1TYDE

Structure of tyrosyl-trna synthetase refined at 2.3 angstroms resolution. interaction of the enzyme with the tyrosyl adenylate intermediate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
319
structure length
317
Chain Sequence
b'MDLLAELQWRGLVNQTTDEDGLRKLLNEERVTLYCGFDPTADSLHIGHLASILTMRRFQQAGHRPIALVGGATGLIGDPSGKKSERTLNAKETVEAWSARIKEQLGRFLDFEADGNPAKIKNNYDWIGPLDVITFLRDVGKHFSVNYMMAKESVQSRIETGISFTEFSYMMLQAYDFLRLYETEGCRLQIGGSDQWGNITAGLELIRKTKGRAFGLTIPLVTKADGTKFGKTESGTIWLDKEKTSPYEFYQFWINTDDRDVIRYLKYFTFLSKEEIEALEQELREAPEKRAAQKTLAEEVTKLVHGEEALRQAIRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSYL-tRNA SYNTHETASE
molecule tags Aminoacyl-trna synthase
source organism Geobacillus stearothermophilus
publication title Structure of tyrosyl-tRNA synthetase refined at 2.3 A resolution. Interaction of the enzyme with the tyrosyl adenylate intermediate.
pubmed doi rcsb
total genus 115
structure length 317
sequence length 319
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 1992-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1tydE02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1tydE01
1M8JA 3VGJA 1EJ2A 3F3MA 2HZ7A 1O0CA 3CVWA 4MWCA 1S4MA 2DXIA 1TYDE 4CT0A 4JYZA 3L93A 4MUFA 4ZCTA 1JZQA 4DDHA 4XFJA 1PFWA 2HGZA 1EFVA 1G59A 2QUKA 5KWVA 3U1VA 2RE8A 2CFOA 1J09A 3FWKA 4ZT3A 4UZFA 4KPUB 1OWLA 1GZUA 4MW7A 2X0KA 1JEEA 4MULA 4MWEA 1JZSA 1U3CA 2CUZA 3P0JA 1A8HA 2E21A 3QE4A 4I6JA 2CYAA 2QJTA 1I2DA 1JHDA 3RK0A 3IMGA 4MVCA 1G8GA 1WY5A 3C8ZA 3IDFA 1N3LA 4PBTA 2A1TR 4QREA 3COWA 4NX2A 4HJXA 4OUDB 2PZBA 2B7LA 4WSOA 3JXEA 2ZUFA 3N2YA 5KHAA 2JANA 3I05A 3TZLA 1I6LA 1J20A 1GTSA 1QU3A 3CLUC 1NUTA 3HGMA 1Y42X 5K0SA 1ZH6A 3ZJUA 4FZJA 4PBSA 3BL5A 3COZA 2QJFA 4KPUA 1H3FA 2GOYA 1J21A 4EG8A 2HMAA 1NZJA 1FFYA 4K03A 3SZGA 1O97D 2OQ2A 1ZH0A 3AKZA 3HV0A 3FG9A 2WB2A 3RFFA 3CR8A 2QUHA 5TS2A 1EUYA 3SDBA 1OWMA 2NSYA 4A91A 4EG5A 4AS1A 3SZ3A 3S3TA 1O0BA 5AHWA 3D6VA 3GUZA 1KH1A 1NUQA 1F7VA 3CLRD 2J08A 2A7XA 3IUBA 1TQ8A 1QRUA 2QUIA 4PBRA 1O5TA 2DLCX 1N2BA 3SYTA 3IMEA 4MWBA 1LI5A 2DR2A 1D2RA 3H97A 4MQ6A 1JILA 1MBZA 4DDKA 1WJGA 1YUNA 1NUPA 1JIKA 1EE1A 1IQRA 2CSXA 1OBCA 3IODA 2O5RA 3H9CA 4WNYA 1I6MA 2H2AA 1KQNA 3CLRC 3FETA 1V47A 2YWBA 4H3SA 4EG3A 2IP1A 4J76A 4G5FA 1XNGA 4Q93A 3SEZA 3G59A 5J5AA 1G8HA 3IVGA 3VU8A 3ZGZA 1WXHA 3IMCA 3UY4A 3ISJA 3IH5A 4GU5A 1XNJA 1V8FA 2X1LA 1JECA 1IH8A 4OJMX 1HYBA 1O94C 2WSIA 3FDXA 4JZYA 3H99A 4ZCPA 2IELA 3CLTC 4MUKA 1XNHA 3ZJVA 4DDMA 1GAXA 5EKDA 4ZT7A 1TYAE 2CYCA 4TS1A 4ND7A 3KT6A 4YP5A 1MB9A 3TNJA 1MAWA 3IOCA 1EFVB 1KQOA 1WQ3A 5LFAA 4MUNA 4X0EA 4NATA 4ZCRA 1TYCA 2J07A 4MVYA 2RD2A 4JXXA 3ZXSA 1PFYA 4U8HA 1N77A 4GRIA 2DUMA 1JIIA 4K0RA 3P0HA 1QRSA 3RHSA 3DLAA 5F23A 1KQPA 4L2IA 3QTBA 5J59A 4QRDA 3CLUD 3GLVA 1WXFA 3N9IA 3PNBA 1GLNA 4MW5A 1M8PA 1NUSA 4DE5A 1OWPA 3RJZA 2ZP1A 1F9AA 4MAFA 1N2IA 2QTMA 5FO0A 1NP7A 3K9WA 2QJOA 2CT8A 3P52A 3ZIUA 2A1UA 5H7XA 4EG6A 4E1AA 3COVA 1IQ0A 2PZAA 1I6KA 2CV1A 2Z3VA 3CVYA 1T9GR 2E89A 1M1ZA 1T6ZA 4EG7A 3KT8A 2OV4A 1KAQA 2H29A 4NAUA 2JA2A 1XJQA 1EUQA 1U0BB 1J1UA 2XRYA 3X1MA 3TS1A 1YULA 5LLTA 3K32A 1MRZA 3ZUGA 2D5BA 1VL2A 1OWNA 1YI8A 3PNYA 3X1KA 4JFAA 3ZJTA 2D13A 1ZUNA 2J09A 4EF6A 2Z08A 4RPIA 3HL4A 2IJGX 1QNFA 1QU2A 3UOWA 2AKEA 4HJRA 1EFPB 1JIJA 3ND7A 1U7XA 3MLAA 3RK1A 1O96A 5LM3A 4NZPA 1T9GS 1X6VA 1MC1A 1SURA 1VBKA 4ZT2A 4AQ7A 3FOCA 4NAHA 4XSVA 4QBTA 1PG0A 4HK4A 1WQ4A 2GM3A 1B6TA 3KT0A 1F4LA 2BTEA 4F4HA 1X8XA 2CYBA 5FO1A 1M8GA 3ND6A 2E0IA 5K0TA 3PRHA 4KKVA 1QJCA 3AFHA 3IUEA 1NSYA 2TS1A 4ZT4A 1MB2A 2Z09A 2EJCA 1JEDA 2PXHA 4CDMA 1WKBA 3NV7A 2GKSA 3DPIA 2WQ6A 3KT3A 1RQGA 3NBAA 3LE8A 4P2BA 1TFUA 4CDNA 4PY2A 3FNRA 4KR7A 4MW9A 1ILEA 4MVXA 1R6UA 2NZ2A 3A05A 1IFXA 3Q4GA 4EGAA 1O97C 2D54A 4EFKA 5HG0A 1U7DA 3SEQA 2VTBB 2YXNA 3FY4A 1ULHA 5TEVA 3D6UA 1T6XA 5HUHA 2A84A 2PZ8A 3L92A 3CVVA 1Q19A 4BWVA 3Q12A 1OBHA 4G6ZA 5KCMA 2AG6A 4MUHA 1Q15A 1VBMA 2A1TS 1K97A 5H16A 1N2HA 2VXOA 5TEWA 1KP3A 4ZCSA 1JMVA 1H3NA 1YUMA 4R2MA 1NURA 1MAUA 3MMXA 3X1JA 2C5SA 4Q16A 1IVSA 5DASA 1O95D 1LW7A 2A88A 2I1LA 2JAXA 4NDAA 4S1OA 1O95C 2V0CA 4F3RA 2X3FA 3M5WA 3H05A 5BNZA 1WXEA 3FH0A 4YMIA 4ZT6A 3G5AA 1KP2A 3HFJA 1Q77A 2VTBA 2XRZA 3ZXIA 1PFVA 1UFVA 5DK4A 1OD6A 4I6EA 5DB4A 2QTNA 3FIUA 1N2JA 4UZEA 2PIDA 1QQTA 4L2IB 1BS2A 1KR2A 4KR9A 1KAMA 1TYBE 5JBNA 4R2LA 3P0IA 4I6GA 3OTWA 4MW6A 2DPLA 4DNXA 1GTRA 3IOEA 3N8HA 1M83A 1WZ2A 2J4DA 4YP6A 3KFLA 3MXTA 3ND5A 3ELBA 2R5WA 3HMQA 1M8FA 3HZRA 1N2GA 3MUEA 1VBNA 1WXIA 3CLSC 2YY5A 3FHJA 1NI5A 3SP1A 3A2KA 1LI7A 1GPMA 4U7JA 2BYTA 1N2EA 1ZJWA 3CVXA 1O6BA 3QTTA 4MUEA 5TGTA 4CQNA 3INNA 4YP7A 5J58A 3Q10A 3UK2A 4HPWA 3CLSD 3A04A 4XFDA 3N05A 4ZCQA 3TQIA 4MUIA 4OUDA 1KORA 2AZXA 1NYLA 3IOBA 1J1ZA 1PG2A 2E18A 3TZEA 1N2OA 1PFUA 5DEOA 1N78A 1QTQA 3G6KA 1R6XA 1J70A 3AG6A 4EG1A 4RUKA 3DO8A 3IVXA 2G36A 1O94D 4MLPA 2O8VA 3TQOA 1KH3A 2QTRA 1O96B 4ARIA 3VRHA 3OP1A 3UC5A 1EXDA 5HUJA 5FNZA 2CV2A 4J75A 1K4MA 1DNPA 5IHXA 3A4IA 4G5YA 4MVWA 3AL0C 1U3DA 2YWCA 1T6YA 1M8KA 4ZT5A 3FI0A 1JGTA 1IHOA 3MLBA 1F7UA 2A1UB 3PNVA 1KH2A 1OWOA 4ARCA 4MWDA 4MW4A 4MUJA 3E27A 2A4MA 3CA8A 2DEUA 1WOYA 3UMVA 1Q11A 2X1MA 3AG5A 2A86A 2ZUEA 4JXZA 1FYDA 4MUGA 1YIAA 1GN8A 4EG4A 3IVCA 1G8FA 4U63A 1QRTA 1N75A 4ND6A 1R6TA 4DLPA 2EL7A 2PFSA 3GMIA 3PXUA 1KKUA 3DV2A 2DETA 2CV0A 2PG3A 2QUJA 5IJXA 3ILVA 4KR6A 1H1TA 1K92A 3AIIA 1COZA 3CLTD 1EFPA 1N1DA 1IQUA 1IRXA 3CVUA 1NUUA 1K4KA 1WXGA 3NBKA 3LCJA 2J5BA 4DJAA 2WQ7A 2V0GA 1MJHA 4MW0A 1CT9A 1VLHA 3RBAA 1H3EA 4R0NA 3COYA 4YBRA 4MW2A 1MOPA 2DERA 1TEZA 4MW1A 3H9BA 1YIDA 1P7PA 3LOQA
chains in the Genus database with same CATH superfamily
1NL3A 3GA5A 3VHLB 2R48A 4DLAA 4URVR 5KDOA 2R6ZA 1SGWA 3K0SA 1QP4A 5L45A 3KQTA 3OPYB 3PXAA 5DWQA 3ZLUA 5MN4A 3QLJA 1CF2O 2BJWA 3S27A 4AUMA 4CKBA 1N7GA 1VJ1A 4AZ0B 1XDDA 2E1RA 4AUEA 4JYZA 1Z13A 4TGLA 1E1NA 1B8OA 2AMLA 3HCCA 2O0LA 3QEMB 5HM6A 1J2EA 4NDNE 1SHKA 4ZQBA 1FYEA 1WP4A 2PZKA 5ANRB 3PQ3A 4DIKA 1II8B 2QUKA 2JEOA 1EFRA 4P4GA 2H51A 5HRUA 1P3DA 3ICCA 4PZLA 5E7IA 2CFOA 4G0XA 5CVVA 3R0ZA 5BSHA 1N5RA 1UJCA 3IQEA 1IBSA 2B30A 3VR0A 3WP0A 4I5EA 3T3PB 1P2UA 3WIVA 5LQNA 2X0KA 4DOMA 1MABA 3LCCA 2A5JA 1RFGE 2AFVA 3VMMA 1E8DA 5FORA 5B7QA 1VL0A 2QG4A 1JIVA 4GT1A 1D1QA 4YCJA 2CXPA 4LOKA 4IX9A 3AY0A 1HH4A 1NDQA 1UJ2A 3LW7A 4K6GA 4D0GA 4WESA 4JBYA 4X97A 4MDHA 5LOVF 2GEDA 4BO3A 2LCIA 2CC2A 4DSUA 3MG9A 2E4VA 2JANA 2QSZA 2GPYA 1HZZC 1J2JA 1QYVA 5E4JA 3R7WA 5CHYA 4JP5A 1XP8A 3TJRA 5DBFA 4FE7A 4PCUA 1IMJA 4LXGA 4HZUA 4Z1OA 3I12A 5JNUA 1BWSA 3GBSA 3MBOA 2VQEB 4A36A 1E2LA 1LH0A 5FUBA 3BWXA 2HEGA 1RPAA 2GK3A 5DBGA 4AJ1A 2Q5JA 5I47A 4XWGA 4EG8A 3THXA 4H3KB 3BRWA 4FEGA 2YCLA 1UK9A 4ZKDA 3QV2A 3L7CA 3D59A 4KP7A 4PNHA 2BM9A 2QW1A 4QJBA 2H57A 2QN8A 3GC6A 1I33A 3BFXA 3CR8A 1SXIA 4MQMA 5D3KA 4N47A 4MYDA 1SVLA 2C3MA 1KMCA 1QGZA 3O2NA 1P2TA 3UIEA 4EZIA 4AS1A 1UXJA 1WXQA 2GWHA 2WMOB 4JJ7A 3WWCA 1M6VA 2X15A 3VHXA 1VSQA 1RWWA 1UM8A 4RTKA 3OPXA 4FYKA 3N3AC 2CLIB 2F3QA 1MD9A 3E22B 4HDCA 5LZ2A 1NAHA 3LUCA 4DJTA 1R6DA 3MAJA 3IXMA 2J08A 4FJ2A 3UJAA 4I1UA 1TQ8A 3NBMA 4XQGA 3RU2A 1TX4B 1VSVA 1ZBQA 4MKRA 3LRPA 1TO2E 4NIMA 3LUAA 4LMRA 4XCQA 4ZVTA 1BFKA 1YDEA 2JGDA 5FPKA 3WK9A 5DCUA 4A16A 4RMIA 2AXEA 2QPLA 3EXHC 1NUPA 4ZO7A 3DVAA 4FYIA 4ACBA 2BKEA 2OGZA 3RSQA 5CBPB 3HB4X 2E5WA 1FTGA 3HCOA 5EWMA 3WMRA 3ZC3A 1WPQA 4G09A 2R7NA 3WMFA 5KYNA 2E5LB 4CCAA 2XMCA 4FONA 1CUDA 3LMKA 3OD5A 1BHO1 3E0XA 1BHQ1 4OHXA 4R8RA 1V47A 1X8KA 1FNMA 4KUHA 4ZVNA 1LDNA 1BROA 2OL4A 4LJ5A 3CONA 1OXUA 1BXGA 4OHMA 2C84A 1U9CA 5EZ6B 3H1TA 3C85A 4J76A 1WCV1 1WKCA 4B46A 3AEYA 1YHNA 4BJHB 1KEVA 2WILA 5J5AA 3NH9A 4IICA 3CSUA 1GNSA 4J3FA 4OP2A 3T4EA 3TQTA 2ESRA 2CGEA 2Y66A 4PANA 3ZGZA 3HUUA 2I4OA 4KO4S 4YJHB 3ZOZA 2VNJA 4UOZA 2AJTA 1DINA 2DPGA 1VI5A 3W78A 2ZCJA 4GPD1 3SR4A 1GFWA 2GCGA 2EKDA 2L19A 1WVGA 4M1EA 4Y2RA 1OVGA 1CX9B 1E79A 1Z2EA 2AE1A 2OLKA 2OAEA 3DAFA 3K0KA 3MIIA 2MSKA 3NOQA 2JGKA 5AICA 1Y6FA 1QMGA 1LKZA 1N2CE 3PXXA 1D0SA 1VCHA 1XZNA 3LQYA 1IHXA 1Q1QA 4WY2A 3W2TA 3CSSA 3OEHA 1PEDA 2YJ6A 1YGYA 4KNVA 4QC2A 4QOIA 4QPDA 5C8ZA 5GJBA 3ZDDA 3TN7A 4HLQB 4D92A 4PQRA 4FW9A 5ICEA 1ZISA 1AK1A 2AV6A 2P3LA 2Q6LA 3G2HA 3MJSA 3PPVA 1T9KA 3IQHX 4Z1MA 1F06A 4J3NA 3HBFA 4DCOA 4S04A 3KQLA 3ICEA 4IDHA 3LM8A 2VBFA 3L18A 2JFZA 3L2OB 4RC9A 5BVHB 2QLNA 3VVCA 3V97A 1NV8A 4O3MA 3SYKA 3P45A 1ID8A 4FEYA 3AZQA 4I55A 4YLYA 1B8VA 3LLMA 1RQ7A 3NAZA 2JPDA 2P67A 3DXFA 2BCGY 1QZ3A 4H0FA 1WSDA 5HFNA 4E6EA 3L8CA 5TIIA 2FX5A 3QV1A 1Y7IA 1V5WA 1UF9A 1BXRA 3N2ZB 4FR2A 3OQ6A 3NBQA 4MEAA 3YASA 4DDVA 5L3VA 3EGXA 1XXLA 3NHKA 1W2HA 4H2DA 4DR2B 1ZM3A 5GONF 3U7IA 3MB5A 3CTMA 3GLGE 5AVSA 2B4TO 1T3SA 4E5DA 5FWXA 4L2IA 4B4OA 1KVSA 1SMKA 2HO4A 2OM6A 3BKXA 3G0IA 4LBYA 1T91A 1Q14A 3KOZA 1JHPA 3NOXA 1Z29A 2BEWA 2OBNA 1XRRA 1Z9BA 3H2GA 4HMOA 4Y18A 3VV2A 3QVXA 1L6RA 4CFZA 1JHXA 1P39A 1I80A 4CMIA 1SZPA 1DARA 3UAOA 4YY3B 4NCAA 2RBGA 2X4IA 3OC0A 1XELA 2A1UA 3DTTA 2D7DA 1RHQA 4D0NA 3DUFB 4YJGA 2VH1A 2CV1A 3KQHA 3NDRA 3U4QB 4F91B 1GL3A 1NBMA 3QVUA 4NAVA 1IBLB 2E89A 4B84A 2RH8A 5EJ6A 3RLFA 5KKNB 4LFAB 4J94A 3DVLA 1I3KA 3NVDA 1SM4A 2FLKA 4TXJA 4MGZR 1CDEA 5M7EA 3N2KB 2YWFA 3WLQA 1XQ6A 1LW6E 1Z37A 4NMLA 3T3GA 2R8RA 4UXHA 5EHNA 3EVCA 1AGNA 3ZGLA 2WVHA 4KX3A 2XWPA 4UUQA 3WYDA 3X1KA 1KQFA 3HWWA 4GWKA 1T0UA 2PA3A 3BCUA 3JQBA 3K8YA 2J09A 2NPFA 4E2FA 5B6PA 1LNQA 4IXNA 1Z8NA 4UHEA 1H0RA 2WMDA 3QXXA 2JCXA 1BWRA 2CNWA 4A3SA 1YQXA 2Y8EA 1LRLA 1KP9A 1QNFA 4C43A 3K71B 1RCUA 3W1WA 1FTYA 4LECA 4Q1BA 1W48A 1WHSA 2IHBA 5TT0A 5AKIA 2XITA 4OLBA 2ERYA 1DAHA 2FJUA 1PNVA 2P2LA 2REQB 4OK5A 1I7QB 1MC1A 1UMCA 4YUZA 2HNAA 1FJ2A 1U81A 3AETA 3KQVA 3JQ8A 4PAMA 5K0NA 3F6PA 3NHMA 4A0FA 2OHGA 1CY7A 3EBOA 4ZOAA 3WK7A 3R9WA 1N2ZA 3CURA 3KB6A 3WHLA 2OMKA 4AJLA 2C9MA 3H8JA 1Z6TA 3OOYA 2BRUC 1C9EA 1OXKB 3KEQA 4XM1A 5CEFA 2Q6KA 5JATA 5EESA 1M8GA 3ND6A 4UNRA 3EVBA 3O8DA 1X7ZB 2WWTA 4QQRA 1RE0A 1ZMRA 3AF1A 3FPLA 3OT1A 3FPKA 2B2XA 2P35A 4C07A 5BQPA 1CJSA 4A0RA 1RRGA 3ABIA 3OWXA 4J0KA 3EIXA 1MB2A 2ODEA 4ND4A 4K81B 4I2VA 2VNKA 2Q8NA 2O2SA 1G1MA 1TXGA 3OT4A 4GI7A 1JI0A 3MCAA 2V7BA 3AR6A 3E7DA 5DM0A 3UOAB 3VC1A 4E30A 5IG2A 5B57C 3OCCA 1FP1D 4JOSA 4P36A 1EFHA 1H5QA 4M1QA 2MINA 3IEIA 4NBTA 1E5TA 2O7QA 2Q9CA 5ECDA 3F9IA 3V2GA 3VPHA 4CNQA 4QSMA 1IOWA 1KXZA 5F78A 3WO1A 1ESCA 3DLTA 5G1NA 1GADO 5KYXA 3QVVA 3H2KA 4M6WA 2A14A 2D54A 2IHJA 1V3VA 1E0SA 2WU1A 3FDJA 3U7FB 3J7AC 3HP1A 4BXOB 6GPBA 1KY4A 1MC4A 4IUDS 5F2NA 1OGJA 4L78A 3C3YA 1TCVA 1P4SA 4NU5A 1T13A 5TEVA 2IYZA 2J0SA 1T6XA 1C7ZA 3H6GA 1MX9A 5ITZB 4B33A 1AG9A 1HGXA 4W5NA 3E9CA 1L5ZA 4BTVA 1SU4A 1YFZA 1CLEA 2BUCA 2XGSA 4UCFA 1DU4A 3HJUA 3H3XA 3UXHA 2VPQA 1POWA 2BFFB 1P91A 1JP7A 3AESA 4LQCA 2PGLA 3MXOA 2ECKA 4CM3A 4EA7A 4B34A 2A78A 2GCOA 3EIUA 1CD5A 1TU0A 2GA8A 1FNNA 1W59A 2ISCA 1TAHA 4HZGA 4Z49A 1X1AA 1ZNXA 2A88A 2I1LA 4NDAA 2O2EA 1KBOA 1MEOA 1XHLA 2D5AA 4ZC1A 1PW5A 2I2XB 4J7XA 2WDZA 3DMNA 3RM3A 2EYUA 4Y67A 2ZYUX 5T67A 3ONDA 5IKPA 3HFJA 2E4XA 3PUZA 3H2JA 2CK3D 2KW5A 1HPLA 3HA7A 2FR0A 4MO2A 1RYNA 3KYDA 2ZI5A 4B8YA 1VSTA 4QYXA 3E7WA 2OAQ1 4JCCA 2QTNA 2FRDC 3OQ1A 4P83A 3SOZA 1JB9A 3GHYA 1MO4A 2C9YA 3L07A 4D8XA 4HN4B 1KFKB 3OUUA 1JJFA 2IQ5A 3B7GA 5FOXA 4LYAA 2ORWA 1O54A 1P0MA 2B5WA 2CXSA 3QSYA 2WM9B 3K9QO 1DEKA 4ZCIA 3OZIA 1L5QA 3FROA 4JVMA 1WZ2A 1QDEA 2VJOA 4F3CA 3ABZA 3OLCX 1HRDA 2AKYA 3MXTA 4XRGA 3IAS1 4F9FA 5K0CA 3B38A 3K1AB 4YP9A 5D5QA 4PPQA 4IXDA 3ZV6A 3A26A 4FFSA 5EIHA 3EVEA 1Z5ZA 4FC7A 4IFBA 3HCAA 5FA5A 3KUUA 4X20B 4CM4B 4ZGWA 1MX1A 3TIIA 4F5EA 3KAJA 2LDXA 4PSKA 4P35A 4EHKA 3PR2B 3UMYA 3Q10A 3HMKA 3UK2A 3IAXA 2PK3A 2XD9A 2OY0A 2BV3A 3MUFA 3R9XA 3OIYA 2PEZA 4G9EA 1G7SA 3ONWA 3WWPA 1AKWA 4Y7CA 1UK7A 3VO2A 3GEDA 4XLZA 1UBLS 3N86A 2QQ5A 1VIAA 4WZAB 5CW2A 2MJLA 1O8BA 2WJPA 3G17A 3A4MA 4UFOA 4Y1RB 4Q03A 3ETNA 3OKPA 3CRNA 3UWOA 3B8EA 3USES 2XEXA 4PN3A 2VYVD 3FUVA 5I6DA 2QRKA 4HH4A 4R8LA 3G2QA 2XJ9A 4HWSA 4KQ9A 3CYFA 5TQJA 1T4CA 2YRXA 1GL6A 4N40A 3AM3A 3SYNA 1YQWA 2IYTA 2QLBA 4X45A 2G1PA 3GMDA 4LYDA 5A0TA 4KG7A 2WJJA 3IBFA 1P7ZA 2ZRDA 4QIHA 3Q0EA 3ZXXA 5H8WA 2BGWA 3I04A 4C0BA 2FPKA 2R9VA 3BHJA 4KVZA 4JNCA 3R6WA 2VCYA 4KQ1A 4RBNA 3W6PA 3Q7EA 2WHPA 2ZROA 3IELA 5CDSA 3KVNA 1KJZA 1L4GA 5TE9A 5L3QB 4EMSA 2P9FA 2OZLB 2ZR7A 3ZNNA 4EFDA 3VPSA 2NO6A 1JN0A 4EMBA 4TTRA 2XBMA 3W2IA 1V45E 4HQRA 2XUOA 3DXXA 2C8JA 3U19A 1NWCA 2BTOA 3OY2A 5TLSA 2IBTA 4F9EA 1B23P 1C0EA 2IOHA 1EI9A 3MLBA 3SS8A 3IBGA 3ZWCA 4BP1A 4WXHA 1P1RA 1XKTA 1NLYA 4XIFA 3SS7X 1IPEA 1K7EB 4JOQA 2CCKA 2KMLA 1NLZA 2B92A 4US1R 5ER9A 4DG8A 4YV7A 5C7IO 1L1QA 3AVVA 3Q7TA 2WYIA 1T1IA 3LXMA 3IV6A 4GPBA 1I2AA 1M1YB 3UWDA 4DKJA 1R4AA 3FHOA 5IT9A 4BFCA 5T64A 4CIXA 4Z6KA 1E7MA 2H4ZA 2HLDD 2XUGA 2CKMA 3WIUA 4DUGA 5I8WA 3WK8A 1UPAA 4OH1A 4QFBA 3T8YA 5KBYA 1AS2A 4KIUA 1QRTA 5AJVB 1Z5WA 4TWRA 3REQA 3RTDA 3PTLA 1C5KA 5DRTA 5IT4A 2PRKA 2XYGA 3AB7A 2PL3A 4MI1A 4ENWA 2VUTA 3B48A 1Z7GA 2CMKA 3DT9A 3OQNA 2DAPA 1WEKA 1OFGA 5L51A 3AIKA 4ZIRB 3A3OA 1EFPA 3KYCB 1F38A 3O9MA 5DOZA 4JLNA 4NOLA 3W8RA 1OREA 3N53A 4ARAA 4EFMA 3CVUA 4ZOCA 3EVAA 1T5SA 1M0TA 2IXTA 5ALPA 3T94A 3TMYA 1DKPA 3LDGA 3M9WA 1WCXA 1WXGA 2SCUB 1EXWA 1H2WA 2QRLA 4DJAA 1YUBA 2WQ7A 2X8LA 4O08A 4RZ3A 1CS0A 1X9HA 4HDMB 1CNMA 1K63A 3IILA 2B69A 5F4ZA 3CWZA 5FYDA 2O8FA 2VPIA 1LB1B 4R0NA 2ATVA 3B5IA 4L22A 1QE3A 5ALHA 4YVFA 3ICPA 2YC4C 4YDSA 4IKEA 4NFYA 2NSDA 8ABPA 4QQKA 3FR8A 2HMUA 4TQGA 4IOLA 4DC0A 1ZL2A 3SEAA 4BJ6A 4E5YA 4G9BA 1DKMA 1ULTA 1NVXQ 2WD7B 1BMDA 4IV0A 4K9OA 2X5KO 4B3CA 4YCMA 4WVFA 4M0UA 1NKVA 5LP6B 4GKKB 3CEMA 2NO0A 4D98A 1LBTA 3I5AA 3M7IA 1BMFD 3RRXA 5AT1A 3H9EO 1NX9A 3AYXB 1NIJA 1O58A 1TM3E 3OO0A 2MSEB 4UNSA 3L8DA 1ISMA 5M3BA 2PJRA 1N4DA 4L07A 3OZWA 3OIUA 5JS2A 3GJ4A 1MV8A 1OGYA 1ISGA 4HNRA 5K4AA 1W5TA 4MMYB 3UGJA 3JQFC 5EXEA 3R3WA 5CVDA 4R9VA 3H5LA 4CIVA 3S0JA 1OOEA 1ZU4A 2OORC 1E6MA 4KPUB 5EJ8A 2BKXA 3NHUA 3SX4A 5HOQA 1M2OA 3LZ6A 4P4SB 5E4FA 1NJ6A 1E2FA 1U3CA 3W5IA 3R1IA 3TOZA 5DCYA 4KKXB 4P32A 2XCRB 3HPQA 3Q8LA 5EKTA 1M34A 4G2TA 1JFSA 5G3YA 5HMMA 1JHDA 2ZE8A 3AILA 3RK0A 1P5FA 1G8GA 2IXGA 3AVXA 1A8SA 3T99A 3TDKA 4BC1A 1PVDA 1A50B 1OX4B 3OHMA 3QU7A 4O2RA 4TKZA 5GP1A 1GZ6A 3VOBA 4PIMA 2A5DA 4QQFA 1O4WA 3T7RA 3TNYA 5CB4F 1XMSA 4PCVA 4JOCA 2HRZA 4WSOA 4Z3DA 2HCTA 3UH1A 4EBBA 1PYOA 4IDAA 2P5YA 4GVPA 5KHAA 4QDZA 1KU6A 1PJCA 5HE9A 3HGMA 3NG1A 4B74A 5U4QA 4J6EA 2G9UA 3FPBA 4A0QA 4KR3A 1G5QA 2RFLA 4IHKA 2I9PA 2JHCA 1N0VC 1ZEJA 1XR3A 1Q83A 2QZZA 1EB8A 1D5WA 2HMAA 3UANA 1UOEA 1OV6A 2EP5A 2VSYA 1YR2A 2V7VA 4J0FA 5DYTA 3RNOA 3SIXA 3SX0A 4JITA 1Z0SA 4QUEA 1C1XA 5TR9A 4C03A 3T5TA 3AH8A 3C1OA 5C51B 1D4AA 2HV9A 2A2ZA 2FQQA 2SHKA 2VYQA 1PEKE 2WTXA 3ENNA 3WK4A 3LUJA 4EG5A 1BA3A 2PZFA 3B3GA 3JQDA 3NOOA 4GX5A 3HYCA 3TXYA 5JHGB 3AF5A 5KOHB 3IGFA 4FMBB 3FTCA 1DC4A 1JKJB 1MC5A 2ZBDA 2H2GA 3GPIA 4BOYA 4ZHQF 3BE6A 1KH1A 1LC3A 2W2OA 2UYOA 5IDYA 1PLLA 2Q2OA 1I1QB 1YS6A 3SZRA 3THSA 4BNXA 4BVJA 3CBGA 1EAMA 2HA6A 1AHPA 5TQVA 2VZ9A 4N8EA 1QQ5A 2OYRA 1OI7A 3AJDA 1OSNA 5H82A 3E9ZA 2Y4NA 1J0XO 1R5NA 2WFZA 3ESZA 3G2JA 4MQ6A 3AOEA 5J63A 3EC2A 2FR8C 1YUNA 1TMGE 1V8ZA 3KOMA 2FHPA 3QENA 1Y81A 4V02A 2CSXA 4QUHA 1TT7A 3PFHA 2XB4A 1VLJA 4P92A 4RIFA 3G0CA 5JO0A 3GUUA 2I1WA 1P72A 5CXUA 5KYKA 2Y1FA 2G9ZA 3BRSA 5HUQA 5BSGA 1UZLA 2E48A 1CQWA 1L5OA 2CL7X 2GERA 3AX6A 3QBTA 4DR5B 2RGYA 4IJ5A 3I3SR 2HSDA 5DLPA 5HP4A 1GNTA 4ZZ0A 1NN5A 4YLGA 4JC4A 2PKQO 3WRXA 2IWHA 2HSEA 1W94A 1HYQA 3ORRA 2FKAA 3ZPXA 1JNXX 5EE5B 3PT9A 3SJZA 4DIBA 4EW6A 2FFJA 1TM7E 2ECOA 5E6SB 1T4BA 4RPKA 4FILA 3JWPA 1QV6A 3L7AA 2I4MA 3IH5A 3L4EA 4M9QA 4AB1A 3AU8A 4V38A 4D1YA 1NW9B 1SKBA 4BZQA 2CBGA 4D0LB 3IOYA 5JR3A 3C2QA 4G37A 2WLSA 3EB9A 4NU0A 3UW1A 3H84A 4DV3B 2PRSA 5FQNA 2O2DA 4J43A 2UYYA 4C0AC 4UTVA 4YIKA 4EZBA 5FAXA 1K4YA 1QO7A 1QCDA 1N7IA 4Q3LA 2ZBUA 4M98A 1QG0A 3L0DA 3PDIB 3HV2A 2PTGA 2QMHA 4QTUB 3RKUA 4E5VA 5BNIA 4BNNA 4DGQA 4JQCA 4BMCA 3W9BA 2OM2A 2XKAA 4C4TA 2CHQA 1XUOA 4NBUA 1AMNA 1GAXA 4FYHA 4KUEA 3QLVA 4NWIA 1OKKA 4ZARA 5C2JB 3IDOA 1H2BA 1M74A 3OOWA 1M76A 4QTYA 1UFQA 1PEYA 4CLXA 1F0KA 1K8XB 2FSHA 5EUBA 2QMOA 3F5DA 5IX8A 2WBLC 2I6TA 2P27A 2ZUSA 3H7IA 2PO7A 3S55A 4TLAA 4D8TA 5L9AA 4RZHA 5I9TA 4NATA 4Y9UA 4A8PA 4ZCRA 4KODA 1TVKB 4DB2A 4M49A 3ZXSA 1EDDA 1L3CA 3L7DA 1U5BA 3IEPA 3UCXA 4B45A 1KR5A 1TA0A 3QKRA 1H6DA 1N8KA 3F2IA 4HAIA 5E8JA 1MAVA 3PR3A 2PMEA 4F6CA 1XOIA 3R9IA 1SBTA 4IIJA 1COWD 3FPFA 2L42A 2XDQA 1WU7A 3LPCA 4WXRA 5CFRA 4BJ5A 3E3NA 3LHSA 3W77A 2YDYA 1Q0UA 4TUYF 2AR0A 4D9MA 1OBOA 5A9TA 5BN4B 2G0TA 4CQLB 1EWKA 1N5KA 2BPOA 3VFDA 1PUIA 3R7SA 2BFOA 4QFMA 3AKYA 1PAUA 5D51S 2JIPA 4U7HA 5AQ1A 2HRDA 5EGSA 4QZVA 1XZKA 4HSEA 5IYZB 1D07A 1U8XX 2AT1A 1YRAA 1IQ0A 2CB9A 2W43A 3LQKA 2ZJ6A 5ENVA 4A27A 1NY6A 5AUNB 3N2GB 4HAVA 2PL5A 2QOEA 3IHTA 1D9ZA 4Y7DA 4FR0A 4JAVC 4RTSA 2BTQB 3IC5A 1JFRA 2EX0A 4NV3A 1RKBA 1W36C 1G9TA 3IR7A 3GLQA 4XWWA 5A5DA 4UE2A 1DX9A 2H2DA 4PHCA 4EY6A 4Z9XA 4W7SA 3R3XA 3I76A 3TECE 4M7OA 4Z86A 3TZKA 4OHUA 1JVSA 4L4YA 1CZUA 1NQ5A 1D7AA 5JZOA 4GMFA 2WF6A 5FYQA 4HY3A 2FNAA 5EFOA 3EVTA 2JI4A 2O07A 2CY0A 4DYVA 1ABFA 1V8PA 1ADYA 4TRMA 1U28A 3DWEX 2FN3A 4JC5A 4YHBA 2NZUG 3FRJA 3OM9A 2WI8A 4KNWA 2TSYB 5L3ZA 3VKUA 4DCPA 5K0JA 3NVKI 1SQGA 1Q0HA 2DJIA 4KBFA 3D3JA 2RH4A 1T2FA 5ALXA 3BTUA 2JGMA 3BWVA 1X7WB 1H5UA 1SURA 4XW2A 3RSGA 4I4TA 3B3QA 5IF9A 2ATCA 4QBTA 1Y7PA 1Q84A 4XSVA 2AJLI 4B40A 5CNJA 3OVMA 1D1PA 2Q5QA 1PV1A 3ED1A 4F1WA 4U6NA 4FKMA 1TCBA 3VBEA 1B7GO 4RHTA 2PBZA 2UAGA 4TV8B 4YRCA 3WL8A 2BMVA 3G02A 1R8SA 1W30A 2NUPA 2BUAA 5F3RA 2OXFA 1UC5B 1UMBA 1WDMA 3KQOA 3OZDA 4KIJA 5IP5A 4WFQA 3SNHA 4EGQA 4JNKA 1RYHA 1Z0ZA 2R87A 4D9EA 2UU9B 3PWKA 3CW2A 4AI6A 2Z09A 4QGHA 2FPOA 5J2UB 1RXWA 3OE4A 1NBAA 3HZHA 3FVQA 1YL6A 2J9FA 2ZITA 4M8LA 3NV9A 4HNSA 3WMGA 1QPGA 2HPHA 5IAAA 3LE8A 4P2BA 3LUDA 4KQMA 5CFNA 5KEIA 1ZCBA 4R69A 3C3WA 3FNRA 3GNLA 3H0KA 1VE7A 3H5AA 4KC0A 2I3BA 4JI1B 2B37A 4EA8A 5A62A 4V0LA 5J4KA 5GINE 2R7LA 3LW8A 5KI6A 1RLTA 2G3YA 4CF6A 5EQFA 3GGCA 1P62B 3W3AD 2HCRA 1BN6A 3DBRA 2V7XA 4B3TB 3DPSA 5EIOA 1SRRA 2QDXA 3GEMA 5JFOA 1ULHA 3K05A 4M8IA 3LFUA 2Z8YA 5B4TA 5EQTA 1NHWA 1G20E 2JH8A 1SA0A 2ZSBA 5MFPA 3HK2A 2EZ8A 3AONB 1FFDA 3B12A 3HN2A 3KLMX 3OEED 3JR7A 4EKIA 5WRFA 4GFDA 2XAAA 3PRKE 1GDHA 5COAA 4IH9A 5SZKB 4D9CA 3BHNA 3K5IA 1QQ6A 1RRVA 1G1AA 3VQTA 1X14A 5ABPA 1D2CA 4D4LA 1CUIA 2QGNA 1XZCA 2AFIB 1U9YA 3FSEA 1L4HA 5AD1A 5BSTA 3COSA 5C32A 4I1IA 3H0EA 4DLKA 3T3MB 1U3GA 4MWTA 2FWPA 4FM9A 1LBHA 1Z2DA 3MJ4A 2AJBA 3RFVA 1XB2A 121PA 3PGA1 3L41A 4JLUA 2F3SA 1YASA 3G8AA 3GJTA 5KYYB 2XCSB 1XCMA 3GCWA 4IMJB 4KXVA 3C3DA 5JXIA 2FRVA 1G4AE 4JBHA 4KQGA 1UKBA 4L6CA 2I7DA 4HT3B 3ZTWA 3BIFA 1KR2A 2FJ0A 2I3AA 3W9UA 4FS3A 4RTLA 3B70A 1CNFA 4XOIA 4B7ZA 3N8HA 1YB5A 2VATA 3H0CA 3MUNA 3PI7A 2XZPA 1D6MA 2V4MA 1DBQA 4YJHA 3FBTA 4MVJH 5KO2A 3K0AB 4P3YA 3PV0A 2OV8A 2IL1A 3AI3A 2EZUA 3QEMA 4JUIA 3C3XA 1W5FA 4KRXA 4ND8A 1U8YA 3KQQA 4DA0A 5B6JA 1GSHA 1K89A 1O9HA 2RAUA 2FPPB 3W2FA 3VO9A 5FWYA 3DWIA 1APBA 1FRZA 5D6NA 4L0QA 1ZQ9A 1TRKA 1RRKA 1NW5A 4INJA 2FWJA 1XYYA 3AQIA 3IULA 3NIFB 3QLUC 3VZQA 1FFEA 4BMDA 3AVPA 3VPCA 4GRAA 1V96A 3B6ZA 4WERA 1BHSA 3JYPA 1P7CA 1DG3A 2ONCA 2Q4BA 4Y2YA 1F3OA 4ZCQA 4R84A 3MBKA 2LKDA 3D4NA 1VHQA 3D8TA 5FI1B 2BGTA 4HLDA 2ZWMA 3UAZA 2GUWA 1YBVA 3I30X 2QI9C 4JJ6A 4ZEXA 4YJFA 3VC7A 2O3TA 2EXXA 2NG1A 3UC9A 1N8TA 3DE2X 1NI3A 3DM5A 4PLVA 3UHJA 3GLIE 1LLDA 2IOYA 1ULBA 4XYBA 4B3FX 2CHEA 4KXWA 4M36A 4QARA 3DMYA 5JD6A 4AKHA 1NBIA 2ASEA 2YXDA 4ZEVA 3FCCA 1J70A 4PRZA 2WTMA 4QWWA 1FUUA 1B00A 1SCUA 3IXLA 1Q0ZA 4RUKA 4E4TA 3GIDA 3UFXB 2AQHA 1XXHB 4TM8A 2VXYA 4BAUA 1P6QA 4LDZA 3UC5A 2BSXA 4UUMA 2ZJ2A 1Z33A 2XOXA 5AFSA 3LKBA 3EMVA 4KXXA 1SVKA 2C2BA 1WIWA 5J4HA 4RF4A 2FAXA 2G70A 5KKCA 2D1FA 4RTRA 5L4SA 2ZATA 2Q4TA 2Q4EA 3OQPA 3PQ2A 3A4IA 3CZ9A 4XX0B 1H23A 1M3SA 1G98A 1WXDA 4ZZ3A 2DBYA 1S3IA 2X5XA 1HEIA 5C0OE 4N5NA 3R41A 3M3PA 4Q7JB 3EQ8A 1F7UA 2MSLA 2V03A 3DW1X 1HQDA 3VR4D 3DOJA 5ERGB 2KI5A 2PY6A 4B32A 2GZAA 1KNXA 3SS9X 3Q8KA 3TD2A 1UZNA 4IG4A 2QQFA 4TZTA 4BAZA 3W7VA 1Z36A 1N6LA 4OGFA 1I1HA 3BMNA 4MUYA 2GJ8A 2DM6A 5E6RA 5H02A 3DKVA 2XLBA 2HIHA 3QPBA 1YR1A 4RQBA 5L7TA 3KOYA 3BCRA 4OEHA 4M89A 4GF5A 2FDXA 1U2DA 1RXSA 5DE3A 4MRNA 5EJGA 4A2PA 4C4XA 4YMVA 4GEKA 3T6KA 3KVYA 1OAOC 4GPIB 4JN6B 4MV5A 3P0FA 1UMDB 4UOQA 4PPGA 3TVTA 4NFLA 1O4VA 1Z8DA 1ULZA 2RGXA 1Z0UA 5B1YA 3P1JA 1PZXA 2OCGA 4HL6A 1QIHA 1FP4B 1VIVA 4CKEB 4G84A 2O8BB 1J25A 2VHZA 4WFJA 1GU7A 3SYRA 5B5SA 1DG9A 4QTTB 1L7DA 2BFFA 3UUWA 1C1HA 1J9GA 2IPLA 4GL2A 1JE0A 3LVBA 4BQQA 4ARZB 1G20B 2C31A 1WHSB 1R9JA 2W8BA 1NVGA 3L6DA 1TI7A 3IAFA 3WGOA 1E1CB 3K1JA 3KD2A 5BWCA 4Z0NA 1G42A 5HIAA 5CDTA 1WM1A 4BX2A 3ZU2A 3PXEA 1ZMXA 1EHCA 1LNSA 2HQBA 3DZGA 4RL6A 1Y63A 5FTJA 2BGGA 3V2HA 4MW0A 5F21A 2HHHB 1ZITA 2QZJA 1SVNA 5KHLB 4L8WB 3TL3A 3QVGB 4S05A 3AIMA 3KDAA 1K8YB 1UXKA 4PC3A 4ZO4A 1U31A 3MFYA 3KFVA 4GH5A 4NOKA 2QYTA 2D06A 1XA4A 4DM4A 1YKFA 5IU6A 1A1VA 4DV0B 1FP6A 4B6QA 3GELA 4AF6A 3RVLA 3M1YA 2ZREA 2I1VB 3JZAA 1MJGM 4CETA 3AW9A 1OTXA 3GDHA 1JT2A 4RZUA 4HDKA 3ACCA 1E2EA 1QKJA 4M0PA 1GKLA 4NS4A 1Z5GA 2VUHB 2YXEA 4BKQA 4RULA 1FQJA 3HBMA 2G7ZA 3GD5A 4HPJB 2XTAA 1IWOA 4FI3F 3CVWA 1CRZA 3HFRA 3ED5A 4D99A 2BP7B 1MRSA 3D0RA 4D3FA 2E7ZA 3SCZA 3KZCA 1PYGA 3M6VA 1I3NA 2JFHA 1PWEA 4P0PB 1EFVA 4FOSA 4DCSA 3HLYA 2C1EA 3ZHVA 1SXGA 2APJA 4C0KA 1G38A 2VQ3A 3GFTA 4A2QA 4OHPA 4TWAA 5BN1A 4KO2S 1XA3A 4K88A 5D3MA 5I7HA 3EFBA 1UP4A 1OWLA 3OE7A 3DL4A 4MK4A 2WSSD 5C8YA 4GKJB 3PC4A 1YL7A 2WJZB 5FWXB 2UUBB 5AVQA 2DBQA 4IDPA 1KETA 4I6JA 1LZKA 2XMPA 3BSFA 2Q50A 1YZTA 2NZJA 1L7NA 1GARA 2IX3A 1O9BA 3GJ8A 1HT1E 5LQDA 4R1NA 5L4NA 2W90A 4CEIA 1ADGA 4TMVA 2VPXA 1RBZA 5LVAA 1RSZA 1CUYA 2NXCA 3FFXA 4NG4A 2XYRA 1LTHR 5DYNA 3ZV5A 2H4WA 2XE4A 5ENZA 2ZYGA 1JDSA 4HNVA 1JR4A 3BK7A 1Y42X 4J0JA 1D03A 2IQIA 5EXPA 3TAXA 5JS8A 1IDN1 2QJFA 2GOYA 2ZAYA 1A97A 1N5MA 1P2DA 5HTKA 3ZGXA 2OO5A 1QVAA 3OPQA 1FYFA 4EHHA 2GNAA 1BRTA 2VHXA 3HV0A 2YC2C 4RANA 3UMMA 3S8YA 2WAOA 5AXBA 1E1QA 4EQZA 4QU5A 4H6VA 2ZJAA 3EYAA 4MR7B 4PYRA 5JFGA 1H8EA 4ZAZA 1SC1A 3IIEA 4P34A 2QGZA 1USVA 4HB4A 4YMTA 1G5IA 1RPJA 1WVIA 1ZBDA 2JGIA 3HQ4O 2PGJA 1H9BA 1JB1A 4YPFA 3F78A 1U7TA 2C88A 2VAMA 1KO5A 1BX0A 1C0KA 5ILOA 3WYFA 2C9ZA 1Y1SA 2NACA 5FI3A 1SOMA 1W4AA 2ZS8A 4XEHA 3MT8A 4AG3A 4AZTA 1RAAA 1Y8QB 1YS2X 2YZ7A 1QRUA 1U7WA 4QXAA 2YVAA 3NPMA 4TVKA 1DO8A 3SXUA 3DKRA 5ECWA 1JILA 1HURA 1TTPB 4ALJA 3MRSA 4DHEA 1U1EA 2I34A 4AZSA 5EJEA 1KPHA 3VR2D 4RMNA 3EXG2 1IQRA 5EE3A 5B7PA 2A9QA 3OLXA 4TYNA 3QXGA 3BZBA 4H0NA 5E0OA 4I14A 5DYWA 2ZETA 2WJ4A 1GV1A 5DHPA 1WZEA 3T5CA 4L7QA 3FDFA 1I0LA 3UATA 2DUNA 2KLHA 3P4UA 1DC8A 1E92A 5J2UA 2C04A 3RHFA 3CMCO 2QY9A 3FETA 4RLQA 4YUAA 1SKMA 1S7CA 3AJ8A 3RNLA 3WSWA 3IIIA 5FNVA 5C8YF 4IR7A 2O8NA 1Y9JA 2IDKA 1Q92A 3IVRA 3JCZA 4ROSA 2GAOA 3SQLA 1PQUA 3BWDD 3HXMA 4CGZA 2M98A 3RV4A 1DZIA 3F74A 4W5WA 2D5CA 3JQRA 4Z5XA 3P5SA 3N6RA 1V8FA 2GB4A 5A2GA 2QK4A 3MSXA 2CKDA 2I62A 2O14A 3LKZA 4LRUA 3FPJA 2HU8A 4TSKA 3MWKA 4N5IX 4CKWB 4DCUA 1HYBA 2FOIA 3ESAA 1DQPA 1SBQA 1U6IA 3P97A 4JZYA 3AUTA 2QR5A 4N8SA 4PXSA 5LCXA 2AH5A 3ZW8A 3VR3D 4ZCPA 3ZHBA 2X7HA 1XLWA 4LJ6A 5FXMA 3B6EA 3SSOA 3DDNA 1VJRA 3DEYX 3ZWAA 1VKNA 4DEXA 4JI3B 2HB6A 2QVZX 4IQ0A 4N82A 1EHIA 1RHRA 1T29A 1HSOA 1WO8A 3ON5A 2CJWA 4I8DA 4MPRA 4UHFA 3V4OA 3TB6A 3GPDG 2I55A 2EL9A 4IFIA 4E2YA 1UAGA 4NHOA 5JNWA 5KOJA 3Q6MA 4IWNA 3QPVA 4HDNA 1FJGB 1XN4A 3JQBC 3O3MB 1T2EA 5CYFA 2X4DA 4BDTA 1JKMA 1KQOA 3LUFA 4FFVA 5LYYA 3B60A 4GYKA 2ZM5A 1WL8A 1JALA 1R66A 3QSGA 5IZCC 2YJTD 4JB2A 4O1HA 4FZ3A 4F8EA 4JI5B 4RCVA 3PUVA 1K68A 4GRIA 4KJZA 2ETXA 3HCNA 3FB1A 3TLMA 2QTBA 1FB5A 2OD7A 2P40A 3JSAA 1FF9A 1SOVA 4DRXB 3TR5A 3I09A 2F4NA 3AVUA 1ZH4A 4AKSA 1OLOA 3DTVD 4V0OA 4DJ5X 2RAFA 1N5LA 4HRYA 4HWPA 4YI5A 3PNOA 4I4NA 2BRUA 2C61A 2JRLA 2CNKA 2CDCA 3I2FA 4LDJA 3KEGA 4NYJR 3EMBA 3LBAA 4WRRA 4P82A 5ER6A 3AZPA 2AN4A 1XRSB 1CUSA 1X39A 2MYNA 3GJ6A 1YOBA 4C7VA 2XE7A 2PWZA 2Q5EA 2Y77A 1FW8A 3EK2A 1QCYA 4LMBA 1LBEA 3I2YX 4DZZA 4MLZA 1K2VN 1IJKA 2KSQA 3AEUB 2OUKA 3O1HB 1JHOA 4BNTA 3A11A 1MTOA 3VPBA 4CZ2A 3CNBA 4NBLA 4X6UA 4YRGA 4ZZ1A 3DYIA 1RCFA 1J0CA 1EEXB 5EHQA 1JYFA 3RVKA 5IN5A 3KXDA 4NDZA 1I3CA 4F2WA 1NBEA 3V3KA 4D9BA 4DREA 4QJ5A 2YJ4A 3NKVA 5GM1A 4YXFA 1SBIA 4E51A 3QLVC 3OQOA 4M21A 1UXGA 3B6MA 2DUJA 5EZYB 1F2UB 5H3LA 3ZUGA 5JJLA 5LP6A 3C3EA 1QVWA 1VGQA 3O3NB 4RH3A 4CM9D 4EHNA 4FEAA 1V7ZA 5CFOA 4DCNA 2VHQA 4UAUA 3F3KA 3DT8A 3U44A 2HNKA 3EZ6A 3PQCA 2IUFA 3T3OA 3IPCA 2IW1A 3KZOA 3LC1O 1YB7A 3S2GA 1O5OA 1EH5A 1TM2A 4DV2B 4A92A 1IN7A 3P94A 4FN5A 4Y0VA 4HVTA 1U63A 4Z54A 2J7PD 2N9UA 3FYCA 4F96A 1XLVA 1YS1X 5T4BA 3RS9A 4F8JA 2ZRHA 3GCDA 5A02A 3VAYA 4XARA 2IC5A 1S4QA 2DY0A 2YW9A 3WGHA 3DDZX 1TM4E 1ML3A 3FA2A 1B6TA 3GVHA 2HK7A 2Z5GA 3AV0B 1BSVA 1MG0A 1W25A 3NWPA 4U8GA 2C3OA 3ZDRA 3NCTA 5K8LA 4BXOA 1TCCA 3NGXA 3MTQA 1NF9A 5F2KA 3AUXA 1E3IA 3B51X 1A8PA 4JZKA 1IUNA 2Z98A 4PZZA 4X8LA 5EJAA 4BFVA 1C8BA 1PUXA 1OGIA 4OQZA 1HFWA 1L7AA 3T15A 1DQNA 3BK2A 4POOA 2FPLA 2VOJA 3RC1A 3WLOA 3ZWOA 3WLAA 5C9ZA 2LUOA 2BI7A 1W0KD 3LOPA 3SKVA 1GTZA 3IBSA 4LMAA 1YU9A 2IX9A 5DT2A 3N5KA 5FJJA 3TSWA 3HGTA 4DNOA 4Z4EA 3OZBA 4LJ4A 2HK9A 4LCEA 3LS2A 3C70A 5IJ9A 4KR7A 3ZIAD 4AMYA 3D31A 5SZIA 4EPRA 2XUPA 2MTBA 3LBNA 5AR1A 2P62A 1SELA 5DISB 4DV5B 4OAQA 4BQPA 4M1MA 3BFVA 4DC1A 5JCPA 3M4JA 2YYSA 3MD9A 1R3DA 2WU0A 4I1YA 4L57A 2FY8A 1O5IA 3AT1A 3CX3A 5KNDA 4OYRA 2VJLA 3V9AA 1XZQA 2HCJB 1ZK4A 4WJLA 5EERA 3OI7A 2ONJA 3QX3A 4R1QA 3HKEA 2WRZA 2ZUDA 1MGOA 4ZCLA 1XVTA 2NNLD 4TKUB 4B4KA 2QRHA 3F7OA 2ZJ8A 1EX7A 1FFCA 4ZCSA 4DUZB 4QGAA 4Y9TA 2VF2A 2SBTA 1ODKA 5D01A 4NJEB 2GJ4A 1L5RA 1F8YA 3O38A 2RHLA 3EH1A 3I53A 3N0WA 3O8OA 4KYTA 2X0FA 1MG5A 4MRPA 3A6FA 4BO0A 4G1MB 1T25A 1IB6A 2XCOA 2ZBEA 4MQEA 5I7UA 2HMWA 2HRQA 1LF5A 2OFPA 2PM8A 5AKYA 4ZU6X 1JVNA 4O8CA 3WB0A 2JAHA 3HDJA 4K9DA 1RLOA 4JVLA 3KL4A 5BSMA 3EY9A 2P9BA 4N0DA 5JC1A 1XEXA 4NYIQ 1EUDB 4JJ8A 2GASA 5J40A 2JVIA 2I91A 2QRVA 1QBKC 2QN1A 2H4HA 2PGXA 2VDKB 5IDXA 3KSAC 1TZJA 2I99A 4MI9A 1VP3A 4XPIB 2QM0A 5CM8B 4D4JA 5FAKA 1GPH1 1UWLA 3OTWA 2DPLA 4RXTA 3WGQA 1J2RA 1NY5A 5E3HA 3KP1A 1CR1A 1A4XA 4CMBA 2C2KA 4LYYA 5DNAA 1JDJA 2G1KA 2VDVE 5IZCA 5LQRA 3ND5A 4ZAYA 5EJ5A 2XKKA 2QTGA 4HMQA 3O8RA 2H3EA 3GN2A 4QDJA 1N3BA 3AP1A 3IT1A 2NYRA 2YY5A 3ZNOA 4B80A 5BV0A 1ACMA 2VHYA 4ICIA 5FP0A 3LVFO 3DKIA 2OUIA 3GA7A 3HRIA 3OFNA 4JOBA 4Q00A 3ZYCA 4CN8A 5LUAA 3GLFA 1F0NA 5B2FA 3LT4A 4BV9A 4E4YA 1YOVB 2PU7A 3ZE0B 3U4QA 1BQ3A 1PK9A 3HU1A 4DQVA 1FVHA 1YBMA 1UJBA 1Z4NA 2ADMA 4IO1A 3I34X 4QOSA 2EQ5A 2FGJA 4TV9F 3R7BA 4ZK2A 1WZCA 3RPEA 1AIPA 3CGWA 4OUDA 4B75A 4CDGA 1RWQA 1HLDA 3PITA 2HIAA 4XD7A 3CKYA 2LW7A 3D3NA 2R60A 3K8ZA 5CVCA 5HCNA 2RG7A 4WZAE 1Y8CA 4CL3A 3C97A 1SVIA 4R01A 1QOQB 4TT3D 1AQNA 3PQ7A 5EMLA 1MPXA 4BFUA 1IUKA 1YZQA 5LQUA 1LBQA 1NM5C 3LQ2A 5AW7A 2H7VA 4L73A 3OKCA 5KTTA 2C59A 5CT5A 1V7PC 3H4MA 4YRBA 1P2FA 3MB8A 4JP8A 3IP1A 1ZVMA 4EP1A 5G41A 1DTWA 3OP1A 1P8AA 1IZ7A 1SUPA 3GAZA 3Q7PA 4J2OA 4BVKA 4MHTA 3PIRA 1ZJYA 4CQJA 3UB2A 4DLVA 2EC5A 5LOVB 4DIDA 1M9NA 2NSHA 3A6ZA 3UMFA 3MSCA 2R25B 1TW3A 2EAUA 5H5JA 3VAAA 2NUPB 4WUTA 4EPYA 1RFLA 2F6RA 1C1XB 1P61B 3IHLA 1SOWA 2H06A 3IHWA 3MGKA 1DNPA 3W6NA 4IHJB 1SU8A 2M2IA 3G9TA 4UATA 1VPDA 1CR4A 3DZ8A 3I8OA 1FXWF 4HGQA 4RZIA 3BJMA 4FMCF 5JSQA 4J49A 1G66A 2ZBPA 5DNUA 1RJWA 1X13A 3ZZ0A 3AHFA 3F8TA 2WK1A 1G5RA 2A9PA 2UVQA 3ASZA 4B9AA 1F51E 1TRHA 4B83A 2EDAA 3P2OA 4OQDA 3AERA 1A9PA 3ZZUA 1L8XA 1WOYA 4L75A 3CO0S 3UMVA 4BLOA 4YRAA 4ZYXA 1E5QA 1ONNA 2FRXA 3OFVA 1VYTA 5KNDH 2QLFA 1X70A 1W1UA 1FYDA 4XVCA 1VL6A 4YXWA 1SQFA 2XUDA 3HHPA 1DIGA 4O0LA 3F3YA 3UMBA 4Z53A 3FMIA 3USZA 3IVCA 1MJGA 3KWFA 2W6PA 1ORWA 2ZM6B 2O20A 3UT0A 3UBTA 1U5CA 1PL6A 3G5UA 4FCVA 3NWBA 4KLAA 4RF5A 4AZ3B 4TKVB 4IZ6A 3TEJA 1CB7A 3A3PA 2ZVQX 4LK3A 1FY2A 1U2QA 3K6SA 2FX3A 2IF0A 2PUJA 3B9PA 1K8RA 3UMCA 3QBJA 5IKXA 3G0GA 4OYHA 4NPAA 1MO6A 1T43A 1OT3A 1U3VA 4AD8A 4AP9A 1IY8A 2IYVA 1N6OA 1FUEA 1GZHB 1NXXA 1TZMA 1Z7YA 3AHEA 2WIKA 3TOSA 4F6RA 4CWAA 1JL3A 1E2MA 1EE2A 2V96A 4M99A 1SQSA 4XDZA 4M0EA 5JNRA 2GS9A 1JYEA 1E6UA 3C7KA 1A5AB 1LRKA 1OUMA 2W58A 4BNLA 1XJ5A 4GNKA 3PFKA 2UZ1B 3O7WA 5MGBA 3D0KA 1H3EA 1FZTA 3WYNA 3S2ZA 2WTEA 3IUJA 3H2IA 2VP3A 3WJAA 4B31A 2Q3JA 3CUTA 2LR0A 4MW1A 1X0XA 3A0RB 4JI8B 4ZQHA 3RYHA 3TLGA 1W8DA 3DJFA 1QGAA 4KLCA 2NP7A 3GJXC 3O7MA 4GQAA 4ODIA 2GYUA 5B1SA 5K3SA 4BKUA 4ZDIA 3S5UA 2IYNA 3IBCA 1DEHA 4G5RA 4NBVA 4C9BA 4E5KA 1I2CA 3AR3A 1RAFA 2OK7A 3HDYA 1AOXA 3PFIA 4RZ2A 3U80A 4XFJA 4CMAA 3VTKA 2C20A 4DDHA 2Z0MA 3LLSA 4PGHA 2FLVA 2QAIA 4BBAA 3R3HA 1SPXA 2PMCA 2RE8A 1QAQA 2NYAA 3W6OA 4V0RA 1PQPA 4ZGBA 2PUDA 1K2WA 3DE0X 1DXOA 5CH8A 3WLEA 4YAKA 4LBWA 4DLYA 4K6OA 1EAYA 4FMPA 1GUZA 4JWTA 1JZSA 2N75A 2P0AA 2NV0A 3E4CA 3DB1A 3HKDB 3RIYA 1O6CA 4OJNA 3UWMA 2FCRA 1KMHA 2N1BA 4PAOA 5IJ0B 4PG4A 2DKFA 1P0QA 3WXMA 2JLXA 5A6SA 4V1CB 4Z9BA 3VO8A 3VVLA 3T3EA 4LXTA 1ZH2A 2I4NA 1RLUA 3VH3A 3WQQA 5BMOA 6AT1A 1N8NA 1R1DA 2HYDA 3KJGA 4Q19A 3SGLA 3N2YA 1K8QA 1NMYA 3T7SA 2ZUFA 2YOFA 3A25A 3PL5A 5LL6P 3SHFA 3GZNA 3TW4A 1UBKS 3UH0A 5CD1A 2BGKA 1PFQA 3MMZA 4K8RB 2E6UX 1POXA 4WGGA 1X7DA 2Q21A 4L3OA 2BAGA 1T4CB 1FC0A 2FMFA 3OZXA 1E5LA 3H3JA 3BPSA 3PE6A 4ITUA 4TLBA 5EL0A 5KSPA 4CT5A 2I2BA 3W8NA 4DMFA 4JLWA 4MGKR 4RM3A 4N3NA 1J8FA 3LIPA 3R40A 4BGUA 1J5XA 5CVUA 1ANKA 2WIAA 3TSOA 2P2GA 4MQFB 3I61A 1C3EA 2PX8A 2NTJA 3D4IA 1XF9A 1FNSA 2BHNA 2C7BA 1Q57A 2M9MA 3ICVA 3SLRA 3B3AA 2EX4A 2HUNA 2NSYA 1XTZA 3FYUA 4XGRA 5B4UA 2E4WA 1TUEA 5DTJA 2JFPA 5F73A 1DFIA 5KKAA 3WB9A 1A9OA 1TU3A 2I7TA 1J4AA 2ZSFA 5AHWA 1XD9A 3ZCQA 3TL6A 2CSUA 1BS1A 1S01A 1WDWB 1WHTA 3JWIA 4MRMB 1OAKA 4Y2JA 3IP5A 2O4CA 2ZJFA 1UL1X 4JT9A 5I8ZA 4X7BA 1J06A 1ZNQO 4AECA 1LY1A 2J4FA 3IUBA 5BYJA 1OXXK 1GILA 4LXYA 3UAXA 3PSHA 4DFDA 3O73A 2HA3A 1HQYE 3JR3A 4N9WA 4UMDA 1E2BA 1KDTA 1LV8A 1R0ZA 1SZJG 5TMDA 1W581 2KX7A 1T4DA 4KN9S 4ZAXA 4LS3A 1L5GB 3GRYA 1CF9A 4NXNB 1B6RA 5JDCC 2GNPA 2QT9A 1P45A 1VG9B 4RACA 3NC0C 2CXTA 2O48X 1WUHS 4BYMA 3GGGA 3PENA 4UE3S 5HJ5A 5IVHA 3ASYA 4POAA 4MR8A 5BT8A 1VYVA 3B1KA 4TLDA 3D7NA 2XDAA 2ZPAA 4GEGA 4ISCA 4ZTBA 1PT6A 1XZHA 2JFVA 2BFBA 1ISRA 3WYBA 3ORYA 2XW6A 4RMHA 3VPXA 1EFDN 1XROA 5IAKA 1YRLA 1RBMA 5THXA 2IYLD 1GPKA 2WD8A 2XLCA 2EKPA 2W6NA 2W83A 2PS9A 1JG4A 1L4FA 3D3WA 3BWEA 1KWKA 4DKXA 2NZ8A 3I6MA 4OP3A 4PX5A 3RS3A 1DX4A 3GJRA 4LE1A 3TLBA 1NOKA 1O77A 1SXJA 2HBQA 1YA6A 1O6ZA 2LKCA 5IK2A 4F4JA 5EMJA 3OOEA 1XG5A 4CLEA 1QOZA 1KXJA 4HDMA 5G3ZA 4BZZA 1Y4ZA 4OBWA 4Q7EA 3CLTC 2J67A 5EPEA 2FMUA 4MUKA 4Y2TA 3OJLA 1W49A 1YZYA 4DA4A 1HZJA 2X41A 3BEDA 4P54A 3RVNA 4EJFA 3S2IA 2K2WA 1HA3A 4G0NA 4PFQA 1WLYA 1HMPA 4RIEA 1I32A 1JPUA 1RWOA 3ZQ6A 1RZRA 1E3QA 3T5DA 4CV2A 1I36A 3QU2A 4QLOA 3IIMA 3G2KA 3V8QA 4R40A 3IS3A 2W42A 2XB8A 2PT9A 3DGEC 2AN9A 3STWA 4QICA 4MUNA 1C81A 3FAZA 4BUCA 4LF4B 2A9KA 2JFWA 2V6MA 1VB5A 1UBMS 1OLXA 2ZIWB 1L5FA 3EZYA 3G2OA 1RW4A 3JQQA 3PPXA 5AJZA 2ZR9A 1CEEA 3EGVA 5LMUB 4K0RA 5A2QA 3P0HA 1TYEB 1TPYA 2ODWA 4G86A 5FX2A 3UN1A 1L7QA 4F2PA 3NTLA 1HFJA 1NXVA 2GESA 2F3UA 1U7PA 2UUCB 4Q5IA 1T0JB 3A27A 5D7NA 1YDMA 3X1ZA 2NGRA 1NXTA 3G5MA 4FYYA 3NIWA 4DE5A 3ITDA 4HQLA 3NUQA 2AVDA 4Y3UA 1QGOA 9LDBA 4QKQA 1IYZA 1XF1A 4X91A 4QM6A 4DRYA 1OFVA 3RQSA 4DQ0A 1NP7A 1CK4A 2FOXA 3KEMA 4ROTA 1M66A 5BR7A 3KZXA 2GM9A 1HKUA 1E9BA 2J3LA 3GXOA 3IHKA 2OILA 3CVYA 4M1TA 3SIPA 5IT0A 1M1ZA 1G3UA 1QF9A 2V9CA 3TPCA 4NAUA 1P4RA 3D6HA 4L4SA 2G5PA 1CF4A 1KK3A 5KQSA 1CJBA 3C5CA 1J1UA 3IA2A 2BT4A 2UZ3A 4BWGA 4UD2A 4J0IA 5MN6A 3NALA 4UMFA 5F1OA 4DJDC 3LT1A 5A4FS 4R83A 3FKQA 1DBSA 1NTOA 2XNKA 3BC1A 3QEOA 1D0VA 3W8DA 5JSZB 4ZOLF 1G5TA 2XTNA 3LC2O 1XCPA 1Y89A 2PMFA 3EXAA 3PWSA 3WB2A 5L6MB 1ZUNA 4KFSA 4IW3B 3EZGA 4GIBA 1TIKA 1UKEA 2GTPA 4YRLA 3ZQUA 3LF2A 1I1NA 2V7QD 5DGIA 4ETNA 2R6R1 3C6YA 3C45A 1WV1A 5I7AA 3TTSA 3WTCA 1CUUA 2IPNA 1E1KA 1P7YA 1QIEA 5CGZA 1TZKA 5AVUA 5MFZA 4OP1A 1ZJZA 2JIQA 3QFHA 4B48A 1RYBA 3ZHSA 1ZP6A 2AX4A 1VXRA 3KU1A 4Z0PA 3STXA 3TH5A 3LBFA 3B1VA 5I3CA 2C58A 1MORA 3IAEA 3TRFA 2MMCA 1DHRA 2QQ0A 3JQ9C 5DDIP 3W7AA 3IT0A 5IM5A 3UFXA 2X76A 4IIBA 4TROA 1PJTA 3N2IA 4X6YA 3PZBA 1TF2A 5KQGA 3F4BA 2W6ID 3AUAA 4AKTA 4HWGA 1X8XA 1UJ6A 4IUCS 3WI7A 3ZGVA 2QTLA 3EUEA 1O9GA 4DA9A 2GPTA 4G56A 3KTDA 2W2KA 3PG5A 2RGBA 1G17A 3OPVA 4RXMA 2WWIA 4LJLA 7YASA 4YAUA 1R3UA 4YAOA 4OBBA 3RAEC 1XEFA 3QF7A 5IUJC 2UUPA 4PYKA 1XMJA 2DYKA 1EWTA 4WXYB 4QBFA 5A03A 4L16A 4D56A 4U1RA 3PKJA 1DIHA 2GKSA 3T0GA 4RTMA 3IDSA 1IOZA 1N2CA 4ITVA 2EHDA 3OCWA 1SVOA 4GGOA 1PL8A 2C5HA 3MBIA 2JJ1D 4I9UA 4PRLA 3TE7A 4FDMA 1WAMA 4PLYA 2I2AA 1Z6GA 3L02A 2DHEA 1CJTC 2ONYA 4PHFA 5CJPA 5ES4B 3S70A 4YHHB 1WTCA 1R6UA 2R2GA 3VU3A 5LNK1 4BB6A 4PX2A 1NVVR 2TMGA 2DOKA 4G1BA 1PFGA 4RH1A 5G4KA 4CG1A 1XTPA 3LYLA 1KYQA 3KUCA 1UEIA 4IXTA 2O0MA 1U2GC 4R9SA 5D3QA 4OG2A 5DFAA 4AG6A 3E3LA 2FPIB 1K27A 1W96A 1T8YA 3A3YA 2YWDA 3OZGA 4KRFA 4XVQA 4Q39A 1QR6A 1SRQA 2MIIA 3C5EA 4WDQA 4PV7A 2FXVA 1VZ2A 3MQFA 4CR7A 2B9VA 2Z2KA 4IG9A 1YJCA 3FWHA 3PDIA 4JT4A 5KCMA 4C5AA 2GK6A 5IH7A 6ABPA 1HKHA 1FDSA 4I5FA 4M9CA 1YZVA 2AQKA 3AB3A 3OETA 2XZDA 3EAQA 3EC1A 4REQB 1KP3A 4UPEA 4ARZA 4W1QA 1EZ1A 1U0GA 2KPOA 1AT1A 1T5OA 1MIOA 5AUOB 4DCCA 1K7SN 2F8SA 4RQTA 1IATA 2Q5FA 1YFKA 3EE6A 1A69A 3MTJA 3WE7A 5DXAA 1L1EA 1G6Q1 1NVKA 3EG9A 1A5BB 4K3UA 2AYXA 2PV7A 2GEJA 2ZQ5A 4LDRA 1JR3A 4HAUA 2HV8A 4HC4A 1PZHA 4LZWA 5DYGA 3DDHA 4X63A 3AHHA 3ROPA 2IGBA 3L8ZA 1A04A 3IUNA 3TRHA 2YL2A 1HBJA 2PKCA 1WP9A 2H48A 3NEYA 4LVCA 4QLAA 1E2HA 4E5SA 1SU6A 4FNAA 4B0PA 1SWVA 1BGVA 2GF9A 2C57A 5HQ3B 2ALJA 3K70C 4G0UA 1P9LA 3I42A 5B12A 5F3WB 3U17A 5CIYA 1V71A 4FEEA 2Q9AA 1MHTA 2HBRA 5C4IA 1BS2A 1U0FA 3OJFA 2VCHA 1H8HA 3IJPA 3KLOA 4KR9A 2QNBA 2PYZA 3BGWA 3CPHA 2ZAOA 2VHWA 3PL1A 3ZW7A 2GBGA 1ZJ4A 2WTAA 4MXDA 4PAQA 2UKDA 3AKEA 3ONFA 4YP6A 1VMEA 1YVRA 3E15A 3SC3A 1QOPB 5L40A 5L4LA 2P9EA 5L8VA 1H2HA 1ZU5A 3GNTA 4NQZA 4UMEA 1N2GA 3IPLA 1I5EA 3A3KA 3OY7A 3ESBA 4CM8A 3ZK8A 1XSEA 1ZC4A 1ZJ5A 4RYDA 4OFXA 2QXYA 1GZ3A 3VYWA 3DVSX 4IIJF 1E9SA 1PHPA 4BRSA 2UXCB 2OGSA 1IPHA 4LOLA 4LQ4A 1W29A 1C0PA 1X0VA 3LZDA 4UU7A 2GN6A 1N57A 5BVGB 2O5VA 1TJYA 3I3OA 3K30A 4WLFA 1MHPA 7REQB 5AVZA 3DZHA 1HE3A 1NX6A 3OPMA 4H35A 2CJYA 4HD8A 1EVJA 3GA0A 2POCA 2VYCA 3ICWA 1EP9A 4XWAA 1B2LA 1NQOA 1TE2A 3FVTA 3RS4A 1JXAA 1EM8B 5DHTA 1HT2E 3DQPA 3BXGA 2X42A 3U3ZA 1T8RA 4A4DA 3ZCTA 5DIZA 3DAYA 4LPKA 1GIAA 5REQB 1E0JA 1FDUA 4MR9A 2Q5IA 4YJ3B 3W5VA 3G49A 3HRKA 3EARA 5JDIC 1KL7A 2ZAMA 4JJ4A 1IG3A 4TX1A 2V9PA 2BFEA 5KNCH 1UWCA 1FLNA 1GRCA 1TD9A 1E2GA 3D5TA 2JLBA 2XUAA 3IAM6 1E32A 5CAEA 1S9DA 2IY9A 4EIWA 3WB1A 2A0UA 3L4BC 1U9JA 1K4MA 3A9UA 2OGUA 3KSBC 2OXCA 3RLIA 1GGEA 4GBJA 2GF0A 4MH0R 4QFDA 4C87A 3O8CA 3DBHA 4PM4A 2QV0A 4O4JF 3GH1A 1L4NA 2IYXA 2XNDD 1SWWA 4MVWA 3IV9A 3ZHTA 3I2JA 2ZULA 3V9PA 2YV2A 1WW3A 3F6YA 2VDMB 3G7SA 5K6TA 4GMXA 1KI8A 3RS0A 1Z7WA 3GBVA 3EW9A 1KH2A 1XZFA 3PD0A 3HB1A 1FTNA 3Q6IA 1CNEA 2RGUA 3ND8A 4MWDA 3ESQA 2GHTA 3JQ9A 5AJYA 4BYGA 2QIPA 1KOGA 1XQVA 3DE6X 1TQ4A 4FFOA 1U0LA 2QPAA 4DC9A 5F7ZA 1P3JA 2G28A 4WBXC 3CQ9A 1Z2PX 3LLUA 4UJ3A 4BLQA 1YIAA 3OCXA 3DHVA 4R2KA 4NEGA 1F2TB 1VKRA 1OIXA 4CU2A 5C3UA 1N75A 5KB3A 2EERA 1V35A 4ND6A 1IZ0A 1BU5A 1N2SA 3DM9B 2DH5A 4OHRA 4P3PA 4DLPA 4OQLA 2PFKA 3PR1A 3GEIA 4HEA6 3EGCA 3OM8A 2BEJA 4J90A 1JDPA 2ABWA 4LRXA 2VUSA 4HAOA 2JL1A 3OICA 2BBTA 2X22A 4TV9B 5HZMA 1SC9A 1L7OA 2BGUA 3SY8A 2YHBA 3VM6A 3TTUA 4PYQA 1SCNE 3PUIA 4MJXA 1AB5A 3DHNA 1JA1A 3HDQA 3VZDA 2BP7A 4YP1A 2V1UA 2FYTA 4UXJA 8LDHA 4WOBA 4HQNA 4KPFC 2J30A 1QG2A 3HFGA 4C78A 3DFFA 2A9FA 2AG0A 2YRFA 4UQOA 4JEIA 4R7TA 2V98A 2WP8J 2WE7A 3ONNA 2IHTA 4AJ4A 3PEEA 2D1TA 3AZOA 4TXMA 5BOSB 1QC5A 5TVGA 2CCJA 3ET4A 1IY1A 1WB4A 3SDSA 4TXNA 3RBAA 2H4FA 4UTNA 2VAWA 2PLRA 3COYA 3PUKA 2ZWIA 4DG9A 1KOFA 3MJDA 4YECA 1UINA 1G5FA 1SCAA 2R11A 3F6CA 5JNVA 1GL9B 1TEZA 2CMHA 4RSGA 2ZYSA 1U0JA 2A0WA 3RHZA 1LQ2A 1G5HA 1BZYA 3OJCA 4HG2A 2AC2A 1Q74A 1QS0A 2VP5A 4MYSA 4Y8VA 2FK7A 4J0GA 2NNWB 4Z9FA 1KOLA 2GRUA 3WFZA 4ASUA 3RUFA 2Q6TA 4C7MA 1MOSA 3ZR4B 4F21A 1EJ2A 4MPDA 1Z28A 4FVTA 1IULA 2ES4A 1ZSYA 3NC1C 3IFSA 4TWJA 5GM2A 3GR6A 1DKNA 2PPVA 3KDSE 3LWNA 4MWCA 2C5AA 4ZQCB 5J5CA 1E69A 2F55A 4Q7MB 4GVXA 1CBUA 2QXUA 5G2OA 5J43A 2FP4B 1FFSA 5KQPA 5CPBA 3GDWA 2AG8A 3IUSA 1FPMA 1SEPA 5DCLA 1U9IC 3H16A 4QQNA 3IQDB 5EE1A 2FPSA 3W5BA 1OFIA 2VK1A 5KX5F 5T3UA 3W5JA 1DO2A 5KYWA 3HDVA 4X1YB 4GI2A 1K9SA 2COKA 3NYWA 2C99A 2P2SA 2C2YA 3LJKA 3PKIA 2AFHA 2FW6A 2FGKA 4J91A 2FW0A 2ONKA 4KAAA 4V0NA 4IVNA 1S6YA 3VTZA 5K3FB 3WS7A 4EH1A 1PZFA 3JALB 4L5JA 3KLBA 5JXWA 4NULA 1PBNA 3W9SA 1XTSA 2C29D 3RYIA 2Z83A 2PKQP 1Q0RA 3BGIA 3NHBA 4RVHA 2NIPA 3CLKA 1G291 3H1BA 4WA7A 4DCVA 5JXGA 3KQKA 1SU7A 1WY5A 2C3YA 4MVJD 3C8ZA 4PBTA 3NEPX 1SD1A 2A1TR 2B82A 3UKOA 3L6EA 1VJ5A 4ERXA 2H8KA 1XKQA 2H18A 1EBBA 2OD2A 5AK6A 5GV8A 1IN6A 3MMPA 3E5RA 4MV0A 1T1SA 1KDOA 2QEQA 4KSCA 4QX6A 1EVIA 2B8NA 3GEHA 3MTGA 1AUXA 3QMMA 3QX9A 4MNTA 4AYTA 4NE9A 3AEZA 2D2VA 1XZ8A 2OZKA 3WGJA 4Z3OA 1W75A 3BL5A 3TX6A 1J33A 4IH1A 3DE1X 3FZEA 3ADCA 4OFZA 1T10A 1J5PA 3R0XA 5GIPE 1ZIDA 3ZHRA 2CW5A 3I45A 3IEMA 2GPSA 2XHEA 3BXZA 3JD2A 2VXCA 2E82A 4TTJA 4U2CA 3LZCA 3QGMA 5JWOA 1Z6ZA 5DLYA 3ZVKA 1XD8A 1UANA 2GN1A 5FUQA 1G2QA 1W4ZA 2P78A 5EZYA 3LBYA 4CVNA 5JEDA 1E2NA 4C05A 4FGWA 2NV2B 3OF3A 4JGBA 4F2DA 3SVLA 4FHFA 3AFGA 2IYEA 5IC4A 3Q3JB 4XX0A 1SZCA 1HMYA 2PUEA 3AY7A 3ZDXB 1E3DA 3NT4A 1UKYA 1DAGA 3W4KA 2I6FA 1ULUA 3I1FA 2WJHA 3ABQB 2ZUTA 4P7GA 5GADl 1G6HA 3BORA 3ORQA 2XD4A 3OZEA 3WRWA 1RNLA 1BJRE 3IMEA 5FBVB 4PCAA 2ZRNA 3V1KA 3ROTA 3ZQ4A 1DV2A 3RV3A 4G25A 4X3CA 1U8TA 4ZAFA 4G67A 4TRJA 3K5HA 1NBHA 3V7FA 4DLUA 4CLRA 1ZIOA 4C6SA 3PGVA 3CWCA 4BB9A 4OF4A 3TQSA 1REQB 3SZOA 3T4XA 5MF6A 1VIDA 3LLVA 3JVDA 1T4MA 1LLQA 1S02A 3G79A 4HYQA 3BRWD 2IYAA 1AO3A 1DS6A 2V3VA 1VHLA 3CH4B 3QX8A 3V1TC 2ZJ4A 3WHIA 2ZYRA 3RT7A 2WJ3A 1NQTA 2FN9A 1SUAA 1NT2A 3ZNPA 3GH3A 4YUXA 4GDFA 4H3SA 1NJFA 4EG3A 3PGLA 2CLMB 1GNQA 1V4VA 1HORA 3ANLA 3BREA 4MITA 4N0MA 5K0FA 3V80A 3K96A 2YIMA 3UJ9A 3NQ41 4BV8A 5JO9A 1R50A 4W8GA 3JASB 2AOTA 4HGRA 3C3PA 4U5QA 1F14A 1T36B 3OFND 5IWCA 5JOQA 2D8AA 2XUJA 2PPLA 1WQ1R 2AK3A 3VVMA 3JTEA 3VU1A 4EGSA 4KQJA 3NCHA 1CDOA 3M6LA 3N07A 3GROA 3NR2A 4GC9A 2PUTA 4W4TA 2AEMA 3D7KA 1KKMA 2VQ6A 4K2HA 1M75A 4AMUA 5LA6F 3BFPA 3Q7QA 3C6QA 1Y4DE 3R6DA 4UD6A 2RGNC 4A6DA 4LV5B 4BGDA 3LQ1A 1JX6A 1S89A 2J33A 3U26A 4X00A 4DQKA 5IJAA 3SSAA 3L8YA 3RYHB 4RD0A 1RP7A 2O05A 4GBMA 3ENZA 3F98A 2FQXA 4GOJA 6NULA 3MUOA 1PWYE 2ZR0A 4US0R 4IMIB 1GQOA 1JXMA 2R8BA 4CF5A 1NPYA 1DEXA 1MPTA 3BIJA 2JIDA 4YR9A 1SK8A 5DULA 2FSVC 4GZ5A 2E9SA 2Y2UA 1FW6A 2FOLA 1ZD2P 3BZUA 2ZB2A 5IANA 3CUYA 4D4HA 2H1IA 1NFFA 1QH1B 1KEKA 4A82A 3LECA 2OFXA 3NM5A 1NMZA 1YR9A 3FXAA 5HKBA 4FS8A 4KE9A 5I9IA 2M1XA 1PFYA 1ZM4A 1W8IA 4K26A 1H05A 4G4IA 3W5DA 2OSVA 3VDNB 1QKKA 1VMIA 1VGVA 4MEBA 1GJRA 1QGED 4GZMA 4I50A 3RD5A 4WCFA 3GVPA 4BJ1A 4F9GA 3ME5A 4R8MA 3KKOA 1PN3A 3X1DA 4OHYA 1R5BA 4K9PA 4OK3A 3GRKA 2YMPA 1DIBA 4B3BA 1ZR2A 1PGJA 2IH4A 3AL2A 4I1SA 4IIVA 4Q47A 4IYJA 4ARSA 1JR2A 5K2OA 3Q8WA 1XHEA 4L9SA 1OY1A 2VHJA 1GU1A 1JHVA 3T1YB 4J16A 4TS3A 2J9ZB 2OO5C 1FLAA 3CG4A 4C0SA 2C98A 1U0SY 2QTMA 3OKAA 2XI4A 1SB8A 3TK1A 1K5PA 4S2EA 2QT1A 4P98A 4BHTA 2HRCA 4HDQB 4AIRA 4JB0A 3NX4A 5BMVF 5BN5B 2SKEA 2NO9A 5BVGA 2GN0A 2A57A 2HF2A 3RHTA 1DT3A 2ZIVB 2IYFA 2Q5CA 3ELWA 4NESA 2Y4OA 5GZ3A 2WAYA 2H29A 4H15A 5AMXA 3WLFA 2OOSA 1V26A 1PHRA 2IXBA 1KRWA 1YNSA 4WLUA 4YX9A 3VJRA 4KIGA 4ZXPA 3LPMA 3BSWA 3CUSA 3N2LA 4EY4A 1GG2A 1MRZA 1VIYA 3C16C 4OLAA 2ASVA 3PNMA 2Q2QA 2XHZA 1DQRA 3OPYA 4IDEA 4DMKA 3EFHA 4B7XA 2GJSA 2JH3A 2GT1A 2Q4OA 3T5MA 2JH9A 2D13A 1OTHA 5EJFA 4M22A 1A9ZA 3UJ7A 3IQZA 4UDNA 4YO7A 2C78A 1JHYA 2E85A 4ZKEA 4QGSA 4OQQA 3V8EA 2CFTA 1LXCA 4P86A 1FPQA 4RPIA 5AOCA 2GBLA 2Q6VA 2OO7A 5BWOA 5JZ9A 1RMTA 2RARA 1GRVA 2P77A 2IEZA 5CX1B 5EIXA 4J7UA 4R1MA 1CJCA 2J9YB 3ND7A 1U7XA 3AI1A 3U4MA 5F1PA 4FQ5A 3TSYA 1ZHFA 4C7OB 3H13A 4ZYWA 5BURA 2LGJA 3NNNA 5B3AA 4GWGA 4YMHA 2HY7A 2VG8A 1X3SA 2AMVA 1PR9A 2AKAB 3DVAB 3HDGA 2A35A 4PTZA 5JAIA 3AHIA 2UXBB 4HK4A 2VT2A 4L27A 1ZN2A 1WMDA 3EDQA 3RWMB 1KMHB 2BMJA 4JHLA 4RWEA 4HLUA 4ZHSA 5JPDA 1EA7A 1H2YA 2B1GA 2WJIA 3RGWS 5LMNB 4OQNA 5BWMA 1Y7HA 5CT6A 5D84A 3V7NA 1I4DD 3G0OA 5BYBA 1RJ9A 2EW2A 1XZBA 3ENKA 2I6UA 2ENUA 2UZAA 1BQ4A 3GG2A 2IHVA 3RH0A 3TUJC 1D9XA 4F45A 3A2LA 1Y7LA 3F8WA 1UXHA 3TOVA 2AOVA 3RGGA 3VMFA 1JEDA 4NY1A 1E0AA 2HCFA 5DHSA 3INTA 4UAGA 3UKJA 3R0VA 1ZICA 1LLUA 2E4UA 4TL6A 1X19A 3WSTA 2HWYA 1P74A 1IAVA 3NP9A 3HJHA 3OZRA 1RBYA 1Q7TA 2H2FA 3CRMA 2VI5A 4J0QA 1L5SA 4ZVVA 5K0LA 2P3SA 3EQ9A 1R0LA 4M9SA 3WGVA 1S1MA 4HNTA 5JSUA 1Z6XA 1IL0A 1O97C 1IBRA 1OYOA 3AINA 5AESA 3R8CA 4DGSA 5A5EA 2WIFA 5F7JA 5B7NA 1WD5A 3KB8A 3ZHOA 2PZ8A 2NOAA 1JTVA 2CD7A 3DSRA 3O4JA 2Y1LA 5BVHA 2PSHA 3U39A 1A1SA 3E2IA 3SYMA 2OXRA 3O75A 4JBWA 4I3GA 4KMSA 4D79A 1H66A 4KNYA 4GOXA 1PR1A 3PNSA 1PIWA 1VSBA 2XMRA 3KSRA 1XVAA 3R44A 3ZHZA 3OHSX 1CS0B 2WJGA 4NV0A 2XT9A 1AGYA 4BX8A 4ZTZB 2FEWB 3MJRA 3N39C 3DMRA 2ODAA 4MYUA 2JAXA 3GUVA 2FG6C 4O1MA 3C6ZA 4CODB 1GPUA 1VMKA 3GBPA 3PEFA 4A0GA 3MWEA 1YS9A 1Z35A 3M5WA 3AR5A 3E9YA 1AUQA 4RVOA 1LLFA 2P4HX 2YV4A 3LLCA 5KPDA 2PQ6A 3OMWA 4LSZA 1DBRA 1QS0B 1S8AA 4FFMA 3EOZA 4QE3A 3TBFA 3ZWMA 4BBJA 1IIRA 1I9CA 1P73A 2JAPA 4KSBA 5JRZA 2ZB3A 3AOEC 3SK0A 1KI9A 3AR8A 3S1LA 3W4IA 3WNVA 4A5OA 1HR0B 3EQ6A 1O89A 2NSJA 3FSGA 2RKOA 3ZBTA 5KYUB 5LJIA 1OAAA 4QXPA 3VYUB 5K6AA 2WU3A 3M1LA 4D9NA 1V1JA 4LXIA 2VT7A 4QEDA 1DAIA 4ZZ2A 3RKRA 1YQEA 4LPSA 4Q3KA 4UU0A 2F1OA 2IUSA 3KS9A 1L7PA 3CG0A 2BSAA 4J1TA 4Q12A 4RIIA 4O4IA 5H1YA 3AQ4A 3U0VA 4DADA 4EPXA 2VZLA 4H27A 1BU8A 1GTG1 4BFWA 1BN7A 1HSZA 3O8NA