09A 3G9KD 3GUSA 5D9WA 2DBWA 4YQMA 4N3ZA 4BVYB 1GNEA 10GSA 1F3BA 4ZB9A 1HNCA 1EEMA 13GSA 5JCUA 1VF3A 2DSAA 4ACSA 3G7JA 3TOTA 2OA7A 1GNIA 1BM0A 3WHQA 3GTUA 5A1NA 3C8EA 3PLAA 1G7OA 4ZB8A 4K2CA 1LOTA 3L0HA 1HK2A 7GSSA 4KSMA 2BXEA 19GSA 3LQ7A 3F6DA 3MHSB 1XWKA 5DCGA 4OMVA 1PX6A 3CRUA 3VPTA 2X64A 3RBTA 5A34A 1MTCA 6GSTA 2E0YA 2VD0A 1TDIA 1JLWA 1JNBA 2KBZA 2BXAA 2I30A 12GSA 2CA8A 3O3TA 3LYPA 4GCIA 4TQ0A 1GSEA 1YQ1A 1OE7A 2WJUA 1BKEA 3CSHA 4LUHA 4HZ4A 4J2FA 1PKZA 5DAKA 3N9JA 4IKHA 4S1YA 2IMKA 4BVXA 4O92A 2JL4A 5D9XA 5F0GA 2Z8IA 1EV9A 3DGQA 3UBKA 4YAVA 1M0UA 3MDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFC A;  1TXU A;  2EFH A;  4G01 A;  4N3Z A;  2OT3 A;  2EFD A;  2EFE A; 
#chains in the Genus database with same CATH topology
 3DD3 A;  5LD0 A;  3UVH A;  4F03 A;  2PER A;  5JCW A;  3LJR A;  1RK4 A;  1HK1 A;  4L5L A;  5ECS A;  1DUG A;  1TXU A;  3NMU A;  5F8B A;  4ZBA A;  1PL2 A;  5IJF A;  4NAW B;  4I97 A;  1LNS A;  1E78 A;  2HSM A;  4IW9 A;  4PI2 C;  3QAW A;  4QQ7 A;  4F5S A;  5IIH A;  3FY7 A;  2R5G A;  5ID7 A;  4MF7 A;  4LB9 A;  1N25 A;  1MIY A;  1HK5 A;  9GSS A;  5ECI B;  1G6Y A;  1HA2 A;  18GS A;  3PR8 A;  3VUR A;  5DQS A;  1XW5 A;  2FNO A;  4HGK A;  1KBN A;  5F07 A;  3KJY A;  1J7E A;  1HK3 A;  4Q5Q A;  4EXJ A;  3TDL A;  4OFN A;  5J4V A;  2PGT A;  3LYK A;  2HSN A;  2YCD A;  5ECQ B;  3I69 A;  2LQH A;  1E7H A;  4KF9 A;  4ECC A;  4AI6 A;  3R2Q A;  2AJE A;  1C72 A;  4EDZ A;  4IBP A;  2AAW A;  3BPJ A;  3W8S A;  5IFO A;  1MIV A;  4K0N A;  4KE3 A;  1U87 A;  5ELA A;  4ZB7 A;  2XMO A;  2Z8J A;  4IW1 A;  2GSQ A;  4G0I A;  4JED A;  2YV9 A;  1XW6 A;  5J4U A;  3VI7 A;  2VUE A;  3SIU B;  2PBJ A;  5AIX A;  1TU8 A;  3PGT A;  3Q18 A;  5DJM A;  3M3M A;  4F0B A;  5LCZ A;  2AGH B;  3LXZ A;  3KM6 A;  3HKR A;  3W1S A;  4MZW A;  4GG2 A;  1BF5 A;  2WVX A;  3HJM A;  1MUS A;  4PTS A;  2PVQ A;  4BVY A;  2CAQ A;  3N5O A;  2WW0 A;  4ZCG A;  1Z9H A;  4AGS A;  2WW3 A;  2VDB A;  4E8H A;  1FW1 A;  2EFD A;  4L9K A;  1K3Y A;  3VI5 A;  4GDK B;  6GSS A;  2EFE A;  3B9L A;  3MAK A;  1AXD A;  3D0Z A;  2VUF A;  3CRT A;  4F5T A;  2GUT A;  3CWG A;  3GX0 A;  4FJC B;  1GSS A;  4K0G A;  3M0F A;  5ID9 A;  5G5E A;  2AHE A;  1K0N A;  3ZMK A;  2CKX A;  1IYH A;  2BXG A;  2BXK A;  5B5T A;  4MK3 A;  3TU3 B;  4BL7 B;  1K0A A;  3IK9 A;  3SIV B;  3UAR A;  5GSS A;  4G0L A;  4Q5R A;  1GTI A;  4MP4 A;  4ECB A;  1YEW C;  3IE3 A;  4IGJ A;  3NIV A;  1VF4 A;  3Q74 A;  2GSS A;  3FWB C;  4MPG A;  1YY7 A;  3CSI A;  2CAI A;  2C8U A;  2HRK B;  1K3L A;  4G10 A;  1GSU A;  5A4V A;  2DBX A;  1MUH A;  2PMT A;  4GDL B;  2O36 A;  3FR9 A;  3M8N A;  8GSS A;  4FQU A;  1PGT A;  5DDL A;  2O3E A;  3VPQ A;  4YQV A;  4MPF A;  4N0V A;  2BXM A;  4W4U B;  1S4B P;  3IK7 A;  4PHZ C;  4I9O A;  3FWC C;  1HNA A;  5IQY A;  4HI7 A;  2NNW A;  2GST A;  2I2Z A;  3GQU A;  4G19 A;  5ECP B;  4Z9O A;  1E7I A;  4YH2 A;  3V08 A;  1H9Z A;  2ON5 A;  1M99 A;  3U6V A;  4L8E A;  1BAY A;  3MHH B;  1O9X A;  1SVL A;  1H5W A;  2LXS A;  3GH6 A;  2DYO A;  4WR4 A;  4EDY A;  4MF6 A;  2BXL A;  3ECP A;  5FWG A;  1R5A A;  5J41 A;  2V36 A;  3WHR A;  5GIO A;  2DYM A;  4GSN A;  4G03 A;  2V6K A;  4PUA A;  1VZS A;  1USB A;  3R3E A;  4N0U D;  4IQA A;  3LG6 A;  2C3Q A;  1OE8 A;  3WD6 A;  5DAL B;  4ZB6 A;  3FNM A;  2XW1 A;  2R6K A;  5DQF A;  1N2A A;  3EE2 A;  3ZML A;  3AY8 A;  3B9M A;  14GS A;  5ECR B;  2JUH A;  1MM8 A;  1V40 A;  1ZL9 A;  3JQZ A;  1V2A A;  3H1N A;  1GUH A;  4IQ1 A;  2BXN A;  4RI6 A;  1PD2 1;  5AIS A;  5ECK B;  4GF0 A;  3H37 A;  1YVL A;  2XSI A;  3FRC A;  4CHS A;  2C4J A;  1SVO A;  1E7A A;  3QR6 A;  1GTB A;  4NHZ A;  1E7C A;  4EMX A;  2BXQ A;  4OT2 A;  1GLQ A;  1K0M A;  4ZBD A;  2CVD A;  4M70 B;  3JRY A;  5D9V A;  2BXP A;  4PUR A;  5A4U A;  4AKH A;  3LU8 A;  4GDF A;  1G6W A;  1N5U A;  3H3A A;  1U88 A;  4J2V A;  2C3N A;  2C3T A;  3KMN A;  3LFL A;  2VCW A;  2H1L A;  2UZ8 A;  4KDY A;  5FT3 A;  3GUR A;  4G04 A;  3QAV A;  1A0F A;  2XVQ A;  1EOG A;  4PO0 A;  4W66 A;  1GTA A;  4KAE A;  4OTT A;  2XVW A;  2EFC A;  2VCT A;  3KMO A;  3KXO A;  1B4P A;  3WHS A;  1PA3 A;  4LMW A;  1E7G A;  1AQV A;  4KGI A;  5F06 A;  1KW2 A;  2AB6 A;  2QMC A;  2QM6 A;  1GSF A;  1AO6 A;  2CZ3 A;  4E99 A;  4MBE C;  6GSW A;  5J47 A;  1HQO A;  3I6A A;  3UBL A;  4BL7 A;  2WS2 A;  3BBY A;  4F0C A;  1BJ5 A;  4LB2 A;  4L8U A;  1F3A A;  5FHI A;  3UIV A;  4ZBR A;  4FK5 B;  5D7G A;  4PGT A;  1J78 A;  5FUO A;  4RI7 A;  2IMI A;  2XVU A;  2HRK A;  3GSS A;  2OZB B;  2OAD A;  5A5H B;  2VD1 A;  4EC0 A;  5F05 A;  3HMJ G;  1NT2 B;  2CZ2 A;  4JK4 A;  1GUK A;  5EVO A;  3F63 A;  1JZR A;  4BKE A;  4N0F D;  3ERF A;  1E7E A;  3SQJ A;  2HQT A;  2WVZ A;  1ZGN A;  4OFM A;  1TU7 A;  2QHB A;  5ECL B;  2R4V A;  4L5O A;  4GDX A;  5ECN B;  6GSU A;  3LU7 A;  1YDK A;  4AKI A;  5IJE A;  3M1G A;  22GS A;  4NHW A;  1BX9 A;  4YAP A;  3KIK A;  2VCV A;  1K3O A;  1PX7 A;  1JLV A;  4HGM B;  1EV4 A;  4ZBK A;  1U3I A;  2DC5 A;  2E0X A;  4L9Q A;  4LUF A;  2A2S A;  1GNJ A;  1M9B A;  4GSS A;  3PPU A;  4Q5F A;  1HNB A;  5BMU A;  2YDF A;  4FXY P;  1E6B A;  2GSR A;  20GS A;  5ECM B;  4F5V A;  4PQH A;  3IC8 A;  2WB9 A;  4Z69 A;  3V03 A;  4MDC A;  5GZZ B;  5D9T A;  3RGB C;  1MIW A;  1OKT A;  1B8X A;  4LA0 A;  3G7I A;  3FR6 A;  5DAL A;  5B7C A;  4YQU A;  4EE0 A;  1TW9 A;  1BYE A;  1GNW A;  3KTL A;  3FYG A;  3ZFL A;  4HOJ A;  5J5N A;  3F6F A;  4E68 A;  2WDU A;  2OAC A;  6GSV A;  4G9H A;  4MF5 A;  3RFR C;  4KX4 A;  2NQO A;  1UOR A;  4IVF A;  4JBB A;  3SWL A;  3ISO A;  1YJ6 A;  4DM0 A;  1AQX A;  4FIP B;  5BMU B;  5BPK A;  3ERG A;  3VLN A;  3TGZ A;  2VCQ A;  4PXO A;  5EL8 A;  1K0O A;  4ZUX V;  2BXC A;  5GIN A;  1MD4 A;  3ZFB A;  4IJI A;  1MD3 A;  1E7B A;  1B48 A;  4ZXG A;  4JZQ A;  2EFH A;  2LJR A;  2NTO A;  2XVV A;  5DJL A;  5J40 A;  1SVM A;  4ECI A;  1PKW A;  2ROH A;  4ID0 A;  4Q5N A;  2GTU A;  1YKC A;  1FOU A;  4F5U A;  1PL1 A;  2D2Z A;  1GTU A;  2VO4 A;  2BXB A;  5AGY A;  2WZS A;  2BXH A;  4KDU A;  3CSJ A;  3P8W A;  3GTU B;  5IJ5 A;  2A2R A;  4DHX B;  4ZBQ A;  1TF0 A;  5A1N B;  2F8F A;  1LJR A;  1IJG A;  4IEL A;  1MA9 A;  4GLT A;  5KEJ A;  2HRA A;  2BXD A;  1Y6E A;  3VK9 A;  5J4Y A;  4QMK A;  2J9H A;  3O76 A;  2WVY A;  1K0C A;  4AKG A;  1I1I P;  3A73 A;  4C31 B;  1GUL A;  1Q4J A;  3NVK A;  2IL3 A;  2BXF A;  3IR4 A;  5A34 B;  1GSY A;  5A5K A;  1VF1 A;  2XW0 A;  1BG5 A;  3VQI A;  3NVI A;  2YV7 A;  2LOQ A;  3LSZ A;  1VFI A;  2K0N A;  5A5H A;  3A75 A;  3KJL A;  4TQ1 A;  1PN9 A;  4HZ2 A;  4PQI A;  1IYI A;  1VF2 A;  1LBK A;  5D73 A;  1GWC A;  5DAK B;  3WYW A;  1GLP A;  3GST A;  1UA5 A;  3GQX A;  3P90 A;  4PNF A;  4BVX B;  2BXO A;  2DG5 A;  2VCX A;  1GUM A;  4HJ2 A;  1ML6 A;  1EOH A;  5GST A;  4G0K A;  2WRT A;  4ECJ A;  2N5F A;  1HK4 A;  2LXT A;  2KWF A;  2O5V A;  2C80 A;  4IS0 A;  5A4W A;  2ON7 A;  5G5F A;  4K71 A;  5ECH B;  2FHE A;  5HOZ A;  4ISD A;  3LU6 A;  3VWX A;  5AN1 A;  4PNG A;  4G01 A;  5DBY A;  1AQW A;  2HSM B;  3HJO A;  3QAG A;  2GLR A;  4GTU A;  4WR5 A;  1GSQ A;  4IW2 A;  1E7F A;  1BG1 A;  2HNL A;  4O7H A;  6GSY A;  11GS A;  3GA9 L;  2Z8K A;  16GS A;  2UV8 G;  3Q19 A;  5IIX A;  5HFK A;  1KDX A;  4E8E A;  1FHE A;  5GIP A;  3EIN A;  1XWG A;  5ELG A;  1M9A A;  2VKZ G;  4LMV A;  4WA6 B;  1OYJ A;  3FR3 A;  4OFT A;  2OT3 A;  2HSN B;  4KDX A;  2R3X A;  3IBH A;  4NAX A;  5ECO B;  2VCZ A;  3TOU A;  4AKX B;  3CBU A;  2BXI A;  17GS A;  4PX1 A;  4ZC6 A;  5EY6 A;  4ZBB A;  2F3M A;  3NVM A;  3CX9 A;  4TOP A;  5AIV A;  3ICX A;  1Y1U A;  4OTU A;  4OR0 A;  6GSX A;  3M99 C;  1PMT A;  3CHX C;  3LXT A;  2DBU A;  5IIU A;  4GST A;  4USS A;  1K0D A;  4KH7 A;  1F2E A;  1GSD A;  1K0B A;  2BX8 A;  5GHK A;  1KXP D;  4BY9 C;  2GDR A;  4DEJ A;  3UAP A;  1AW9 A;  2WVX B;  1NHY A;  3V09 A;  3G9K D;  3GUS A;  5D9W A;  2DBW A;  4YQM A;  4N3Z A;  4BVY B;  1GNE A;  10GS A;  2WW1 A;  1F3B A;  4ZB9 A;  4PI0 C;  1HNC A;  1EEM A;  13GS A;  5JCU A;  1SB0 A;  1VF3 A;  2DSA A;  4ACS A;  3G7J A;  3TOT A;  2OA7 A;  1GNI A;  1BM0 A;  3WHQ A;  3GTU A;  5A1N A;  3C8E A;  3PLA A;  1G7O A;  4ZB8 A;  4K2C A;  1LOT A;  3L0H A;  1HK2 A;  7GSS A;  4KSM A;  2BXE A;  19GS A;  3LQ7 A;  3F6D A;  3MHS B;  1XWK A;  5DCG A;  4OMV A;  1PX6 A;  3CRU A;  3VPT A;  2X64 A;  3RBT A;  5A34 A;  1MTC A;  6GST A;  2E0Y A;  2VD0 A;  1TDI A;  1JLW A;  1JNB A;  2KBZ A;  2BXA A;  2I30 A;  12GS A;  2CA8 A;  2LQI A;  3O3T A;  3LYP A;  4GCI A;  4TQ0 A;  1GSE A;  1YQ1 A;  1OE7 A;  2WJU A;  1BKE A;  3CSH A;  4LUH A;  4HZ4 A;  4J2F A;  1PKZ A;  5DAK A;  3N9J A;  4IKH A;  4S1Y A;  2IMK A;  4BVX A;  2WW2 A;  4O92 A;  2JL4 A;  5D9X A;  5F0G A;  2Z8I A;  1EV9 A;  3DGQ A;  3UBK A;  4YAV A;  1M0U A;  3MDK A;  4D7X A; 
#chains in the Genus database with same CATH homology
 3DD3 A;  5LD0 A;  3UVH A;  4F03 A;  2PER A;  5JCW A;  3LJR A;  1RK4 A;  1HK1 A;  4L5L A;  5ECS A;  1DUG A;  1TXU A;  3NMU A;  5F8B A;  4ZBA A;  1PL2 A;  5IJF A;  4NAW B;  4I97 A;  1LNS A;  1E78 A;  2HSM A;  4IW9 A;  3QAW A;  4QQ7 A;  4F5S A;  5IIH A;  3FY7 A;  2R5G A;  5ID7 A;  4MF7 A;  4LB9 A;  1N25 A;  1MIY A;  1HK5 A;  9GSS A;  5ECI B;  1G6Y A;  1HA2 A;  18GS A;  3PR8 A;  3VUR A;  5DQS A;  1XW5 A;  2FNO A;  4HGK A;  1KBN A;  5F07 A;  3KJY A;  1J7E A;  1HK3 A;  4Q5Q A;  4EXJ A;  3TDL A;  4OFN A;  5J4V A;  2PGT A;  3LYK A;  2HSN A;  2YCD A;  5ECQ B;  3I69 A;  4ECC A;  1E7H A;  4KF9 A;  4AI6 A;  3R2Q A;  2AJE A;  1C72 A;  4EDZ A;  4IBP A;  2AAW A;  3W8S A;  5IFO A;  1MIV A;  4K0N A;  4KE3 A;  1U87 A;  5ELA A;  4ZB7 A;  2XMO A;  2Z8J A;  4IW1 A;  2GSQ A;  4G0I A;  4JED A;  2YV9 A;  1XW6 A;  5J4U A;  3VI7 A;  2VUE A;  3SIU B;  2PBJ A;  5AIX A;  1TU8 A;  3PGT A;  3Q18 A;  5DJM A;  3M3M A;  4F0B A;  5LCZ A;  3LXZ A;  3KM6 A;  3HKR A;  3W1S A;  4MZW A;  4GG2 A;  1BF5 A;  3HJM A;  4PTS A;  2PVQ A;  4BVY A;  2CAQ A;  3N5O A;  4ZCG A;  1Z9H A;  4AGS A;  2VDB A;  4E8H A;  1FW1 A;  2EFD A;  4L9K A;  1K3Y A;  3VI5 A;  4GDK B;  6GSS A;  2EFE A;  3B9L A;  3MAK A;  1AXD A;  3D0Z A;  2VUF A;  3CRT A;  4F5T A;  3CWG A;  3GX0 A;  4FJC B;  1GSS A;  4K0G A;  3M0F A;  5ID9 A;  5G5E A;  2AHE A;  1K0N A;  3ZMK A;  2CKX A;  1IYH A;  2BXG A;  2BXK A;  5B5T A;  4MK3 A;  3TU3 B;  4BL7 B;  1K0A A;  3IK9 A;  3SIV B;  3UAR A;  5GSS A;  4G0L A;  4Q5R A;  1GTI A;  4MP4 A;  4ECB A;  3IE3 A;  4IGJ A;  3NIV A;  1VF4 A;  3Q74 A;  2GSS A;  3FWB C;  4MPG A;  1YY7 A;  3CSI A;  2CAI A;  2C8U A;  2HRK B;  1K3L A;  4G10 A;  1GSU A;  5A4V A;  2DBX A;  2PMT A;  4GDL B;  3FR9 A;  3M8N A;  8GSS A;  4FQU A;  1PGT A;  5DDL A;  3VPQ A;  4YQV A;  4MPF A;  4N0V A;  2BXM A;  4W4U B;  3IK7 A;  3FWC C;  1HNA A;  5IQY A;  4HI7 A;  2NNW A;  2GST A;  2I2Z A;  3GQU A;  4G19 A;  5ECP B;  4Z9O A;  1E7I A;  4YH2 A;  3V08 A;  1H9Z A;  2ON5 A;  1M99 A;  3U6V A;  4L8E A;  1BAY A;  3MHH B;  1O9X A;  1SVL A;  1H5W A;  3GH6 A;  4WR4 A;  2DYO A;  4EDY A;  4MF6 A;  2BXL A;  5FWG A;  1R5A A;  5J41 A;  2V36 A;  3WHR A;  5GIO A;  2DYM A;  4GSN A;  4G03 A;  2V6K A;  4PUA A;  1VZS A;  1USB A;  3R3E A;  4N0U D;  4IQA A;  3LG6 A;  2C3Q A;  1OE8 A;  3WD6 A;  5DAL B;  4ZB6 A;  3FNM A;  2XW1 A;  2R6K A;  5DQF A;  1N2A A;  3EE2 A;  3ZML A;  3AY8 A;  3B9M A;  14GS A;  5ECR B;  2JUH A;  1V40 A;  1ZL9 A;  5AIS A;  3JQZ A;  1V2A A;  3H1N A;  1GUH A;  4IQ1 A;  2BXN A;  4RI6 A;  1PD2 1;  5ECK B;  4GF0 A;  3H37 A;  1YVL A;  2XSI A;  3FRC A;  4CHS A;  2C4J A;  1SVO A;  1E7A A;  3QR6 A;  1GTB A;  4NHZ A;  1E7C A;  4EMX A;  2BXQ A;  4OT2 A;  1GLQ A;  1K0M A;  4ZBD A;  2CVD A;  4M70 B;  3JRY A;  5D9V A;  2BXP A;  4PUR A;  5A4U A;  4AKH A;  3LU8 A;  4GDF A;  1G6W A;  1N5U A;  3H3A A;  1U88 A;  4J2V A;  2C3N A;  2C3T A;  3KMN A;  3LFL A;  2VCW A;  2H1L A;  2UZ8 A;  4KDY A;  5FT3 A;  3GUR A;  4G04 A;  3QAV A;  1A0F A;  2XVQ A;  1EOG A;  4PO0 A;  4W66 A;  1GTA A;  4KAE A;  4OTT A;  2XVW A;  2EFC A;  2VCT A;  3KMO A;  3KXO A;  1B4P A;  3WHS A;  1PA3 A;  4LMW A;  1E7G A;  1AQV A;  4KGI A;  5F06 A;  1KW2 A;  2AB6 A;  2QMC A;  2QM6 A;  1GSF A;  1AO6 A;  2CZ3 A;  4E99 A;  4MBE C;  6GSW A;  5J47 A;  1HQO A;  3I6A A;  3UBL A;  4BL7 A;  2WS2 A;  3BBY A;  4F0C A;  1BJ5 A;  4LB2 A;  4L8U A;  1F3A A;  5FHI A;  3UIV A;  4ZBR A;  4FK5 B;  5D7G A;  4PGT A;  1J78 A;  5FUO A;  4RI7 A;  2IMI A;  2XVU A;  2HRK A;  3GSS A;  2OZB B;  2OAD A;  5A5H B;  2VD1 A;  4EC0 A;  5F05 A;  3HMJ G;  1NT2 B;  2CZ2 A;  4JK4 A;  1GUK A;  5EVO A;  3F63 A;  1JZR A;  4BKE A;  4N0F D;  3ERF A;  1E7E A;  3SQJ A;  2HQT A;  1ZGN A;  4OFM A;  1TU7 A;  2QHB A;  5ECL B;  2R4V A;  4L5O A;  4GDX A;  5ECN B;  6GSU A;  3LU7 A;  1YDK A;  4AKI A;  5IJE A;  3M1G A;  22GS A;  4NHW A;  1BX9 A;  4YAP A;  3KIK A;  2VCV A;  1K3O A;  1PX7 A;  1JLV A;  4HGM B;  1EV4 A;  4ZBK A;  1U3I A;  2DC5 A;  2E0X A;  4L9Q A;  4LUF A;  2A2S A;  1GNJ A;  1M9B A;  4GSS A;  3PPU A;  4Q5F A;  1HNB A;  5BMU A;  2YDF A;  1E6B A;  2GSR A;  20GS A;  5ECM B;  4F5V A;  4PQH A;  3IC8 A;  2WB9 A;  4Z69 A;  3V03 A;  4MDC A;  5GZZ B;  5D9T A;  1MIW A;  1OKT A;  1B8X A;  4LA0 A;  3G7I A;  3FR6 A;  5DAL A;  5B7C A;  4YQU A;  4EE0 A;  1TW9 A;  1BYE A;  1GNW A;  3KTL A;  3FYG A;  3ZFL A;  4HOJ A;  5J5N A;  3F6F A;  4E68 A;  2WDU A;  2OAC A;  6GSV A;  4G9H A;  4MF5 A;  4KX4 A;  2NQO A;  1UOR A;  4IVF A;  4JBB A;  3SWL A;  3ISO A;  1YJ6 A;  1AQX A;  4FIP B;  5BMU B;  5BPK A;  3ERG A;  3VLN A;  3TGZ A;  2VCQ A;  4PXO A;  5EL8 A;  1K0O A;  4ZUX V;  2BXC A;  5GIN A;  1MD4 A;  3ZFB A;  4IJI A;  1MD3 A;  1E7B A;  1B48 A;  4ZXG A;  4JZQ A;  2EFH A;  2LJR A;  2NTO A;  2XVV A;  5DJL A;  5J40 A;  1SVM A;  4ECI A;  1PKW A;  2ROH A;  4ID0 A;  4Q5N A;  2GTU A;  1YKC A;  1FOU A;  4F5U A;  1PL1 A;  2D2Z A;  1GTU A;  2VO4 A;  2BXB A;  5AGY A;  4KDU A;  2BXH A;  3CSJ A;  3P8W A;  3GTU B;  5IJ5 A;  2A2R A;  4DHX B;  4ZBQ A;  1TF0 A;  5A1N B;  2F8F A;  1LJR A;  1IJG A;  4IEL A;  1MA9 A;  4GLT A;  5KEJ A;  2HRA A;  2BXD A;  1Y6E A;  3VK9 A;  5J4Y A;  4QMK A;  2J9H A;  3O76 A;  1K0C A;  4AKG A;  3A73 A;  4C31 B;  1GUL A;  1Q4J A;  3NVK A;  2IL3 A;  2BXF A;  3IR4 A;  5A34 B;  1GSY A;  5A5K A;  1VF1 A;  2XW0 A;  1BG5 A;  3VQI A;  3NVI A;  2YV7 A;  2LOQ A;  3LSZ A;  1VFI A;  5A5H A;  3A75 A;  3KJL A;  4TQ1 A;  1PN9 A;  4HZ2 A;  4PQI A;  1IYI A;  1VF2 A;  1LBK A;  5D73 A;  1GWC A;  5DAK B;  3WYW A;  1GLP A;  3GST A;  1UA5 A;  3GQX A;  3P90 A;  4PNF A;  4BVX B;  2BXO A;  2DG5 A;  2VCX A;  1GUM A;  4HJ2 A;  1ML6 A;  1EOH A;  5GST A;  4G0K A;  2WRT A;  4ECJ A;  2N5F A;  1HK4 A;  2O5V A;  2C80 A;  4IS0 A;  5A4W A;  2ON7 A;  5G5F A;  4K71 A;  5ECH B;  2FHE A;  5HOZ A;  4ISD A;  3LU6 A;  3VWX A;  5AN1 A;  4PNG A;  4G01 A;  5DBY A;  1AQW A;  2HSM B;  3HJO A;  3QAG A;  2GLR A;  4GTU A;  4WR5 A;  1GSQ A;  4IW2 A;  1E7F A;  1BG1 A;  2HNL A;  4O7H A;  6GSY A;  11GS A;  3GA9 L;  2Z8K A;  16GS A;  2UV8 G;  3Q19 A;  5IIX A;  5HFK A;  4E8E A;  1FHE A;  5GIP A;  3EIN A;  1XWG A;  5ELG A;  1M9A A;  2VKZ G;  4LMV A;  4WA6 B;  1OYJ A;  3FR3 A;  4OFT A;  2OT3 A;  2HSN B;  4KDX A;  2R3X A;  3IBH A;  4NAX A;  5ECO B;  2VCZ A;  3TOU A;  4AKX B;  3CBU A;  2BXI A;  17GS A;  4PX1 A;  4ZC6 A;  5EY6 A;  4ZBB A;  2F3M A;  3NVM A;  3CX9 A;  4TOP A;  5AIV A;  3ICX A;  1Y1U A;  4OTU A;  4OR0 A;  6GSX A;  3M99 C;  1PMT A;  3LXT A;  2DBU A;  5IIU A;  4GST A;  4USS A;  1K0D A;  4KH7 A;  1F2E A;  1GSD A;  1K0B A;  2BX8 A;  5GHK A;  1KXP D;  4BY9 C;  2GDR A;  4DEJ A;  3UAP A;  1AW9 A;  1NHY A;  3V09 A;  3G9K D;  3GUS A;  5D9W A;  2DBW A;  4YQM A;  4N3Z A;  4BVY B;  1GNE A;  10GS A;  1F3B A;  4ZB9 A;  1HNC A;  1EEM A;  13GS A;  5JCU A;  1VF3 A;  2DSA A;  4ACS A;  3G7J A;  3TOT A;  2OA7 A;  1GNI A;  1BM0 A;  3WHQ A;  3GTU A;  5A1N A;  3C8E A;  3PLA A;  1G7O A;  4ZB8 A;  4K2C A;  1LOT A;  3L0H A;  1HK2 A;  7GSS A;  4KSM A;  2BXE A;  19GS A;  3LQ7 A;  3F6D A;  3MHS B;  1XWK A;  5DCG A;  4OMV A;  1PX6 A;  3CRU A;  3VPT A;  2X64 A;  3RBT A;  5A34 A;  1MTC A;  6GST A;  2E0Y A;  2VD0 A;  1TDI A;  1JLW A;  1JNB A;  2KBZ A;  2BXA A;  2I30 A;  12GS A;  2CA8 A;  3O3T A;  3LYP A;  4GCI A;  4TQ0 A;  1GSE A;  1YQ1 A;  1OE7 A;  2WJU A;  1BKE A;  3CSH A;  4LUH A;  4HZ4 A;  4J2F A;  1PKZ A;  5DAK A;  3N9J A;  4IKH A;  4S1Y A;  2IMK A;  4BVX A;  4O92 A;  2JL4 A;  5D9X A;  5F0G A;  2Z8I A;  1EV9 A;  3DGQ A;  3UBK A;  4YAV A;  1M0U A;  3MDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...