1TYJA

Crystal structure analysis of type ii cohesin a11 from bacteroides cellulosolvens
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
170
structure length
170
Chain Sequence
b'GSVLTAIDNDKVAVGDKVTLTINVDKITNFSGYQFNIKYNTTYLQPWDTIADEAYTDSTMPDYGTLLQGRFNATDMSKHNLSQGVLNFGRLYMNLSAYRASGKPESTGAVAKVTFKVIKEIPAEGIKLATFENGSSMNNAVDGTMLFDWDGNMYSSSAYKVVQPGLIYPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulosomal scaffoldin
publication title Crystal structure of a type-II cohesin module from the Bacteroides cellulosolvens cellulosome reveals novel and distinctive secondary structural elements
pubmed doi rcsb
source organism Bacteroides cellulosolvens
molecule tags Structural protein
total genus 39
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2004-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1tyjA00
4UYPA 3FNKA 4FL4C 1OHZA 3KCPA 1QZNA 3GHPA 3BWZA 3UL4A 3F2LA 2JH2A 5G5DA 3L8QA 2VN5A 3KCPB 4IU2A 1G1KA 2Y3NA 2VO8A 2B59A 5AOZA 2O4EA 4U3SA 1ZV9A 2W1NA 1ANUA 4FL4B 5LXVA 5K39A 4WI0A 2BM3A 2ZF9A 1AOHA 1TYJA 2OZNA 4IU3A 2CCLA 2XDHA 4N2OA 4WKZB 4UYQA 4DH2A 4UMSA 2VN6A
chains in the Genus database with same CATH superfamily
3OXRB 1BJ8A 1LL1A 1RUKH 2AK4E 1MI5D 1DQDH 5BUAA 3CXDL 2EDDA 4X6FB 4QNPE 5C0BB 5D9SA 4N3UA 2DJMA 3KJ6H 4OZHA 4UWQB 3TH2T 3QHTC 3DRQA 3L3IA 3QUYD 5HDRA 3BKJL 4WFFE 5HHVL 3GXNA 2XI9A 3ZMEA 2HFGL 1BGXL 4A37A 2LLLA 3OL2A 4AX3A 5DD0L 2C4FT 3GMPB 4KITB 1OY3B 2AAAA 1KEML 3CSGA 1AQ8A 1L0YA 4ODVH 1NKGA 1CYGA 3RY4A 1VGEL 1J0JA 1EHLL 1G94A 3VRJB 2BS8A 4XNYH 2DWDB 1YNTA 3LNFA 4AQ8A 1IM3A 5I1KL 1OCRB 2QPUA 2VIRB 1Q90A 4AYID 4BFNA 1UJ3B 1UEYA 1VLXA 2KLRA 1XSOA 3O2WH 5TDPB 3EFOB 3GJEA 4JG9A 1FV1A 2DJ4A 4NLHA 4FXKA 1Q8MA 5I26A 4YLQT 5I71B 2F53D 4XHQA 5BMFH 2JI1A 1W0VA 2XWTB 4PGBB 4PJXF 5EEUA 1F1DA 3ESMA 3V55A 1S4IA 2EDYA 4QRRA 1NCWH 2UY7B 2VMJA 2QSCH 5ABDE 4NBZB 4PJHF 5CD3B 1SJHB 1KJMA 3GINA 1NCAH 2ARWA 3OKMB 4RWYH 4HOMA 3BZFA 1M7DB 4QY8B 4M7ZC 2O5NA 3QDGE 2VDRH 3PIQB 4LPCA 3O4LA 2E76C 4DOHE 1NIBA 4LGSB 4W9KC 2OV0A 4I3SL 4XVTH 5CJXA 2C3VA 1OGAB 1P7HL 2R8SH 1L9QA 1MDAA 3FU5A 4FZEH 2ITCA 4ZMOA 1AE6H 4Y5VB 4MVBD 2GSGA 4L0ZA 5E56A 2CR0A 1QVOA 1E3XA 2UWEB 1M57B 3VFPB 4NKIH 3IGAA 4LNRA 4BZ1A 2VSKB 5F1SA 1B6UA 2VDOB 4DAGH 1A6VL 1K4CA 4DZBA 5PAZA 2ILLA 3DUHA 3BDXA 4KROB 4U6YB 2XZZA 4Q7DA 4FQ1H 5CMAB 5FO8A 1KGCE 1OAKL 2AJZA 2MTAA 2QFRA 3FN0H 5DQDH 5H35A 1EEQA 3V4PL 1OVZA 4C58B 1B4JL 4DPCX 4YDNA 5I1HL 3I74A 1A4JA 4TNFA 4Y5YB 5D7LE 2Z3FA 4FQXC 4YXHL 2IAMC 3PUCA 3FJTA 5C0FB 4OCMC 4NSKB 3QDJE 1FNSL 4GT0A 5DJ8B 4CU8A 3KS0J 2IOOA 2WPGA 4UM9B 3EDDA 3P11L 2FJGB 3NBNA 2KT6A 3L3GB 3OZLA 4ZMWA 5IVXB 2BVOA 3M8OL 1J9SA 4N8CL 2WWNA 2VXVL 1ACXA 5B7FA 4GRWH 1M2OA 5E2TH 1JZ7A 3PL6C 1FLRH 1I7RA 4ANKA 4ODUA 4YHIA 1Q72L 2ITEA 3EJZC 4HIXH 3K6FA 1AR1C 4OLZL 3CSTA 3D87B 3Q1SL 5HTSA 1OZTG 4AVIA 2EH7L 4ELME 4AV0A 3HAEB 2PW1A 3RUGB 5I5IA 1UTDA 1IC4H 3D33A 4I5BA 3RJOA 4ZDHB 4E5XA 4XPHL 1KBVA 3T09A 5DJ0A 4IK7A 2ED9A 2Q6WA 3UYRH 1UZ8B 1CLOL 2BSSB 1PLAA 3BSZL 3IETA 3T2NL 4PRBA 4EEEA 1BJ1J 3C6EA 2EZ0D 5JQHC 4ZMNA 3N9GL 1Y0LB 2EO9A 3BP5B 3HE7B 1ZGLP 5BRZB 1RVFL 4QTFA 1TETL 1BF8A 4JANA 4KTDL 2J12B 4QT5B 1WWBX 5LVEA 3L3KA 2FBJL 4XNAA 1AIZA 5KSVA 2ZAGA 5IQNA 4R8WL 1VPOL 1RL1A 1QEWB 3T0WA 2ICWJ 1MCOH 2GSIB 1CLZH 5HYQB 1W6WA 5I1LB 4S0SD 3G6JB 5GS2D 3IFPB 2HT4C 4GY4A 4WW2A 1NLDH 2PO6B 3LJ3A 3NSFA 3BMWA 3GD1C 1UQSA 1A6UH 3GC3A 5IW1A 3ESNA 1QSFD 4NNPH 1WF5A 1MHHB 3ETSA 4XWGH 2AJSH 2BNRA 5AB1A 2OZ4A 4XWOC 3VXNB 3ZZSA 5FYKH 4DW2L 1I7TA 2EYTA 2F7RA 2QMKA 2XJKA 3GTTA 1KGXA 3E2HC 1E9OA 1EANA 3QZNA 4F8TA 1U8IB 2MFNA 2I27N 4UV4L 3ZYOA 4BK5C 5K9QG 3HPLB 3GM8A 4BK8A 5FYLH 1RZFH 5CLZA 2X6UA 4N24A 4G43A 1M71A 4KV5F 1SDAB 3RWIB 1N19A 2J3SA 4MJ5A 1HL9A 2RACA 4PJ8C 3QRBA 1CICB 1DBKH 1WJ3A 3PWNB 2R83A 5ALCL 1K8DA 2PP8A 2O5YL 1JVOA 2I9LA 1B2WH 1PG7L 1UA3A 3KYOA 4M1GL 4O58L 4TSAL 1MQKH 5FYJL 4M6NH 2K7QA 4XP1L 3IDXL 1DTUA 4XH2A 4NQCA 3L4TA 2IADB 3LKSA 3RZCA 4NAMA 1F4HA 3OB8A 2BIMA 3SYPA 2J8UB 4G7VL 4D9RE 1XGPB 1VENA 3C8HA 5B39A 1LM8V 1X5YA 4HLJA 3V7AE 1NAMA 5KTEH 1HEJC 3FTYA 5GSRA 1TJHL 3IJHA 3LPFA 4OZHF 3GKZA 1ZAGA 4XVOA 4MMZC 3S3DB 2UXGA 3UAEA 1AJ7H 5AEAA 3EH5B 2LAAA 1BOGB 1HHGB 4TUUA 3IAGC 2XG5A 4PJ5A 2PF6A 2F54B 4X98B 2J56A 2JI3A 4Q52A 4F2ME 4XB7A 2VERA 4WWKC 4FTVE 1WFIA 3SKOA 4FFZH 1RERA 2GUYA 1SN5A 1IZJA 2X41A 3OKNA 2VERN 4ONFH 1YNTF 4LCUB 1AZZC 2OR9L 2AJYL 3AY4A 4I8DA 1ECZA 2V33A 2E59A 2HZHA 4F57H 2ZZUT 4HISA 5E95B 1FH5L 1T1YB 4KQ3H 4AVJA 3B2VL 4JFQB 4JFDD 1MG3C 2OJZL 5ERWA 2BOBA 4MAUL 3MLWH 3QDGD 4JY4A 3UX9B 4PWHA 2B77A 3HS9A 4AE1A 1TJMA 4B3EA 4UT9H 1KLFA 1FL3A 1T03H 5E8OA 3GNML 3K7UA 4NWUH 5AUMB 1QFWI 2AGJL 3QW9A 4PH8A 3HPJA 4X5LA 2NTSP 4KRNA 5CR8A 4EZMA 1QSVA 2C8NA 3HFMH 3U9UA 3BQUD 3SDCC 5TDOA 2V5TA 2J88L 1EZUA 4TOYH 3HZVB 4PJEA 3JWNH 4FLOA 1IBHA 5E70A 3HG1B 2YXMA 1UGKA 1IBGL 3VRLF 1FE8H 3MN8A 1E7UA 3MGTB 3EZJB 4FKHA 4DKFH 2EVGA 1JVLA 3DSNB 5E24E 1HESA 1OF0A 2Y6SC 3ALXA 3HUJE 1TZIB 1EAPB 1NEUA 1JMXA 1J0KA 1DO6A 5IFJA 3QDJD 2YAQA 3FNKA 3WBDA 3PAUA 5MHSE 4BGDA 4IYKA 3WIHH 1CTOA 1KPVB 2X4UB 2WXMA 5FKAB 3U7YH 1IAMA 1ILSA 3TX4A 5I2IB 1OAJA 4QRPE 1RP8A 4ZZFA 4J5VA 1MXGA 1QWNA 2NMSA 3CDYA 3ARGD 3MBEA 1FFNA 2LHAA 3SYOA 1UD3A 4U6XA 4D9LH 1KTBA 3KM1A 4EN2A 5EIIB 1OAXH 5T3ZH 5GGSB 3UJTH 2OP4L 3FAXA 1JN6A 1UB6B 1VESA 2D3VA 4JFWA 4PBVC 4HOXA 5JLZA 3RVWC 4MXVF 3DYMA 4HOWA 1E5BA 1JZDC 4RMWA 5KANI 3TT1L 3TVMA 2VLLB 1Q0EA 1JFHA 4KKAD 3HE6C 3CN0A 4MDJB 3RPKA 2VDMB 2Q10A 2BNQA 4JFOB 1JXGA 1XTLA 5TE4H 1J5OL 3DRTB 1T2JA 2R4SH 1XCQA 2HX7A 3TV8A 5DDHB 4GSUA 2EUWA 2RQ8A 4N1HB 4X50A 5E51A 1J1XL 1R1CA 1NBYB 4JO4H 3W0WA 3LRSB 3SE9L 4BWTA 3FRUB 1ORSA 4MJID 4KK5D 2BSTA 2R69L 2UZYA 3JTSB 4H4NA 2EC9T 4UNUA 4YHLH 3ZSSA 3ULUE 1HX0A 1ODAA 4OF5A 1BECA 1K72A 1P7QD 3V6OC 2EE9A 1DZBA 1J8HD 3CFJB 4IBWA 1CXLA 2AEPH 4YQXL 2XKNB 3BZDA 3TPUA 5JMOC 2FECL 1LK3L 4M93B 1WBXB 4QYAA 5KSAA 4NO0B 4NOBA 1B4TA 3GWJA 2YXWA 2ARJB 5D1QB 5FC9A 1ID5I 3BPCB 4J3UA 5HYSB 4NZTL 1D6VL 2B3IA 1QSEA 2FEJA 3AROA 4MA7L 4OD3H 2EABA 4ZK8A 2VC2H 3DJZA 3IWVA 4ZW7A 4KX8A 4NEHB 3P4NB 3OKYA 5KW9H 2GAZA 2VXTL 2YGVA 1ZLSL 3IJEB 5IMMA 1KY6A 4MD5A 2F8XC 4IOIB 2JKLA 1ZLWH 5CR1A 5CP7A 5I9QB 5DSCB 4KZEH 4M1CD 1TEGA 1BOYA 3OHXA 1KLUA 3HOGA 3MI6A 1UKQA 2QKIB 3MRDA 1F4XH 1GY2A 1KT2A 3OWEA 4L4VD 4WW2F 3Q05A 2Y7LA 1BYPA 4FYRA 4YSDA 2N7AA 4K7PX 4ZXBB 4PWFA 4GAJL 1JGUL 5IQLA 4CVWA 3FCGA 1ROWA 4X5PA 5F1IA 4WFEE 1ZCRA 1BLNB 1TYRA 2G5RA 2ZSWA 1KTCA 2F0CA 4EXKA 4D9RD 1Q4NX 5AOLA 4LSRL 3MUGB 4NM8H 3AADB 1RLWA 4U31A 3F65A 4W9GC 4XP6L 4JJOA 2Y25A 4YUEH 3G6DL 5F6IB 1T6WA 1T1WB 5I1AA 4POZC 4YK4C 3KXFA 2B9BA 1B3IA 1G7IA 4LKCB 2WWKO 4GFXA 3AGVA 2V37A 1XH3A 3L4YA 3JWDC 5HVWA 3NIDF 1R47A 4WI8A 1SXBA 2OR8A 3MRCB 3BEVB 4RBPK 5AYUH 1BMWA 3DO7A 3B5HA 3MLRL 4G8GE 4NDMA 1Q1PA 3IRZA 5C0IB 5TGBB 1FRGL 4ZQKB 2HP4A 2WQSA 3IMUA 3NAAH 3T77A 4CMMA 4DKEL 2GUOB 3FB5A 5HDQL 5KZCB 3ZDXE 4JFTA 3OR7B 4QRBA 1T22B 4ZOCA 5JHLH 2L04A 3QQDA 3CVIL 5T1DL 4S1SH 3RGVD 5I8CB 5CZKA 1IEBB 4HK3J 4HJTA 5IMKB 4I7ZC 1F3DJ 4UF7C 2EDMA 4ZTPL 4GT7A 4DVRH 2PW2B 3TC9A 4TSAH 2X4RB 3I50L 2KERA 3QDMA 2Z64C 3O3EA 1BFOB 3KE0A 3QQNA 5C07A 2VTFA 3W9DB 2G60L 1PX8A 4F7KA 1XIWD 3I85A 5FXCH 2MIZA 4NHCH 2NR6A 1HOEA 5IY5B 4YPJA 3FCSB 5GGUA 1EXGA 1HHJA 4HH9A 1HYSC 4ACPA 4LAQL 4X6EA 3KPSA 3KPPA 4KH2A 5LNGA 1DO5A 2I7SA 4X8JB 2WQWA 2YC1B 4BEIA 4W9HC 4XVJH 5A2LH 5MHSD 3QR0A 2XBTA 3MJ9A 4N1CA 4PRHE 5IREA 2QQQA 1EWHA 5JA8B 3QIUB 2PCYA 1MQ8A 1OXYA 3CXFA 3FU6A 1G4RA 4QRPD 1GW6A 4PJEF 3GJFB 1J05B 1NPUA 1MFCH 1UWYA 4HFUH 4UQCA 4EQ2A 5C08B 1CD9B 2ADFL 3KGRA 2IH8A 4XBGB 4XP5H 3DJSA 4PJXE 3UTTE 4YHKL 1ZRUA 2G2RB 3NVQA 3TBWB 1FVCB 1Z3GL 3TESA 1YEEH 1XL6A 2NUPB 3TLRA 4WUUA 2XVKA 3KCPA 2ZUXA 4PJHE 1MIEL 3NJMA 1ORQA 2BX5A 4WIQA 3WFDH 4EJ1C 4LU5H 4KO6A 4FFWC 4N0FB 3TJEL 4PGCB 3FMGH 1OQXA 1MCFA 3GSNL 2QLVB 1CXHA 5BVJA 4EI5C 1DQJA 4FQLL 4Y9CA 3KZ8A 4Q9BA 4O02B 1NOLA 3MMEA 2R23B 2JI2A 1NIAA 3V52L 4F93B 3WUWA 3ARVA 2UX7A 1MCJA 1TZGL 1D5XA 3PWPE 2DQFA 1ADQH 3ULUD 3QA3B 3O6ML 3EO0B 2AMUA 1FORL 1WZKA 1U2HA 4IRSD 1OLZA 3QORA 4OJYA 3FT3B 4FG6C 5K1JA 2EDLA 3MRGA 4AW4A 1AGCB 1CGSL 3P0VH 4JN2B 4AXWA 4ZMAT 1MCKA 2FVNA 3V4LA 5CLWA 2M26A 4G83A 1PS3A 5IVZA 1G7JB 3WV0A 3VXSE 5GSVA 5FAAA 3FF8A 1TENA 5E0QA 1PZCA 2O6EA 3CHSA 2A9BA 4AKOA 4UT7L 4FQXD 5IB4B 1Z6JT 2IAMD 4BFKA 3S34H 1K5NA 5LN4A 1E4WH 4X7SL 1X7TA 2F1EA 2IQAB 2N59A 4UTCA 4HEPG 5CGYD 2BIIA 1H6UA 3I6LE 5F96H 3HNTL 1UT1A 4JG1H 4Q9CA 4OD2A 2JXMB 4LLAA 4UINL 1S3KH 5FM5O 1TQTA 1KV3A 5D1ZB 3UXFA 5L2JA 1T0NB 3QEUB 4K3JH 4UT6L 2X4NA 3D3VE 5HD8C 3UTSB 1YEIH 5C0CD 3CZFB 5I1EH 2OMUB 5DS8A 2Z31A 4OT1H 1YC8A 3II3A 1CK0L 3X3GH 3NIFB 3CX5J 2X9YA 5LNEA 3F58H 3S5LB 4ZMLA 4AM0Q 5IR1B 4MZ2A 1MDTA 1Q9OA 3LEXB 2VMEA 1VEPA 3WNOA 3FQYA 2A3TA 4LSQH 3FB8B 2GTZA 3WGUB 4YJZL 5EEVA 3TBYA 1JRHL 2NXYD 2XV6B 3BN9C 3TN0A 3C2SA 2W07B 3D09A 3HG3A 3FH7A 1JV5A 4LARH 4LBEA 5B38A 1DZ0A 2VH5H 3S9DB 2G5UA 3V5DA 2KQMA 3KVDD 3KPMB 4LQFL 4F2EA 1CFQA 4LE8A 4LVEA 3AREC 1IJ9A 5IB3A 1MWOA 4IBLT 5DC9B 5B1JA 4X6CA 4UIKH 2OMYB 2H47C 5C8JA 2XPZA 2NY1D 4P2QD 1LEKA 3ZL4L 1DBBL 4PCTA 1WC7B 3CHXA 1CGUA 4PJCA 4HUUB 4X0KA 3RWCA 5LO7A 4MNHA 3ZHNA 4MAYB 4A2LA 2FEEI 4A67A 1QASA 3DVNA 3EO9H 4H44C 1XGUA 4O51A 3H7BB 2OZNA 3LPGA 3QEQA 5HI5C 2Y1VA 1C7SA 4QYOB 4UQ3A 5DUJA 1CUOA 3L7EB 1EFXD 5KVFE 4N2MA 2EDHA 4Z6AT 1AIFB 4JDZB 4YBLB 3SYQA 2DMHA 4KDTC 3LNIA 2BDNL 4FNLH 5T5FH 3A3YB 5I82A 3MV8D 4JHWL 1D6EB 5TPWH 4YR6A 3EAKA 3MRIA 4MKMA 3BO8B 2EVHA 2Y5QA 1WFNA 2HG5A 3PU7A 4FF9A 2QMJA 3DX9A 4HIEB 1AC0A 2MOGA 4HMEA 3O6FB 4JB9L 5AVQB 2IJ0C 3MJ7A 3RNKB 3SJVB 2XX1A 3WE6B 1BZEA 4CGUB 5JO5A 1UYWH 3P2BA 3DUUA 1X5ZA 2B0SL 1L7IH 2GCYA 5HGAB 1CF1A 1MWAB 4FFVD 3UP1A 1DBMH 3US1A 2ZXEB 4NZDA 1ZHKA 3ZKSD 4GP8B 1EXHA 4IJTA 4WU7A 2NQ3A 2KQNA 4NN7C 3I6KB 4OZHE 4R2GC 3BAEL 4N8VA 1WGVA 1JF1B 1BQSA 1RZQA 4DTGH 2NSXA 4M7LH 1NDMA 4H13C 3TO2A 2QHRH 4X9YA 1KB3A 1FNLA 3C09C 2OYMA 4LHUD 1UXSB 3TFBA 3MLVL 4XNZC 4A6YB 3O2VL 5ILTL 5AQ0A 3UTTD 1IGFL 2NY5H 3WFZA 4V33A 2WCSA 1H6FA 1TOXA 1SJMA 5HP5A 2WSDA 1IARB 1CT8B 5ES4B 1A3LL 3PP3K 4WWKD 5I66B 1NCBH 2FT6A 4RA3A 5KVEL 2COVD 5EFIB 3BD4A 3AM8C 4RMBA 1HI6B 1KCVL 4JJHA 4L8BA 2R1WA 4KGLA 4PB9L 5I1GH 4TVPL 1P5VB 2VE6B 3QO0B 5IOPB 4S1RL 3NJFA 1U36A 1U8NA 3WJMA 2NNAA 3NABH 4P2RE 2F7OA 3LIZH 3U4KA 4N0UB 3QBTB 2VDQH 3VXMB 5C92A 2NT0A 5JA9A 5EWIH 4OKDA 1AXTH 43CAB 1J0ZA 2FR4B 1ERNA 2Y07H 1UASA 2XJLA 4OZFA 4ZAKC 2VKXA 3WEXA 2N7SA 2WBJA 4PJBA 2MH4A 3VRLE 3QRLA 4BZ2H 1JHTB 2R0ZL 2ADJB 4DP9X 1FGVH 4PS3A 1QFUL 5A2JH 4MMXA 1KN2L 2DKMA 4GBXB 2V8MA 2X28A 2WIMA 5AB0A 1U2YA 5FB8A 5JR1H 5CZVH 4XN9A 3X2QB 2ZUTA 1IC1A 4KXCA 2WSKA 5G4MA 3R7RA 4R4FH 2BNUB 5ESVB 3O4LE 2Q2LA 4QXVA 4X42A 2QDVA 2CPUA 1T20B 1HYRC 1GKEA 2CCWA 2WLIA 3D39B 4JM2B 4L37B 4ZS7H 1XGYL 4P0DA 3SDYH 1DSWA 2HT3C 3N50A 3S35X 2PTUA 3N55A 4HKBA 5I1DA 5F1NB 1A4BA 3ISRA 1NCGA 3MJ8A 2XA3A 4DPBX 3CN3A 4KZDL 3KDMB 2CHXA 3U48A 3LMJL 5BO1L 1VB9A 5CJ8A 1KYAA 1G6RL 4KJPC 2FJFA 2FSDA 1S9XA 5FV2A 4MXVE 1RIHH 5IHBA 4AT6A 4TLTA 3EJPA 4J1UB 5I8EB 5KUMA 2EYRA 4GPVA 4U0RB 1Z5LA 4OIIH 1CGTA 3SPVA 3TBSA 4WO0A 5A7EA 4KUCF 1TU2B 2F9BT 1KB9J 3SDXB 5CEZL 1EO8H 3LPPA 4I9WE 1B0RB 1MCWW 5H37G 1NJ9A 5ETUB 3EOTL 5L7XH 1DEDA 1GGTA 3ZTCC 1MLCA 5EIVA 1TCRA 1SLVA 1MIML 1YNLH 2MHAA 3STLB 3L9RB 5MP6L 1UB5B 2Q8BL 4YHPB 1A5FL 1JPST 4YNYA 4U3SB 2CWRA 3L13A 4HQQL 4IU3A 1NFAA 5DZNA 3UYPA 2G3XA 1KYOJ 3AXLA 3NDYE 5GS2H 5AOKA 2WBKA 5ESAA 3ZX1A 3ARDA 3HNSL 1E3ZA 5KAQF 2O5XH 5AWNH 5E00B 3SEPA 1FL5A 2D7OA 2Y0SA 3BPNB 3MODH 4Y16D 1GHFL 1QPKA 1GOFA 3L17A 5FPIA 1X9LA 4BCXA 4PS4H 4R7XA 3TP4A 4LLVA 1VHPA 4Q6KA 5T1LB 5I71C 1KG0B 1OB1A 3OX8B 1HH6B 1XXDC 2H1XA 2R2HB 3LHPH 1ZEAL 1IJNA 1NLBH 4FTDA 4DUWA 1T0MA 2H9GB 2ZG3A 1E5AA 3OKEB 3NCYS 2E6JA 1BV8A 4L8DA 1E28A 5C0RH 1CF8H 3RKDC 2UVEA 4G8IA 3CC5B 1NFDB 3N06B 4QF1B 1ZK5A 5GGRY 3GO1L 3EGDB 1RUMH 5CILH 4Y1AA 3WFBH 1XF5B 5JHDB 4ISVB 3VXPB 3H53A 4X6CF 1NCJA 1S78C 1SRDA 2YD7A 1HSBB 3DHJA 4OLVH 5JW5A 3KPOA 1EEYA 3HC0B 1WHOA 2BNRE 2FX7H 2CKBB 4AL8H 4PJCF 4E9WA 2NNRA 4Y5VC 2HPTA 1P4IH 3GHEL 2CPCA 3VD5A 3AS0A 2CUHA 3LRHA 1A6TB 3ECUA 4TMPA 2YA0A 1NBZB 1X5LA 4QWWC 4LHUG 3HS0C 1GR7A 2R2BB 4KI1A 4HG4J 5E5UB 3PHQB 4N2BA 1N0LB 2VLRB 4WKXA 3L5XL 2BVQB 1K8IA 2BP5M 3H9HA 3GSQB 3L2MA 4D0CA 3PJLA 3D0VA 5DWPA 3C08L 5INCB 2QPSA 3CPLB 4HK0A 3L1OL 4P48A 3KPNA 2A7BA 4U1JA 4Y4KD 4Y5YC 3O81A 4OM0L 4KKRA 3K74B 4HS8H 4R97C 1SJEB 2YPLA 1NGQL 2C9XA 3PLYA 4DQOH 3ZDWA 3LB6C 4DEPB 4W9CC 3SDDC 4NQCE 1OAYL 1RZGB 2PR4L 1JF6A 2ZOKB 4ADJA 3D06A 5AW5B 1KB5L 3NJLA 1CLYL 1LGVA 2DY2A 3L95B 3QQXA 1U3HB 3IDJB 4PWIA 3S3BB 1AKJD 1OSPH 4F33B 2BIPA 4UU9A 2WQAA 4ZFOB 1KN4H 2Y7QA 4Z0BL 4ELKA 2JIXA 4HPYH 4LOUD 1JWMA 4PJ5E 5FUCE 1FFOA 4YZFF 5C0AB 4FQPA 2FYYA 2LU7A 3WENA 5EUKB 4CKQA 3DROB 3PP4H 2VQTA 4D7BA 1MFAH 4QRRD 3GMLA 4XVUC 5L6YH 5DJAB 4P23B 1SOXA 2X6AA 4J3TA 5IW6B 3B9EA 3B37A 4P8QA 5MERB 1OGTB 4MRCA 4M61B 2JF1A 4PJIB 5D7JB 4JGNA 3O8XC 1QUPA 3QCUH 1MJUH 5B1CA 2YAFA 1MHCA 5FDWB 3WIFB 5GXBB 4YDKL 2EYSB 3F12B 1KEGL 3TEWA 1T0PB 3MCLL 2WOBA 3ILQC 3O4LD 2X4TA 1FN4A 1N7ML 1A6AB 3NFPB 4KUZH 3RHWF 1UA7A 4DEWA 3UZQA 4N5ED 1KULA 3TCXA 3WNKA 2QR0A 2WBXA 1SLUA 5GS0L 1PDKB 5E6IA 1CL7H 4NT6B 3CVHH 2R0KL 4ZUSB 4EIGB 1MREH 1XZ0A 4NCC1 4YXKH 2J6EL 4PJEE 3QO1B 1ZE3H 3SDAA 3WY3A 1WG3A 2WXHA 1RZ8B 4BD4A 1IAII 2DQJL 3HR5B 5DRXA 3ULVL 3K6NA 4OZ4A 4PJBF 4HS6B 5C3LD 1OOAA 2B59A 3G7TA 1A7PL 1YEJH 3DUSA 5ADPH 4CU7A 2XN0A 4W9LC 4KJYB 3ZRFC 1A66A 3QIBD 5JZ7D 3B4NA 2OFQA 5J3HC 2QQNL 1O9ZA 3MRPB 3NSXA 3WNPA 1XQ4A 2NQDA 2DYSB 3SGEH 1UKSA 1SEQH 3JV6A 2AJ3A 4I9WD 4PTUA 4HEMA 3TF4A 3P4MB 3U4EB 5C09B 1ACYH 4U1IA 4Q74A 1CDYA 1AO7A 2PR9A 2IWGA 3H56A 3MRBB 2WD0A 4NBXB 1Q9KA 1DJXA 2W0FB 4C83A 5AW7B 4XMVA 1F90H 1QLEB 4I1PA 2V2XB 1NIFA 2WVSA 2IH9A 1U21A 1U8PB 1G1YA 2NXZB 2AVGA 1D9KA 1QFHA 3CDGA 1OTUC 1UZGA 1Q9LA 5E6SB 4UMSA 3BUQA 3QJSB 4XZUA 2A83B 2LTQC 4E9VA 3ULVC 2FGWL 5DVMA 4WY7H 5KBDA 2BNQE 5CBAB 3FQRB 3MROB 4FG6D 4AGMA 4ENZA 1DANT 4GKLA 3GSXB 2DQMA 1KIPA 3MA9L 3PV7A 4JFPB 1NMAL 4QGYA 1F13A 2V5YA 3E3QC 1TTGA 1OPGH 3OKOB 2RCSH 4G7YH 4JAMA 2PYED 2K6WA 4GIPD 1ID2A 5D7IB 4PFEA 3W0WE 1JNHB 4ZNCD 2VZSA 1X4ZA 4J3OC 2YMXL 1U58A 1WZ1L 2X4OB 5D72H 2KMWA 3BE1H 2MNUA 4ANXA 5AW9B 3I3DA 4ONOA 3VH8G 3AG2B 3VG9B 3S0PA 1NPNA 2Y1YA 2WIIA 5DZPA 1QBMH 4JE0A 1WRFA 5BCAA 1YY9C 4P9HL 4F7TA 2AANA 1XXFC 2OKMA 4ZTOH 1GGUA 4QRQB 5F1OB 3EJJX 1FVEB 2AC0A 2DWSA 5T1KA 4HC1A 2BK8A 1KBBA 4Z3FA 3D52A 1QSEE 4Y4FB 2FIKB 4ODHH 2X4PA 4YHOL 5I1JL 3VA2C 5I1CL 2IBZX 3MRLB 2VMCA 2V7NA 1CE6B 2XZCL 4GRLB 3GSWB 4MQ7B 3LV3A 4NPYA 3PHSA 5I19L 4RMUA 1OARL 5F3HB 5C6WH 1MVUA 2CNYA 3H9SA 5FA4B 4XC1H 1MNUH 3BN9D 1NGWA 1XWVA 4YO0B 1GC1H 4X4XA 3RVUC 3UTPD 3WHXA 5KJRL 1I9IL 1T66C 2ZXGA 1GOGA 5IMLA 3RZCD 2BZCA 3QQ4B 3BAKA 1QHPA 2QGBA 4KVNH 3FUFA 1L6XA 3ARED 1U8OB 1N6VA 4OJDH 4AGLA 4WZ9A 3IDGB 4X99B 2FO8A 2YOCA 1A9BB 1E7VA 3WAKA 2Z7UA 3F7KA 4P9HC 5HYJA 3VQLA 2YD8A 4EDWH 4URTB 4X6BB 1L5GA 4UZUA 2BHFA 3CTTA 3L7FA 4UOZA 1C1EH 3P30L 2G5BA 3V6OA 3KXFE 4WU5A 3BKCL 1XH2A 4LASH 5IEKA 2PLTA 1DFBL 3PNWA 1S7VB 5AVWB 1A0QL 4LFHD 1RUQL 4LESA 4YMPA 4PRIA 2VDRB 1GYAA 3GMQB 3W39A 4Z18A 4XVSH 2L8AA 4HLZG 2NUTB 1S7XA 3ROOA 3IRPX 1RFDH 5DO2D 3UGXA 1I4FB 4L29B 3Q6FB 3A4EA 5G5DA 1J1OH 1SJXA 3QZWA 1FHNA 4HBCH 5KYXB 1JK9B 1RZ7L 2Y3NA 5DR5L 4N0CC 5F7HA 1MFVA 4N5UA 4PJGA 2QPFA 5C7ZA 5T1MB 3P0GB 2QKSA 4DGVL 2OW6A 1PD6A 3PABB 5E23A 3CFQA 5AZ2H 1G7MB 1Q9WA 1YN6B 3FCTB 4XPFH 3UBXB 2P80A 3QDME 3MLSH 1L9TA 4UTAL 5C07E 4E9QA 2R69A 3D34A 3HB3D 1KYDA 2KZWA 2QADC 5CHNA 5IHUH 1M05B 4H8WH 4Z7OB 2DTSA 3DOHA 5D1QC 4Z7WB 4OKVA 2XRAL 4YDJB 3DX6B 1XGRA 4GXVL 2AEQH 2JJTC 5IIEA 4ZO7A 1U0QA 1MFEH 4AZ8A 3JSSA 4HPOL 3AU0A 3CC1A 3DX3A 1NPJA 5E0FA 5EO9B 3ZLQC 5ACZB 2RFXA 2FSEA 1DLHA 3ZE0E 1JGEA 3NH7L 4GRWB 1W72L 4AEEA 3QS2A 4PR5A 2DLEA 1WT5C 1A7NL 1BIIA 4KRPB 1QKZL 1EHLH 5J9PA 1BPVA 2F74B 1SF5A 1AZBA 4HYTB 4JQIH 1KWGA 1JGDB 4I4WB 3ZW3A 3MBED 4AUYA 3UYOD 4JRWA 2ZP9A 3ULUH 3KWXA 1YEGL 3FTGA 1IM9A 2BHUA 2NY6B 3RHWK 1BXUA 3QCVH 1SYSA 5GS1B 1JHKL 3IDNA 4YHML 3RWEB 4BQBA 4E5XG 1GIGH 2DYRB 3Q5YA 1CIUA 4K5NA 4DWHA 4GIAA 5EBLB 2XACC 3BGFB 4ZAKD 3P73B 3TVMD 4LK4A 3O9WC 4WUUE 5H94A 2K3HA 2HTLD 2Z8SA 1FJ1B 1DQLH 2COQA 2VN6A 3QRGH 3T6VA 4FQ2H 3U36A 1AS8A 4XOEA 1I8LA 4NUPA 3RY5A 3B43A 1AC6A 3JTTB 1AH1A 4LOVA 4I0PB 1NGXB 1N64H 4AYGA 2WINB 1RPQA 3FSZA 3PQYA 5BVPL 2Z0BA 1CDIA 3D2UA 4PV9A 2W9LA 3HS8A 4G1EB 4GNKB 5EPMA 4CC4A 1FO0H 3FN3A 5FR3A 3TJHD 1JD7A 2WAHA 4Y7MA 1U3YA 4XTRD 4MCYB 3OAZK 1MH5A 4M62H 2Y2YA 4F80A 2HT3D 5C0JB 2JKIS 4Z78B 3OGCB 1JPSL 2BH0A 1J1PL 4I3SH 1I53A 1NCOA 2M2DA 1TZOA 2OQJB 2KZBA 1YMMA 5KSAD 4WJ5A 1L0PA 3D9AL 4KJPD 3EGSA 5KVMC 5DFVC 5EBGA 1OF2A 3S36L 2VJ0A 4AYFB 5BQ7A 1QSED 1A7QL 2VQ4A 3R19A 1NGPH 1F3JA 4Q9QL 1OAKH 2O26U 3CAFA 1BQLL 3EJCA 1O6SB 2V5MA 4JKLA 4N6RA 3F6LA 1Z1WA 2HX8A 4ALAC 3O41A 4APXB 4D3CL 4J6RH 1HSAA 2XCMC 1U33A 1DLFL 1MAML 4KO9A 3S3JA 3TBVB 1EUTA 2I7OA 1KFAH 3S7GA 4A2HA 4MQSB 2BFVL 4NP4L 1IGCH 4M5TA 3ZHDA 2BSBA 1F41A 1IX2A 4UQAA 4FI8A 5B39G 1P0SE 3HI1A 1JS4A 4LCWA 5IG7A 2H8PB 5H2BA 3WNJA 2A6DB 3VXQA 2IALA 1XHHA 2X0UA 2DBLH 4H5SA 3H2QA 3QIUC 3BFQG 1XO8A 2CBTA 3GRWH 4IBYA 2VLKB 5L4FA 1UH3A 3DHPA 4JO3L 1UWXK 4PCKA 1U8MB 5D2NA 4PG2A 1WTLA 1IFHL 4OLZH 5HVFB 2C9UA 3H3PH 2YEZA 3QUGA 5DMIH 3WEAA 3GXUB 4MDIA 1WICA 1EJFA 4HGWB 4TQEH 3OKKA 1G5AA 3QULB 4LLDB 5DMKA 3VXRA 1G1CA 4YHNA 3WNNA 4LFHG 3VFSA 3VG0L 3KXFD 4P5SA 4Q6IB 2YBRB 4NKOB 2NW3B 1NDTA 1QA9B 5D1XB 4XHJD 5F7KC 4CDHA 5K9OA 1CLCA 2D31A 4JN1H 2CO2A 5L8JB 3RKDD 5GRWA 1Q1JH 3FK3A 3ALWA 3TIEB 4FLQA 4P5MB 3CBRA 3ROLB 3G5YB 2NDGA 2OXHA 2NLJA 4J8RA 4NKDB 2GJ6A 2RQEA 4X6CE 4PSRA 2FJHA 4P5KA 4YGVA 4O4YH 3FQTB 3BVNB 2F8IA 1AQDB 1IIIA 2SEBA 3HCVA 4MB4A 4PJCE 1WD8A 4AMXA 1U95A 3MFGB 1P4UA 5IEHB 1AGBB 2IWKA 3VFVA 3SCMB 1HWGB 5I6OA 2YWZA 1GH7A 4PP2A 1TVDA 4O2EA 3DX7A 4Q97A 3QEQE 3VX1A 1NCUA 3HVNA 3VTMA 3GKWH 3LN5B 4P59L 4KWUA 1FYTA 5HHMD 5TD4A 1P53A 2WYIA 3C5JB 1U93A 1EO5A 4JO1L 4OV5B 3GHPA 2NR6D 4UAOB 5I17B 1S9WA 4E9TA 1UACH 5GS3A 3U1SL 1MNNA 4UV4H 4CADA 4PD4J 2H7WA 3BP6B 3KPSD 2ENYA 3MXVL 3EYSL 4UV7H 1SMAA 2CGZA 5HHPB 4EPSA 5F7EH 5L88L 1N9PA 3SDDD 4PJGF 1H3GA 4MD4B 3K8LA 4GUQA 5D1ZC 4C56A 1TQBB 1JWSA 1KTKE 2HVJB 3QB7C 1TVBB 4TUJA 3RBGA 4LP4A 3C2AH 3N0AA 5IFAH 2E74C 2WXIA 1IV8A 4G9DB 4BFIB 5FWQA 4AG4L 4MNGB 4I0CC 1PYWB 1E40A 1LEGB 4GW1B 4GAGH 4YZFE 1YQ2A 4GSRA 3I9GH 1MRCL 4M43L 3VWKA 3HI6L 1AQMA 2HRPH 3VQ2C 4U3XA 2B1AL 2FBOJ 4NNXB 2MKWA 4BM7A 4BBWA 5FEBA 4XGZA 4E9RA 5J1AB 2VLJD 2KLSA 3ZR5A 2GBUA 4WUUD 3ZR6A 1N5AB 1MJ7H 1MFBH 4O9HH 1E9PA 3WCYA 1WZMA 5DMGC 3DSFH 5DRWA 4KXDA 3L3OA 1U91A 5SWSA 5GGVY 1PSKL 2X2IA 2MQGA 1YNKL 1YPZB 1CFTB 4HWBL 3VXUD 3O3UN 2AXGA 2YAMA 3B2DC 4LCYB 4FERA 1IKOP 3P77B 5HPOA 3ILQD 2XZAH 3LS5H 4HXAL 2QTEA 2GI0A 2OJEA 2P5ED 4W1TA 1FH5H 5AVYB 1ROCA 1ZHBA 2OJZH 2NYKA 2L0DA 4WV1B 3HC3L 4ZD3L 4OF3A 4WWPA 2ZWLT 2CJUH 3FSWA 3VFOA 1INDH 3CDCA 3D69B 1ZT4A 2C4FU 2YK1H 4JKPL 3A6BH 3FOLB 3HZKA 3WUZA 5KOVC 4OLUL 5J13C 5IJVA 4PJBE 3GMNB 2WNXA 4L9LC 3QXDB 4QMEA 1FZOA 4P5TB 2ZD0A 2Z1PA 4E41A 5JW4N 3P40A 2WO4A 3FB6B 4QOKB 2VC2B 3NYKA 1YCSA 4K9EL 1DQIA 4A6YL 1INQA 1S9YB 4JPIB 5SX4H 2ENQA 2LAGB 2Z1KA 4LL1A 3OSKA 4YSEA 4HIHB 1JNLH 1BPLB 1ONQB 2QVTA 3IXTA 1S9VA 4KUCD 4ZTEA 5J3HD 2WB1A 4LCCB 5F9JA 4MJ4A 5FS5A 2HFEA 2J73A 5F7BA 4F9LC 4YBLC 2A9AA 4X83A 4OQTH 4JREC 1NGYA 1FAIH 5EF1A 1NSNL 2AQSA 2BVPB 3AITA 8FABA 3QNYB 4JFYB 3Q2LA 3OKDA 4LEXL 3EYUH 4ZO6A 2J71A 5FHAH 4I2XB 2WLKA 1LWJA 1ZVSA 2P7TB 1BZDA 4LLMA 3VVVA 2EXWC 5I15L 4JM4H 3BWAB 1U4FA 5IQ7H 4CN4A 1HOCA 1S7UA 1NUNB 4FI7A 4FX5A 12E8H 3OKLA 3BFWA 3OC5A 1GGIL 5DK3A 1Y07A 1D3CA 1KACB 2CDGB 1G4MA 4LP5A 3GPSA 1OTUD 4WSKA 3VDAA 4N1EA 5BV7L 4O2FA 4N2EA 1HHHA 3DX4A 3WFEL 2XQYA 3V10A 2CRYA 3GZOA 3K2UH 2HN7B 1I1FB 4J3WA 4KI5C 4H26B 4DZ8A 3HMWL 3F04A 4K9EC 1GJIA 4ODSH 4RBPH 4GP5B 3TCLA 4M8UA 4POUB 1AMXA 3BIAX 4L23A 3TN0D 3FO0L 1JGLH 5KVFH 2EDTA 5FLUA 2D0FA 1CU4H 2DM7A 3T0DA 3G5XA 2Q3XA 3IFLL 4KXZH 3K2MC 4JZJC 1E5ZA 3K4AA 5EEXA 4ORGA 6FABH 4D8PB 2L7UA 2VAAA 3B2UC 2GC7C 4WKZB 3VFTB 3OMAB 1QHOA 5TE6L 4Z7VB 1QRND 4Z9KB 3ERXA 4YE4H 4BCZA 3L4XA 3HHSA 4YIQB 1OM3L 3CXHK 4XN2A 5HI3C 4AVHA 4GLRH 1R6VA 2A74A 2FQGA 2WLMA 4XXDA 1YMHB 5AW0B 3ASNB 2E8ZA 2XYCA 4FMKA 5BV7C 3QEQD 4GSDL 4YSAA 3C5SB 4EOWH 2GFBB 1EQWA 3PJSB 3U0WH 3JVGA 4K3EH 4KJWD 1KJ3H 5JORB 2UUDK 1E4KA 4YEEA 3OXRA 3NRFA 4O2CA 5J89A 3QXTA 4Z7UB 2VR5A 1BVLB 3ABGA 3I2CL 4X6FA 4Y1AE 1JJUA 5LQBL 2X4SB 5C0BA 3CUPB 1PKQB 3JWDH 3RVUD 4Y4HB 1U8CB 1QO3A 3CD4A 1QLRB 1I8UA 2TSBA 2AV1A 3NP3A 4OF0A 5IESL 4PS7A 1K4DA 1T66D 4R5TA 3GMPA 5CJQL 3NCJL 3WTUA 1B2YA 4AQ1B 1KPRB 2F58H 5DD1L 5IB1B 3NCYP 1E5UI 3EFFA 4LLQB 1IGYB 4ZFZA 3X13B 4AKPA 4B9ZA 4N3TA 3FQWB 1GZPB 1ZA6A 4OBRA 3VRJA 1RZJL 3FU3A 2DWDA 2IANB 2FZ3B 3FZUC 3C6LC 2VXQL 3RJQB 4XX5A 1WWWX 1QG3A 3VFNA 5I24A 2VIRA 3RNQB 4YLCA 1JPFA 3LN4B 1S5IL 1UJ3A 3IS1X 3WJLC 2VUYA 3AMKA 3MR9B 6PCYA 1IQWL 5CCKL 3L6FB 3WS3B 4H0HB 4M8RA 4NXKA 3EFOA 1WO2A 4U0RC 2CHDA 5TDPA 3RG1C 2B5IC 3HC2A 4ZYKB 4CSPA 1JHLH 2YPLE 1QFWM 4FL4B 4F27A 3AT0A 1IIKA 3EH2A 4DCQB 3P9MA 3VCLA 2LT9A 4Z3EA 4V1DE 4CMHC 1IU1A 1P69B 2FT8A 4PGBA 5DHDA 4W9ZA 3WUWG 4HLZH 2UY7A 5EBWB 4R4NC 2X7LA 2XSKA 1NEPA 1B3JA 5IBTH 3VGAB 4KH9A 1OAZL 4F5CA 5CD3A 1PCXA 3GLAA 4IRZL 2CKBL 3QNFA 1E6JH 4DKEH 4RAUA 2VR8A 1SY6H 3S96B 3ECQA 3PV6B 1QNIA 1M7DA 2R29L 4QY8A 1KDIA 2XFXB 3NIGB 2GKIA 5D8JL 3PIQA 1AFVH 2EADA 4MXQC 4P2OB 1L9OA 1RZJC 4BZ1H 4HCRH 2WXFA 5KYYB 3UERA 2WBJD 3CVIH 4UAHA 4XPAH 5DYOB 5T1DH 4D7PA 3VD2A 1OGAA 2XPYA 3MRKB 4NN5B 3IXAB 1L7TH 3QUMB 4K3DL 5DURD 2ATPA 4LDLB 3ATDA 1H9DA 2UWEA 1VIWA 3IB4A 4OLEA 3VFPA 2HJLA 5C86A 5F8QC 3V6ZB 3SSGA 1K2DB 3GI8L 3TO4C 1CE1L 2VO8A 3WY1A 2FD6H 4Z7NB 2YPKA 5E4IA 4LSSH 3QJVB 4FMFA 1CFVH 1MJJB 4M5ZH 5BOJA 1SEBA 2IG2H 4N0RA 2JCCA 2C26A 4Y5YA 1L9MA 5DA0B 5EU3B 1UD5A 2VOTA 4ZUWB 4XPTH 4F7PA 2CXKA 3FF7A 5C0FA 4NSKA 5DJ8A 1TR7A 4BFGA 2IFFH 2D7TH 1XBRA 3L2NA 4N28A 3U2IA 4ZFOL 4UM9A 2Q8AL 2FJGA 5ESQB 1A9VA 3ETBF 1JFQL 1Y6KR 1QNZH 4Y19A 5IVXA 2XV3A 2WKOA 3CFKB 1EJ8A 3VMOA 1A22B 3T3PB 2LGNA 4G8FB 2V17L 3MNVB 4APQC 1NA8A 3CBKB 4XP4L 3RPIB 4UOQA 5FA3B 4HEME 1AXSA 1H9VA 2DMKA 3C5ZB 1HXKA 1AO7E 1G7HA 2W60A 5B38G 5KJ7E 1R3IH 1GYCA 3RUGA 1CDCA 5DT1L 2R56H 2P5WD 1BD2A 3EF4A 4ZDHA 1WFMA 2UXVA 1N0XH 4TSCH 1AZRA 3TJEH 3S37X 3IKCB 4RA0C 3T0EC 3TYFB 1UZ8A 3ATBA 1MCPL 1WBYB 3NACL 4ZW8A 2DWXA 4PJ9D 4WJKB 4IW4C 3O3DA 3TA3B 1FBIL 2ZONA 2DLTA 1A7OH 3N1GC 3WN5B 1SN2A 1Y0LA 3ARDD 3MXWL 5ID1B 1MI5B 3HE7A 5BRZA 1ZT7B 2XPGB 1OAQL 2JKWA 3AT9A 1NCCL 4JDVA 4QT5A 5BJTB 2OZ4H 1XH1A 5B4MD 2NNFA 1FYHB 2JKRM 4BXVA 4ODTL 5F7LB 5KBKA 1R5IB 1TO5A 4GG6B 1QEWA 2A9NH 2WHVA 1X44A 5E99H 2GSIA 5HYQA 1CD1B 2C1PB 3G6JA 3S8WA 3IFPA 3NCWA 2PO6A 1NMBL 1DUYB 3EYQC 3R06A 5BXFB 1E4XL 1R3LB 2YWYA 1MHHA 1AMYA 3IJ9A 4LCVA 4U1LA 4XNUL 3OTTA 1HVXA 4IRJC 5D7JC 2NTFB 1RU9H 1JV2B 2J5LB 2AJVH 3DIDA 5I1IH 2E7LC 4OLXL 3VAEA 1SXNA 5DZVA 1UM4H 1ZLVH 1I3VA 4Y1AD 1U8IA 3CLEH 4GUCA 2ZCKL 4CN6A 1OCWL 3IMRA 2G75A 5FUOH 3K1DA 3PAVA 2CLVA 1G1OA 1GZQB 2JTDA 3QJRB 4NJ9L 4NO5B 2JJVA 5E8DH 1QLEL 2ZCHL 4BE6A 1RULH 2IPUG 3IJ7A 5EN2B 4DP4X 3RWIA 3ESPA 3CQQA 2PWFA 3DIVA 3T4YA 1WEJL 1CICA 3PWNA 3T0BA 1NAMH 1LP9A 3ILPB 4GG8B 3KWVA 2F53B 1UXMA 5JOPE 5I23A 4L1BA 3OJ2C 4NQDE 4XCFL 4CRPA 1TJGH 4JQXC 1QRKA 3DA0A 3PP3H 1KGUA 3HR6A 3FONB 2YQBA 3CZSA 1YYCA 1BM7A 2J8UA 3H9SE 1BLIA 4OB5L 2CLZB 2VMFA 2VAJA 3GZPA 1NCDL 2EC9U 2HT2C 2TRYA 3GXTA 1A4KA 4NP9A 5D5MB 5H8DA 4FCHA 2QGCA 5ICYB 1P4BH 3L5JA 1WS7A 2JJWA 3EJTA 2GBTA 1C7TA 2YPLD 3FT9A 5E4EC 2YSTA 1HHGA 3FUEA 1GZHA 3DJTA 2F54A 3A5VA 4R90L 4X98A 2H32H 3QH3B 2VW7A 3SBWA 1OGPA 3DX8B 5HYJE 2A6JB 1R3JB 1RUKL 1I31A 2DKUA 2CXGA 2YJQA 3A6CH 4LCUA 4EN3B 1LE9B 4OZFG 1DQDL 2A2QT 4WW1B 2J8HA 2JIXD 2NXZC 5EU7C 3SKUD 1T1YA 1YEFH 5J6HB 1T83A 3CIAA 3KJ6L 4UILH 5HJBA 2OMXB 3V6OE 5FDYA 5EULV 4CSSA 4P46B 5AW4B 4A63A 4ZOBA 3BRGC 1ZHLA 1HWWA 4PRIE 2X0WA 4ODVL 3MV9D 5DLLA 4NO2B 1FZJB 3T3MB 1RUAH 2IDSA 1FUNA 4XNYL 4KKLC 3BJ91 3IMTA 3HZVA 3MHZA 4F91B 4GMSH 3DI2B 3RBSA 4W4OC 4Z7QB 4PVLA 1PAMA 3HG1A 3UZVB 1HC1A 2W94A 3UAJA 2YAEA 5I0VA 5L2KB 1KTLB 1OB0A 2X3CA 4JFXA 4W9IC 2EH8H 2ITDA 1U3JA 3LOWA 3MGTA 4MJHA 3O2WL 3DSNA 5C70A 3BJLA 5E6ID 1I9JH 1GAFH 3VG9C 15C8H 1DQTA 4FFYA 1TZIA 1EAPA 4NCDA 2ZKXA 2QBWA 2AXHA 3Q5TA 1D2PA 4BH8B 2FJUB 2D9QB 3BXNB 3D25B 4HK3N 3LNDA 4C4UA 1S8DB 2XTJC 1KPVA 2X4UA 4PN6A 5FKAA 1NCWL 4NPJA 2WUCH 2QSCL 3GMRB 4Y4FC 3QISA 5I2IA 1EEZB 2FL5B 4D94A 2UWEF 3APCA 3MBXH 3CFDB 4G6FB 4DT2A 4HX1B 4L5FH 1NCAL 4QKXB 4RWYL 4B60A 4GRLC 5EIIA 3MLVH 5GGSA 5ILTH 1URZA 5AVRB 1UB6A 1CVSC 2VDRL 5J6SA 5FECB 1SHXA 1KCRH 1AO7D 2MPVA 3CFNA 4HUXB 4AY0A 2RHEA 3MDJA 2VLLA 2IXQA 4MNQD 2R8SL 5GGVH 4MDJA 4FZEL 4M56A 1MFNA 4PMEA 5JW4R 1AE6L 4JFOA 4MXWH 3FAWA 2Z8RA 5LDUA 4GSXA 1QMUA 5AKTA 1OE1A 1QSFB 3EDEA 2Y3AA 2X4QB 1C5CH 4NKIL 1X5XA 2NQCA 5JPNC 5G4OA 1D9KD 2XVLA 5DDHA 4DAGL 5IM7B 5IVXF 3SN6N 1IB5A 2WKOF 3BIKB 4EMZA 1MRFH 3CHOA 4FQ1L 1NBYA 3OHMB 3C12A 3FRUA 3FN0L 1I3RA 5DQDL 4TTDD 1H3WM 3WAJA 3KL5A 4OGAC 4KNQA 2ATKA 4HJ1A 1ETB1 3JTSA 4U1GB 2HJFB 2VR7A 4AM0B 3JV4B 1LILA 2HG0A 1IFGA 2J20A 4GS7B 1VFAB 4I3GA 4XOAA 1H8NA 3MV7B 3PQYE 5J6GA 1SOQA 3RUGF 2XKNA 4XN5A 3DX1A 4HXBH 3LTVA 1WBXA 4JUTA 4XE5B 4NO0A 5CUSH 2ARJA 4NRYA 2APFA 5D1QA 1M9SA 3HHRB 2E86A 3BPCA 5F7NC 2ESVB 2P5PA 2EIMB 3GBLA 5E2TL 1MCWM 3VWJC 1FLRL 2BSRB 3AJ7A 3CN4A 4HSCX 2XWCA 3IMVA 4HIXL 2EXWD 3RVVC 3QI9C 1KGJA 5HGDB 1XGYH 3P4NA 1YMME 3TWYA 3BKYH 3IJEA 1VF5C 1J48A 5C0ND 2CJTA 5FO9B 3RY6A 4IOIA 5DSCA 1IC4L 1XF4B 7PAZA 5T1KD 5HGHB 2QKIA 3CLFH 3CQPA 3MLZH 4YAQA 7CGTA 3G6JF 1HKFA 2GIXA 3UYRL 4K7FA 4LBAA 4OGXH 4ZXBA 3N42B 4LF3B 3R1GH 4PB0H 4KI5D 2ROYA 1BLNA 3V0DA 2XU9A 2H2SD 3H9SD 1G7LB 2XQYK 5JPMB 3MLTB 1JZGA 1ETZA 3GXPA 3BCDA 1XD1A 4JFDB 1K6QH 1EXUB 2W9DL 2VRQA 1M42A 3QDGB 2XNAB 1MLBB 4MCZB 1MCOL 2Y4SA 3MV11 3EOTH 1CLZL 4LCWE 3SE4C 2SODB 3UIZA 1T1WA 1NLDL 1A6UL 3VB8A 3B2UD 4NNPL 2HMIC 3O11A 3MCG1 3A4DA 2AJSL 4PUBH 4XWGL 3SE6A 1LP9F 3BQUB 5FYKL 4OZIB 1N2RB 4ORZC 5D2NE 3H1ZA 4G8AC 5AW1B 5A2KH 3MRCA 3BEVA 3L3DB 5C0IA 5TGBA 2E6PA 2NY6C 2KH2B 5HI3D 4ZQKA 2ZTBA 5A3IC 4JG0H 3KL3A 5JQ6H 2GUOA 1UCTA 2J8UF 5FYLL 3D2TA 2GY5A 1NFIB 1RZFL 1G0DA 4D0DB 4Z5RB 3BGFC 3L08A 1T22A 3W2DH 5JDSA 3BAWA 3FCUB 4G6JH 4YFLI 4WCYH 3ULVF 3UJJH 1G43A 4IIQC 1DBKL 1IEBA 3FFCD 5IMKA 3RTQC 2A0LD 2NT1A 1J8SA 5E2VL 4F15C 2PW2A 2GJ6E 2GYSA 4FE9A 1FC2D 1B2WL 3BP7B 2UV3A 1MQKL 4M6NL 2X4RA 3K5SA 4U3HA 3DV4B 1MAJA 4CVXB 4NOFA 3W9DA 4PRNB 4QHNB 3MJ9H 2CBQA 3ARGB 4OGQC 1CZ8H 4WO4D 2XVGA 5KTEL 5IVNA 4LEEA 2VZ3A 1RHHB 1A65A 4RNRB 3FRPG 3JVFC 5KANG 5J11C 3QAQA 3BYTA 2XXCB 1AJ7L 1CDHA 2P80D 4NO3B 2DLFL 2H1LM 2ZKYA 3FZUD 2OBGA 4X8JA 1FYTE 5F1KC 5DLMH 2VZUA 2YC1A 4KTYA 2OL3H 2EE3A 4G72B 4D0BB 1NGZB 3FDWA 1OTTC 1C08B 3FTZA 3DGGB 3P2TA 4FFZL 4ONFL 4LOFA 3GJFA 1J05A 4F57L 1YUHB 2ODIA 4KQ3L 1UWGH 5C08A 5E2UH 5I6NA 3VSTA 4XBGA 1V7MH 2ZJSH 3UBXI 3VQMA 2IGTA 4WTZG 1ZSHA 2X6CA 3MLWL 1OSEA 3FT0A 3TBWA 3G6AA 2BM3A 4MJIB 5FFGA 5DZ9A 4C56E 4UT9L 2HA1A 3KYAA 1T03L 3GSRA 2NUPA 4HWZB 4NWUL 2X87A 4Q14A 3ZPDA 1P7QB 3FQ2A 4J4PC 5HGBB 1J8HB 4XO4A 3RYMA 3ZE2B 3COOA 3HFML 3H7LA 4N0FA 2W0KA 4PGCA 4TOYL 2X05A 3VI3B 2PPFA 4Z77A 4Q4EA 4U1HB 5EZPA 5GQBA 4O02A 5DHMC 4B27A 2IWFA 1FE8L 4LNVA 3HRPA 3RDTD 3H0TB 1OQOA 4RGMB 4DKFL 3R8BB 3DXAD 5L0QB 1LTXA 4OF7A 3K4DA 3NCCB 4OFIA 3VDCA 3QA3A 2V5SA 3LZRA 5CJBA 1BZOA 3EO0A 3WELA 4UQ2B 2YUXA 5E8PB 3RB7A 1NQBA 1QSZA 4PREB 1RIUH 4F7EB 1P9MA 1BAGA 3FT3A 3AXIA 4L4TA 3WIHL 4E68A 5CZRA 5JW4M 5M94B 2PCFB 4I13B 3PFUA 4JN2A 3QS3A 1QTPA 3IDYC 5E1HB 4L4VB 2BZDA 5EC1B 5HHOD 3U7YL 3V0GA 1G7JA 2KZ1B 2CO3A 3SY0B 1YSOA 3ARXA 4D9LL 1IC7H 3EG9A 5IB4A 1KGYE 1RSYA 1UJTA 1OAXL 2N1TE 5T3ZL 3UJTL 3NTCH 2IQAA 2QL1A 4I1NB 4E42B 5A1AA 3SD5A 2YJLA 1TFPA 2IDQA 5BZZA 4E41E 3V95A 4ZZKA 1YMMD 2GJJA 4XODA 3PAZA 3JWNC 4A2DA 2JXMA 3C60C 5D1ZA 3UCQA 1T0NA 1TDQA 2OSXA 4UANA 4O5LH 3BIBX 1AGDB 3HG0A 3CZFA 5TE4L 3ARRA 3L5WB 2R4SL 2NYZA 4N26A 5EC2A 3UROR 1L0XA 1S3RA 4FEIA 4APQD 4F2MB 4DO6A 3F83A 3HLKA 3INUH 3QPQC 1QAWA 2ZP0T 4L3EE 1BYOA 4JW3A 5DS1A 5TTRA 3S88H 1Z7JA 4JO4L 2CZNA 4S0TD 2XY2A 1BM3H 3LEXA 4YHLL 5EF2A 4U1SB 2ZCZA 1HNFA 5D7EA 1IZKA 1V5JA 1N8OE 3CK0H 3ZHLA 4TL4A 1NANH 2PYFB 3T0ED 3FC8A 4LCWD 2C9AA 4Q0XL 2HX9A 4QGTA 2AEPL 3RGVB 2BP0B 2W07A 4JRXD 4KNUA 4N4YB 2P24B 3MLUH 4JY6B 5EO0B 3THMH 1RP9A 2NW2A 1EZVY 2ZUSA 3HG2A 4YSQA 1XEUA 2P48B 1WE5A 3KPMA 4TNVF 1J9RA 1FHGA 2D73A 4OD3L 4HMCA 5A2FA 1I85A 1FGNH 2VC2L 1XIWB 4BA8A 2OMYA 3FULA 5I5JA 3VXRD 1FIGH 4UM8B 1TQSA 4N86A 5KW9L 1WC7A 4HUUA 3Q43A 3NSDA 4QRAA 3KLLA 2CRZA 3VJ6B 4JE4B 1ASQA 4MAYA 4KZEL 5F89B 3UP6A 4MJ2A 7TAAA 3H7BA 2W1NA 4EZJA 4X80H 1F4XL 1GYWA 2RGSA 4QYOA 1J0HA 1LYQA 2G3NA 3S6CA 4HKZB 5DRNA 3L7EA 2EKJA 3MAWA 1SXAA 2JTYA 1VFOA 1EAOA 1F3DH 2H45A 1JNNH 1F1GA 1UCBH 4IOFC 4JDZA 3ZL1A 2HKAA 3S4SA 3M17A 1YO4A 5LCVA 4WEUD 1D6EA 1QOKA 2VKWA 2DEYX 3VO0A 3BO8A 4NM8L 5C3IA 4HIEA 4UDUB 1RV6X 2GITB 3O6FA 4J3BA 4YUEL 3SJVA 3WE6A 4IM8A 3CDZB 4KK6C 4P5TC 3RDJA 5HGAA 3LSOB 3T2PA 1NIEA 1QQDB 1MWAA 1YQVH 3BDBA 1F11B 1S7QA 2EDRA 4WJG3 4HKJA 4K23H 5C0BE 3R18A 4U2YA 2GHWB 3I6KA 1PZBA 1JF1A 3OMNB 1YAIA 1JPGB 5AYUL 3RURA 3NZSA 5F7YC 3ZUNC 3DTDA 2DQDH 3H85A 4M7ZB 5DYFA 5I19H 3N40F 1EK3A 4BINA 2WP3O 1UXSA 2UZXB 2ZWYA 1KBWA 4ENEC 4YHYB 2K0RA 2CSPA 5JHLL 2NCEA 1MHPH 3KDPB 1DUZB 3V5KB 2DLHA 1J0YA 1M7IB 4ZT1A 1JTOA 1TMCB 4TKWA 4S1SL 1UG9A 5IWLC 2HLAB 1A6ZA 4IRSB 5I66A 1C16B 5EFIA 3OJMB 4DVRL 4HV8A 5C7XH 1R9FA 1BX2B 4OZFH 3VWKD 3RIFK 3RIAF 1X5HA 3NJKA 4UDTA 4WI9A 1P5VA 3QO0A 4NENB 5C6TH 3WKPA 1MFDH 4NHCL 1DJYA 4NYLB 4Y2DD 1W0WB 2X1XR 3EBGA 1P7BA 4FQXB 2IAMB 2BRRH 4N0UA 1KIRA 3GDCA 1GMIA 1Q0XH 3ZT5A 3TZVC 2LR4A 1UATA 5SWSD 43CAA 2XETA 5AFAA 1FO0B 2ADGB 4XVJL 1F2QA 2ADJA 2VL4A 4NCC2 3VRIB 3U1QA 3Q2VA 4QXTB 4F5CE 1G9MH 5DZLA 2E8YA 1PQZB 3L9YA 4GBXA 5DQ9A 4XNMB 5C0CB 4WVRA 5IJBC 1VGKB 4S2SB 1IMHC 4LSUH 4WF7A 3VVWA 1A1NA 2BNUA 5ESVA 1MFCL 2JLPA 2FHCA 4HFUL 1ZLUH 2X38A 3ARBD 4LLYA 5E4AA 1BVKA 1RJCA 4FQIH 1T20A 4XP5L 1OGAE 2XUWA 2OMZA 3EJYC 4LKXB 3D39A 3UAFA 4JM2A 3U0PA 2CCLA 3ZTNH 2NZIA 1YEEL 2LOEA 5EOCH 2UWEE 4D9QE 5F1NA 2YO3A 2CGYA 2W91A 5C9JB 1AZVA 3V4PB 1LO5B 3WFDL 3DHMA 4HHAB 4LU5L 5KJ4A 3CN2A 2EE2A 1HQRB 2NXYB 4KOBA 2EUVA 3FMGL 2H3NA 4KHXH 2AXWA 3TBTB 5F7WC 4M29A 2EVIA 4FG0A 3J8F7 3R4DA 3MX0B 4NQTA 4OW6A 5AENA 3MRJB 1E27B 1USQA 4K5MA 3MZTA 5DJXB 3VFMB 4Y4KA 2O61B 4G3YH 4XMZA 1T5WB 2VDKH 2HVBA 2VWEC 4GH7B 3D18B 1G7PB 5FFOA 1TU2A 4MA1C 4Y4HC 3SDXA 1AYRA 1ADQL 4P2QB 1B0RA 5EU6B 4OI7A 3OWRA 1UWXH 3WY4A 1JP5A 4Y19E 5EU4B 4JG5A 5IVXE 4AQ1C 3QAZB 4JY5H 4JGUA 1HEZB 2A6KB 2WXPA 5D7SH 3STLA 1R0AH 5E8EB 4JQVC 1UB5A 5DVPA 3P0VL 3GSOA 3EDKA 1OD9A 4PLJC 4YHPA 3MRFA 1H6EA 3QIWA 4P2AA 4NKMB 2W65B 4HJUA 4U3SA 4LZKA 3BX7C 1KBKA 4ZUVB 2DM2A 3FU0A 3GMMB 3JYCA 1OTSD 2CUMA 3S34L 1CIDA 1ZD6A 2D03H 3RUGE 4B9JA 3MV8B 3WD5H 1DP0A 3KJ4B 4LDEB 3K6OA 5E00A 3OZKA 5F96L 2VXQA 3PE9A 4JG1L 1EDHA 1ND0B 2ZUQC 4FL4C 2EDOA 2YXFA 4GRMB 3RKPA 1S3KL 3BZ4B 3LRMA 4ALAH 4K3JL 1AP2B 3HW7A 2KBGA 2ED6A 4KKBD 3H4FA 1HH6A 3SKMB 1YEIL 2R2HA 1DJHA 3SPHA 2H9GA 3OKEA 3VWJD 5I1EL 5BRZE 4L1DA 1MZYA 5EUOB 4OT1L 4M8QB 3RVVD 3QI9D 1BXVA 1WDAA 3VGAC 4R3SB 3X3GL 3CC5A 1NFDA 4MYWB 1TTAA 4QF1A 3BWUF 2JKXA 4WFGE 1VKXB 1W16A 3EGDA 3F58L 3P54A 3Q7JA 5TH2A 3S97C 3FPYA 2R0WH 4MMZB 3G6JE 4QIRA 4LHUB 2NY2D 4H1LA 5JHDA 4ISVA 5DK0B 3VXPA 4P2OC 4GMTH 2D7PA 3UTTB 4PGJA 2MNWA 5EBMB 4LSQL 2V2WB 1R19A 2X9WA 5EB9A 3K6SB 3HC0A 3AVEA 4NN5C 2WZPA 5I73B 4MS6A 4R7NB 4WWKB 4HUNB 4NQXA 4HIJA 1XCWA 3KWWB 3LH2H 4PJHB 1CBVL 4TNVK 4LARL 3QUXC 3EBIA 2VH5L 4HCGA 5ANMB 5C0BD 4A1RA 1OO2A 1JZHA 4YSSA 2R2BA 3FQNA 4CU6A 2TRHA 5MENA 4HP5A 2YMOA 1QX1A 1N0LA 1LMIA 3SGJA 2VLRA 4UIKL 1VZGA 2BVQA 2K4AA 1DANU 1MAMH 4XBPB 5TDNB 3TTYA 5INCA 3CPLA 1D7CA 3U46B 3MYJB 3CFBB 1OIOA 4HETA 2IPTH 1WITA 1QFWH 3MO1B 4I1RA 1G7QB 2I26N 3W82A 2HMID 1SJEA 2FWLB 3MNWB 3EO9L 3I75B 1X5IA 1RZGA 1L6ZA 1OW0C 2ZOKA 2YBGA 2P8LB 2J8UE 2FO4B 1RXLA 1OK0A 2WOYA 3L95A 5BRQA 1U3HA 1WWCA 2WVUA 1MW0A 3IDJA 3PGCB 4LRNH 4UOW0 3GIVB 4P9MH 4F33A 3ULVE 3AB0C 1R5WB 4XMUA 4FNLL 1IEAB 5GRVL 5T5FL 4ZFOA 1BJMA 1BMGA 4B7IA 3SGKA 3HBGA 5TPWL 2IDUA 4HF5H 1XB3A 3RIKA 3WO4C 1M6OA 3RTQD 2F54E 4IHOB 5C0AA 3E3QE 1M6UA 5EUKA 2MCPH 4KMLB 3DROA 3DARA 4FS0A 3EBHA 1A1MA 3CG8A 3L48A 2KUTA 1L7IL 3FHEA 5DJAA 4P23A 5ENWB 3FL7A 4I9XA 4DVBB 5IW6A 1VACA 3TIDB 5MERA 1DBML 4RGOH 4GXFA 1Y1UA 3MVSA 4KK9C 4DTGL 5FDWA 2VLMD 3M86A 3BC9A 1T1XA 3F12A 4JHZA 2I25N 3SPGA 3WN5C 3CFEB 4M7LL 3WHE0 2H0EA 2QHRL 4YBQC 1A6AA 2QVFB 3NFPA 1B4LA 1LDPH 2ZCLH 4HSQA 3ABMB 4JUSA 2Z4QB 2NY5L 3HBQA 3QUYC 4ES9A 1PDKA 4HJGB 4NT6A 2R7EB 2W92A 3QO1A 3AU1B 1NCBL 3HG1E 3HR5A 3RIAK 4XXWC 4XCCH 4HS6A 3T2LA 5HYIA 4HT1H 1VADA 1QW8A 5I1GL 3GJFK 1JCVA 4KJYA 4L8SA 2KZKA 3DV6B 5AKRA 4PGDB 1I7UB 1C5BH 3NABL 2V9RA 3MRPA 4XBMA 5JIQA 1LO4H 1A4CA 3QC6X 2YR3A 2VDQL 2CRMA 5EWIL 3M6DA 5LXGH 1AXTL 2HLFD 4HUCA 4N20A 1GMEA 2GJZB 4QTHB 3P4MA 3U4EA 4DUVA 2Y07L 1MCQA 4UM9D 5C09A 4Y16B 3DNKA 4JM2F 1OSYA 4F9PC 1H6TA 1UT9A 4QHKJ 3Q0HA 4Y19D 2XQYG 4BZ2L 4OCLC 2W0FA 3UPAA 1ZLDA 3Q8CA 4LPXA 3MV01 3V0FA 2ZF8A 3ARZA 5E1QA 5JR1L 3UG4A 3K6IA 2NY5C 5CZVL 5F3BB 3IE4A 4KX9A 1U8PA 4LSVH 3GB7B 3PWVA 3DURB 3PG2A 4R0LC 4R4FL 5AW2B 2BXYA 5AAWC 1XF2B 1R5VB 1HCVA 4GW4B 2I85A 1F45A 5DJDA 1TTBA 1T7ZA 4JVWA 5MEPB 1KWKA 2A83A 2PABA 4YX2H 3TEYA 1SXCA 4JPVH 3ZTDC 4ZS7L 1BD2D 4AGQA 5CBAA 4N2IA 3FQRA 2AEWA 3MROA 1N10A 3SDYL 5J8OA 2ZSVB 1O9WA 3GSXA 3HUJA 3SDXF 1SXSA 3ML9A 3GRGA 3VH8B 4H8PA 5JIMA 4JFPA 4KKNA 2JLLA 3OKOA 3IVKB 4W4OA 4W6YB 3HE7D 4GUPB 1JNHA 2C7UA 3K91A 5ALBL 4YWGH 3T8VA 3GHBH 3ESVF 2YQ3A 3L3IB 4HC1H 4WFGD 2UUDH 4OIIL 3LRGA 4FXGC 4WI5A 1EO8L 2FNBA 4F92B 4WEBH 4W6XB 1TIUA 2EUZA 4DHLA 1Z5YD 4YK4B 3FFOA 3NFSH 3ULSB 5L7XL 4HUVB 1V3MA 4QRQA 3QWRA 2MOQA 5DEZA 1FVEA 1YNLL 5D1QE 2XWZA 1BZ9B 2BZ7A 3DOSB 4RDQF 3TNNB 2IWEA 3X3FH 4QUOA 2B7DT 5MEQB 4RH4A 5DVOA 1PY0A 4BWUA 1FVDB 1JPTH 5C6PB 4ZX6A 4MQ7A 1PTZA 3GSWA 1AKJB 1HHIA 1EBPA 1JK8A 4JFUA 5CN1A 3GJEB 2PPAA 3IMSA 4PQXA 1GGBH 4PI2A 3NZHH 5F3HA 3LH9A 1THAA 1NFDF 2O5XL 5AWNL 1A02N 4A7UA 1CICD 2ZOOA 3EUUA 1BVZA 4YO0A 4HFWB 1DFXA 2WW8A 5SWZD 32C2A 3VFRB 1NC2D 4PS4L 2D2OA 2YN3A 5TJWK 4QXGH 1BFSA 4QRRB 3LHPL 1NLBL 2AZAA 5BS0B 3WDJA 3QQ4A 3PCYA 4BGLA 2ZKHH 4X99A 4OY9A 5C0RL 5CN3A 2MNJB 1A9BA 1CF8L 4YDZA 1UENA 4JPKH 4DGIH 3BZFB 2ZX7A 3BSGA 3FXIC 3KG5A 1RUML 5CILL 3O4LB 3M46A 1BG1A 4X6BA 2ZYRA 3WFBL 3N85H 4FQHA 5MEOB 4YC2B 1AACA 1L4IA 3PAYA 2F54D 4OLVL 1OE2A 2DTMH 2Y06H 2P45B 2FX7L 4RIRB 4NERA 3I9PA 4K07A 5BW7C 3T1WA 1DYZA 1FFTB 2C3HA 3U2SB 1P4IL 2UXTA 3GMQA 3WMPA 4N2CA 4GAYB 3WJJA 3BH8B 4DK5A 1ZTXH 4LSTH 2XA8H 4UIMA 4L2LA 2NUTA 4DZBB 1XAKA 2IGFL 2YZ1A 5AYQA 5FO8B 1I4FA 5D70H 3Q6FA 4FLSA 5H35B 5KYXA 1JK9A 3QIBB 3U6RB 1A4JB 4HZ1A 1OM3H 5FM8A 5T1MA 4KK6D 1ZGLB 3MJ6A 5I0DA 4BFJA 3PABA 2K45A 1G7MA 2W0PA 5CEYA 4GS7C 3GS4A 1FG9C 4HS8L 1YN6A 4ATWA 3FCTA 5GZOA 3UBXA 4DQOL 2CR6A 4NGHH 3FUMA 3DO4A 4K7PH 1UOWA 3HG1D 4RGND 4EI5B 3GGWB 3T6ZA 3UAJD 1N3NB 1M05A 5LQBH 1G9HA 1OSPL 4YDJA 4ENED 1JZ5A 2IDFA 2ERJC 2K8MA 1KN4L 3OLGA 3LZLA 3QZOA 5AAMA 1Y6MR 2D9CA 1J9CT 3N91A 3L54A 5FGCB 4HPYL 5EO9A 1SBBA 3SE3C 4YLBA 3E1ZA 4I5BB 3D1MC 3SE4A 1SFHA 3PP4L 3K2IA 4E5XB 5CSBA 5IHZA 1MFAL 2AF2A 5C2BH 5L6YL 4PBXA 2R2EB 2F74A 5C2UB 1J7VR 3CQFA 2BINA 4L1SA 4PRBB 1OM9A 5TF0A 4L18A 4ZFFA 5AOMA 3QCUL 1PU0A 3OJDA 2PYEB 3AG1B 5C08E 1WFJA 1CDBA 1PLGH 4OUUB 1HCZA 1KZYA 4JFSA 5GS1A 2PXYC 3BWSA 5E9DB 4JHUA 4I87A 2WLLA 4KUZL 5KSVB 5TE7H 5JPMC 5EBLA 3PS6A 3D5OF 4A2EA 5DTFB 1RJYB 3BD3A 5IUCA 3KYNA 1CL7L 3BUPA 3CVHL 1MREL 1LEIB 1AGFA 1VFMA 4YXKL 2H5UA 1XR8B 4AK2A 4QTIH 4I0PA 1NGXA 1F97A 4Y0GA 2WINA 3D8MA 3N44B 4PIBA 5FGSA 2ZQKA 2EYTB 3BOVA 3KH4A 3BQUC 4G1EA 4CSZA 1E9OB 3WKMH 3KYMB 1YEJL 5ADPL 3P2DA 3EJYD 4K5LA 3NSJA 3LVEA 4N8UA 4MCYA 4YEFA 2WM0A 1AOZA 3T04D 2Y5EA 3MYZA 3RILA 4J3XA 4WI3A 5C0JA 2WMPB 1OP4A 4Z78A 4PYGA 4G43B 3OGCA 4XCYA 5K1VA 2JQAA 4BFEA 1SEQL 4PJXA 4OLWH 3V7MA 4MJ5B 2D0GA 4P04A 1ACYL 3MGOA 3QE5A 2A4EA 2OQJA 3UCRA 1QZNA 1K8DB 4MLSA 4E9XA 3NIDB 5E8NB 3OZ9H 4I48B 3OJVC 3UEQA 1VCAA 4WTWA 3TBCA 1QPXA 1F90L 4HBQA 2HCZX 2VR3A 5AZEH 3RZCB 3QYMA 4OFKA 4XO3A 2RTTA 2ZX9A 3RVXD 1IL1B 3AREB 2GIYA 4TTGA 4PBDA 3WFHB 1O6SA 5B39B 3V4VA 4IMKC 5D6DC 5A2AA 4LSPH 4AV5A 1ZE3C 4Y5XA 4M7JH 2NY7H 5L4MA 3QYNA 4TLKA 2Q2EB 3UBHA 2L7QA 2MSPA 4MBRA 3UDWC 1GGYA 2O6PA 4WY7L 3LH8A 8PAZA 5KSBB 3VW3H 3UTSE 3FH8A 2FWOA 3TBVA 1MPAH 4TVUA 1BWWA 3NEOA 4XMKH 3BUIA 1JFQH 4KKAC 1OPGL 4ZXBD 3RRQA 2R1XA 2RCSL 4G7YL 1REIA 2H8PA 4TPRH 3JUYA 1IAKB 3KGTA 5TF1H 3OAYH 2NY3D 3L5HA 3QHZH 4NQSA 4XAWH 5D72L 3BE1L 2DQ6A 3NUKA 4FLRA 4XMWA 1U8MA 3KD4A 1TFHA 1ETJA 1UC6A 2BOBB 4BZYA 2RH0A 1T5KA 1AHKA 2H32B 1XEDA 3MUJA 4HGWA 4FA7B 2L3BA 4X7EC 3QULA 4FFZA 1YY8B 4G1MB 4LLDA 4XCEB 1BXAA 5E8OB 1QBML 3L8QA 2YD3A 4Q6IA 2YBRA 3H2PA 1HCYA 1NKOA 2NW3A 1QA9A 5D1XA 4ZTOL 5EMYA 4PIRF 5JOFB 1IGTA 2EEBA 2VDPH 4MZIA 9CGTA 4PJEB 2UY6B 5F71A 1TNMA 5A2IH 4XP9H 5A2CA 3QWOA 4P5MA 5B7EA 3ROLA 3G5YA 3HB3B 4UT9A 4R96B 4HIIA 5DHEA 4PWKA 3FQTA 5LBSH 3AMLA 2LABA 3TF7C 2Q20A 5FLVA 1ZA3B 4XNZB 1AQDA 1PX3A 1B9KA 5K93A 3BVTA 4RGMC 4UBDD 5IEHA 2AERT 4JRYD 1AGBA 2YAHA 5L0QC 3SCMA 2DV6A 4XC1L 1JZ6A 4K94C 1MNUL 4HZLB 1GYVA 2OK0H 2WQVA 1GC1L 1QD0A 2F8VA 2FE0A 2VUKA 3MTXA 5F7MC 3QUXD 3LN5A 1XDTT 1BQHG 4LOEA 4M1CC 3H42H 5C9KA 3V9CA 3B9KC 4KVNL 1GVIA 4OLXH 3BD5A 1HINH 2BSED 1E8XA 3MBEB 5TQ2H 2B4CC 5I17A 2WTOA 4Z0XB 5E9NA 4FA6A 4FJYA 4R4BB 1ZHNA 4IS6B 3SPCA 5DFTA 1VRSA 3SJVE 4EDWL 5JOEA 4QCIA 3QXUA 5HHPA 3VTAA 5LUMA 4LRIC 4ZAKB 1C1EL 4OFYA 1HXYB 1UZ6F 5FW6A 3TVMB 5JHBA 4MD4A 2QGDA 1GY1A 3P3RA 1EPFA 3HBZA 3DWTA 4LASL 4IKJA 5EEWA 5GGSY 1TVBA 1XCQB 3JUZA 4JO2H 4BFIA 4XVSL 4AIXA 4MNGA 2FEDD 4GW1A 1ZVYA 4M8VA 1RFDL 4MCNA 1I3GH 5SX5K 3IFNH 5HJ3B 1GC1C 1J1OL 4U0QB 4HBCL 1CXIA 4Z7OF 3NA9L 4GO8A 2Z0UA 2BSTB 2UZYB 3KMDA 4FXTA 3UADA 4FG2A 1NM9A 4RFNC 5J1AA 5F9AC 3IGFA 1N5AA 4G9FB 1TQVA 3IRCA 5AZ2L 4YVNA 1XBDA 5ACMA 4IBTA 4XPFL 3TPUB 3E1F1 3C6SA 1YPZA 3MLSL 3RGVC 3KNBB 5KSAB 3TEUA 4Y8AA 2XIIA 2DQIH 2RJMA 2V6HA 2QQLH 3HMXA 3QJZA 1KJ2A 2DQHH 4LCYA 4NI3A 3P77A 2MEJB 3PPSA 5IHUL 4LHQB 2OSLA 2WXNA 3NMEA 4H8WL 1QSEB 4YBQD 1RZIB 1CURA 1YUKB 2BVEA 4N0UE 3GXIA 3WE1A 4G5ZH 3VXME 1U92B 4OFVA 4NAQA 2BMKA 2AEQL 2FGZA 4WV1A 2OX5A 5FYKU 2XICA 2DN7A 1XIWC 1MFEL 3D69A 2ICWB 4FP8H 4JKKA 2GAZB 1E5CA 4M9OA 1EH9A 4PVBA 3GMNA 1PF3A 2AI0H 4L4TD 2UYLB 3MNDA 5E7FA 3OHXB 3N04A 1OLLA 2AJXH 3FB6A 3X1EA 1NICA 1KC5H 4QOKA 4ZUTB 4M3HA 4ETQA 3L1GA 4JQIL 1S9YA 2VN7A 4JPIA 1UWEL 1IQDB 4HIHA 5DZJA 4NRZB 3ZE1B 4LCCA 3D12B 3ULUL 1J5HA 2R4RH 1UXWA 3F62A 2ZSWB 2WQUA 2ISDA 5KG9A 3QCVL 3D39E 4Z3TA 2P28B 4YSPA 3R8QA 4FYQA 1GIGL 3QNYA 2XG4B 3BLKA 1G6RB 2JMRA 5F7FA 2G3ZA 4NQEB 4P2RA 2P7TA 1DQLL 1RK0B 1E50A 4LVNC 5B8CA 1TTUA 4KNTA 1Z9PA 3BWAA 3QRGL 5FO7A 4FQ2L 4H8WC 2WCPA 3GF8A 5LAXA 4HZAA 2IFGA 3KXFB 2CGRH 2XTSA 3VMPA 4MBOA 1BCIA 3MREB 1N64L 3V6FB 2I60H 5LGJB 5A2BA 4TLSA 3JTBA 5GJTH 4HU2A 1FO0L 3DO7B 4JX0A 2LFEA 3UO1H 3KAAA 1U8JA 1H0DB 1RQ5A 4QAMB 3SDXE 1OT1A 1D5RA 4Z7IA 4M62L 5JIKA 3FB5B 1I1FA 4ZX5A 5HI4C 4Z76A 1DN0A 1IC5H 4UUJB 5GZNC 4AIZB 5D4HA 2EJ1A 2YEQA 3QQDB 4YHYC 3DGDA 3KLAB 2N7BA 4GKNB 4HUWA 1KCLA 3ULUC 2CDFB 4RZCA 4AYEC 1BIHA 4S1DD 4IRSC 4LHJB 4WI7A 1XMEB 3CZGA 4OIBA 4F8QA 2IPKA 3G08B 3HS0B 4HCFA 5JHLA 2VYRE 4IOSA 5HHMB 5K39A 1NGPL 3LKRA 4WKZA 3WLBA 5D7KE 5EU5A 2LVCA 4IKIA 4P4KD 4HAFA 4Z7VA 5GPRA 4BHUI 4GXUN 1HHJB 1SBSH 4J6RL 3T6XA 2O6FA 3S35H 4YIQA 3KPSB 4X5WB 5L8LB 3FU7B 1YMHA 3MRQB 4J3VA 5CGYC 2AZUA 4R97B 4HPHA 3IJYB 1KFAL 3HRZC 4KC3B 3ZXAC 4QJ3B 3SDDB 3VX0A 3VM5A 3ILEA 5EZLB 1IGCL 3C5SA 4RMSA 3VD4A 3B56A 2GFBA 1LO3H 4BH7B 3PJSA 2K70A 2WO3B 1VERA 1X5KA 5JORA 3E8UH 1YEKH 2I5YH 4J2QA 1NFDE 2O5ZH 2DBLL 2QZ5A 2BRQA 4Z7UA 3NZUA 3ZKMC 1IRAY 1BVLA 3DYPA 3GRWL 1OAUH 1PY9A 3MNMA 3PDGA 3T4AC 2X4SA 5JHDE 3VGEA 2OL3B 4LB8A 4TVSa 1PKQA 1DVFA 2M1KA 2P3YA 3EO1B 1T89C 3H3PL 3H3KA 3I02A 3O6FD 5DMIL 1U8CA 3FO1B 4TQEL 2VLJB 1WGOA 2BO0A 1J5IA 2PWDA 3FQ4A 4AQ1A 1KPRA 5IB1A 1RZPA 4LLQA 1IGYA 3WEOA 2VSMB 3FQWA 1GZPA 3O8XB 4JN1L 1G0XA 2IANA 4NFBA 3Q8FA 5DJ6A 2NXYC 1Q1JL 3VXUB 2P8PB 5MENE 3LS4H 2DD8H 2VLRE 3D07A 3LN4A 4O4YL 3N43B 2P5EB 1Z9OA 4WTQA 3L6FA 5CINH 3WUWB 5JXEA 1R4XA 2W9DH 4G5AA 3ESUF 1UD6A 2NX5D 3VUAA 1KB5B 1WCQA 4ZYKA 4XNDA 4ODWB 1HN1A 5JYLA 4DCQA 2OCCB 2NY1C 5FHBH 3KHQA 1IAIH 3CJJA 3D4ZA 3KR3H 2G9HB 3H6JA 3GKWL 3MRGB 4J7RA 3QAZC 2ICEB 3JQOB 5EBWA 3CIQA 3P3UA 5IVZB 1E67A 3V5HA 1NINA 1MRDH 2AK4D 1SF3A 4ZX4A 3OXSA 4OCXH 2AVFA 1UACL 4P05A 4J8QA 5DK2B 3S96A 5EOQH 3PV6A 4G70B 5C0AE 4QRSB 3GK8H 3QSKB 3P1VA 4WFFD 2ZUVA 4WSJA 4UV7L 4P2OA 2YPVA 1V27A 5JTWA 1I8MB 2VDOH 3KJ4C 4OD2B 5F7EL 3GLDA 4JDEA 1KXVA 5DYOA 5L2JB 1MEXH 2WKGA 3MRKA 1VFBB 1AD9B 2X4NB 1H5BB 3SO3C 3QUMA 4ZMQA 5E2VH 2EE0A 4GBXD 5CIPB 2X2JA 3VB9A 1DCEA 2GT9B 4PJAB 3WN6A 1NDGA 3C2AL 1CO1A 5IFAL 4L3FA 3KPRA 4GIOA 5DS8B 5DUMH 1YPZF 2G2PA 3D85D 5H4ZA 4FFVC 1K2DA 4GAGL 4U7MA 3QCTL 1XVSA 1TXKA 4Z95H 3VFUB 4R7LA 3AQZA 5A40E 3KPLB 3I9GL 4YL9A 3S8GB 2HRPL 1MJJA 4JM2D 2X6VA 3DMMA 2OSWA 2LTQB 5DUBB 1GJWA 2VCOA 3CNKA 2WZAA 1N70A 1PL3A