1TYQA

Crystal structure of arp2/3 complex with bound atp and calcium
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
417
structure length
399
Chain Sequence
b'AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
molecule tags Structural protein
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
total genus 126
structure length 399
sequence length 417
ec nomenclature
pdb deposition date 2004-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1tyqA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1tyqA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1tyqA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1tyqA04
3GE1A 1JCFA 3O08A 3O6WA 1IJJA 1NGDA 1GLEG 1XQSC 3TU5A 2E2NA 3VOVA 3QFUA 2A42A 4EAHD 5AQVA 5AFUA 1X9JA 3MCPA 2ASMA 1NGIA 3J8AA 4BREA 2P9NB 4CJ7A 5FPEA 2A6AA 1NGJA 3KHYA 3MMVA 4FWRA 5AZJB 3VEZA 3VEYA 4YDUC 4BRIA 3SLCA 5JICA 3UKRB 5FPMA 4FOEA 5AQJA 3GL1A 3CQYA 3TPQA 3LL3A 1BWFO 4H0PA 2QW9A 3AAQA 2NRHA 5AQXA 3ULEB 2ZGYA 3L4IA 1GLDG 4BGAA 3WXIA 3QBXA 1H1VA 3VGKA 1GLAG 3WXJA 1RDWX 4DQ8A 4BRCA 4A62A 3CERA 3FFKB 1C0GA 2PBDA 2CH6A 1MDUB 5BRFA 2Q0RA 3QBWA 1GLBG 2ZGZA 4JHDA 2Q0UA 3HM8A 4A61A 4NB4A 4MLHA 3ATUA 3GDQA 5ADXH 3QICA 1V4SA 5FPNA 2YI1A 4IJAA 3U4LA 1EQYA 1D4XA 4ISFA 3QFPA 2YCHA 2E2PA 2Q1NA 3ENHA 4H5NA 2I7PA 4IWVA 3ZETA 3O80A 4IJNA 3W3DA 2IVNA 3HSCA 4FL9A 1DGKN 5CE3A 1BUPA 3UKUB 4BRLA 3BF1A 4B1XB 3ATVA 1CZAN 3R8EA 4FWNA 3A5LC 4GNIA 4Y0WA 2Q31A 4FPAA 2P9IB 2D4WA 1NGEA 1ZC6A 4ISEA 1GLJO 4BRDA 3MK6A 2UYTA 2ASPA 5EX5A 1KAZA 4BRHA 2NZTA 2Q36A 4CZIA 1BDGA 4WYBA 4CZJA 2GEMA 4K41A 1T6CA 2AA4A 3U8XA 2F9WA 4MO4A 2VCPA 5AFUH 4A2AA 5AQQA 2FSJA 1NBWA 3VENA 3H1QA 4QS9A 1GLLO 5BREA 1JCGA 3DAWA 5KQDA 3OHRA 3M1FA 1R59O 4H0TB 4I6MA 4PKHA 3VEOA 3C0BA 2W40A 4CZFA 4O5FA 4B1YB 1Z05A 3VETA 1RFQA 1QQOA 3WQTA 2D0OA 2P9UB 2E2QA 3EKUA 3LDQA 3CQXA 1TYQA 4BR9A 5BN8A 3GOIA 2CGLA 1NGHA 3ZX0A 2YHXA 3O1BA 4NO7A 2QXLA 4BG9A 1ATNA 1NGCA 5BN9A 3UE5A 1HLUA 4FOIA 2P9KA 1QZ5A 2P9KB 2F9TA 1HKGA 4BRMA 3UKRA 2QWNA 1LOTB 4H0OA 2GELA 3VF6A 5AQUA 4EIAA 4FWMA 5AQSA 4CZLA 4MO5A 1P8ZA 4BR2A 3A8YA 4CZKA 5JLFA 3VERA 4PKIA 3LM9A 4I6MB 4J8FA 3VGLA 1WOQA 2FSNA 1G99A 2FF6A 2H3GX 3A5NC 3HI0A 4M7YA 2V51B 4C23A 4FWQA 2GUPA 5AQOA 4XH4A 4BC5A 3FZKA 5AQZA 1MWMA 3A5MC 3R6MA 2ITMA 5BRDA 3H1VX 1BOTO 3VEWA 3EO3A 4FWKA 3CETA 2CGJA 1BU6O 2P9LB 3FR0A 4XH1A 2FF3B 4H0VB 1K8KB 4CZHA 1KXPA 3IMXA 4LC9B 1HKBA 3ENOA 3UB5A 4WQ5C 3IUCA 4DB3A 5EY4A 1NWKA 2P9SB 2NLXA 2ASOA 2QM1A 4FWOA 4WQ4A 4K43A 4BRFA 4BC2A 3MN9A 3U9DA 2HF3A 3DXKB 5ELZA 1YXQA 4CD3A 4RWTA 2YHYA 2ZF5O 2EWSA 4DCHA 3ZETB 2GWJA 4EHTA 3O5BA 2I7NA 3HBTA 3M3ZA 5AQLA 4BROA 3D2EB 3FZMA 2A40A 3I33A 5AQHA 2VWBA 3CJ9A 1ZXOA 5KPRA 4AM6A 5EOYA 5AQGA 1NGFA 2V52B 3ID8A 4BVPA 3IFRA 5B8HA 1NLVA 3CJ7A 1X3MA 2V7ZA 4M7XA 4FWSA 3D2EA 2YJEA 1K8KA 4BR4A 1GLCG 4H0YB 2QWQA 1U2VB 5LY3A 4KBOA 5AQKA 1NM1A 5AQWA 2V7YA 1DEJA 3FZHA 3FZFA 4BC4A 1J6ZA 4BRKA 3DXKA 4CBUA 4WQ5A 4FPBA 1HKCA 3WXLA 3LM2A 2VYPA 5AQFA 2W41A 3ULEA 2QWRA 1KAYA 4L3QA 3JXUA 4HTLA 2QWOA 3LDOA 1MA9B 1NGBA 2AP1A 1C0FA 4CD1A 5LJVA 2CGKA 3CJAA 3EZWA 5ADXA 4BR5A 3MN5A 5AZJA 3SJHA 3D7EO 3SMSA 3UKUA 1QHAA 4CZGA 1ESVA 4BR0A 3LDLA 3ZEUB 3CJCA 3WQUA 2P9LA 3WUHA 4JN4A 4B1WB 1GLFO 5AQMA 3D2FB 1BA1A 1YAGA 3O4WA 4B1ZA 1XUPO 3BEXA 3EKSA 2P9PB 4WQ4C 3VEVA 5AQTA 1TUYA 2KHOA 2A3ZA 5LJWA 5EVZA 4K25A 1S22A 3EL2A 5F1XA 3U9ZA 2E8AA 2D0PA 2DPNA 4XH5A 4JHDB 3L6QA 4BG8A 2E1ZA 5AQIA 5EXWA 1LCUA 2HMPA 1T44A 1BO5O 3DXMA 4IO8A 1BG3A 2Q97A 4BVOA 1OKJA 4BGBA 2HOEA 3H46O 3VESA 4CZEA 3F9MA 3KVGA 3MN6A 4FWPA 3AAPA 4H5RA 4EFHA 5BPNA 1YUWA 1E4GT 3RSEB 3HZ6A 3GG4A 3D2FA 3BF3A 4Z94A 3DJCA 3RSEA 4DHYA 2J4RA 4BR7A 1KAXA 2P9UA 4H03B 1NMDA 3ZEUA 4PL7A 1QQNA 3R9PA 3AY9A 1RGIA 2E20A 4PKGA 2YHWA 4BC3A 1S3XA 1BA0A 1MWKA 5F0XA 2E88A 2GWKA 3WEEA 4H0XB 5KQ8A 3VF2A 2A41A 4FWLA 2QWPA 4B9QA 4YDUA 4CBWA 4JAXA 5AR0A 2PAVA 1TYQB 4H5WA 5KPTA 2D1KA 2IIRA 2FLOA 2YJFA 1XC3A 5TKYA 3EN9A 2ZWHA 5AQRA 3H3OB 1IG8A 2OANA 3FLCO 4ISGA 4JD2B 4BRQA 1YVNA 3DWLA 3QDKA 4BRPA 5E26A 4FSVA 3CJ1A 3O1WA 3M6GA 3BUZB 3WT0A 4JD2A 1HX1A 5JLHA 1JCEA 2P9PA 3B8AX 3IDHA 4CBXA 4RTFD 3A5OC 1TUUA 4JNEA 3MN7A 5AZIB 1X3NA 3L0QA 3C7NA 3CIPA 3P4IA 1Y64A 3W0LA 4BRNA 4M63C 3CI5A 3VF4A 1SQKA 1HUXA 4QS8A 1WUAA 5AQNA 5E84A 3I8BA 1U2VA 3CJBA 3MDQA 4CI6A 4RCHA 3WEEB 3QMLA 5F2RA 2P9IA 4H5VA 1HPMA 4O8KA 3BP8A 4MLEA 1NGGA 4F9OA 1Q18A 3H3NO 3VEXA 3SMPA 1SZ2A 1DKGD 1U6ZA 5JMVA 3ZX3A 2IVOA 4GY2B 1T6DA 5BPMA 2BUPA 2Q2RA 2IVPA 3C7NB 5AZIA 3O8MA 3FE1A 2WUSA 3S41A 3VPZA 1V4TA 1Z6RA 1NGAA 3KZBA 1ZBSA 1ATRA 3JS6A 1SAZA 2A5XA 3G25A 3H45C 3HTVA 5BPLA 3ZX2A 4FO0A 4HWIA 3FGUA 4B1UB 2QWMA 2GTDA 4BRGA 4BQLA 1HJOA 2P9SA 2BTFA 1E4FT 5KPZA 4XEIA 5I9EB 2P9NA 4CZMA 3DXMB 4IZ9A 4E1JA 2FSKA 3H6EA 4PL8A 5AQYA 3CHWA 4BQZA 5BR9A 3GBTA 4K42A 2E1YA 1QQMA 4B1VA 3LDPA 4BRAA 5FPDA 3LDNA 3WXKA 3FZLA 5AQPA 2QWLA 2FXUA 4IXCA 3SK3A 4EHUA 1QZ6A 3VGMA 1ATSA 2CH5A 4A2BA 2E2OA 4AM7A 4H5TA 2HF4A 3A0IX 3AARA 5BRHA 3QB0A 4QS7A
chains in the Genus database with same CATH superfamily
1EWRA 5GAHP 3AO5A 3VQ7A 2Z1HA 5C12A 1IJJA 1GLEG 1XQSC 2BANA 2E2NA 3QFUA 2A42A 4CGHA 3CCVN 2O8DB 3RWUA 4CJTA 4JS5A 1ASWA 4NYNA 2P9NB 5FPEA 1NGJA 4FLZA 2BDPA 4FVMA 3AVBA 3KJVA 1P90A 1RNHA 1N6QA 2HHSA 2HHHK 1VSEA 4IEEA 4YOWA 5FPMA 3QEVA 3CQYA 3OYHA 1HYVA 3AAQA 1IBMK 3WNEA 3VQQA 3VGKA 3WXJA 1RDWX 2E5LK 3P1GA 4WFAL 3AVIA 4A62A 2YV0X 3AVCA 3CERA 1QE1A 3BY5A 2Q0RA 1KD1O 1VSKA 4JHDA 4YOYA 1KLNA 4LF4K 3KLEA 3DYAA 5HRPA 4GV6A 4CJ4A 3HRGA 3GDQA 2YI1A 3AA2A 4JK8A 3U4LA 4W5QA 3NH0A 3MCAB 1T3VA 4DSKA 3P83D 4OKKA 4CFAA 3U6FA 4B3OA 1EO1A 3HSCA 3SUQA 1DGKN 2VQEK 1BUPA 3NH2A 4JI7K 3DMJA 4DG1A 1HR0K 3G4SN 3CG7A 3ATVA 1CZAN 1HNXK 4GMJB 4HUEA 3SV3A 3VA0A 4FWNA 3ZSXA 3HK2A 2ZD1A 3OYKA 4H4OA 3P39A 2XO7A 3ZLJA 2D4WA 1BI4B 4BRDA 3SCXA 5HRRA 3VQAA 1TAUA 4CEZA 1SL1A 4LFBK 4CZIA 1VSFA 1BDGA 4WYBA 1RT4A 2VGMA 4K41A 1SKWA 1FJGK 2KTQA 3C95A 1WN7A 2F9WA 4FJGA 5AFUH 3SZ2A 2FSJA 1TK8A 1NBWA 1VQ4N 2XY8A 2ZE2A 3ZT0A 5GIPA 3S5TA 1VSDA 3L2WA 5EU7A 4CF9A 4U7BA 3M1FA 1R59O 3C0BA 4AHVA 3KWGA 1RFQA 3VQ5A 2P9UB 4KHSA 2HMIA 2E2QA 4FZYA 2IDOA 1LWEA 3LPTA 3QERA 1NGHA 3ZX0A 2YHXA 3O1BA 1Q7YO 4ZTJA 3UE5A 2BH1A 1HLUA 2X6NA 3ZT2A 4OPJA 4OGCA 4JI0K 4BRMA 1Y97A 2QWNA 4BEBA 1LOTB 5M1OA 4B08A 3VF6A 1EWQA 4CZLA 2KFNA 4CZKA 2QI2A 3VERA 4PKIA 5J2PA 3VN5A 3SBGA 3K5OA 4CEEA 4M7YA 4C23A 4FWQA 4B9MA 4FJHA 4DR6K 5AQOA 4F2RA 4YOVA 2PY5A 5C42A 4H8KA 3VTHA 5AQZA 1CXUA 4JKFA 4I2PA 5BRDA 1VSLA 2XRIA 3VEWA 3CCEN 1KC8O 4F3OA 2KLAA 2YNIA 4DMNA 1T8EA 1BU6O 1CZ9A 2NRRA 4N56A 4FJ9A 1IO2A 3ZSOA 4XH1A 3CC4N 1TK5A 4KI6A 4DWIA 4CZHA 1RT1A 3V81A 4LC9B 1HKBA 3UB5A 1EX4A 1LW0A 4CGJA 1DLOA 3TSPA 4DR1K 4UY8O 5IT9O 3MN9A 4CJQA 4CHYA 5ELZA 3AVKA 3J7YP 3E66A 4EHTA 1RDAA 5J2NA 5CZ1A 5M1NA 3HBTA 3M3ZA 4E72A 1D9DA 3P31A 4JRPA 2VG6A 3HOSA 2A40A 2OTJN 4OPAA 3I56N 3KKSA 1X9WA 2QEXN 4AM6A 2OPPA 4B3SK 1NGFA 3SUOA 3ID8A 2ETJA 4DSEA 1VQON 3IFRA 4KO0A 4K0KK 1E3MA 1TKZA 4M7XA 3OY9A 1LV5A 2GV9A 1S72N 1WSJA 4DU3A 1GLCG 3NF9A 5C24A 4DTOA 1JXEA 3OYDA 4KBOA 1NM1A 4YORA 2OPSA 3SAGA 1YT3A 4BRKA 4Y1DA 2GX9A 4FPBA 3L2RA 4B3MK 3KK2A 4ZTFA 3G10A 3DRRA 3MXJA 2W41A 3ZSRA 3QETA 1JL2A 3LDOA 1FXXA 3VQBA 3O3HA 4O0JA 4CD1A 2BGGA 4IDHA 3E01A 3B6OA 4B3TK 4W5NA 2VWJA 1S1VA 1HYSA 4OPHA 3SMSA 4LFCK 1QHAA 3AGRA 4CZGA 3LDLA 2RN2A 3SNNA 3Q7BA 2Q3SA 3WUHA 3PO4A 3SQ1A 1LWCA 3J7ZO 1X9MA 1XNQK 1A5VA 2YHBA 1RTDA 3OYFA 2HHVA 3B6PA 3EKSA 2P9PB 3L2UA 3VEVA 2KHOA 3HYFA 5LJWA 1OH6A 4K25A 4KRFA 3U9ZA 2ZJQL 2F8SA 3LANA 4JHDB 3L6QA 3ID6A 2E1ZA 2HMPA 3G6EN 1BG3A 2Q97A 4IFEA 2O8CA 3VESA 4CZEA 5HP1A 3KVGA 3OS0A 4Z4EA 1E4GT 4MDBA 4DTPA 3PX0A 4O44A 4Z94A 3DJCA 4CIEA 4DHYA 1NJZA 1K8AO 3V9UA 4CJLA 3ZEUA 1FK9A 1BQMA 3VMFB 4KB0A 4KHQA 4FLYA 1QQNA 4KHWA 1RT7A 1HNWK 3E1YA 5I3UA 2HB5A 4CHNA 3OS2A 4B9UA 4HTUA 3RMAA 1BA0A 4OKJA 2GWKA 2HNYA 1R0AA 5KQ8A 3OW2M 2O8FA 4A5AA 4B9QA 3KK1A 2YKMA 1TV6A 2G8UA 5AR0A 5J1EA 3SQ2A 2PAVA 4Z0UA 4M45A 1TYQB 2FLOA 1XC3A 5TKYA 1UWBA 3VA3A 2X6SA 3V4IA 3HO1A 3C6AA 1RBSA 1LAVA 3H3OB 1IG8A 4BRQA 3FLCO 4ILJA 3LAMA 3M6GA 3BUZB 4DSFA 1HX1A 1BCOA 1C0UA 4A57A 4CBXA 1JKHA 1KRPA 4RTFD 3CYGA 4JNEA 3MN7A 3VQ4A 2NRWA 4DSJA 3P4IA 1Y64A 4M3XA 3QNOA 1NKCA 3H08A 1B9FA 1SQKA 5AQNA 2AJQA 3PSFA 1W7AA 3I0SA 1XHXA 2F7TA 3K5LA 4FW1A 1T03A 4CI6A 4E1MA 3F73A 2VWKA 3WEEB 3ZSVA 3QMLA 1HPMA 4PA1A 3MWPA 4O8KA 3BP8A 4F9OA 1JLEA 3THWA 2IVOA 4DF8A 3AVAA 4LH4A 4BE2A 1NKEA 1X9SA 1IKWA 3FE1A 3PIOL 3VPZA 4DTXA 1Z6RA 4IEIA 1NGAA 4F3TA 3VQEA 1VAZA 1ZBSA 1ATRA 1SAZA 3FFIA 3THYB 4B3RK 2IGIA 4FO0A 1GOAA 2D0BA 1HJOA 2P9SA 4BQLA 1DTQA 3M8PA 4CGFA 4I9LA 3DXMB 4IZ9A 1NK5A 3Q7CA 3S9HA 1IH7A 3AVMA 3H6EA 4ILGB 3GBTA 1VQ6N 5H1SQ 4B1VA 5HRSA 3LDPA 4QCLA 3WXKA 5AQPA 5J2QA 2HHTA 3CM5A 2QXFA 4X65K 5HOOA 4AHCA 1I94K 2CH5A 1DTTA 4OVLA 1RT5A 1RBVA 2NRZA 5BRHA 3MWTA 4KHNA 4WF9L 3GE1A 1JCFA 3M8QA 3L4QA 1WBBA 4EAHD 1X9JA 3MCPA 1KLMA 4DU4A 3J8AA 1TKXA 1WSEA 3QIPA 3AO3A 4EP4A 2A6AA 3MMVA 4FWRA 3T19A 3THXB 4O5BA 4YDUC 4BRIA 5JICA 1HQEA 4AHSA 3PO5A 5E41A 4CK1A 3ULEB 3MAQA 1GLDG 4FJ8A 2P5GA 1C0TA 1JLFA 4NXMK 3HXMA 4RW9A 5IWAK 1QS4A 4BRCA 2ZJPL 1KTQA 3EY1A 1NJIO 1SL0A 3FFKB 4Q5VA 4CEFA 4CGIA 1JLGA 1MDUB 4B9LA 4XIUA 3OYGA 2Z1GA 4BWMA 1GLBG 2ZGZA 4RW7A 2QA4N 3K59A 1L3UA 3KLIA 4A61A 3AA3A 3ATUA 3MEGA 1M90O 5FPNA 4KHYA 3OYMA 4IJAA 3QFPA 4H5NA 2E2PA 3OVNA 3QNNA 1A5WA 2KQ2A 3O80A 1NJWA 1U4BA 4CFDA 4V19S 3DRSA 4FL9A 1S6PA 1TKTA 3TAFA 4HCCA 1GOBA 4CIGA 4DLEA 1D9FA 3AVGA 5MLCQ 2DY4A 3NF6A 3R8EA 3DLEA 3SYZA 3PY8A 3BDPA 4GNIA 4JKHA 4FJ5A 4Y0WA 2Q31A 4FJKA 4FPAA 1VHXA 1JLBA 2I5JA 4CHOA 2D5RA 3IRXA 3K9JA 5GIOA 1Q82O 2UYTA 2IS3A 5EX5A 1IBKK 4HHTA 4BRHA 2Q36A 2HHXA 4CZJA 4C8MA 4M42A 2AA4A 1C0MA 4FJ7A 4MO4A 5LMNK 3LZJA 4CF8A 1ITGA 2DFHA 3TTDA 2NUBA 4CFBA 4N76A 4DQPA 4KTQA 3VENA 3O9QA 4KI4A 4DR7K 4QS9A 1GLLO 1JCGA 5LL6Z 1YIJN 4RW6A 3TAPA 4CJPA 4FLUA 4H0TB 1S1WA 4I6MA 2W40A 1BCMA 4B1YB 3ULDA 3NFAA 3LDQA 3ZSQA 3QINA 4R5PA 4BG9A 2QXLA 4ILHA 1NGCA 5BN9A 4FOIA 4M3TA 1ASVA 4CJFA 4PHTX 3CF5L 1O13A 1NK0A 2F9TA 5HROA 4H0OA 3KIOA 2GELA 4C8LA 1OH7A 1Q8IA 4EIAA 4MO5A 4YOUA 1P8ZA 1OVYA 4BDZA 4YNQA 4JI8K 4G1QA 4I6MB 2HW3A 1WOQA 3O9SA 1G99A 2FF6A 1KCFA 4YY3K 2WC9A 3V1OA 3KTQA 4LF8K 5M1FA 1RILA 3FZKA 4PQUA 4ELVA 3R6MA 3D45A 4NYFA 3EO3A 3V1RA 4DSIA 2CGJA 3FR0A 3HOTA 4L8RB 1RT3A 1KVCA 2O8CB 1WSIA 3AA5X 1W2BM 4IBNA 2YNHA 3T3FA 4E7IA 1QHTA 4WQ5C 4IO9L 4DB3A 1C1BA 5EY4A 2QM1A 2NLXA 4FWOA 4WQ4A 4KV8A 4FYDA 5T7BA 3K9KA 4BRFA 4DLGA 4OKEA 4CGGA 2DFFA 3T69A 1TKDA 2HF3A 1WNSA 1YXQA 4CD3A 1W9HA 3LALA 2YHYA 4RWTA 2ZF5O 4BE1A 2EWSA 3RTVA 4C1NI 5FLXO 2VG7A 3QLHA 4HCBA 3O5BA 5CYQA 3I33A 5AQHA 4RG8A 3ZCMA 1IBLK 1ZXOA 5KPRA 1CLQA 5AQGA 3NAEA 5LMUK 4CHQA 3SI6A 5B8HA 5GAEP 3CJ7A 3ISNC 3NGYA 1VQ5N 4FCYA 4DR4K 2O8BB 3CCSN 3D2EA 3DLRA 3THYA 1K8KA 4H0YB 2QWQA 4FZXC 4FJIA 3FZHA 3FZFA 4WQ5A 4FLVA 1HKCA 3LM2A 3DLLL 5C0YA 5AQFA 1BGXT 1N34K 1VQNN 1IKYA 3IAYA 4HTLA 2QWOA 1SL2A 1MA9B 1NGBA 2WBNA 3C6UA 4CK2A 5LJVA 4E3SA 3SJJA 2YX6A 4Z4IA 3D0PA 3ZT3A 4BACA 4PUOA 3UKUA 3CMEN 2NRVA 4Z4GA 3ZEUB 1HNIA 2UXBK 2HVHA 5M1KA 1GLFO 4DTRA 2W6KA 1LWFA 3AGKA 4DV5K 3AVJA 5BR8K 3O4WA 4O0IA 3RMCA 4JI4K 5AQTA 1TUYA 3RMDA 1S22A 3PV8A 2E8AA 1FW6A 3NMUA 4RW4A 1J54A 3CCJN 5AQIA 2IAJA 4DTUA 4NXNK 1BO5O 4A5BA 4BVOA 4F2SA 1OKJA 4BGBA 1BISA 1RBUA 2HOEA 3F9MA 3MN6A 3VQDA 3AAPA 3OYCA 3O4NA 4EFHA 3RSEB 3HZ6A 3BF3A 5C2DA 3UIQA 4CJVA 3VQ6A 1U49A 4GKJK 1Q81O 1XI1A 3SQ4A 3M8SA 3THWB 5C25A 3AY9A 1C1AA 3TAMA 1RGIA 4CJKA 4A59A 2YHWA 4BC3A 1TGOA 1S3XA 5C15A 3TTFA 2NRXA 2RKIA 3DLGA 3WEEA 3OBYA 1N8RO 3N4PA 1VQMN 3L2VA 3I0RA 3NHGA 4CIFA 1WLJA 3KLGA 3OYAA 5KPTA 5FRMA 4KAZA 3EN9A 2ZWHA 5KRTA 3TAGA 3AO2A 1XC9A 4JD2B 4DQSA 4DF4A 4DFKA 3U3GA 1I39A 4BRPA 3CJ1A 3V9SA 1RDDA 3O1WA 4NLBA 1ZBFA 1NMNA 5JLHA 1JCEA 2P9PA 3L2QA 3LPUA 4W5TA 2LSNA 1TUUA 5AZIB 1X3NA 3C7NA 3CIPA 4KKOA 3VF4A 3CI5A 2RF2A 1WUAA 2YNGA 3ASMA 5J2MA 1U2VA 3MDQA 4JYAK 4WFNL 2OPQA 3K0SA 3ITHA 4CJUA 2W6LA 4KB1A 4GVEA 2GUIA 4FK4A 4H5VA 3G0ZA 3IKMA 3E9PA 3H3NO 1QVGM 1JLAA 2HBLA 3SMPA 1QSYA 2QTDA 5C2FA 1U6ZA 3ZX3A 4I9QA 2JGUA 1RTHA 4GY2B 1T6DA 5BPMA 2BUPA 3V9WA 3C7NB 4CESA 3S3NA 2WUSA 3S41A 4FLWA 3J7AP 3G25A 5TKWA 2EHGA 1RCHA 4B1UB 1M1KO 1J9AA 1YITN 3RR7A 3MEDA 5KPZA 4XEIA 4LF5K 4CZMA 4PL8A 2NRTA 4BE0A 2E1YA 1QQMA 3K57A 3ENBA 4BRAA 5CZ2A 5FPDA 4I2QA 2O8EB 2QWLA 4IXCA 3SK3A 3VGMA 1ATSA 3CPEA 3DRPA 1HPZA 4FJMA 4PY5A 2HF4A 3A0IX 3AARA 1YHQN 3QB0A 5GAGP 4ID5A 3AVFA 4DV4K 1UA0A 3O6WA 3HP6A 5A2QO 5M1PA 1NGDA 2OYQA 3TU5A 3VOVA 4LF6K 5AFUA 4LF7K 1VQPN 4CJ7A 3C6TA 3WNFA 5AZJB 3CFOA 3VEYA 4DS4A 4DV1K 5SWMA 1C1CA 1WBDA 2OPRA 4B9VA 3UKRB 3WXMB 1KQSM 1BWFO 4MQ3A 2NRHA 5AQXA 3CCQN 3O9TA 1OH8A 1S1XA 3WXIA 4E89A 3M5RA 1Q9XA 3L3UA 4NCAA 1Z26A 3TAQA 1U04A 3O3FA 1C0GA 5DM7L 4ELUA 5BRFA 1QQCA 3QBWA 4CEDA 2OZSA 4CK3A 3HM8A 2QKBA 5DK5A 4NB4A 4MLHA 5ADXH 3QICA 1V4SA 2E4LA 2XHBA 3QEXA 3O3GA 4E7JA 1D4XA 4OGEA 2YCHA 3S3MA 1BIUA 2I7PA 4K8ZA 4JI6K 3ZETA 3OJUA 2FC0A 1DT9A 4N47A 4IJNA 4JEPA 2IVNA 4XJXA 4DQRA 4JK9A 1UA1A 4GW6A 1RBTA 4O8UA 4LSNA 3UKUB 4BRLA 2HHUA 3BF1A 5C10A 5HRNA 1NU0A 2B5JA 1WAJA 4JS4A 5HBMA 3CCUN 3A5LC 1OVQA 1U47A 2P9IB 5KI6A 1JL1A 3OYIA 4CJSA 1ASUA 5JENA 4ISEA 2RPIA 3MK6A 3LP1A 2G8HA 2ASPA 4E7LA 2NZTA 1T6CA 4UQGA 2OTLN 5KGXA 4BDYA 2VCPA 3O9RA 5AQQA 2X74A 4ID1A 4FM2A 5BREA 3QEIA 3DAWA 4CEQA 1JLQA 5HL7L 3LZIA 3OHRA 4PKHA 4CZFA 4O5FA 1ZYQA 4JKEA 4DV6K 5SZTA 3WQTA 4WCEL 2D0OA 1YTUA 1RT6A 1TYQA 2UUAK 4BR9A 3NF7A 5BN8A 1B92A 2CGLA 4JI5K 1ATNA 4Z4HA 3QEPA 1QZ5A 4RW8A 4GV3A 3PUFA 2O8EA 3ZSWA 4DV3K 3UKRA 4X66K 5AQUA 3LDSA 4BR2A 1RDUA 3A8YA 5JLFA 1TAQA 1SS6A 1HYZA 2D0AA 3KKRA 1NJXA 3LM9A 5KTQA 3VGLA 3KLFA 2H3GX 4DV7K 3HJFA 4QOZB 2GUPA 4DR5K 4Q0BA 4C8KA 1YJWN 3OTOK 2ITMA 3H1VX 3N4QA 2KZZA 1O1WA 1YF5L 3V9XA 5JVGL 3T1HK 2C1GA 4FM1A 4DFMA 1QSLA 2P9LB 1U45A 2DTUA 5DMRA 2FF3B 1FKOA 4F8RA 4W5RA 3TR8A 4F4KA 3AVNA 3IMXA 4M3ZA 3L8BA 4ZHRA 3ENOA 1G15A 3IUCA 1NWKA 3CPWM 1RBRA 2P9SB 1K9MO 3LP0A 2PZSA 3MX2A 3RR8A 2IC3A 2UUCK 1VRUA 1GOCA 3C94A 3U9DA 3DXKB 4OX9K 3KK7A 4KTZA 1QTMA 3NVMA 3KLHA 4LSLA 3ZETB 2GWJA 3VQPA 4BE7B 3A2FA 1WSFA 4CECA 1NOYA 4B8AB 2KW4A 1SKSA 2C1IA 4H4MA 1RDCA 2V52B 3I55N 4BVPA 4OLAA 4C8OA 3QESA 3NE6A 1NG9A 3EEQA 4U67L 4C8NA 5LY3A 3OA9A 3OYEA 4CJ5A 2V7YA 1HNVA 3DXKA 4CBUA 2PYJA 3NH1A 1A5XA 1VSIA 4FJNA 4M41A 4BWJA 1ZBUA 1BL3A 2QWRA 3CC7N 1ZBHA 4L3QA 3JXUA 4OLBA 2P1JA 2CGKA 3CJAA 3EZWA 1L5UA 4BR5A 3QO9A 1L3SA 1FKPA 5AZJA 1TL1A 3D7EO 3O9UA 5CYMA 1ESVA 3LWMA 2O8DA 4Z4FA 4JI1K 4CJRA 5AQMA 3ALYA 5D3GA 1YAGA 4E19A 4B1ZA 1N36K 2YNFA 1XUPO 3SV4A 2EX3A 4FJLA 4JI3K 3NCIA 1WSHA 3F5TA 3EL2A 3C6HA 5F1XA 2D0PA 2DPNA 4XH5A 2X78A 4B9SA 3HT3A 5EXWA 4FK0A 4IO8A 2VQFK 4KHUA 1YTAA 1HQUA 2OZMA 1LW2A 4E0DA 3HL8A 4FWPA 5BPNA 1S5JA 3CFRA 3OS1A 4JKDA 3TTCA 3G71N 4X64K 1N5YA 3BGRA 3RSEA 4DS5A 1OH5A 4BECA 2J4RA 3OYBA 2D0CA 4BR7A 4N5SA 1KAXA 4AHUA 4H03B 4LFAK 2W42A 1K73O 2KZMA 2B4JA 3SPYA 3R9PA 4PKGA 4B8CA 4WFBL 4AHRA 3IS9A 2QKKA 4G9ZA 1BQNA 5F0XA 2E88A 2KKZA 1S1UA 1UAXA 3TSQA 3VF2A 1XNRK 3NGIA 2A41A 4YDUA 4CBWA 4KH4A 4IOCL 4CJWA 1Q9YA 2NNWA 3S3OA 4H5WA 4OO1J 2D1KA 1NK8A 1XWLA 2UXDK 2A1RA 4CF1A 2OANA 3QDKA 5E26A 4FSVA 1N32K 1NK7A 4FLXA 1D8YA 4CJEA 4J2AA 3IDHA 1W0HA 1HJRA 3A5OC 3L0QA 4M63C 2GBZA 2WOMA 4QS8A 3J81O 5E84A 2Z1JA 4DTMA 2UU9K 3TABA 4CJ3A 4RCHA 2HHWA 2FBTA 2ITGA 5F2RA 2PFUA 2P9IA 3CCLN 4Y1CA 3TSUA 3QIOA 3DLBA 1NGGA 1NNEA 1SZ2A 3DOLA 3KWIA 3HPGA 1HRHA 4JKAA 1S9GA 4K8XA 4IFVA 3AVHA 4FVUA 1W97L 1V4TA 2RHKA 1U48A 2PYLA 4AQYK 3KZBA 1WB9A 2A5XA 4IDKA 3CYMA 3H45C 4IOAL 3ZX2A 3ZSZA 3FGUA 2GTDA 4I7FA 2BTFA 4GV9A 1E4FT 3CQ8A 5I9EB 2WONA 4E1JA 5AQYA 4BQZA 3CHWA 5BR9A 4K42A 3HVRA 4NCGA 3DI6A 1NKBA 1KVBA 3SBTA 3U3YA 4EHUA 2E6LA 4R79A 2IOCA 2E2OA 4AM7A 4CW7B 3CMAN 2HHIA 4DFPA 4BDPA 3ZSYA 3CCRN 3O08A 3TAEA 3V6DA 3SUNA 4JRQA 3E9LA 1KSPA 5AQVA 3CD6N 1ZBIA 3OYNA 2ASMA 1NGIA 3RMBA 5JVHL 4BREA 4KFBA 3KHYA 3VEZA 1T05A 1SUQA 3SLCA 4DV0K 5GADP 4FOEA 5AQJA 3GL1A 4CEBA 3TPQA 3LL3A 4H0PA 2QW9A 3K2PA 2ZGYA 3L4IA 4J2EA 2R7YA 1RTJA 4BGAA 3MEEA 3QBXA 1H1VA 1GLAG 2BE2A 4LD0A 4O55A 4DQ8A 1SKRA 1VQLN 4C1NK 2FBYA 2PBDA 1TK0A 2CH6A 5I42A 4FJJA 2O8BA 2Q0UA 3V1QA 4JKBA 4E7HA 3JAMO 3MX5A 4B9TA 2ZM6K 2JWLA 1J5EK 3L3VA 1EQYA 4ISFA 2Q1NA 3ENHA 1BIZA 4IWVA 3AV9A 3M8RA 1UOCA 4EZ6A 3W3DA 4M3RA 3F9KA 4IOXA 2ZQBA 3PX4A 5CE3A 5HLFA 1X1PA 3TANA 2F8TA 4B1XB 3AVLA 4FZZA 1NGEA 1ZC6A 3WNHA 1GLJO 4O4GA 4FLTA 3KK3A 4DV2K 1J5OA 1KAZA 2G8FA 3ZYYX 1VQKN 2A1SA 2P5OA 2GEMA 3CM6A 2O8FB 3U8XA 1VQ9N 4CCHA 1YJNN 2KFZA 2OCEA 4A2AA 4FXDA 3BZCA 3H1QA 3D6RA 1JJ2M 3KD1E 2G8IA 1NK9A 5KQDA 4DSLA 4YOTA 1MU2A 3VEOA 1VRTA 2F96A 1EXQA 2VG5A 3DLKA 1Z05A 3VETA 1XMOK 1QQOA 4Z4CA 1D5AA 3EKUA 1VQ8N 3CQXA 3C65A 4DU1A 3T1YK 3GOIA 1EETA 4OPKA 4JI2K 4NO7A 2ATQA 5AJ3K 3SAFA 2P9KA 4M3WA 3JSMA 3SQ0A 2P9KB 3T7ZA 1VSMA 1HKGA 4DR2K 3LP2A 3MXIA 4FK2A 5FDLA 4DQQA 4FWMA 5AQSA 4KPYA 4EP5A 2OA8A 4LY7A 4LH5A 4J8FA 2XY7A 2FSNA 3A5NC 3HI0A 3AA4A 1VSHA 2V51B 3BZKA 1L3VA 1VSJA 2O4GA 4AF1A 4XH4A 4BC5A 2RE2A 3KD5E 3VQCA 1Z25A 1YJ9N 1MWMA 3A5MC 1QSSA 4M3UA 2UXCK 1BOTO 4OJRA 1BHLA 4FWKA 3CETA 4FM0A 1J53A 4AHTA 4H0VB 1K8KB 1KXPA 4IFYA 4KH6A 3ZT4A 3PSIA 2YHAA 3SUPA 3P5JA 4KTWA 2HHQA 1NK6A 3OYJA 2ASOA 4DUYK 4B9NA 2F4VK 1NJYA 2DFEA 5CY4A 4DKWA 3P38A 3O4QA 4K43A 3MXMA 4ICLA 4BC2A 4PWDA 4AILC 4W5OA 2XY6A 4JKGB 5FROA 5CHIA 4X62K 3PLAA 1IKVA 2HNDA 1IG9A 1EP4A 4DCHA 2I7NA 5AQLA 4BROA 3D2EB 4GKKK 3FZMA 3IG1A 3HPHA 2VWBA 3CJ9A 1L3TA 1VK0A 4E1NA 5EOYA 3RVCA 2HNZA 4CVNE 1NLVA 1X3MA 3EE9A 2V7ZA 4FWSA 5JS2A 4KH5A 2YJEA 2JLEA 4BR4A 1Q86O 4DUZK 2Y1IA 1U2VB 5AQKA 3LWLA 5AQWA 4IG0A 1DEJA 4YOXA 4BC4A 1J6ZA 4JKGA 3PIPL 3LP3A 2VGNA 3CCMN 2P51A 4EZ9A 3WXLA 4KHPK 2VYPA 4GVMA 3J80O 3ULEA 1S9EA 1KAYA 1RTIA 3DM2A 3OBWA 2AP1A 1C0FA 3ZT1A 4LF9K 4YFUA 5ADXA 3SAHA 3MN5A 3SJHA 5JS1A 1C6VA 4BR0A 3CJCA 3WQUA 2P9LA 3E9OA 1LAWA 2FBVA 4CE9A 4JN4A 1KFDA 4B1WB 1TL3A 1YI2N 1N33K 3LAKA 1SV5A 1BA1A 3D2FB 1VQ7N 1KFSA 5FRNA 3BEXA 1HNZK 1TVRA 4WQ4C 4JLHA 2A3ZA 5EVZA 1ILYA 3CXCM 2Y1JA 1EKEA 1YVUA 4BG8A 1LCUA 3CC2N 1T44A 1CXQA 3DXMA 1QVFM 4N41A 3H46O 3EE8A 2B6AA 4H5RA 4ELTA 2QK9A 4DFJA 1YUWA 4WE1A 1K6YA 2XY5A 3GG4A 1KVAA 3D2FA 5DM6L 4NCBA 1T7PA 3OYLA 4HUFA 1XMQK 1RT2A 2ZJRL 2WTUA 2P9UA 1NMDA 4PL7A 3RRHA 3THXA 3QEWA 1REVA 3SPZA 4JKCA 1BI4A 4CERA 2E20A 5KGWA 1JXBA 2JWKA 4TSXA 4DR3K 3T1AA 3VQ8A 1S1TA 1MWKA 5M1QA 4CF2A 3I8DA 4H0XB 3NF8A 5CR4A 4HUGA 1WSGA 4FWLA 3HVTA 2QWPA 3DOKA 4DQIA 1B9DA 4JAXA 1WAFA 3AO4A 3R1XA 4CEOA 4JV5K 4FW2A 3EZ5A 2UUBK 5K14A 4NLCA 2YJFA 2IIRA 4HVJA 4MDAA 2O4IA 1S6QA 1JLCA 2W00A 5AQRA 1XHZA 2G8KA 4ISGA 4E7KA 1YVNA 3NVKA 4CFCA 3DWLA 1NOZA 3HSTB 2G8WA 3AO1A 3HPOA 3WT0A 4JD2A 3F2KA 2WFBA 2HBJA 2Z1IA 3B8AX 4IG3A 4KREA 1RDBA 2G8VA 3DLHA 2YKNA 3THVA 2HSTA 3MECA 3W0LA 3WNGA 4BRNA 3K5MA 3NGZA 1HUXA 5KRSA 4QAGA 1ZBLA 4AH9A 3I8BA 4MFBA 3CJBA 2E6MA 4CHPA 3HM9A 3VTIA 4MLEA 4DTSA 1Q18A 3VEXA 5GINA 3NDKA 3K5NA 4M3YA 4DTJA 1DKGD 4FJXA 2HBMA 5JMVA 3VQ9A 3JYTA 2FBXA 2HBKA 3CFPA 2Q2RA 1CZBA 2IVPA 5AZIA 3O8MA 3EYZA 1HMVA 1IV0A 3JS6A 3K58A 4CHZA 3TWHA 3HTVA 3NBPA 5BPLA 3PX6A 3OJSA 4CGDA 4HWIA 2QWMA 4BRGA 4CEAA 4J2BA 4IKFA 1NK4A 3HP9A 4J2DA 1IKXA 2P9NA 3TARA 2FSKA 3TI0A 3R3LA 2HVIA 4JK7A 4YHHK 3LDNA 3RRGA 3FZLA 4CF0A 1I3AA 2FXUA 1QZ6A 4DTNA 4A2BA 1F21A 4H5TA 4BY9C 3V9ZA 4QS7A
chains in the Genus database with same CATH topology
5GAGP 4WF9L 3GE1A 5GAHP 1JCFA 3CCRN 3O08A 3O6WA 5C12A 1IJJA 5M1PA 1NGDA 1GLEG 1XQSC 3TU5A 2E2NA 3L4QA 3QFUA 2A42A 3E9LA 5AQVA 3VOVA 4EAHD 1X9JA 5AFUA 3MCPA 2ASMA 1NGIA 3CCVN 3CD6N 5JVHL 3J8AA 4BREA 1VQPN 2P9NB 4CJ7A 5FPEA 2A6AA 1NGJA 3KHYA 3MMVA 4FWRA 5AZJB 1P90A 3VEZA 3VEYA 4YDUC 4BRIA 3SLCA 5JICA 4IEEA 4YOWA 3UKRB 5GADP 5FPMA 3WXMB 4FOEA 5AQJA 1KQSM 3GL1A 3CQYA 3TPQA 3LL3A 1BWFO 4H0PA 2QW9A 3AAQA 2NRHA 5AQXA 3ULEB 2ZGYA 3L4IA 3CCQN 1GLDG 3O9TA 4BGAA 3WXIA 3QBXA 1H1VA 3VGKA 1GLAG 3M5RA 1RDWX 3WXJA 4DQ8A 4BRCA 1VQLN 4WFAL 2ZJPL 4C1NK 4A62A 1NJIO 3CERA 3FFKB 1C0GA 2PBDA 2CH6A 5DM7L 1MDUB 5BRFA 2Q0RA 1KD1O 3QBWA 1GLBG 2ZGZA 4JHDA 4YOYA 2Q0UA 2QA4N 3HM8A 4JKBA 4A61A 4NB4A 4GV6A 3MX5A 3HRGA 4MLHA 3ATUA 3GDQA 5ADXH 1M90O 3QICA 1V4SA 2JWLA 5FPNA 2YI1A 4IJAA 4JK8A 3U4LA 1EQYA 1D4XA 4ISFA 3QFPA 2YCHA 2E2PA 1T3VA 2Q1NA 3ENHA 3MCAB 4H5NA 2I7PA 4IWVA 3ZETA 3O80A 1DT9A 4IJNA 3W3DA 4JEPA 1EO1A 2IVNA 4XJXA 4IOXA 3HSCA 4FL9A 4JK9A 1DGKN 5CE3A 1BUPA 4O8UA 3UKUB 4BRLA 3BF1A 3G4SN 4B1XB 5MLCQ 5C10A 3ATVA 1CZAN 3R8EA 4FWNA 3CCUN 3A5LC 4GNIA 4JKHA 4Y0WA 2Q31A 4FPAA 3P39A 2P9IB 2D4WA 1NGEA 1ZC6A 3K9JA 4ISEA 5GIOA 1Q82O 1GLJO 4BRDA 3MK6A 2UYTA 2ASPA 5EX5A 1KAZA 3ZYYX 4BRHA 2NZTA 2Q36A 4CZIA 1BDGA 4WYBA 4CZJA 2VGMA 2GEMA 4K41A 1T6CA 2AA4A 2OTLN 3U8XA 5JLHA 2F9WA 1VQ9N 4MO4A 2VCPA 1YJNN 3O9RA 5AFUH 3TTDA 5AQQA 4A2AA 2FSJA 1NBWA 1VQ4N 3VENA 3O9QA 5GIPA 3H1QA 4QS9A 3D6RA 1GLLO 5BREA 1JJ2M 1JCGA 3DAWA 5HL7L 5KQDA 1YIJN 4YOTA 3OHRA 4U7BA 3M1FA 1R59O 4H0TB 4I6MA 4PKHA 3VEOA 3C0BA 2W40A 5BRHA 4CZFA 4O5FA 4B1YB 3KWGA 1Z05A 4JKEA 3VETA 1RFQA 1QQOA 3WQTA 4WCEL 2D0OA 2P9UB 2E2QA 3EKUA 3LDQA 1VQ8N 3CQXA 1TYQA 3C65A 4BR9A 5BN8A 3GOIA 2CGLA 1NGHA 3ZX0A 2YHXA 3O1BA 4NO7A 2QXLA 4BG9A 1Q7YO 4ILHA 1ATNA 1NGCA 5BN9A 3UE5A 3SAFA 2BH1A 1HLUA 4FOIA 2P9KA 1QZ5A 2P9KB 4GV3A 3T7ZA 4PHTX 3CF5L 1O13A 2F9TA 1HKGA 4BRMA 3UKRA 4BEBA 2QWNA 1LOTB 4H0OA 2GELA 5M1OA 3VF6A 5AQUA 4EIAA 4FWMA 5AQSA 4CZLA 4MO5A 4YOUA 1P8ZA 1OVYA 4BR2A 1RDUA 3A8YA 4CZKA 5JLFA 2QI2A 1SS6A 3VERA 4PKIA 3LM9A 4I6MB 4J8FA 3VGLA 1WOQA 3SBGA 2FSNA 3O9SA 1G99A 2FF6A 2H3GX 3A5NC 3HI0A 4M7YA 2V51B 4C23A 2WC9A 4FWQA 4AF1A 2GUPA 5AQOA 4XH4A 4YOVA 4BC5A 2RE2A 1YJWN 5M1FA 3VTHA 3FZKA 5AQZA 1YJ9N 1MWMA 3A5MC 3R6MA 4JKFA 2ITMA 3H1VX 3N4QA 5BRDA 1BOTO 3VEWA 3CCEN 3EO3A 4FWKA 1KC8O 1YF5L 2KLAA 5JVGL 3CETA 2C1GA 2CGJA 1BU6O 2P9LB 2NRRA 3FR0A 3HOTA 4XH1A 2FF3B 4H0VB 1K8KB 3CC4N 4CZHA 1KXPA 4KH6A 1W2BM 3IMXA 4LC9B 1HKBA 3ENOA 3UB5A 4WQ5C 4IO9L 3IUCA 4DB3A 5EY4A 1NWKA 3CPWM 2P9SB 2NLXA 2ASOA 2QM1A 4FWOA 4WQ4A 1K9MO 3MX2A 3TSPA 4DKWA 3P38A 3K9KA 4K43A 4UY8O 4BRFA 4BC2A 3T69A 3MN9A 3U9DA 2HF3A 3DXKB 4JKGB 3KK7A 5ELZA 1YXQA 5CHIA 3PLAA 4CD3A 3NVMA 4RWTA 2YHYA 2ZF5O 2EWSA 4C1NI 3E66A 4DCHA 3ZETB 2GWJA 4EHTA 3O5BA 2I7NA 4BE7B 5M1NA 3HBTA 3M3ZA 5AQLA 4BROA 3D2EB 3P31A 3HOSA 3FZMA 2A40A 2OTJN 3I33A 4OPAA 5AQHA 3I56N 2C1IA 2VWBA 3CJ9A 2QEXN 1ZXOA 5KPRA 4AM6A 5EOYA 5AQGA 1NGFA 3RVCA 2V52B 3ID8A 3I55N 4BVPA 1VQON 3IFRA 5B8HA 5GAEP 1NLVA 3CJ7A 1X3MA 3EE9A 1VQ5N 2V7ZA 4M7XA 4FWSA 3CCSN 3D2EA 4KH5A 1S72N 2YJEA 1K8KA 4BR4A 1GLCG 4H0YB 4U67L 1Q86O 2QWQA 1U2VB 5LY3A 4KBOA 3OA9A 5AQKA 1NM1A 5AQWA 2V7YA 4YORA 3SAGA 1DEJA 4YOXA 3FZHA 3FZFA 4BC4A 1J6ZA 4JKGA 3DXKA 4BRKA 3PIPL 2VGNA 4CBUA 2GX9A 4WQ5A 4FPBA 3CCMN 1HKCA 3WXLA 3LM2A 3DLLL 5C0YA 2VYPA 5AQFA 2W41A 3ULEA 2QWRA 3CC7N 1VQNN 1KAYA 4L3QA 3JXUA 3OBWA 2QWOA 4HTLA 3LDOA 1MA9B 1NGBA 2AP1A 2WBNA 1C0FA 4CD1A 4IDHA 5LJVA 2CGKA 3CJAA 3EZWA 5ADXA 2YX6A 4BR5A 3SAHA 3MN5A 5AZJA 3SJHA 4OPHA 3D7EO 1VQKN 3O9UA 3SMSA 3UKUA 3AGRA 1QHAA 4CZGA 3CMEN 1ESVA 2NRVA 3LDLA 3ZEUB 3CJCA 4BR0A 3WQUA 3Q7BA 2P9LA 3E9OA 3WUHA 4JN4A 5M1KA 4B1WB 1GLFO 5AQMA 3AGKA 1YI2N 3D2FB 1BA1A 1YAGA 3J7ZO 3O4WA 1VQ7N 4B1ZA 1XUPO 3BEXA 3EKSA 2P9PB 4WQ4C 3VEVA 5AQTA 1TUYA 2KHOA 2A3ZA 3F5TA 5LJWA 5EVZA 4K25A 1S22A 3EL2A 3C6HA 5F1XA 3U9ZA 2E8AA 3CXCM 2ZJQL 1ILYA 2D0PA 2DPNA 4XH5A 4JHDB 3NMUA 3L6QA 3ID6A 4BG8A 3CCJN 2E1ZA 5AQIA 5EXWA 1LCUA 3CC2N 2HMPA 1T44A 1BO5O 3DXMA 4IO8A 1BG3A 3G6EN 2Q97A 4IFEA 4A5BA 4BVOA 1QVFM 1OKJA 4BGBA 2HOEA 3H46O 3EE8A 3VESA 4CZEA 3F9MA 3KVGA 3MN6A 4FWPA 3AAPA 4H5RA 4EFHA 5BPNA 4JKDA 1YUWA 1E4GT 3RSEB 3TTCA 3HZ6A 3G71N 3GG4A 4MDBA 3D2FA 5DM6L 3BF3A 4Z94A 3DJCA 5C2DA 3RSEA 4DHYA 4BECA 2J4RA 1K8AO 4BR7A 1KAXA 2ZJRL 2P9UA 4H03B 1Q81O 1NMDA 3ZEUA 4PL7A 3VMFB 1K73O 1QQNA 4JKCA 3R9PA 3AY9A 1RGIA 2E20A 2JWKA 4PKGA 3E1YA 4A59A 2YHWA 4BC3A 1S3XA 5C15A 4WFBL 1BA0A 1MWKA 3TTFA 2NRXA 5M1QA 5F0XA 4G9ZA 2E88A 2GWKA 2KKZA 3WEEA 4H0XB 5KQ8A 3TSQA 3OBYA 3OW2M 5CR4A 1N8RO 3N4PA 3VF2A 1VQMN 4A5AA 2A41A 4FWLA 2QWPA 4B9QA 4YDUA 4CBWA 4KH4A 4IOCL 4JAXA 3R1XA 2NNWA 5AR0A 2PAVA 1TYQB 4H5WA 5KPTA 4OO1J 4NLCA 2D1KA 2IIRA 2FLOA 2YJFA 1XC3A 5TKYA 4MDAA 3EN9A 2W00A 2ZWHA 5AQRA 3C6AA 3H3OB 1IG8A 2OANA 3FLCO 4ISGA 4JD2B 4BRQA 1YVNA 3NVKA 4ILJA 3DWLA 3QDKA 4BRPA 5E26A 4FSVA 3CJ1A 3O1WA 3M6GA 3BUZB 3WT0A 4JD2A 1HX1A 3F2KA 2WFBA 1JCEA 2HBJA 2P9PA 3B8AX 4NLBA 4A57A 3IDHA 4CBXA 4RTFD 3A5OC 1TUUA 4JNEA 3MN7A 5AZIB 1X3NA 2NRWA 3C7NA 3CIPA 3L0QA 1Y64A 3P4IA 2HSTA 3W0LA 4BRNA 4M63C 3CI5A 3VF4A 1SQKA 1HUXA 4QS8A 1WUAA 5AQNA 5E84A 3I8BA 1U2VA 2F7TA 3CJBA 3MDQA 4WFNL 4CI6A 4RCHA 3WEEB 3QMLA 5F2RA 2PFUA 2P9IA 4GVEA 3CCLN 4H5VA 1HPMA 3IKMA 3TSUA 3MWPA 4O8KA 3BP8A 3VTIA 4MLEA 1NGGA 3E9PA 1Q18A 3H3NO 4F9OA 1QVGM 2HBLA 3VEXA 5GINA 3SMPA 1SZ2A 1DKGD 2HBMA 2QTDA 3KWIA 5C2FA 1U6ZA 5JMVA 3ZX3A 2IVOA 2HBKA 4JKAA 4GY2B 1T6DA 5BPMA 2BUPA 2Q2RA 2IVPA 3C7NB 5AZIA 3O8MA 4FVUA 3FE1A 3PIOL 1W97L 2WUSA 3S41A 3VPZA 1V4TA 1Z6RA 2RHKA 1NGAA 4IEIA 3KZBA 1VAZA 1ZBSA 1ATRA 3JS6A 1SAZA 2A5XA 3G25A 3H45C 3HTVA 5BPLA 4IOAL 3ZX2A 5TKWA 4FO0A 4HWIA 3FGUA 4B1UB 2QWMA 2GTDA 4BRGA 4BQLA 1HJOA 2P9SA 1M1KO 1YITN 2BTFA 4GV9A 1E4FT 5KPZA 4XEIA 5I9EB 2P9NA 4CZMA 3DXMB 4IZ9A 4E1JA 3Q7CA 2FSKA 3H6EA 4ILGB 2NRTA 3CHWA 4PL8A 5AQYA 3GBTA 4BQZA 4K42A 5BR9A 1VQ6N 2E1YA 1QQMA 3R3LA 5H1SQ 3ENBA 4B1VA 3LDPA 4JK7A 4BRAA 3SBTA 5FPDA 3LDNA 3WXKA 3FZLA 5AQPA 2QWLA 2FXUA 4IXCA 3SK3A 4EHUA 5HOOA 1QZ6A 3VGMA 4R79A 1ATSA 3CPEA 2CH5A 4A2BA 2E2OA 4AM7A 4H5TA 3CMAN 2HF4A 3A0IX 2NRZA 3AARA 3MWTA 1YHQN 3QB0A 4QS7A 4BY9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GE1 A;  1JCF A;  3O08 A;  3O6W A;  1IJJ A;  1NGD A;  1GLE G;  1XQS C;  3TU5 A;  2E2N A;  3VOV A;  3QFU A;  2A42 A;  4EAH D;  5AQV A;  5AFU A;  1X9J A;  3MCP A;  2ASM A;  1NGI A;  3J8A A;  4BRE A;  2P9N B;  4CJ7 A;  5FPE A;  2A6A A;  1NGJ A;  3KHY A;  3MMV A;  4FWR A;  5AZJ B;  3VEZ A;  3VEY A;  4YDU C;  4BRI A;  3SLC A;  5JIC A;  3UKR B;  5FPM A;  4FOE A;  5AQJ A;  3GL1 A;  3CQY A;  3TPQ A;  3LL3 A;  1BWF O;  4H0P A;  2QW9 A;  3AAQ A;  2NRH A;  5AQX A;  3ULE B;  2ZGY A;  3L4I A;  1GLD G;  4BGA A;  3WXI A;  3QBX A;  1H1V A;  3VGK A;  1GLA G;  3WXJ A;  1RDW X;  4DQ8 A;  4BRC A;  4A62 A;  3CER A;  3FFK B;  1C0G A;  2PBD A;  2CH6 A;  1MDU B;  5BRF A;  2Q0R A;  3QBW A;  1GLB G;  2ZGZ A;  4JHD A;  2Q0U A;  3HM8 A;  4A61 A;  4NB4 A;  4MLH A;  3ATU A;  3GDQ A;  5ADX H;  3QIC A;  1V4S A;  5FPN A;  2YI1 A;  4IJA A;  3U4L A;  1EQY A;  1D4X A;  4ISF A;  3QFP A;  2YCH A;  2E2P A;  2Q1N A;  3ENH A;  4H5N A;  2I7P A;  4IWV A;  3ZET A;  3O80 A;  4IJN A;  3W3D A;  2IVN A;  3HSC A;  4FL9 A;  1DGK N;  5CE3 A;  1BUP A;  3UKU B;  4BRL A;  3BF1 A;  4B1X B;  3ATV A;  1CZA N;  3R8E A;  4FWN A;  3A5L C;  4GNI A;  4Y0W A;  2Q31 A;  4FPA A;  2P9I B;  2D4W A;  1NGE A;  1ZC6 A;  4ISE A;  1GLJ O;  4BRD A;  3MK6 A;  2UYT A;  2ASP A;  5EX5 A;  1KAZ A;  4BRH A;  2NZT A;  2Q36 A;  4CZI A;  1BDG A;  4WYB A;  4CZJ A;  2GEM A;  4K41 A;  1T6C A;  2AA4 A;  3U8X A;  2F9W A;  4MO4 A;  2VCP A;  5AFU H;  4A2A A;  5AQQ A;  2FSJ A;  1NBW A;  3VEN A;  3H1Q A;  4QS9 A;  1GLL O;  5BRE A;  1JCG A;  3DAW A;  5KQD A;  3OHR A;  3M1F A;  1R59 O;  4H0T B;  4I6M A;  4PKH A;  3VEO A;  3C0B A;  2W40 A;  4CZF A;  4O5F A;  4B1Y B;  1Z05 A;  3VET A;  1RFQ A;  1QQO A;  3WQT A;  2D0O A;  2P9U B;  2E2Q A;  3EKU A;  3LDQ A;  3CQX A;  1TYQ A;  4BR9 A;  5BN8 A;  3GOI A;  2CGL A;  1NGH A;  3ZX0 A;  2YHX A;  3O1B A;  4NO7 A;  2QXL A;  4BG9 A;  1ATN A;  1NGC A;  5BN9 A;  3UE5 A;  1HLU A;  4FOI A;  2P9K A;  1QZ5 A;  2P9K B;  2F9T A;  1HKG A;  4BRM A;  3UKR A;  2QWN A;  1LOT B;  4H0O A;  2GEL A;  3VF6 A;  5AQU A;  4EIA A;  4FWM A;  5AQS A;  4CZL A;  4MO5 A;  1P8Z A;  4BR2 A;  3A8Y A;  4CZK A;  5JLF A;  3VER A;  4PKI A;  3LM9 A;  4I6M B;  4J8F A;  3VGL A;  1WOQ A;  2FSN A;  1G99 A;  2FF6 A;  2H3G X;  3A5N C;  3HI0 A;  4M7Y A;  2V51 B;  4C23 A;  4FWQ A;  2GUP A;  5AQO A;  4XH4 A;  4BC5 A;  3FZK A;  5AQZ A;  1MWM A;  3A5M C;  3R6M A;  2ITM A;  5BRD A;  3H1V X;  1BOT O;  3VEW A;  3EO3 A;  4FWK A;  3CET A;  2CGJ A;  1BU6 O;  2P9L B;  3FR0 A;  4XH1 A;  2FF3 B;  4H0V B;  1K8K B;  4CZH A;  1KXP A;  3IMX A;  4LC9 B;  1HKB A;  3ENO A;  3UB5 A;  4WQ5 C;  3IUC A;  4DB3 A;  5EY4 A;  1NWK A;  2P9S B;  2NLX A;  2ASO A;  2QM1 A;  4FWO A;  4WQ4 A;  4K43 A;  4BRF A;  4BC2 A;  3MN9 A;  3U9D A;  2HF3 A;  3DXK B;  5ELZ A;  1YXQ A;  4CD3 A;  4RWT A;  2YHY A;  2ZF5 O;  2EWS A;  4DCH A;  3ZET B;  2GWJ A;  4EHT A;  3O5B A;  2I7N A;  3HBT A;  3M3Z A;  5AQL A;  4BRO A;  3D2E B;  3FZM A;  2A40 A;  3I33 A;  5AQH A;  2VWB A;  3CJ9 A;  1ZXO A;  5KPR A;  4AM6 A;  5EOY A;  5AQG A;  1NGF A;  2V52 B;  3ID8 A;  4BVP A;  3IFR A;  5B8H A;  1NLV A;  3CJ7 A;  1X3M A;  2V7Z A;  4M7X A;  4FWS A;  3D2E A;  2YJE A;  1K8K A;  4BR4 A;  1GLC G;  4H0Y B;  2QWQ A;  1U2V B;  5LY3 A;  4KBO A;  5AQK A;  1NM1 A;  5AQW A;  2V7Y A;  1DEJ A;  3FZH A;  3FZF A;  4BC4 A;  1J6Z A;  4BRK A;  3DXK A;  4CBU A;  4WQ5 A;  4FPB A;  1HKC A;  3WXL A;  3LM2 A;  2VYP A;  5AQF A;  2W41 A;  3ULE A;  2QWR A;  1KAY A;  4L3Q A;  3JXU A;  4HTL A;  2QWO A;  3LDO A;  1MA9 B;  1NGB A;  2AP1 A;  1C0F A;  4CD1 A;  5LJV A;  2CGK A;  3CJA A;  3EZW A;  5ADX A;  4BR5 A;  3MN5 A;  5AZJ A;  3SJH A;  3D7E O;  3SMS A;  3UKU A;  1QHA A;  4CZG A;  1ESV A;  4BR0 A;  3LDL A;  3ZEU B;  3CJC A;  3WQU A;  2P9L A;  3WUH A;  4JN4 A;  4B1W B;  1GLF O;  5AQM A;  3D2F B;  1BA1 A;  1YAG A;  3O4W A;  4B1Z A;  1XUP O;  3BEX A;  3EKS A;  2P9P B;  4WQ4 C;  3VEV A;  5AQT A;  1TUY A;  2KHO A;  2A3Z A;  5LJW A;  5EVZ A;  4K25 A;  1S22 A;  3EL2 A;  5F1X A;  3U9Z A;  2E8A A;  2D0P A;  2DPN A;  4XH5 A;  4JHD B;  3L6Q A;  4BG8 A;  2E1Z A;  5AQI A;  5EXW A;  1LCU A;  2HMP A;  1T44 A;  1BO5 O;  3DXM A;  4IO8 A;  1BG3 A;  2Q97 A;  4BVO A;  1OKJ A;  4BGB A;  2HOE A;  3H46 O;  3VES A;  4CZE A;  3F9M A;  3KVG A;  3MN6 A;  4FWP A;  3AAP A;  4H5R A;  4EFH A;  5BPN A;  1YUW A;  1E4G T;  3RSE B;  3HZ6 A;  3GG4 A;  3D2F A;  3BF3 A;  4Z94 A;  3DJC A;  3RSE A;  4DHY A;  2J4R A;  4BR7 A;  1KAX A;  2P9U A;  4H03 B;  1NMD A;  3ZEU A;  4PL7 A;  1QQN A;  3R9P A;  3AY9 A;  1RGI A;  2E20 A;  4PKG A;  2YHW A;  4BC3 A;  1S3X A;  1BA0 A;  1MWK A;  5F0X A;  2E88 A;  2GWK A;  3WEE A;  4H0X B;  5KQ8 A;  3VF2 A;  2A41 A;  4FWL A;  2QWP A;  4B9Q A;  4YDU A;  4CBW A;  4JAX A;  5AR0 A;  2PAV A;  1TYQ B;  4H5W A;  5KPT A;  2D1K A;  2IIR A;  2FLO A;  2YJF A;  1XC3 A;  5TKY A;  3EN9 A;  2ZWH A;  5AQR A;  3H3O B;  1IG8 A;  2OAN A;  3FLC O;  4ISG A;  4JD2 B;  4BRQ A;  1YVN A;  3DWL A;  3QDK A;  4BRP A;  5E26 A;  4FSV A;  3CJ1 A;  3O1W A;  3M6G A;  3BUZ B;  3WT0 A;  4JD2 A;  1HX1 A;  5JLH A;  1JCE A;  2P9P A;  3B8A X;  3IDH A;  4CBX A;  4RTF D;  3A5O C;  1TUU A;  4JNE A;  3MN7 A;  5AZI B;  1X3N A;  3L0Q A;  3C7N A;  3CIP A;  3P4I A;  1Y64 A;  3W0L A;  4BRN A;  4M63 C;  3CI5 A;  3VF4 A;  1SQK A;  1HUX A;  4QS8 A;  1WUA A;  5AQN A;  5E84 A;  3I8B A;  1U2V A;  3CJB A;  3MDQ A;  4CI6 A;  4RCH A;  3WEE B;  3QML A;  5F2R A;  2P9I A;  4H5V A;  1HPM A;  4O8K A;  3BP8 A;  4MLE A;  1NGG A;  4F9O A;  1Q18 A;  3H3N O;  3VEX A;  3SMP A;  1SZ2 A;  1DKG D;  1U6Z A;  5JMV A;  3ZX3 A;  2IVO A;  4GY2 B;  1T6D A;  5BPM A;  2BUP A;  2Q2R A;  2IVP A;  3C7N B;  5AZI A;  3O8M A;  3FE1 A;  2WUS A;  3S41 A;  3VPZ A;  1V4T A;  1Z6R A;  1NGA A;  3KZB A;  1ZBS A;  1ATR A;  3JS6 A;  1SAZ A;  2A5X A;  3G25 A;  3H45 C;  3HTV A;  5BPL A;  3ZX2 A;  4FO0 A;  4HWI A;  3FGU A;  4B1U B;  2QWM A;  2GTD A;  4BRG A;  4BQL A;  1HJO A;  2P9S A;  2BTF A;  1E4F T;  5KPZ A;  4XEI A;  5I9E B;  2P9N A;  4CZM A;  3DXM B;  4IZ9 A;  4E1J A;  2FSK A;  3H6E A;  4PL8 A;  5AQY A;  3CHW A;  4BQZ A;  5BR9 A;  3GBT A;  4K42 A;  2E1Y A;  1QQM A;  4B1V A;  3LDP A;  4BRA A;  5FPD A;  3LDN A;  3WXK A;  3FZL A;  5AQP A;  2QWL A;  2FXU A;  4IXC A;  3SK3 A;  4EHU A;  1QZ6 A;  3VGM A;  1ATS A;  2CH5 A;  4A2B A;  2E2O A;  4AM7 A;  4H5T A;  2HF4 A;  3A0I X;  3AAR A;  5BRH A;  3QB0 A;  4QS7 A; 
#chains in the Genus database with same CATH topology
 1EWR A;  5GAH P;  3AO5 A;  3VQ7 A;  2Z1H A;  5C12 A;  1IJJ A;  1GLE G;  1XQS C;  2BAN A;  2E2N A;  3QFU A;  2A42 A;  4CGH A;  3CCV N;  2O8D B;  3RWU A;  4CJT A;  4JS5 A;  1ASW A;  4NYN A;  2P9N B;  5FPE A;  1NGJ A;  4FLZ A;  2BDP A;  4FVM A;  3AVB A;  3KJV A;  1P90 A;  1RNH A;  1N6Q A;  2HHS A;  2HHH K;  1VSE A;  4IEE A;  4YOW A;  5FPM A;  3QEV A;  3CQY A;  3OYH A;  1HYV A;  3AAQ A;  1IBM K;  3WNE A;  3VQQ A;  3VGK A;  3WXJ A;  1RDW X;  2E5L K;  3P1G A;  4WFA L;  3AVI A;  4A62 A;  2YV0 X;  3AVC A;  3CER A;  1QE1 A;  3BY5 A;  2Q0R A;  1KD1 O;  1VSK A;  4JHD A;  4YOY A;  1KLN A;  4LF4 K;  3KLE A;  3DYA A;  5HRP A;  4GV6 A;  4CJ4 A;  3HRG A;  3GDQ A;  2YI1 A;  3AA2 A;  4JK8 A;  3U4L A;  4W5Q A;  3NH0 A;  3MCA B;  1T3V A;  4DSK A;  3P83 D;  4OKK A;  4CFA A;  3U6F A;  4B3O A;  1EO1 A;  3HSC A;  3SUQ A;  1DGK N;  2VQE K;  1BUP A;  3NH2 A;  4JI7 K;  3DMJ A;  4DG1 A;  1HR0 K;  3G4S N;  3CG7 A;  3ATV A;  1CZA N;  1HNX K;  4GMJ B;  4HUE A;  3SV3 A;  3VA0 A;  4FWN A;  3ZSX A;  3HK2 A;  2ZD1 A;  3OYK A;  4H4O A;  3P39 A;  2XO7 A;  3ZLJ A;  2D4W A;  1BI4 B;  4BRD A;  3SCX A;  5HRR A;  3VQA A;  1TAU A;  4CEZ A;  1SL1 A;  4LFB K;  4CZI A;  1VSF A;  1BDG A;  4WYB A;  1RT4 A;  2VGM A;  4K41 A;  1SKW A;  1FJG K;  2KTQ A;  3C95 A;  1WN7 A;  2F9W A;  4FJG A;  5AFU H;  3SZ2 A;  2FSJ A;  1TK8 A;  1NBW A;  1VQ4 N;  2XY8 A;  2ZE2 A;  3ZT0 A;  5GIP A;  3S5T A;  1VSD A;  3L2W A;  5EU7 A;  4CF9 A;  4U7B A;  3M1F A;  1R59 O;  3C0B A;  4AHV A;  3KWG A;  1RFQ A;  3VQ5 A;  2P9U B;  4KHS A;  2HMI A;  2E2Q A;  4FZY A;  2IDO A;  1LWE A;  3LPT A;  3QER A;  1NGH A;  3ZX0 A;  2YHX A;  3O1B A;  1Q7Y O;  4ZTJ A;  3UE5 A;  2BH1 A;  1HLU A;  2X6N A;  3ZT2 A;  4OPJ A;  4OGC A;  4JI0 K;  4BRM A;  1Y97 A;  2QWN A;  4BEB A;  1LOT B;  5M1O A;  4B08 A;  3VF6 A;  1EWQ A;  4CZL A;  2KFN A;  4CZK A;  2QI2 A;  3VER A;  4PKI A;  5J2P A;  3VN5 A;  3SBG A;  3K5O A;  4CEE A;  4M7Y A;  4C23 A;  4FWQ A;  4B9M A;  4FJH A;  4DR6 K;  5AQO A;  4F2R A;  4YOV A;  2PY5 A;  5C42 A;  4H8K A;  3VTH A;  5AQZ A;  1CXU A;  4JKF A;  4I2P A;  5BRD A;  1VSL A;  2XRI A;  3VEW A;  3CCE N;  1KC8 O;  4F3O A;  2KLA A;  2YNI A;  4DMN A;  1T8E A;  1BU6 O;  1CZ9 A;  2NRR A;  4N56 A;  4FJ9 A;  1IO2 A;  3ZSO A;  4XH1 A;  3CC4 N;  1TK5 A;  4KI6 A;  4DWI A;  4CZH A;  1RT1 A;  3V81 A;  4LC9 B;  1HKB A;  3UB5 A;  1EX4 A;  1LW0 A;  4CGJ A;  1DLO A;  3TSP A;  4DR1 K;  4UY8 O;  5IT9 O;  3MN9 A;  4CJQ A;  4CHY A;  5ELZ A;  3AVK A;  3J7Y P;  3E66 A;  4EHT A;  1RDA A;  5J2N A;  5CZ1 A;  5M1N A;  3HBT A;  3M3Z A;  4E72 A;  1D9D A;  3P31 A;  4JRP A;  2VG6 A;  3HOS A;  2A40 A;  2OTJ N;  4OPA A;  3I56 N;  3KKS A;  1X9W A;  2QEX N;  4AM6 A;  2OPP A;  4B3S K;  1NGF A;  3SUO A;  3ID8 A;  2ETJ A;  4DSE A;  1VQO N;  3IFR A;  4KO0 A;  4K0K K;  1E3M A;  1TKZ A;  4M7X A;  3OY9 A;  1LV5 A;  2GV9 A;  1S72 N;  1WSJ A;  4DU3 A;  1GLC G;  3NF9 A;  5C24 A;  4DTO A;  1JXE A;  3OYD A;  4KBO A;  1NM1 A;  4YOR A;  2OPS A;  3SAG A;  1YT3 A;  4BRK A;  4Y1D A;  2GX9 A;  4FPB A;  3L2R A;  4B3M K;  3KK2 A;  4ZTF A;  3G10 A;  3DRR A;  3MXJ A;  2W41 A;  3ZSR A;  3QET A;  1JL2 A;  3LDO A;  1FXX A;  3VQB A;  3O3H A;  4O0J A;  4CD1 A;  2BGG A;  4IDH A;  3E01 A;  3B6O A;  4B3T K;  4W5N A;  2VWJ A;  1S1V A;  1HYS A;  4OPH A;  3SMS A;  4LFC K;  1QHA A;  3AGR A;  4CZG A;  3LDL A;  2RN2 A;  3SNN A;  3Q7B A;  2Q3S A;  3WUH A;  3PO4 A;  3SQ1 A;  1LWC A;  3J7Z O;  1X9M A;  1XNQ K;  1A5V A;  2YHB A;  1RTD A;  3OYF A;  2HHV A;  3B6P A;  3EKS A;  2P9P B;  3L2U A;  3VEV A;  2KHO A;  3HYF A;  5LJW A;  1OH6 A;  4K25 A;  4KRF A;  3U9Z A;  2ZJQ L;  2F8S A;  3LAN A;  4JHD B;  3L6Q A;  3ID6 A;  2E1Z A;  2HMP A;  3G6E N;  1BG3 A;  2Q97 A;  4IFE A;  2O8C A;  3VES A;  4CZE A;  5HP1 A;  3KVG A;  3OS0 A;  4Z4E A;  1E4G T;  4MDB A;  4DTP A;  3PX0 A;  4O44 A;  4Z94 A;  3DJC A;  4CIE A;  4DHY A;  1NJZ A;  1K8A O;  3V9U A;  4CJL A;  3ZEU A;  1FK9 A;  1BQM A;  3VMF B;  4KB0 A;  4KHQ A;  4FLY A;  1QQN A;  4KHW A;  1RT7 A;  1HNW K;  3E1Y A;  5I3U A;  2HB5 A;  4CHN A;  3OS2 A;  4B9U A;  4HTU A;  3RMA A;  1BA0 A;  4OKJ A;  2GWK A;  2HNY A;  1R0A A;  5KQ8 A;  3OW2 M;  2O8F A;  4A5A A;  4B9Q A;  3KK1 A;  2YKM A;  1TV6 A;  2G8U A;  5AR0 A;  5J1E A;  3SQ2 A;  2PAV A;  4Z0U A;  4M45 A;  1TYQ B;  2FLO A;  1XC3 A;  5TKY A;  1UWB A;  3VA3 A;  2X6S A;  3V4I A;  3HO1 A;  3C6A A;  1RBS A;  1LAV A;  3H3O B;  1IG8 A;  4BRQ A;  3FLC O;  4ILJ A;  3LAM A;  3M6G A;  3BUZ B;  4DSF A;  1HX1 A;  1BCO A;  1C0U A;  4A57 A;  4CBX A;  1JKH A;  1KRP A;  4RTF D;  3CYG A;  4JNE A;  3MN7 A;  3VQ4 A;  2NRW A;  4DSJ A;  3P4I A;  1Y64 A;  4M3X A;  3QNO A;  1NKC A;  3H08 A;  1B9F A;  1SQK A;  5AQN A;  2AJQ A;  3PSF A;  1W7A A;  3I0S A;  1XHX A;  2F7T A;  3K5L A;  4FW1 A;  1T03 A;  4CI6 A;  4E1M A;  3F73 A;  2VWK A;  3WEE B;  3ZSV A;  3QML A;  1HPM A;  4PA1 A;  3MWP A;  4O8K A;  3BP8 A;  4F9O A;  1JLE A;  3THW A;  2IVO A;  4DF8 A;  3AVA A;  4LH4 A;  4BE2 A;  1NKE A;  1X9S A;  1IKW A;  3FE1 A;  3PIO L;  3VPZ A;  4DTX A;  1Z6R A;  4IEI A;  1NGA A;  4F3T A;  3VQE A;  1VAZ A;  1ZBS A;  1ATR A;  1SAZ A;  3FFI A;  3THY B;  4B3R K;  2IGI A;  4FO0 A;  1GOA A;  2D0B A;  1HJO A;  2P9S A;  4BQL A;  1DTQ A;  3M8P A;  4CGF A;  4I9L A;  3DXM B;  4IZ9 A;  1NK5 A;  3Q7C A;  3S9H A;  1IH7 A;  3AVM A;  3H6E A;  4ILG B;  3GBT A;  1VQ6 N;  5H1S Q;  4B1V A;  5HRS A;  3LDP A;  4QCL A;  3WXK A;  5AQP A;  5J2Q A;  2HHT A;  3CM5 A;  2QXF A;  4X65 K;  5HOO A;  4AHC A;  1I94 K;  2CH5 A;  1DTT A;  4OVL A;  1RT5 A;  1RBV A;  2NRZ A;  5BRH A;  3MWT A;  4KHN A;  4WF9 L;  3GE1 A;  1JCF A;  3M8Q A;  3L4Q A;  1WBB A;  4EAH D;  1X9J A;  3MCP A;  1KLM A;  4DU4 A;  3J8A A;  1TKX A;  1WSE A;  3QIP A;  3AO3 A;  4EP4 A;  2A6A A;  3MMV A;  4FWR A;  3T19 A;  3THX B;  4O5B A;  4YDU C;  4BRI A;  5JIC A;  1HQE A;  4AHS A;  3PO5 A;  5E41 A;  4CK1 A;  3ULE B;  3MAQ A;  1GLD G;  4FJ8 A;  2P5G A;  1C0T A;  1JLF A;  4NXM K;  3HXM A;  4RW9 A;  5IWA K;  1QS4 A;  4BRC A;  2ZJP L;  1KTQ A;  3EY1 A;  1NJI O;  1SL0 A;  3FFK B;  4Q5V A;  4CEF A;  4CGI A;  1JLG A;  1MDU B;  4B9L A;  4XIU A;  3OYG A;  2Z1G A;  4BWM A;  1GLB G;  2ZGZ A;  4RW7 A;  2QA4 N;  3K59 A;  1L3U A;  3KLI A;  4A61 A;  3AA3 A;  3ATU A;  3MEG A;  1M90 O;  5FPN A;  4KHY A;  3OYM A;  4IJA A;  3QFP A;  4H5N A;  2E2P A;  3OVN A;  3QNN A;  1A5W A;  2KQ2 A;  3O80 A;  1NJW A;  1U4B A;  4CFD A;  4V19 S;  3DRS A;  4FL9 A;  1S6P A;  1TKT A;  3TAF A;  4HCC A;  1GOB A;  4CIG A;  4DLE A;  1D9F A;  3AVG A;  5MLC Q;  2DY4 A;  3NF6 A;  3R8E A;  3DLE A;  3SYZ A;  3PY8 A;  3BDP A;  4GNI A;  4JKH A;  4FJ5 A;  4Y0W A;  2Q31 A;  4FJK A;  4FPA A;  1VHX A;  1JLB A;  2I5J A;  4CHO A;  2D5R A;  3IRX A;  3K9J A;  5GIO A;  1Q82 O;  2UYT A;  2IS3 A;  5EX5 A;  1IBK K;  4HHT A;  4BRH A;  2Q36 A;  2HHX A;  4CZJ A;  4C8M A;  4M42 A;  2AA4 A;  1C0M A;  4FJ7 A;  4MO4 A;  5LMN K;  3LZJ A;  4CF8 A;  1ITG A;  2DFH A;  3TTD A;  2NUB A;  4CFB A;  4N76 A;  4DQP A;  4KTQ A;  3VEN A;  3O9Q A;  4KI4 A;  4DR7 K;  4QS9 A;  1GLL O;  1JCG A;  5LL6 Z;  1YIJ N;  4RW6 A;  3TAP A;  4CJP A;  4FLU A;  4H0T B;  1S1W A;  4I6M A;  2W40 A;  1BCM A;  4B1Y B;  3ULD A;  3NFA A;  3LDQ A;  3ZSQ A;  3QIN A;  4R5P A;  4BG9 A;  2QXL A;  4ILH A;  1NGC A;  5BN9 A;  4FOI A;  4M3T A;  1ASV A;  4CJF A;  4PHT X;  3CF5 L;  1O13 A;  1NK0 A;  2F9T A;  5HRO A;  4H0O A;  3KIO A;  2GEL A;  4C8L A;  1OH7 A;  1Q8I A;  4EIA A;  4MO5 A;  4YOU A;  1P8Z A;  1OVY A;  4BDZ A;  4YNQ A;  4JI8 K;  4G1Q A;  4I6M B;  2HW3 A;  1WOQ A;  3O9S A;  1G99 A;  2FF6 A;  1KCF A;  4YY3 K;  2WC9 A;  3V1O A;  3KTQ A;  4LF8 K;  5M1F A;  1RIL A;  3FZK A;  4PQU A;  4ELV A;  3R6M A;  3D45 A;  4NYF A;  3EO3 A;  3V1R A;  4DSI A;  2CGJ A;  3FR0 A;  3HOT A;  4L8R B;  1RT3 A;  1KVC A;  2O8C B;  1WSI A;  3AA5 X;  1W2B M;  4IBN A;  2YNH A;  3T3F A;  4E7I A;  1QHT A;  4WQ5 C;  4IO9 L;  4DB3 A;  1C1B A;  5EY4 A;  2QM1 A;  2NLX A;  4FWO A;  4WQ4 A;  4KV8 A;  4FYD A;  5T7B A;  3K9K A;  4BRF A;  4DLG A;  4OKE A;  4CGG A;  2DFF A;  3T69 A;  1TKD A;  2HF3 A;  1WNS A;  1YXQ A;  4CD3 A;  1W9H A;  3LAL A;  2YHY A;  4RWT A;  2ZF5 O;  4BE1 A;  2EWS A;  3RTV A;  4C1N I;  5FLX O;  2VG7 A;  3QLH A;  4HCB A;  3O5B A;  5CYQ A;  3I33 A;  5AQH A;  4RG8 A;  3ZCM A;  1IBL K;  1ZXO A;  5KPR A;  1CLQ A;  5AQG A;  3NAE A;  5LMU K;  4CHQ A;  3SI6 A;  5B8H A;  5GAE P;  3CJ7 A;  3ISN C;  3NGY A;  1VQ5 N;  4FCY A;  4DR4 K;  2O8B B;  3CCS N;  3D2E A;  3DLR A;  3THY A;  1K8K A;  4H0Y B;  2QWQ A;  4FZX C;  4FJI A;  3FZH A;  3FZF A;  4WQ5 A;  4FLV A;  1HKC A;  3LM2 A;  3DLL L;  5C0Y A;  5AQF A;  1BGX T;  1N34 K;  1VQN N;  1IKY A;  3IAY A;  4HTL A;  2QWO A;  1SL2 A;  1MA9 B;  1NGB A;  2WBN A;  3C6U A;  4CK2 A;  5LJV A;  4E3S A;  3SJJ A;  2YX6 A;  4Z4I A;  3D0P A;  3ZT3 A;  4BAC A;  4PUO A;  3UKU A;  3CME N;  2NRV A;  4Z4G A;  3ZEU B;  1HNI A;  2UXB K;  2HVH A;  5M1K A;  1GLF O;  4DTR A;  2W6K A;  1LWF A;  3AGK A;  4DV5 K;  3AVJ A;  5BR8 K;  3O4W A;  4O0I A;  3RMC A;  4JI4 K;  5AQT A;  1TUY A;  3RMD A;  1S22 A;  3PV8 A;  2E8A A;  1FW6 A;  3NMU A;  4RW4 A;  1J54 A;  3CCJ N;  5AQI A;  2IAJ A;  4DTU A;  4NXN K;  1BO5 O;  4A5B A;  4BVO A;  4F2S A;  1OKJ A;  4BGB A;  1BIS A;  1RBU A;  2HOE A;  3F9M A;  3MN6 A;  3VQD A;  3AAP A;  3OYC A;  3O4N A;  4EFH A;  3RSE B;  3HZ6 A;  3BF3 A;  5C2D A;  3UIQ A;  4CJV A;  3VQ6 A;  1U49 A;  4GKJ K;  1Q81 O;  1XI1 A;  3SQ4 A;  3M8S A;  3THW B;  5C25 A;  3AY9 A;  1C1A A;  3TAM A;  1RGI A;  4CJK A;  4A59 A;  2YHW A;  4BC3 A;  1TGO A;  1S3X A;  5C15 A;  3TTF A;  2NRX A;  2RKI A;  3DLG A;  3WEE A;  3OBY A;  1N8R O;  3N4P A;  1VQM N;  3L2V A;  3I0R A;  3NHG A;  4CIF A;  1WLJ A;  3KLG A;  3OYA A;  5KPT A;  5FRM A;  4KAZ A;  3EN9 A;  2ZWH A;  5KRT A;  3TAG A;  3AO2 A;  1XC9 A;  4JD2 B;  4DQS A;  4DF4 A;  4DFK A;  3U3G A;  1I39 A;  4BRP A;  3CJ1 A;  3V9S A;  1RDD A;  3O1W A;  4NLB A;  1ZBF A;  1NMN A;  5JLH A;  1JCE A;  2P9P A;  3L2Q A;  3LPU A;  4W5T A;  2LSN A;  1TUU A;  5AZI B;  1X3N A;  3C7N A;  3CIP A;  4KKO A;  3VF4 A;  3CI5 A;  2RF2 A;  1WUA A;  2YNG A;  3ASM A;  5J2M A;  1U2V A;  3MDQ A;  4JYA K;  4WFN L;  2OPQ A;  3K0S A;  3ITH A;  4CJU A;  2W6L A;  4KB1 A;  4GVE A;  2GUI A;  4FK4 A;  4H5V A;  3G0Z A;  3IKM A;  3E9P A;  3H3N O;  1QVG M;  1JLA A;  2HBL A;  3SMP A;  1QSY A;  2QTD A;  5C2F A;  1U6Z A;  3ZX3 A;  4I9Q A;  2JGU A;  1RTH A;  4GY2 B;  1T6D A;  5BPM A;  2BUP A;  3V9W A;  3C7N B;  4CES A;  3S3N A;  2WUS A;  3S41 A;  4FLW A;  3J7A P;  3G25 A;  5TKW A;  2EHG A;  1RCH A;  4B1U B;  1M1K O;  1J9A A;  1YIT N;  3RR7 A;  3MED A;  5KPZ A;  4XEI A;  4LF5 K;  4CZM A;  4PL8 A;  2NRT A;  4BE0 A;  2E1Y A;  1QQM A;  3K57 A;  3ENB A;  4BRA A;  5CZ2 A;  5FPD A;  4I2Q A;  2O8E B;  2QWL A;  4IXC A;  3SK3 A;  3VGM A;  1ATS A;  3CPE A;  3DRP A;  1HPZ A;  4FJM A;  4PY5 A;  2HF4 A;  3A0I X;  3AAR A;  1YHQ N;  3QB0 A;  5GAG P;  4ID5 A;  3AVF A;  4DV4 K;  1UA0 A;  3O6W A;  3HP6 A;  5A2Q O;  5M1P A;  1NGD A;  2OYQ A;  3TU5 A;  3VOV A;  4LF6 K;  5AFU A;  4LF7 K;  1VQP N;  4CJ7 A;  3C6T A;  3WNF A;  5AZJ B;  3CFO A;  3VEY A;  4DS4 A;  4DV1 K;  5SWM A;  1C1C A;  1WBD A;  2OPR A;  4B9V A;  3UKR B;  3WXM B;  1KQS M;  1BWF O;  4MQ3 A;  2NRH A;  5AQX A;  3CCQ N;  3O9T A;  1OH8 A;  1S1X A;  3WXI A;  4E89 A;  3M5R A;  1Q9X A;  3L3U A;  4NCA A;  1Z26 A;  3TAQ A;  1U04 A;  3O3F A;  1C0G A;  5DM7 L;  4ELU A;  5BRF A;  1QQC A;  3QBW A;  4CED A;  2OZS A;  4CK3 A;  3HM8 A;  2QKB A;  5DK5 A;  4NB4 A;  4MLH A;  5ADX H;  3QIC A;  1V4S A;  2E4L A;  2XHB A;  3QEX A;  3O3G A;  4E7J A;  1D4X A;  4OGE A;  2YCH A;  3S3M A;  1BIU A;  2I7P A;  4K8Z A;  4JI6 K;  3ZET A;  3OJU A;  2FC0 A;  1DT9 A;  4N47 A;  4IJN A;  4JEP A;  2IVN A;  4XJX A;  4DQR A;  4JK9 A;  1UA1 A;  4GW6 A;  1RBT A;  4O8U A;  4LSN A;  3UKU B;  4BRL A;  2HHU A;  3BF1 A;  5C10 A;  5HRN A;  1NU0 A;  2B5J A;  1WAJ A;  4JS4 A;  5HBM A;  3CCU N;  3A5L C;  1OVQ A;  1U47 A;  2P9I B;  5KI6 A;  1JL1 A;  3OYI A;  4CJS A;  1ASU A;  5JEN A;  4ISE A;  2RPI A;  3MK6 A;  3LP1 A;  2G8H A;  2ASP A;  4E7L A;  2NZT A;  1T6C A;  4UQG A;  2OTL N;  5KGX A;  4BDY A;  2VCP A;  3O9R A;  5AQQ A;  2X74 A;  4ID1 A;  4FM2 A;  5BRE A;  3QEI A;  3DAW A;  4CEQ A;  1JLQ A;  5HL7 L;  3LZI A;  3OHR A;  4PKH A;  4CZF A;  4O5F A;  1ZYQ A;  4JKE A;  4DV6 K;  5SZT A;  3WQT A;  4WCE L;  2D0O A;  1YTU A;  1RT6 A;  1TYQ A;  2UUA K;  4BR9 A;  3NF7 A;  5BN8 A;  1B92 A;  2CGL A;  4JI5 K;  1ATN A;  4Z4H A;  3QEP A;  1QZ5 A;  4RW8 A;  4GV3 A;  3PUF A;  2O8E A;  3ZSW A;  4DV3 K;  3UKR A;  4X66 K;  5AQU A;  3LDS A;  4BR2 A;  1RDU A;  3A8Y A;  5JLF A;  1TAQ A;  1SS6 A;  1HYZ A;  2D0A A;  3KKR A;  1NJX A;  3LM9 A;  5KTQ A;  3VGL A;  3KLF A;  2H3G X;  4DV7 K;  3HJF A;  4QOZ B;  2GUP A;  4DR5 K;  4Q0B A;  4C8K A;  1YJW N;  3OTO K;  2ITM A;  3H1V X;  3N4Q A;  2KZZ A;  1O1W A;  1YF5 L;  3V9X A;  5JVG L;  3T1H K;  2C1G A;  4FM1 A;  4DFM A;  1QSL A;  2P9L B;  1U45 A;  2DTU A;  5DMR A;  2FF3 B;  1FKO A;  4F8R A;  4W5R A;  3TR8 A;  4F4K A;  3AVN A;  3IMX A;  4M3Z A;  3L8B A;  4ZHR A;  3ENO A;  1G15 A;  3IUC A;  1NWK A;  3CPW M;  1RBR A;  2P9S B;  1K9M O;  3LP0 A;  2PZS A;  3MX2 A;  3RR8 A;  2IC3 A;  2UUC K;  1VRU A;  1GOC A;  3C94 A;  3U9D A;  3DXK B;  4OX9 K;  3KK7 A;  4KTZ A;  1QTM A;  3NVM A;  3KLH A;  4LSL A;  3ZET B;  2GWJ A;  3VQP A;  4BE7 B;  3A2F A;  1WSF A;  4CEC A;  1NOY A;  4B8A B;  2KW4 A;  1SKS A;  2C1I A;  4H4M A;  1RDC A;  2V52 B;  3I55 N;  4BVP A;  4OLA A;  4C8O A;  3QES A;  3NE6 A;  1NG9 A;  3EEQ A;  4U67 L;  4C8N A;  5LY3 A;  3OA9 A;  3OYE A;  4CJ5 A;  2V7Y A;  1HNV A;  3DXK A;  4CBU A;  2PYJ A;  3NH1 A;  1A5X A;  1VSI A;  4FJN A;  4M41 A;  4BWJ A;  1ZBU A;  1BL3 A;  2QWR A;  3CC7 N;  1ZBH A;  4L3Q A;  3JXU A;  4OLB A;  2P1J A;  2CGK A;  3CJA A;  3EZW A;  1L5U A;  4BR5 A;  3QO9 A;  1L3S A;  1FKP A;  5AZJ A;  1TL1 A;  3D7E O;  3O9U A;  5CYM A;  1ESV A;  3LWM A;  2O8D A;  4Z4F A;  4JI1 K;  4CJR A;  5AQM A;  3ALY A;  5D3G A;  1YAG A;  4E19 A;  4B1Z A;  1N36 K;  2YNF A;  1XUP O;  3SV4 A;  2EX3 A;  4FJL A;  4JI3 K;  3NCI A;  1WSH A;  3F5T A;  3EL2 A;  3C6H A;  5F1X A;  2D0P A;  2DPN A;  4XH5 A;  2X78 A;  4B9S A;  3HT3 A;  5EXW A;  4FK0 A;  4IO8 A;  2VQF K;  4KHU A;  1YTA A;  1HQU A;  2OZM A;  1LW2 A;  4E0D A;  3HL8 A;  4FWP A;  5BPN A;  1S5J A;  3CFR A;  3OS1 A;  4JKD A;  3TTC A;  3G71 N;  4X64 K;  1N5Y A;  3BGR A;  3RSE A;  4DS5 A;  1OH5 A;  4BEC A;  2J4R A;  3OYB A;  2D0C A;  4BR7 A;  4N5S A;  1KAX A;  4AHU A;  4H03 B;  4LFA K;  2W42 A;  1K73 O;  2KZM A;  2B4J A;  3SPY A;  3R9P A;  4PKG A;  4B8C A;  4WFB L;  4AHR A;  3IS9 A;  2QKK A;  4G9Z A;  1BQN A;  5F0X A;  2E88 A;  2KKZ A;  1S1U A;  1UAX A;  3TSQ A;  3VF2 A;  1XNR K;  3NGI A;  2A41 A;  4YDU A;  4CBW A;  4KH4 A;  4IOC L;  4CJW A;  1Q9Y A;  2NNW A;  3S3O A;  4H5W A;  4OO1 J;  2D1K A;  1NK8 A;  1XWL A;  2UXD K;  2A1R A;  4CF1 A;  2OAN A;  3QDK A;  5E26 A;  4FSV A;  1N32 K;  1NK7 A;  4FLX A;  1D8Y A;  4CJE A;  4J2A A;  3IDH A;  1W0H A;  1HJR A;  3A5O C;  3L0Q A;  4M63 C;  2GBZ A;  2WOM A;  4QS8 A;  3J81 O;  5E84 A;  2Z1J A;  4DTM A;  2UU9 K;  3TAB A;  4CJ3 A;  4RCH A;  2HHW A;  2FBT A;  2ITG A;  5F2R A;  2PFU A;  2P9I A;  3CCL N;  4Y1C A;  3TSU A;  3QIO A;  3DLB A;  1NGG A;  1NNE A;  1SZ2 A;  3DOL A;  3KWI A;  3HPG A;  1HRH A;  4JKA A;  1S9G A;  4K8X A;  4IFV A;  3AVH A;  4FVU A;  1W97 L;  1V4T A;  2RHK A;  1U48 A;  2PYL A;  4AQY K;  3KZB A;  1WB9 A;  2A5X A;  4IDK A;  3CYM A;  3H45 C;  4IOA L;  3ZX2 A;  3ZSZ A;  3FGU A;  2GTD A;  4I7F A;  2BTF A;  4GV9 A;  1E4F T;  3CQ8 A;  5I9E B;  2WON A;  4E1J A;  5AQY A;  4BQZ A;  3CHW A;  5BR9 A;  4K42 A;  3HVR A;  4NCG A;  3DI6 A;  1NKB A;  1KVB A;  3SBT A;  3U3Y A;  4EHU A;  2E6L A;  4R79 A;  2IOC A;  2E2O A;  4AM7 A;  4CW7 B;  3CMA N;  2HHI A;  4DFP A;  4BDP A;  3ZSY A;  3CCR N;  3O08 A;  3TAE A;  3V6D A;  3SUN A;  4JRQ A;  3E9L A;  1KSP A;  5AQV A;  3CD6 N;  1ZBI A;  3OYN A;  2ASM A;  1NGI A;  3RMB A;  5JVH L;  4BRE A;  4KFB A;  3KHY A;  3VEZ A;  1T05 A;  1SUQ A;  3SLC A;  4DV0 K;  5GAD P;  4FOE A;  5AQJ A;  3GL1 A;  4CEB A;  3TPQ A;  3LL3 A;  4H0P A;  2QW9 A;  3K2P A;  2ZGY A;  3L4I A;  4J2E A;  2R7Y A;  1RTJ A;  4BGA A;  3MEE A;  3QBX A;  1H1V A;  1GLA G;  2BE2 A;  4LD0 A;  4O55 A;  4DQ8 A;  1SKR A;  1VQL N;  4C1N K;  2FBY A;  2PBD A;  1TK0 A;  2CH6 A;  5I42 A;  4FJJ A;  2O8B A;  2Q0U A;  3V1Q A;  4JKB A;  4E7H A;  3JAM O;  3MX5 A;  4B9T A;  2ZM6 K;  2JWL A;  1J5E K;  3L3V A;  1EQY A;  4ISF A;  2Q1N A;  3ENH A;  1BIZ A;  4IWV A;  3AV9 A;  3M8R A;  1UOC A;  4EZ6 A;  3W3D A;  4M3R A;  3F9K A;  4IOX A;  2ZQB A;  3PX4 A;  5CE3 A;  5HLF A;  1X1P A;  3TAN A;  2F8T A;  4B1X B;  3AVL A;  4FZZ A;  1NGE A;  1ZC6 A;  3WNH A;  1GLJ O;  4O4G A;  4FLT A;  3KK3 A;  4DV2 K;  1J5O A;  1KAZ A;  2G8F A;  3ZYY X;  1VQK N;  2A1S A;  2P5O A;  2GEM A;  3CM6 A;  2O8F B;  3U8X A;  1VQ9 N;  4CCH A;  1YJN N;  2KFZ A;  2OCE A;  4A2A A;  4FXD A;  3BZC A;  3H1Q A;  3D6R A;  1JJ2 M;  3KD1 E;  2G8I A;  1NK9 A;  5KQD A;  4DSL A;  4YOT A;  1MU2 A;  3VEO A;  1VRT A;  2F96 A;  1EXQ A;  2VG5 A;  3DLK A;  1Z05 A;  3VET A;  1XMO K;  1QQO A;  4Z4C A;  1D5A A;  3EKU A;  1VQ8 N;  3CQX A;  3C65 A;  4DU1 A;  3T1Y K;  3GOI A;  1EET A;  4OPK A;  4JI2 K;  4NO7 A;  2ATQ A;  5AJ3 K;  3SAF A;  2P9K A;  4M3W A;  3JSM A;  3SQ0 A;  2P9K B;  3T7Z A;  1VSM A;  1HKG A;  4DR2 K;  3LP2 A;  3MXI A;  4FK2 A;  5FDL A;  4DQQ A;  4FWM A;  5AQS A;  4KPY A;  4EP5 A;  2OA8 A;  4LY7 A;  4LH5 A;  4J8F A;  2XY7 A;  2FSN A;  3A5N C;  3HI0 A;  3AA4 A;  1VSH A;  2V51 B;  3BZK A;  1L3V A;  1VSJ A;  2O4G A;  4AF1 A;  4XH4 A;  4BC5 A;  2RE2 A;  3KD5 E;  3VQC A;  1Z25 A;  1YJ9 N;  1MWM A;  3A5M C;  1QSS A;  4M3U A;  2UXC K;  1BOT O;  4OJR A;  1BHL A;  4FWK A;  3CET A;  4FM0 A;  1J53 A;  4AHT A;  4H0V B;  1K8K B;  1KXP A;  4IFY A;  4KH6 A;  3ZT4 A;  3PSI A;  2YHA A;  3SUP A;  3P5J A;  4KTW A;  2HHQ A;  1NK6 A;  3OYJ A;  2ASO A;  4DUY K;  4B9N A;  2F4V K;  1NJY A;  2DFE A;  5CY4 A;  4DKW A;  3P38 A;  3O4Q A;  4K43 A;  3MXM A;  4ICL A;  4BC2 A;  4PWD A;  4AIL C;  4W5O A;  2XY6 A;  4JKG B;  5FRO A;  5CHI A;  4X62 K;  3PLA A;  1IKV A;  2HND A;  1IG9 A;  1EP4 A;  4DCH A;  2I7N A;  5AQL A;  4BRO A;  3D2E B;  4GKK K;  3FZM A;  3IG1 A;  3HPH A;  2VWB A;  3CJ9 A;  1L3T A;  1VK0 A;  4E1N A;  5EOY A;  3RVC A;  2HNZ A;  4CVN E;  1NLV A;  1X3M A;  3EE9 A;  2V7Z A;  4FWS A;  5JS2 A;  4KH5 A;  2YJE A;  2JLE A;  4BR4 A;  1Q86 O;  4DUZ K;  2Y1I A;  1U2V B;  5AQK A;  3LWL A;  5AQW A;  4IG0 A;  1DEJ A;  4YOX A;  4BC4 A;  1J6Z A;  4JKG A;  3PIP L;  3LP3 A;  2VGN A;  3CCM N;  2P51 A;  4EZ9 A;  3WXL A;  4KHP K;  2VYP A;  4GVM A;  3J80 O;  3ULE A;  1S9E A;  1KAY A;  1RTI A;  3DM2 A;  3OBW A;  2AP1 A;  1C0F A;  3ZT1 A;  4LF9 K;  4YFU A;  5ADX A;  3SAH A;  3MN5 A;  3SJH A;  5JS1 A;  1C6V A;  4BR0 A;  3CJC A;  3WQU A;  2P9L A;  3E9O A;  1LAW A;  2FBV A;  4CE9 A;  4JN4 A;  1KFD A;  4B1W B;  1TL3 A;  1YI2 N;  1N33 K;  3LAK A;  1SV5 A;  1BA1 A;  3D2F B;  1VQ7 N;  1KFS A;  5FRN A;  3BEX A;  1HNZ K;  1TVR A;  4WQ4 C;  4JLH A;  2A3Z A;  5EVZ A;  1ILY A;  3CXC M;  2Y1J A;  1EKE A;  1YVU A;  4BG8 A;  1LCU A;  3CC2 N;  1T44 A;  1CXQ A;  3DXM A;  1QVF M;  4N41 A;  3H46 O;  3EE8 A;  2B6A A;  4H5R A;  4ELT A;  2QK9 A;  4DFJ A;  1YUW A;  4WE1 A;  1K6Y A;  2XY5 A;  3GG4 A;  1KVA A;  3D2F A;  5DM6 L;  4NCB A;  1T7P A;  3OYL A;  4HUF A;  1XMQ K;  1RT2 A;  2ZJR L;  2WTU A;  2P9U A;  1NMD A;  4PL7 A;  3RRH A;  3THX A;  3QEW A;  1REV A;  3SPZ A;  4JKC A;  1BI4 A;  4CER A;  2E20 A;  5KGW A;  1JXB A;  2JWK A;  4TSX A;  4DR3 K;  3T1A A;  3VQ8 A;  1S1T A;  1MWK A;  5M1Q A;  4CF2 A;  3I8D A;  4H0X B;  3NF8 A;  5CR4 A;  4HUG A;  1WSG A;  4FWL A;  3HVT A;  2QWP A;  3DOK A;  4DQI A;  1B9D A;  4JAX A;  1WAF A;  3AO4 A;  3R1X A;  4CEO A;  4JV5 K;  4FW2 A;  3EZ5 A;  2UUB K;  5K14 A;  4NLC A;  2YJF A;  2IIR A;  4HVJ A;  4MDA A;  2O4I A;  1S6Q A;  1JLC A;  2W00 A;  5AQR A;  1XHZ A;  2G8K A;  4ISG A;  4E7K A;  1YVN A;  3NVK A;  4CFC A;  3DWL A;  1NOZ A;  3HST B;  2G8W A;  3AO1 A;  3HPO A;  3WT0 A;  4JD2 A;  3F2K A;  2WFB A;  2HBJ A;  2Z1I A;  3B8A X;  4IG3 A;  4KRE A;  1RDB A;  2G8V A;  3DLH A;  2YKN A;  3THV A;  2HST A;  3MEC A;  3W0L A;  3WNG A;  4BRN A;  3K5M A;  3NGZ A;  1HUX A;  5KRS A;  4QAG A;  1ZBL A;  4AH9 A;  3I8B A;  4MFB A;  3CJB A;  2E6M A;  4CHP A;  3HM9 A;  3VTI A;  4MLE A;  4DTS A;  1Q18 A;  3VEX A;  5GIN A;  3NDK A;  3K5N A;  4M3Y A;  4DTJ A;  1DKG D;  4FJX A;  2HBM A;  5JMV A;  3VQ9 A;  3JYT A;  2FBX A;  2HBK A;  3CFP A;  2Q2R A;  1CZB A;  2IVP A;  5AZI A;  3O8M A;  3EYZ A;  1HMV A;  1IV0 A;  3JS6 A;  3K58 A;  4CHZ A;  3TWH A;  3HTV A;  3NBP A;  5BPL A;  3PX6 A;  3OJS A;  4CGD A;  4HWI A;  2QWM A;  4BRG A;  4CEA A;  4J2B A;  4IKF A;  1NK4 A;  3HP9 A;  4J2D A;  1IKX A;  2P9N A;  3TAR A;  2FSK A;  3TI0 A;  3R3L A;  2HVI A;  4JK7 A;  4YHH K;  3LDN A;  3RRG A;  3FZL A;  4CF0 A;  1I3A A;  2FXU A;  1QZ6 A;  4DTN A;  4A2B A;  1F21 A;  4H5T A;  4BY9 C;  3V9Z A;  4QS7 A; 
#chains in the Genus database with same CATH homology
 5GAG P;  4WF9 L;  3GE1 A;  5GAH P;  1JCF A;  3CCR N;  3O08 A;  3O6W A;  5C12 A;  1IJJ A;  5M1P A;  1NGD A;  1GLE G;  1XQS C;  3TU5 A;  2E2N A;  3L4Q A;  3QFU A;  2A42 A;  3E9L A;  5AQV A;  3VOV A;  4EAH D;  1X9J A;  5AFU A;  3MCP A;  2ASM A;  1NGI A;  3CCV N;  3CD6 N;  5JVH L;  3J8A A;  4BRE A;  1VQP N;  2P9N B;  4CJ7 A;  5FPE A;  2A6A A;  1NGJ A;  3KHY A;  3MMV A;  4FWR A;  5AZJ B;  1P90 A;  3VEZ A;  3VEY A;  4YDU C;  4BRI A;  3SLC A;  5JIC A;  4IEE A;  4YOW A;  3UKR B;  5GAD P;  5FPM A;  3WXM B;  4FOE A;  5AQJ A;  1KQS M;  3GL1 A;  3CQY A;  3TPQ A;  3LL3 A;  1BWF O;  4H0P A;  2QW9 A;  3AAQ A;  2NRH A;  5AQX A;  3ULE B;  2ZGY A;  3L4I A;  3CCQ N;  1GLD G;  3O9T A;  4BGA A;  3WXI A;  3QBX A;  1H1V A;  3VGK A;  1GLA G;  3M5R A;  1RDW X;  3WXJ A;  4DQ8 A;  4BRC A;  1VQL N;  4WFA L;  2ZJP L;  4C1N K;  4A62 A;  1NJI O;  3CER A;  3FFK B;  1C0G A;  2PBD A;  2CH6 A;  5DM7 L;  1MDU B;  5BRF A;  2Q0R A;  1KD1 O;  3QBW A;  1GLB G;  2ZGZ A;  4JHD A;  4YOY A;  2Q0U A;  2QA4 N;  3HM8 A;  4JKB A;  4A61 A;  4NB4 A;  4GV6 A;  3MX5 A;  3HRG A;  4MLH A;  3ATU A;  3GDQ A;  5ADX H;  1M90 O;  3QIC A;  1V4S A;  2JWL A;  5FPN A;  2YI1 A;  4IJA A;  4JK8 A;  3U4L A;  1EQY A;  1D4X A;  4ISF A;  3QFP A;  2YCH A;  2E2P A;  1T3V A;  2Q1N A;  3ENH A;  3MCA B;  4H5N A;  2I7P A;  4IWV A;  3ZET A;  3O80 A;  1DT9 A;  4IJN A;  3W3D A;  4JEP A;  1EO1 A;  2IVN A;  4XJX A;  4IOX A;  3HSC A;  4FL9 A;  4JK9 A;  1DGK N;  5CE3 A;  1BUP A;  4O8U A;  3UKU B;  4BRL A;  3BF1 A;  3G4S N;  4B1X B;  5MLC Q;  5C10 A;  3ATV A;  1CZA N;  3R8E A;  4FWN A;  3CCU N;  3A5L C;  4GNI A;  4JKH A;  4Y0W A;  2Q31 A;  4FPA A;  3P39 A;  2P9I B;  2D4W A;  1NGE A;  1ZC6 A;  3K9J A;  4ISE A;  5GIO A;  1Q82 O;  1GLJ O;  4BRD A;  3MK6 A;  2UYT A;  2ASP A;  5EX5 A;  1KAZ A;  3ZYY X;  4BRH A;  2NZT A;  2Q36 A;  4CZI A;  1BDG A;  4WYB A;  4CZJ A;  2VGM A;  2GEM A;  4K41 A;  1T6C A;  2AA4 A;  2OTL N;  3U8X A;  5JLH A;  2F9W A;  1VQ9 N;  4MO4 A;  2VCP A;  1YJN N;  3O9R A;  5AFU H;  3TTD A;  5AQQ A;  4A2A A;  2FSJ A;  1NBW A;  1VQ4 N;  3VEN A;  3O9Q A;  5GIP A;  3H1Q A;  4QS9 A;  3D6R A;  1GLL O;  5BRE A;  1JJ2 M;  1JCG A;  3DAW A;  5HL7 L;  5KQD A;  1YIJ N;  4YOT A;  3OHR A;  4U7B A;  3M1F A;  1R59 O;  4H0T B;  4I6M A;  4PKH A;  3VEO A;  3C0B A;  2W40 A;  5BRH A;  4CZF A;  4O5F A;  4B1Y B;  3KWG A;  1Z05 A;  4JKE A;  3VET A;  1RFQ A;  1QQO A;  3WQT A;  4WCE L;  2D0O A;  2P9U B;  2E2Q A;  3EKU A;  3LDQ A;  1VQ8 N;  3CQX A;  1TYQ A;  3C65 A;  4BR9 A;  5BN8 A;  3GOI A;  2CGL A;  1NGH A;  3ZX0 A;  2YHX A;  3O1B A;  4NO7 A;  2QXL A;  4BG9 A;  1Q7Y O;  4ILH A;  1ATN A;  1NGC A;  5BN9 A;  3UE5 A;  3SAF A;  2BH1 A;  1HLU A;  4FOI A;  2P9K A;  1QZ5 A;  2P9K B;  4GV3 A;  3T7Z A;  4PHT X;  3CF5 L;  1O13 A;  2F9T A;  1HKG A;  4BRM A;  3UKR A;  4BEB A;  2QWN A;  1LOT B;  4H0O A;  2GEL A;  5M1O A;  3VF6 A;  5AQU A;  4EIA A;  4FWM A;  5AQS A;  4CZL A;  4MO5 A;  4YOU A;  1P8Z A;  1OVY A;  4BR2 A;  1RDU A;  3A8Y A;  4CZK A;  5JLF A;  2QI2 A;  1SS6 A;  3VER A;  4PKI A;  3LM9 A;  4I6M B;  4J8F A;  3VGL A;  1WOQ A;  3SBG A;  2FSN A;  3O9S A;  1G99 A;  2FF6 A;  2H3G X;  3A5N C;  3HI0 A;  4M7Y A;  2V51 B;  4C23 A;  2WC9 A;  4FWQ A;  4AF1 A;  2GUP A;  5AQO A;  4XH4 A;  4YOV A;  4BC5 A;  2RE2 A;  1YJW N;  5M1F A;  3VTH A;  3FZK A;  5AQZ A;  1YJ9 N;  1MWM A;  3A5M C;  3R6M A;  4JKF A;  2ITM A;  3H1V X;  3N4Q A;  5BRD A;  1BOT O;  3VEW A;  3CCE N;  3EO3 A;  4FWK A;  1KC8 O;  1YF5 L;  2KLA A;  5JVG L;  3CET A;  2C1G A;  2CGJ A;  1BU6 O;  2P9L B;  2NRR A;  3FR0 A;  3HOT A;  4XH1 A;  2FF3 B;  4H0V B;  1K8K B;  3CC4 N;  4CZH A;  1KXP A;  4KH6 A;  1W2B M;  3IMX A;  4LC9 B;  1HKB A;  3ENO A;  3UB5 A;  4WQ5 C;  4IO9 L;  3IUC A;  4DB3 A;  5EY4 A;  1NWK A;  3CPW M;  2P9S B;  2NLX A;  2ASO A;  2QM1 A;  4FWO A;  4WQ4 A;  1K9M O;  3MX2 A;  3TSP A;  4DKW A;  3P38 A;  3K9K A;  4K43 A;  4UY8 O;  4BRF A;  4BC2 A;  3T69 A;  3MN9 A;  3U9D A;  2HF3 A;  3DXK B;  4JKG B;  3KK7 A;  5ELZ A;  1YXQ A;  5CHI A;  3PLA A;  4CD3 A;  3NVM A;  4RWT A;  2YHY A;  2ZF5 O;  2EWS A;  4C1N I;  3E66 A;  4DCH A;  3ZET B;  2GWJ A;  4EHT A;  3O5B A;  2I7N A;  4BE7 B;  5M1N A;  3HBT A;  3M3Z A;  5AQL A;  4BRO A;  3D2E B;  3P31 A;  3HOS A;  3FZM A;  2A40 A;  2OTJ N;  3I33 A;  4OPA A;  5AQH A;  3I56 N;  2C1I A;  2VWB A;  3CJ9 A;  2QEX N;  1ZXO A;  5KPR A;  4AM6 A;  5EOY A;  5AQG A;  1NGF A;  3RVC A;  2V52 B;  3ID8 A;  3I55 N;  4BVP A;  1VQO N;  3IFR A;  5B8H A;  5GAE P;  1NLV A;  3CJ7 A;  1X3M A;  3EE9 A;  1VQ5 N;  2V7Z A;  4M7X A;  4FWS A;  3CCS N;  3D2E A;  4KH5 A;  1S72 N;  2YJE A;  1K8K A;  4BR4 A;  1GLC G;  4H0Y B;  4U67 L;  1Q86 O;  2QWQ A;  1U2V B;  5LY3 A;  4KBO A;  3OA9 A;  5AQK A;  1NM1 A;  5AQW A;  2V7Y A;  4YOR A;  3SAG A;  1DEJ A;  4YOX A;  3FZH A;  3FZF A;  4BC4 A;  1J6Z A;  4JKG A;  3DXK A;  4BRK A;  3PIP L;  2VGN A;  4CBU A;  2GX9 A;  4WQ5 A;  4FPB A;  3CCM N;  1HKC A;  3WXL A;  3LM2 A;  3DLL L;  5C0Y A;  2VYP A;  5AQF A;  2W41 A;  3ULE A;  2QWR A;  3CC7 N;  1VQN N;  1KAY A;  4L3Q A;  3JXU A;  3OBW A;  2QWO A;  4HTL A;  3LDO A;  1MA9 B;  1NGB A;  2AP1 A;  2WBN A;  1C0F A;  4CD1 A;  4IDH A;  5LJV A;  2CGK A;  3CJA A;  3EZW A;  5ADX A;  2YX6 A;  4BR5 A;  3SAH A;  3MN5 A;  5AZJ A;  3SJH A;  4OPH A;  3D7E O;  1VQK N;  3O9U A;  3SMS A;  3UKU A;  3AGR A;  1QHA A;  4CZG A;  3CME N;  1ESV A;  2NRV A;  3LDL A;  3ZEU B;  3CJC A;  4BR0 A;  3WQU A;  3Q7B A;  2P9L A;  3E9O A;  3WUH A;  4JN4 A;  5M1K A;  4B1W B;  1GLF O;  5AQM A;  3AGK A;  1YI2 N;  3D2F B;  1BA1 A;  1YAG A;  3J7Z O;  3O4W A;  1VQ7 N;  4B1Z A;  1XUP O;  3BEX A;  3EKS A;  2P9P B;  4WQ4 C;  3VEV A;  5AQT A;  1TUY A;  2KHO A;  2A3Z A;  3F5T A;  5LJW A;  5EVZ A;  4K25 A;  1S22 A;  3EL2 A;  3C6H A;  5F1X A;  3U9Z A;  2E8A A;  3CXC M;  2ZJQ L;  1ILY A;  2D0P A;  2DPN A;  4XH5 A;  4JHD B;  3NMU A;  3L6Q A;  3ID6 A;  4BG8 A;  3CCJ N;  2E1Z A;  5AQI A;  5EXW A;  1LCU A;  3CC2 N;  2HMP A;  1T44 A;  1BO5 O;  3DXM A;  4IO8 A;  1BG3 A;  3G6E N;  2Q97 A;  4IFE A;  4A5B A;  4BVO A;  1QVF M;  1OKJ A;  4BGB A;  2HOE A;  3H46 O;  3EE8 A;  3VES A;  4CZE A;  3F9M A;  3KVG A;  3MN6 A;  4FWP A;  3AAP A;  4H5R A;  4EFH A;  5BPN A;  4JKD A;  1YUW A;  1E4G T;  3RSE B;  3TTC A;  3HZ6 A;  3G71 N;  3GG4 A;  4MDB A;  3D2F A;  5DM6 L;  3BF3 A;  4Z94 A;  3DJC A;  5C2D A;  3RSE A;  4DHY A;  4BEC A;  2J4R A;  1K8A O;  4BR7 A;  1KAX A;  2ZJR L;  2P9U A;  4H03 B;  1Q81 O;  1NMD A;  3ZEU A;  4PL7 A;  3VMF B;  1K73 O;  1QQN A;  4JKC A;  3R9P A;  3AY9 A;  1RGI A;  2E20 A;  2JWK A;  4PKG A;  3E1Y A;  4A59 A;  2YHW A;  4BC3 A;  1S3X A;  5C15 A;  4WFB L;  1BA0 A;  1MWK A;  3TTF A;  2NRX A;  5M1Q A;  5F0X A;  4G9Z A;  2E88 A;  2GWK A;  2KKZ A;  3WEE A;  4H0X B;  5KQ8 A;  3TSQ A;  3OBY A;  3OW2 M;  5CR4 A;  1N8R O;  3N4P A;  3VF2 A;  1VQM N;  4A5A A;  2A41 A;  4FWL A;  2QWP A;  4B9Q A;  4YDU A;  4CBW A;  4KH4 A;  4IOC L;  4JAX A;  3R1X A;  2NNW A;  5AR0 A;  2PAV A;  1TYQ B;  4H5W A;  5KPT A;  4OO1 J;  4NLC A;  2D1K A;  2IIR A;  2FLO A;  2YJF A;  1XC3 A;  5TKY A;  4MDA A;  3EN9 A;  2W00 A;  2ZWH A;  5AQR A;  3C6A A;  3H3O B;  1IG8 A;  2OAN A;  3FLC O;  4ISG A;  4JD2 B;  4BRQ A;  1YVN A;  3NVK A;  4ILJ A;  3DWL A;  3QDK A;  4BRP A;  5E26 A;  4FSV A;  3CJ1 A;  3O1W A;  3M6G A;  3BUZ B;  3WT0 A;  4JD2 A;  1HX1 A;  3F2K A;  2WFB A;  1JCE A;  2HBJ A;  2P9P A;  3B8A X;  4NLB A;  4A57 A;  3IDH A;  4CBX A;  4RTF D;  3A5O C;  1TUU A;  4JNE A;  3MN7 A;  5AZI B;  1X3N A;  2NRW A;  3C7N A;  3CIP A;  3L0Q A;  1Y64 A;  3P4I A;  2HST A;  3W0L A;  4BRN A;  4M63 C;  3CI5 A;  3VF4 A;  1SQK A;  1HUX A;  4QS8 A;  1WUA A;  5AQN A;  5E84 A;  3I8B A;  1U2V A;  2F7T A;  3CJB A;  3MDQ A;  4WFN L;  4CI6 A;  4RCH A;  3WEE B;  3QML A;  5F2R A;  2PFU A;  2P9I A;  4GVE A;  3CCL N;  4H5V A;  1HPM A;  3IKM A;  3TSU A;  3MWP A;  4O8K A;  3BP8 A;  3VTI A;  4MLE A;  1NGG A;  3E9P A;  1Q18 A;  3H3N O;  4F9O A;  1QVG M;  2HBL A;  3VEX A;  5GIN A;  3SMP A;  1SZ2 A;  1DKG D;  2HBM A;  2QTD A;  3KWI A;  5C2F A;  1U6Z A;  5JMV A;  3ZX3 A;  2IVO A;  2HBK A;  4JKA A;  4GY2 B;  1T6D A;  5BPM A;  2BUP A;  2Q2R A;  2IVP A;  3C7N B;  5AZI A;  3O8M A;  4FVU A;  3FE1 A;  3PIO L;  1W97 L;  2WUS A;  3S41 A;  3VPZ A;  1V4T A;  1Z6R A;  2RHK A;  1NGA A;  4IEI A;  3KZB A;  1VAZ A;  1ZBS A;  1ATR A;  3JS6 A;  1SAZ A;  2A5X A;  3G25 A;  3H45 C;  3HTV A;  5BPL A;  4IOA L;  3ZX2 A;  5TKW A;  4FO0 A;  4HWI A;  3FGU A;  4B1U B;  2QWM A;  2GTD A;  4BRG A;  4BQL A;  1HJO A;  2P9S A;  1M1K O;  1YIT N;  2BTF A;  4GV9 A;  1E4F T;  5KPZ A;  4XEI A;  5I9E B;  2P9N A;  4CZM A;  3DXM B;  4IZ9 A;  4E1J A;  3Q7C A;  2FSK A;  3H6E A;  4ILG B;  2NRT A;  3CHW A;  4PL8 A;  5AQY A;  3GBT A;  4BQZ A;  4K42 A;  5BR9 A;  1VQ6 N;  2E1Y A;  1QQM A;  3R3L A;  5H1S Q;  3ENB A;  4B1V A;  3LDP A;  4JK7 A;  4BRA A;  3SBT A;  5FPD A;  3LDN A;  3WXK A;  3FZL A;  5AQP A;  2QWL A;  2FXU A;  4IXC A;  3SK3 A;  4EHU A;  5HOO A;  1QZ6 A;  3VGM A;  4R79 A;  1ATS A;  3CPE A;  2CH5 A;  4A2B A;  2E2O A;  4AM7 A;  4H5T A;  3CMA N;  2HF4 A;  3A0I X;  2NRZ A;  3AAR A;  3MWT A;  1YHQ N;  3QB0 A;  4QS7 A;  4BY9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...