1TYQA

Crystal structure of arp2/3 complex with bound atp and calcium
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
417
structure length
399
Chain Sequence
b'AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
molecule tags Structural protein
total genus 126
structure length 399
sequence length 417
ec nomenclature
pdb deposition date 2004-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1tyqA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1tyqA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1tyqA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1tyqA04
3EN9A 3GE1A 3H46O 3AAPA 4H5TA 4E1JA 4BRFA 4ISGA 3MDQA 4EIAA 3H1VX 4K41A 1S3XA 3C7NA 1QHAA 3MN5A 5AQPA 2E2NA 5B8HA 3VENA 3HM8A 3ZX2A 3D2FB 2QXLA 4H0YB 3ATVA 3A5LC 2D0PA 4B1UB 2CGLA 3U4LA 2V7ZA 1TYQA 2P9LB 3A8YA 4IWVA 1RFQA 1DGKN 3SMPA 4B1YB 4KBOA 4BRDA 2AA4A 3MN6A 3GL1A 5LJWA 3A5MC 3KHYA 4B1VA 3VF6A 5I9EB 2QW9A 4ISEA 4BRCA 3D2EB 5AZJB 3RSEB 1D4XA 1NGBA 4J8FA 1ZXOA 2GWKA 5JLFA 1QQOA 3ZX0A 2QWNA 4B1XB 3DXMB 3W0LA 3R6MA 3SK3A 1GLJO 4H0XB 4WQ5C 1RDWX 2FF6A 5AQIA 2P9IA 4CZLA 4PL8A 1JCGA 1C0FA 1NGHA 1SZ2A 1HKGA 3CJ1A 4FWRA 4DHYA 3VF2A 3M6GA 2YHXA 4FO0A 1XUPO 3FFKB 2GWJA 1QQNA 3CQYA 4BRLA 5AQSA 4BC3A 1ATNA 3H6EA 5AQLA 4BR4A 5KPZA 3CJ9A 3BF3A 4CZEA 3VOVA 1NGAA 2P9SB 3FZMA 3ZETB 5ELZA 3VEVA 2IVNA 4FL9A 4JAXA 3DWLA 5BRHA 4IJNA 3DAWA 4JHDB 5EY4A 3O08A 5F0XA 4WYBA 1K8KA 5BR9A 4A2BA 4FWLA 3DXKA 4XEIA 5BPNA 1NGCA 1WUAA 1MWMA 1KAXA 1KAZA 3FGUA 4H0TB 3KZBA 1T44A 4QS7A 3FZLA 2P9UB 2Q0RA 3ZEUB 3EO3A 3VETA 1HJOA 1U6ZA 1YVNA 5BRFA 1NGGA 4CZMA 3LM2A 5FPEA 1V4TA 4FWQA 3FZHA 2WUSA 2YJFA 3QDKA 1U2VB 2P9KB 3UE5A 2VWBA 2H3GX 4H0PA 3QMLA 1OKJA 1HLUA 5BREA 2YI1A 4ISFA 1MDUB 2P9NA 3A0IX 3CHWA 4FWPA 3QB0A 1BUPA 4WQ5A 4HWIA 2CH6A 3VEXA 3ULEB 4HTLA 1NGIA 5AQKA 4H0OA 5AFUH 5EX5A 3WT0A 2QWOA 4BR0A 4BVPA 4JN4A 2Q97A 4I6MB 4JD2B 1G99A 2CH5A 3EKSA 5BRDA 2NRHA 2V7YA 3VERA 1IJJA 1YXQA 2Q0UA 5AQFA 2J4RA 4DB3A 4CJ7A 4EHUA 2A42A 1T6CA 3OHRA 3LL3A 3CJBA 3L6QA 3D2FA 3LDOA 3LDLA 3MN7A 2IVPA 3FE1A 3WXJA 4H5NA 4PKHA 4IZ9A 4LC9B 5E26A 4BR5A 1R59O 4EAHD 2P9LA 3FZKA 2ITMA 1YAGA 4XH1A 3VGMA 3LDNA 4QS9A 4B1ZA 2CGJA 1QZ6A 2FSNA 2GEMA 2Q1NA 3D2EA 5AZJA 3RSEA 2E1YA 3O6WA 2IVOA 3DXMA 1X9JA 5AFUA 3AY9A 4MLEA 2VCPA 4BROA 2A6AA 2E8AA 5AQOA 4NO7A 3L0QA 4CBUA 1EQYA 3UKUA 1QZ5A 2HMPA 2V52B 4FWNA 4RTFD 3HZ6A 3CI5A 5KPRA 1Q18A 2P9SA 3ZETA 4MO5A 1GLLO 5AQTA 1J6ZA 4CZKA 1X3MA 2ZGZA 2E2PA 3L4IA 1JCFA 5AZIB 3WEEB 3WQUA 2YHWA 4M7XA 3IFRA 4A2AA 1TUYA 4C23A 3U9ZA 1GLFO 3LDPA 2FSKA 4EFHA 3IUCA 1MWKA 3QICA 5AQVA 1NMDA 3QBXA 2Q31A 3S41A 4A61A 2PAVA 4IJAA 4CBXA 4EHTA 4H5RA 1MA9B 3J8AA 2D4WA 1BG3A 3ZEUA 3ENOA 4IO8A 1NBWA 2QWLA 4MO4A 4BRGA 2I7NA 4H03B 3CJAA 2UYTA 2NZTA 3QBWA 4K25A 4Z94A 1NLVA 3FLCO 4PL7A 4WQ4C 1BA0A 2IIRA 1U2VA 2P9KA 4F9OA 3I33A 3AAQA 5BPLA 3BUZB 3O4WA 1KAYA 1Y64A 3W3DA 4Y0WA 4B1WB 1ESVA 2FXUA 3CERA 5BN8A 4CD1A 2E1ZA 4A62A 5AQRA 5AQQA 5AQYA 3CJ7A 1ZC6A 4FPAA 3ULEA 2HOEA 5FPDA 2ASOA 1S22A 1BWFO 2YJEA 2QM1A 2QWMA 3H1QA 3UKRB 4BC2A 4O5FA 1ATSA 4CZJA 4GNIA 5KPTA 2HF3A 2CGKA 3U8XA 4BG9A 4FWKA 1T6DA 2QWPA 3WXKA 4I6MA 4GY2B 4JD2A 4BRQA 2A3ZA 4AM6A 5JLHA 1ATRA 2YCHA 2AP1A 3R8EA 4CD3A 5KQDA 3HI0A 4BRMA 2OANA 1Z05A 4B9QA 2E20A 4K43A 2HF4A 2E88A 3GDQA 2A41A 3JXUA 1BOTO 5AQUA 3EZWA 1HPMA 3B8AX 2FSJA 3LM9A 3H3NO 1NGDA 1RGIA 5AQHA 2I7PA 4NB4A 3EL2A 5AQGA 4BRAA 5AQZA 3EKUA 3O5BA 3QFUA 3SLCA 2P9PB 4IXCA 4MLHA 4BRIA 4BREA 2A40A 2Q36A 4CZGA 2GTDA 3HSCA 4FPBA 3VF4A 2BTFA 2NLXA 1ZBSA 2YHYA 4BGAA 1SAZA 4BVOA 3FZFA 3IDHA 4BC5A 4RWTA 4BQLA 4YDUA 4BG8A 3ATUA 5ADXH 1GLEG 1LOTB 4WQ4A 1H1VA 1BDGA 2V51B 3BEXA 3C7NB 3H3OB 5EOYA 4RCHA 4CZHA 4FOIA 3VEZA 1NGEA 4PKGA 3BF1A 2PBDA 1NWKA 1HX1A 4FWMA 5E84A 3D7EO 1TYQB 5AZIA 1P8ZA 3WEEA 3GOIA 1JCEA 4CZIA 1WOQA 5BN9A 2W40A 3MN9A 3VGKA 3C0BA 2ASPA 4JHDA 3P4IA 2D0OA 2DPNA 2ZGYA 4JNEA 1BU6O 2A5XA 2F9TA 2Q2RA 1HKCA 2D1KA 4M7YA 3M3ZA 1TUUA 2GUPA 5FPNA 3IMXA 3TU5A 1LCUA 1XC3A 1Z6RA 3AARA 3UKUB 5AQXA 1NGFA 3G25A 2P9IB 5F1XA 2FLOA 3I8BA 3U9DA 1HUXA 1DKGD 3ZX3A 4K42A 5AR0A 3HBTA 5ADXA 1XQSC 2FF3B 1IG8A 2P9UA 3CETA 1BO5O 4L3QA 5TKYA 5FPMA 3A5NC 4BRPA 4FWOA 3TPQA 3ID8A 3SMSA 1GLAG 2ASMA 1HKBA 3LDQA 4QS8A 4YDUC 5LJVA 3H45C 1BA1A 3R9PA 4BQZA 4BRKA 3CJCA 4CI6A 1V4SA 3A5OC 3VPZA 2ZWHA 1K8KB 3MK6A 4BR9A 3GG4A 1NGJA 1DEJA 2QWRA 5F2RA 3DXKB 1C0GA 3VEOA 3O8MA 5EVZA 1NM1A 3UKRA 4XH4A 3SJHA 2QWQA 4FSVA 4M63C 1SQKA 1GLDG 5AQNA 3VEWA 3MCPA 4BR2A 1QQMA 3FR0A 4XH5A 5BPMA 5LY3A 4BC4A 2KHOA 3JS6A 2F9WA 4BRNA 2E2OA 3UB5A 4DQ8A 4AM7A 3M1FA 3O1WA 3QFPA 4H0VB 4CZFA 4O8KA 2E2QA 1KXPA 1E4FT 5KQ8A 1GLBG 3CIPA 3DJCA 1GLCG 3VESA 1CZAN 4H5WA 2EWSA 5AQMA 4H5VA 4BR7A 4FOEA 3F9MA 2VYPA 3BP8A 3WUHA 3WQTA 5AQWA 3VEYA 3MMVA 5AQJA 3KVGA 2P9NB 4BGBA 1YUWA 2P9PA 2W41A 4DCHA 1X3NA 4FWSA 3CQXA 2ZF5O 4CBWA 3VGLA 2GELA 3HTVA 5JICA 4PKIA 3WXIA 5JMVA 3ENHA 3WXLA 3GBTA 2BUPA 5EXWA 4BRHA 5CE3A 3O80A 1E4GT 3O1BA
chains in the Genus database with same CATH superfamily
4M3YA 1YITN 4H5TA 4RW8A 3EYZA 3RVCA 4L8RB 1RT3A 4DSFA 4FW2A 3H1VX 5GAGP 1S3XA 4BWJA 2YKNA 5B8HA 2ITGA 2QXLA 1JXBA 1CZBA 2ZJPL 3V1QA 2D0PA 3G6EN 4GW6A 3AO2A 4B1UB 2IGIA 1TYQA 1RILA 4IWVA 3SMPA 1RFQA 1DGKN 4LD0A 3VQAA 1VQ8N 4B1VA 3PIPL 2HVIA 3VF6A 2QW9A 5AZJB 3R3LA 1D4XA 3NF8A 5JLFA 1QQOA 3ZX0A 1NK4A 4M3UA 4GV6A 1EO1A 3QETA 5M1OA 2WFBA 2FF6A 4B9MA 2RE2A 1TV6A 1SZ2A 1A5WA 1C0FA 3CJ1A 4DHYA 3VF2A 3AVCA 3KK2A 3OYJA 2GWJA 1QQNA 4KHSA 4DKWA 4CGFA 4BC3A 5HRNA 4FLVA 4HVJA 1EKEA 5AQLA 4OKEA 4NCBA 3T19A 4KTWA 1NGAA 2P9SB 3FZMA 3ZETB 3VEVA 2O8DB 4KTZA 3DWLA 5BRHA 5I42A 3MECA 4IJNA 4ZTFA 1QSYA 4JHDB 1LWCA 1REVA 1LWEA 2X74A 3ZSRA 1X9WA 4R5PA 2ZJQL 3AVKA 3OYKA 1BIZA 3DXKA 1WUAA 4KO0A 3NAEA 1OH6A 4DU4A 1KAXA 1XWLA 1EXQA 4GV3A 3LALA 4B9UA 3KZBA 3VQ8A 2P9UB 1JL2A 1U6ZA 3OYBA 2YNFA 5KGXA 4CZMA 3LM2A 1Q9YA 4DV1K 3T1AA 3QDKA 3M8PA 1U2VB 2P9KB 3LP1A 3ZLJA 1I39A 1S1TA 4QCLA 1RBVA 4CF0A 2YI1A 3O9SA 5C0YA 2NRXA 4ISFA 5CZ2A 3O4NA 1MDUB 1ZBLA 3V9WA 4FWPA 3QB0A 2ETJA 1SKSA 4WQ5A 4CEOA 4GKKK 3K5NA 3ULEB 3NHGA 4BR0A 3MX2A 1ASVA 3LZJA 1WAJA 4CJVA 3EE8A 4E19A 2QTDA 4I6MB 4JD2B 3KKSA 1NJWA 1P90A 3TSPA 4FJIA 4YORA 4FM2A 3EKSA 4X66K 3AO4A 1TAUA 2NRHA 1IJJA 3T1YK 5AQFA 2PZSA 2A42A 3OHRA 3LL3A 3CJBA 3D2FA 3FE1A 2F96A 3PO5A 1JLQA 2ITMA 3ZT0A 1U49A 1GOBA 1RDUA 4I9QA 3DOLA 5C25A 2Q1NA 2GEMA 3D2EA 4F8RA 4CJWA 1WLJA 1TL1A 3O6WA 2P5GA 1KFDA 5C10A 4LFAK 3CFPA 4IOCL 4MLEA 3OS1A 3CCUN 3L0QA 3KWGA 5T7BA 2D0CA 1NK5A 4KI4A 1RT4A 2V52B 4IDKA 1Y97A 1C0TA 3CI5A 4PA1A 1JKHA 4OX9K 4MO5A 5AQTA 3HM9A 2XO7A 3CC2N 5FLXO 2X78A 3L4IA 4CFDA 3WQUA 4A2AA 3IFRA 3OJUA 2O8CB 1HMVA 1GLFO 3LDPA 4YOWA 2PYJA 4CHZA 5J2NA 3SQ1A 2HHVA 3NBPA 3N4QA 5AQVA 2G8WA 1N6QA 1JL1A 3S41A 2BGGA 2IS3A 1L3TA 2D4WA 4XIUA 1BG3A 3CYMA 4DR5K 5HOOA 2B6AA 3RR7A 3VQQA 4KHPK 2OPRA 4H03B 4C8LA 3D6RA 3H08A 4GV9A 1XHXA 4Z94A 4LF4K 2IIRA 1QHTA 3MAQA 4YHHK 1VQ6N 1BQMA 3AAQA 5BPLA 2DY4A 5M1PA 1KAYA 1Y64A 3PIOL 1ESVA 2FXUA 3TSQA 3SBGA 1XHZA 3AVFA 2P1JA 1ZC6A 4CK2A 4KB1A 4LFCK 5M1FA 3I0SA 5KPTA 4Y1CA 3VMFB 1Z26A 3WXKA 4FJMA 4CFBA 2A3ZA 2NRWA 4KHNA 2AP1A 1C1BA 4RW9A 5KQDA 5HP1A 1ZBFA 3PUFA 3VTHA 1HNVA 3JXUA 2VG7A 1NU0A 1U4BA 1EETA 3H3NO 3QLHA 1TK5A 1I3AA 1N33K 1QE1A 4JYAK 2I7PA 5AQZA 3EKUA 1NK8A 3K9JA 3O3HA 4IXCA 3K59A 4BREA 2QA4N 4FPBA 2ZD1A 2OZSA 3J80O 2O8EB 2BTFA 1SAZA 3QEWA 5FRNA 4DUYK 3E9PA 2YNGA 3G71N 2VWKA 3CPWM 1I94K 1GLEG 3NGIA 4WQ4A 4CZHA 4K0KK 1YJNN 3VA3A 5SZTA 4H8KA 2PBDA 1S1WA 4CJQA 4JKGB 3Q7CA 1P8ZA 4DUZK 4IBNA 4C8NA 2JWLA 1D9DA 2D0OA 1WSGA 2F9TA 1NJXA 2Q2RA 2A1RA 3VTIA 4CK1A 1L3VA 3CCSN 1YIJN 4B3SK 1TUUA 1VAZA 1JLGA 1BI4B 3I8DA 3IMXA 3QESA 1C6VA 3LWLA 4DR2K 2BDPA 2OCEA 2FLOA 1HYSA 3K5MA 5AR0A 4B9LA 1NOYA 3DRSA 3VQ6A 5TKYA 1KTQA 1JLEA 4FWOA 3OYHA 1Z25A 3LAMA 2ASMA 1HKBA 4AF1A 3THWA 2PFUA 4V19S 3TAFA 3V9ZA 4CI6A 1V4SA 3A5OC 3VPZA 5E41A 2ZWHA 3MK6A 3VQ4A 3CMEN 1T3VA 2G8UA 2QWRA 3L2RA 4A5BA 3HSTB 4KFBA 2O8FA 1C0GA 3CFOA 4WFBL 1S5JA 3UKRA 1LV5A 1FKPA 3SZ2A 1GLDG 3DMJA 1FXXA 2Y1JA 4BR2A 1D9FA 4CEDA 4J2BA 4FK2A 2ZE2A 4CIGA 1D8YA 1S6QA 1A5XA 3O1WA 3QFPA 4I2QA 4DS4A 2XHBA 3CF5L 1NKBA 4O8KA 2E2QA 4CHOA 3E9OA 4N56A 4CJUA 5AQMA 3ZSWA 3VQCA 4O5BA 5DM6L 4ID1A 3S3NA 1L3SA 3BP8A 3KLGA 1N8RO 4UY8O 3ZYYX 3WQTA 1O1WA 3VEYA 1QSSA 4LSNA 1FW6A 2P9NB 1G15A 2P9PA 3DLEA 2W41A 4DCHA 1X3NA 2RF2A 2O8BA 1X1PA 3M8SA 4F2RA 3HTVA 4G9ZA 3SUPA 4NLCA 3GBTA 4JRQA 3BY5A 4BRHA 2WTUA 3O80A 1HNIA 4NO7A 3EN9A 3GE1A 1VSEA 2ZJRL 2GUIA 4LF8K 3DM2A 3PX4A 3THYA 4AQYK 3HRGA 4OJRA 5AQPA 3CCRN 3CC4N 3LDSA 3TTCA 1W7AA 3VENA 1LWFA 3OYIA 3ATVA 5CYMA 1KCFA 1RT1A 1SUQA 2CGLA 1HNWK 2V7ZA 4JK8A 3A8YA 4B1YB 3EZ5A 4W5NA 2AA4A 4CJPA 3WNFA 2NRRA 2YNIA 3GL1A 2ATQA 4JI0K 1W97L 3E66A 1HNZK 3V6DA 4IEIA 4J8FA 3V9SA 4LSLA 4B1XB 5HL7L 3OS0A 3DXMB 3AV9A 2YNHA 3WNGA 2UUBK 3SK3A 4X62K 3S9HA 4WQ5C 5AQIA 2P9IA 2XY7A 1HR0K 4OGEA 1NGHA 4FWRA 1DTTA 1HKGA 2HNDA 1CLQA 2YHXA 4BDYA 3NVMA 1T05A 5J1EA 3HVRA 5AQSA 3M8RA 3H6EA 3WNHA 4C8MA 4FJ7A 3VOVA 1EP4A 3KJVA 1SKRA 4JKDA 1KFSA 3A2FA 2IVNA 4TSXA 1JJ2M 3SJJA 1QSLA 1WN7A 5EY4A 1ZBUA 2HB5A 1JLFA 5F0XA 5HROA 4O55A 3VQBA 4MDBA 1WBDA 4JK9A 1BCOA 1N5YA 1CXUA 3I56N 2KFZA 4DQQA 4PQUA 4NCAA 4OGCA 5C2FA 2UXDK 2G8FA 1W9HA 1YI2N 3BDPA 4AH9A 1WNSA 2G8HA 3FGUA 4H0TB 4FXDA 4QS7A 5HBMA 3ZEUB 4FJ8A 4CGGA 1YVNA 3PV8A 4RG8A 5FPEA 2YHAA 1N34K 3THWB 4CFAA 3FZHA 3UE5A 2VWBA 4JI7K 3SUQA 2KKZA 2B4JA 4H0PA 3QMLA 3NVKA 1VRTA 1BL3A 2W6LA 1QTMA 2O8FB 1W2BM 3AVJA 3M8QA 3VQPA 3CCJN 4NLBA 3A0IX 3RMDA 4M3XA 3VEXA 4HWIA 2DFEA 3TI0A 5AQKA 1YF5L 1Q86O 3KLFA 1ITGA 4LF9K 4BVPA 4JN4A 5C2DA 2Q97A 1RDBA 3HL8A 2CH5A 2HHUA 3RMAA 5CR4A 1TAQA 2HHTA 4CVNE 1YXQA 2Z1HA 1YJWN 1XMOK 3L6QA 3LDOA 2HBLA 3O9RA 2IVPA 2FBXA 3WXJA 1IKYA 4H5NA 3ZT4A 4LC9B 5E26A 4BR5A 1VRUA 2P9LA 3FZKA 3SI6A 3VGMA 3KWIA 4JKCA 2FSNA 3L8BA 4CJSA 1L5UA 3ID6A 3RR8A 3RSEA 4IG0A 4JI1K 3SBTA 2C1IA 4EP4A 1HRHA 3EY1A 1WB9A 3OTOK 4FJLA 1NK6A 3P1GA 1VSKA 4E7HA 1Q7YO 2VCPA 4BROA 2A6AA 1OH7A 3OYFA 1NNEA 3L2UA 4M3ZA 3QO9A 3RMBA 1VSMA 1EQYA 4FM0A 1C0UA 2KLAA 4O8UA 2HMPA 4OLAA 4FWNA 4RTFD 3T3FA 3HZ6A 3HJFA 2WBNA 3WNEA 3J7YP 4IFYA 1J6ZA 1XMQK 4DV6K 3ENBA 5JS2A 4DTNA 3THXA 1B92A 1X3MA 3K5LA 4LF7K 5GAEP 2ZGZA 4JKAA 1NOZA 2YHWA 4M7XA 4J2EA 4CHPA 4G1QA 4NCGA 1VSJA 3UIQA 2Q31A 4OPJA 4B3OA 2VG5A 1VK0A 2PAVA 3MEDA 4YOVA 4CBXA 4EHTA 4H5RA 3EEQA 1XNRK 3J8AA 4KKOA 3AA2A 4KAZA 3C6AA 1JLAA 3ENOA 3OW2M 3HP9A 3P39A 4QAGA 2RHKA 2I7NA 3NFAA 4K25A 1SS6A 2O4IA 3IS9A 3E01A 4HUGA 4WQ4C 1RDAA 4HHTA 5BR8K 3QIPA 3NCIA 4DSLA 4CEEA 4DWIA 1YJ9N 2F8TA 4YFUA 3CERA 4C1NI 5BN8A 4CJLA 1U48A 2E1ZA 3K2PA 4A62A 4DFPA 3SPZA 3ASMA 5AQQA 4DTPA 4JKHA 4FPAA 3KLHA 4FLYA 2HOEA 5FPDA 4ELTA 1S22A 1BWFO 3AVHA 3F2KA 2QWMA 4O5FA 4DV3K 1ATSA 4GNIA 2HF3A 2QK9A 2CGKA 1T6DA 2QWPA 3BZCA 4AM6A 4M3WA 4OPAA 2YCHA 3R8EA 4CD3A 4BE0A 3TANA 1Z05A 4B9QA 2E20A 4M3TA 2HF4A 4IOXA 3GDQA 2A41A 1IO2A 2XY5A 4DFJA 2OZMA 3U3GA 5LL6Z 4JKEA 5FRMA 1LAWA 1RGIA 1NGDA 5AQHA 2HHQA 1C1CA 4I2PA 4NB4A 3EL2A 4BRAA 4M41A 3QINA 2HVHA 4DQSA 3LPUA 3NF6A 4KHQA 1ZBHA 3B6PA 1RT7A 4MLHA 2HNZA 1J9AA 4CZGA 2DTUA 2NRTA 3VF4A 1ZBSA 3FZFA 3IDHA 3KKRA 3AO5A 4MDAA 2YHBA 4BQLA 4DG1A 3QNNA 4B9NA 2KQ2A 3HO1A 3ATUA 1R0AA 3SPYA 4Q0BA 1H1VA 4DSEA 3H3OB 1L3UA 2FBVA 4RCHA 1IBKK 4B3MK 4FOIA 5HRSA 2DFHA 4O44A 3PO4A 1IG9A 1NGEA 3BF1A 1NWKA 1HX1A 2OTJN 1S9EA 4FWMA 5E84A 3D7EO 1TYQB 3VQDA 5AZIA 3SYZA 1VQMN 3WEEA 4CJRA 5JVHL 4W5OA 3V4IA 2F8SA 3OYMA 4PHTX 4ZTJA 4EZ9A 4DFMA 1RT5A 3J7AP 1VQKN 4B8CA 2DPNA 2ZGYA 4JNEA 3OS2A 2D1KA 4M7YA 3CCVN 1VSFA 3MEGA 2GUPA 5FPNA 3HXMA 1LCUA 1Z6RA 4C1NK 3I8BA 3VQ5A 4N76A 1HUXA 2DFFA 4KREA 4XJXA 4K42A 2FF3B 3HVTA 2E6LA 4DS5A 1IG8A 3RRGA 1GOAA 2O4GA 2EHGA 3A5NC 4BRPA 3THXB 1LW0A 2VG6A 1WSJA 3WXMB 5HLFA 4YDUC 1U45A 3ZT2A 1K73O 2KW4A 3TAPA 3QIOA 4U67L 4X64K 2FBTA 1NGJA 4DR6K 5F2RA 4CEBA 5M1KA 3L2QA 4KHWA 3DXKB 4DQIA 3VEOA 3O8MA 1WSHA 2QWQA 3LP0A 3RTVA 1NMNA 1K9MO 1SQKA 5AQNA 5SWMA 4YOYA 3MCPA 5DM7L 4EZ6A 5BPMA 5LY3A 4BC4A 2KHOA 2F9WA 4BRNA 3HPHA 1J5OA 4AM7A 4CJTA 4CZFA 3HPGA 4A57A 1KXPA 1E4FT 1GLBG 3CIPA 1NJZA 4EP5A 3VESA 3KIOA 1CZAN 1N36K 2EWSA 4KH6A 3SUNA 1RBTA 4HCBA 2OA8A 1YT3A 3LP3A 1TKXA 1B9DA 1KVCA 2ZQBA 2UXBK 3MMVA 3SV3A 1DLOA 1YUWA 3LP2A 4WF9L 5M1NA 5KRSA 3HK2A 1NK0A 4CBWA 4M42A 3P31A 5JMVA 4PKIA 3KLIA 4Z4IA 3KK1A 1E4GT 4E89A 4Z4EA 4IFVA 3H46O 3AAPA 5TKWA 1KLNA 4AHCA 4ISGA 1HNXK 1IKVA 3AO3A 2KZZA 3C7NA 1Q82O 3MN5A 3SUOA 4HCCA 4J2DA 3ZX2A 3D2FB 4H0YB 3A5LC 2XY8A 4WFNL 1C0MA 3U4LA 3TAEA 5J2PA 4O0JA 3C95A 3SAHA 3KHYA 4OPHA 5I9EB 2QXFA 4ISEA 2W6KA 3D2EB 3FFIA 3JYTA 3V1RA 1YTAA 2E4LA 1ASWA 2GWKA 2WONA 3W0LA 4JI6K 3R6MA 3HYFA 3F5TA 4CZLA 1XNQK 1UAXA 1SL2A 4FO0A 1XUPO 3FFKB 1RT2A 4E1NA 4FCYA 3ALYA 3K0SA 3TABA 4B9SA 4BR4A 5KPZA 3PLAA 4YNQA 3CJ9A 3CQ8A 4CZEA 3KTQA 3O9UA 2OYQA 3QNOA 5ELZA 2IAJA 4FL9A 4JAXA 3MEEA 1HQEA 3SNNA 3DAWA 4E1MA 3G0ZA 1RBUA 4WYBA 1K8KA 2G8IA 1J5EK 4MFBA 4YOUA 1MU2A 5BR9A 4DQRA 1TVRA 2VQFK 4ILJA 4CK3A 3OBWA 2GBZA 5HRRA 1MWMA 4CE9A 2Y1IA 1S1XA 2E5LK 4DMNA 5GINA 1T44A 4OO1J 1X9MA 1VSIA 2Q0RA 1HJOA 3OYNA 1S6PA 5BRFA 1NKCA 1NGGA 4CW7B 4AHTA 4KV8A 4N5SA 1QQCA 1V4TA 2RKIA 1IBLK 4BY9C 4GVEA 4E72A 1OKJA 4ELVA 4CF2A 3T7ZA 4J2AA 1KVBA 2D0AA 2YV0X 3ZSVA 3LZIA 2CH6A 1SL1A 4B9VA 5AFUH 1NGIA 4H0OA 4CF8A 1C1AA 5EX5A 4M45A 3WT0A 3THVA 3DRRA 2UUCK 3PY8A 1UA0A 4DR1K 2OTLN 2NRZA 3AVAA 1T8EA 1G99A 4CEFA 1J54A 5IT9O 4E7LA 3SQ2A 4EHUA 1JLBA 1T6CA 1UOCA 2G8KA 3CD6N 4KTQA 4PKHA 3PSIA 4IZ9A 2P5OA 1R59O 4GMJB 2EX3A 3MXIA 4XH1A 4B1ZA 3LDNA 4QS9A 4DLGA 3KK3A 5CY4A 1QZ6A 1KSPA 3TR8A 2KZMA 4OKKA 5AZJA 3U6FA 3ZCMA 3NDKA 5KRTA 3IRXA 4DF8A 2IVOA 5AFUA 3AY9A 3SQ0A 1KD1O 4BDZA 1OH8A 5JENA 2IDOA 2JWKA 5J2QA 4FJHA 3L4QA 1HYZA 1J53A 2HHWA 1QZ5A 3RRHA 4BECA 4FLWA 4Z4GA 3SV4A 1IV0A 1KLMA 2NUBA 5KPRA 3CYGA 2P9SA 3ZETA 4DSKA 2O8DA 4BE2A 1BQNA 3E1YA 4IFEA 1JCFA 4CHQA 4CJKA 3NH1A 3Q7BA 2FSKA 2R7YA 3IUCA 5C15A 1MWKA 3QICA 3HPOA 3VQ9A 1NG9A 3QBXA 5JS1A 2BANA 3AVBA 4IJAA 3L2VA 4ICLA 1KQSM 1MA9B 1UWBA 4FK4A 3OBYA 4CGHA 3MXJA 4FJXA 3IKMA 4IO8A 1NBWA 1OVYA 2QWLA 3CJAA 2OPSA 2NZTA 3QBWA 4CJ3A 3FLCO 2RPIA 5CYQA 1LW2A 3EE9A 1ASUA 1U2VA 2P9KA 3K9KA 5CZ1A 3I33A 3DLRA 3W3DA 3V9UA 4B1WB 4BWMA 4CD1A 5EU7A 4DU1A 2PY5A 3K58A 5AQRA 5A2QO 5AQYA 3CJ7A 4CIEA 1VSLA 4JRPA 3ULEA 4AILC 3ZT1A 2ASOA 2YJEA 3AVNA 3H1QA 3UKRB 4BC2A 4CGIA 1TK0A 4FVUA 4BG9A 4NXMK 5KI6A 4FJNA 4IDHA 4I6MA 4JD2A 3JAMO 3CM5A 5JLHA 2P51A 1ATRA 2JGUA 4X65K 4IOAL 3HI0A 4O0IA 2OANA 4CHNA 2E88A 3T1HK 1VQPN 4JI2K 1BOTO 3EZWA 3L2WA 3IAYA 3OYCA 3B8AX 4DU3A 2HBKA 4B9TA 1RTHA 1E3MA 3MX5A 1S1UA 4FK0A 3P83D 4RW7A 4DTMA 4E0DA 3CC7N 2KFNA 3MXMA 1JLCA 2P9PB 5DMRA 3QEVA 2O8BB 4RW6A 2GTDA 3HSCA 4E7KA 3O3GA 4BGAA 3OYGA 4BVOA 4U7BA 3ZT3A 4RWTA 1LAVA 4WFAL 5JVGL 2Z1GA 4FZYA 2VGNA 1BDGA 2V51B 3THYB 2Z1JA 2HNYA 4CEQA 4B8AB 1TKZA 2WOMA 4PKGA 3DOKA 4DV7K 3DLHA 4W5TA 4JV5K 2G8VA 2ZM6K 1D5AA 1SKWA 1RTJA 3QERA 2UUAK 4K8ZA 1JCEA 4CZIA 5GIOA 4CEZA 2O8CA 3VGKA 4WCEL 3MN9A 3C0BA 4IEEA 3P4IA 3NF7A 1HJRA 4I7FA 1HKCA 4F2SA 2JLEA 3M3ZA 3NGZA 3C6TA 4DLEA 4NXNK 1TKDA 1XI1A 4CGDA 3TU5A 1XC3A 5M1QA 3AARA 4UQGA 5AQXA 4YOTA 1NGFA 3G25A 4CHYA 1NK7A 2P9IB 4KB0A 5F1XA 3TAQA 3U9DA 4A59A 1DKGD 1HYVA 2F7TA 3ZX3A 3HBTA 3OYDA 2A1SA 3VA0A 1TKTA 1WSFA 3CETA 3E9LA 1FJGK 4LFBK 3CCMN 2BH1A 3OJSA 4PY5A 3TPQA 3BZKA 1CXQA 3LDQA 5LJVA 5CHIA 4I9LA 1UA1A 4FW1A 4BRKA 3CJCA 4QOZB 3C65A 4CF1A 3ZSQA 3QEXA 4BR9A 4FJGA 1DEJA 3AGKA 1WSEA 1TL3A 4CEAA 1NM1A 4XH4A 3SJHA 4FSVA 4M63C 4ZHRA 3MCAB 4OVLA 4DSIA 1IKXA 5DK5A 4CECA 4CERA 1QQMA 3TTFA 3FR0A 2RN2A 4OKJA 4XH5A 4R79A 3UB5A 4JS4A 5GIPA 4H0VB 3KD1E 1K8AO 1S9GA 5KQ8A 1F21A 1Q81O 4CJEA 4DF4A 3HP6A 2VYPA 4B3RK 3I55N 1KVAA 3S5TA 5AQWA 5AQJA 3HOSA 3KVGA 3ZSZA 4BGBA 4FWSA 3CQXA 2ZF5O 1VQ9N 4JI5K 1O13A 2IOCA 2O8EA 5JICA 1VQ7N 3WXIA 4E3SA 3ENHA 3WXLA 5IWAK 5EXWA 2WC9A 3S3MA 4Y1DA 3O1BA 4QS8A 1IKWA 2QEXN 3CCEN 4DV4K 1VQ5N 4E1JA 4BRFA 4KPYA 2OPQA 3MDQA 4EIAA 4K41A 3K57A 1QHAA 3IG1A 5D3GA 2E2NA 3DLKA 3V81A 3JSMA 3HM8A 4CJFA 4FJ5A 1ILYA 4JKGA 4ILHA 2FC0A 4DR4K 1RTDA 5KGWA 4BE1A 4DTJA 2P9LB 1EWQA 4BRDA 4KBOA 1BGXT 3P38A 3MN6A 5LJWA 4DTSA 3A5MC 4ILGB 4BRCA 3RSEB 5GAHP 1NGBA 4DR7K 1ZXOA 2HMIA 2QWNA 5LMUK 1FK9A 1BI4A 2GV9A 3HOTA 4CJ4A 3L3VA 1GLJO 4H0XB 1RDWX 1RBRA 1YTUA 3HT3A 4PL8A 1JCGA 3M6GA 4FZZA 4O4GA 3MWPA 1BCMA 3CQYA 4BRLA 5C12A 3TARA 1XC9A 3DLLL 1ZBIA 3OVNA 1ATNA 3BF3A 1OH5A 1VQ4N 4LH5A 2VWJA 2YX6A 4C8KA 2VGMA 3F73A 2QI2A 3AO1A 4NYFA 3PX6A 1KRPA 4KHUA 3O08A 3R1XA 2AJQA 4RW4A 4F3TA 3AA4A 4A2BA 2FBYA 4E7IA 4FWLA 4XEIA 3DLGA 5BPNA 2XRIA 1EX4A 1NGCA 2UU9K 1QS4A 4KRFA 1M1KO 5GADP 2PYLA 1KAZA 1RDDA 4ELUA 2Z1IA 3AVMA 3FZLA 3EO3A 3VETA 3T69A 3MWTA 2HHHK 3AGRA 3J81O 4DFKA 4FWQA 3P5JA 3OY9A 3J7ZO 2WUSA 2YJFA 1RTIA 1B9FA 1X9SA 2H3GX 3M5RA 1HLUA 4FLTA 5BREA 2IC3A 3O9TA 3C6UA 4CCHA 1QVGM 2P9NA 3CHWA 1TK8A 3V9XA 3NH0A 1BUPA 4HTLA 3TAGA 2LSNA 2OPPA 2QWOA 1HPZA 2HBMA 4HUFA 4FVMA 3ZSOA 4LH4A 4A5AA 5BRDA 2V7YA 3VERA 2Q0UA 4LF5K 2J4RA 3ISNC 4DB3A 4CJ7A 3NE6A 3MN7A 4FLUA 3LDLA 1VQNN 3DYAA 3NGYA 4IO9L 1VQLN 4EAHD 4YOXA 2D5RA 4F4KA 1YAGA 2YKMA 2HHXA 3N4PA 1RDCA 3LAKA 2CGJA 2XY6A 1SV5A 3NMUA 2E1YA 4Z4CA 2HW3A 4F3OA 3RWUA 1TGOA 3DXMA 1X9JA 5K14A 4JI4K 4H4OA 2E6MA 5J2MA 2E8AA 5AQOA 1S1VA 3D45A 4CBUA 3UKUA 3U3YA 3TTDA 3BGRA 5H1SQ 4FJ9A 4B3TK 3D0PA 3G10A 1Q18A 3NF9A 4KH5A 1GLLO 1S72N 4CZKA 5MLCQ 5AZIB 2E2PA 3WEEB 2NRVA 4C8OA 4FJJA 1TUYA 1BISA 1T7PA 4C23A 3U9ZA 4EFHA 1K6YA 3AA3A 4W5RA 4CJ5A 1NMDA 4ID5A 3VQEA 1FKOA 4CIFA 3AVLA 5LMNK 4HUEA 4A61A 4Z4FA 1SL0A 2BE2A 4YY3K 1WAFA 3ZEUA 4B08A 3I0RA 4MO4A 4BRGA 3C94A 1IH7A 3VQ7A 1DT9A 2UYTA 4JI8K 3ITHA 1NLVA 4PL7A 1BA0A 4F9OA 5KTQA 4LF6K 3BUZB 3O4WA 4FYDA 4Y0WA 2HBJA 4WE1A 4IG3A 1RT6A 3TAMA 2I5JA 1GOCA 4LY7A 1DTQA 4Q5VA 4AHSA 2HHIA 1NJIO 3AA5X 3B6OA 4AHUA 2W42A 2QM1A 4H4MA 3RMCA 4CZJA 2HSTA 1Q8IA 3U8XA 4M3RA 1T03A 4IKFA 4JKBA 4FWKA 1NK9A 4AHVA 4BRQA 4GY2B 4AHRA 3S3OA 3NH2A 4FM1A 5HRPA 3CCLN 3LPTA 4PWDA 4JI3K 4BRMA 4K43A 3VN5A 3LWMA 4BDPA 3CCQN 5AQUA 4N41A 1HPMA 3O4QA 2FSJA 3LM9A 5I3UA 1IBMK 1WSIA 5AQGA 2QKBA 3KK7A 1U04A 3CFRA 3O5BA 3QFUA 3SLCA 4OLBA 2Q3SA 3SAFA 4BRIA 1CZ9A 2A40A 1BHLA 2Q36A 3O9QA 4BEBA 4BE7B 2NLXA 3KLEA 2YHYA 4Z0UA 1VHXA 4BC5A 4JK7A 3AVIA 4N47A 3G4SN 2VQEK 2NNWA 3LANA 4YDUA 4BG8A 4DV2K 4DR3K 5ADXH 1LOTB 2B5JA 3OYAA 3BEXA 3C7NB 5EOYA 4DSJA 1U47A 4JS5A 3PX0A 3VEZA 1VSHA 3SCXA 4FZXC 3GOIA 1Q9XA 1WOQA 4E7JA 5BN9A 2W40A 2ASPA 4JHDA 1HQUA 1OVQA 1BU6O 2A5XA 3OYLA 4JKFA 4FLXA 4GKJK 2UXCK 5C24A 4DQPA 4GVMA 3AVGA 2W00A 1YVUA 4DV0K 2HHSA 3CG7A 3TSUA 5FROA 1KC8O 4NYNA 4Z4HA 3UKUB 3TWHA 1M90O 1BIUA 4CFCA 3QEPA 1WBBA 2X6NA 1QVFM 4JLHA 3QEIA 1NJYA 2QKKA 4JEPA 5ADXA 4DTXA 1XQSC 3F9KA 2C1GA 2P9UA 3CXCM 1NKEA 4MQ3A 1BO5O 4L3QA 5FPMA 4CGJA 1A5VA 3ID8A 3SMSA 1GLAG 1RBSA 3H45C 3KD5E 1BA1A 3R9PA 4FJKA 4BQZA 5C42A 4BACA 4W5QA 4DV5K 1YHQN 1K8KB 3GG4A 3SQ4A 3L3UA 3C6HA 4K8XA 1RNHA 2KTQA 1W0HA 4DTOA 5EVZA 3CMAN 4KH4A 3DI6A 1EWRA 3VEWA 5AJ3K 2F4VK 1VQON 1VSDA 4FLZA 3JS6A 2E2OA 4DQ8A 3M1FA 3OYEA 3K5OA 4HTUA 3DJCA 1GLCG 3ZSXA 3PSFA 4H5WA 4H5VA 3SAGA 4BR7A 3V1OA 3CPEA 4FOEA 3F9MA 3CM6A 4PUOA 3WUHA 4DTRA 5FDLA 4DTUA 3O3FA 2D0BA 3ZSYA 3DRPA 2X6SA 3ULDA 1ZYQA 2GX9A 4OPKA 1RCHA 4KHYA 3OA9A 4CF9A 3VGLA 4KI6A 2GELA 4CESA 3DLBA 1JXEA 2BUPA 1N32K 5CE3A
chains in the Genus database with same CATH topology
3EN9A 3GE1A 3CCEN 3H46O 1YITN 3AAPA 4H5TA 5TKWA 4E1JA 1VQ5N 4BRFA 2ZJRL 4ISGA 3RVCA 3MDQA 4EIAA 3H1VX 4K41A 1S3XA 3C7NA 5GAGP 1QHAA 3HRGA 1Q82O 3MN5A 5AQPA 2E2NA 3CC4N 5B8HA 3TTCA 3CCRN 3VENA 3HM8A 3ZX2A 3D2FB 2QXLA 4H0YB 3ATVA 3A5LC 2ZJPL 1ILYA 4WFNL 2D0PA 3G6EN 4JKGA 4B1UB 2CGLA 4ILHA 3U4LA 2V7ZA 1TYQA 4JK8A 2P9LB 3A8YA 4IWVA 1RFQA 1DGKN 3SMPA 4B1YB 4KBOA 4BRDA 3SAHA 2AA4A 2NRRA 3P38A 3MN6A 3GL1A 5LJWA 3A5MC 3KHYA 4ILGB 4OPHA 4B1VA 3VF6A 5I9EB 2QW9A 3PIPL 4ISEA 4BRCA 1W97L 3D2EB 5AZJB 3E66A 3RSEB 3R3LA 1D4XA 5GAHP 4IEIA 1NGBA 4J8FA 1ZXOA 2GWKA 5JLFA 1QQOA 3ZX0A 2QWNA 4B1XB 5HL7L 3DXMB 3W0LA 3HOTA 4GV6A 1EO1A 3R6MA 3SK3A 1GLJO 4H0XB 5M1OA 4WQ5C 2WFBA 1RDWX 2FF6A 5AQIA 2P9IA 3F5TA 4CZLA 2RE2A 4PL8A 1JCGA 1C0FA 1NGHA 1SZ2A 1HKGA 3CJ1A 4FWRA 4DHYA 3VF2A 3M6GA 2YHXA 4FO0A 1XUPO 3NVMA 3FFKB 2GWJA 1QQNA 3MWPA 3CQYA 4BRLA 4DKWA 5C12A 5AQSA 4BC3A 3DLLL 1ATNA 3H6EA 5AQLA 4BR4A 5KPZA 3CJ9A 3PLAA 3BF3A 4CZEA 3VOVA 3O9UA 1VQ4N 1NGAA 4JKDA 2P9SB 2YX6A 3FZMA 3ZETB 5ELZA 3VEVA 2IVNA 4FL9A 4JAXA 2VGMA 1JJ2M 2QI2A 3DWLA 5BRHA 4IJNA 3DAWA 4JHDB 5EY4A 3O08A 3R1XA 5F0XA 4WYBA 4MDBA 2ZJQL 1K8KA 4JK9A 4YOUA 5BR9A 4A2BA 4ILJA 3I56N 3OBWA 4FWLA 3DXKA 4XEIA 5BPNA 1NGCA 1WUAA 5C2FA 1M1KO 5GADP 1MWMA 1KAXA 1YI2N 1KAZA 4GV3A 3FGUA 4H0TB 5GINA 3KZBA 1T44A 4OO1J 4QS7A 3FZLA 2P9UB 2Q0RA 3ZEUB 3EO3A 3VETA 1HJOA 3T69A 1U6ZA 1YVNA 3MWTA 5BRFA 1NGGA 3AGRA 4CZMA 3LM2A 5FPEA 1V4TA 4FWQA 3J7ZO 3FZHA 2WUSA 2YJFA 3QDKA 1U2VB 2P9KB 4BY9C 3UE5A 2VWBA 4GVEA 2KKZA 2H3GX 3M5RA 3QMLA 4H0PA 3NVKA 1OKJA 1HLUA 5BREA 3O9TA 2YI1A 3O9SA 3T7ZA 1W2BM 1QVGM 2NRXA 4ISFA 5C0YA 3CCJN 1MDUB 2P9NA 3A0IX 3CHWA 4FWPA 4NLBA 3QB0A 1BUPA 4WQ5A 4HWIA 2CH6A 3VEXA 3ULEB 4HTLA 1NGIA 5AQKA 1YF5L 4H0OA 5AFUH 5EX5A 3WT0A 1Q86O 2QWOA 4BR0A 3MX2A 4BVPA 4JN4A 5C2DA 2Q97A 3EE8A 2HBMA 2QTDA 4I6MB 4JD2B 1P90A 3TSPA 2OTLN 2NRZA 4YORA 1G99A 2CH5A 3EKSA 4A5AA 5BRDA 5CR4A 2NRHA 2V7YA 3VERA 1IJJA 1YXQA 2Q0UA 5AQFA 2J4RA 4DB3A 4CJ7A 1YJWN 4EHUA 2A42A 1T6CA 3OHRA 3LL3A 3CJBA 3L6QA 3D2FA 3LDOA 3LDLA 2HBLA 3MN7A 1VQNN 3O9RA 2IVPA 3FE1A 3WXJA 4H5NA 4IO9L 1VQLN 3CD6N 4PKHA 4IZ9A 4LC9B 5E26A 4BR5A 1R59O 4EAHD 2P9LA 3FZKA 2ITMA 4YOXA 1YAGA 4XH1A 3N4PA 3LDNA 4QS9A 1RDUA 3VGMA 2CGJA 3KWIA 4B1ZA 4JKCA 1QZ6A 2FSNA 2GEMA 2Q1NA 3D2EA 3ID6A 5AZJA 3RSEA 3NMUA 3SBTA 2E1YA 2C1IA 3O6WA 2IVOA 3DXMA 1X9JA 5C10A 5AFUA 3AY9A 4IOCL 1KD1O 4MLEA 1Q7YO 2VCPA 4BROA 2A6AA 2JWKA 3CCUN 2E8AA 3L4QA 5AQOA 4NO7A 3L0QA 4CBUA 1EQYA 3KWGA 2KLAA 4O8UA 3UKUA 1QZ5A 4BECA 2HMPA 2V52B 4FWNA 4RTFD 3TTDA 1VQ8N 5H1SQ 3HZ6A 2WBNA 3CI5A 5KPRA 1Q18A 2P9SA 4KH5A 4MO5A 1GLLO 3ZETA 1S72N 5AQTA 1J6ZA 3ENBA 3CC2N 4CZKA 1X3MA 5MLCQ 3E1YA 2ZGZA 2E2PA 3L4IA 1JCFA 4IFEA 4JKAA 5AZIB 3WEEB 3WQUA 2NRVA 2YHWA 4M7XA 3IFRA 4A2AA 1TUYA 4C23A 3U9ZA 1GLFO 3LDPA 2FSKA 3Q7BA 4YOWA 4EFHA 3IUCA 5C15A 1MWKA 3N4QA 3QICA 5AQVA 1NMDA 3QBXA 2Q31A 3S41A 4A61A 2PAVA 4IJAA 4YOVA 4CBXA 4EHTA 4H5RA 1KQSM 1MA9B 3J8AA 3OBYA 2D4WA 1BG3A 3C6AA 3ZEUA 3IKMA 3ENOA 4IO8A 5HOOA 3OW2M 3P39A 1NBWA 2RHKA 1OVYA 2QWLA 4MO4A 4BRGA 2I7NA 4H03B 1DT9A 2UYTA 3CJAA 2NZTA 3QBWA 4K25A 3D6RA 1SS6A 4GV9A 4Z94A 1NLVA 3FLCO 4PL7A 4WQ4C 1BA0A 3EE9A 2IIRA 3K9KA 1U2VA 2P9KA 4F9OA 3I33A 1VQ6N 3AAQA 5BPLA 3BUZB 3O4WA 5M1PA 1KAYA 1Y64A 3W3DA 4Y0WA 2HBJA 4B1WB 3PIOL 1ESVA 2FXUA 3CERA 4C1NI 5BN8A 3TSQA 4CD1A 2E1ZA 3SBGA 4A62A 5AQRA 1NJIO 5AQQA 5AQYA 3CJ7A 4JKHA 1ZC6A 4FPAA 3ULEA 2HOEA 5FPDA 2ASOA 1S22A 1BWFO 2YJEA 2QM1A 3F2KA 5M1FA 2QWMA 3H1QA 3UKRB 4BC2A 4O5FA 1ATSA 4CZJA 4GNIA 2HSTA 2HF3A 5KPTA 2CGKA 3U8XA 3VMFB 4BG9A 4FVUA 4JKBA 4FWKA 1T6DA 2QWPA 3WXKA 4IDHA 4I6MA 4GY2B 4JD2A 4BRQA 2A3ZA 4AM6A 2NRWA 4OPAA 3CCLN 5JLHA 1ATRA 2YCHA 2AP1A 3R8EA 4CD3A 4IOAL 5KQDA 3HI0A 4BRMA 2OANA 1Z05A 4B9QA 2E20A 4K43A 2HF4A 4IOXA 2E88A 3GDQA 3VTHA 1VQPN 2A41A 3JXUA 3CCQN 1BOTO 5AQUA 3EZWA 1HPMA 3B8AX 2FSJA 2HBKA 3LM9A 3H3NO 4JKEA 1NGDA 1RGIA 3MX5A 5AQHA 2I7PA 4NB4A 3EL2A 5AQGA 4BRAA 3KK7A 5AQZA 3EKUA 3O5BA 3QFUA 3SLCA 3CC7N 3K9JA 2P9PB 4IXCA 3SAFA 4MLHA 4BRIA 4BREA 2QA4N 2A40A 2Q36A 4CZGA 2GTDA 3HSCA 3O9QA 4FPBA 2NRTA 3VF4A 2BTFA 4BEBA 4BE7B 2NLXA 1ZBSA 2YHYA 4BGAA 1SAZA 4BVOA 4U7BA 3FZFA 3IDHA 3E9PA 4BC5A 4RWTA 4MDAA 4JK7A 4BQLA 3G71N 3G4SN 3CPWM 4WFAL 5JVGL 2NNWA 4YDUA 4BG8A 3ATUA 5ADXH 1GLEG 1LOTB 4WQ4A 2QEXN 1H1VA 2VGNA 1BDGA 2V51B 3BEXA 3C7NB 3H3OB 5EOYA 4RCHA 4CZHA 4FOIA 1YJNN 3VEZA 1NGEA 4PKGA 3BF1A 2PBDA 1NWKA 1HX1A 2OTJN 4FWMA 4JKGB 5E84A 3D7EO 1TYQB 1VQMN 5AZIA 3Q7CA 1P8ZA 3WEEA 5JVHL 3GOIA 1JCEA 4CZIA 5GIOA 1WOQA 4PHTX 5BN9A 2W40A 3MN9A 3VGKA 4WCEL 2JWLA 2ASPA 3C0BA 4JHDA 1VQKN 4IEEA 3P4IA 2D0OA 2DPNA 2ZGYA 4JNEA 1BU6O 2A5XA 2F9TA 2Q2RA 4JKFA 1HKCA 3VTIA 2D1KA 4M7YA 3CCVN 3CCSN 1YIJN 3M3ZA 2W00A 1TUUA 1VAZA 2GUPA 5FPNA 3IMXA 3TU5A 1LCUA 1XC3A 1Z6RA 5M1QA 3TSUA 1KC8O 3AARA 1M90O 3UKUB 5AQXA 4YOTA 1NGFA 3G25A 4C1NK 5GAEP 2P9IB 5F1XA 2FLOA 3I8BA 3U9DA 4A59A 1HUXA 1DKGD 2F7TA 1QVFM 4XJXA 4JEPA 3ZX3A 4K42A 5AR0A 3HBTA 5ADXA 1XQSC 2FF3B 2C1GA 1IG8A 2P9UA 3E9LA 3CETA 3CXCM 1BO5O 3CCMN 2BH1A 4L3QA 5TKYA 5FPMA 3A5NC 4BRPA 4FWOA 3TPQA 3ID8A 3SMSA 3WXMB 1GLAG 2ASMA 1HKBA 3LDQA 4QS8A 4YDUC 4AF1A 3H45C 5LJVA 1BA1A 2PFUA 3R9PA 5CHIA 1K73O 4BQZA 4BRKA 4U67L 3CJCA 4CI6A 1V4SA 3A5OC 3C65A 3VPZA 2ZWHA 1YHQN 1K8KB 3MK6A 4BR9A 3CMEN 3GG4A 1T3VA 1NGJA 1DEJA 2QWRA 3AGKA 5F2RA 3C6HA 4A5BA 5M1KA 3DXKB 1C0GA 3VEOA 3O8MA 4WFBL 5EVZA 1NM1A 3UKRA 4XH4A 3SJHA 2QWQA 3CMAN 4FSVA 4M63C 3MCAB 4KH4A 1K9MO 1SQKA 1GLDG 5AQNA 4YOYA 3VEWA 3MCPA 4BR2A 5DM7L 1VQON 1QQMA 3TTFA 3FR0A 4XH5A 5BPMA 5LY3A 4BC4A 2KHOA 3JS6A 2F9WA 4BRNA 2E2OA 3UB5A 4R79A 4DQ8A 4AM7A 3M1FA 3O1WA 3QFPA 4H0VB 4CZFA 5GIPA 3CF5L 4A57A 4O8KA 2E2QA 1KXPA 1K8AO 1E4FT 5KQ8A 1GLBG 3CIPA 3DJCA 1GLCG 3VESA 3E9OA 1CZAN 4H5WA 1YJ9N 2EWSA 4KH6A 5AQMA 1Q81O 4H5VA 3SAGA 4BR7A 3CPEA 4FOEA 3F9MA 2VYPA 5DM6L 3BP8A 3WUHA 3I55N 1N8RO 4UY8O 3ZYYX 3WQTA 5AQWA 3VEYA 3MMVA 5AQJA 3HOSA 3KVGA 2P9NB 4BGBA 1YUWA 2P9PA 4WF9L 2W41A 4DCHA 1X3NA 2GX9A 3CQXA 2ZF5O 4FWSA 5M1NA 1VQ9N 1O13A 3OA9A 4CBWA 3VGLA 2GELA 3HTVA 3P31A 5JICA 4PKIA 3WXIA 5JMVA 3ENHA 4NLCA 1VQ7N 4G9ZA 3WXLA 3GBTA 2BUPA 5EXWA 2WC9A 4BRHA 5CE3A 3O80A 1E4GT 3O1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EN9 A;  3GE1 A;  3H46 O;  3AAP A;  4H5T A;  4E1J A;  4BRF A;  4ISG A;  3MDQ A;  4EIA A;  3H1V X;  4K41 A;  1S3X A;  3C7N A;  1QHA A;  3MN5 A;  5AQP A;  2E2N A;  5B8H A;  3VEN A;  3HM8 A;  3ZX2 A;  3D2F B;  2QXL A;  4H0Y B;  3ATV A;  3A5L C;  2D0P A;  4B1U B;  2CGL A;  3U4L A;  2V7Z A;  1TYQ A;  2P9L B;  3A8Y A;  4IWV A;  1RFQ A;  1DGK N;  3SMP A;  4B1Y B;  4KBO A;  4BRD A;  2AA4 A;  3MN6 A;  3GL1 A;  5LJW A;  3A5M C;  3KHY A;  4B1V A;  3VF6 A;  5I9E B;  2QW9 A;  4ISE A;  4BRC A;  3D2E B;  5AZJ B;  3RSE B;  1D4X A;  1NGB A;  4J8F A;  1ZXO A;  2GWK A;  5JLF A;  1QQO A;  3ZX0 A;  2QWN A;  4B1X B;  3DXM B;  3W0L A;  3R6M A;  3SK3 A;  1GLJ O;  4H0X B;  4WQ5 C;  1RDW X;  2FF6 A;  5AQI A;  2P9I A;  4CZL A;  4PL8 A;  1JCG A;  1C0F A;  1NGH A;  1SZ2 A;  1HKG A;  3CJ1 A;  4FWR A;  4DHY A;  3VF2 A;  3M6G A;  2YHX A;  4FO0 A;  1XUP O;  3FFK B;  2GWJ A;  1QQN A;  3CQY A;  4BRL A;  5AQS A;  4BC3 A;  1ATN A;  3H6E A;  5AQL A;  4BR4 A;  5KPZ A;  3CJ9 A;  3BF3 A;  4CZE A;  3VOV A;  1NGA A;  2P9S B;  3FZM A;  3ZET B;  5ELZ A;  3VEV A;  2IVN A;  4FL9 A;  4JAX A;  3DWL A;  5BRH A;  4IJN A;  3DAW A;  4JHD B;  5EY4 A;  3O08 A;  5F0X A;  4WYB A;  1K8K A;  5BR9 A;  4A2B A;  4FWL A;  3DXK A;  4XEI A;  5BPN A;  1NGC A;  1WUA A;  1MWM A;  1KAX A;  1KAZ A;  3FGU A;  4H0T B;  3KZB A;  1T44 A;  4QS7 A;  3FZL A;  2P9U B;  2Q0R A;  3ZEU B;  3EO3 A;  3VET A;  1HJO A;  1U6Z A;  1YVN A;  5BRF A;  1NGG A;  4CZM A;  3LM2 A;  5FPE A;  1V4T A;  4FWQ A;  3FZH A;  2WUS A;  2YJF A;  3QDK A;  1U2V B;  2P9K B;  3UE5 A;  2VWB A;  2H3G X;  4H0P A;  3QML A;  1OKJ A;  1HLU A;  5BRE A;  2YI1 A;  4ISF A;  1MDU B;  2P9N A;  3A0I X;  3CHW A;  4FWP A;  3QB0 A;  1BUP A;  4WQ5 A;  4HWI A;  2CH6 A;  3VEX A;  3ULE B;  4HTL A;  1NGI A;  5AQK A;  4H0O A;  5AFU H;  5EX5 A;  3WT0 A;  2QWO A;  4BR0 A;  4BVP A;  4JN4 A;  2Q97 A;  4I6M B;  4JD2 B;  1G99 A;  2CH5 A;  3EKS A;  5BRD A;  2NRH A;  2V7Y A;  3VER A;  1IJJ A;  1YXQ A;  2Q0U A;  5AQF A;  2J4R A;  4DB3 A;  4CJ7 A;  4EHU A;  2A42 A;  1T6C A;  3OHR A;  3LL3 A;  3CJB A;  3L6Q A;  3D2F A;  3LDO A;  3LDL A;  3MN7 A;  2IVP A;  3FE1 A;  3WXJ A;  4H5N A;  4PKH A;  4IZ9 A;  4LC9 B;  5E26 A;  4BR5 A;  1R59 O;  4EAH D;  2P9L A;  3FZK A;  2ITM A;  1YAG A;  4XH1 A;  3VGM A;  3LDN A;  4QS9 A;  4B1Z A;  2CGJ A;  1QZ6 A;  2FSN A;  2GEM A;  2Q1N A;  3D2E A;  5AZJ A;  3RSE A;  2E1Y A;  3O6W A;  2IVO A;  3DXM A;  1X9J A;  5AFU A;  3AY9 A;  4MLE A;  2VCP A;  4BRO A;  2A6A A;  2E8A A;  5AQO A;  4NO7 A;  3L0Q A;  4CBU A;  1EQY A;  3UKU A;  1QZ5 A;  2HMP A;  2V52 B;  4FWN A;  4RTF D;  3HZ6 A;  3CI5 A;  5KPR A;  1Q18 A;  2P9S A;  3ZET A;  4MO5 A;  1GLL O;  5AQT A;  1J6Z A;  4CZK A;  1X3M A;  2ZGZ A;  2E2P A;  3L4I A;  1JCF A;  5AZI B;  3WEE B;  3WQU A;  2YHW A;  4M7X A;  3IFR A;  4A2A A;  1TUY A;  4C23 A;  3U9Z A;  1GLF O;  3LDP A;  2FSK A;  4EFH A;  3IUC A;  1MWK A;  3QIC A;  5AQV A;  1NMD A;  3QBX A;  2Q31 A;  3S41 A;  4A61 A;  2PAV A;  4IJA A;  4CBX A;  4EHT A;  4H5R A;  1MA9 B;  3J8A A;  2D4W A;  1BG3 A;  3ZEU A;  3ENO A;  4IO8 A;  1NBW A;  2QWL A;  4MO4 A;  4BRG A;  2I7N A;  4H03 B;  3CJA A;  2UYT A;  2NZT A;  3QBW A;  4K25 A;  4Z94 A;  1NLV A;  3FLC O;  4PL7 A;  4WQ4 C;  1BA0 A;  2IIR A;  1U2V A;  2P9K A;  4F9O A;  3I33 A;  3AAQ A;  5BPL A;  3BUZ B;  3O4W A;  1KAY A;  1Y64 A;  3W3D A;  4Y0W A;  4B1W B;  1ESV A;  2FXU A;  3CER A;  5BN8 A;  4CD1 A;  2E1Z A;  4A62 A;  5AQR A;  5AQQ A;  5AQY A;  3CJ7 A;  1ZC6 A;  4FPA A;  3ULE A;  2HOE A;  5FPD A;  2ASO A;  1S22 A;  1BWF O;  2YJE A;  2QM1 A;  2QWM A;  3H1Q A;  3UKR B;  4BC2 A;  4O5F A;  1ATS A;  4CZJ A;  4GNI A;  5KPT A;  2HF3 A;  2CGK A;  3U8X A;  4BG9 A;  4FWK A;  1T6D A;  2QWP A;  3WXK A;  4I6M A;  4GY2 B;  4JD2 A;  4BRQ A;  2A3Z A;  4AM6 A;  5JLH A;  1ATR A;  2YCH A;  2AP1 A;  3R8E A;  4CD3 A;  5KQD A;  3HI0 A;  4BRM A;  2OAN A;  1Z05 A;  4B9Q A;  2E20 A;  4K43 A;  2HF4 A;  2E88 A;  3GDQ A;  2A41 A;  3JXU A;  1BOT O;  5AQU A;  3EZW A;  1HPM A;  3B8A X;  2FSJ A;  3LM9 A;  3H3N O;  1NGD A;  1RGI A;  5AQH A;  2I7P A;  4NB4 A;  3EL2 A;  5AQG A;  4BRA A;  5AQZ A;  3EKU A;  3O5B A;  3QFU A;  3SLC A;  2P9P B;  4IXC A;  4MLH A;  4BRI A;  4BRE A;  2A40 A;  2Q36 A;  4CZG A;  2GTD A;  3HSC A;  4FPB A;  3VF4 A;  2BTF A;  2NLX A;  1ZBS A;  2YHY A;  4BGA A;  1SAZ A;  4BVO A;  3FZF A;  3IDH A;  4BC5 A;  4RWT A;  4BQL A;  4YDU A;  4BG8 A;  3ATU A;  5ADX H;  1GLE G;  1LOT B;  4WQ4 A;  1H1V A;  1BDG A;  2V51 B;  3BEX A;  3C7N B;  3H3O B;  5EOY A;  4RCH A;  4CZH A;  4FOI A;  3VEZ A;  1NGE A;  4PKG A;  3BF1 A;  2PBD A;  1NWK A;  1HX1 A;  4FWM A;  5E84 A;  3D7E O;  1TYQ B;  5AZI A;  1P8Z A;  3WEE A;  3GOI A;  1JCE A;  4CZI A;  1WOQ A;  5BN9 A;  2W40 A;  3MN9 A;  3VGK A;  3C0B A;  2ASP A;  4JHD A;  3P4I A;  2D0O A;  2DPN A;  2ZGY A;  4JNE A;  1BU6 O;  2A5X A;  2F9T A;  2Q2R A;  1HKC A;  2D1K A;  4M7Y A;  3M3Z A;  1TUU A;  2GUP A;  5FPN A;  3IMX A;  3TU5 A;  1LCU A;  1XC3 A;  1Z6R A;  3AAR A;  3UKU B;  5AQX A;  1NGF A;  3G25 A;  2P9I B;  5F1X A;  2FLO A;  3I8B A;  3U9D A;  1HUX A;  1DKG D;  3ZX3 A;  4K42 A;  5AR0 A;  3HBT A;  5ADX A;  1XQS C;  2FF3 B;  1IG8 A;  2P9U A;  3CET A;  1BO5 O;  4L3Q A;  5TKY A;  5FPM A;  3A5N C;  4BRP A;  4FWO A;  3TPQ A;  3ID8 A;  3SMS A;  1GLA G;  2ASM A;  1HKB A;  3LDQ A;  4QS8 A;  4YDU C;  5LJV A;  3H45 C;  1BA1 A;  3R9P A;  4BQZ A;  4BRK A;  3CJC A;  4CI6 A;  1V4S A;  3A5O C;  3VPZ A;  2ZWH A;  1K8K B;  3MK6 A;  4BR9 A;  3GG4 A;  1NGJ A;  1DEJ A;  2QWR A;  5F2R A;  3DXK B;  1C0G A;  3VEO A;  3O8M A;  5EVZ A;  1NM1 A;  3UKR A;  4XH4 A;  3SJH A;  2QWQ A;  4FSV A;  4M63 C;  1SQK A;  1GLD G;  5AQN A;  3VEW A;  3MCP A;  4BR2 A;  1QQM A;  3FR0 A;  4XH5 A;  5BPM A;  5LY3 A;  4BC4 A;  2KHO A;  3JS6 A;  2F9W A;  4BRN A;  2E2O A;  3UB5 A;  4DQ8 A;  4AM7 A;  3M1F A;  3O1W A;  3QFP A;  4H0V B;  4CZF A;  4O8K A;  2E2Q A;  1KXP A;  1E4F T;  5KQ8 A;  1GLB G;  3CIP A;  3DJC A;  1GLC G;  3VES A;  1CZA N;  4H5W A;  2EWS A;  5AQM A;  4H5V A;  4BR7 A;  4FOE A;  3F9M A;  2VYP A;  3BP8 A;  3WUH A;  3WQT A;  5AQW A;  3VEY A;  3MMV A;  5AQJ A;  3KVG A;  2P9N B;  4BGB A;  1YUW A;  2P9P A;  2W41 A;  4DCH A;  1X3N A;  4FWS A;  3CQX A;  2ZF5 O;  4CBW A;  3VGL A;  2GEL A;  3HTV A;  5JIC A;  4PKI A;  3WXI A;  5JMV A;  3ENH A;  3WXL A;  3GBT A;  2BUP A;  5EXW A;  4BRH A;  5CE3 A;  3O80 A;  1E4G T;  3O1B A; 
#chains in the Genus database with same CATH topology
 4M3Y A;  1YIT N;  4H5T A;  4RW8 A;  3EYZ A;  3RVC A;  4L8R B;  1RT3 A;  4DSF A;  4FW2 A;  3H1V X;  5GAG P;  1S3X A;  4BWJ A;  2YKN A;  5B8H A;  2ITG A;  2QXL A;  1JXB A;  1CZB A;  2ZJP L;  3V1Q A;  2D0P A;  3G6E N;  4GW6 A;  3AO2 A;  4B1U B;  2IGI A;  1TYQ A;  1RIL A;  4IWV A;  3SMP A;  1RFQ A;  1DGK N;  4LD0 A;  3VQA A;  1VQ8 N;  4B1V A;  3PIP L;  2HVI A;  3VF6 A;  2QW9 A;  5AZJ B;  3R3L A;  1D4X A;  3NF8 A;  5JLF A;  1QQO A;  3ZX0 A;  1NK4 A;  4M3U A;  4GV6 A;  1EO1 A;  3QET A;  5M1O A;  2WFB A;  2FF6 A;  4B9M A;  2RE2 A;  1TV6 A;  1SZ2 A;  1A5W A;  1C0F A;  3CJ1 A;  4DHY A;  3VF2 A;  3AVC A;  3KK2 A;  3OYJ A;  2GWJ A;  1QQN A;  4KHS A;  4DKW A;  4CGF A;  4BC3 A;  5HRN A;  4FLV A;  4HVJ A;  1EKE A;  5AQL A;  4OKE A;  4NCB A;  3T19 A;  4KTW A;  1NGA A;  2P9S B;  3FZM A;  3ZET B;  3VEV A;  2O8D B;  4KTZ A;  3DWL A;  5BRH A;  5I42 A;  3MEC A;  4IJN A;  4ZTF A;  1QSY A;  4JHD B;  1LWC A;  1REV A;  1LWE A;  2X74 A;  3ZSR A;  1X9W A;  4R5P A;  2ZJQ L;  3AVK A;  3OYK A;  1BIZ A;  3DXK A;  1WUA A;  4KO0 A;  3NAE A;  1OH6 A;  4DU4 A;  1KAX A;  1XWL A;  1EXQ A;  4GV3 A;  3LAL A;  4B9U A;  3KZB A;  3VQ8 A;  2P9U B;  1JL2 A;  1U6Z A;  3OYB A;  2YNF A;  5KGX A;  4CZM A;  3LM2 A;  1Q9Y A;  4DV1 K;  3T1A A;  3QDK A;  3M8P A;  1U2V B;  2P9K B;  3LP1 A;  3ZLJ A;  1I39 A;  1S1T A;  4QCL A;  1RBV A;  4CF0 A;  2YI1 A;  3O9S A;  5C0Y A;  2NRX A;  4ISF A;  5CZ2 A;  3O4N A;  1MDU B;  1ZBL A;  3V9W A;  4FWP A;  3QB0 A;  2ETJ A;  1SKS A;  4WQ5 A;  4CEO A;  4GKK K;  3K5N A;  3ULE B;  3NHG A;  4BR0 A;  3MX2 A;  1ASV A;  3LZJ A;  1WAJ A;  4CJV A;  3EE8 A;  4E19 A;  2QTD A;  4I6M B;  4JD2 B;  3KKS A;  1NJW A;  1P90 A;  3TSP A;  4FJI A;  4YOR A;  4FM2 A;  3EKS A;  4X66 K;  3AO4 A;  1TAU A;  2NRH A;  1IJJ A;  3T1Y K;  5AQF A;  2PZS A;  2A42 A;  3OHR A;  3LL3 A;  3CJB A;  3D2F A;  3FE1 A;  2F96 A;  3PO5 A;  1JLQ A;  2ITM A;  3ZT0 A;  1U49 A;  1GOB A;  1RDU A;  4I9Q A;  3DOL A;  5C25 A;  2Q1N A;  2GEM A;  3D2E A;  4F8R A;  4CJW A;  1WLJ A;  1TL1 A;  3O6W A;  2P5G A;  1KFD A;  5C10 A;  4LFA K;  3CFP A;  4IOC L;  4MLE A;  3OS1 A;  3CCU N;  3L0Q A;  3KWG A;  5T7B A;  2D0C A;  1NK5 A;  4KI4 A;  1RT4 A;  2V52 B;  4IDK A;  1Y97 A;  1C0T A;  3CI5 A;  4PA1 A;  1JKH A;  4OX9 K;  4MO5 A;  5AQT A;  3HM9 A;  2XO7 A;  3CC2 N;  5FLX O;  2X78 A;  3L4I A;  4CFD A;  3WQU A;  4A2A A;  3IFR A;  3OJU A;  2O8C B;  1HMV A;  1GLF O;  3LDP A;  4YOW A;  2PYJ A;  4CHZ A;  5J2N A;  3SQ1 A;  2HHV A;  3NBP A;  3N4Q A;  5AQV A;  2G8W A;  1N6Q A;  1JL1 A;  3S41 A;  2BGG A;  2IS3 A;  1L3T A;  2D4W A;  4XIU A;  1BG3 A;  3CYM A;  4DR5 K;  5HOO A;  2B6A A;  3RR7 A;  3VQQ A;  4KHP K;  2OPR A;  4H03 B;  4C8L A;  3D6R A;  3H08 A;  4GV9 A;  1XHX A;  4Z94 A;  4LF4 K;  2IIR A;  1QHT A;  3MAQ A;  4YHH K;  1VQ6 N;  1BQM A;  3AAQ A;  5BPL A;  2DY4 A;  5M1P A;  1KAY A;  1Y64 A;  3PIO L;  1ESV A;  2FXU A;  3TSQ A;  3SBG A;  1XHZ A;  3AVF A;  2P1J A;  1ZC6 A;  4CK2 A;  4KB1 A;  4LFC K;  5M1F A;  3I0S A;  5KPT A;  4Y1C A;  3VMF B;  1Z26 A;  3WXK A;  4FJM A;  4CFB A;  2A3Z A;  2NRW A;  4KHN A;  2AP1 A;  1C1B A;  4RW9 A;  5KQD A;  5HP1 A;  1ZBF A;  3PUF A;  3VTH A;  1HNV A;  3JXU A;  2VG7 A;  1NU0 A;  1U4B A;  1EET A;  3H3N O;  3QLH A;  1TK5 A;  1I3A A;  1N33 K;  1QE1 A;  4JYA K;  2I7P A;  5AQZ A;  3EKU A;  1NK8 A;  3K9J A;  3O3H A;  4IXC A;  3K59 A;  4BRE A;  2QA4 N;  4FPB A;  2ZD1 A;  2OZS A;  3J80 O;  2O8E B;  2BTF A;  1SAZ A;  3QEW A;  5FRN A;  4DUY K;  3E9P A;  2YNG A;  3G71 N;  2VWK A;  3CPW M;  1I94 K;  1GLE G;  3NGI A;  4WQ4 A;  4CZH A;  4K0K K;  1YJN N;  3VA3 A;  5SZT A;  4H8K A;  2PBD A;  1S1W A;  4CJQ A;  4JKG B;  3Q7C A;  1P8Z A;  4DUZ K;  4IBN A;  4C8N A;  2JWL A;  1D9D A;  2D0O A;  1WSG A;  2F9T A;  1NJX A;  2Q2R A;  2A1R A;  3VTI A;  4CK1 A;  1L3V A;  3CCS N;  1YIJ N;  4B3S K;  1TUU A;  1VAZ A;  1JLG A;  1BI4 B;  3I8D A;  3IMX A;  3QES A;  1C6V A;  3LWL A;  4DR2 K;  2BDP A;  2OCE A;  2FLO A;  1HYS A;  3K5M A;  5AR0 A;  4B9L A;  1NOY A;  3DRS A;  3VQ6 A;  5TKY A;  1KTQ A;  1JLE A;  4FWO A;  3OYH A;  1Z25 A;  3LAM A;  2ASM A;  1HKB A;  4AF1 A;  3THW A;  2PFU A;  4V19 S;  3TAF A;  3V9Z A;  4CI6 A;  1V4S A;  3A5O C;  3VPZ A;  5E41 A;  2ZWH A;  3MK6 A;  3VQ4 A;  3CME N;  1T3V A;  2G8U A;  2QWR A;  3L2R A;  4A5B A;  3HST B;  4KFB A;  2O8F A;  1C0G A;  3CFO A;  4WFB L;  1S5J A;  3UKR A;  1LV5 A;  1FKP A;  3SZ2 A;  1GLD G;  3DMJ A;  1FXX A;  2Y1J A;  4BR2 A;  1D9F A;  4CED A;  4J2B A;  4FK2 A;  2ZE2 A;  4CIG A;  1D8Y A;  1S6Q A;  1A5X A;  3O1W A;  3QFP A;  4I2Q A;  4DS4 A;  2XHB A;  3CF5 L;  1NKB A;  4O8K A;  2E2Q A;  4CHO A;  3E9O A;  4N56 A;  4CJU A;  5AQM A;  3ZSW A;  3VQC A;  4O5B A;  5DM6 L;  4ID1 A;  3S3N A;  1L3S A;  3BP8 A;  3KLG A;  1N8R O;  4UY8 O;  3ZYY X;  3WQT A;  1O1W A;  3VEY A;  1QSS A;  4LSN A;  1FW6 A;  2P9N B;  1G15 A;  2P9P A;  3DLE A;  2W41 A;  4DCH A;  1X3N A;  2RF2 A;  2O8B A;  1X1P A;  3M8S A;  4F2R A;  3HTV A;  4G9Z A;  3SUP A;  4NLC A;  3GBT A;  4JRQ A;  3BY5 A;  4BRH A;  2WTU A;  3O80 A;  1HNI A;  4NO7 A;  3EN9 A;  3GE1 A;  1VSE A;  2ZJR L;  2GUI A;  4LF8 K;  3DM2 A;  3PX4 A;  3THY A;  4AQY K;  3HRG A;  4OJR A;  5AQP A;  3CCR N;  3CC4 N;  3LDS A;  3TTC A;  1W7A A;  3VEN A;  1LWF A;  3OYI A;  3ATV A;  5CYM A;  1KCF A;  1RT1 A;  1SUQ A;  2CGL A;  1HNW K;  2V7Z A;  4JK8 A;  3A8Y A;  4B1Y B;  3EZ5 A;  4W5N A;  2AA4 A;  4CJP A;  3WNF A;  2NRR A;  2YNI A;  3GL1 A;  2ATQ A;  4JI0 K;  1W97 L;  3E66 A;  1HNZ K;  3V6D A;  4IEI A;  4J8F A;  3V9S A;  4LSL A;  4B1X B;  5HL7 L;  3OS0 A;  3DXM B;  3AV9 A;  2YNH A;  3WNG A;  2UUB K;  3SK3 A;  4X62 K;  3S9H A;  4WQ5 C;  5AQI A;  2P9I A;  2XY7 A;  1HR0 K;  4OGE A;  1NGH A;  4FWR A;  1DTT A;  1HKG A;  2HND A;  1CLQ A;  2YHX A;  4BDY A;  3NVM A;  1T05 A;  5J1E A;  3HVR A;  5AQS A;  3M8R A;  3H6E A;  3WNH A;  4C8M A;  4FJ7 A;  3VOV A;  1EP4 A;  3KJV A;  1SKR A;  4JKD A;  1KFS A;  3A2F A;  2IVN A;  4TSX A;  1JJ2 M;  3SJJ A;  1QSL A;  1WN7 A;  5EY4 A;  1ZBU A;  2HB5 A;  1JLF A;  5F0X A;  5HRO A;  4O55 A;  3VQB A;  4MDB A;  1WBD A;  4JK9 A;  1BCO A;  1N5Y A;  1CXU A;  3I56 N;  2KFZ A;  4DQQ A;  4PQU A;  4NCA A;  4OGC A;  5C2F A;  2UXD K;  2G8F A;  1W9H A;  1YI2 N;  3BDP A;  4AH9 A;  1WNS A;  2G8H A;  3FGU A;  4H0T B;  4FXD A;  4QS7 A;  5HBM A;  3ZEU B;  4FJ8 A;  4CGG A;  1YVN A;  3PV8 A;  4RG8 A;  5FPE A;  2YHA A;  1N34 K;  3THW B;  4CFA A;  3FZH A;  3UE5 A;  2VWB A;  4JI7 K;  3SUQ A;  2KKZ A;  2B4J A;  4H0P A;  3QML A;  3NVK A;  1VRT A;  1BL3 A;  2W6L A;  1QTM A;  2O8F B;  1W2B M;  3AVJ A;  3M8Q A;  3VQP A;  3CCJ N;  4NLB A;  3A0I X;  3RMD A;  4M3X A;  3VEX A;  4HWI A;  2DFE A;  3TI0 A;  5AQK A;  1YF5 L;  1Q86 O;  3KLF A;  1ITG A;  4LF9 K;  4BVP A;  4JN4 A;  5C2D A;  2Q97 A;  1RDB A;  3HL8 A;  2CH5 A;  2HHU A;  3RMA A;  5CR4 A;  1TAQ A;  2HHT A;  4CVN E;  1YXQ A;  2Z1H A;  1YJW N;  1XMO K;  3L6Q A;  3LDO A;  2HBL A;  3O9R A;  2IVP A;  2FBX A;  3WXJ A;  1IKY A;  4H5N A;  3ZT4 A;  4LC9 B;  5E26 A;  4BR5 A;  1VRU A;  2P9L A;  3FZK A;  3SI6 A;  3VGM A;  3KWI A;  4JKC A;  2FSN A;  3L8B A;  4CJS A;  1L5U A;  3ID6 A;  3RR8 A;  3RSE A;  4IG0 A;  4JI1 K;  3SBT A;  2C1I A;  4EP4 A;  1HRH A;  3EY1 A;  1WB9 A;  3OTO K;  4FJL A;  1NK6 A;  3P1G A;  1VSK A;  4E7H A;  1Q7Y O;  2VCP A;  4BRO A;  2A6A A;  1OH7 A;  3OYF A;  1NNE A;  3L2U A;  4M3Z A;  3QO9 A;  3RMB A;  1VSM A;  1EQY A;  4FM0 A;  1C0U A;  2KLA A;  4O8U A;  2HMP A;  4OLA A;  4FWN A;  4RTF D;  3T3F A;  3HZ6 A;  3HJF A;  2WBN A;  3WNE A;  3J7Y P;  4IFY A;  1J6Z A;  1XMQ K;  4DV6 K;  3ENB A;  5JS2 A;  4DTN A;  3THX A;  1B92 A;  1X3M A;  3K5L A;  4LF7 K;  5GAE P;  2ZGZ A;  4JKA A;  1NOZ A;  2YHW A;  4M7X A;  4J2E A;  4CHP A;  4G1Q A;  4NCG A;  1VSJ A;  3UIQ A;  2Q31 A;  4OPJ A;  4B3O A;  2VG5 A;  1VK0 A;  2PAV A;  3MED A;  4YOV A;  4CBX A;  4EHT A;  4H5R A;  3EEQ A;  1XNR K;  3J8A A;  4KKO A;  3AA2 A;  4KAZ A;  3C6A A;  1JLA A;  3ENO A;  3OW2 M;  3HP9 A;  3P39 A;  4QAG A;  2RHK A;  2I7N A;  3NFA A;  4K25 A;  1SS6 A;  2O4I A;  3IS9 A;  3E01 A;  4HUG A;  4WQ4 C;  1RDA A;  4HHT A;  5BR8 K;  3QIP A;  3NCI A;  4DSL A;  4CEE A;  4DWI A;  1YJ9 N;  2F8T A;  4YFU A;  3CER A;  4C1N I;  5BN8 A;  4CJL A;  1U48 A;  2E1Z A;  3K2P A;  4A62 A;  4DFP A;  3SPZ A;  3ASM A;  5AQQ A;  4DTP A;  4JKH A;  4FPA A;  3KLH A;  4FLY A;  2HOE A;  5FPD A;  4ELT A;  1S22 A;  1BWF O;  3AVH A;  3F2K A;  2QWM A;  4O5F A;  4DV3 K;  1ATS A;  4GNI A;  2HF3 A;  2QK9 A;  2CGK A;  1T6D A;  2QWP A;  3BZC A;  4AM6 A;  4M3W A;  4OPA A;  2YCH A;  3R8E A;  4CD3 A;  4BE0 A;  3TAN A;  1Z05 A;  4B9Q A;  2E20 A;  4M3T A;  2HF4 A;  4IOX A;  3GDQ A;  2A41 A;  1IO2 A;  2XY5 A;  4DFJ A;  2OZM A;  3U3G A;  5LL6 Z;  4JKE A;  5FRM A;  1LAW A;  1RGI A;  1NGD A;  5AQH A;  2HHQ A;  1C1C A;  4I2P A;  4NB4 A;  3EL2 A;  4BRA A;  4M41 A;  3QIN A;  2HVH A;  4DQS A;  3LPU A;  3NF6 A;  4KHQ A;  1ZBH A;  3B6P A;  1RT7 A;  4MLH A;  2HNZ A;  1J9A A;  4CZG A;  2DTU A;  2NRT A;  3VF4 A;  1ZBS A;  3FZF A;  3IDH A;  3KKR A;  3AO5 A;  4MDA A;  2YHB A;  4BQL A;  4DG1 A;  3QNN A;  4B9N A;  2KQ2 A;  3HO1 A;  3ATU A;  1R0A A;  3SPY A;  4Q0B A;  1H1V A;  4DSE A;  3H3O B;  1L3U A;  2FBV A;  4RCH A;  1IBK K;  4B3M K;  4FOI A;  5HRS A;  2DFH A;  4O44 A;  3PO4 A;  1IG9 A;  1NGE A;  3BF1 A;  1NWK A;  1HX1 A;  2OTJ N;  1S9E A;  4FWM A;  5E84 A;  3D7E O;  1TYQ B;  3VQD A;  5AZI A;  3SYZ A;  1VQM N;  3WEE A;  4CJR A;  5JVH L;  4W5O A;  3V4I A;  2F8S A;  3OYM A;  4PHT X;  4ZTJ A;  4EZ9 A;  4DFM A;  1RT5 A;  3J7A P;  1VQK N;  4B8C A;  2DPN A;  2ZGY A;  4JNE A;  3OS2 A;  2D1K A;  4M7Y A;  3CCV N;  1VSF A;  3MEG A;  2GUP A;  5FPN A;  3HXM A;  1LCU A;  1Z6R A;  4C1N K;  3I8B A;  3VQ5 A;  4N76 A;  1HUX A;  2DFF A;  4KRE A;  4XJX A;  4K42 A;  2FF3 B;  3HVT A;  2E6L A;  4DS5 A;  1IG8 A;  3RRG A;  1GOA A;  2O4G A;  2EHG A;  3A5N C;  4BRP A;  3THX B;  1LW0 A;  2VG6 A;  1WSJ A;  3WXM B;  5HLF A;  4YDU C;  1U45 A;  3ZT2 A;  1K73 O;  2KW4 A;  3TAP A;  3QIO A;  4U67 L;  4X64 K;  2FBT A;  1NGJ A;  4DR6 K;  5F2R A;  4CEB A;  5M1K A;  3L2Q A;  4KHW A;  3DXK B;  4DQI A;  3VEO A;  3O8M A;  1WSH A;  2QWQ A;  3LP0 A;  3RTV A;  1NMN A;  1K9M O;  1SQK A;  5AQN A;  5SWM A;  4YOY A;  3MCP A;  5DM7 L;  4EZ6 A;  5BPM A;  5LY3 A;  4BC4 A;  2KHO A;  2F9W A;  4BRN A;  3HPH A;  1J5O A;  4AM7 A;  4CJT A;  4CZF A;  3HPG A;  4A57 A;  1KXP A;  1E4F T;  1GLB G;  3CIP A;  1NJZ A;  4EP5 A;  3VES A;  3KIO A;  1CZA N;  1N36 K;  2EWS A;  4KH6 A;  3SUN A;  1RBT A;  4HCB A;  2OA8 A;  1YT3 A;  3LP3 A;  1TKX A;  1B9D A;  1KVC A;  2ZQB A;  2UXB K;  3MMV A;  3SV3 A;  1DLO A;  1YUW A;  3LP2 A;  4WF9 L;  5M1N A;  5KRS A;  3HK2 A;  1NK0 A;  4CBW A;  4M42 A;  3P31 A;  5JMV A;  4PKI A;  3KLI A;  4Z4I A;  3KK1 A;  1E4G T;  4E89 A;  4Z4E A;  4IFV A;  3H46 O;  3AAP A;  5TKW A;  1KLN A;  4AHC A;  4ISG A;  1HNX K;  1IKV A;  3AO3 A;  2KZZ A;  3C7N A;  1Q82 O;  3MN5 A;  3SUO A;  4HCC A;  4J2D A;  3ZX2 A;  3D2F B;  4H0Y B;  3A5L C;  2XY8 A;  4WFN L;  1C0M A;  3U4L A;  3TAE A;  5J2P A;  4O0J A;  3C95 A;  3SAH A;  3KHY A;  4OPH A;  5I9E B;  2QXF A;  4ISE A;  2W6K A;  3D2E B;  3FFI A;  3JYT A;  3V1R A;  1YTA A;  2E4L A;  1ASW A;  2GWK A;  2WON A;  3W0L A;  4JI6 K;  3R6M A;  3HYF A;  3F5T A;  4CZL A;  1XNQ K;  1UAX A;  1SL2 A;  4FO0 A;  1XUP O;  3FFK B;  1RT2 A;  4E1N A;  4FCY A;  3ALY A;  3K0S A;  3TAB A;  4B9S A;  4BR4 A;  5KPZ A;  3PLA A;  4YNQ A;  3CJ9 A;  3CQ8 A;  4CZE A;  3KTQ A;  3O9U A;  2OYQ A;  3QNO A;  5ELZ A;  2IAJ A;  4FL9 A;  4JAX A;  3MEE A;  1HQE A;  3SNN A;  3DAW A;  4E1M A;  3G0Z A;  1RBU A;  4WYB A;  1K8K A;  2G8I A;  1J5E K;  4MFB A;  4YOU A;  1MU2 A;  5BR9 A;  4DQR A;  1TVR A;  2VQF K;  4ILJ A;  4CK3 A;  3OBW A;  2GBZ A;  5HRR A;  1MWM A;  4CE9 A;  2Y1I A;  1S1X A;  2E5L K;  4DMN A;  5GIN A;  1T44 A;  4OO1 J;  1X9M A;  1VSI A;  2Q0R A;  1HJO A;  3OYN A;  1S6P A;  5BRF A;  1NKC A;  1NGG A;  4CW7 B;  4AHT A;  4KV8 A;  4N5S A;  1QQC A;  1V4T A;  2RKI A;  1IBL K;  4BY9 C;  4GVE A;  4E72 A;  1OKJ A;  4ELV A;  4CF2 A;  3T7Z A;  4J2A A;  1KVB A;  2D0A A;  2YV0 X;  3ZSV A;  3LZI A;  2CH6 A;  1SL1 A;  4B9V A;  5AFU H;  1NGI A;  4H0O A;  4CF8 A;  1C1A A;  5EX5 A;  4M45 A;  3WT0 A;  3THV A;  3DRR A;  2UUC K;  3PY8 A;  1UA0 A;  4DR1 K;  2OTL N;  2NRZ A;  3AVA A;  1T8E A;  1G99 A;  4CEF A;  1J54 A;  5IT9 O;  4E7L A;  3SQ2 A;  4EHU A;  1JLB A;  1T6C A;  1UOC A;  2G8K A;  3CD6 N;  4KTQ A;  4PKH A;  3PSI A;  4IZ9 A;  2P5O A;  1R59 O;  4GMJ B;  2EX3 A;  3MXI A;  4XH1 A;  4B1Z A;  3LDN A;  4QS9 A;  4DLG A;  3KK3 A;  5CY4 A;  1QZ6 A;  1KSP A;  3TR8 A;  2KZM A;  4OKK A;  5AZJ A;  3U6F A;  3ZCM A;  3NDK A;  5KRT A;  3IRX A;  4DF8 A;  2IVO A;  5AFU A;  3AY9 A;  3SQ0 A;  1KD1 O;  4BDZ A;  1OH8 A;  5JEN A;  2IDO A;  2JWK A;  5J2Q A;  4FJH A;  3L4Q A;  1HYZ A;  1J53 A;  2HHW A;  1QZ5 A;  3RRH A;  4BEC A;  4FLW A;  4Z4G A;  3SV4 A;  1IV0 A;  1KLM A;  2NUB A;  5KPR A;  3CYG A;  2P9S A;  3ZET A;  4DSK A;  2O8D A;  4BE2 A;  1BQN A;  3E1Y A;  4IFE A;  1JCF A;  4CHQ A;  4CJK A;  3NH1 A;  3Q7B A;  2FSK A;  2R7Y A;  3IUC A;  5C15 A;  1MWK A;  3QIC A;  3HPO A;  3VQ9 A;  1NG9 A;  3QBX A;  5JS1 A;  2BAN A;  3AVB A;  4IJA A;  3L2V A;  4ICL A;  1KQS M;  1MA9 B;  1UWB A;  4FK4 A;  3OBY A;  4CGH A;  3MXJ A;  4FJX A;  3IKM A;  4IO8 A;  1NBW A;  1OVY A;  2QWL A;  3CJA A;  2OPS A;  2NZT A;  3QBW A;  4CJ3 A;  3FLC O;  2RPI A;  5CYQ A;  1LW2 A;  3EE9 A;  1ASU A;  1U2V A;  2P9K A;  3K9K A;  5CZ1 A;  3I33 A;  3DLR A;  3W3D A;  3V9U A;  4B1W B;  4BWM A;  4CD1 A;  5EU7 A;  4DU1 A;  2PY5 A;  3K58 A;  5AQR A;  5A2Q O;  5AQY A;  3CJ7 A;  4CIE A;  1VSL A;  4JRP A;  3ULE A;  4AIL C;  3ZT1 A;  2ASO A;  2YJE A;  3AVN A;  3H1Q A;  3UKR B;  4BC2 A;  4CGI A;  1TK0 A;  4FVU A;  4BG9 A;  4NXM K;  5KI6 A;  4FJN A;  4IDH A;  4I6M A;  4JD2 A;  3JAM O;  3CM5 A;  5JLH A;  2P51 A;  1ATR A;  2JGU A;  4X65 K;  4IOA L;  3HI0 A;  4O0I A;  2OAN A;  4CHN A;  2E88 A;  3T1H K;  1VQP N;  4JI2 K;  1BOT O;  3EZW A;  3L2W A;  3IAY A;  3OYC A;  3B8A X;  4DU3 A;  2HBK A;  4B9T A;  1RTH A;  1E3M A;  3MX5 A;  1S1U A;  4FK0 A;  3P83 D;  4RW7 A;  4DTM A;  4E0D A;  3CC7 N;  2KFN A;  3MXM A;  1JLC A;  2P9P B;  5DMR A;  3QEV A;  2O8B B;  4RW6 A;  2GTD A;  3HSC A;  4E7K A;  3O3G A;  4BGA A;  3OYG A;  4BVO A;  4U7B A;  3ZT3 A;  4RWT A;  1LAV A;  4WFA L;  5JVG L;  2Z1G A;  4FZY A;  2VGN A;  1BDG A;  2V51 B;  3THY B;  2Z1J A;  2HNY A;  4CEQ A;  4B8A B;  1TKZ A;  2WOM A;  4PKG A;  3DOK A;  4DV7 K;  3DLH A;  4W5T A;  4JV5 K;  2G8V A;  2ZM6 K;  1D5A A;  1SKW A;  1RTJ A;  3QER A;  2UUA K;  4K8Z A;  1JCE A;  4CZI A;  5GIO A;  4CEZ A;  2O8C A;  3VGK A;  4WCE L;  3MN9 A;  3C0B A;  4IEE A;  3P4I A;  3NF7 A;  1HJR A;  4I7F A;  1HKC A;  4F2S A;  2JLE A;  3M3Z A;  3NGZ A;  3C6T A;  4DLE A;  4NXN K;  1TKD A;  1XI1 A;  4CGD A;  3TU5 A;  1XC3 A;  5M1Q A;  3AAR A;  4UQG A;  5AQX A;  4YOT A;  1NGF A;  3G25 A;  4CHY A;  1NK7 A;  2P9I B;  4KB0 A;  5F1X A;  3TAQ A;  3U9D A;  4A59 A;  1DKG D;  1HYV A;  2F7T A;  3ZX3 A;  3HBT A;  3OYD A;  2A1S A;  3VA0 A;  1TKT A;  1WSF A;  3CET A;  3E9L A;  1FJG K;  4LFB K;  3CCM N;  2BH1 A;  3OJS A;  4PY5 A;  3TPQ A;  3BZK A;  1CXQ A;  3LDQ A;  5LJV A;  5CHI A;  4I9L A;  1UA1 A;  4FW1 A;  4BRK A;  3CJC A;  4QOZ B;  3C65 A;  4CF1 A;  3ZSQ A;  3QEX A;  4BR9 A;  4FJG A;  1DEJ A;  3AGK A;  1WSE A;  1TL3 A;  4CEA A;  1NM1 A;  4XH4 A;  3SJH A;  4FSV A;  4M63 C;  4ZHR A;  3MCA B;  4OVL A;  4DSI A;  1IKX A;  5DK5 A;  4CEC A;  4CER A;  1QQM A;  3TTF A;  3FR0 A;  2RN2 A;  4OKJ A;  4XH5 A;  4R79 A;  3UB5 A;  4JS4 A;  5GIP A;  4H0V B;  3KD1 E;  1K8A O;  1S9G A;  5KQ8 A;  1F21 A;  1Q81 O;  4CJE A;  4DF4 A;  3HP6 A;  2VYP A;  4B3R K;  3I55 N;  1KVA A;  3S5T A;  5AQW A;  5AQJ A;  3HOS A;  3KVG A;  3ZSZ A;  4BGB A;  4FWS A;  3CQX A;  2ZF5 O;  1VQ9 N;  4JI5 K;  1O13 A;  2IOC A;  2O8E A;  5JIC A;  1VQ7 N;  3WXI A;  4E3S A;  3ENH A;  3WXL A;  5IWA K;  5EXW A;  2WC9 A;  3S3M A;  4Y1D A;  3O1B A;  4QS8 A;  1IKW A;  2QEX N;  3CCE N;  4DV4 K;  1VQ5 N;  4E1J A;  4BRF A;  4KPY A;  2OPQ A;  3MDQ A;  4EIA A;  4K41 A;  3K57 A;  1QHA A;  3IG1 A;  5D3G A;  2E2N A;  3DLK A;  3V81 A;  3JSM A;  3HM8 A;  4CJF A;  4FJ5 A;  1ILY A;  4JKG A;  4ILH A;  2FC0 A;  4DR4 K;  1RTD A;  5KGW A;  4BE1 A;  4DTJ A;  2P9L B;  1EWQ A;  4BRD A;  4KBO A;  1BGX T;  3P38 A;  3MN6 A;  5LJW A;  4DTS A;  3A5M C;  4ILG B;  4BRC A;  3RSE B;  5GAH P;  1NGB A;  4DR7 K;  1ZXO A;  2HMI A;  2QWN A;  5LMU K;  1FK9 A;  1BI4 A;  2GV9 A;  3HOT A;  4CJ4 A;  3L3V A;  1GLJ O;  4H0X B;  1RDW X;  1RBR A;  1YTU A;  3HT3 A;  4PL8 A;  1JCG A;  3M6G A;  4FZZ A;  4O4G A;  3MWP A;  1BCM A;  3CQY A;  4BRL A;  5C12 A;  3TAR A;  1XC9 A;  3DLL L;  1ZBI A;  3OVN A;  1ATN A;  3BF3 A;  1OH5 A;  1VQ4 N;  4LH5 A;  2VWJ A;  2YX6 A;  4C8K A;  2VGM A;  3F73 A;  2QI2 A;  3AO1 A;  4NYF A;  3PX6 A;  1KRP A;  4KHU A;  3O08 A;  3R1X A;  2AJQ A;  4RW4 A;  4F3T A;  3AA4 A;  4A2B A;  2FBY A;  4E7I A;  4FWL A;  4XEI A;  3DLG A;  5BPN A;  2XRI A;  1EX4 A;  1NGC A;  2UU9 K;  1QS4 A;  4KRF A;  1M1K O;  5GAD P;  2PYL A;  1KAZ A;  1RDD A;  4ELU A;  2Z1I A;  3AVM A;  3FZL A;  3EO3 A;  3VET A;  3T69 A;  3MWT A;  2HHH K;  3AGR A;  3J81 O;  4DFK A;  4FWQ A;  3P5J A;  3OY9 A;  3J7Z O;  2WUS A;  2YJF A;  1RTI A;  1B9F A;  1X9S A;  2H3G X;  3M5R A;  1HLU A;  4FLT A;  5BRE A;  2IC3 A;  3O9T A;  3C6U A;  4CCH A;  1QVG M;  2P9N A;  3CHW A;  1TK8 A;  3V9X A;  3NH0 A;  1BUP A;  4HTL A;  3TAG A;  2LSN A;  2OPP A;  2QWO A;  1HPZ A;  2HBM A;  4HUF A;  4FVM A;  3ZSO A;  4LH4 A;  4A5A A;  5BRD A;  2V7Y A;  3VER A;  2Q0U A;  4LF5 K;  2J4R A;  3ISN C;  4DB3 A;  4CJ7 A;  3NE6 A;  3MN7 A;  4FLU A;  3LDL A;  1VQN N;  3DYA A;  3NGY A;  4IO9 L;  1VQL N;  4EAH D;  4YOX A;  2D5R A;  4F4K A;  1YAG A;  2YKM A;  2HHX A;  3N4P A;  1RDC A;  3LAK A;  2CGJ A;  2XY6 A;  1SV5 A;  3NMU A;  2E1Y A;  4Z4C A;  2HW3 A;  4F3O A;  3RWU A;  1TGO A;  3DXM A;  1X9J A;  5K14 A;  4JI4 K;  4H4O A;  2E6M A;  5J2M A;  2E8A A;  5AQO A;  1S1V A;  3D45 A;  4CBU A;  3UKU A;  3U3Y A;  3TTD A;  3BGR A;  5H1S Q;  4FJ9 A;  4B3T K;  3D0P A;  3G10 A;  1Q18 A;  3NF9 A;  4KH5 A;  1GLL O;  1S72 N;  4CZK A;  5MLC Q;  5AZI B;  2E2P A;  3WEE B;  2NRV A;  4C8O A;  4FJJ A;  1TUY A;  1BIS A;  1T7P A;  4C23 A;  3U9Z A;  4EFH A;  1K6Y A;  3AA3 A;  4W5R A;  4CJ5 A;  1NMD A;  4ID5 A;  3VQE A;  1FKO A;  4CIF A;  3AVL A;  5LMN K;  4HUE A;  4A61 A;  4Z4F A;  1SL0 A;  2BE2 A;  4YY3 K;  1WAF A;  3ZEU A;  4B08 A;  3I0R A;  4MO4 A;  4BRG A;  3C94 A;  1IH7 A;  3VQ7 A;  1DT9 A;  2UYT A;  4JI8 K;  3ITH A;  1NLV A;  4PL7 A;  1BA0 A;  4F9O A;  5KTQ A;  4LF6 K;  3BUZ B;  3O4W A;  4FYD A;  4Y0W A;  2HBJ A;  4WE1 A;  4IG3 A;  1RT6 A;  3TAM A;  2I5J A;  1GOC A;  4LY7 A;  1DTQ A;  4Q5V A;  4AHS A;  2HHI A;  1NJI O;  3AA5 X;  3B6O A;  4AHU A;  2W42 A;  2QM1 A;  4H4M A;  3RMC A;  4CZJ A;  2HST A;  1Q8I A;  3U8X A;  4M3R A;  1T03 A;  4IKF A;  4JKB A;  4FWK A;  1NK9 A;  4AHV A;  4BRQ A;  4GY2 B;  4AHR A;  3S3O A;  3NH2 A;  4FM1 A;  5HRP A;  3CCL N;  3LPT A;  4PWD A;  4JI3 K;  4BRM A;  4K43 A;  3VN5 A;  3LWM A;  4BDP A;  3CCQ N;  5AQU A;  4N41 A;  1HPM A;  3O4Q A;  2FSJ A;  3LM9 A;  5I3U A;  1IBM K;  1WSI A;  5AQG A;  2QKB A;  3KK7 A;  1U04 A;  3CFR A;  3O5B A;  3QFU A;  3SLC A;  4OLB A;  2Q3S A;  3SAF A;  4BRI A;  1CZ9 A;  2A40 A;  1BHL A;  2Q36 A;  3O9Q A;  4BEB A;  4BE7 B;  2NLX A;  3KLE A;  2YHY A;  4Z0U A;  1VHX A;  4BC5 A;  4JK7 A;  3AVI A;  4N47 A;  3G4S N;  2VQE K;  2NNW A;  3LAN A;  4YDU A;  4BG8 A;  4DV2 K;  4DR3 K;  5ADX H;  1LOT B;  2B5J A;  3OYA A;  3BEX A;  3C7N B;  5EOY A;  4DSJ A;  1U47 A;  4JS5 A;  3PX0 A;  3VEZ A;  1VSH A;  3SCX A;  4FZX C;  3GOI A;  1Q9X A;  1WOQ A;  4E7J A;  5BN9 A;  2W40 A;  2ASP A;  4JHD A;  1HQU A;  1OVQ A;  1BU6 O;  2A5X A;  3OYL A;  4JKF A;  4FLX A;  4GKJ K;  2UXC K;  5C24 A;  4DQP A;  4GVM A;  3AVG A;  2W00 A;  1YVU A;  4DV0 K;  2HHS A;  3CG7 A;  3TSU A;  5FRO A;  1KC8 O;  4NYN A;  4Z4H A;  3UKU B;  3TWH A;  1M90 O;  1BIU A;  4CFC A;  3QEP A;  1WBB A;  2X6N A;  1QVF M;  4JLH A;  3QEI A;  1NJY A;  2QKK A;  4JEP A;  5ADX A;  4DTX A;  1XQS C;  3F9K A;  2C1G A;  2P9U A;  3CXC M;  1NKE A;  4MQ3 A;  1BO5 O;  4L3Q A;  5FPM A;  4CGJ A;  1A5V A;  3ID8 A;  3SMS A;  1GLA G;  1RBS A;  3H45 C;  3KD5 E;  1BA1 A;  3R9P A;  4FJK A;  4BQZ A;  5C42 A;  4BAC A;  4W5Q A;  4DV5 K;  1YHQ N;  1K8K B;  3GG4 A;  3SQ4 A;  3L3U A;  3C6H A;  4K8X A;  1RNH A;  2KTQ A;  1W0H A;  4DTO A;  5EVZ A;  3CMA N;  4KH4 A;  3DI6 A;  1EWR A;  3VEW A;  5AJ3 K;  2F4V K;  1VQO N;  1VSD A;  4FLZ A;  3JS6 A;  2E2O A;  4DQ8 A;  3M1F A;  3OYE A;  3K5O A;  4HTU A;  3DJC A;  1GLC G;  3ZSX A;  3PSF A;  4H5W A;  4H5V A;  3SAG A;  4BR7 A;  3V1O A;  3CPE A;  4FOE A;  3F9M A;  3CM6 A;  4PUO A;  3WUH A;  4DTR A;  5FDL A;  4DTU A;  3O3F A;  2D0B A;  3ZSY A;  3DRP A;  2X6S A;  3ULD A;  1ZYQ A;  2GX9 A;  4OPK A;  1RCH A;  4KHY A;  3OA9 A;  4CF9 A;  3VGL A;  4KI6 A;  2GEL A;  4CES A;  3DLB A;  1JXE A;  2BUP A;  1N32 K;  5CE3 A; 
#chains in the Genus database with same CATH homology
 3EN9 A;  3GE1 A;  3CCE N;  3H46 O;  1YIT N;  3AAP A;  4H5T A;  5TKW A;  4E1J A;  1VQ5 N;  4BRF A;  2ZJR L;  4ISG A;  3RVC A;  3MDQ A;  4EIA A;  3H1V X;  4K41 A;  1S3X A;  3C7N A;  5GAG P;  1QHA A;  3HRG A;  1Q82 O;  3MN5 A;  5AQP A;  2E2N A;  3CC4 N;  5B8H A;  3TTC A;  3CCR N;  3VEN A;  3HM8 A;  3ZX2 A;  3D2F B;  2QXL A;  4H0Y B;  3ATV A;  3A5L C;  2ZJP L;  1ILY A;  4WFN L;  2D0P A;  3G6E N;  4JKG A;  4B1U B;  2CGL A;  4ILH A;  3U4L A;  2V7Z A;  1TYQ A;  4JK8 A;  2P9L B;  3A8Y A;  4IWV A;  1RFQ A;  1DGK N;  3SMP A;  4B1Y B;  4KBO A;  4BRD A;  3SAH A;  2AA4 A;  2NRR A;  3P38 A;  3MN6 A;  3GL1 A;  5LJW A;  3A5M C;  3KHY A;  4ILG B;  4OPH A;  4B1V A;  3VF6 A;  5I9E B;  2QW9 A;  3PIP L;  4ISE A;  4BRC A;  1W97 L;  3D2E B;  5AZJ B;  3E66 A;  3RSE B;  3R3L A;  1D4X A;  5GAH P;  4IEI A;  1NGB A;  4J8F A;  1ZXO A;  2GWK A;  5JLF A;  1QQO A;  3ZX0 A;  2QWN A;  4B1X B;  5HL7 L;  3DXM B;  3W0L A;  3HOT A;  4GV6 A;  1EO1 A;  3R6M A;  3SK3 A;  1GLJ O;  4H0X B;  5M1O A;  4WQ5 C;  2WFB A;  1RDW X;  2FF6 A;  5AQI A;  2P9I A;  3F5T A;  4CZL A;  2RE2 A;  4PL8 A;  1JCG A;  1C0F A;  1NGH A;  1SZ2 A;  1HKG A;  3CJ1 A;  4FWR A;  4DHY A;  3VF2 A;  3M6G A;  2YHX A;  4FO0 A;  1XUP O;  3NVM A;  3FFK B;  2GWJ A;  1QQN A;  3MWP A;  3CQY A;  4BRL A;  4DKW A;  5C12 A;  5AQS A;  4BC3 A;  3DLL L;  1ATN A;  3H6E A;  5AQL A;  4BR4 A;  5KPZ A;  3CJ9 A;  3PLA A;  3BF3 A;  4CZE A;  3VOV A;  3O9U A;  1VQ4 N;  1NGA A;  4JKD A;  2P9S B;  2YX6 A;  3FZM A;  3ZET B;  5ELZ A;  3VEV A;  2IVN A;  4FL9 A;  4JAX A;  2VGM A;  1JJ2 M;  2QI2 A;  3DWL A;  5BRH A;  4IJN A;  3DAW A;  4JHD B;  5EY4 A;  3O08 A;  3R1X A;  5F0X A;  4WYB A;  4MDB A;  2ZJQ L;  1K8K A;  4JK9 A;  4YOU A;  5BR9 A;  4A2B A;  4ILJ A;  3I56 N;  3OBW A;  4FWL A;  3DXK A;  4XEI A;  5BPN A;  1NGC A;  1WUA A;  5C2F A;  1M1K O;  5GAD P;  1MWM A;  1KAX A;  1YI2 N;  1KAZ A;  4GV3 A;  3FGU A;  4H0T B;  5GIN A;  3KZB A;  1T44 A;  4OO1 J;  4QS7 A;  3FZL A;  2P9U B;  2Q0R A;  3ZEU B;  3EO3 A;  3VET A;  1HJO A;  3T69 A;  1U6Z A;  1YVN A;  3MWT A;  5BRF A;  1NGG A;  3AGR A;  4CZM A;  3LM2 A;  5FPE A;  1V4T A;  4FWQ A;  3J7Z O;  3FZH A;  2WUS A;  2YJF A;  3QDK A;  1U2V B;  2P9K B;  4BY9 C;  3UE5 A;  2VWB A;  4GVE A;  2KKZ A;  2H3G X;  3M5R A;  3QML A;  4H0P A;  3NVK A;  1OKJ A;  1HLU A;  5BRE A;  3O9T A;  2YI1 A;  3O9S A;  3T7Z A;  1W2B M;  1QVG M;  2NRX A;  4ISF A;  5C0Y A;  3CCJ N;  1MDU B;  2P9N A;  3A0I X;  3CHW A;  4FWP A;  4NLB A;  3QB0 A;  1BUP A;  4WQ5 A;  4HWI A;  2CH6 A;  3VEX A;  3ULE B;  4HTL A;  1NGI A;  5AQK A;  1YF5 L;  4H0O A;  5AFU H;  5EX5 A;  3WT0 A;  1Q86 O;  2QWO A;  4BR0 A;  3MX2 A;  4BVP A;  4JN4 A;  5C2D A;  2Q97 A;  3EE8 A;  2HBM A;  2QTD A;  4I6M B;  4JD2 B;  1P90 A;  3TSP A;  2OTL N;  2NRZ A;  4YOR A;  1G99 A;  2CH5 A;  3EKS A;  4A5A A;  5BRD A;  5CR4 A;  2NRH A;  2V7Y A;  3VER A;  1IJJ A;  1YXQ A;  2Q0U A;  5AQF A;  2J4R A;  4DB3 A;  4CJ7 A;  1YJW N;  4EHU A;  2A42 A;  1T6C A;  3OHR A;  3LL3 A;  3CJB A;  3L6Q A;  3D2F A;  3LDO A;  3LDL A;  2HBL A;  3MN7 A;  1VQN N;  3O9R A;  2IVP A;  3FE1 A;  3WXJ A;  4H5N A;  4IO9 L;  1VQL N;  3CD6 N;  4PKH A;  4IZ9 A;  4LC9 B;  5E26 A;  4BR5 A;  1R59 O;  4EAH D;  2P9L A;  3FZK A;  2ITM A;  4YOX A;  1YAG A;  4XH1 A;  3N4P A;  3LDN A;  4QS9 A;  1RDU A;  3VGM A;  2CGJ A;  3KWI A;  4B1Z A;  4JKC A;  1QZ6 A;  2FSN A;  2GEM A;  2Q1N A;  3D2E A;  3ID6 A;  5AZJ A;  3RSE A;  3NMU A;  3SBT A;  2E1Y A;  2C1I A;  3O6W A;  2IVO A;  3DXM A;  1X9J A;  5C10 A;  5AFU A;  3AY9 A;  4IOC L;  1KD1 O;  4MLE A;  1Q7Y O;  2VCP A;  4BRO A;  2A6A A;  2JWK A;  3CCU N;  2E8A A;  3L4Q A;  5AQO A;  4NO7 A;  3L0Q A;  4CBU A;  1EQY A;  3KWG A;  2KLA A;  4O8U A;  3UKU A;  1QZ5 A;  4BEC A;  2HMP A;  2V52 B;  4FWN A;  4RTF D;  3TTD A;  1VQ8 N;  5H1S Q;  3HZ6 A;  2WBN A;  3CI5 A;  5KPR A;  1Q18 A;  2P9S A;  4KH5 A;  4MO5 A;  1GLL O;  3ZET A;  1S72 N;  5AQT A;  1J6Z A;  3ENB A;  3CC2 N;  4CZK A;  1X3M A;  5MLC Q;  3E1Y A;  2ZGZ A;  2E2P A;  3L4I A;  1JCF A;  4IFE A;  4JKA A;  5AZI B;  3WEE B;  3WQU A;  2NRV A;  2YHW A;  4M7X A;  3IFR A;  4A2A A;  1TUY A;  4C23 A;  3U9Z A;  1GLF O;  3LDP A;  2FSK A;  3Q7B A;  4YOW A;  4EFH A;  3IUC A;  5C15 A;  1MWK A;  3N4Q A;  3QIC A;  5AQV A;  1NMD A;  3QBX A;  2Q31 A;  3S41 A;  4A61 A;  2PAV A;  4IJA A;  4YOV A;  4CBX A;  4EHT A;  4H5R A;  1KQS M;  1MA9 B;  3J8A A;  3OBY A;  2D4W A;  1BG3 A;  3C6A A;  3ZEU A;  3IKM A;  3ENO A;  4IO8 A;  5HOO A;  3OW2 M;  3P39 A;  1NBW A;  2RHK A;  1OVY A;  2QWL A;  4MO4 A;  4BRG A;  2I7N A;  4H03 B;  1DT9 A;  2UYT A;  3CJA A;  2NZT A;  3QBW A;  4K25 A;  3D6R A;  1SS6 A;  4GV9 A;  4Z94 A;  1NLV A;  3FLC O;  4PL7 A;  4WQ4 C;  1BA0 A;  3EE9 A;  2IIR A;  3K9K A;  1U2V A;  2P9K A;  4F9O A;  3I33 A;  1VQ6 N;  3AAQ A;  5BPL A;  3BUZ B;  3O4W A;  5M1P A;  1KAY A;  1Y64 A;  3W3D A;  4Y0W A;  2HBJ A;  4B1W B;  3PIO L;  1ESV A;  2FXU A;  3CER A;  4C1N I;  5BN8 A;  3TSQ A;  4CD1 A;  2E1Z A;  3SBG A;  4A62 A;  5AQR A;  1NJI O;  5AQQ A;  5AQY A;  3CJ7 A;  4JKH A;  1ZC6 A;  4FPA A;  3ULE A;  2HOE A;  5FPD A;  2ASO A;  1S22 A;  1BWF O;  2YJE A;  2QM1 A;  3F2K A;  5M1F A;  2QWM A;  3H1Q A;  3UKR B;  4BC2 A;  4O5F A;  1ATS A;  4CZJ A;  4GNI A;  2HST A;  2HF3 A;  5KPT A;  2CGK A;  3U8X A;  3VMF B;  4BG9 A;  4FVU A;  4JKB A;  4FWK A;  1T6D A;  2QWP A;  3WXK A;  4IDH A;  4I6M A;  4GY2 B;  4JD2 A;  4BRQ A;  2A3Z A;  4AM6 A;  2NRW A;  4OPA A;  3CCL N;  5JLH A;  1ATR A;  2YCH A;  2AP1 A;  3R8E A;  4CD3 A;  4IOA L;  5KQD A;  3HI0 A;  4BRM A;  2OAN A;  1Z05 A;  4B9Q A;  2E20 A;  4K43 A;  2HF4 A;  4IOX A;  2E88 A;  3GDQ A;  3VTH A;  1VQP N;  2A41 A;  3JXU A;  3CCQ N;  1BOT O;  5AQU A;  3EZW A;  1HPM A;  3B8A X;  2FSJ A;  2HBK A;  3LM9 A;  3H3N O;  4JKE A;  1NGD A;  1RGI A;  3MX5 A;  5AQH A;  2I7P A;  4NB4 A;  3EL2 A;  5AQG A;  4BRA A;  3KK7 A;  5AQZ A;  3EKU A;  3O5B A;  3QFU A;  3SLC A;  3CC7 N;  3K9J A;  2P9P B;  4IXC A;  3SAF A;  4MLH A;  4BRI A;  4BRE A;  2QA4 N;  2A40 A;  2Q36 A;  4CZG A;  2GTD A;  3HSC A;  3O9Q A;  4FPB A;  2NRT A;  3VF4 A;  2BTF A;  4BEB A;  4BE7 B;  2NLX A;  1ZBS A;  2YHY A;  4BGA A;  1SAZ A;  4BVO A;  4U7B A;  3FZF A;  3IDH A;  3E9P A;  4BC5 A;  4RWT A;  4MDA A;  4JK7 A;  4BQL A;  3G71 N;  3G4S N;  3CPW M;  4WFA L;  5JVG L;  2NNW A;  4YDU A;  4BG8 A;  3ATU A;  5ADX H;  1GLE G;  1LOT B;  4WQ4 A;  2QEX N;  1H1V A;  2VGN A;  1BDG A;  2V51 B;  3BEX A;  3C7N B;  3H3O B;  5EOY A;  4RCH A;  4CZH A;  4FOI A;  1YJN N;  3VEZ A;  1NGE A;  4PKG A;  3BF1 A;  2PBD A;  1NWK A;  1HX1 A;  2OTJ N;  4FWM A;  4JKG B;  5E84 A;  3D7E O;  1TYQ B;  1VQM N;  5AZI A;  3Q7C A;  1P8Z A;  3WEE A;  5JVH L;  3GOI A;  1JCE A;  4CZI A;  5GIO A;  1WOQ A;  4PHT X;  5BN9 A;  2W40 A;  3MN9 A;  3VGK A;  4WCE L;  2JWL A;  2ASP A;  3C0B A;  4JHD A;  1VQK N;  4IEE A;  3P4I A;  2D0O A;  2DPN A;  2ZGY A;  4JNE A;  1BU6 O;  2A5X A;  2F9T A;  2Q2R A;  4JKF A;  1HKC A;  3VTI A;  2D1K A;  4M7Y A;  3CCV N;  3CCS N;  1YIJ N;  3M3Z A;  2W00 A;  1TUU A;  1VAZ A;  2GUP A;  5FPN A;  3IMX A;  3TU5 A;  1LCU A;  1XC3 A;  1Z6R A;  5M1Q A;  3TSU A;  1KC8 O;  3AAR A;  1M90 O;  3UKU B;  5AQX A;  4YOT A;  1NGF A;  3G25 A;  4C1N K;  5GAE P;  2P9I B;  5F1X A;  2FLO A;  3I8B A;  3U9D A;  4A59 A;  1HUX A;  1DKG D;  2F7T A;  1QVF M;  4XJX A;  4JEP A;  3ZX3 A;  4K42 A;  5AR0 A;  3HBT A;  5ADX A;  1XQS C;  2FF3 B;  2C1G A;  1IG8 A;  2P9U A;  3E9L A;  3CET A;  3CXC M;  1BO5 O;  3CCM N;  2BH1 A;  4L3Q A;  5TKY A;  5FPM A;  3A5N C;  4BRP A;  4FWO A;  3TPQ A;  3ID8 A;  3SMS A;  3WXM B;  1GLA G;  2ASM A;  1HKB A;  3LDQ A;  4QS8 A;  4YDU C;  4AF1 A;  3H45 C;  5LJV A;  1BA1 A;  2PFU A;  3R9P A;  5CHI A;  1K73 O;  4BQZ A;  4BRK A;  4U67 L;  3CJC A;  4CI6 A;  1V4S A;  3A5O C;  3C65 A;  3VPZ A;  2ZWH A;  1YHQ N;  1K8K B;  3MK6 A;  4BR9 A;  3CME N;  3GG4 A;  1T3V A;  1NGJ A;  1DEJ A;  2QWR A;  3AGK A;  5F2R A;  3C6H A;  4A5B A;  5M1K A;  3DXK B;  1C0G A;  3VEO A;  3O8M A;  4WFB L;  5EVZ A;  1NM1 A;  3UKR A;  4XH4 A;  3SJH A;  2QWQ A;  3CMA N;  4FSV A;  4M63 C;  3MCA B;  4KH4 A;  1K9M O;  1SQK A;  1GLD G;  5AQN A;  4YOY A;  3VEW A;  3MCP A;  4BR2 A;  5DM7 L;  1VQO N;  1QQM A;  3TTF A;  3FR0 A;  4XH5 A;  5BPM A;  5LY3 A;  4BC4 A;  2KHO A;  3JS6 A;  2F9W A;  4BRN A;  2E2O A;  3UB5 A;  4R79 A;  4DQ8 A;  4AM7 A;  3M1F A;  3O1W A;  3QFP A;  4H0V B;  4CZF A;  5GIP A;  3CF5 L;  4A57 A;  4O8K A;  2E2Q A;  1KXP A;  1K8A O;  1E4F T;  5KQ8 A;  1GLB G;  3CIP A;  3DJC A;  1GLC G;  3VES A;  3E9O A;  1CZA N;  4H5W A;  1YJ9 N;  2EWS A;  4KH6 A;  5AQM A;  1Q81 O;  4H5V A;  3SAG A;  4BR7 A;  3CPE A;  4FOE A;  3F9M A;  2VYP A;  5DM6 L;  3BP8 A;  3WUH A;  3I55 N;  1N8R O;  4UY8 O;  3ZYY X;  3WQT A;  5AQW A;  3VEY A;  3MMV A;  5AQJ A;  3HOS A;  3KVG A;  2P9N B;  4BGB A;  1YUW A;  2P9P A;  4WF9 L;  2W41 A;  4DCH A;  1X3N A;  2GX9 A;  3CQX A;  2ZF5 O;  4FWS A;  5M1N A;  1VQ9 N;  1O13 A;  3OA9 A;  4CBW A;  3VGL A;  2GEL A;  3HTV A;  3P31 A;  5JIC A;  4PKI A;  3WXI A;  5JMV A;  3ENH A;  4NLC A;  1VQ7 N;  4G9Z A;  3WXL A;  3GBT A;  2BUP A;  5EXW A;  2WC9 A;  4BRH A;  5CE3 A;  3O80 A;  1E4G T;  3O1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...