1TYJA

Crystal structure analysis of type ii cohesin a11 from bacteroides cellulosolvens
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
170
structure length
170
Chain Sequence
GSVLTAIDNDKVAVGDKVTLTINVDKITNFSGYQFNIKYNTTYLQPWDTIADEAYTDSTMPDYGTLLQGRFNATDMSKHNLSQGVLNFGRLYMNLSAYRASGKPESTGAVAKVTFKVIKEIPAEGIKLATFENGSSMNNAVDGTMLFDWDGNMYSSSAYKVVQPGLIYPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellulosomal scaffoldin
publication title Crystal structure of a type-II cohesin module from the Bacteroides cellulosolvens cellulosome reveals novel and distinctive secondary structural elements
pubmed doi rcsb
source organism Bacteroides cellulosolvens
molecule tags Structural protein
total genus 39
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2004-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1tyjA00
3FNKA 3UL4A 5AOZA 3BWZA 2OZNA 1ZV9A 1ANUA 5K39A 3GHPA 1TYJA 3L8QA 4UYPA 2JH2A 4U3SA 1QZNA 5G5DA 2Y3NA 2BM3A 2W1NA 4UYQA 4WI0A 1OHZA 3KCPB 2CCLA 4FL4B 3KCPA 4IU2A 4UMSA 4WKZB 4FL4C 1AOHA 5LXVA 2ZF9A 4N2OA 3F2LA 4IU3A 1G1KA 2B59A 2XDHA 2VO8A 4DH2A 2VN5A 2O4EA 2VN6A
chains in the Genus database with same CATH superfamily
3ABKB 1NEPA 3EJZD 1MCJA 5D72L 4EZJA 3B3IB 5ELIA 1FF5A 4RMQA 3FU6A 2XOTA 2JH2A 4TNWK 1E50A 1VCBC 1MHCB 3TV3H 3TBTB 1BFVL 2Y3NA 4HS8L 4NNPH 1A21A 4R9HA 4L1SA 2WSPA 5DQ9B 5HHMD 3HMXH 4RETB 4TKWA 2ATPB 4YFDB 4C58B 5F6IC 1HHJB 2IADA 3VXSA 1R75A 2VDMB 3VXUA 4QKXB 3HW7A 4NHUB 3NP4A 5SWSB 3A0OA 3OAYH 3P30H 1GCFA 5ECJE 5B1JA 1A7PL 4X83A 2V2WB 1T6BX 3A21A 1GS7A 4UDUB 1RZ8A 4KDWA 4M1CD 4UNUA 4I1RA 1NUGA 2FWSA 3CX2A 3JT0A 3KHOA 4Z95L 1IAKB 1DJZA 3Q8BA 4GRWE 1IE4A 3FFDB 3IK2A 4Z7VF 4LBEB 2YN5A 4PJXB 3TYFB 4F27A 5EBLA 1RPKA 1X4YA 2EDXA 1M9SA 3TA3B 4YBLB 2OMBA 4PB0L 4HU2A 1UEMA 4X7FC 4GW1B 1EBPA 1RPUA 4PGZA 2DMHA 4KH2A 4P4KD 3UTZB 2OTWB 5C70A 4FQHA 3D39E 3EXJA 5F7LB 2L3BA 1KJMA 3U9WA 1NC4A 4YHZL 2LVCA 2N7BA 1PY4A 1MVYA 1KIQB 2IAMD 4QRRA 1IM9A 5C0NC 2CDGB 3KW7A 3BP5A 1HEHC 5IROC 4QTIH 2GY7B 4NKDA 3H6JA 1NANI 4P06A 3GK8L 1JTOA 3ARFB 1RZFL 4TVUA 2XWTB 1EZUA 2BVQA 3BX7C 5IEKB 3CFJA 3DSFH 4OJEH 5GGUB 5IBLC 4JHVA 1MIML 2ENYA 2H45A 5IF0A 1HL9A 1OP3K 1YEJH 4R83A 1ZGLB 3QIUA 2IH1A 3DV4B 1JS4A 4KUZH 1XHHA 3KPRB 1H3UA 3B9VA 1CCZA 1ZSHA 4OUOA 1KIUA 4M8RA 1QLEH 4V1DD 2WYTA 5ADOH 1FFOA 1F0LA 4L18A 1IL1B 2P28B 3CH1B 3V5DB 3DURA 4PBDA 5IFHL 1WS7A 4AGPA 5CD5C 1J5CA 2WUCH 4WTZG 3EGXA 4G70B 1I7UB 3VXQA 4QHKI 4WCYH 4OV5A 1X9UA 2CHZA 5AVWB 5BRZD 3VU2A 2BCKB 3IMVA 4H8WH 3MODL 4XOEA 2QTVA 3CVCA 3IMSA 3M8OH 4OGAD 5IT2H 5DS8B 1ZGLM 1FNEB 1MJJB 1QNZL 2Z93B 3FTYA 4LGPB 5C9KA 1LE5B 3LJ3A 5K9OA 4NRZA 5EU7E 1MG2C 1IC4L 4KRNA 2QDVA 4GG6F 2DM2A 1C7SA 4JG5A 1EAOA 1WRFA 4HIIA 2DQUH 4PJIE 4JJ5B 5HI4D 3UAJA 1I1AC 4U31A 5DFVD 3GBNL 1B0WA 3LXCA 1NAKL 2QPDB 3SJVE 3MO1A 4ACPA 2HTKD 3FYEB 4X80L 1PDKA 5GQBA 1URZA 4HK0B 1O7VA 2Q6WB 2IGFL 5LB1A 4ETQB 1HSBA 1KBPA 3L45A 4A2FA 4FFWD 1OAYL 4F9LC 1LMKA 2FQDA 5C0EB 3DMMC 3T0DA 1I1YB 3BDBA 3EJYD 1PKQA 1I7RB 3KPNB 3ESOA 1K5NB 3A5VA 3UTQA 5KSAB 1Y18A 4M7KH 4IDJH 4P2QB 2FLMA 4JG0H 1I3GL 1H8SA 3VD3A 4R7VA 2HVJB 1SOQA 4KI1A 3QJVB 3C8KA 4OUUA 5E5MA 5FF6A 5MP6L 1MJ8H 3EJRA 3DX7B 1KOAA 1UH2A 2HN7A 3HRZB 3OR7A 4LCUB 2X9XA 3MUGA 1I53A 2PP9A 1KCKA 4ELME 2OMNA 2K3HA 1RJLB 4PJGB 1Z9PA 3ZVVA 5HDLA 4XO8A 2OSLB 3GMRA 1O9VA 3MFFA 2VM9A 1GY1A 3OAZK 4PGDB 4EBQH 3HI1B 3HS8A 2JJWA 5TDNA 1VIWA 2DW5A 1ACXA 3GFUA 3J07A 1BLIA 1DO6A 2J6WA 4K73A 1UXWB 4Y9FA 2Y1AA 5TQ2L 2FO4B 1EHLL 1CTNA 1Y6NR 4RGMC 3D3VE 3VFWA 2C9XA 1PZ2A 1SNRA 2B7DT 4FXGA 5KS9A 2P47B 3RY4A 4QO1B 4RISH 4F7PA 2OZNA 1F45A 1SHMA 4IKIA 1FIGL 2AXGB 5L0QC 3D4ZA 3P2BA 5L2JB 5HJGA 4BH7A 4H1LB 3FB8B 2PYFA 3ZE1F 5E6SB 5C6PB 2Y07L 4IBSA 5ILTL 3ARDA 4U0RC 3GBLA 2WANA 2EJ1A 3PFUA 1KB3A 5KSBF 3LKQA 3II2A 5MENE 1Z9SA 3OKEA 3G04A 4M48H 3D0VB 1NLBH 5EO1A 4X4XB 4QHUA 2LLGA 4QRPD 1TJIH 1BD2E 1ADQL 5FYLD 4OIBA 5DLMH 1EZVY 2VSDA 4JY5L 4HOWA 1OT1A 1YEWA 4ZYKA 2G60H 3CG8A 2BNQA 3CDYA 4OZHB 5L4JA 3UIYA 1X5GA 1PZ3A 4PV8B 2CO2A 3GBDA 1PZ5B 4FKEA 5JR1L 5EBLB 1CC3A 1ZA3B 2VE6A 1KB9K 1YSOA 1YECL 1WO2A 3U0PB 4CBZA 3SSGA 4XT1C 4MDJA 2DQCH 4P2OC 3VWKD 2QGEA 2VZSA 3LXUX 1VKXB 3VD2A 1OTTD 5JPMC 3UTPD 2RBLA 2BHZA 3H2WA 3MCG1 3NH7H 3AY2A 5FUZL 1I8LA 3NG5A 3PP3H 5I73C 5C3LD 4Y4FC 4PWKA 2PPCA 3LRSB 1UWGL 3O9WD 3ZTCC 4NPJA 2WIIA 4OJFL 5HHOE 4DOHB 3GS7A 1NEZG 4FHJA 3T6VA 2Z4QB 1OD7A 3C6LC 3HAEH 4DN4H 2P49B 5CFHA 3HBQA 4E9YA 3CFJB 2Q87A 2D7QA 1L0XA 4XPBH 2Y3AA 3PJLA 1FVEB 3GD1C 4MJ5B 3MI6A 2F61A 4J3OF 2BSTA 1QKZH 2K8MA 5FLUA 1DANU 4LGRB 2OMYA 4WDIB 4ZI8A 5EMYA 5DRWB 4BZ2L 4KX8A 2VXTH 1MXDA 1ZTXH 2XWXA 3MV01 1E4HA 5TE4L 3EO0A 1CLOL 4ODTH 3ZMRA 2AJYH 3O6FB 1Q0XL 1UGNA 2DQIL 1RCYA 2N59A 2PWEA 3WL9B 4F7TA 3NZUA 3L5WA 2C9AA 4WW1B 3ZRSA 2MWCA 3KXFD 3EGXB 5D2LE 1KCSH 3MREB 3RLSA 5B7EA 3STBA 4OV5B 4HH8A 2XVKA 3MNWA 1IEBB 1MFDL 3IEAA 3CFEA 3MCLH 5LXGL 2PCPB 4N0YL 3QDJD 4FQ2L 1AI1H 1UM6H 4MGXA 1ZHNA 3UJIH 1OM3H 2V5SA 4H40A 5TK4A 5L9DL 4IMKA 3X17A 4KNSA 5FGRA 5DCCA 3ZQWA 4EI5B 1MI5D 3MRDB 4OZGB 5IM7A 2MKLC 3N04A 1LJMA 5I1IH 3FBQA 1RZKL 4LRIA 2C7UA 5TF1L 2HFEA 1RP8A 3G5XB 1HH9A 4TTDD 4KU1A 5FOBA 1H9VA 1NKOA 3BVVA 4FC3E 5I1GL 2IQAB 4KPHL 2FIKA 4NQDA 1N64L 5CN3A 4L5FL 3IE9A 1A4AA 2YGPA 4YAQB 4GW4B 1J5DA 2X87A 1KJ3L 2VDPB 4J8QA 1WA2X 1HSBB 4N5ED 4G43A 3ZO9A 5E6ID 3FB5A 3K1KC 3OKOA 4YHOL 1Y18B 2GBAA 3AU1B 1A22B 3MJ8A 2R0LH 5DGRA 1NCTA 1OLZA 1WIOA 2F5BL 3CHPA 1MSPA 2FECI 4FA7B 1UUNA 4MMZA 4YHYB 1WLHA 4U4BA 2Q1EA 1RVFL 2O5YL 1I7TB 1ZK5A 2XTJC 2QKIB 5ICUA 5TE6L 1THAA 4OCWH 2VXQH 3DX4A 1CGTA 2J88H 1K4CB 2DLFH 3FQ2A 4NEHB 1HHIA 3MLVL 5E2WH 3RUGE 1CFVH 1FJ1A 5FHAH 4R97C 2NXZD 1Q9KB 3BDYH 2PYED 4H2AA 4XO9A 3CVHA 5FDYA 4HXBL 1DSFH 5DHDA 1XGUA 3CN4A 1BZQK 4LF3B 4PS4H 4OQTA 3NSXA 2K78A 1E65A 1AO7E 1ZHKA 5CUSH 3UJJH 1LEIB 2B1HH 4M7JL 1N6QL 4TQPA 4U2ZA 4A7TA 3HLAB 1KDJA 4M5YH 4JDEA 2WBJC 3TOPA 2QPEB 2CG9X 4L5FE 1KBBA 2DQHH 4GSQA 1YNTA 4ZPTA 3CHSA 5FGCB 4CC4A 4Z7UB 5LN8A 5E5RB 3G04B 5F0JB 4P2RA 2CCLA 2WYIA 1OOWA 1QTPA 2X4TA 4RCAA 5HDWA 4HUWB 3RGVB 1LEGB 3TO4D 1JK8A 4MMXB 5DUBA 3UTSE 1QVOA 3DKHA 4FQLL 4FI7A 3NQIA 1TXKA 3WY1A 1CD8A 4NKIL 4O58H 4TOYH 3DRQA 5BMFL 4KKZA 4AWJC 4WI8A 3DIDA 5K9KA 2MPAL 2Q7YA 3PGFH 5C0JA 3QXUA 2GSGA 1CICB 2LV4A 3GMMA 3UYRH 3DIFA 1QTSA 5B1AB 1DO5A 2L4OA 1UWXH 4HC1H 1U92A 3JVGC 3P2TA 1CR9H 4RAVB 4QRBA 2AXJA 1JDDA 4FHKA 3HNVH 4HT1H 1TEGA 1N7ML 3NCYP 1D2PA 1MCWM 1BAFL 2CE6A 2J21A 3NK3A 3QEQE 2CNYA 1G7JA 1PLGL 2IMMA 1J9RA 3IFOB 4N0UA 1IGIL 1XCXA 5E8DH 3VTAA 4Y16A 4XNXL 2JI1A 2CXGA 4G7YL 4NQSB 3R06B 4W9DC 3SYPA 1EMTH 4OZFA 3L1GA 4OZ4B 1BVLA 1IC0A 5JTWA 2AKRB 4TL4A 1A8JH 2QL1A 3FB7B 5DK0A 5HYJE 1YJDL 3R0MA 3SN6N 3AGWA 5EU5A 3FU8A 1G4MA 2QFPA 3BD4A 1GGIL 3IMWA 4UYQA 2VDOL 5F3HB 3JQOB 1EFXD 1A0QL 1E9OB 3DTDA 5DYOB 3VGAC 2CO4A 2IANE 5F72S 3K80A 1ZLUH 1KJ2H 1P7HL 2UYLB 1A5FL 1YYML 2BSTB 2WUBL 4EDWL 4Y4HA 1QFOA 2NQ3A 1D5BA 1SPDA 2HLAA 4PWJA 1L3WA 5BJTA 4BM7A 1EZSA 2LLNA 1ZLVH 2OMVB 2X6MA 5HJBA 1Z0NA 5GGVH 4UT6H 4AT6A 2V17L 4UQBA 3PRZA 3X12B 2ED8A 1HYRC 1VESA 2YBGA 1FGVL 5K9QG 3NSJA 3ZN6A 2DH2A 2PWDA 5SWSD 1ZHNB 4N87A 5T3ZH 4PYGA 1FIEA 3K1DA 1NFAA 1G6RL 2VXUH 3W1ZA 3Q6GH 2JJTA 4X98B 2UY7B 1JNLH 1WA1X 4PWHA 3GBMH 2VIRB 1CO1A 3NYKA 4KXZH 4R7NB 4NCDA 5B39B 2FH6A 1PCSA 5AW2B 2Z34A 2APFA 2VDRH 1NC2A 2VERA 4WV1C 4G8IA 1E8YA 3TA3D 4I5BA 1MFCH 5KBMA 5EDSA 1L6PA 2FIKB 4NQDB 2XKNA 2FZ3B 2P9RA 4HAKA 3I2CL 3TBYA 4L8CB 2FEEI 4M8QA 4UM9D 2V7HA 2AGJH 5I23A 3W37A 1OB1A 2YMXH 2FGZA 3MLWH 5KVFH 3ECBB 4ANUA 3BPNB 4IK6A 3AB0C 1M7XA 2EACA 4LU5L 4Y4KC 5CHNB 3R7RA 5KBNC 4Z6AT 2XG4B 3FQRB 4QRFA 4D0DA 4EVNA 3M1CA 4KJPD 4P5TA 3W39A 1E4JA 1PAZA 2V9RA 1XZWA 4Z7WA 1KWKA 1P9MC 3MLUH 3MCYA 2CO1A 2ZUTA 1FNHA 2Y7QA 3OJ2C 1VAHA 4L8BB 4K5NA 2GFBB 1HKFA 4Y5VA 3EUDA 5KUMA 3AS1A 4RZKA 3O6KH 4ZFOL 1G7QB 4LLQA 1T03H 3L4TA 4N8VA 3VG9C 3D69B 4LLWA 1JGEA 3KPRD 2DF3A 3LPOA 4LKXA 1OAUH 5IHUH 3RJQB 5D7EA 1AJ7L 1FAIH 1HHIB 5B8CA 2A0LC 5DD6A 5AVRB 1XZ0B 2MOVA 3SB3A 1D6VH 3PWPA 1T2XA 4J27A 5C0AD 3RGHA 3CVHB 1F58H 2YLKA 3ESMA 2N1KA 3PAVA 3L5XL 1NUDA 3C5ZB 2AQSA 4HCFA 3TO2A 4QOKE 1IGML 1LDPH 1AY1H 1XXFC 3PWLB 1DFXA 4I3SL 2HRLA 4JKNA 5IK3A 5I1JL 1CFNB 4C4UA 5CM1A 1J8RA 3IXAB 3LN5A 3TH3T 4AYMC 1MHPH 4A6YH 4LSPH 1QFWL 2JE8A 4QNPE 3D48R 4MJJA 1N5YL 1HFUA 2CIIA 2G9KA 1SY6A 4YBHA 3A24A 4MB1A 4UQ9A 3BUIA 2X4TB 1AZNA 4JVWA 3C60C 4X8JA 2EC8A 2AK4B 1QVOB 3QHZH 2V5RA 2A9ML 1E9PA 3OB0H 2R1XB 4RSYA 4ENEC 3DRQB 5GS2H 2EO7A 2IQ9H 5D7KD 2J25A 1SM3L 3CE1A 4N6RA 3KVPA 3KPSA 5I5IA 4R4FL 3DIFB 1ZT4A 3HBPA 5EC2B 5IUSA 2C9PA 5GS3A 3TEXA 2HT4C 2VZ1A 3LDBB 3OAZH 4QWWD 3OHXB 2CRYA 2A3TA 1J1OL 5KSAD 2R23B 5DRNB 3QQ9C 4XMPH 4P2QD 3VYNA 5AVVB 4LCYB 3L2NA 4JPKL 4NQQA 3X11B 1NGYB 4OZIF 1IM3A 4HALA 1N6UA 4HEMA 4MB3A 4YFEA 4XB3A 1LNUB 1YPZA 1QI4A 2OZ4H 3CUPB 4M7LH 1QRNE 3L4VA 1XAUA 3WU1A 4OZFB 1DUZA 2EDLA 5GS0H 2EVJA 2KT6A 2GT9A 5IIEA 3RE0A 2V4LA 4E0RA 3HI5H 5D7SL 3FO1A 5IWLC 3EOBA 4B41A 5ACMA 2I60L 2ITDA 2J8HA 2JMRA 3B5HA 3A4FA 4HUKB 5JXAH 4HHWA 4YDVB 4N0FA 2DN7A 3KLQA 1WWAX 4YQXH 4HBCH 1C16A 3IXTB 3C6EA 1KGIA 4X99B 2CO6B 2YK1L 3D25A 3FFCB 4K9EC 1DN0A 4Y4HB 4JFZL 5BJTB 4HCIA 4YNYB 4WHTA 2P7TA 1S46A 4FL4B 3B2UD 1B2WH 5SWZB 4E9WA 3AWEA 4RGOL 1W8OA 2D2CC 2X4SA 3QPQC 5I82A 2H1XA 2WSDA 2Z6FA 1SJMA 3BZDA 2PR4H 3BUBA 1QFWM 1BZ9B 1TQSA 3X13A 4AQ1C 5IVNA 3RNKA 1DVSA 4WRLA 2B5IB 3NGBB 5GXBB 1DBAL 1GC1C 1O5PA 3RY6A 3VXSD 5D1ZC 1FAKT 2DIBA 3N42F 1PF3A 5J6GB 5I6OA 1OQXA 3F5WB 1A9BA 3QUMB 3VI4E 2HFFA 4PV9B 4ZX4A 1URLA 1BVOA 3TH2T 5GS1B 4R26L 2YSSB 1K9TA 5K9QI 1BFSA 1R3KB 4JPWH 4CN4A 1PX3A 2X4NA 4YHNA 2DQJL 3CLFH 4JDTL 1IJ9A 4QRUA 5DD0H 3RX5A 1L9OA 1RZ7L 1XCTA 1UCBH 1NC2B 2OL3A 3QFJB 5I18H 3QIBC 4MNGA 4HHGA 4K3EH 5GZNA 3RFRA 3B7SA 3VRJA 2C3VA 1B3IA 3B2VH 2PR9A 5CEZD 4KI5F 4QPEA 5BO0D 3H9SE 5TQ0H 2RTTA 2XN9A 2YKLL 3AITA 5ERWA 3NIGE 3BAEL 4OIIH 5D4HA 3T0WA 4WFED 2H32B 1SF3A 1CFMA 3I02B 4OGXL 4P5MA 2E7HA 1OGSA 1CXIA 5IMLB 4QRRD 3DOSA 3MA7A 1BIIA 3IU3B 3SDCA 5A3ID 5HHME 4YSCA 2HLEB 1MHEB 3NDYE 3C5JA 3F12B 1Q8MA 2BWQA 3TPKA 3C08L 4FFZL 2ICCA 4K9EH 1IZJA 3I6GA 3BKJL 4BYHA 1RK0B 2KUTA 2XZAH 1CLVA 2H2PC 4DKTA 3COOA 5KW9H 3PXLA 3UTTA 1DDTA 3GMQA 3HS0C 4FTVB 3MRJB 2XBDA 3TFKC 1RIUL 2GUOB 2EE2A 2FL5B 3TCTA 2GBVA 1W0VB 3QIUD 2D7OA 1RJYA 4AJYV 2N0KA 1Z5LA 3ZX1A 1V27A 4Z3TA 3BSZA 1QSEA 3OM3B 5AFAA 1EEQA 1GGCL 1R5IA 3QB7C 2EP6A 4UT9L 5L2KA 4QJ5B 5C0CB 3CN2A 4NENA 3BWSA 4B27A 1NJ9B 2YQ2A 4ZW5A 2WN2A 5IBTL 1TENA 4ZRGA 1S78D 1RMFL 3CFBA 3V7MA 5K9JH 2WQXA 4JN1L 4OJCA 4MXQD 3ZRFC 3V55A 1KLUB 2X38A 1KTDA 1ZA6A 4QI3A 4C83A 3AXHA 1U36A 2Y25A 1CGSL 4FQIL 1QA9A 3RFZC 5HYIA 4K9JA 5IVZB 1O7DC 3OTTA 3OKKA 2AQ2A 3FUKA 4Q9RL 4XZUA 4BCXA 5E9DE 2ZWYA 1A6ZA 3NJGA 1KFAL 1I1RA 1WGOA 2W0PA 5J8OA 1GCYA 4LHUA 3MN8A 1CE1H 2KZWA 4YE4L 5DQDL 2DLGA 3UAJD 5CEXA 3J27A 4Q6KA 5DI8B 3L4WA 4R7LA 1T7VA 4HD9A 5C0BE 5C08B 1CXLA 2CPUA 1QASA 1OT4A 3RA7L 1TZ8A 4LVOB 5T1DL 3FUIA 4UNVA 4J6RH 3T0XA 4WUUB 4XP4H 3H42H 1ZT4B 1OV8A 1I9IL 2HJLA 2QGCA 3GT6A 4NUPA 3WLBB 3DGCR 4V1DE 1KGUA 3B6SB 4AOFA 3Q3GB 12E8L 3US0A 2EQDA 4AUJA 5DC4B 4NFBA 5C0FB 2H8PA 4ZOEA 4GBXC 4G1EA 4QHKJ 5DLLA 3FOLA 5BRZE 1AP2B 4DFIA 1SLUA 1OO2A 1R46A 4FMFA 5JLZA 3EYVA 3PWNB 5FO9B 5E8EB 4XP9L 2WLKA 4X7CC 4MJ2A 1EBAA 1UZ8B 4KOBA 3VG0H 5CR8A 5D2NE 4GRMA 1BZOA 1M7UA 3EJZC 4E0RB 3HNSL 2F5AH 3ELQA 3QFGA 2NTFB 4LLVA 4E9RA 1EJ6A 4YXHL 4JQIA 2CKBB 1IAOB 4PI2A 3ZKSD 1C5BL 2BIOA 3AS0A 3M1BB 3QQ3A 3WN5C 3JTBA 1G0XA 3I74A 4MCZB 3PHOB 5F3BB 1TF4A 4KMQA 4OKVA 1WAAA 3PDGA 3QJTB 4KTDL 2J1YA 1DN0B 3L13A 2ADJB 2ITCA 5T1LB 3APFA 4MHHG 3FSOA 5LN4A 1IIKA 4XP6L 1NCNA 2H6UA 4BDVB 2J2ZA 1SDDB 5T5NG 1AC0A 5AZEH 4KUCF 5DEGA 4G7RB 5K1JA 1FN4A 3VQ2C 3ES6A 3ATFA 3RG1C 1U8OB 2VJ0A 1KPUA 4Y2DB 5H2BA 4QLRA 2YD6A 3K3QA 3RGVD 1BM3L 3NIFB 4KRPC 3QG7H 1AAJA 1S5HA 5J12C 3VXRE 3ZIMA 4EOWH 3FQNA 1E4KC 3BFWA 3QJFB 5FO8B 1GAFH 2O72A 1WFNA 1RZPA 4ZAKB 5C07E 4EMZA 1S7RB 2OW6A 3LV3B 1NAML 4LARL 5I75B 5K5YA 1CICD 3QZPA 4J12A 4P4KC 3E1F1 4YSSA 1GZHA 1MDAA 1G9ML 4XCYA 1QR4A 1TZAA 4DEUA 1B90A 2LFGA 2BHYA 2Q2EB 1ZXKA 1D6EA 1U4FA 2IAMC 4XWGL 5E8OB 4MNGB 2OQJA 1QRKA 3VRJB 5I1AB 2JB5L 1J0KA 3GRGA 3VDCA 1QW9A 1HINL 4X5XB 4F15B 4U2YA 4QHNA 4JG1H 3ALXA 3KLHD 1J0IA 2I7OA 3L1FA 1F6FB 4Y9CA 4ZSOB 5I6XB 5HYSA 5BV7C 2R0ZH 1C5DA 4AIZB 4BRVA 4MNQA 1N0LA 2FBRA 4ANXA 4ZZFA 1INDH 3U0WL 5HSFA 5BRPA 3MNMA 2FJUB 1J5IA 1DLFH 3BOVA 1S9YA 1PD0A 4LOUD 4OT1H 4HH9A 3UL4A 3PL6B 5D2LF 2ZCLH 1OP5K 4PJAA 1PLBA 1T4WA 1OWRM 4OTXH 1MVUA 2H3NB 2VL4A 4RA3A 1K6QH 4XN7A 3VD7A 3G5VB 3IFPA 1ZWIB 2K7PA 2X1QA 1U3ZA 4QRPE 2XQBL 4UQ2A 4CW1B 2OCFD 4OCMC 1DUYB 4XN5A 5FYLE 2FBJH 2HP4A 2Y36H 4PJCE 32C2A 5DJ2A 1TJHL 2B4CL 1JVLA 3SGKA 4EN3B 3NABH 4AKPA 3REVB 5HGGS 2P52A 5DTFA 4XAKD 3AXIA 1K3IA 2VXVH 1MLBA 1T7ZA 4G59C 4OZGF 4NIKB 4NENB 3F65A 3B83A 3VW3H 4XHQA 3MRPB 4B9JA 3MJ7A 3ZL4H 2CGRL 2YPVL 4RGNB 3BAIA 5CILH 5BOPA 4OLXL 3CFMA 3W9EB 3OL2A 4TQEL 1MJUL 4FF9A 3UTPE 4L3EB 5DA0B 2L04A 5HI4C 1QA9B 3RVVD 3FOMB 2KL6A 1UD6A 4NQVA 3S37H 2KBGA 5FOJA 3LEYH 1OK8A 2NT1A 4MNHB 1HNFA 4I18A 2X1XR 2O6EA 3ARBA 2I25N 3HAEG 3VFMB 4LBAA 4XPGL 3B8YA 3UO1H 2IPTL 1A6AA 3E80A 1Q9LA 4YWGH 2O5ZH 2FLRT 5DEFA 1S7VA 2ADFL 3TN0A 5HI5C 4FG6C 4JLRB 5BV7H 2BM3A 5ID1B 4N2BA 3ASOB 4NQDD 2XTLA 3JXAA 3HE6A 3FTXA 5HVHB 3I84A 1OPGL 4PI0A 3SBWC 3SBRA 1YO4A 3CSTA 1EIBA 3V8CA 3RUGF 1S7SB 4AL8L 5FUCE 4OF3A 3VXPA 3D50A 3HCVA 3IFNL 1JZ5A 6PAZA 4Q9BA 2VC2L 5DRXA 5FECA 3C87A 1JGDA 4LPXA 3VXOA 4JZOB 5AZ2L 4G6AD 4NLAA 1CDHA 3LVEA 2AJVH 3KXFE 4GFXA 1HAWA 1EHXA 2NNAA 3L3OA 3SE9H 3HG5A 1HILB 4XN4A 2WP3T 1KB5B 5CIPA 1BQHG 5J1SC 2XWZA 1SVZA 3VSTA 2YO3A 5LBSL 3QDJE 1T1XB 4ANVA 4LVHC 1NCDH 2CDFB 4LSUH 5HGHA 4J3OH 5FYKH 1WFJA 4N8VG 1LWJA 3RWDB 1QLFA 1YDPA 5FGBC 2BH0A 2IWGA 3VNZA 3H85A 3QEUB 1KUMA 2E9GA 3RNQA 1QAWA 3V0AC 4WUKH 1JPGA 5DZLA 3V2AR 3ZPDA 5CMAB 1XH3B 3DUUA 3ZXAC 4K5MA 1AS8A 2WLLB 3IN0A 4OY9A 2UZIL 2YPKB 5I71B 4YL4A 5J6SA 4UDTB 3M86A 4F3FA 4P8QA 4UMGA 1NIDA 4KQ4L 1YY9C 3N50A 4RLDA 3H3PL 5C3IA 1PZDA 3WFBH 4XC1H 1XBDA 1HE7A 5EU4A 2I32A 1HZHL 2XXCB 3U2JA 3L3HB 1E28B 2UY6A 1K3ZA 1P1ZA 4N2DA 4RDQG 4GEIA 4MHHI 1FN4B 2WVSA 3QNZB 4MJ6A 4OBRA 4L0ZA 2EE9A 4DGIL 4XB7A 3L9YA 3CBKB 2ENQA 2V6HA 4HD5A 4K8RH 2XJLA 1U8HA 4KNUA 3V95A 4URKA 2DV6A 2AK4D 1NWOA 1DJIA 1DL7L 1E7VA 2AEPH 2WCSA 3JV4A 3TIEB 4LKCA 2YFNA 1UZGA 2WLIB 3HZKA 3VWKC 3REWB 3S5YA 3GSRB 1Z9NA 4XVOA 5L6YH 5F9JB 1WIUA 2IGLA 2D9QB 1NFDE 1VPOH 2DTMH 5DQJB 5E94B 4N9OB 4BINA 5E2VH 2PYEE 4ZMXA 3MLZH 5IVXA 3WXWH 3GXDA 3O9WC 5A2CA 1UJ3B 4OFIA 3BDXA 3DVFA 4CVWA 4YEFA 1TMQA 2VM4A 4EJ1C 2V7NA 5D1QA 4QY8B 3QULB 1C5DB 4DPRA 4NI3A 4MNQB 2WXJA 3K7UA 4TUJB 4ZXBC 3QXAA 2OR9H 2GB2A 3P77B 1F1DA 1ZHBA 3ETBF 6TAAA 3BPOC 3VWJB 2XY2A 5I0VA 5FFGA 1FL5A 3G6JF 4XB8A 2AEWA 4G6ML 4PGCA 1EPFA 1NDMB 4U3SB 1IVTA 1BJMA 2F18A 4F24A 3IRPX 3ME0A 4WWNA 3QZMA 4OFPA 3DO7A 5C9JA 32C2B 1LK3L 4GRLC 4LPYA 5EO9A 1NMCC 3NFNA 3SDXE 4Y4HD 4KX9A 3O41A 4OLWH 4UMSA 1T5XB 5DTFB 3RWFA 4PS8A 2VSMB 3FRPA 5HHQB 3ULVD 1MLBB 2E7DA 1RSFA 2BNUA 4Z23A 4MA7L 3MLSL 1CD1B 1FQ9C 3QXDA 3W5MA 2BVOA 4LP4A 4HS3A 4J5VA 2G5BB 3MBEA 2VXSH 3JWOH 1QI5A 2KDGA 5GZOA 2MIZA 3P3YA 4M9OA 3U6XS 1DLHB 3DO4A 3O6LH 4LCVA 5IB4B 2YN3A 4RBPH 4RA0C 3GIVA 3UBFA 5FLVA 4BELD 1E4WH 1NCAL 4X42A 4UTBA 1FVCB 5IEHB 5JPNB 4PJBB 4YGVA 4TTDC 4IEFB 4C4KO 4P3CH 4GUPA 3BO8B 4LDOB 1S7XB 1NEZB 1FBIL 3ARBB 2X4RB 4WFHD 1PIFA 4U6XA 3MACH 4U3XA 3MOBL 5DMJB 2JV6A 3GB7B 3LKNA 3NSYA 3TJHC 1E5UI 4UILH 4FZEH 5DVOA 5E6IC 2V2TA 1NC2D 5HDQL 4P04A 2K6ZA 3QFJD 3WEAA 2R2EA 1ES0A 4YXLL 4J2XA 5AKVA 2ORBH 3EJQA 4EUPA 3HE6B 4MJIA 2OTUB 2IBZY 4PJHB 4P46A 2R59A 1A14L 2DEXX 1NPUA 1P4BH 5A2LH 5I1CH 3UZQA 3GNML 3VXPB 1OAQL 2PW2B 4MAZA 5LCVL 2F7PA 4KZEH 1QBLL 1MIEH 2YPLB 3RTQA 3J7HA 5EA0H 3VXOB 4JDZA 4N2GA 4BH8A 2QMJA 4DKEH 4P5TD 3CZFA 5KSVA 1EAQA 1X9LA 4YLQT 1U3JA 3F58L 5CIPB 4OGYH 1OCRB 5IVOA 1FLRH 1W0YT 2D73A 4LLYB 4WW2A 4X5QA 3QHFH 4QNPF 4YPGA 4ZQKB 3QNXA 4PGBB 5IJVB 4G83A 5FYJH 4LSDA 2H1LM 2NZIA 1IIIA 4G3YH 1F4XH 4AMKH 2R69A 1QLFB 3IDNB 1AHWC 1C8PA 1YDPB 3IRZA 4R5VA 1TIUA 5JMRA 1BX2B 3O3DA 4NB7A 4R0LA 5KJRH 2GCYA 2IAAC 1H6EA 1BQLL 5DZJA 3RNQB 2OP4H 1KT2B 1QUNA 5LAPA 4WWID 1KPRA 3DUUB 3TJPA 4J4PA 3SKMB 1FVDB 3BT2H 2ZAHA 4ZMAT 2FR4B 1G0YR 2A6KA 4UTAH 4X5WA 1MCOH 2EVIA 2MCPL 1N10A 1XCQA 1BJ1J 3FRUB 1KLGA 3PQYB 3ESUF 2E9IA 2AW2A 5GGTH 4JKWA 4M62L 1MN4A 3LNDA 2HVKA 2B8OT 4PSPA 3PWJA 4A7VA 4DFHA 2WW8A 2ED6A 3OAUL 4J3VA 2EDJA 1BEXA 3RB5A 4ABUA 2PXYA 2YSTA 4M5SA 2P4AB 2ZYSA 1CBVH 1MCFA 3SODB 3L7EA 2CA3A 5EZOL 1JRHL 2KPWA 3P73A 3LHPL 4WY7H 4TUKL 5LVEA 5FK9A 4JO5A 3T0EB 3A6BH 3LY6A 4DN3L 5I8OH 4YVUA 5I6PA 4MZIA 3V4PH 3CFTA 1BF2A 3G9AB 1N70A 1X5AA 2VDQH 3HZKB 1P6FA 1ZEAH 4JQVA 1II4E 5MEOA 3IGKA 3MPCA 3KPRE 1WZAA 4ZS6D 2VAAA 5HGBA 1NICA 5IJBC 35C8H 3KZ8A 1MWAB 4V33A 2FSEA 3P9LA 4XNUL 3VMPA 3AREA 5IGXL 1IAIL 1U8JB 3ETTA 3UMTA 3WKMH 1JDAA 1MNUH 5C0AE 4TVPD 3MROB 5A2FA 3U2SA 4EQ3A 5I0ZA 1CE6A 1UKTA 2YRZA 2VDNB 3PF2A 1IM3D 1LP9A 5LQBH 2FO1A 1BQUA 2D0GA 3N0PB 2AS5M 1MFEH 2SEBA 4JFFB 3UOAB 4XC3L 4ZO6A 1U8IB 4E9LA 4IIQA 3GJFK 4JVPA 3UZVB 1B88A 2IH3A 1YEHL 1CIUA 1AXIB 3FSWA 3L4ZA 2V3FA 4GP4B 3ZL1A 1S9WA 2EDWA 1VRSA 2A9NL 3Q9PA 4OCRH 4ORZC 4W9ZA 3WFHA 5SWQB 4U1NB 3DSNB 4FULA 4AGLA 1LYQA 4ENZA 2X28A 4XP1H 3S3CB 3QUYB 1BOGB 2JCCB 4OCYL 2NY4B 5CO1A 5KOMC 3VI4F 1KYUA 3U9PL 5G5DB 5ID0A 1QTYT 2MTPA 1HDMB 3K5SA 5D7KE 3VD1A 2VLJB 4KHXL 3TF7C 5CLTA 4JRFA 4RFEA 5MI0B 9PCYA 8FABA 4QHLB 4QUOA 2BY3A 4NOFA 4L4JA 3LIUA 2J6EH 4W4NA 3FT9A 5CINL 4AGNA 1SJEB 3MRFB 2R8SL 4XVUC 5BVPL 2IF7A 3S8FB 1U2HA 3BUTA 4P2QE 1FZJA 1A3RL 3KPLB 3GMLB 1HKLL 5D7JC 2HH0L 4YN3A 4Y2DD 4A04A 1HSAA 3GIVB 4GJTB 3VXNB 4AH2A 1ZCRA 5CBAA 5JORB 4MDRA 5F21B 3SQRA 4GO6B 4YBLC 3TA3C 4ABQA 3E8UH 1S5IH 5IQOA 3UH8A 5LGJB 4XZ4A 4Y5XA 1OP5H 2XDHA 1C5CH 4ILDA 3QC5X 1GS6X 4YIQA 4U1LB 5GGSA 3RKDD 2A4ZA 5GGRY 1ID5I 1H5BA 5LAXB 4DIXA 2P5PA 3K4AA 2R2EB 1IAIM 5FW6A 5GZND 1EHAA 4HIJA 1YY8B 3WS3B 4AUYA 3DTXA 4H8QA 5IBUG 2I5YH 4EUPB 4OF0A 4MJIB 4MD4A 4JX0A 2XN9D 4G1MA 2AJZA 4TNEA 3D9AL 4K7PL 3STLB 3ARFC 3FQUB 3EGSB 1HWGB 4JN2A 3ULSA 4TUOB 1SQ2N 4KZCA 4KI5C 5F7HA 2F0CA 4L4TA 3CU7A 4NKOA 1H3XA 4Z7OB 3BKML 1NGXB 5F9OH 1LO4H 5CZVH 1CFQB 3DROB 1CI3M 1ZHLA 2C1PB 1KIPB 3SDCD 3FQWA 1PD1A 5JHDB 1CIDA 1ZD6A 3U4EB 5AVQB 3AVEA 3VXSE 3VXUE 3HVDA 4GP5B 5I0XA 1PZSA 1R3LB 3GWJA 3ZO0A 1QYGH 1FWXA 4PJ7A 1KCBA 3SPVA 1DEEB 1T0NB 5JUEH 2QGDA 2R29A 3QNFA 1CYXA 2HLFD 2QTEA 3KCPB 4EN3D 2BVTA 4WSKA 3LEVH 3CLEL 4O5LH 2YXFA 1WBXA 1D5MA 2E6QA 4KXDA 2DLHA 3CFCH 3TGXA 3F62A 1QSED 2XV0A 5L2KD 2CLVA 4TSAH 1JF1A 4XX1G 5BW7C 1KTLA 4GMSL 2ZXEB 3EOTH 4KC3B 4KXZI 5T5FA 2P48B 2YAOA 4MS8D 3P02A 1QUNB 3V0FA 1KPRB 4ZUTB 3SKUD 4V11A 1TKWA 3GHEL 4JFOA 4RGND 5CEZE 1UXLA 3JTTA 3GMOA 3HB3B 3OX8B 2GTZB 1UM5H 1A7OL 4BE6A 3OXRA 5D6DC 1YEKL 4YDIH 3C2AL 2JJSC 4LEOA 5B22A 5I9QB 2EADA 4QRRE 1T6VN 5E23A 4AKQA 4HOXA 1NLDL 4QRQA 2E7LA 3FCTB 5D72H 5BCAA 3VJ6A 4MCYB 1HL4A 5FKAB 2PXYB 3V0EA 3V6OC 5INDA 1ROCA 3FHAA 2X7LB 1BFVH 4LHUD 1IBFA 3UDWA 3SOBL 2WNKA 2Q20A 1LQBC 2A99A 3N9GL 4ZFZB 3ZKND 4YSEA 4QWWC 4IBVA 5KSAC 5GPRA 4LLDB 4LQ1A 5TTRA 1Z32X 4L3CB 3DO3A 4GW5A 1OGAA 1CDCA 3LH2L 4B3VA 5I17A 4R2GC 1Q0YL 3PREA 5E56A 4LP8A 3MRBA 3RJDA 5HGBB 4NZTL 2D2OA 2ESVA 4G7QB 5AW6B 2GKIA 3HRZC 4UQDA 4X9YA 1L0YA 3G08B 5JXEA 5E4EB 1SZNA 2FJGA 2XFGB 3QA3B 2VRKA 4K5OA 5AVUB 1HS6A 2A74B 3UO8B 4NQCB 3DYMA 4Z95H 3SZ6A 4POYA 3D12B 5D5MA 3IJ8A 3WNPA 3U2SB 3IT8D 1AR1B 1TSRA 1LP9B 1N67A 3GZQA 3ATDA 2GJ6A 4M9PA 3D30A 4PB0H 1JFHA 4F2MB 1SJVA 4OM1L 1LO5A 3EYFA 4F8QA 1HL8A 4ZOAA 2X2JA 5DJXB 4JNXA 2XIDA 1IGTB 3EH3B 3FU7A 3P4OA 4NYLB 3SPCA 3TBBA 3WFHB 5ICYA 3ZUNC 4BK4A 4XVTL 2IG2L 2G4EA 4QRSA 1BXUA 3B2UC 4RQQA 4HLZG 3JWNC 2HX8A 5LGYA 3KGTA 3WEXA 4GAGL 4K3JL 2FT6A 3WKPA 2ZOUA 3D87B 4Q4EA 4HDIA 2DAVA 5AKRA 4AXWA 3GK8H 1RZFH 3DVGA 3B56A 2JKTM 1IC5L 3P1VA 1DANT 2RFXA 1MIMH 2I69A 4HGKC 3VVWA 1TZGL 1PKQE 1OT2A 3MUZ1 3DHJA 5M95B 2OJZL 5C09B 3F7VB 1L3NA 1NKRA 2DQGH 3PG2A 4AV5A 5I2IA 3QRFM 1JI1A 1WWWX 4TLTA 1TG8A 3H6AA 3OWRA 3LMJL 2CGZA 3LXAA 4L37B 1I7ZA 4EXKA 5CBAB 5EC1A 5IFHH 3EW3B 1D2OA 2VQUA 4GAAA 4PHZA 5AW0B 4JO4L 4Q89A 3TF4A 4GYBA 3T3MF 4DHLA 3FO0H 4QJ4B 5A6LA 3CFDB 5I28A 2X9YA 5C6WH 5C0RH 2EH8L 1FHNA 1LQSR 2D3NA 5IROA 2Y5TA 4UINL 5DSCA 3V6FA 3ZGHA 2LT9A 4W4OC 2JNZA 4FYSA 3V0VA 1BJ8A 1QNZH 3KLLA 3UACA 3WUWA 1JPEA 4NXSA 4K71B 5A3IC 1HE8A 1JZGA 3FHEA 1IC4H 1X7SA 3EF7A 1FH2A 1UH4A 3DX8A 5KS9E 4OM0L 2PP7A 1F6AB 4KDTC 4XCCL 5EOTA 3U9UB 4HUVA 5E2JA 4JN2B 1AGCB 2H6PB 4JPQA 4MNQD 1NAKH 1NTDA 4NKOB 4X80H 1H3WM 5F93C 5KYXA 1K8DB 4P49A 3FFOA 1D5IL 1U8PA 3JWNH 2Y2TA 5GSVA 4JFEA 3CXHK 2IGFH 3VWJD 3BGAA 3BSGA 5TH2A 1ZSDB 2XQYA 4WO0A 4GQZA 5AB1A 1OAYH 1VFBB 4F9PC 4PUBH 4AX3A 5C2BL 2YBRB 3OKLA 2WQAA 1JV5A 3FT2A 4HXAL 4OD3L 3O6FC 2AMUA 4X5LA 5DJCA 4XPFL 3SD2A 1I3GH 3VAEA 3KLDA 2OV0A 5L8LB 2BNQE 2AVFA 3K2MC 3CJJA 3EJPA 3NRPA 5MP6H 3GSOB 2NY6C 1QOKA 2F54A 3FRPG 4FJ6A 1XGTA 1RU9L 1JPFB 1JVKA 4ODSL 3SDAB 5L7XL 1FUNA 2QR0B 2YR3A 4EI5C 3JTTB 4F93B 2X9ZA 1I1AA 5GRJL 4X6DB 1DR9A 5IQNA 1C9SA 1L9SA 3GSNA 2MOGA 3S5LG 2NXYC 1P6AB 5TQ2H 2HX7A 4B97A 2PCXA 1EHLH 1JGUL 1QD0A 1NCOA 4N9GB 4B0MM 3KWWA 4F9LA 1OAZH 2OCJA 3BAJA 5ITFB 3DMMA 5L88L 3ARBD 1BP3B 4NO3A 3IDJA 4PRHA 3KG5A 1XMEB 3F7YB 1OTSD 2FJHA 5BOZG 5AVSB 2Y07H 3ROLA 5ILTH 4G9FB 4HUNB 2F15A 2XLLA 4GW5B 3HE6D 4YR6B 3ZK0A 2O5XL 3FTZA 1OKEA 2ZWNA 5KBPA 4JANA 1FFPA 3GJEA 4XAKE 2VDKL 4Z0BL 1ADQH 43CAA 4BKLB 4YHYC 8CGTA 4UM8B 3KH3A 5LUMA 3LPFA 1M42A 2PN5A 1CTOA 1YUKB 3FUMA 5TF0A 2WXMA 2YPLD 3PYCA 5E70A 2GVYA 3MVSA 2QKIC 4XNZC 3C6SB 4GXVL 4HVBA 3CHQA 1HC1A 1FYTB 3K6SB 2QLVB 1KMGA 4Q56A 3QWOB 5D5MB 2X40A 4AV4A 2VZTA 4YLCA 2OM5A 5JR1H 3BLPX 4JRYA 4L4VB 2R1YA 3QJHA 5F1NA 5CNHA 4M4RB 5J9PA 1EJFA 4LZKA 2I7SA 1YECH 4JFPB 5CCKL 4ZMOA 5D7LA 1G94A 3HUJA 5L8JB 4PIBA 4Y9GA 3NQKA 4Z5RB 1RZIB 5CJQL 3FU7B 1AMXA 3P4OB 4V2CB 4OQTL 5FUZH 2J72A 4OI7A 4HUCA 5HY9A 3D52A 3Q8FA 3VXMB 4BWUA 1UWGH 3CSBA 1QLEB 1UB5A 4HFWB 3IWUA 5F6IB 1LD9A 3C5SA 4NQDE 2VJ8A 1UATA 2AV1A 3QI9B 2HT3D 2G2RA 3FU0A 4R4BA 3T77A 4JB9H 3BHBA 2D8KA 2M83A 4C56B 2ICES 3ZTJG 1T04B 3RGVC 1S9XA 1NFDF 2AERT 4NP4H 5KUKA 4MMXC 1T1ZA 4Z0XB 4D8PB 4CSTA 2RFXB 1QLRB 3RWJA 4FYQA 3S34H 2J57A 3RX9A 4ZMQA 1G6VK 3D8MA 4KK9D 1W0WA 4JPIA 1F3JA 4ZOCA 3DX6A 3QCUL 43C9A 4HP5A 1IKNC 1EEZB 1UFUA 1G0DA 1YMMB 4BZ2H 3SE8L 1CICC 4PRNA 4X8XA 5FIEA 1PSKH 5TE4H 1CLOH 3TYGL 4UUJA 1I7ZB 2G2NA 1Q0XH 5EC1B 4P2OA 3QDGA 3T0ED 5DA4A 3N06B 5JPMA 5EPMB 1MFDH 3GJFH 3KLHC 3KPPB 1SLXA 3UBGA 1SYSA 1AG6A 3BZ4B 2WAQA 1I1FB 3GDCA 1UURA 1K4DB 4RAUA 4Y4FA 5ACLA 5AAPA 4N0YH 5LXGH 1E8ZA 4FQ2H 3V4VA 2R51A 2YEZA 3ISWA 4KK5D 1T3FA 1AVAA 4OLZL 1AXSA 5L9DH 4M93C 4GQQA 4XWOC 2O6FA 2YAHA 3WUZA 4BSVA 3BYTA 4LOUC 3ZDWA 3L7FA 5KYUB 3OXSA 4WEBL 3VFNB 1XH0A 3C6LA 2O6PA 1L5GB 1RZKH 3ZHKA 4F91B 3JV5A 2ZUVA 1P2CA 4NO0A 4L29A 5D1QD 4O2EB 2WXPA 3P4MA 1YEFH 2DKUA 4ZTEA 3EFOA 4M61B 2O61B 3GSXB 1U95B 1C08B 4KPHH 1N64H 2E86A 4H0HB 4KKCC 4L5FH 4EDXB 1UENA 2XN1A 2VUOA 3T08A 4GKNA 4JFEB 2EVFA 3KPMB 1SN0A 2OR8A 5PCYA 4P2RE 1LTXA 1N68A 4FEIA 4A2DA 3ULVL 4WF7A 1S7TA 4YHOH 4ZTOL 5E2TL 3FT2B 3VFVA 5DJCB 2X1PA 1WBZA 2P5WA 3WE1A 2HCZX 2VLJD 4L8DA 4X0KB 5DJ0B 2EECA 3H4FA 1EERB 2P8PB 3IB4A 3PNWB 1E43A 5F0MB 3B9DA 2W60A 1RVFH 2O5YH 4WKXA 4ZW8A 3FW6A 2F54B 2PETA 3DA0A 4DETA 5MEQB 5I30H 4DESA 3RVVC 5D4IA 4HIQA 2CHWA 3MBED 4ZG1A 5GZOD 1R4XA 2AF2A 2GTWA 2FT7A 4NZUL 5E5UB 4OCSL 1I1AB 5K1NA 1KTBA 2ZSWB 4N0UE 2LABA 4RIRA 3H9ZA 2EYRA 2BVUA 3IJHA 1UA7A 4RZCB 5DO2D 4HXBH 4G5AA 3ZMEA 3P9MA 3VH8A 1FYHB 4H8HA 1E6JH 4HUUA 4O2FA 4P9ML 2A38A 2WWOA 3DX9B 2WXHA 5BO1L 5H94B 4E36A 1HJCA 4YO0A 1W80A 1LO0H 2DEYX 3IDJB 1I1CA 4M7JH 2IEPA 1N6QH 2ZOTA 4FFYL 2UV3A 1NCBL 2BJMH 3BPNC 1MAJA 4FA8A 3ECVA 5KTEL 3U7WL 3HZMA 3SGJC 2G9HA 2WXOA 4IRSC 4MJID 1ONQA 3F8UB 1T4KB 4FLSA 3QO0A 4XBGB 3RIFF 5F7DA 3U4KA 1U8MA 3U46A 3I3DA 3ULVE 2DM4A 4N1CA 1T0OA 4NKIH 3TU6A 1KXTB 4HPHA 3PABB 2DBJA 3X14B 3RTQD 4C55A 4MASA 4ERSL 2MPAH 3JSSA 3MRCB 3MRIB 1QPPA 2ZSVA 1A2YB 4BUHA 4ZUUA 4AQAB 2NX5A 2Y7LA 5TK2A 5JHDD 1BLNA 2VDLL 3TBSB 3CSGA 3AS2A 1MW2A 3HC3L 2F53B 4G80B 4J3UA 1DVZA 2R1YB 2AXFA 5EO0B 5KVGL 3SE4C 2OCCB 4XNDA 3VDAA 5J9PB 3FUDA 2VLRA 1IQWL 1WG3A 3CHRA 3HAEB 4K7PY 1YEDB 2LE9A 1N7MH 5J1AA 1BAFH 5C86A 2EEBA 3SY6A 4ZFQA 1PLGH 4N4YB 1IGIH 3C5ZC 1V05A 1K8IA 4PW3A 4XNXH 1G9HA 2WBJA 4G7YH 1KEML 5T3XL 3MV8A 1VZIA 1MFVA 4JM2B 2B16A 3WJMA 1D9KB 1GZQA 1UB5B 4LDEB 3OG4B 5E6RB 2H2SD 1YJDH 3GEFA 3H55A 4M00A 4KXAA 4IOIA 2G2RB 1GGIH 5SX4H 4U1SB 2ZCHL 3HB3D 2VDOH 4I1NB 3TNMA 3S88L 1A0QH 2VAJA 4IKKA 5IQ7L 4YK4C 1T1ZB 3VFSB 2ZG2A 4YHKL 2MKWA 3CDGA 1JNNH 3AQDA 5DJDA 4X4ZA 3VCLB 4D7PA 1A5FH 1YYMH 3IKCA 4JPIB 2GC4C 1DQQB 2NQDA 2Q76B 1BQHB 1U3HB 4PRAA 4FA6A 3DX6B 1BBJA 4YHLL 2A73A 4NHCL 1EGJA 3FTSA 3JVGA 2PXYD 5ENWA 2DTSA 1JFQL 4HKZB 5I6KA 4Z7WE 2YUVA 2IV9A 2QDWA 2JKLA 2V8LA 1FFQA 4AGQA 3X1NA 2VM3A 3B5GA 4PYHA 4X6CB 1NBZB 3LDBC 3U83A 5F9WB 5A16B 2V17H 3OHXC 1NGWA 1P4IL 1NPJA 3P4NB 1OANA 2DQ6A 2K7QA 3OSKA 4ODWA 4MD0A 4Y1AA 2UWEB 5H37H 4ODUA 5AD0B 1JPST 1MFBL 2UZXB 4NQTA 1FGVH 5KVGE 3PP4L 3QS2A 2HKAA 1TCMA 1HH6A 5FCSH 2HKFL 1EUUA 1G6RH 3T4YA 3FC8A 3ARED 3P3SA 4IMLB 3L3JB 3PWPE 1N4XL 3C8DA 3O0LA 4R8WL 3ZDZF 4NQCD 1W72L 5KYWA 1SLVA 3O4LA 3FNKA 1AYRA 3VD4A 4MJ4A 5T3XE 2A7BA 2B3IA 1OHQA 1G7MB 4OGQC 2OSYA 3EFOB 5I1LB 2G3XA 1QSFA 4M6OL 1RURL 3M07A 1H9DA 4AQOA 2NY1D 3ARGB 3V9FA 5I0YA 1ZVSA 4GKNB 1N26A 3MXWL 5I16A 4G71B 1Y1UA 3KGRA 4M3KB 2J73A 4HU8A 2WZ5A 1ZE3C 5DO8A 1UEYA 4FL4C 1XX9C 4H88L 5GISL 3A67L 4FHBD 1U8CA 4LU5H 1S7TB 1ZJBA 1RUPL 4KO7A 1P69B 1MPAH 2XWBA 3VFVB 4C59B 4DP8X 3DBXB 3FS9A 3QG6A 4PLJC 3EOYG 5DJ6A 4N25A 4D8OA 4QTHB 2CBTA 3R8QA 3CIAA 3TT1H 4UOZA 4U1HB 4MAYC 2JXMB 3AFLA 2B5IC 3NGBC 3PGCB 4PY7A 4AC4A 3KPSE 1WZ1L 3RVWD 2P46B 4ZUVB 4ZD3L 2W60B 4M3JA 1E9QA 5EN3A 2YAEA 5GHWL 4ELKA 3RWCB 3L3DB 3F83A 5BUPA 3I9PA 3UXFA 3WNLA 5GS1C 1G9NL 4FXKC 2DMCA 3IDMB 3QT2A 5DMGD 3VQMA 2AK1H 4WV1A 1CL7L 2BINA 4HEME 5ISZB 1OF2A 3NFSL 1YPZE 2LU7A 3TFBA 4DO5A 2OL3L 3LZOA 4NJ9H 1M7DB 5JNYA 3L5XH 1PY0A 4PV1C 3GXPA 1JPSL 1HAUA 3HE7B 2FWUA 1IGMH 5FA4A 4K3GA 4I3SH 5I1JH 4Y4KA 4OIFA 5AB0A 2ZX6A 5ICXA 1BPVA 1RUKL 1R17A 2B1OA 1EXUB 1J18A 1QFWH 3OMAB 4P0DA 1N5YH 4TLKA 3WUWG 1P9MA 1AGFA 2OMTB 1ONQB 4N2NA 4OF6A 3NJJA 4ONFL 4P4RA 4N8UA 3QO0B 4LASL 3O0RL 5JW5A 1HK6A 2A9MH 1YA5A 2B77A 3G3LA 4J2QA 5HVGB 2ZOKB 4L4TD 3UPRB 1JGVL 4R7DB 1SM3H 1GKOA 3QP3A 1QQDB 2BVEA 2ZYHA 4YHIB 1CBJA 5HHNB 1KCVH 4ZUUB 3T5WA 1N3NB 4R4FH 4BV1A 2EE3A 2EDRA 1XD1A 1DBJL 5D7IF 3AXLA 4GUOA 5DMIL 4PTTB 4Z77B 1NDGB 1KGCD 3BSZL 3MX0B 3Q5OA 2YJQA 3MRNB 4I4WA 2GBUA 2F8OA 2FSDA 1J1OH 2YQ3A 3BAYA 2WHVA 5I8KL 7TAAA 2JI3A 4G9DB 4JPKH 1PX4A 4W81A 5D8JL 4YDJA 3A4DA 1KJ2B 1DQDL 3KWTA 1R3JA 2CLRB 5I6MA 3I6KA 2LQRA 1KY7A 1WFOA 5FHBL 3OWEA 4FD0A 1KG0B 5EUKA 3MRHA 5JO5B 1V7NL 1PL3A 1GZQB 2YAQA 2DYPA 4MNGE 3VI3A 3K2UL 2AXHA 3SDAD 1G4RA 5D7SH 3C60A 1L4IA 4JR9L 4TVSa 4WWOA 5BZXA 2I60H 2XN9E 5CBEB 1N8OE 3MV7B 3SDDB 2EKSB 2OXHB 3L95B 3RI5K 2YRLA 1RZGB 2H32H 1CXHA 3S35H 3HHRB 2YK1H 2EXYD 5E1AA 5D1XC 5FKPB 2YS4A 4JFZH 4LVOC 4DF9A 3HPLB 1OAKL 2TRHA 2ZKMX 4NBYB 3RDJA 4KVCH 3TEZA 4RGOH 2FE0A 1XCWA 4HKBA 5FCUL 1IGJA 4GAJL 2FJSA 3HKZA 4AZ8A 1FSKB 4JHZA 4IS6A 4HSQA 3UGXA 1WISA 3UTTE 4DVBB 1IQDB 3GHBL 4K0OA 1JWMB 4M5TA 4CVXB 2VDRB 1FO0A 5JDJA 3TPUB 1DBBL 2BP8B 1IILE 1XXDC 2XICA 1DBAH 2OULB 3K91A 5DWUH 3T6ZA 3O3BB 1UT1A 1OIOA 2V9TA 3CVIL 1J9TA 2YA1A 1QSEE 3ARQA 3KYMB 4WAFA 4BZ1A 1DVFB 2Q8AH 5L2KE 4BUQA 4HW6A 1A66A 2AAAA 1A7BA 5JXED 5IWLA 1XF3B 1RUML 5DHVH 3ML8A 5J5EA 2B0SL 4Y19B 2C3HA 1AE6H 1OSYA 2R39A 1A6TA 4RGNE 2FNWA 2DQJH 4Y2OA 3WDJA 5KYWB 4OB5H 4JDTH 3WFDL 3EYOA 5HHXL 3EYUL 2OX5B 2F1EA 1CB4A 4KQ0A 2GJ6D 3VD5A 1I75A 4LAJH 4JQIL 2XBTA 3ULUF 2XXMB 3QIWC 3RIFK 3KE0A 3Q8CA 4C4BA 2BNRA 2YKLH 3BAEH 4N85A 4CDHA 1FCGA 3CXFA 3KNBA 3HG3A 2CLZA 1JHTB 4OF7A 4AQ1A 1KBVA 1U8CB 3EZ8A 3MZTA 3N1FC 4PG9B 2FQGA 1WC7B 1J8HA 2WV3A 1R6VA 2W0FA 4CSPA 3JV0A 1AQKL 2XPGA 5D1ZA 5F8RC 2HXAA 4W9FC 4FAAB 3QI9D 4OAWB 2Q5BA 2OSWA 4HCRA 1ZAGA 2GSMB 4HZ1A 4IHOA 4PY7B 4Y2DC 2CALA 3C08H 4FFZH 1FI8C 4C56D 4HAFA 3BKJH 1J7VR 2DWYA 5H35A 1OWWA 2IDTA 1SXBA 2OFQA 2E7BA 3HFMH 5EZLA 3K6NA 1RIUH 4WI4A 4OSUL 4ZAKC 5GJTL 4A6YB 3PU7A 2ETWA 1YMMD 5I75C 4GKOA 2YQBA 3BP7B 2ADIA 1GGCH 1TVDA 3NIDE 4UT9H 5CN2A 3QIBA 1UD8A 4L0PB 5EUOF 2VR4A 1J8SA 3MUY1 1JCKA 4PGEB 5D96B 5IBTH 3IJYB 1UT2A 3CSFA 4ALAL 1VERA 3FT3A 4JN1H 5ANMB 3GHPA 4FX5A 3ZDXE 2PNDA 1WSST 3VFOB 3IETA 3AB0B 1I8KA 2AJ3B 5J6HA 1CGSH 3PJSA 4FQIH 2Z35B 5C0ND 1XF2B 5ICXB 4BFFA 5IROD 1R5VB 1BQSA 4XNMA 1TZHB 3K8MA 3OKDA 2FLBT 4Q9RH 3CCHA 5GRZA 1CVSC 3SKNB 1AGFB 3KVDD 1M6OB 3PL6C 1ID2A 1WAAE 5AUMB 1OE1A 4ORGA 1NPNA 4JKPH 3P9WB 3V8OA 3HS0A 5IBLD 1UQSA 3D18B 4YE4H 5DQDH 1U8KA 1JZ2A 1T7YA 1XWVA 1JXFA 4KFMA 3WD5L 4N8CL 1Z5YD 2ZWLT 3IBEA 4X2UA 3ZR5A 1LWRA 5C8JB 2YXMA 1I9JL 1VFOA 2K6WA 3UBHA 1K72A 5T1DH 1E27A 4JFED 2HLFC 4H8PA 5E9AA 4EN3C 2X1OA 1FRGL 3JWDC 3VFRA 2PTTB 1I9IH 1BAWA 3ECQA 3BQUB 4JDVB 5FM8A 3HNTL 3V0WL 3VRIB 2IDSA 3D85B 4YHPB 5CD5D 12E8H 4P3DA 2K45A 4ACTA 3FO9B 4U6TA 1AIZA 4HZLA 5AW8B 3ILEA 4MS8C 1GKEA 3GUFA 2FD6L 3QC6X 1P7BA 4G8EA 1XGRA 1CK0L 1H15A 3RFZA 4JRXA 1HN1A 3AG1B 1R0AL 4RNRB 4XP9H 5GRWA 2F54D 4TLUA 5IBUB 3CFQA 3DTUB 4MX7A 5DD1L 3QHTC 4NNXA 1OARH 5D9SA 5LNDA 2VN4A 2M8XA 3IVKA 1P6WA 2CUIA 5EU6A 5ESAA 1AOZA 3HNSH 3MV9A 3QWNA 1BFOB 3Q2NA 1I1AD 1B0IA 5ALCL 4CAGA 4YXHH 1AFVL 2JSFA 4GG6A 3AG4B 4PWGA 3OKMA 1WK0A 3DGDA 4MNQE 4DERA 1NDTA 1XT5A 5D71L 1S8DA 3LKOB 1T80A 2R0WL 1ASOA 4QF1A 5IB5B 4KTDH 4FS0A 4AEHL 1FZOB 5HVHC 4HIEB 4NO2B 4PJAE 3KAAA 3DHMA 5A43C 3QWRD 1KV7A 4XP6H 2LW3A 1ZPUA 1S3KL 3S4SA 1E5YA 1KB9J 1FL3B 1XB8A 2DRUA 3GRWA 4HKBB 4GQ9H 4HWEL 4GBXA 4NC2B 4S1RL 2QSCH 1HI6A 5T1MA 3WFZA 3GDBA 1UD4A 3TASA 5E6YA 3IF1B 2BSRB 2WQWA 4PJFB 3MNVB 4KO6A 4OI8A 1CD0A 1HCZA 4YH6A 3JWDH 3DX3A 4AYSA 4JUSA 5IJCC 2GSIA 2ROYA 3MRMB 2C5DC 2BP5M 1H8OA 4HKJB 2Z0UA 1NAMH 4LARH 2D31A 5BXFB 3MRQB 4S2SB 4HWBA 3ILPA 1RZJL 3UAAA 1CF8L 3ZTDC 1JZ7A 4JRYD 1YMHA 3EYOB 3WN5A 1OCCB 3BWAA 4EAEA 4XWGH 5KVDL 2W8CA 3D09A 4CU6A 3CZSA 2H9GA 5ETUB 2W92A 4JUTA 3APDA 2Z1PA 2ALWA 5I19L 5D7LD 1GVIA 4H25B 3L8QA 4H7VA 3UYPA 1QR1A 4QHPA 1BWWA 4DGVL 5I71C 1T21A 3WELA 4JFXB 3I50L 5ESQA 4DZBA 4PP1C 3WAJA 3U0WH 3K72A 3R18A 2K4AA 4GNKB 4AQ1B 1UTDA 3H9YA 3ZIYA 2OMXB 2XFXB 4E41B 4HJJL 3BN9C 4X6FA 2Y1ZA 1NMAL 5KN5A 2WNXA 3DJRA 4XCEA 1E4KA 3PWUA 4FNLL 4P9HL 2NUTB 1XGQA 2XQBH 3GSWB 4JRLA 2CNZA 1RJZB 1B0GA 3JVFC 2PUQT 1ZVHA 1TJHH 2B4CH 1O9WA 2JTDA 1KY6A 2VR8A 4P4KA 3C2SA 1U3HD 2X4PA 4CNIB 4QHMA 3NCFB 4AIEA 3QO1A 2JJUA 4PTUA 3BGMA 2IAMA 1THCA 3QUKA 4IU2A 4JAMA 1LO3H 1KZQA 4G6FB 4Z7VB 3UGUA 3ZYOA 2APVA 1PEZA 1J5OL 5T5NF 1H8LA 3BLBA 2YPVH 4L1BA 3T71A 1YNTF 2Z8SA 1U8QA 1UJ3C 3HZVB 4WNSA 5IMKA 3TCXA 3AQZA 3VFPA 4TQEH 1MJUH 4Y4FD 5IB1A 5J6HB 1ED3B 1S7QA 1TVBA 5EOCL 2Q8BL 5KVDE 2AFNA 2QV4A 4P5SA 4Y8AA 4UV4L 2FYYA 2YFOA 3UBXI 4QXUL 3TESA 5IFJB 3C6LD 4RMBA 5F0PB 3VWJC 3QXWA 5F7YC 2O30A 4O51B 2IPTH 4ORGB 5K59F 4A7GF 4ZDHA 3HS0B 3GYRA 3OZKA 2ERJB 1X9QA 2LGNA 1R24A 7CGTA 3MXVL 4TNGA 3ARGD 5A7BA 4JM4L 3IMBA 1NBCA 1CUOA 1OPGH 2WMPB 3P54A 1E27B 5EBWA 1F1AA 4PBWD 4AL8H 3ABMB 5DUML 4NIYE 5GRVK 2OMWA 1OGTA 2XWEA 3IFNH 3ZJAA 4F8LA 4BCZA 2VC2H 1VFMA 4N20A 5HJ3A 2J5LB 1MUJA 5AZ2H 3U1PA 4WKZA 1PS3A 1YQVH 5MEPA 2J44A 3K81A 4WFGD 5CFAA 4YSUA 4G8EB 3RFZB 3VYPA 1IRAY 1UOVA 4KV5E 5LBSH 3O2DA 5CZXC 1AZCA 3BEVA 3FH8A 5JPNC 3SCMC 1J88A 5G4OA 3ZZSA 1ETZA 3IVKB 2X4UB 3NJKA 3PNRB 5CSZB 5EN2B 4O2CA 5IVXE 5CD3A 1KN4L 2W5PA 3Q5TA 5D4JA 4P23C 2IXQA 3AUVA 4M6NL 5IHZB 4RRPA 2JLPA 2XIIA 4OLVL 2HJKB 3ZMNA 5D1QE 1ITCA 4WHYH 3ULVF 4IOSA 1OTSC 4PM1A 4HLEA 3EBAA 4IBTA 2AJSL 1TETL 5GSRA 3SBWA 3BVXA 3FXIC 3WNIA 3DETD 1YLBB 2UZIH 4ONHB 3HE7D 1CZ8L 1QO3B 1SYVB 4KQ4H 4F7MA 1XF4A 3IAGC 3H3PH 3H9HA 3VGEA 4WI0A 1AXTL 2QHRL 4Y9EA 5AYQA 5TJWK 1UACL 1HZHH 1QFPA 3CH8A 2WXGA 1NBVL 3TJEL 3X3FL 1JHKL 2H0EA 2L7EA 3QNYA 4DGIH 4QT5A 4ZFGH 3TT3L 1NMBH 2XTJD 1YNKL 3DARA 5EFIB 5CJXC 1DL7H 2NY2B 2TSBA 3FT4A 4H26A 3W9DA 4BKSC 2FX9L 4JM2F 5FGBA 5CCJA 3S5LB 4FZ8L 2FGWL 1KYOJ 3AC0A 3SGEH 3ILPB 2V0AA 2R69L 5J3HD 3L54A 1OTUC 4EQ2A 1SN2A 1Q1JL 4EPSA 3O81A 4NO5B 3RIAF 2P80A 4MQXC 3PWVA 1RJCA 2BP0B 4HEPA 5CJOL 2WB1A 2ZPKL 1M57B 4DKAA 4E2OA 4LLMA 1N59B 4OF8A 3BEWA 2FNBA 5PAZA 3LSOA 3UYPB 2HT3C 1XFPA 4FI6A 5AYUL 5B38G 4Z7WF 3WEBA 5JHAA 2CQVA 4J28A 3MV8D 4DPBX 3DRTB 2TRYA 1MDTA 4FQJL 5J11B 1QFUL 2VZVA 1A3QA 1NFKA 4XMXA 3H2QA 1X6NA 1EHKB 3MRRA 1HYSD 1Q1PA 4UF7C 1AKJA 4TSBL 4MJIE 4FADA 2X41A 2EYSA 1FNSL 3P3TA 4G6MH 4MCNA 5BS0B 5LBVA 3SIKA 3D0LA 5KSBB 5C0IB 1KCUL 4K94L 4X7DC 3E6FB 1LK3H 1QBBA 2XKSA 3VWKA 4U1IB 1X5LA 2WWKO 2DL2A 3T0EC 2Z7UA 3W5NA 1QWHA 5T3ZD 2BK8A 1CFTA 3OAYK 1YAIA 2VR7A 3HI6L 4G8AC 1DQVA 5EIVA 4PTUB 4ABVA 1TJXA 4MA7H 3MLSH 4PH8A 3O9WA 2V8MA 3EUUA 3WHXA 4BFNA 2CRZA 4Y89A 1AGEA 2NMSA 3H7BB 4NDMB 1PG7X 4KXBA 4P5KB 4RDBA 3OHMB 5TDPA 5CZRA 5J57B 3EZJB 5BV7B 3BYYA 3GMPA 4WNQB 2J71A 4Y1AD 5IMKB 1U8LA 1RKRA 3VFPB 5KBKA 4ZXBA 1DQKA 1NCAH 2R4SL 5I15L 3QAZB 2PF6A 1WYJA 3RL2A 4LEXL 1AIFB 1ORSB 3UG3A 1T1YB 3TBWB 2NY5C 4JJOA 3B9KB 4BK5C 4JY4B 4KJYB 4XVSL 1FBIH 5ALBL 3MLYL 3TTYA 3D07A 4PIRF 4Y19D 1AD0A 1F4YL 1FV1B 2EDDA 2R7EA 5F0LB 4DP7X 4FNUA 4NT6A 2IV8A 3WN6A 4OV6F 3B1UA 2RIKA 3HG1A 4GRLA 1SGKA 5HDQH 3QUYC 1MCRA 3DVIA 1OP4A 2NY4C 1QSFD 1MVFA 2QT6A 4YXLH 1BQ5A 3V5KA 2RCSH 2UXVA 1UASA 1NGQL 1F4AA 3LQAC 1A14H 4I0PB 1F00I 5LGHL 3NN8A 3GNMH 5MI0C 1LVEA 1MFUA 1OAQH 4G8GB 1OGTB 5A1AA 4H2CA 4XCFL 1YPZF 2V2XB 2XG5A 5HJ3B 1G7LB 1QBLH 3CPUA 3NRFA 1VZHA 1MUJB 3CC5B 1MI5A 1GJUA 3U0TA 3UPCA 4FG4A 2Y5EA 4QXGL 3KLSA 4N2IA 4PREA 5TDOA 1W15A 4PCTA 3B7TA 1CLCA 1V3JA 2QBWA 5B7FA 5AVXB 1XBRA 2YGOA 4WWKB 4UTAA 2X6AA 3QK0A 5IW1A 4ODHL 1TPXB 1ZANL 1GSKA 2CWRA 1ETZB 4G7VL 5HHVL 4YDKL 5GGTA 3BP4B 3FDWA 2P43B 4L2LA 2GW5A 1JERA 4EKJA 4BXSV 3RPKA 3UADA 1SQMA 3GSQB 3N1GC 4Y9BA 5AKSA 1ZOXA 3CTTA 3V7AE 1LP9E 4TMPA 1BQLH 1E0OB 4ADGA 1OOAA 1KENL 2NY7L 2H0PA 3HN3A 4JMXA 1E5ZA 3RL1A 2HUHA 4LDCA 3E3QC 5AWNL 3V6ZB 1QACA 4WFFE 1BIHA 4MQ7A 2MOQA 2MCPH 2GEQA 1L7TL 3V4PA 2EE6A 1CGYA 4Y4KD 4F7MB 2J5WA 3PHQA 3H9HB 1BSIA 1XGPA 4M62H 4APXB 4WEMB 2GIMA 4W93A 5GGQL 4EZLA 3H4HA 2X3CA 3WYRA 1PU0A 3OAUH 4MQTB 5HYFA 4LAQL 5DZNA 2ZAGA 3L6FA 5E6ZA 4QT5B 3EYQD 1A4JA 4AYGA 2PYEA 2WM0A 5EZOH 1RLWA 2CXKA 5I26A 1JRHH 3S97C 3SE3C 1VDGA 1WFMA 3LHPH 4TUKH 4Z7NE 2YA2A 4ZTPH 1BMWA 3RWHB 2AQRA 2APTA 3GSUB 4YL9A 4KO9A 1DBKL 4DN3H 4DP4X 4J3BA 1AHWA 1JJUA 1VADB 4H26B 4OI9A 3X3GL 5GS0D 2I07A 2A0LD 3SDYH 3LKRA 2R29L 1RHHA 4NKMB 5KYYA 2ZOWA 2BSSA 4JZJB 1UB6B 1UXSB 2X2HA 3FTGB 4JFDA 2IDCA 4I13B 4YDLC 4UANA 1OW0C 3D85D 2DH3A 2EIDA 1IAIH 3HFFA 3MRGB 4Z18A 5IGXH 2ROXA 4X6EB 5IHWA 4FQQA 1GY2A 1OPOA 4P57B 2WO4A 2WINB 2G0LA 2H2SC 4N90D 5T5FL 4AITA 5ITBL 1KEGL 1RUAL 1KTJA 1QEWA 2AJUL 1GJWA 5E00B 4NWTH 5AB9A 1D7FA 3KGSA 2O5NA 3HB3C 4KH9A 1GZPA 2NYKA 1N2RB 3O3UN 1YN6B 4NCC1 4P2CG 3WIIH 3GI9L 2ODIA 4PR5A 1I3RB 4XC3H 3T3PE 1FC1A 2AP2A 2GUYA 1UG9A 4P07A 2ZWZA 3STZB 5I9QC 1T0MB 2WVTA 2J6EA 2DYPD 2J8UF 2HUEA 3LQZA 3U36B 1EANA 4NNYB 4UV7L 2A9NH 3PV6A 1MREH 2QKSA 3QR2A 4F7CB 5CLWA 2ZX7A 2CK0L 4KAQL 1NGZB 1E5BA 2EYSB 3HPJB 2CIKA 3D0LB 4ENED 4OCYH 4FYTA 4YSPA 1J10A 4HS6A 3U9PH 3N41F 2LVEA 5F89B 4DH2A 4L4TE 5B3SB 5KG9A 4KHXH 1T66D 4R5XA 5J1TC 4PS7A 1W9XA 3W0WA 1CFTB 3SY0A 5K39A 1RULL 2HT4D 3CZLA 1FNGB 1LE9B 1FPTL 3QQ9D 1KGCE 4LQFL 2R8SH 1HXMA 3S4SG 1NBYB 2FCBA 4CMMB 1ETJA 3GTTA 5BVPH 4PW9A 1CYWA 4XCNB 5E4EC 2BC4B 1G1OA 4PJ7E 4WLCA 3PDOB 1HCFX 1A3RH 4OVVA 5TDPB 3KYOB 1HKLH 4KNQA 2A74C 2HH0H 1EFXA 3GMPB 5D6CB 3V5HB 3W11C 1AR1C 4I2XB 2B59A 1I85C 4ZXBB 4QTIL 1KC5L 1E3FA 2R83A 2W0LA 4OZIA 2JELH 1P84K 4NPKA 4A2HA 5JHBA 1N8ZB 1F8TL 5F6HI 1UOWA 3BPOB 1MRFH 4I8DA 3B3IA 1JK9B 4K15A 5FO7B 3L9RB 3PP3K 2A6JB 2CD0A 4OD2B 2FVNA 3DSFL 5JW4R 3TBTA 2ZXGA 4NT6B 5E7BA 3OR6B 2JQZA 2LAAA 1PKOA 2AXWA 1NKGA 2Z31B 4DTGL 5DQ9A 2MNJB 1NMCB 3UG5A 2BZ7A 2DS4A 5SX4I 4DGYH 1P4LB 5LDSA 3QS3A 3EHBC 4LRNH 1IGYB 2WKGA 1HHJA 3EFFA 3ISRA 1SXAA 4AENB 2BRRH 2BNRD 4NHUA 5FA3A 4GSRA 3D9AH 2RQ8A 4K7PH 4N28A 3NIDF 3X1FA 1NM4A 5SWSA 3ULUC 1NCWL 2BW4A 3QPQD 4NUJB 3LTVA 3HR5B 2V2WA 2E8ZA 2WXLA 2XG5B 3OJDA 3VDBA 1MH5A 4UDUA 3BKMH 3MKGA 4B95C 5D7JA 2X44D 3H0TA 5IT2L 1CT8B 3FFDA 3ZDXF 4LBEA 3TYFA 4PJXA 2NW3B 5D1ZD 3SKOA 1OGAE 4JZNB 5KAQG 2XKUA 1JV2B 1TU2B 3RIAK 4WTQA 3TA3A 1QEXA 4HIHB 1F1GA 2ESVE 3FAWA 2PP8A 3S9DB 4GW1A 1VEMA 2PWHA 2IBGA 4XO5A 3IBOA 4ZMVA 3UTZA 2OTWA 1CDJA 2UXGA 3FB6A 3QUZB 3CLEH 2OYPA 4NI6A 4XXWC 5D5ME 5F96L 1KIQA 3TS8A 5DUPL 2CDGA 4GMSH 3DDGA 3H3KA 3OPZL 2GJ6E 3HHSB 4G6FD 4NFDA 4FTDA 1I4FB 3FCUB 5DK2B 5HDRA 4XPTL 3ARFA 3GHEH 4PRPB 5DJYB 5ABZA 2RA1A 1URIA 1A7OH 5IEKA 4ISVA 1VFUA 3Q8AA 5GGUA 5IESL 3K71B 3V4PB 2IGTA 4WVRA 1OZTG 5FR3A 1YEKH 2VDQB 1PZCA 1A9EB 4JJHA 1JZ6A 2MPVA 1DQML 4KQ3L 1KNOB 1BREA 3WHE0 4MKTA 4PJEB 1ZGLA 5H4ZA 2LU3A 1NLDH 3DV4A 1TQTA 3IN2A 5EBGA 4FDWA 3NZSA 2AEOA 1UADC 4W9KC 4AEEA 3MC0A 1ZK9A 2F74B 3F05A 2H2PD 1E4XL 5SX5H 1IL1A 3CH1A 3SOBH 3V5DA 1QBML 3A22A 4AM0B 1UJTA 3N9GH 1XGYL 1ODUA 4HHAB 3FAXA 3ULUH 4NZRL 5JIMA 1HU8A 4B50A 5IHHA 3U48A 4AKOA 3MJGX 3LH2H 1JZJA 4IBWA 1Q0YH 1DVYA 1NIAA 4G7SB 5BW7A 2ZYIA 3GMNB 2K0RA 5CGTA 4NZTH 5DS8A 3ZKMD 5HGDB 5HYQB 3K6OA 5HI5D 2F68X 1BZ8A 2CR0A 2Z93A 3GXMA 5LKNA 4UBDC 2RD0A 3NAAL 2ZOLB 4GKSB 4FQQB 5AOKA 2J4WL 5AKTA 1PTZA 1BF5A 5CCGE 3CGTA 3SDAC 4JW3A 3VO0A 5KANI 5D6DA 2XVLA 4JJ5A 1L9MA 1FCCA 2JJSA 4FJYA 5AW4B 4JRXD 3NJFA 4PY8I 2IC2A 4GLRH 2ICWI 3WJJC 3GSNL 4OM1H 1M7IB 2EAEA 4HMEA 4OH2A 5KOVC 3T0VA 1I8IB 4HJTA 1CD9B 4HK0A 5D7HA 3V6OA 2Q6WA 4B3EA 2EYTB 4ETQA 3LQZB 3FUNA 4YX2L 3PV6B 3TLRA 3MGOA 1JWSA 1I1YA 3DJ9A 1QFWI 3OAWA 4XVTH 1UWYA 3WHE1 1MCSA 3VGBA 1I7RA 4A2EA 3KPNA 1K5NA 1H6UA 3OJMB 4URTB 2QQKH 2A9BA 5KSAA 1WGVA 4GKLA 4YC2B 4GAGH 2F1AA 3CQPA 2HVJA 3GKWL 3BC9A 1MW3A 2XZZA 2A4CA 4NOBA 4JFEE 3HRZA 4BXVA 4LCUA 1S6NA 1OZUA 1IC5H 4ZK8A 1VLXA 1D5ZB 1RJLA 3H53A 4O02H 4PJGA 2OJZH 3K2KA 3UP1A 4APQB 3OF6D 2OSLA 3HIZA 4JO3L 4PGDA 3HI1A 2C8NA 5HD8D 4XE5B 4MCMA 3LMJH 1T7XA 4GQRA 1UXWA 3N44F 2FO4A 3FN0L 2P8MB 1MW0A 2F54E 4U6HB 2EEDA 4B9GA 3IWVA 2NY2D 4JO4H 4RMUA 5D93B 5IREA 1GYCA 5JIQA 1KPVB 4QO1A 1RK1B 2AXGA 4XPBL 1F02I 2H0JA 1UC6A 3D06A 5L2JA 1A1MB 2EH8H 5KYNA 4H1LA 3FB8A 3JUZA 4X4MA 1CMOA 5KEZA 1UD3A 1TJMA 4W9JC 1MRCL 1MRDL 2E6PA 1DQIA 1Q9OB 1ZTXL 3EFFB 3D0VA 3J8F7 5I5MA 1JGLH 4X4XA 3WCYA 2W65B 4AVHA 4W9CC 5FA3B 1V55B 3QI9C 4OM0H 1ZLUK 2AZUA 1RIHL 4XCCH 3BIKB 3VXTB 5DMKB 1Z0MA 4PRHE 4UQ3B 3OJDB 4H8WC 1MH5B 3B37A 4OZHA 3QARA 5D7JB 1D5IH 3NJNA 1ZLVK 3O8XC 4K5LA 4PV8A 3H0TB 4XO3A 5DHMC 4GS7B 4IGBB 1PZ5A 2OYMA 3SKOB 4BE5A 4JFUA 1C1EL 1RY7B 4KRPD 5BZWB 5F7WC 1ZA3A 3ZKQD 1IT9L 2HT2D 4QCIA 4U6VH 4OD3H 3D39B 4HXAH 3U0PA 2CPCA 3N42B 3EAKA 1JF6A 2MNWA 3OZ9L 4XPFH 1VKXA 2A9CA 3M46A 3LVTA 4I89A 3FB6B 4U49A 2N0MA 1KGJA 4W4OA 4JFTA 4HGWB 4JRYE 3LRSA 4C4KT 4AYFA 4DNLA 4EEEA 3S96A 3V4VL 5B3NA 5I0WA 1RU9H 4Z7QE 5JA9A 1BOYA 4ODSH 2WZ6A 3MJ6A 5L7XH 2R2HB 5E03A 2R2BB 3EDFA 4KDTA 2Z4QA 5D7LE 3HUJE 4DZ8B 5GRJH 2BWIA 4ISVB 5B1BB 2NUPB 3V4UL 1BWMA 3VTMA 5I66B 4NAMA 1FVEA 4MJ5A 2OKMA 4NSKA 1JGUH 1Z6JT 2AHIA 3V4LA 4WDIA 1ZTXE 2BY1A 5DRWA 5E8NB 4U3CA 2VZOA 4F9PA 3N43B 4X7TA 4MVBC 4HMDA 1KBWA 2Y6SD 1XL6A 1OXYA 2KERA 3O6FA 4KV5F 4NQUA 2GABA 4OVUA 3WL9A 1IGCL 4WW1A 2F2HA 2Q3AA 4FI8A 1PVHA 1VHPA 3MREA 2UX6A 1CFVL 3FQ1A 1OE3A 1IEBA 5IVXF 3ZE2E 2E3VA 2O5XH 5LO7A 3D0AA 3EGDB 4I0PD 2D7TL 2PCPA 4J3OD 4UQIM 5C6TL 1CQYA 2ZZUT 4AMWA 2VDKH 4Z0BH 5FYKD 5MHSD 3EH4B 5JDSB 2Q9OA 3IJEB 4CJ0A 1D3CA 3WO3B 1O6SB 4Q97A 1Z2KA 2PO6B 3CFKB 3S3BB 3UBXB 4OZGA 3MRDA 4KWUA 4EI5A 3QDGE 2COVD 3PPEA 4GXVH 1GSMA 1ZPLA 1U2YA 5CUSL 2BOBB 1JNHB 3JZ7A 3PXJA 5DRZB 2J55A 3ASWA 3G5XA 1F42A 3BUYB 2DQHL 4L8SB 1M71B 2WZPD 2IQAA 4LHJB 4WWKD 4MZ2A 2AVGA 1XEUA 3O3AA 4YAQA 4GW4A 5CCKH 2EEFA 4X9BA 1AH1A 5IFAH 4K07A 4DQOL 4JGMA 5CJQH 3MGOB 3BVNB 1JWSB 1JE6A 2MH4A 1RFDL 1M1XB 3B7YA 3TM6A 4FG6D 4JFWA 4HJ0C 2H1PL 3MJ9A 1P5UB 3AU1A 4U6YA 4IOSD 3G5ZB 4NPYB 4M4PA 2WVVB 4R2GB 2P5EA 1GW6A 5LWYL 4WGWB 2JI2A 4IBUA 1MFAL 3OB0K 5CGMA 2ZIDA 4LIQL 4ELMB 3Q6FB 3HNVL 1I7TA 4PJDF 3KYAA 1I9RL 3GJFA 4AVIA 1MLCB 2QKIA 4FXLA 3B2DC 1DVXA 1YUHB 3KD4A 3LEXA 5E8DL 1K4CA 4U1JB 1FDLL 1ETA1 2DWDB 4WFGE 1UKQA 2P5WE 5B3JF 1EMTL 2X1WL 2EZ0C 5F7MC 3SE8H 4P5RA 2DIEA 1F41A 4GO8A 1F2XK 3VFUB 1Q9KA 5E0FA 3TYGH 1FFNB 1Z7JA 5F88B 3P3UA 4BFJA 4MKMA 2FX8L 4G2AA 2C9UA 1HWHB 3ARWA 3FQYA 4LF3A 3IPEA 4OLUL 3KWXA 3CSYB 3LNGA 1LEIA 4HUXB 4WHYG 2BMKB 3AABA 2F7RA 3HLAA 1AD9A 3I3EA 5MENB 2ILLA 1ORQB 3FCSB 3CDZA 1ZMYA 4OLZH 3DK2A 1Q94B 4JPSA 4JM2C 1BD2B 1RIVL 2GYSA 4Z7UA 1KLFB 1D9KC 2A1WL 2P80D 5BZDB 4WEBH 4ZPVB 4Q58C 4TYUA 3RGVA 4HIXL 1Y07A 4I85A 4HUWA 5E99H 1LEGA 1YY9D 4CU8A 4R3SB 2EC9T 4MMXA 3UROR 1MQKL 4K3DL 3FTVA 1PZAA 2CMRL 4FJZA 2WBWB 3TX4A 4X6BB 1F86A 1UZ6E 1IKNA 4NN6C 4UZGA 1CICA 1LLAA 4YZFE 2E76C 3AZUA 1U3HC 1HIML 4LIQE 4EI6B 3F01A 1AKJD 1USZA 4AGMA 1EGJL 3Q6GL 4RAVA 3MRLB 2XA3A 1PFCA 3S3SA 3ULVH 1BG9A 2XTJE 3IGUA 1OF0A 3EO1B 2I9LB 4HWNA 2RGSA 4LMQI 4ZTOH 5E2TH 4QCIB 2LU4A 1E2ZA 2G75B 5F9WC 2ZF8A 5C0GB 2ZG1A 3IFOA 1P4UA 3QZOA 2DI8A 4ZODA 5B1KA 4HA1A 5INCA