1TYJA

Crystal structure analysis of type ii cohesin a11 from bacteroides cellulosolvens
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
170
structure length
170
Chain Sequence
GSVLTAIDNDKVAVGDKVTLTINVDKITNFSGYQFNIKYNTTYLQPWDTIADEAYTDSTMPDYGTLLQGRFNATDMSKHNLSQGVLNFGRLYMNLSAYRASGKPESTGAVAKVTFKVIKEIPAEGIKLATFENGSSMNNAVDGTMLFDWDGNMYSSSAYKVVQPGLIYPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a type-II cohesin module from the Bacteroides cellulosolvens cellulosome reveals novel and distinctive secondary structural elements
pubmed doi rcsb
source organism Bacteroides cellulosolvens
molecule tags Structural protein
molecule keywords cellulosomal scaffoldin
total genus 39
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2004-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1tyjA00
2Y3NA 5G5DA 3GHPA 4WKZB 3BWZA 2XDHA 1G1KA 3F2LA 2ZF9A 3KCPB 1AOHA 2BM3A 5LXVA 2VN6A 1OHZA 2B59A 4UMSA 1TYJA 2OZNA 4UYPA 2VN5A 1ZV9A 3L8QA 1QZNA 4U3SA 4DH2A 4FL4B 4FL4C 2CCLA 2O4EA 3FNKA 2W1NA 4IU3A 5K39A 2JH2A 5AOZA 4WI0A 4IU2A 1ANUA 3UL4A 2VO8A 4N2OA 3KCPA 4UYQA
chains in the Genus database with same CATH superfamily
2Z0BA 3IPEA 2OMTB 1UA6L 5DK3A 3TT1H 3Q0HA 4XX1E 2HTLD 1NKRA 3KDPB 4E41A 4N8CH 2HLFD 1MRCL 4AH2B 4HV8B 4TS6A 5L6YL 3BDXA 3RDJA 4P2RA 5C0BB 3VFNA 3QISA 2KPNA 5DUJA 5IMKA 4H1LH 4U33A 3TNMA 5ISZA 3RX8A 1DBBL 2H6PB 2FE0A 1UQSA 3MV7D 2XWEA 3P4MB 1LO2H 1TSRA 3EJZD 3GSQA 1MSPA 3KDMA 2Z8WC 1Q94A 2BW4A 4O5LL 2I07B 2JB5L 1HIML 3C9NB 5EZIL 1B0IA 1AFVH 2Y5TA 4YDNA 2AQ2A 5DGRA 3DOSB 3PGCB 4EMZA 5B39A 1UUNA 5EC2B 1GGIL 2VH5H 1HQRA 2C3WA 4L9LB 4QMEA 4Z7AA 4XMWA 4H88H 2X41A 1FL3B 1PQZB 1DBAH 1JDAA 1JZ6A 2KQMA 1QHOA 3R06B 1N5AA 3MLXH 2IAMD 2HVJB 2P45B 3QUMH 4HCRA 2B2XH 5GGVH 4LSVL 2IADB 5LAXA 2WXNA 3OQ3B 4LEOB 4ZS6D 1IM3B 2VDNB 5D1ZC 1IGYB 3W9DB 5EN2B 5C07A 4WHTB 2IBZY 3NT0A 2NZ1A 1J5CA 2P8LB 3S3CB 3D69B 2P8MA 3AADB 3WD5H 2Y5EA 5F0PB 3FUDA 3IDMB 2PCFA 4OI8A 3BZFA 3RURA 2FEEI 2K3TA 5IJVA 4Y5YC 3GBNL 2OXHA 1NFDB 1U33A 1W72A 1BP3B 3NCMA 3MRCB 1JGEB 4MBRA 5FW7A 4IQHA 5TDPB 1T7XA 2IANB 3ARBA 4PCTA 3OBAA 3IJHB 1KYOK 4YSSA 4X8CA 5F96H 2HYMA 1VFMA 3U9WA 4E9YA 3MJ9H 5DJ0A 4A63A 1QYGL 1R19A 4WU5B 3UG5A 3ZGHA 4P5KA 2FLMA 4N26A 3VA6A 4AZ8B 3LN4B 4LLYB 5CD3B 3NESA 3I6GB 3NZHH 4PLOB 4ACPA 3MRQB 4HOXA 4KVPA 4TQEL 4L9DA 4TULH 1DQLL 5FPIA 2PYEE 2CO2A 1IAIL 2CHNA 4I88A 4ODUB 1N2RA 1ZE3H 4WEBH 5HYJB 2Y9RT 4LSPH 4D9RD 3UX9B 3D5OF 1OP3H 4X7TA 5HHVH 2FQFA 2X9ZA 1ND0B 2FX9H 4XBPA 4GG6E 2EXYC 1RIHH 3CX5J 2XPGB 4NQCB 4AEHH 1N19A 4UQEA 1BYNA 4HOMA 2CKNA 5CEZD 1Q1PA 1CD9B 3OVUB 4FP8L 4PJ7A 4WTZA 3RWDB 3G6AB 3TURA 1YMMD 3ARZA 4FYRA 3S35X 4IRJA 5F9OL 1K2DB 1B0WA 1SN0A 2Z4QB 3ATBA 3VM7A 3C5ZB 4BGDA 2B15A 4RAVB 2FATL 3P02A 4Y4KA 4MSWA 2XLLA 2CIKB 5TQ0L 1XGPB 4XN9A 3RVUD 2DJMA 4Z0BL 3WUWA 3ZR5A 3MN8A 3GDCA 3M1OA 4PJ9A 4BK5A 1YNTF 4AE0A 3PPEA 4NPJA 4LCYB 1A25A 1RU9H 5E56A 3OL2A 2EYRA 1H3VA 3A6OA 3GSOA 2Y5QA 4XBMA 4HBCL 1U8CA 1A6ZA 2QADB 2H3KA 1QPKA 1T1ZB 2D9CA 2EDEA 4QT5B 4AIXA 1UUSA 2CXKA 1A3RL 2D3NA 3BC9A 4P2QA 1QHQA 2ICWI 2HJKB 1ZLWK 2G5RA 3RFZB 1HDMB 4M56A 4E0RA 2V8MA 3HNTH 4OM1L 3FU5A 1K4CB 5DC0A 3HFML 3WKYA 3HUJF 5AOLA 4RVBA 4Y1SA 3RTQB 2FL5A 4PJ5E 1T66D 3SE8L 4A2GA 3PJNA 4R7DA 4Y4HD 4FFVD 3UP6A 3ZL4L 3BAXA 4CGTA 3B1UA 4L0ZA 4LAQH 2B3IA 3LAFA 4RETB 5I15L 3APFA 2VDMB 3U2SA 1U95B 3HJEA 4XWOD 5I2IA 3EOBB 2NYKA 4GUPA 5KJRL 1AGFB 4MJJA 3DO7A 3N1MC 1ZRUA 2FD6H 3LB6D 1JRHI 2YD3A 4FN0A 4IW4C 1AIZA 3S37H 5C09D 3ARDC 4M4RA 3UTTE 1IEAA 3NCJH 4HWBL 1LWRA 5CEYA 1Z6JT 3CZKA 4GS7B 4DP0X 4EOWH 1YSOA 3DTDA 4CW1A 1DZBA 6FABH 3L3KA 1SDYA 1J8RA 4OM1H 4JDZA 2CLZB 1QSED 1RERA 2VLJB 4CVZA 5ICYB 4L5FE 4LCCB 4N2MA 3K0YA 4KHXL 4PCYA 2UV3A 4R90H 3VFUA 4Y16B 2FO4B 2J1WA 2NQ3A 5DT1L 1F3JB 3OD3A 5HI5C 1HHKA 4P2CG 2WCPA 5D72H 1FFTB 2X4OB 1DBMH 4N22A 3ASNB 3BRGC 5H37G 3DARA 3MNWA 1O75A 5FGBC 5ITFA 2CO6B 3MRBB 2IPUG 4U05A 4AEIH 1R9FA 1DUYA 1VZHA 4RA0C 1ITCA 3TWCH 2ADJA 5J13C 1TNMA 3WMSA 3U6XA 2OMUA 3LIUA 5E2UL 5E70A 5SWSD 1E2ZA 2VXVH 2FQGA 3SCMB 1QSEB 1GAFH 4K2UH 1Z9MA 5I6XC 3S98A 4UILL 5M95B 1BVLB 5BO1L 4ZFQA 1HH6B 3QCUH 4K8RC 2F5BH 1DVQA 3UZQB 3ZYOA 1HOCB 2VXSH 5C0CA 1WBYB 3UYOD 1OTSD 1SF3A 5I18L 3GPEA 1ED3A 4GQQA 4HHGA 4ODWA 2MRYA 1XXDC 2X6UA 2HRGA 1OTTC 4FNTA 1NOFA 4XCFL 5HYIA 2MOVA 1LD9A 3DDFA 3FC8A 3ARFA 1RZFH 1DQLH 2YUVA 1XHHA 5CEXB 2YAMA 1DR9A 3KBEA 1SEBB 5GZOC 3UYRL 4Y1AD 4MMXB 1QTSA 4ZFOL 3VFVB 5KVEH 4D7BA 1KT2B 5I15H 1H15A 1I9JL 3CN2A 4LNVA 2J25A 5IJVB 2DBJA 1T20B 3IDMA 5DVMA 2JK5B 1U8MA 5KSAD 2WXQA 4Z95H 3UROR 4UINH 4IOFC 4FXKA 3PWUA 1L9OA 2LTQC 2F53E 3RVXD 2FX7H 4PJGF 1YY8A 2EYTA 4IRJC 4U6TA 4M62L 3ULAB 5I71C 3EYVB 5C2BH 2ALAA 5I1LB 1ACZA 2IH9A 3VFTA 5FUOH 4BFIA 4FQJH 3T6ZA 5GS1C 2H2SC 4AV5A 3UZEC 2I9LB 4WI5A 2X4PB 5D2NC 4WDIA 1MFBH 1TPXC 4PBXA 5PCYA 2B1HL 3RTLA 2R2HB 2YKKA 5IB2B 4ERSL 3IETB 2XZAH 3MLSL 5IFHH 1E4JA 2FVNA 3LS5L 4W6XB 1YEHH 2XDHA 1RJCA 1JF1A 2AKRB 3GFUA 5GHWL 2R29H 3BCDA 4NO5B 4NQXA 5F71A 3OMZA 3RWCA 2P5ED 3SGKC 3CK0H 5E08L 3ABKB 4IBZA 3EJYD 1CIDA 3WJMA 2WLYA 1U8OA 1CG9A 5JQHC 2ZUWA 3HC3H 3BGAA 4PRDA 4UUJA 5IJKC 3MO1B 2WXIA 2WXMA 1Z1WA 4LLWA 3ALXA 5EZIH 4UQDA 2D0HA 4EKXA 1RL1A 1S7UB 4KXDA 2NRDA 3BHBB 3SE3C 3UTTD 4FCHA 4I77H 4XRCB 4DQOL 2FECI 3P9WB 3GJFA 3RNQB 4AQ8C 4KVNH 2VH5L 3IJSB 4L1BA 4ABQA 3VB8A 4EUPG 1AI1H 3QCUL 4XB8A 3VH8A 4YAQA 5I73C 1JE6A 3O0RH 5CJOL 3DIDA 5C0GB 1D6VH 4BCXA 2XYBA 4QOKE 4Z77A 2CHXA 3SKJL 3C75A 1DVFC 3T09A 1VFBB 3LKSB 4OD2A 3INOA 5E8NA 1NCCH 3QDMB 4OH2A 3IU4H 5GSVB 2CJUH 3MSPA 1EVUA 1AS8A 2C9RA 4Y5VC 5F7EL 4U6HA 2ZX5A 5C08A 4UOZA 1MKFA 1G0DA 3GSNH 3I6KB 3HB3D 3TA3A 5M94B 5B21A 1KYOJ 4F9LC 4JZOB 5FYJE 3UBHA 1EGJH 1HEZA 5D2LB 1NCDH 4P2OA 3Q8BA 2DLFL 4FFYL 4XP4L 3LVTA 3J2PA 1UH2A 4FQHA 4FHJA 1Q0YL 3X14A 2X4NB 3EJTA 2CO3A 3P2DA 3SDDB 1YEKL 3CFKB 1NGQH 3SODB 1FG2B 2HKFL 5B38G 4NHCL 1OCCB 1OCOB 1NDGB 2OAAA 1EEYB 1TDQA 4Y4FD 3RY5A 1RH8A 3S6CA 3PXJA 4TNWK 5EEXA 1HQ4B 5ALCL 3N43B 4HAGA 3NCFB 3IMSA 5GRZA 4LP8A 2EH8H 2X7LB 1YEIL 1M7DA 5GGSA 4NUMA 4GRLB 4TL4A 3D51A 2Y6TE 3BW9A 5FM5O 4JK0D 1A7QH 2Q10A 4QRAA 1M7UA 2ZCLL 3JWNE 3SE4A 4HUMB 3U36B 2UX6A 1OD7A 3MRJB 3UJIH 2ESVE 3QHFL 4XCEB 5FGCE 1F42A 1MCOL 3GSNB 5C0FA 4DN3L 4GQRA 2R1XB 1XD0A 2ZUYA 4WHYH 1OT4A 4DGIL 3VD1A 1TJGH 2WWNA 4YFLF 4YHZL 2FK9A 3NOIA 5EO9B 4AOFA 1OLLA 3IJEA 4CSTA 4KU1A 3EGXA 3RVUC 4BINA 4R2GB 3UGXA 4IBLT 2F7PA 2ADIB 4YSQA 2VR4A 3MLZH 3ORJA 1K3IA 3FRUB 3HZVA 1NZRA 3C60B 1BVKA 2AQRA 1HJCA 1T0NA 4OD3H 4AL8L 3B9KC 5K59F 2QHRH 2E9WA 4ZUUB 1A3QA 1CYWA 3PWLA 4N24A 3MGTB 1JTPA 2XWZA 2NZ9D 3HNVL 4X80L 3AUVA 5EO0B 2EAEA 4MZ2A 5ITBL 3RWGB 3H6AA 5EO9A 2WCGA 5ICXB 1XF3B 1RUAL 3MV7B 1LE5B 5A6MA 1IGIH 2VMEA 3DSFL 3MJ9A 4Z3EA 2K6YA 5JXEA 3S3JA 2CNYA 4OLEA 1BZ7B 3GSNA 4NWTH 5IV2B 1L9NA 3LRKA 3VFMB 1LO4L 3JTBA 1RZJH 2G0LA 3B37A 3HHMA 4R26H 5ANHA 1F8TL 1I85A 5JDJA 3QUZC 1ADQL 3B5HA 3VSTA 3EF7A 1KN2L 3V6ZA 4LCUB 3QRBA 2PCPB 5DTFA 3DVFA 3FQUA 3E8VA 4YOKA 3M46A 1IGIL 1C5DA 1V10A 3O2DA 1HK6A 4DOHB 2GCYB 1O5DT 5BJTA 3QYNA 5IMMB 1UH3A 5IEKA 1IJNA 1EEYA 2VKXA 2DL2A 2BP8A 2R4SH 4CGUB 2OSLA 1M6OA 3PIQB 3E1ZA 1NM4A 4WJ5A 3BSGA 3QO0A 3L3IA 3DSNB 1ZLUH 3X1EA 3MBED 2X12A 3TASA 2NNAB 1CFBA 4QLWA 3PNWB 1FNFA 4Q4IA 4KXAA 2WKLA 3O6KH 1UWEH 4PEEA 3ARGA 3LH2L 4OIFA 3ZYJA 3MCLL 2QKIB 2Z35A 1IEBA 4NO2A 4GW4B 4NJ9L 5TDNB 2EO7A 3I6KA 1A4AA 3IMRA 5AD0B 1G9NC 2C4XA 3SZKC 3S5YA 3GPSA 4JY4A 2OMWA 4NBXB 1CVSC 1FAIH 2ESVB 5D1QD 4TSBH 5E8NB 1JRHH 1AOHA 2CM5A 2IG2H 2QSQA 2R27A 1UJ3A 4HD5A 3MLWH 2MCAA 1RZIB 1R5IB 3UZVB 5BPPA 3D50A 4UDUA 1BA9A 1MCRA 4NO2B 3N1FC 1E40A 3NSJA 1EPFA 2VQUA 4Y8DC 3PV6A 2APBA 1X9UA 4F9LA 1R3IL 5IROD 4JPIA 3O3DA 1X5ZA 5LKNA 3ZE1F 4J2XA 1RD6A 3MV9A 3WN5A 4W9GC 5FOJA 5DJ2A 5DQDH 4UM9D 5IJBC 3QDAA 4J1UB 3C5SB 3LNFA 5E5MA 2QLVB 1A4KB 3QJZA 2N3JA 4PJAA 3X3FH 4CU6A 5D2NE 5IMMA 1IC5L 1OP4A 2F53A 2WKOF 4FQQB 2GCYA 5KBMA 5B39G 4ZK8A 4BSJA 4V1DE 4GRWF 1T66C 3VWKA 3AGWA 2C5DC 1UM5H 2P8PB 3KGSA 4X5XA 2H26B 2D4FA 3JT0A 3R4RA 4X8JB 4DP2X 2JKIS 1FZJB 1WRFA 4PYHA 1R34A 4FTVA 1MVUB 2J21A 3MNZB 4UT9L 1ZHKA 4KV5E 4ZFFA 3S7GA 1HSBB 1N0LA 4PBVC 2YUWA 3OKEA 4LARH 2IOMA 5I8KL 3SKJH 4CNIB 1EV2E 1OK8A 1P2CB 4PJBB 4AL8C 2UYLA 3WEOA 1IMHC 4GFXA 1LMIA 1ET8A 1UWGL 2PW2B 1X3DA 4L1HA 4XCCH 3BP6A 3O6FD 5EBLA 5IFAL 2O26U 5DD3L 1I4FA 1JWUA 1HL5A 1FLRH 4Z7QB 2DWDB 5CEZE 1LP9B 4PG9B 2D73A 1U8MB 4XAWL 2V7NA 3II2A 4YE0A 3WY3A 4A7SA 1T83A 3AABA 2N01B 4WI8A 5DMGC 2BSTB 2V33A 1HKFA 3QHZH 4FS0A 2CK0L 2IGFL 2IH1A 3WNPA 3QULB 3ZHNA 4ADIA 5FB8A 4NYLB 3UTSE 2D8KA 2EXSA 4NUPA 2YSSA 3RL1B 1F4XH 1T0MA 3RVVC 1NCOA 2C9SA 4P5TD 3VACA 3F7LA 4O9HH 1IM9B 3QJXA 4LL1A 4RWYL 2HT2C 4PB9L 1R3LA 5BRZE 3MRIB 1UXLA 3NFPA 4QOKA 1ED3B 3MYJA 2GC7C 3K1KC 1DJSA 2BCMA 5BQ7B 4DGYL 4UYQA 3QCTH 3SGEH 1TZIA 5CR1A 4XXDA 5J1SC 3RDTB 2VDLL 3LZFH 3G9AB 3A47A 3QUXA 4Q8BA 4ZODA 5TPWH 3O6FB 3PFQA 5EDSA 3GBMH 5CGTA 5F7LB 2DQCH 4B9FA 4XP5H 3BQUC 4XVJL 5DRWB 2KH2B 1MRFH 1EJOH 1FZOA 5CR8A 3UP1A 2ADJB 3V7AE 2FBJH 2QVIA 1Q9LA 1U36A 2HZHA 2OJZL 2WBJC 3OLIA 3OZLA 3WFHB 1FG2A 5J11B 1WBXA 1MREH 3M17A 2VCOA 4J2QA 1XL6A 1IGMH 3DV6A 3FCSA 5C9KA 1OSPH 3MROA 5F7DB 5GJSH 3ZN6A 4FQHB 4FJYA 4OSUL 4OFYA 2BNRD 5CP7A 1JZ3A 4OLVH 2VLKB 4AYDC 5L4FA 3UAFA 1V7MH 2GEEA 3T08A 3SD2A 5DC9B 1GGBH 2UZXA 3C8DA 3GS7A 3ZDWA 1CTNA 3HE7A 1HJBC 3AQXA 2J56A 2X70B 2YRLA 4LPCA 2VZTA 5DD0H 2VDKL 5BS0E 1WT5A 3IDJB 4PJGA 2YBRB 4PJBE 1DJIA 2G3MA 1AGBA 3FT3B 4M5ZH 5EUKB 3WMQA 4F80A 1AHWA 3OC5A 4HX1B 4O58L 2AJ3A 5ID1A 2XX1A 4GW1B 4MQXD 3HUJE 1ADQH 2PNDA 1P6FA 3MU3A 3MV7E 1Z0MA 2Z8RA 5D71H 3WNNA 1OHZA 1XH3B 1C9SA 1ZV9A 5LBVA 3IF1A 3NAAH 4YDIH 2CG9X 1JHTB 5T1LD 3FB6B 3SJVE 1R4XA 5F3BB 5CM1A 1S7UA 5KW9H 4AG4L 3QPQC 2X4RB 3QQ3B 1J1XL 2GSGB 5HJ3A 5C7XH 4KC3B 2E4FA 3IKCB 3ARDA 5KSAB 4QRTB 3REWA 4M48H 1U91B 2CCWA 4L4TA 3S96B 1KPVA 2OKMA 2H6UA 2KLTA 4FADA 3BZ5A 5IG7B 3LEXB 1GW6A 3VXSE 1A6AB 3VD2A 3BPLC 2D7PA 3QDME 1NCWL 4PJEA 3HBZA 2NR6A 2OXGA 1KGXA 2Z4TA 1NICA 3G08B 4AM0Q 2H32H 4I2XE 2J8UF 4Z3JA 2NQCA 2RH0A 4G43B 4JKWA 1W6WA 3O3EB 1USQA 4JO1L 5E8EB 5JO5A 4JO8A 4NAQA 3ULUL 5FFOA 4H0GA 3IEAA 2DQMA 2KT6A 1KXQE 3TX4A 5FUCE 5GS1B 1JPEA 3BKCL 4MS8C 3GK8L 4OM0H 3W9EA 2FIKB 4BE5A 1BLIA 1YEKH 4EBQL 2V5SA 3BE1L 3MBEA 2LTQB 2ENYA 4XMPL 1RJYB 4Y2LA 1SHMA 3FTWA 3TO4C 2DQFA 5IFHL 4J23A 4YWGH 3DMMB 1SPDA 1WZMA 1BEXA 3LXBA 3O3AB 5TE4H 2CPCA 1EX0A 1SEBA 1DDTA 4MCNA 1XCWA 3KVQA 3FT1A 2YGNA 2FQEA 3WGUB 1N2RB 4PLJC 3WTXA 1BZ9B 2CXGA 3P4NB 4YSCA 2OX5A 4WIQA 4GRWH 4C59B 4W9LC 1JGUL 3VRJB 1RUKL 4E2OA 3CHXA 3B7SA 1MWOA 1NCWH 2BJML 1JN6A 2V37A 3VRJA 4Y4FC 4Z3FA 3CZJA 3V10A 4FABL 3ARRA 3M17B 3FTXA 3OMNB 1MFEH 2CKBL 4UT6A 1J10A 3MDJA 1ZTXH 4ZXBB 2VMDA 2L3BA 5D2LE 1OP3K 4BFBD 4MYWB 5FGCB 4HH9B 3VJ6B 3NYKA 2OMYB 1XAKA 1E43A 1A7BA 5TF1L 1NFDA 3MV9D 3S4SA 3T3PB 3WAKA 4XHJD 2J4WL 1RFDL 2R2BB 2W60B 2FDBP 2LW3A 4GYBA 3D69A 1GYVA 3D2UD 4YUEH 5J13B 4NRYA 1X9RA 2YPKA 3C87A 4KMQA 3C6SB 2V2XB 2ZZUT 2COVD 1AJ7H 1JWSA 2IADA 2A6DA 2ARJB 4I18C 3IMUA 4H2AA 4NZFA 3QORD 1XF1A 4HU8A 1KJVB 3QUYB 4KDWA 4PLJD 3VFUB 4UILH 5JO5B 4UNUA 5MENE 4ONOA 4P3DB 3OC8A 4ZS7L 4UQ3B 2CKBA 4HC1A 2VDKH 4WO4C 5TK4A 2GQHA 2BOCA 2AEQL 1DVXA 3VFWA 1PU0A 2VDOB 4KZ0A 3B1TA 4K7PY 2VN6A 4YSPA 4Y9BA 3NIGB 3K80A 2NLJA 4NP9A 3PU7A 5DO8A 1SDDB 4Y0GA 4HCIA 1CT8A 1I1YA 3CDYA 1DSFH 3QIBA 4ODTL 5T5NG 4BCZA 4BFGA 1BD2E 1MF2L 5T1MA 5EUOB 3I02B 4E42A 2VDQB 5HJDA 3S8FB 3KPNA 1CK0L 1U8JA 4MDIB 1I1AA 4JM4H 1KXVC 2VR5A 3Q2WA 3ARDB 1CL7L 4Z78A 5KSAA 4FXGA 4GUPB 4NGHH 1HH9B 1ODAA 2AF2A 1C5BL 3AY4A 3ZQWA 3Q5OA 4OD3L 3O11A 4LOUC 4MWFA 1E3ZA 1BMGA 5IVOA 4TF4A 3C60D 5I1AB 2HUHA 4FTVB 4N0UE 4XXCC 4PRIA 2IQAB 1PJ9A 4GAYA 1WQVT 2BH0A 4P4KC 4X6FB 5AALA 1RV6X 3NCYP 3VXQA 1IIKA 1BDYA 3HAEB 3VWKB 3BSHA 2Q86A 1A1MA 3IXAB 3NCJL 5EWIL 2A83B 3LKPB 1HEHC 3G6JA 5CINL 2CUMA 2F53B 4FQQA 5JYLA 1XGRA 5DHDA 2LAAA 4ZUSA 4M1DL 4I9XA 4Q9RL 4J1UA 3NRQA 5E6ZA 4TSAL 3QZBA 1D5XA 3BAYA 1UM6H 3LIZL 4OFDA 3UYRH 2MWCA 4G6FD 1MEXL 4Y8AA 2X1QA 3HG4A 4LCYA 1TIUA 2PTVA 3K2KA 3H7BA 1F8TH 3GBEA 4ETYA 1UACH 2Z7UA 2CDGA 1JHKL 4NKDA 1XGYL 5T3ZL 2ZUUA 1YNKH 1N64H 5JR1H 1PGRB 1CTOA 3F6JA 5A2AA 1CBVH 4F2FA 2E6QA 3B43A 4FQXB 3FU8A 1BFVL 4BKLA 2QDWA 1VZIA 5J57B 2OV0A 1WBXB 2EDMA 4GAYB 1FO0B 1OB1A 1RK0B 1CGSL 1J0IA 2OMWB 4YE4H 3MZGB 4WEUD 4B6ZA 1FO0H 2AI0L 5JMOC 1XCXA 5C6WH 3L1OL 4QTHA 1SHSA 1W0YT 1DQQB 4GKNB 4HJSA 2H32B 2D31B 4J8RA 1BF8A 1EZVX 2FYYB 1X5AA 1A3LL 1WK0A 2FJFA 3KLQA 4O2FB 4GBXD 5TGBB 4HWBH 2ICEB 4DVBA 4PG2C 1RJZB 2QL1A 3K2IA 4MAYC 2BSED 5BS0A 1YAZA 3U0TA 1QR1A 1QRND 3AW5A 1I7TA 1IL1A 3C5JA 4LF3B 5DUPL 3MJ8B 4NO0A 3TVMA 5LUMA 5BZWA 3VXRE 1EBPA 3LQAC 4JR9H 5FYLH 2PPFA 4JPKL 4M03A 2WCSA 2BHUA 4UQ2B 5DJ6A 2QELA 4X9FA 4P23C 3PGFH 1KIUA 2V7NB 2KUTA 2ZOOA 1GXEA 4I2XB 3NP4A 3QPXL 5KZCB 4JRXB 4NQDD 3IN0A 3VFMA 3ISRA 2LU4A 1YPZA 1FYTA 1QSFB 2EDWA 1JWSB 4IOIA 5LAXB 3EO0B 1JNNH 4ZX4A 5IW3A 4B7LA 2PW2A 5DZOA 1BG1A 4M1CD 1T4KB 1ZSDA 4LOFA 2IPTH 1TOXA 3RRQA 4L4TE 3MUY1 2RGSA 3D9AL 4MAZA 1GY2A 5EUOE 3QDJB 3A6BH 1BZEA 1J8HE 1QSVA 4WO4D 4NZTL 5DZVA 4I0PA 2CBMA 2AXGB 1FYTB 2R1YA 1ZVHA 4OGXL 3HS0A 4BQ8A 2F8XC 5A40E 2DQIL 5EH1A 3VXMA 5D1XB 1L0QA 4XXWC 3NIDF 4YHMH 4R97B 3VXRD 2KDGA 4WO4A 1FZJA 1CZ8L 3QWRD 1TETL 4FMFA 1MF2H 3H3PL 5DRZA 3RPKA 5F7EH 4OGZA 4I1RA 1CQYA 1S9YB 3QUHA 1AE6H 4PJ8B 4G9DB 1AKPA 1EEZB 3SPVA 3VQ2C 3MMEB 4LHUD 2Y7OA 2W9DH 4P0DA 2DBLL 4NQDA 5JHBA 1U8PA 2DS4A 4JPQA 4NEHB 4DUVA 2A6KB 4XP1L 4HBQA 5GRUL 1QSFD 2ICWJ 2L7UA 4BEIA 3GLDA 1OF2B 1WEJL 4XNQB 3OKNA 1FSKB 2EC8A 2FJFB 2XWTA 3H55A 4HPOH 4F20A 4YVUA 5IW6A 4RBPH 3SOBL 2GUOA 3O8XB 1ORQB 3AS0A 5AKTA 4LHUG 5DUPH 3ABLB 2IXQB 2X0UA 4ZFGH 2FEEL 4R96A 15C8H 4TLSA 4WO0A 1PAMA 4Z7UE 1KJ2A 3V6OA 1F6AA 1A7OH 3HC3L 1UJ3C 1TO5A 4TOYL 1S5IL 2CDFB 5CMAA 2ZUSA 1WZLA 4XCNB 5IT2L 1DO5A 1YDPA 1FZKB 4BELD 5DLLA 3ZUCA 5SX5H 5I66A 1L9TA 3SDDA 2A74B 4BKLB 3T2PA 3MGOA 3FB5A 1HE8A 4LSPL 4XB7A 3VVVA 4MCMA 5TDNA 1CF8H 4XX1G 5DUML 4KMTH 1E30A 4WENB 2P52A 2AP2A 3ME0A 4P2OB 4S1RH 3BSZL 4GXUN 4BE6A 5D2LA 2OXGB 1AGCA 2VRAA 2WBWB 4G1EA 3IE4A 5ISZD 3IMWA 5IB3B 1BJ1H 3G5XA 4PWGA 1JGUH 2VLLB 3QIWA 2BHFA 5I75B 3CVHB 3PAVA 1NFDE 2DQEL 2BW5A 2ADGB 1BFVH 3QCVH 4WHDA 3AAZB 4W9DC 4LSVH 5EBMB 2K8MA 4DEUA 4JGJA 2CDFA 3RGVD 3MBWA 3GWJA 1YEFL 1AG6A 2WXLA 2R56L 2C7UB 3MACL 4AVIA 2BXZA 5HTSA 3GZQA 5EIIB 4CSPA 3PXLA 3HG0A 4JFXB 1KB5A 3RGVA 5DTFB 2OW6A 3T6XA 3ZHLA 1IGTB 1JFHA 2BOLA 2B59A 4WI4A 4R7VA 4R8WH 4ES9A 3NZ8B 2GK0A 3HG1E 3V9CA 4L2YA 1KCRH 2NW2B 3F7PC 3HHRB 4LGRB 4RISL 4OY9A 4WK4B 1KXTA 3PGDA 3RA7H 4AK1A 3SDAD 5I1CH 2ETWA 1UZ8B 2FRGP 2WLJA 1NCJA 3FT3A 4ZQKA 5CZVL 1U8PB 2AV7B 3VXNA 5ACZB 4JM2B 1IE5A 3BI9X 4FXGB 4PRDB 2FEDD 5ICXA 3KL5A 4PUBL 3H9HB 4MAYA 2XQYA 3EJSA 3NFSL 1V27A 1WIOA 5D1ZD 1LK2A 1XIWB 1M1SA 4R8WL 4U31A 4DP4X 4Y2DA 2DWTA 3TVMC 1X4YA 5MERB 4AQ1C 4JHVA 4QRBA 5ECGA 1DN2A 1J9CT 2ZUTA 3ARTA 3ARSA 5MHSD 3AG4B 3CHSA 3BAWA 3R4DA 4XP4H 4FQ1H 1Y0LB 5EIVA 4MB5A 4IBSA 5DHYA 1OO2A 5IBLC 4S1DD 2C26A 1YN7A 2Z93B 1JJUA 3MTRA 1KBGH 3DURB 4OW6A 1RZKL 3Q8CA 4QXVA 3S5LA 4ORGA 7FABH 3ULUE 2AK4B 2E9BA 5AL0A 2QVKA 1XZWA 3V5DB 2ARJA 5DJYA 3G6JE 5TQ0H 2AC0A 2IIJA 2V2XA 1KDJA 2G3NA 4FXKB 4XCEA 1AGDA 1I8MB 1AACA 4YE4L 1W8NA 1CD8A 3X17A 1U8LB 2G75B 4PREB 4I0PC 3ZE0B 1ZT7A 2Z7WA 4YHKH 4KHXH 1RIUL 4KI5C 4PIBA 4RFOH 5CU9A 5D7LE 3GMOB 2G75A 5SWSE 2Z31D 4MLSA 3TBWA 3TONA 4Z7NF 5CLWA 1D5RA 2FH6A 4NQQA 5CSZA 2QPSA 2QQLH 3JWOL 4IGBB 3CGTA 3KHOA 3MRIA 2DMCA 5DJYB 2RALA 3V7AG 3GB7A 3FPYA 1Z5YD 1WAAF 3J8F7 2DYSB 3LN5B 1SM3H 3JWDL 4LU5H 2AQPA 3F7YB 5H37H 3ATFA 1YN7B 1E8XA 4LDOB 1GYUA 2X38A 4F7TA 4MFHA 4E9QA 1WA2X 4HPOL 3U2JA 1DQQA 5K39A 3VGGA 2LU7A 1TZAA 1MPAH 4XO5A 5E0QA 1TZHA 4GAGL 5MERA 1HCFX 1WS8A 2ZAHA 3BYTA 5KVGH 1WF5A 2W92A 1MCCA 2WN2A 3DUHA 5CZXD 5CXPA 4APQB 4P2YA 2CO6A 2LOEA 4GRWE 4LASH 3OAYK 4X7FC 1CFQA 1B9ZA 2FJUB 3I3BA 5DJZA 3SDXA 3BX7C 4KWUA 2Q76B 3CFBA 5GGUB 2O6DA 1G7MA 1QFUH 5FCUH 1JUFA 5DS1A 3D05A 1NMCC 1KXTB 3PGDB 1PZ3A 5T1LA 4YHML 1K9TA 3GXMA 4LHQB 2IALB 4S1RL 4NLHA 4Z95L 4XHQA 3GBNH 5DWPA 3WY1A 2V5TA 5T3ZD 2H26A 2BNRA 5CN3A 5T3XD 3B2VH 2F54A 2W81C 2X4SA 2YEZB 3EGDA 1I3GL 4DGWC 3HB3C 2Q6WB 3FDWA 4R84A 5LCVL 4Z5RB 1F4XL 3K72B 1PZDA 4MD4A 3ZVVA 1MDAA 1RULL 1AJ7L 4XPTL 3C5SA 5E5MB 4G6FB 3LEYH 3CTTA 4F15B 4LKXA 4OJYA 2NR6D 4C56D 4ZPTB 1BX2A 1CU4L 1PZ5A 2ZJSL 1S78D 3PHOB 3Q1EA 2JCCA 5A6IA 3ARPA 2KL6A 5KVFE 3S2AA 3BAKA 1T5XA 4XPHL 1BJ8A 1QQDB 3POHA 4YVNA 5E03A 2NY0C 3PL6C 1U6AH 1QX1A 5HJ3B 4MLIA 3UDWA 3KJ4B 3FRPB 5KYUB 3MUHL 4J3VA 2QVMA 2Q2LA 3QSKB 3QXDA 3B2DC 1U30A 1NIFA 5D7LB 1E9PB 1X44A 2HH0H 2FL5B 5EZLA 1XH3A 2QTEA 2O5ZL 1RMFH 2ZOLA 3MV8E 1G9NH 5C86A 3QT2A 3QAZB 1X5JA 1U3HA 4Z7OB 1B90A 4ZAKA 1CL7I 1E8ZA 1CT8B 1I1YB 4LVNC 1KB9J 4QT5A 1PG7H 1KCBA 4MJIA 4LT7A 1VPOL 3CV5A 4KJYA 1T20A 2Z35B 1AZBA 1WITA 3BVTA 3KPLB 3L4TA 3SKOA 1NBQA 3CFIC 1DBKH 3GSOB 2YPLD 3W5MA 4RNRA 3SY6A 3OKNB 5I76B 4ZD3L 3V0WH 4Y4HC 5LN8A 3G5ZB 4HSCX 1FNHA 1HVXA 3EIFA 4LPUA 4ZZFA 5TQ2L 4OGYH 4PGCB 4BGLA 1P5UA 4HUVB 1WBZA 1WGOA 4Z3HA 1MFAL 2YWYA 3VXRB 3KG5A 3MROB 5H35B 2XKSA 4OCYL 2GJ6A 5TH2A 3DV6B 3FCSB 4XP9L 4AEFA 4AMWA 5IB5A 5D6DA 4F8LA 4HC1L 4G8IA 4JEGB 5F7KC 3V6ZB 1WZ1L 1DJZA 5GPRA 2ZUQC 2UWEF 3KWUA 2UVFA 4FDWA 3O2DH 2MOQA 2NY6C 5SWZD 4X9HA 1H3PH 2DM3A 2CIIA 1T2XA 1KYAA 3HA0A 2DQTH 4A6YB 1J88A 1H8LA 1K6QH 2ZCKH 3RPIA 4OFKA 2HCZX 1SLUA 2HX8A 3P0GB 1FDLH 5HYSB 2M26A 5D7SH 3SEPA 2VO8A 1KTCA 1HXYA 1VGEH 3EO0A 3NEOA 3CPLA 5D4IA 4CU7A 1ZANL 1NLBH 2W65B 3UIZA 3OMAB 5DJ0B 2LE9A 1BZ9A 1QLFA 4JRXA 1XZ0B 3GSWA 5LBSA 4UTBA 1BFTA 3BUIA 1E2VA 3VGDA 4NLAA 4NB7A 1LL1A 1WCQA 5DQ9A 4Q14A 2O72A 3E9TA 4YO0A 5F7BA 3QIBC 4YDMA 5MI0C 3ULVC 1MZYA 1OAYH 2DY2A 3WXWH 5EZOH 4JM2A 1IZJA 1OLZA 2QGEA 3I3EA 1H3GA 1Z66A 4DVRH 3MBXH 4ILDA 4HKBB 1QO3A 4HJ1A 5AB9A 4M1GH 1G1KA 3BKML 3F2LA 4WI6A 2Q7NA 3NJMA 5A2BA 1AO7D 4YK4B 2AEQH 5SX4I 5EZLB 5DDHB 2CO4A 2NY4B 5I1KL 4ONGH 3KLAB 4FLQA 3TBTA 1A4JB 4XNZB 1NUNB 4ZPVA 5LHDA 1OY3B 2V17L 2X89D 4JRXD 1D5MB 4NZDA 4P5MB 5DVKA 4N2HA 3H9SD 5ANMB 5JXAL 2B08A 4JB9L 2IBBA 3MBWB 3I74A 1N0XH 3MRNB 2EZ0C 3OKMB 4R4ND 2H9GA 5CILL 4YGAB 1KCKA 4QF1A 4D0CA 2YAFA 1D5IL 4J8QA 3BUBA 4HD9A 5C08D 1OAXL 3MJ6A 3UFIA 5CBAA 3MCG1 4J4PA 4QNPE 2DQGH 2ICCA 5DMIL 4PIRF 2XQYG 5F1IB 3WIIL 3RU8H 1UQSB 2JKJA 3JV0A 3WTYA 3NSXA 1HEZB 3TIEB 1UCBL 4JO5A 1PTZA 5AOZA 2VJXA 3WHXA 2ZSWA 1MNUL 4HAKA 3IF1B 1YAIA 2HFGL 3D12B 1G7LA 4GLRH 3MODH 4XVTH 5E8PA 2DQTL 1F13A 1XDTT 1G9ML 4YQXL 3WLBB 2R9HD 1MCOH 2E7BA 2K78A 2WLIA 3LKSA 2K6WA 2A4ZA 3P3YA 2V9UA 2ZQKA 2EACA 2P5PA 3OAYH 4PWHA 3O45A 4HX1A 3ZU8A 3T65A 5F1NA 4PJXF 2E27H 4IHBA 4X6DB 5KSUA 3Q2CA 4XVOA 3ZKSD 4BSWB 4PJ5B 4X6FA 4KQ3H 5AOKA 4LFHD 1N6QL 5CJBA 3O81A 3VG0H 1YC8A 4GIPD 4OLUL 2VMJA 2FECL 3M8OL 3FUMA 3N2JA 2D0FA 3B4NA 4NQTA 1MW2A 2EIZB 4U1GC 3V0EA 5HDWA 4DTGH 2VW6A 1DANT 4RRPA 1ZLUK 1FVDB 3FN9A 3IE9A 2GABA 1AKJB 1CG9B 4Z3TA 3AG2B 4FNPA 1I1AB 1IAKA 4O02L 2AMUA 3RVTC 3DSNA 2DEWX 3NJIA 4MJ2A 1DQMH 3KPQB 2F2HA 4O4YH 2AQNA 3MRLA 4UT6H 3IDNB 3BPOB 2UY6A 1KCVL 4WV1B 5KG9B 1T2QL 3MRHA 2F1AA 1KG0A 3JVGC 4NQEB 2R4RH 3ECQA 2O30A 1JGEA 2DIBA 1YHPA 3HI6H 4WSJA 2PTTB 4WLCA 4CL7A 4DFIA 5I1LA 1ZT7B 3FAWA 3T4YB 4DGUA 2VAJA 4MJ4A 2F54E 1HNGA 1IC5H 3KZ8A 4N3UA 1YY8B 2EYTB 3EYFB 5IV2A 2A6DB 4LCWE 3MA9L 3NQKA 5DD5H 5AAWC 2Z92A 3I9PA 4JFYB 3P3TA 3QJVB 1S9VA 2DZEA 4ORGB 3ZTJH 4TV3A 4RQQA 4HG4K 5HYJE 3VXMD 4HGWA 2TRYA 3SQOL 1UM5L 5DJ6B 5H2BA 4AK2A 4M3KB 2JCCE 1T1YB 3QVAA 4U1HA 5T33H 5JLZB 3K6IA 1Y0LA 1TEGA 2Y07L 5B7FA 3LH8A 3N40P 4C4KT 1LXMA 3FK3A 4ZXBA 2QQKH 3WN6A 4KXZI 2VDPB 3NJFA 3GTNA 2R29L 4JFSA 4BUHA 1EXUA 2C1OA 5J1TC 3DSFH 2ADIA 3MYZA 3OKKA 1PZBA 2NXYC 5AB0A 1JN6B 3L5WA 2XZAL 1Q0XL 1S9XB 3RIAF 1JYWA 3MUGB 43CAB 5MP6L 4MJ6B 1WAPA 3OMIB 5ACZA 3DOHA 5IOKA 1AXTL 4LLVB 2UYLB 1S7RA 4ZQKB 1O7DC 1SF5A 4Y89A 2F1BA 2HB0A 4AQAB 3LKRA 3CDGA 3LY6A 5T3XL 1S7RB 5GS2H 2ZOKB 4ODSH 2NY0D 2HWZH 1ZHKB 4ZFZA 1E5ZA 2W95A 3V52L 2IDTA 3D09A 3T3MB 3RBSA 4N4YB 4QTIL 3KWVA 4HVBA 4WUKL 2DQFB 1OTTD 4PJ5A 3VI3E 2Z91B 4L48A 3VGFA 5D7JA 1XSJA 3GRWH 1MUJB 1E3XA 3ASOB 1U3ZA 3FOLA 2NTFA 3CCHA 2ZX6A 3IDYC 3JV6B 5DFWH 4ZXBD 4K8RH 3BH4A 3CQQA 1XMEB 3QNFA 1QNZL 3CVHL 3FT2B 4NKDB 4IIZA 3V52H 3SD5A 8CGTA 3WN5B 1JVOA 3NIDE 3N1QC 4A67A 4P4RB 4I0KA 3SE6A 2CPUA 5DD6A 2ZSWB 5TTRA 4OZHA 5IOPA 1R46A 1A8JH 5ICYA 3O3EA 3EH5B 5HHNB 1HHHB 4W68A 5CJQL 4PJEB 2OBGA 1PKQA 3RZWA 3DIFB 4KTEL 5FXCH 5KJ7E 4PRBB 3PJSA 4TXVB 1P7QD 2DLIA 1NC2B 1BF2A 1NGQL 3QZNA 4R9HA 5HHOA 5HGBB 3H9YA 4LSRH 1N7MH 3EH3B 4PW9A 4ZO8A 2WBJA 1L3NA 1NBZA 2VW4A 3PWPB 3TEWA 3DC0A 1GAFL 3R7QA 4AGQA 3OKMA 5F6IC 3NFNA 1HE7A 1IARB 2OULB 5JPNC 1MHPH 4IDLA 3W11C 5CU5A 1LJMA 3O2WH 4JHBA 4AW7A 4ONFL 1TCMA 5HSFA 4HIEB 5D7LD 4AI7A 1WFNA 1NC4A 3U4AA 4Y1AA 1E90A 4GMSH 3CC1A 5F3BA 4PJHE 3FB6A 1MCPH 1CFMA 3LRMA 3D4CA 1ZY9A 5DLML 1S9WA 2B0SH 3KLHD 5D9SA 2OA9A 5C0IB 4OR1A 5IF0A 2PP7A 2M83A 1IKOP 1OF0A 2EYSA 3QI9B 1BWWA 4GT7A 4HUXA 5A3IC 5MEOA 2YQGA 1G9NL 1S46A 5DZLA 2GJRA 4YXHL 2I69A 1PJWA 3PIQA 1TLKA 1G43A 2BP8B 2N7SA 1IKNA 4L37A 3S88H 2V5MA 4Y2DD 5LJYH 4R90L 2VMFA 1E27A 4IRZH 5DD1H 3ZTEA 1GKOA 1MCFA 2IVFC 1NIAA 2OMXB 1W0VA 3OAWA 3DI2B 3D30A 1M3JA 5AVXB 5FEBA 2JKXA 2ARJQ 1RPQA 3ZIMA 2E8ZA 1KY6A 2WTPA 4TUJA 4CVUA 1MWAL 1KEGL 3TH3T 3IXTA 2YHGA 1YECL 2BDNL 4U1KA 3NPZB 2P7TA 1DJXA 3V0JA 2DJ4A 1GS6X 2A9DA 4RGOH 4MBOA 1ZE3C 5FKAB 1YZZA 1OCZB 2F18A 1GS8A 1EEUA 2WGNB 5EN3A 5EOQL 1NJ9B 4QXUH 3ZYZA 3IFLH 3QWQB 1MI5B 4OJAA 2ESVD 2Q9OA 3ROOB 1NCIA 3VDAA 3ETBF 2IGLA 4MZIA 2X9XA 3T2QA 3MGAA 4HUWB 2C3GA 1C7SA 4B7IA 3QNZA 5I6KA 1KTRL 1CGUA 2EUZA 4PJIF 4NHCH 1A9EB 1CWVA 3F58L 4OT1L 4F58H 1I7ZA 3BFWA 3GUTB 2P24A 3P0YH 3RWEA 3O9WC 4NAMA 4WCYH 4XMZA 5IBUG 5ERWA 2ED8A 3FQ4A 5GJTH 1R3LB 4ZG1A 4QUOA 3U0TB 2C9PA 1HSAA 3PABA 1JZ7A 4N85A 3TFKC 2HTKC 4JDEA 1JV5A 3WTVA 4OZGF 4GB9A 3WFDH 2YMOA 3LS4H 3ARYA 4ANXA 2RMNA 1ZMYA 5DU7A 5ALBH 2XZQH 5DDHA 4PJCF 2JVUA 3R8QA 5FECB 2MIZA 2PPEA 2BP5M 2R0KH 4TUOA 2D31A 1J1XH 3TO4A 4Y5YA 3L5XL 1YC7A 2LHAA 2O5ZH 2ERJC 3WS3A 3IRPX 1QLRB 4Q6YA 5GRVL 3C8KA 3CU7A 4XMTA 4FZEH 1X9QA 1JK9B 2HUEA 2X42A 2G60L 5IESH 2FIKA 4ADGA 4FHBD 5FUZH 2FEDC 2GITA 1U2CA 2HVJA 2CO7B 4A2EA 2CMRL 4XNXL 2WQVA 4KVNL 2AS5M 3CH1B 2XFXA 3WFBH 3RPBA 4PV9B 2BVUA 4LNRA 3LS5H 1T89A 1RIUH 4WGKA 1JZFA 2DAVA 2Y2YA 1N0LB 3FXIC 4YHNB 2OL3A 1YNTB 4NXKA 2MQ3A 3HNVH 2CDGB 5E6SB 4DPBX 4KNTA 2W5PA 3FH5A 2MCPH 1EJ8A 5JORA 5JW3L 1D5ZA 3WE6B 1IBFA 5EF0A 1QVOB 1IAOB 1IRAY 2D0GA 3TJPA 2HKHL 1HZLA 4PLKC 4APQD 4C56A 3H6JA 4JFWA 4X6EB 3V8OA 4JBSA 4GOSA 2XTSA 5F7NC 4ZW7A 3QNZB 3EBAA 5D7SL 2A6IA 1NGPH 3V5HB 5BUGA 3W39A 5KBPA 2JQZA 3JVFC 4L8SC 3AMKA 5FHAH 3QWOA 3Q8AA 2CGZA 4L5FH 2UWEE 3TZVD 2R15A 1OGTB 3WFZA 3DGDA 2W94A 1X5KA 5A2JH 3F6IA 5KSBB 3L3OC 4KAQH 4ZSOA 1TCRA 4FFZA 3GGWB 4NOBA 2DIJA 4HKXA 4R7DB 2KLSA 4TUJB 4M93B 5FDWB 5BV7B 3DRQA 5F93C 3QNXB 4ZAKC 3FTYA 1EO8H 1HXMB 5HPMA 1IGJB 4K07A 2PYED 1GGCH 3OAUH 1Q9WB 1IKNC 2EO9A 4IRZA 2MJWA 2OMXA 3RZCA 3NP3A 5KJRH 3VU2A 1XSKA 4L3EA 3VI4A 3TNNA 3MRKB 4JZJC 5B38A 1A5FH 1A4CA 2UZXB 3H2PA 1CFTB 4Y5XA 3K91A 1FBIH 2DLFH 4NQUA 1N12A 1A6WL 1A14L 1LE9B 2W0KA 3B6SB 4F7TB 3SQBB 3BWUC 1Y1UA 3HPJB 3LKNB 3MLUH 4IJ3B 1URZA 2NNAA 4TRPL 4TUKL 5LGHL 2ZOLB 1WAAE 4OCWL 1KTLA 3QCVL 4TNVF 3NH7L 4YPGA 2ZKWA 4BRJA 4GP8B 3L08A 4HKXB 3ZDXF 3Q1SH 5J1AB 1OCRB 3GB7B 3FF7A 3W5NA 3VWJA 1XVSA 4EDWL 3CE1A 1DFBL 1KZYA 3TEXA 1MWAB 1DBKL 4RAHA 1EGJL 3FQTA 4BM7A 1GZHC 2PCPA 1CE1L 1PD0A 1GOHA 3B7UX 3A0OA 3G9VA 4OZHE 2GY5A 1AGDB 3TPUB 3FQRA 1ANUA 1MLBA 4XBPB 3VCLA 1KIPB 4WWOA 4YZFF 5E1GA 1NAMA 2DEYX 4MD4B 4LCWB 3P9MA 2F15A 4OCXH 1U8QB 2HT3D 4HKZA 1HHHA 4P49A 5GZND 1M05A 4JKMA 2X4SB 5CSBA 3RIAK 4UTAH 5LNGA 2JJSA 4RFNB 5I5RA 3CZLA 2ED7A 4KY2A 1PCXA 2EEFA 2AJSL 4LLQB 4X7EC 2DIAA 4RX4A 5BZDB 2X3BA 4XWOC 3PDDA 4FL4C 4AT6B 1HH6A 5LCVH 3K4DA 5IHZA 2P80A 3HLKA 2WYHA 4L8DA 4TLTA 3FN3A 4CSZA 3QR2A 3FOLB 2Y7SA 5F0JB 3SDXB 4KGLA 4PJHA 3TEZA 1AS6A 1AIFA 3LKOB 5IB1B 1D2PA 1P1ZB 3A4FA 4FKKA 4KJWD 4XP6L 3OXRB 1FGVH 3B34A 2CO7A 2GBTA 4M5YL 3D06A 1AMYA 4UIMB 2IH3B 2NY7H 4FI8A 3OQRA 5TK2A 5IUCA 4LZKA 1ETB1 3MJWA 1BW8A 2Y1YA 3O2VH 3CSTA 2EP6A 1XF2B 1ILUA 2XWBA 4R5XA 1FORL 1OGAB 1KBBA 3I2CH 4JRWA 1WFTA 5C71A 2AW2A 3BJLA 3KWWB 4U1LA 3VUAA 1Q9OA 5EORL 2JJTA 1CQKA 3P1VA 3BDYL 3GXUB 3BPNC 4K5MA 3CXFA 4GRLA 4KKRA 3L5WB 2MEJB 5D93B 3KYKH 2YSTA 5I1GH 1O9WA 4HJ0D 1DSFL 1LQBC 3AWEA 4OIIL 1EXUB 2FWUA 3KCPB 3UBXA 3EDDA 4KKZA 3MREA 5HJGA 1A4KA 5EBMA 1FGVL 4I5BA 1MLBB 4MZRA 3VCLB 1RUQL 3DK2A 2VW7A 4E41E 3CX2A 4K7PH 3RY4A 3IJ7A 3GSQB 4JPIB 2B4CC 4QO1B 5AWNL 1NM9A 2BSDA 2NUTB 3NRPA 2ZUXA 4WK2B 2EDQA 2MNWA 2FR4A 2CU9A 3NJVA 1S7SA 2FLBT 5D2NA 5I16B 2WIIB 4V1DA 2KMWA 3BJ91 1I82A 4KKBC 1TZ8A 4MASA 4HXBL 3EH4B 3L3OA 4LHUB 1SM3L 3P69A 1BQHG 1IC4L 4JHWH 1I3UA 2Z8VC 2XVGA 3QUMB 3LPPA 2BSEA 4XCNA 5FFGA 3HPJA 4R7XA 4B95C 2HJKA 4OB5L 3RHWF 4NERA 3RTQD 4BQCA 1DBBH 2JB6B 4I1PA 1PG7X 4GW4A 4QWWC 4KITB 1U4FA 1MJ8L 2IV9A 4N20A 4NQVA 1HT6A 5E6IB 3II3A 3CHOA 2UXFA 1DLHB 2BSSB 4RH4A 2HAZA 2ITCB 3BLPX 1P6AB 4N28A 3ZRSA 1CI5A 1T1XB 3SPJA 3QJHB 2J8UB 3HE7D 2HVKB 4FYSA 1NUGA 2CDEA 4X9GA 5B3SB 4GIAA 5KS9F 3RE0A 4BSVB 1FH5H 3EYSH 4FULA 2E59A 3DO3A 1QD0A 4XNYL 5C07E 4KQ4H 5TE4L 3SYPA 4ABVA 4JDTH 2CBTA 1QP1A 1TKWB 4XWGL 1XGTB 4N8VG 1JZ4A 3F05A 4IMKC 3RWDA 4NC0B 4BFKA 4NRXB 1XWVA 1CLOH 3QUGA 2BS71 1TVBB 4JFXA 2WW8A 4PWIA 4HLZG 5E9DD 1P4LA 4DN4H 5BOZG 1KCRL 3U6RA 5BRZA 4CU8A 1J5HA 1DBJH 2JI2A 2DLTA 4JVPA 1ND0A 2F54D 4IEFA 1CR9H 2B2XL 5GGVL 4WW2C 2BDNH 2J1XA 4WFFE 3DX1A 3QDJA 4Z8FH 3MRDB 5BRZD 1KEGH 1SXZA 2V3EA 1ZDQA 2NYYC 3AQYA 1KXHA 1ML0A 2IDQA 5IMOA 3QIWC 4IK6A 1D5ZB 3V0GA 3HBPA 4WHCA 4PTUB 3SDCC 1VF5C 4NDMB 4C56E 1PKQB 4KQ4L 5GS3A 4G5AA 5EEUA 1DBJL 3GLEA 1CC3A 3NIFE 4XHJC 3LNDA 3RWHA 3TTSA 4IOSD 4Z7VA 5FB8B 4GH7B 3ETBJ 2JB5H 2BSTA 3RGVC 4JANB 4FLHA 2ZP8A 4PJ7E 4G7YH 2DKSA 1JCKA 4JKNA 4F9PA 3T6WA 1JF6A 1LK3L 2TSAA 3CU1A 5HD8C 1ITBB 4AEIL 3HNTL 2GJZA 3FKUS 1JXDA 2A9NL 1D9KC 3ARFB 4D8PB 4JPSA 3HMXA 4NHUB 4C47A 2E74C 3WS3B 1ASOA 1FCGA 2XNAA 1YQVL 3RP1A 5MEQB 1OAJA 2GUOB 3E8UL 1U92B 2RQEA 4G42B 3U1SH 1FVEA 3BVVA 4DO5A 3KPMB 2XWTB 4GSUA 1L6XA 1OF2A 1P2CA 4PJBA 3UPAA 5E6ID 3UACA 2ZPKL 5HDQH 1UZ6E 2BFGA 1NCBL 4Y2DC 1GHFH 3VI4E 3K81A 3OKEB 4EI5C 5IFJA 3EO1A 12E8H 2FAUA 4BRVA 1Y18B 3T4AA 3MMEA 3BIKB 1YEJH 1T6BX 4PJXE 4G9DA 3VX1A 4GSDH 2IDCA 3MV8B 1A7PH 4N8UA 3BMVA 2NW3B 1VLXA 4YDVA 5JTWA 3TN0D 3EBGA 5T3XE 1AXSA 2EXTA 3KJ6L 3L1GA 4ATWA 1V7ML 4ENZA 1XZ0A 1ZHBA 4NKMA 1QYGH 4R7NA 3MV9B 3NGBC 1MI5A 6PAZA 4HDIB 1H19A 4R4FL 1P7KA 3HHSA 1WWWX 5C0BA 1I8AA 4KJPC 3VFSB 3GRWL 4ZW3A 5BCAA 2Z31B 1YEFH 3QDMA 4CMMA 1DFXA 1F2XK 2CIIB 3BUQA 4K7FB 4U1KB 3SB3A 4XPFH 2HPTA 3UTTA 1W0WB 2J73A 2P5WB 3O4OB 4YMPA 3FQRB 1J9SA 1QFUL 5FCUL 3KL0A 4HUNB 3GRGA 3O2VL 3UTSB 1S8DA 3T4YA 5TPWL 2PO6D 1AQKL 1UB5A 2EE9A 4X99A 4DNLA 2V9TA 2IAMB 5I0ZA 2VQ1B 4QRUB 4X4ZA 1KFGA 2FYVA 3IJSA 3JUZA 2K0RA 2IAAC 2K1MA 3JSSA 2ZCHL 4RMBA 2CJSA 1X9LA 3KLDA 1E27B 2UY6B 3K7UA 4I4WA 4JL2A 5D7EA 5ETUA 3VM5A 1UKSA 3BP5A 5JHDD 1MPAL 2BO0A 1HKLH 2EUVA 3N9GL 3SHSA 3HKZA 2VN4A 2AQSA 3D85A 1OEZW 3A4DA 1E2WA 1JGDB 2EADA 2WVTA 2FATH 3FSOA 1IAKB 5C07D 4JNXA 4O2FA 4S1SH 3MOAL 4XVSL 3L1EA 3RIFF 1PD6A 3U2IA 3BXNB 4M6ML 2IFGA 1I7UA 2QV4A 4FFZL 2DL9A 2EDFA 3GSUB 1YVLA 3I75A 3QYCA 1RHHA 5SWZB 5GQBA 2VXSL 3VXUD 3B3IB 1WEJH 3GHPA 2AK1H 2VQ1A 4QRUA 2V3DA 3ZDYE 4BFIB 1HXMA 2O5XH 4MMZC 5HPMB 3DRQB 1GA2A 2XTJE 1F90L 5DJCA 1R5VB 2OTUA 3EZ8A 1UD3A 3MC0A 1QMUA 1T5WB 3MV8D 5JPMA 4QRFA 3TA3D 3FT0A 3ULVF 3HOGA 3PWUB 3BRFA 2WO4A 4UT9H 2BVYA 2YPKB 1AR1B 4C4UA 3ILQC 2Y4SA 4M7LH 2YC1B 2ADFH 3QXAB 3WFDL 1JGIA 1O7DE 2YMTA 3BVDB 3HG2A 4KXCA 1QRKA 5I30H 5IOPB 2NDGA 4GBXA 3RWGA 3O4LB 3EYOB 1G7JB 1A02N 4OD1H 3V5HA 4HUUB 5FOBB 3ZE0E 1JPSL 2FGWH 5HGAA 2YMXH 1ZV5A 5ENWB 5CNHA 3HI5L 3Q48A 4XH2B 4Y88A 1K4DB 2E9GA 5D5MB 1RI8A 4W9IC 2D7TH 3GI8H 4MQXC 4PB0L 3F5WB 4EN2A 2EIMB 3GMRA 3IWVA 4OJEH 4G8EA 3IJEB 3CWGA 5IM7A 2VDQH 3A24A 4H25B 5L0QC 4OLUH 1MLCB 3HG1D 1AZVA 2OX5B 2A77H 1TUPA 4AITA 2R7EB 5EBWB 4MA7L 4KOCA 4UTAA 2OQJA 5HPOA 3KWWA 1U3HC 3CDGB 5CIPA 1MIEH 2ZSVA 1BD2A 2BHZA 4MTMA 4PJDE 1PNCA 1O7VA 4IKJA 2QQQA 5D1ZI 1NTDA 3CH1A 4H7VA 5HGGS 3L8QA 4HUCA 4MA8L 2DH2A 3BW9B 2BIQA 3GIVA 1AD0B 2K3HA 2F7RA 3KPNB 4MDIA 2JV6A 4RGNB 3WXVH 1PYWA 5IK3B 4XNAA 1UB6B 2UY7B 4FEMA 2ZAIA 5HVFB 4BKSC 3GTTA 4MXWL 1JDCA 3FUNA 3D39D 3N42B 1VACB 1DVTA 4DEPB 2CAKA 1WSST 2DQJL 3P3RA 2C4FT 3RL2B 5BZDA 3ILEA 3R06A 4R0LB 2CKBB 1SOKA 3EO9L 4H8HA 2ZAGA 5T3XH 1N4XH 2CHZA 1COBA 2HX7A 4NN6B 1G1YA 4XZUB 2AZUA 3QP3A 4MQSB 4MXVF 4LVHB 3LPFA 2CBPA 3KPSB 1UG9A 4M48L 5T5FA 3JTTA 4JGUA 3QB7C 5C09A 4WI2A 4LDLB 1JHLL 4PJEF 1N3NA 1A6AA 4B27A 2IWEA 1N7ML 3ETSA 3N44F 2F19H 3CHQA 1ETZB 3WEAA 1LHZA 4AGNA 1RSYA 1BIHA 4OCRL 3UYPB 4W9JC 1YY9C 4IHOB 3P0VH 4P5TB 2PXYC 3E3QC 1UURA 1PPIA 3ECVA 3CLFL 1WZKA 4HIXH 5AZ2H 1T2JA 3A4AA 1GIGH 1TZGL 4QRPE 3V5DA 1SEQL 1TVBA 3OR6A 2MHAB 4M5ZL 1E4XH 1PVHA 5D1QE 2OZ4L 5ESVB 4P9HC 4XCYB 3RNQA 1DJGA 4UTBH 5LBSH 1LWJA 3MA9H 4Q9RH 2HSIA 1P5UB 3C12A 4HUVA 5EF2A 3RFRA 2APXA 4UTCA 4OGAD 4OF3A 2QHRL 5DEGB 4L3ED 3QJHA 1LNUA 3Q13A 3BPCB 3GIZL 1HCVA 4JREB 4RNRB 1LK2B 4EIBA 3HI1A 2VXTH 5JXED 4YPJA 4X6CB 2FUTA 4Y5XC 3LB6C 3BPCA 5ALBL 2H7WA 4EEEA 5IUSA 3EUDA 2C1PB 2X44D 4JMNA 1LILA 4HXAL 5IQ7L 1CDJA 5DEGA 3T0EC 5JNYA 3CC5B 3OKLB 3RHWK 4HWEH 2R2HA 4ZMOA 3UC0L 4TVPE 3VWKD 1CO1A 1H3PL 3V4PL 3D25A 2GTZB 2YIHA 5EIIG 3FBKA 2CK2A 4Q7DA 3X11B 5C0IA 1JK8B 1WZ1H 5I5MA 1NGZB 3BE1H 4GO6B 4NT6A 1E9PA 4U2ZA 5ICUA 2JIXB 4JFED 3UJJL 5E8EA 4EUPH 1Q9LB 1RVFL 4QHNA 3ZL1A 4PJCA 4GIOA 4HCFA 2CK0H 3HRZA 1YUHA 4AJWA 1GZHA 4WWPA 4JY5H 4X0KB 3D3VB 3GRWA 3VSUA 3QH3B 3ULUC 3CDFA 1MIMH 1QI3A 2Y24A 2BCKA 1EAQA 2HRPH 1T1WB 4K94C 3IAQA 1TYRA 3JTSA 3OKDB 2OR8A 5BNXD 3PHOA 1IAOA 2ZXGA 1IX2A 3BZDA 3WE6A 2A0LC 4LAJH 1TQBB 4QF1B 4D0CB 3KGRA 1FAKT 3LHPL 4AZ8A 4AUYA 3V4PH 4AXWA 4N86A 3VD7A 2VT0A 3ME0B 4NM8H 1SFDA 5IMLB 4ELKA 3CZUB 3K74B 4Z18A 3KLKA 2G4GA 1S7TA 2WAQA 4LOUD 2YD7A 3U1QA 1GH7A 4MQ7A 4ZQTA 3LV3A 5GRVK 1NC4D 4E68A 4JRFA 1SVZA 2D9QB 3LYRA 5E99H 1UJTA 1A9BA 2CGRL 2MMXA 3BUTA 3Q6FA 2JFCA 4NS0A 4OUUA 2NXZD 1I31A 3RG1C 4N5ED 3C8KB 2E47A 2NDFA 1W9XA 1Z3GH 1I4FB 3L9EA 4GEJA 2ZX9A 3FONA 4X0NA 3E9UA 1R3JB 4GRMA 1WJ3A 5CILH 4MCYB 4N6QA 1MCSA 3TYFA 1E7UA 1MRDL 1KLGA 2R29A 1KCVH 5SX4H 1PEZA 3U4EB 4EIGB 3S48A 1P7KB 3HHSB 5DLMH 3ARBD 4OUOA 1AR2A 1E6JL 1WPCA 3ATEA 4Z7UA 3WKML 4B5ZA 3IPFA 1NA8A 4JL1A 5T3ZH 1HSAB 32C2A 3PABB 3MCKA 4TNWF 1MVUA 3BESR 1UC6A 3VMNA 1FL6A 5KTEH 4JGNA 2FO4A 4F8QA 4X8JA 4S1DC 4YSTA 3U0PB 4M3JA 3ZBMA 3KXFB 4R2GD 4UM9B 2F19L 1E9OB 1U58B 3A67L 4ZI8A 3L3KB 3T4AB 3NTCL 5HDOA 4WFGD 3LDBC 1Y18A 3X1GA 2QFRA 4KKCD 4J4PD 3VXMB 3HS0B 3KVPA 3CZGA 4JW3A 1BMZA 2VR7A 4WI9A 3EKCA 1MREL 4LB8A 2YS4A 2IFFL 4YHLH 4NI3A 2FBJL 1FC1A 4FFTA 3B5GA 3ZJAA 3EOBA 4AH2A 3O9WD 3MV9E 5MEQA 3GMMB 2BVTA 3DBXA 5JQ6L 4K71C 3G04B 5DJDA 3EYFA 1ZHNA 4AE1A 2A6JA 4XB3A 4JRYD 2GI7A 1OSZA 1P7HL 1IBZA 3KPRD 5D2LF 2YSSB 3RL1A 3UTZA 4G6JL 4NYLA 4TVPD 4U6XB 2Y3NA 4R5VA 2J20A 2NY1B 2VDRL 3B6SA 5LNDA 3QJQB 1TQWA 2W0FB 2XWJB 1RHHB 2HWZL 1KXVA 4DF9A 3MXVH 5TE7L 3RVWC 4MJIB 5MEND 5L88H 5J3HD 4HSQA 2N7BA 4ZO9A 3TO4D 3N41F 1L0PA 2ID5A 2DWDA 4MHHI 4YDKH 1NAKL 3ZLQC 4F7CB 2ICEA 4DVBB 1NCAL 5D71L 1WA0X 3T0EA 3BP6B 2OTWB 1BZOA 1ZA3B 4O51B 3TBBA 1DE4A 12E8L 1PY9A 4E9WA 1NMAL 4YHPB 4XC3H 2ZKHL 5EZOL 2EE3A 4MDJA 4NC1C 4AMXA 5AZ2L 5ETUB 3SGDH 2QPDB 4JN2B 1CD1B 3DXAD 4JRYA 3O6MH 4TTDD 1TTUA 3P77A 3E2HB 4B60A 1A6TB 3HRZC 1ACXA 4KI5F 4AL8H 1P9MC 4AYID 3DROA 1F58H 1IFHL 4B97A 1A6TA 3L5XH 3UTSA 4QRPB 2XG5A 4WW2A 3TN0C 7FABL 3H1ZA 4WY7H 3O45B 5DD5L 3FRPG 2PWEA 3PWVA 3UTTB 4G7QB 2VISA 1MJUL 3WLBA 4OV6F 4C56B 4KXBA 4U1JB 4JCWA 4UZUA 2EC9T 4L8BA 4L3CB 4TUUA 5SWSA 4B0MM 5FWRA 5JORB 1KB5H 4X5RA 5KWYC 1ZCRA 4LCIH 3F85A 4JKKA 4KO6A 5DRNB 2BNQE 2CLRA 2VWEE 3GKZA 4FE9A 4NKMB 4ODSL 3AQDA 5DQDL 3W1ZA 4A7QA 4ENED 1IC7L 3IDGA 3QA3A 4NFDA 4UDUB 5I1JH 5AQ0A 4NQED 2ED6A 3G6JB 2XWJA 2W0FA 2RCSH 5DK2A 2GIMA 4JQIA 1H5BB 4OZ4B 5IW1A 4Q9BA 3Q06A 4S1SL 2C4FU 3QUMA 2IQ9H 2HKFH 2IDFA 4HCRH 4HT1L 4K71B 4OCLC 3UJJH 5IP4A 2D7TL 1F4YL 5E2VH 5C07B 3MNMA 3QPQD 1QLRA 1UXSB 1YMHB 1JZGA 1XXFC 4LCVA 3RVWD 1KF9B 2IXQA 2VC2H 4J28A 2Z7ZA 3PHQB 2XSKA 1ORQA 2DW5A 2ZYRA 1R3IH 1HH9A 5T33L 2GSIA 3ULVL 2VL4A 2VKWA 5HGDB 3OTTA 4RSYA 2DMHA 2NUTA 5C6PB 4N9OB 3FBQA 3I02A 4PJ5D 2EABA 5BXFA 4DWHA 1HQRB 4L9LA 2H2SD 2E27L 2DWSA 5JOFA 3HVDA 5CD5D 3SO3B 5HHQA 1DQVA 4LCIL 2FX7L 3BAEH 3K8MA 3R1GH 3LNIA 2Y5TB 4C57C 2ZWLT 3HZKA 4U1HB 2DTML 4TKWA 2BNRE 3AJ7A 4DAGH 4DP1X 1XBDA 3AB0C 3QIUD 1VPOH 3FQUB 1NAML 3PAZA 4GAGH 3BQUD 3GM8A 3QJRB 3SJVD 1M9SA 4AUUA 1KGJA 3B2MA 5AOJA 4KRPC 2CJUL 1QLFB 5BVJB 1AZRA 5C0AB 2GAZB 5I0XA 2WY3B 3L3GB 1J9QA 4Z7UB 1BZ7A 1CB4A 4BWTA 5IMKB 5D96B 5HYSG 4DPAX 4JFPA 1EGJA 1TQVA 2WWOA 2XWBB 2H2PC 1IC4H 2V6HA 3BN9D 2YPLA 3IPBA 4LSTL 3QORA 2FSDA 5CF3A 2R0LL 3GINA 3DURA 1CI3M 2W60A 4UIMA 2DLGA 2Z93A 4OZIB 3QNYB 1HAUA 4I3RL 2AJYL 1F1AA 5E23A 2BIPA 4H20L 1W15A 1MY7A 1JMXA 3C6LB 4KBPA 5DK2B 1UADC 5J56B 3V0VA 1OCWH 4PJEE 1HKLL 4M7KH 3LQZB 2ATKA 1EAPA 3GMPB 4KK9C 4I2XA 1MHEB 2Y6SD 1ZAGA 3N43F 3BUDA 1OAYL 5F1KC 3M8OH 1MCNA 1YEDB 1E8YA 4NWUL 1KV7A 5ADPH 1EA9C 3A5VA 4LLQA 4KUCF 3VSVA 3TIDB 3H85A 4XPTH 3SCMD 5F44A 2UZYA 5JHLL 1IL1B 1AE6L 5KUMA 1MAJA 2J2ZB 4KRLB 5J12B 4MJIE 4AJYV 1O0VA 3VB9A 1IBBA 2WQAA 4UB0L 4YXKL 4OF6A 1K3ZA 1UZ8A 1BCIA 1C8PA 5C0AE 3HC0B 2BIMA 4PTTB 2J88L 2ITCA 2B5IB 3O3AA 3FSZA 4GRWB 1HS6A 3JZ7A 3DMMA 3SKOB 3F12B 3S36X 4NQVB 3NCWA 3VRLE 3UC2A 4WGVB 3CZFA 3VSQA 5DXWA 4D0BB 4Y1AB 3HPLA 4X6DA 1EJOL 4BFJA 4NO3B 1F4HA 4PJCB 4KRMB 2NY1D 3GBLA 1DJHA 2EH8L 3JWDH 5DUBA 5AW5B 5FCSH 4F7MB 3QDGA 5JPMC 1G7LB 4MGXA 3KGTA 4Y4KC 3FUHA 3Q9PA 2XVLA 1B4TA 4X9IA 1J48A 5E6YA 4IGBD 3PQYD 3D25B 3ZTDC 4KROD 5KYXB 3NEEA 5A43C 4B3EA 1RXLA 2NY6D 4GI6A 4ODVL 4CAGA 4D9RE 2OYPA 3KJ6H 5F7AA 5KANI 4RFOL 5M7QA 2UZIL 4XOAA 3PF2A 5B38B 3E7JA 4YGVB 4JREC 5DJ8B 4QXGH 1AFVL 4OZHB 3PWNB 3CLFH 2N56A 2YJQA 2ARWA 2CR3A 2D3VA 3RUGE 2J72A 4NZUL 4Q2ZA 4OJCA 2OW7A 3O3BB 3OZKA 2BP0A 2GT9B 5KYYA 4M1GL 1VFBA 1YYML 3FFCD 2BIOA 1NIBA 2X4RA 3QQ3A 4QGTA 2HFEB 3L3JA 2XOTA 4JFHD 3GMMA 5ITBH 4JY6B 4ZO7A 3N55A 1V3KA 2BVQB 4JQXA 3VE0B 2VAAA 4A6YH 2O61A 2VE6A 3CLWA 5KOVC 5MENA 1VZGA 1SY6H 2OTPA 1DN0A 4P5SA 3EJCA 3NIFB 2NYYD 2O5XL 3LKRB 3GSXB 4XODA 3RWFA 2D3JA 2JJUA 1I3RA 2EEAA 3WY2A 3PJLA 1JXKA 3CBKB 4NQDB 1EWHA 3LD8B 3GI9H 4MNQE 4PJGB 4V1DD 2BSBA 4PY8J 4YDJA 3AG1B 4TUKH 3O41B 2CM6A 2VLRA 2W9LA 3WNOA 3RKPA 2GK2A 4ISVB 3MRBA 1FDLL 3T0EE 4UOW0 1MN4A 3R0MA 1JXJA 1UTDA 1UD6A 2PR4H 1J0KA 4JPVH 3V5KA 4UMGA 1QG3A 2F74B 4QHKI 2K9FB 2P3YA 3P9LB 2J6EH 4MKMA 1ZT4A 3TZVC 1UD4A 4AT6A 2H0PA 3PL6D 2APFA 3WEXB 1DLFH 2YOCA 2W65A 3HZ3A 2X6AA 4R0LC 1O6TA 2F7OA 2X4PA 1I3GH 4PUBH 3O8XD 2DQDH 4LLDB 1WG3A 4WU7B 1CE6A 5C7ZA 4DESA 2XBZA 5C0JB 2VL5A 1WWBX 1CCZA 4Q9QL 5EWIH 3BUPA 3TYFB 3FN0L 4OCSH 4DEPC 1BOGA 4POUB 4ZMNA 4YLQT 4JDTL 4IBQA 1A1OB 2FUQA 4H13C 4KQ3L 3WNKA 1FZOB 1FH5L 1M4KA 3EYSL 4B50A 5I1IL 5DRWA 3D4ZA 4P3CL 1O6SB 1WYJA 2AJZB 3CSPA 3H3PH 4EXPX 1CFVL 2XY2A 5E9DB 2PTTA 5FV1L 3OKOA 1G0YR 3VW3H 5IB5B 4JRLA 4F2MB 4FXTA 1I8MA 3MRRB 1BV8A 3NIFF 3EXJA 3C5JB 4HXAH 5IQ7H 1Z7JA 1L9SA 4MD5B 5F1SA 2WWKT 2E9JA 4TNFA 2XTJC 4P3CH 3VRLF 1KWGA 4NKIH 1KELL 5FUCC 1SYSA 3IU4L 3T77B 1T0MB 3TJHC 1OE2A 1E6OH 3DRTA 5AVUB 3MJ7A 4P4KD 1JVLA 3WIIH 4C83B 3TWYA 5BZZA 3HC4H 1JNHA 5DVNA 4ZW8A 5EU4A 3WLWC 1OAXH 4YH6A 4I48B 3HNSL 3KM2A 3QEHB 3QO1A 4B9IA 4JAMB 5H37A 4NCDA 4Y9FA 3V4VL 1L7IL 4DP9X 1FN4B 5CO1A 1QSEA 1X5LA 2GJJA 1SXCA 1U41A 4XNUH 3VI4B 3IGKA 1KYUA 2P48B 3NJHA 4HK3J 1I9IH 2CSPA 3D1MC 3O4LA 4FX5A 3ZYIA 2FO1A 4JDVA 4BHUA 1A7OL 1AR1C 1QWUA 2VLMD 2C9UA 4KRNA 4L1SA 1PFOA 4TOYH 2ADYA 1CU4H 3HNSH 3EUUA 2MPVA 1NKGA 1OZUA 1W8EA 2Y23A 4C8XA 4FYTA 3T3PE 1USZA 1Y6KR 2DMGA 4N9GB 2P7TB 5AYUH 3KPSE 1VADB 5F3FA 4Y4KB 4RAVA 3OLEA 1OM3L 5JPMB 1R5WB 1RZGA 2CHDA 2HKAA 4HFUL 4K94H 2C3XA 5DZAA 2IF7A 1M1XA 2AQQA 4WNSA 1TSHA 1MCKA 5E1QA 5I8EA 2YKLL 4OLXH 1CLYL 3WHXB 2H5UA 2J5LB 4UT7L 4F37F 2NNCA 2I60H 2JCCF 4F24A 2APVA 3UH8A 3H9ZA 1VERA 5JIHA 4Q74A 2W9DL 2C7UA 4MMYA 3US9A 4KJWC 4MS6A 3KPPA 3QAQA 5AUMA 5AB2A 1WD8A 1ZWIA 2X3CA 3L9YA 3M7FB 3E6FB 2ZX8A 4NNPL 2O6PA 5GS0C 1QEWB 2YPLE 3FB7A 3CVHA 1LGVA 1ZOXA 1KACB 3I6GA 4M5YH 1A6VH 2ZYSA 3DETC 3T1FA 3CIAA 5CWSA 1KJ2L 3DRTB 5DSCA 3IKCA 1Q90A 1AGCB 5FYJU 3SE3A 4UOQA 4M6NL 1JHKH 1TYEB 4YHNA 4OGAC 2WOYA 3KPSD 3QIUC 3WJJA 1OSYA 4CBZA 4GXVH 3H0TA 4AY0A 1JHTA 2PMZA 2P80D 1IT9L 4G9FA 1XGUA 1UOWA 4QNPF 5GZOD 1PMYA 1CFQB 1O6VA 1L9RA 3PP4H 1MHCA 5I66B 4P5TA 5AKSA 4DH2A 4KZEH 5ADOL 3NFSH 5DYFA 1KJMB 2XV0A 3FNKA 3C6LC 1XR8B 2XC8A 3O4OC 3KW8A 4LU5L 4OAWB 5F6HJ 1E9QA 2P8LA 4JFVA 5T1JA 1AHWB 5IHBA 5J0BA 4HZ1A 1AH1A 3EGSA 3W9DA 2XUWA 1SDDA 1HI6A 1MW0A 4LDCA 4JO1H 5C09B 2E7CA 1XB6A 3CMGA 2AANA 1UEYA 3MI6A 4N8VB 5HVHB 4IIQB 4QRSA 2OSYA 3PP4L 4ETQB 4GT0A 3WIAA 1X4XA 3Q5TA 1GKEA 5F7MC 3L4VA 3LZNA 4L05A 3QJTB 2PTUA 2PO6C 4KRPB 1UOVA 2BMKA 4R7NB 5JOPD 2L8AA 3QK0A 1HIMH 2BNQD 4N2GA 3LQMA 5FO8A 3STLB 5IJDC 1BVOA 3MACH 3PGCA 5B39B 1YLBB 1J0ZA 1JWMA 2MPAL 3CPLB 1HL9A 2I60L 3RVVD 3RX7A 3D85D 2WZ6A 1VACA 3VU1A 3OR7A 4Z76A 5BJTB 2LLNA 3RWEB 5DI8A 2AGJL 3T0AA 3GMOA 4R3SA 2JELH 2LQRA 4N2NA 5J06A 3KDMB 2R2BA 2AEOA 3N04A 5HHME 3FS9A 3MV01 2F6AA 1S7XA 4PJIA 4G6KL 1FO0L 2AI0H 4BZ2L 4K5NA 2ZT9C 5CCKL 4HQQH 1PKQE 2EVHA 3NJJA 3IGUA 4GQ9H 15C8L 1BD2B 4AKQA 4UIKL 2EJ1A 1DP0A 1MJ8H 4ZFGL 2XX0A 3L7EB 4Z7QF 2AK4A 3TBYB 4KVCH 2RBLA 4KTGA 2WQSA 1L5GA 2EDXA 4DP7X 5KYWA 3IDXH 4G7RB 4NN5C 3MUGA 43CAA 4LLYA 1EANA 4RAUB 4KX7A 2VDPL 3NFPB 4EI0A 2D7OA 4NQEE 1RHFA 1YPZB 1L7IH 4NUJB 1I1FB 4Y1AE 4L4VA 3MRGA 4LSSH 2EDRA 4MA3B 4U0QB 5B1KA 3Q44A 3ZTCC 3KWXA 3IS0X 5CFHA 3AREB 5FIEA 5EO1A 4PM1A 4RIRA 1RFDH 3CFEA 1MOEA 1SXAA 5FHBH 5KOMC 35C8H 4N90E 3EJRA 2NY2D 4G8AC 4RA3A 5H2BB 4C55A 4URTB 1CDYA 2R2EA 4XMUA 3F00A 4P46B 4AEEA 1EH9A 2R0WL 4L37B 3EFOB 1X5FA 3T6VA 4L4TD 4Z7WF 3UAAA 3J07A 3ZDXE 5EBGA 4K15A 4X7CC 4EI5A 1T5WA 4L1LA 4PTUA 5MEOB 1S3KH 2EH7L 2NY5C 5JXEC 1DVYA 4V11A 1AQKH 5L2KA 4JFFA 3W57A 2B59B 2FYYA 2QKSA 2VLRE 3CMOL 3E6HB 2H1XA 3GBML 1UT1A 2BWIA 2P43B 4M62H 3QXDB 3SE9L 4PU2A 3F58H 1C5BH 1W8OA 1WDAA 4ZJ9A 5KYUA 4JLRA 4DPCX 3DUUA 3D4GA 1ZTXE 5GGVY 3EW3B 3U6RB 4K5LA 5CZRA 2BERA 3KPRA 5E51A 1T5XB 4QGYA 3KL3A 3R8BB 3V55A 1V3MA 4P2RE 1ZK9A 4FQIH 3GO1H 1Y6MR 2HFFA 5ABAA 4ETQA 4XO8A 2XRAH 2R1WB 4FQXA 5HI3D 4WFGE 1DSYA 4I3RH 2VSDA 3P4MA 1WV7T 1UD5A 4JE0A 1VSCA 3N6YA 2GC4C 4PJDB 5C6TH 4OV5B 4YR6B 3K72A 2AAVA 3L3HA 1KGWA 3NK3A 2PXYD 2VABB 1RP8A 4M61B 2J2ZA 4J12A 3CVDA 5E6IC 2C8NA 1PX4A 2BNRB 4HU2A 4DK5A 2AJUH 2XI9A 4QR7A 5DD6B 1OCWL 3RILA 1MELA 1C7TA 4TTGA 1AZNA 1A3LH 4F7PA 4XNUL 1JZ5A 1CXIA 4F7EA 2CRZA 2NUPA 5C0CD 5HGHB 4M43L 2WIMA 3GMPA 2F8IA 3ZDZB 3TBVA 1XGRB 3L81A 4WEBL 3UZVA 3H56A 3HN3A 2BIHA 1JD7A 1QRNB 3IXAA 4PV8B 4X4XA 3E8UH 2XJKA 3U7YL 3VNZA 1EDHA 1R3HA 4MB1A 3H2QA 3KBFA 2D4DA 3H53A 4KROC 5EMYA 3EFDH 3WFEH 1UASA 3AS1A 4XPGH 1NGWB 1WFJA 5I28A 1JOIA 3WUZA 3PAUA 4JFQA 4AG4H 4LOVA 4OT1H 4S10A 3O11B 3Q2LA 4V1DB 4MQTB 3RGHA 3MHZA 1E4WH 5ESQA 1QWNA 3K2UL 4HEPG 4JVUA 5TDOA 3GJEA 3S3BB 1QSEE 3R1GL 4CMHC 3DJRA 3UADA 2HT4C 2I24N 4N8CL 2YGQA 2AEPL 1TJXA 4G8GD 1Z32X 3OJ2C 3LDBB 3OPZL 3IVKA 2D2OA 4JHAL 4PJFE 7PAZA 2OI9B 3QARA 1R5WA 1RZGB 3WFHA 4I5BB 4HJJL 4P57A 5LQBH 2ATPB 1DVSA 3LOWA 4N9GA 1UATA 2ITDA 1VESA 4KDTA 3ULSB 2HXAA 3NUKA 4IM8A 5GSRB 4QHUA 5INDA 5CUSL 3MZTA 2DQDL 2NTSP 4ZMYA 4ELDA 1PZCA 4XPAL 4ZAKD 4QHMA 1DQJB 4L23A 5EFIA 2B8OT 4JFFB 5T1KA 1T04A 3S34L 5HJBA 1JFQH 4IKNA 3G5WA 5DVPA 3ZKMC 3B83A 3S88L 3TBCA 3B7YA 4RRPG 5G5DB 5EOTB 1N8ZA 3UTPD 2Y36H 5FYJL 2XN0A 1DO6A 1MJUH 1S5HB 2YD6A 2F53D 1B0GB 4UQ2A 5DHVB 5BV7H 4DCQA 4Q6IB 3ABMB 1JAEA 4KPHH 2QLYA 4JANA 4S0TD 1G0XA 3LH2H 4WWID 3BP4A 1T21B 5DD1L 4XVJH 1WUNT 1CE1H 3ZO0A 5TD4A 2X1XR 1N68A 3BDBA 2PWGA 3K5RA 1SY6L 2NPLX 2VUOA 2HTLC 1A0QH 3L2LA 3ZDYB 1OE1A 2O5YH 5D7KE 4AVJA 4G9FE 2NSQA 2WSPA 1JD9A 4LCWD 1PLAA 3PLYA 4L3EE 1UA6H 1UZGA 4ZS6C 2AJZA 1NMAH 1ZA6A 2L7EA 3HEIB 3L3DA 1EBAA 2VISB 1KN2H 3MNDA 2Y7MA 2VNCA 5A2CA 1BOGB 1A6WH 3BWAB 1BIIB 1Z9NA 4QCIB 4ALAH 5ADPL 1FFOB 2EE2A 3KH3A 5F9AC 3WS6A 4HG4J 2OJEA 5CGMA 1CTMA 5BMFL 5J9PA 5MEPA 1CE6B 3VTAA 1QLEB 2BRRL 4P2OD 3VXPA 5E2JA 3FHAA 1PEWA 2ZNXA 2WTRA 3DA0A 2GJ6B 3HTLX 5TH2B 3U30C 3WAJA 1RUMH 1I9IL 2WMPB 3CZEA 1UKQA 3UBGA 3BIAX 3L4CA 3AU1A 1GGCL 5EV7A 1Z2KA 2QDVA 1QW8A 2VITB 4FNSA 5SWQB 3VWJB 1A64A 1NDGA 3DX6A 5AWNH 3ZKMD 3V5KB 3AAZA 4N2EA 4W9FC 5FV2A 5GS1A 1DDHB 5IQ9A 3HBQA 1EFXB 4YPGB 3OJDB 1OQXA 4BBWA 2FJHA 1BAGA 5GGQL 4EN3C 1ZA3A 4O51A 1KULA 4KFZC 3LKNA 3FT9A 4GG8A 5IR1B 1RUKH 5I74C 3QG6B 4A2DA 4PJIE 2XZQL 4Y5XB 4UU9A 5F8QC 4K4KA 1UYWL 3IS1X 4PMEA 5FW8A 4G80A 3QFDB 5KBLA 3K1DA 4GG6B 4MAUL 3MRKA 3MGOB 2VQTA 3HE6D 3U6XS 1A1MB 4XMVA 1LWHA 1WFIA 1E9QB 1J0HA 4XPBH 1CL7H 3QIUB 1M53A 2IMNA 4OD2B 3LRGA 3MRNA 2XZCL 3L4ZA 1BJMA 4JE4B 1QATA 4FHKA 4ZTEA 3ARXA 2I7SA 5B1CA 1NUFA 4JQXC 2IFFH 4L0PB 2H1PL 5GGTL 3GXPA 1AC0A 3K4ZA 2DD8H 3KR3L 4NRZB 2NCMA 4A66A 2WIIA 5AVQB 5L7XH 5FLVA 3GZKA 1FNEB 3WO3B 5JIDA 5KBNC 1OVZA 1W72H 1OGTA 1U42A 3UJTH 4RWYH 3PG2A 2XCMC 4OF5A