1TYQA

Crystal structure of arp2/3 complex with bound atp and calcium
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
417
structure length
399
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
molecule tags Structural protein
total genus 126
structure length 399
sequence length 417
ec nomenclature
pdb deposition date 2004-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1tyqA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1tyqA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1tyqA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1tyqA04
3IFRA 5AQSA 4JNEA 4B1WB 2QWLA 5AQXA 5AQJA 5AQNA 4CZIA 2QWPA 3A5LC 2FSKA 2E2QA 3EL2A 3F9MA 3VEWA 5I9EB 4ISGA 1BU6O 4CBUA 2QW9A 5AZJB 5E84A 4H5RA 4BRMA 1QZ5A 2P9SA 1BDGA 4NB4A 2EWSA 4J8FA 4H5NA 2D4WA 5BR9A 4K42A 4C23A 3WQUA 4AM6A 4CJ7A 4BRKA 3VEOA 2P9KA 3L4IA 1NGIA 3L0QA 3VERA 3HM8A 5ADXH 1NGCA 1X3NA 2Q36A 3ATUA 4JHDB 3WXLA 1Z6RA 2HF3A 3TPQA 4A61A 5TKYA 5EVZA 4FOEA 4BGBA 1NGBA 5BREA 1HKGA 4CZMA 3H6EA 2E1ZA 4RTFD 3UE5A 4BR7A 3EKUA 3LL3A 1BO5O 1DEJA 3D2EA 3FZKA 3EO3A 3CHWA 5FPDA 3I33A 1OKJA 2HF4A 2BTFA 1SZ2A 3O4WA 2E2PA 2PAVA 4GNIA 3MN6A 5F1XA 3VENA 2I7NA 4Y0WA 4FOIA 1QZ6A 1Q18A 2ITMA 3A8YA 4BRPA 3SJHA 3QICA 4K25A 3GE1A 5BN8A 3ZX2A 3O8MA 5KPTA 2A40A 2ZGZA 3AAPA 5FPNA 2UYTA 4CZEA 3GL1A 3QBXA 1RDWX 3S41A 3UB5A 4BRAA 2QWQA 4BRIA 5AZIA 4A2BA 3VPZA 4H0PA 4I6MA 2FF3B 5AFUA 2E2OA 3BF1A 3KHYA 4BRNA 4IO8A 1GLEG 3VGKA 1IJJA 3WEEB 4BC5A 1E4FT 1RGIA 1TUYA 3AY9A 4PL8A 1D4XA 2HMPA 3R9PA 2ASOA 3JXUA 5B8HA 4FWMA 3RSEA 3C0BA 1DKGD 3WT0A 4B1ZA 3CIPA 4B1XB 3CJBA 4XH4A 4A62A 3GG4A 1BWFO 2E88A 3UKRA 3WXIA 1R59O 5AQFA 3QFUA 5EX5A 2H3GX 3O5BA 3GDQA 1MDUB 1TYQA 2P9UA 5E26A 2GWKA 2YHYA 4BVOA 2ZGYA 4B9QA 3ZX3A 3EN9A 3A5OC 2IIRA 4DCHA 3M3ZA 1KAYA 3R8EA 3CJ7A 2I7PA 1NGHA 1TUUA 1X9JA 2P9NB 4XH1A 3VEVA 5AQHA 4FO0A 5F0XA 1KXPA 1NGAA 1QHAA 1WUAA 2CGLA 2VWBA 4MO4A 4PKIA 3BEXA 3BUZB 4BRFA 4CD3A 2V7ZA 3MMVA 1YXQA 3FFKB 3M6GA 2ASMA 3MK6A 4H0YB 5AZJA 4HWIA 1CZAN 1T44A 4BC4A 1LOTB 2Q1NA 4H0TB 4QS9A 1T6CA 4BREA 3VEXA 3LDQA 4IWVA 1NGGA 5BN9A 3HSCA 3H1QA 2Q0RA 4CZFA 3J8AA 1KAZA 3TU5A 3OHRA 4CBWA 2WUSA 5AQTA 2ZF5O 3BP8A 4JHDA 2E8AA 3ENOA 1ATRA 4RCHA 3H1VX 3IDHA 3QMLA 1Z05A 5ELZA 1ESVA 4EAHD 2YI1A 4FL9A 3VF4A 3U8XA 4M7YA 4WYBA 3O6WA 2E1YA 3CQXA 3KZBA 1P8ZA 1MA9B 1GLLO 3O1WA 5EY4A 1IG8A 4BVPA 2ASPA 1ATSA 1GLFO 1QQMA 3H3OB 3QFPA 2CGKA 4BQLA 5FPMA 3CJAA 4BROA 4DQ8A 2FLOA 5LY3A 3MN7A 4EFHA 4F9OA 2E20A 3VEZA 1S3XA 2V52B 4DHYA 1YVNA 4FWQA 3CJ9A 4HTLA 3LDOA 4H5TA 2YHWA 3R6MA 2AP1A 2P9PB 2IVPA 3VOVA 3LM2A 3ULEA 3FZMA 3UKUA 4IJNA 1NGJA 4NO7A 4EHUA 2A41A 2VCPA 2D1KA 1HLUA 2W41A 3WEEA 3IUCA 5AQUA 3WXKA 4FWPA 4CZJA 3SMSA 3ULEB 4BR5A 3HZ6A 3UKUB 5AQZA 3ATVA 4JD2B 4BQZA 1GLBG 3ID8A 3CI5A 4IZ9A 3C7NB 3P4IA 3ZEUB 1G99A 5AQWA 3ENHA 1GLCG 1ZXOA 2IVNA 2QWRA 3A0IX 4FWLA 3WQTA 2P9IB 4BRHA 5BRHA 3CERA 3QBWA 4WQ4C 5AFUH 2ZWHA 3KVGA 3MN9A 4K43A 4YDUC 3W0LA 5BPNA 4M63C 4CBXA 3D2FB 4B1UB 2A42A 1BA1A 2Q97A 4PKHA 2CGJA 2YJEA 3H46O 2P9LB 2GUPA 4QS7A 1NMDA 3MCPA 2AA4A 3O80A 3VEYA 2GELA 4B1YB 2W40A 4FSVA 2QM1A 4MLHA 1GLDG 4IXCA 4BR2A 1JCEA 4CZHA 1NGFA 4ISEA 3FZFA 2GWJA 2P9NA 4BG9A 1MWKA 2F9TA 1C0FA 4H5WA 3O1BA 2FXUA 3U9ZA 5AQKA 3DXKA 5AQIA 1YAGA 3FZLA 2DPNA 4M7XA 4Z94A 2QWNA 5AQRA 4BRQA 1NBWA 3DXKB 5LJVA 1U2VB 3IMXA 4BGAA 4PKGA 1JCGA 5KQDA 3M1FA 3AAQA 1RFQA 4WQ4A 3ZETB 3VGMA 2FSNA 2QXLA 3FZHA 1YUWA 3H45C 1LCUA 4YDUA 3DWLA 4BC3A 5F2RA 1QQNA 5AQLA 4BC2A 4BRGA 5JICA 4BG8A 1SAZA 4WQ5C 3VGLA 2Q2RA 4FWNA 1MWMA 4MO5A 2F9WA 4H03B 3WXJA 5KQ8A 1C0GA 1WOQA 3I8BA 4BR9A 4DB3A 4FWSA 2FSJA 3LDNA 1Y64A 4XEIA 1ZBSA 2GTDA 5AQOA 4FPAA 4XH5A 3A5NC 1HPMA 4CI6A 4FWRA 2A6AA 1SQKA 1S22A 3W3DA 2CH6A 1GLAG 4RWTA 2YCHA 5ADXA 1NM1A 4CD1A 4PL7A 2J4RA 1HKBA 3FE1A 3QDKA 4CZGA 3U9DA 2NZTA 3U4LA 2P9SB 1NGDA 1GLJO 5FPEA 1DGKN 2A3ZA 2E2NA 4AM7A 2PBDA 2P9PA 3CJCA 2NRHA 1V4SA 3EKSA 4LC9B 1HUXA 3LDPA 2YHXA 3D7EO 4MLEA 5JLHA 2P9KB 1K8KA 5AQVA 4A2AA 2CH5A 3MN5A 2BUPA 5AR0A 1NLVA 5KPZA 4JD2A 3HTVA 4WQ5A 3JS6A 4B1VA 3C7NA 4H0VB 4O8KA 3ZEUA 5BRDA 1K8KB 2IVOA 2P9IA 2YJFA 3SMPA 3D2EB 1XQSC 4IJAA 4EIAA 3L6QA 2VYPA 3DJCA 3CETA 2V51B 4O5FA 3DXMA 3FGUA 3D2FA 5AQQA 4ISFA 3VESA 4FPBA 3B8AX 3O08A 1J6ZA 1BA0A 1BG3A 5BPMA 1BUPA 3G25A 3GBTA 3EZWA 3CQYA 1JCFA 2P9LA 2FF6A 3DXMB 1ZC6A 1V4TA 1U6ZA 4H5VA 4BRCA 5BRFA 3HBTA 4QS8A 4CZLA 5AZIB 4I6MB 5AQPA 3VETA 3BF3A 1H1VA 4BR0A 1X3MA 3QB0A 1BOTO 3FR0A 1NWKA 5AQGA 5AQYA 3VF6A 2NLXA 1ATNA 3MDQA 2GEMA 1HX1A 3GOIA 4BRLA 2Q0UA 5AQMA 3CJ1A 3LM9A 1HKCA 1XC3A 1NGEA 5KPRA 1EQYA 5EOYA 4H0XB 5LJWA 3VF2A 3HI0A 1HJOA 3RSEB 5EXWA 5CE3A 4CZKA 3FLCO 1U2VA 3SLCA 2D0OA 3SK3A 2Q31A 2HOEA 4JN4A 3ZETA 4E1JA 3UKRB 1QQOA 2QWMA 2QWOA 4KBOA 1E4GT 4H0OA 5JMVA 4FWKA 2V7YA 4L3QA 4GY2B 3AARA 3H3NO 5BPLA 2D0PA 2OANA 2KHOA 4BRDA 1TYQB 2P9UB 3LDLA 4JAXA 3A5MC 5JLFA 1KAXA 3WUHA 1XUPO 4K41A 1T6DA 4EHTA 3ZX0A 4FWOA 2A5XA 3DAWA 4BR4A
chains in the Genus database with same CATH superfamily
3IFRA 3KLHA 3S3NA 1HMVA 3TWHA 1RBUA 4G1QA 4CZIA 2QWPA 1REVA 1QHTA 1WNSA 5E84A 4OKJA 1QZ5A 1RBVA 3F73A 4NB4A 2HHUA 1OH6A 3AVAA 4LF8K 3O4NA 1RT1A 5BR9A 5DMRA 4FW2A 2UU9K 1LW0A 4BRKA 1NMNA 1XI1A 2JWKA 3O9RA 3SUNA 1NGCA 3HP6A 4JHDB 4M42A 5TKYA 4LD0A 3G6EN 4FOEA 4BGBA 3NCIA 3ZYYX 4JI0K 3SUPA 2E1ZA 2KFZA 1JLQA 3D2EA 1FKOA 3R3LA 1SZ2A 2UXCK 3AA4A 3MN6A 1M1KO 3J7AP 1ZBUA 5F1XA 4AHUA 3UIQA 3GE1A 4X66K 1YF5L 4IFEA 4HTUA 3ALYA 2BDPA 2HVHA 1NNEA 4BRAA 4BRIA 3VPZA 1S9EA 1SKWA 4QCLA 5AFUA 3BF1A 4G9ZA 3TAFA 3ZLJA 4JI1K 3DLGA 5GIPA 3P31A 1RGIA 4OKKA 4WFAL 4O0IA 3EY1A 2O8CB 1JKHA 4RW7A 5B8HA 4FWMA 1VQPN 2W6LA 3CIPA 4OKEA 4XH4A 4JKAA 4A62A 3RMCA 4KRFA 4JI5K 4JKCA 1ASWA 3N4QA 3CMEN 3I0RA 3WXIA 1WN7A 1S1VA 3VQQA 1IKWA 3HOTA 4B9LA 5E26A 1BI4B 3TSQA 3NBPA 4BVOA 1UAXA 4FZYA 3EN9A 4AHTA 5M1FA 4F4KA 3OTOK 3M3ZA 1KAYA 4JI2K 4PQUA 1X9JA 3AVFA 4B3TK 5F0XA 2VWBA 3AO3A 3OYGA 2XY7A 2GUIA 3B6OA 4MO4A 4PKIA 3BEXA 4B08A 4IKFA 1C0MA 4BRFA 4ZTJA 3N4PA 2V7ZA 3SAHA 3IG1A 1S1UA 3FFKB 4JK8A 3SPYA 1ITGA 4H0YB 1FKPA 2PY5A 1VQON 4NXNK 1T44A 4BC4A 2Q1NA 3CFOA 1VAZA 1Q8IA 3JYTA 3LDQA 4OGEA 1J54A 4CGFA 4KTZA 2OA8A 1S1XA 3SBTA 1EXQA 3P83D 3SQ2A 2X6NA 4E0DA 2O8FB 3CD6N 5C0YA 3V1OA 3O9UA 1NK7A 1SKRA 3BP8A 4N47A 4KV8A 4ILGB 3QEVA 4HCCA 3M8PA 3P38A 3J7YP 5ELZA 1ESVA 5J2MA 2IAJA 4E7IA 1BHLA 3O6WA 3L2WA 2EX3A 4DV5K 3LDSA 3AA5X 3CQXA 1TL1A 5EY4A 4BVPA 4ZTFA 1ATSA 1ZBIA 1GLFO 1QQMA 3QFPA 2CGKA 5FPMA 3AO5A 5LY3A 2C1GA 4X65K 4WFBL 3MN7A 4EFHA 1NK6A 2NNWA 3OYKA 4JI3K 5CR4A 4FLWA 2RE2A 3KK7A 2AP1A 4OPJA 3PO4A 2GX9A 3FZMA 4IJNA 4I9LA 2VCPA 1HLUA 5AQUA 4BDPA 5C2DA 4NCBA 3HZ6A 1HPZA 4JD2B 4DR7K 4W5QA 2RKIA 3DI6A 3VTHA 3WQTA 1YIJN 1QSSA 3O3HA 3AVBA 3RMAA 4KB1A 2ATQA 1JLGA 1F21A 5GAEP 2WOMA 1N6QA 4RW8A 2ZWHA 3KVGA 4PA1A 2VG5A 5IT9O 4C8LA 4YDUC 4CBXA 1UA0A 1J5EK 2UXDK 4DG1A 2CGJA 4CF0A 4EP4A 2WFBA 2FC0A 4B3SK 1SV5A 2F4VK 1NMDA 4J2DA 4CJWA 2GELA 2W40A 2QM1A 4IXCA 4FYDA 4FK2A 3VA3A 1WSJA 2NRTA 4JKEA 4ISEA 1A5WA 3P1GA 3SV3A 4CJTA 4LFCK 3S5TA 4JKHA 2F9TA 1W7AA 4BY9C 1FW6A 3ENBA 1SKSA 1YAGA 2DPNA 5JS1A 4AQYK 4Z94A 3KKSA 3KWGA 3RMDA 2DFHA 4KPYA 1NBWA 1OVQA 5GINA 2JGUA 1U2VB 1TKTA 1Q7YO 3IMXA 4BGAA 3OYNA 5FROA 3M1FA 4Q5VA 1RFQA 4IOXA 2HHTA 4EP5A 3CCSN 3RRGA 4CGIA 1LCUA 4YDUA 3L3UA 2KZMA 3NVMA 4IBNA 5F2RA 4IG0A 1QQNA 3DMJA 4BC2A 1R0AA 1SAZA 4U7BA 2F9WA 3BDPA 4Z4IA 3WXJA 2HVIA 2BE2A 4YY3K 1WOQA 1K6YA 4CFCA 4FLXA 1J5OA 4H8KA 3ZT1A 3QINA 1J9AA 1ZBSA 2O8DB 3SUOA 4WF9L 2GTDA 4FWRA 4NXMK 1A5XA 1N5YA 4CD1A 5SWMA 4XIUA 3C6AA 5JENA 4CZGA 3U9DA 3J7ZO 2P9SB 1NGDA 3HXMA 3THVA 4KO0A 1GLJO 2HBLA 4MDAA 2E2NA 2YNGA 2P9PA 2IDOA 4OVLA 1HUXA 4M41A 2YHXA 3D7EO 3O9QA 1YITN 4B9TA 5AQVA 4A2AA 3F2KA 4KI6A 1NLVA 3HPOA 4B1VA 3C7NA 4CERA 3ZEUA 4HUEA 2P9IA 4OPHA 1DTQA 2YJFA 3MEDA 3OBWA 3SMPA 1XQSC 2VGNA 2VYPA 3DJCA 2HHIA 4FK4A 2O4GA 4O5FA 1QE1A 2YKMA 1BA0A 5BPMA 4CE9A 1RNHA 2A1RA 3GBTA 1NOZA 1KTQA 3NF9A 3LAKA 4YFUA 1T8EA 4BRCA 5BRFA 3QNOA 3HBTA 3BY5A 4CZLA 1YJNN 4N41A 4MFBA 4I6MB 5AQPA 2HNYA 4BR0A 2NRXA 1Z26A 4GMJB 2IC3A 5AQGA 4CJUA 3VQCA 3HSTB 5C42A 4BECA 5AQMA 4Z4CA 3K57A 4K8ZA 1KSPA 1QVFM 1D5AA 3KIOA 2QKKA 1HKCA 1Q9YA 1HNXK 1XC3A 1EQYA 4PUOA 1VSIA 3VF2A 4JRPA 1HJOA 5EXWA 3KLEA 1IH7A 3AVNA 4MDBA 2D0OA 5JVHL 4IFYA 4CESA 3QEPA 5KRTA 3ZETA 4DTXA 1IKYA 4H0OA 2X74A 3E66A 4L3QA 1RILA 4RW4A 1VK0A 5M1KA 3K5MA 2D0PA 4JKFA 2KHOA 3D0PA 2P9UB 3LDLA 3THYB 4JAXA 1KAXA 4B8AB 3WUHA 1XUPO 1OH8A 2HHSA 1S6PA 4K41A 4CEOA 1N33K 1ZBLA 4K8XA 5AQSA 1KVAA 2Y1IA 4B1WB 5AQNA 4EZ6A 1N36K 4CJFA 3EL2A 5C2FA 3QEWA 4GVEA 4KTWA 2P5OA 4ISGA 1BU6O 3K5OA 3CMAN 4IOAL 4J2EA 4LH5A 4JK7A 1W97L 4N76A 1TAUA 4BE2A 1VSFA 4H5NA 3LP0A 4NCAA 4LF6K 4K42A 3U3GA 3WNEA 1S1WA 2C1IA 5JVGL 4WFNL 3DM2A 1KLNA 1X3NA 3LPUA 1Z6RA 2HF3A 3IKMA 1HKGA 1YTUA 4DSKA 1Q86O 4DR5K 3EKUA 4F8RA 1BO5O 3EZ5A 3OYDA 3OJSA 3I33A 4RG8A 2OYQA 2VWJA 2I5JA 1LWEA 2DY4A 1QZ6A 2ITMA 3A8YA 4W5OA 3QICA 4KH6A 4CGDA 5BN8A 4JYAK 2OTJN 3O8MA 4CJKA 5KPTA 2A40A 3AVHA 2QTDA 3GL1A 3QBXA 4MQ3A 2KQ2A 5LMNK 4LH4A 5C10A 4BEBA 3CCUN 4ELVA 2E2OA 4DFKA 4DS5A 4IO8A 4GV9A 3WEEB 2OPQA 3EE8A 1A5VA 1E4FT 4O0JA 4DV6K 1TUYA 4ILHA 3HVTA 3ZSYA 4PL8A 4UY8O 3RRHA 3R9PA 1L3UA 3AO2A 3RSEA 3E1YA 3CPEA 4B1ZA 1M90O 1Y97A 1QS4A 4B1XB 3CJBA 2YHBA 5DK5A 3UKRA 3TARA 3K2PA 3QFUA 3LP2A 1X1PA 3LP1A 3LPTA 3M8SA 1MDUB 1WBDA 1TYQA 2NUBA 3PIOL 4B9QA 3O3FA 3ZX3A 3ISNC 2RN2A 3A5OC 2PFUA 3CC4N 2IIRA 4DCHA 5HP1A 3DLRA 4M3YA 3CJ7A 2I7PA 1NGHA 1TUUA 1DT9A 1KCFA 1S9GA 4JKGA 3TANA 4DQQA 4GKKK 1E3MA 2P9NB 1LAVA 1KXPA 1KVBA 1QHAA 1TL3A 1WUAA 4JKDA 4U67L 3JSMA 4W5TA 3SQ1A 4ELUA 1RT3A 4JV5K 3OYFA 3MK6A 4UQGA 1IO2A 1IKXA 4HWIA 2A1SA 3K5NA 3BGRA 3NMUA 3S3MA 1JLBA 1W0HA 4DTUA 4QS9A 1T6CA 4N56A 2X78A 4XJXA 5IWAK 3H1QA 4Q0BA 2Q0RA 1YI2N 1YJWN 4CF2A 4M3TA 1JXEA 1TK8A 1HYSA 5D3GA 3M8QA 4CBWA 3SZ2A 5AQTA 2AJQA 3L2QA 4JHDA 3ENOA 4JK9A 4E7LA 1O13A 4IDHA 4RCHA 3QIOA 1KRPA 3H1VX 3THXB 2Z1GA 3IDHA 1RTDA 4FM0A 3SBGA 3ZSXA 1WBBA 2WC9A 4OLAA 4M7YA 4O44A 4OGCA 2E1YA 4LF5K 2E4LA 1P8ZA 5FRNA 1IG8A 5C24A 2ASPA 5HOOA 3THWA 2HBKA 4A59A 1XWLA 1NK0A 5KI6A 4BQLA 4BROA 3CPWM 4F2SA 2HHVA 3SV4A 3THWB 2ZJQL 4F9OA 3VEZA 1BQNA 3KWIA 4FJNA 1S3XA 1YVNA 4HTLA 1HJRA 3CJ9A 2YHWA 3T3FA 4FJMA 2IVPA 3LM2A 3NE6A 4PWDA 1NGJA 4EHUA 3CCQN 2A41A 2D1KA 4CFBA 4FWPA 2FBVA 4CZJA 3MWTA 4YOVA 3RVCA 2O8CA 5GAGP 4IOCL 1KC8O 1GLBG 4IZ9A 1NK8A 1ZXOA 1VQ6N 4CEBA 1DLOA 3KD1E 1CZ9A 1VRUA 2G8HA 4WQ4C 3MN9A 4B9UA 4LFAK 1I39A 4K43A 4CIFA 3P39A 3OYBA 2G8KA 3D2FB 1XHZA 4DTSA 3SJJA 5J2NA 3VTIA 2A42A 1N8RO 4FM2A 5LL6Z 4M3WA 4PKHA 1Q82O 2YJEA 1RCHA 5M1OA 2GUPA 1BI4A 1RDBA 2D0CA 4GV6A 4CVNE 1UOCA 3A2FA 4MLHA 1L3VA 1HYZA 2YV0X 1NGFA 3FZFA 5JS2A 3TAQA 4CJRA 3VQ7A 4FZXC 3O3GA 1MWKA 3PUFA 3LZJA 3PV8A 3O1BA 2FXUA 3U9ZA 3K58A 3DXKA 5AQIA 4LF4K 3VQBA 3VN5A 2Z1JA 4M7XA 5AQRA 5C25A 4B3RK 1RDAA 2QA4N 3DXKB 2XY8A 2W00A 3HVRA 3NAEA 4CIEA 4KHWA 4AF1A 3AAQA 4WQ4A 3KKRA 3VGMA 1YUWA 3C94A 1D8YA 1QQCA 4OPAA 4C1NK 5HROA 2O8FA 1TAQA 2QK9A 3M5RA 4IO9L 4KH4A 3ZSRA 5AQLA 4BDZA 3EYZA 2Q2RA 5DM7L 2O8EA 2RHKA 1MWMA 3LALA 4H03B 4MO5A 3CFRA 5KQ8A 3T1HK 4DB3A 3TAPA 4FWSA 3LDNA 1Y64A 4LSLA 2O8EB 3G10A 5AQOA 4FPAA 3A5NC 4KH5A 1JXBA 1S6QA 1HQEA 3KJVA 2YNHA 4I2PA 1S22A 1RTJA 5KRSA 2YCHA 2DFFA 3JAMO 2DFEA 3TTDA 1TKZA 4DR6K 4J2AA 5KGXA 1ASUA 5FPEA 5HRRA 4JS5A 3AA3A 1V4SA 2IGIA 4YOYA 4FLTA 4LC9B 2GBZA 2NRZA 3LDPA 1VQKN 3PX4A 1XC9A 1U48A 2P9KB 4N5SA 3MN5A 4R5PA 3K59A 3ZT4A 4HCBA 1WSHA 4JD2A 3AV9A 3VQEA 3JS6A 1SUQA 3SAFA 4O8KA 4DUYK 5BRDA 4DLEA 4KI4A 3OBYA 4CCHA 4EIAA 3L6QA 4Z4EA 3CETA 5M1PA 3VQDA 3G71N 3DXMA 4E1NA 1Q9XA 5AQQA 1SL2A 4FPBA 3B8AX 3O08A 3ZSWA 1J6ZA 3MXIA 3J80O 3J81O 1OH5A 3DXMB 1ZC6A 4NYNA 3O4QA 3CM6A 4QS8A 5AZIB 4B9VA 4I9QA 5BR8K 3T69A 1X3MA 1BOTO 3DYAA 1C1CA 1NWKA 3QLHA 5AQYA 2NLXA 2O8BA 2GEMA 3GOIA 4BRLA 3TTFA 4B9MA 4CJVA 4CECA 4IFVA 1EWRA 2O8BB 1WSIA 5LJWA 3AGRA 3HI0A 1HNVA 2VGMA 1S1TA 4AHVA 3FLCO 1U2VA 3SLCA 2Q31A 4Z4GA 5FDLA 3AVKA 4JN4A 3ZT0A 4JLHA 2UUAK 1LAWA 2QWOA 3Q7BA 4FJXA 4FWKA 3DLLL 3O9SA 4FM1A 3AARA 1K9MO 3OYEA 1IG9A 2OANA 4KKOA 1NKCA 2QKBA 1G15A 3A5MC 1U04A 3G4SN 5CYMA 1OH7A 1SS6A 2GV9A 3ZX0A 2O8DA 4XH1A 4BR4A 3NH0A 4HVJA 1VSDA 4I2QA 4JNEA 3KLFA 3HJFA 2W6KA 5AQJA 4OLBA 5MLCQ 2EHGA 4KHSA 2E2QA 5I9EB 3VQ8A 4CBUA 1VSMA 2QW9A 5AZJB 4NCGA 4PY5A 4BRMA 5H1SQ 2P9SA 2KTQA 4NYFA 2EWSA 4GVMA 4J8FA 3ASMA 3CC2N 4HHTA 3V9UA 4C23A 3WQUA 4C8KA 4CJ7A 4CF9A 3VEOA 4C8MA 4JS4A 2Z1IA 3L0QA 4DFPA 1BISA 4CGJA 3WXLA 3TPQA 4A61A 4KREA 3VMFB 5BREA 1NGBA 1UA1A 2NRWA 4CZMA 3E9LA 1YJ9N 2UUCK 3RR8A 1YVUA 3H6EA 5TKWA 1RT4A 4RTFD 3UE5A 4CJLA 3LL3A 1HYVA 1OKJA 2BTFA 4GNIA 4E3SA 2PAVA 3VENA 1C0UA 1KLMA 4Y0WA 1IV0A 1BIZA 1NK4A 4BRPA 4ZHRA 1NJWA 3PX0A 1IBKK 2ZD1A 3PSIA 4KHPK 1RBTA 2ZJRL 5HRPA 2ZGZA 5FPNA 4CZEA 3QO9A 1RDWX 3UB5A 4DUZK 2QWQA 4DTMA 4CJPA 4QOZB 4I6MA 1JJ2M 3E9OA 1YTAA 4H4OA 5AJ3K 4BRNA 4FJLA 1NJYA 1X9WA 1IJJA 4OPKA 1JL2A 2O4IA 4H4MA 4DQPA 1Z25A 3AY9A 1N32K 5SZTA 1D4XA 1NU0A 2ASOA 3JXUA 2HNZA 3VQ4A 3HK2A 3AVIA 1DKGD 1U45A 4CJQA 3S3OA 2B6AA 1IBLK 1BWFO 2JLEA 5AQFA 4AILC 5EX5A 3O5BA 3PY8A 4KHNA 3GDQA 2P9UA 3F5TA 3THYA 2GWKA 2XRIA 3VQPA 2YHYA 1L5UA 2ZGYA 4DR2K 2WTUA 5T7BA 4ELTA 4CGHA 4W5NA 3R8EA 1JLAA 3MAQA 3VEVA 3NFAA 1W2BM 4W5RA 4FJ5A 4ICLA 4DWIA 4CD3A 2KKZA 1YXQA 3MX2A 3WNHA 4JEPA 1CZAN 2QI2A 1LOTB 3TAEA 1GOCA 1T03A 1BCMA 3VEXA 4DTPA 3V81A 1NGGA 5BN9A 3HSCA 4WCEL 1C0TA 2B4JA 2VQFK 3J8AA 1KAZA 4E19A 3CFPA 4AHRA 3OYAA 4GV3A 3TU5A 3OJUA 5HRSA 1XNRK 3CYMA 1XHXA 3VQ5A 3ZCMA 4DQRA 1DTTA 3CXCM 4M3RA 1ATRA 1OVYA 4CHYA 3Q7CA 4E7KA 4OJRA 4DV1K 3V9WA 2Y1JA 2VG7A 4EAHD 3VF4A 1U4BA 1CLQA 3U8XA 3BZCA 4C1NI 3WXMB 3O1WA 3KZBA 1GLLO 1MA9B 3I56N 1RT5A 4IDKA 5GADP 1NJXA 3NF7A 3H3OB 3SPZA 4YNQA 4DQ8A 5HL7L 5HBMA 4X64K 3KLIA 2F8SA 3ZSVA 4E7JA 3NF6A 4CHPA 4CF1A 1TK5A 4H5TA 3R6MA 3L4QA 1W9HA 2OZMA 3VOVA 3ZSQA 3ULEA 1NJZA 1L3SA 3UKUA 4FLVA 5FRMA 3AO4A 3VA0A 3WEEA 3HM9A 2E5LK 3IUCA 5GIOA 3DLEA 3ULEB 4BR5A 3CCRN 1VSHA 5AQZA 3UKUB 3ATVA 3U6FA 1FK9A 3P4IA 3D45A 3TAGA 3ENHA 1GLCG 1D9FA 4BRHA 4DR3K 4F3OA 3CM5A 3NF8A 3W0LA 4KTQA 4B1UB 4KHQA 3ID6A 1KFDA 1RDDA 2UXBK 3RWUA 3OVNA 2LSNA 3H46O 2P9LB 1LWCA 3PSFA 2YNFA 4QS7A 4IEEA 1NJIO 3VEYA 4B1YB 4A5BA 1XMQK 4CF8A 1JCEA 4CZHA 3VQ6A 1VQMN 2GWJA 2OPSA 4IEIA 4LFBK 2P9NA 4OX9K 1C6VA 3HRGA 1C0FA 3SAGA 2VWKA 4H5WA 3V9SA 1VSJA 5J1EA 2KW4A 3FZLA 3CG7A 4FJGA 2G8VA 5CYQA 2QWNA 4DV7K 2HW3A 4FLUA 3HPHA 1WAJA 3L3VA 3MEEA 4BRQA 3RTVA 5LJVA 3HP9A 4PKGA 1EKEA 1HRHA 4LF7K 4CHOA 3FZHA 4FZZA 4DR1K 5CHIA 3G0ZA 4E1MA 3IAYA 4BWJA 4BRGA 5JICA 3MXJA 3VQ9A 3VGLA 4FWNA 3OW2M 1JL1A 3RMBA 4E7HA 2E6MA 4DTOA 3MCAB 3I8BA 3THXA 3RR7A 4XEIA 4EZ9A 4CHZA 4CJEA 1UWBA 3DOKA 4L8RB 1KVCA 4JI8K 1B9DA 4RWTA 2CH6A 1NM1A 4PL7A 3QERA 1BIUA 3HPGA 1S72N 1HKBA 3FE1A 3QNNA 3U4LA 3OA9A 4K0KK 4JI7K 4AM7A 2PBDA 1BCOA 1P90A 1I94K 1C1BA 3DRRA 3SYZA 5JLHA 3E9PA 3LZIA 1NK9A 2P1JA 4DTRA 4DV3K 3O9TA 5KPZA 2UUBK 2FBTA 3HTVA 1C1AA 3CF5L 3K9KA 4O4GA 1RBRA 3LP3A 2IVOA 1VQ5N 2WBNA 5M1QA 3D2EB 3NDKA 4IJAA 3CCLN 4KHUA 1RT6A 4FW1A 1CXUA 2V51B 5K14A 1TGOA 3C6HA 2G8FA 3D2FA 3KLGA 4FJ7A 2D0BA 4J2BA 1BG3A 1BUPA 4DV2K 4FVUA 3EZWA 3CQYA 2WONA 3ZT3A 4DU3A 3I55N 1V4TA 3NVKA 4I7FA 3C65A 3D6RA 1H1VA 2VG6A 3L2RA 5C12A 4FVMA 3BZKA 4CHNA 2P5GA 4M45A 3MWPA 4KFBA 3OYMA 1ATNA 2P51A 1HX1A 2F7TA 4DFMA 3V1RA 3LANA 1XMOK 3OYLA 3LM9A 2D5RA 4H0XB 5HLFA 2RF2A 3AA2A 1VSLA 3LAMA 5CE3A 3FFIA 4CZKA 2HHHK 4RW9A 5C15A 3SK3A 2HOEA 2XY6A 4JKBA 1QQOA 2QWMA 3I8DA 4Y1CA 1RTIA 4DSJA 3H3NO 5BPLA 4BE1A 2ITGA 3V9ZA 3MX5A 1TKXA 4BRDA 1HNIA 4AH9A 5JLFA 3M8RA 2PYLA 1T3VA 4KB0A 4CJ5A 3S9HA 3B6PA 4YOXA 4C8OA 4A5AA 2KZZA 2A5XA 4B8CA 2KLAA 1QTMA 1VQ9N 2QWLA 2ETJA 5AQXA 3PIPL 3A5LC 1VHXA 1ILYA 2FSKA 3F9MA 3VEWA 4DSLA 3SI6A 1WLJA 3CCMN 1TK0A 1KQSM 4Y1DA 4H5RA 4O5BA 3KD5E 1D9DA 2ZJPL 1BDGA 2HHXA 4O8UA 1T05A 1KD1O 2OCEA 5A2QO 3DLBA 3ZSOA 4DR4K 2D4WA 3TI0A 4F3TA 3LWLA 4AM6A 5CZ1A 3TSPA 3V6DA 3V9XA 3E01A 4DLGA 2P9KA 3NGYA 3IRXA 1NGIA 3L4IA 5LMUK 3VERA 3SCXA 3HM8A 4AHSA 5ADXH 3SUQA 3ZSZA 4CK1A 3ATUA 2Q36A 4B3OA 5KGWA 3OYHA 5EVZA 1VSEA 3KK3A 3T1AA 4BR7A 3HO1A 1DEJA 3FZKA 1ZBHA 3EO3A 3CHWA 5FPDA 3I0SA 2HF4A 3O4WA 2QEXN 4CIGA 2E2PA 2I7NA 3AVMA 4FOIA 2PZSA 1Q18A 4DU1A 3SJHA 4CGGA 3CYGA 2QXFA 4K25A 2HHQA 2D0AA 1ZBFA 3ZX2A 5FLXO 3AAPA 3T7ZA 2UYTA 4NLBA 3S41A 3AVCA 2IOCA 5AZIA 4A2BA 3KK2A 4H0PA 2FF3B 4PHTX 1I3AA 3T19A 4CK3A 3VQAA 3NH1A 3KHYA 1GLEG 4TSXA 3VGKA 4BC5A 4CHQA 4DSIA 1VQ4N 4FLZA 3NHGA 4DV0K 1EX4A 2F96A 2HMPA 4DMNA 4E89A 4WE1A 2R7YA 3C0BA 3WT0A 4FJ9A 2OPPA 1GOBA 4FXDA 1X9SA 3SQ4A 3GG4A 2E88A 1R59O 1EO1A 5CZ2A 4OO1J 3IS9A 5I42A 2H3GX 1NKEA 2YNIA 3U3YA 1L3TA 2OZSA 1BQMA 4FCYA 4AHCA 1EWQA 4DSEA 4FJ8A 2B5JA 4NLCA 2BH1A 1VQ7N 2Z1HA 1U49A 5AQHA 3CCJN 4FO0A 1NGAA 2CGLA 3BUZB 3QETA 3MMVA 4QAGA 3K9JA 3CCEN 1IKVA 1NK5A 3M6GA 2ASMA 3HYFA 4B3MK 5AZJA 2JWLA 2NRRA 1VQNN 4H0TB 4BACA 2G8WA 4DV4K 4BREA 3OYCA 3MECA 5HRNA 4IWVA 4LY7A 2HB5A 4FJJA 2YHAA 4BDYA 2XHBA 4CZFA 1YHQN 3AVLA 3DOLA 4GW6A 4A57A 3OHRA 1IBMK 2WUSA 3C6TA 2ZF5O 4O55A 5CY4A 2E8AA 3OYIA 4CJSA 1HNZK 2X6SA 3QMLA 1Z05A 4JI4K 2YI1A 2YKNA 4FL9A 1VQ8N 4M3UA 3AVJA 3C6UA 3TAMA 3TR8A 4WYBA 4CFDA 1B92A 3KK1A 4LSNA 1LV5A 3QEIA 1CXQA 2HBJA 3TSUA 1X9MA 1N34K 1Q81O 1K8AO 1RT2A 1TKDA 5DM6L 2XO7A 1LWFA 3CJAA 3SNNA 2FLOA 2E20A 1NG9A 2V52B 4DHYA 4FWQA 3OY9A 3LDOA 3MXMA 1TV6A 1K73O 2PYJA 2HSTA 3ITHA 2G8IA 1RTHA 5EU7A 2P9PB 1RT7A 4IG3A 4CEDA 4HUFA 4DQIA 4CJ3A 4NO7A 3T1YK 5I3UA 2W41A 2F8TA 4CK2A 3WNFA 3WXKA 2DTUA 3SMSA 1ASVA 4DKWA 4BQZA 3ID8A 3CI5A 2BGGA 2E6LA 3C7NB 3ZEUB 1G99A 5AQWA 4E72A 3A0IX 2IVNA 2QWRA 4FWLA 5BRHA 2P9IB 3TTCA 3CERA 3QBWA 5J2QA 2YX6A 4BWMA 1QVGM 5AFUH 3HT3A 4CEFA 4YOWA 4BE0A 5BPNA 4M63C 4FLYA 4FK0A 3AGKA 1BA1A 2Q97A 3QIPA 1WAFA 3EE9A 4KAZA 1WB9A 3MCPA 4YHHK 3NGIA 2AA4A 3O80A 2ZM6K 4FSVA 5E41A 1GLDG 1KFSA 4BR2A 4HUGA 1JLFA 3QEXA 4DF4A 4R79A 4BG9A 3WNGA 2W42A 3MEGA 1SL1A 4CEEA 5M1NA 5AQKA 3OS2A 1HR0K 1FXXA 3ULDA 4ILJA 1RBSA 4YORA 3V4IA 4CW7B 4Z4HA 3LWMA 1JCGA 5KQDA 3V1QA 4CJ4A 1RDCA 3HOSA 3ZETB 4F2RA 2FSNA 2QXLA 3H45C 3K0SA 3DWLA 4BC3A 3L8BA 4LF9K 1TVRA 3PO5A 4JI6K 1T7PA 4B9SA 4BG8A 4WQ5C 1SL0A 1NOYA 5J2PA 4Z0UA 2XY5A 4DFJA 1QSYA 3CC7N 1C0GA 4BR9A 2FSJA 1XNQK 2FBXA 1VSKA 4RW6A 3AVGA 3HL8A 3PLAA 4XH5A 3PX6A 1HPMA 5GAHP 4CI6A 1GOAA 2A6AA 4DSFA 1SQKA 3DLKA 1O1WA 3F9KA 3W3DA 3CCVN 1GLAG 4DF8A 5ADXA 3DLHA 4FJHA 2FBYA 1B9FA 4C8NA 1BL3A 1EP4A 2J4RA 3KTQA 1MU2A 3QDKA 4BE7B 1BGXT 2NZTA 2G8UA 3CQ8A 2HHWA 3AO1A 1DGKN 2A3ZA 1VRTA 2Q3SA 1LW2A 1FJGK 3CJCA 2NRHA 4DU4A 2IS3A 2ZE2A 3EKSA 4FJKA 1VQLN 1HQUA 1WSGA 4CEQA 4MLEA 3OYJA 1RDUA 1K8KA 1J53A 2CH5A 2BUPA 5AR0A 4DTJA 2NRVA 4WQ5A 2ZQBA 3SQ0A 1CZBA 4H0VB 4CEZA 1K8KB 4X62K 4CFAA 3NGZA 3H08A 1S5JA 2OPRA 3DRPA 3DRSA 4M3ZA 3FGUA 4ISFA 3VESA 1JLEA 4ID1A 3G25A 3OS0A 4YOTA 1JCFA 2P9LA 2FF6A 3R1XA 1U6ZA 4H5VA 4B9NA 5KTQA 3EEQA 1QSLA 4Z4FA 3VETA 3C95A 3BF3A 3ZT2A 2RPIA 3QB0A 3FR0A 3P5JA 1HNWK 3VF6A 3MDQA 2Q0UA 3CJ1A 3OS1A 1ZYQA 4GKJK 1YT3A 4DTNA 2HBMA 1NGEA 5KPRA 5EOYA 4KHYA 2OTLN 3QESA 4YOUA 3RSEB 3L2VA 1EETA 4ID5A 2HNDA 4E1JA 3UKRB 4KBOA 1E4GT 5JMVA 4V19S 2V7YA 4GY2B 1JLCA 2BANA 4JRQA 2HMIA 3K5LA 1TYQB 4DS4A 4DQSA 3L2UA 1WSFA 1U47A 4FJIA 4M3XA 1T6DA 1WSEA 1NKBA 3NH2A 3TABA 4EHTA 4CEAA 2KFNA 4FWOA 3DAWA 4JKGB 2VQEK
chains in the Genus database with same CATH topology
1VQ9N 3IFRA 5AQSA 4JNEA 4B1WB 2QWLA 5AQXA 5AQJA 5AQNA 4CZIA 3PIPL 2QWPA 3A5LC 5MLCQ 1ILYA 5C2FA 2FSKA 2E2QA 3EL2A 3F9MA 4GVEA 3VEWA 5I9EB 4ISGA 1BU6O 4CBUA 2QW9A 3CMAN 5AZJB 3CCMN 1KQSM 4IOAL 5E84A 4H5RA 4BRMA 4YOVA 1QZ5A 5H1SQ 2ZJPL 2P9SA 1BDGA 1W97L 4JK7A 4NB4A 4O8UA 2EWSA 4J8FA 1KD1O 3CC2N 4H5NA 4BR4A 2D4WA 5BR9A 4K42A 4C23A 3WQUA 4AM6A 4CJ7A 4BRKA 3TSPA 2JWKA 3VEOA 2C1IA 2P9KA 5JVGL 3O9RA 4WFNL 3L4IA 1NGIA 3L0QA 3VERA 3HM8A 5ADXH 1NGCA 1X3NA 2Q36A 3ATUA 4JHDB 3WXLA 1Z6RA 2HF3A 3IKMA 3TPQA 5TKYA 3VMFB 5EVZA 4FOEA 4A61A 1NGBA 4BGBA 5BREA 1HKGA 3G6EN 2NRWA 4CZMA 3E9LA 3ZYYX 1YJ9N 3H6EA 5TKWA 1Q86O 2E1ZA 4RTFD 3UE5A 4BR7A 3EKUA 3LL3A 1BO5O 1DEJA 3D2EA 3FZKA 3EO3A 3CHWA 5FPDA 3I33A 3R3LA 1OKJA 2HF4A 2BTFA 1SZ2A 3O4WA 2E2PA 2PAVA 4GNIA 3MN6A 1M1KO 2QEXN 5F1XA 3VENA 2I7NA 4Y0WA 4FOIA 1QZ6A 1Q18A 2ITMA 3A8YA 4BRPA 3SJHA 3QICA 4K25A 3GE1A 4KH6A 5BN8A 3ZX2A 2OTJN 3O8MA 5KPTA 1YF5L 2ZJRL 2A40A 4IFEA 2QTDA 2ZGZA 3AAPA 5FPNA 2UYTA 4NLBA 3T7ZA 3GL1A 3QBXA 4CZEA 1RDWX 3S41A 3UB5A 4BRAA 2QWQA 4BRIA 5AZIA 4A2BA 3VPZA 4H0PA 4I6MA 1JJ2M 5C10A 2FF3B 5AFUA 3E9OA 4PHTX 4BEBA 3CCUN 2E2OA 3BF1A 4G9ZA 3KHYA 4BRNA 4IO8A 1GLEG 4GV9A 3VGKA 1IJJA 3EE8A 3WEEB 3P31A 1E4FT 4BC5A 5GIPA 1RGIA 1VQ4N 1TUYA 4ILHA 3AY9A 4PL8A 4WFAL 4UY8O 1D4XA 2HMPA 3R9PA 2ASOA 3JXUA 5B8HA 4FWMA 3RSEA 3C0BA 3E1YA 1DKGD 3WT0A 3CPEA 1VQPN 4B1ZA 1M90O 3CIPA 4B1XB 3CJBA 4XH4A 4JKAA 4A62A 3GG4A 4JKCA 1BWFO 3N4QA 2E88A 3UKRA 3CMEN 3WXIA 1R59O 1EO1A 5AQFA 3QFUA 4OO1J 5EX5A 2H3GX 3O5BA 3GDQA 1MDUB 3HOTA 1TYQA 2P9UA 3F5TA 5E26A 2GWKA 3PIOL 3TSQA 2YHYA 4BVOA 2ZGYA 4B9QA 3ZX3A 3EN9A 3A5OC 2PFUA 3CC4N 4NLCA 2IIRA 4DCHA 5M1FA 3M3ZA 1KAYA 3R8EA 2BH1A 3CJ7A 1VQ7N 2I7PA 1NGHA 1TUUA 1DT9A 4JKGA 1X9JA 2P9NB 4XH1A 3VEVA 5AQHA 1W2BM 3CCJN 4FO0A 5F0XA 1KXPA 1NGAA 1QHAA 1WUAA 2CGLA 2VWBA 4JKDA 4U67L 4MO4A 4PKIA 3BEXA 3BUZB 4BRFA 4CD3A 2KKZA 3N4PA 2V7ZA 3MMVA 3K9JA 1YXQA 3CCEN 3SAHA 4JK8A 3FFKB 3M6GA 2ASMA 3MX2A 3MK6A 4H0YB 5AZJA 2JWLA 4HWIA 4JEPA 1CZAN 1VQON 1T44A 2NRRA 4BC4A 2QI2A 1LOTB 2Q1NA 1VQNN 4H0TB 3NMUA 1VAZA 4QS9A 1T6CA 4BREA 3VEXA 3LDQA 4IWVA 1NGGA 5BN9A 4XJXA 3HSCA 3H1QA 4WCEL 2Q0RA 3SBTA 1YI2N 1YJWN 4CZFA 1YHQN 3J8AA 1KAZA 4A57A 3CD6N 4GV3A 5C0YA 3TU5A 3OHRA 4CBWA 2WUSA 3O9UA 5AQTA 2ZF5O 3BP8A 4JHDA 2E8AA 3ENOA 4JK9A 3CXCM 4ILGB 1ATRA 1O13A 1OVYA 4IDHA 4RCHA 3Q7CA 3H1VX 3P38A 3IDHA 3QMLA 1Z05A 5ELZA 1ESVA 3SBGA 2YI1A 4EAHD 2WC9A 4FL9A 3VF4A 1VQ8N 3U8XA 4M7YA 4WYBA 3O6WA 2E1YA 4C1NI 3WXMB 3CQXA 3KZBA 1P8ZA 1MA9B 1GLLO 3O1WA 2HBJA 1IG8A 5EY4A 3TSUA 4BVPA 2ASPA 5HOOA 3I56N 2HBKA 4A59A 1Q81O 1ATSA 5GADP 1GLFO 1K8AO 1QQMA 3H3OB 3QFPA 2CGKA 4BQLA 5FPMA 5DM6L 3CJAA 4BROA 4DQ8A 3CPWM 2FLOA 5HL7L 5LY3A 2C1GA 4WFBL 3MN7A 2ZJQL 4EFHA 4F9OA 2E20A 3VEZA 2NNWA 3KWIA 1S3XA 2V52B 5CR4A 4DHYA 1YVNA 4FWQA 3CJ9A 4HTLA 3LDOA 4H5TA 1K73O 2YHWA 2RE2A 2HSTA 3R6MA 3L4QA 3KK7A 2AP1A 2P9PB 2IVPA 3VOVA 3LM2A 3ULEA 2GX9A 3FZMA 3UKUA 4IJNA 1NGJA 4NO7A 4EHUA 3CCQN 2A41A 2VCPA 2D1KA 1HLUA 2W41A 3WEEA 3IUCA 5AQUA 3WXKA 4FWPA 4CZJA 3SMSA 5GIOA 3MWTA 5C2DA 3RVCA 3ULEB 4BR5A 3HZ6A 3UKUB 5AQZA 4DKWA 3ATVA 4JD2B 5GAGP 4BQZA 3CCRN 1GLBG 3ID8A 4IOCL 1KC8O 3CI5A 4IZ9A 3C7NB 3P4IA 3ZEUB 1G99A 5AQWA 3ENHA 1GLCG 1ZXOA 2IVNA 3A0IX 2QWRA 4FWLA 3VTHA 2P9IB 3TTCA 3WQTA 4BRHA 3CERA 5BRHA 1YIJN 3QBWA 2YX6A 4WQ4C 5GAEP 1QVGM 5AFUH 2ZWHA 3KVGA 3MN9A 4K43A 4YDUC 3W0LA 3P39A 5BPNA 4M63C 4YOWA 4CBXA 3D2FB 4B1UB 3ID6A 3AGKA 3VTIA 2A42A 1BA1A 1N8RO 2Q97A 4PKHA 2CGJA 1Q82O 2YJEA 2WFBA 3H46O 2P9LB 3EE9A 5M1OA 2GUPA 4QS7A 1NMDA 4IEEA 3MCPA 2AA4A 1NJIO 4GV6A 3O80A 3VEYA 2GELA 4B1YB 2W40A 4FSVA 2QM1A 4MLHA 1GLDG 4IXCA 4A5BA 1JCEA 4BR2A 2NRTA 4CZHA 4JKEA 1NGFA 4ISEA 3FZFA 1VQMN 2GWJA 4IEIA 4R79A 2P9NA 4BG9A 1MWKA 3HRGA 4JKHA 2F9TA 4BY9C 1C0FA 3SAGA 4H5WA 3O1BA 2FXUA 3ENBA 3U9ZA 5M1NA 5AQKA 3DXKA 5AQIA 1YAGA 3FZLA 2DPNA 4ILJA 4M7XA 4Z94A 2QWNA 5AQRA 3KWGA 4YORA 1VQ6N 4BRQA 1NBWA 5GINA 3DXKB 2QA4N 5LJVA 1U2VB 1Q7YO 3IMXA 4BGAA 2W00A 4PKGA 1JCGA 5KQDA 3M1FA 4AF1A 3AAQA 1RFQA 4IOXA 3HOSA 4WQ4A 3ZETB 3VGMA 2FSNA 2QXLA 3FZHA 1YUWA 3H45C 5CHIA 4OPAA 4C1NK 3CCSN 1LCUA 4YDUA 3DWLA 4BC3A 3M5RA 4IO9L 3NVMA 5F2RA 4KH4A 1QQNA 5AQLA 4BC2A 4BRGA 5JICA 4BG8A 1SAZA 4WQ5C 3VGLA 2Q2RA 5DM7L 4U7BA 4FWNA 2RHKA 1MWMA 4MO5A 2F9WA 4H03B 3OW2M 3WXJA 5KQ8A 3CC7N 1C0GA 1WOQA 3MCAB 3I8BA 4BR9A 4DB3A 4FWSA 2FSJA 3LDNA 1Y64A 4XEIA 1ZBSA 4WF9L 2GTDA 5AQOA 3PLAA 4FPAA 4XH5A 3A5NC 1HPMA 5GAHP 4KH5A 4CI6A 4FWRA 2A6AA 1SQKA 3CCVN 1S22A 3W3DA 2CH6A 1GLAG 4RWTA 2YCHA 5ADXA 1NM1A 4CD1A 4PL7A 3TTDA 2J4RA 1S72N 1HKBA 3C6AA 3FE1A 3QDKA 4BE7B 4CZGA 3U9DA 2NZTA 3U4LA 2P9SB 1NGDA 3J7ZO 3OA9A 1GLJO 5FPEA 1DGKN 2A3ZA 2HBLA 4MDAA 2E2NA 4AM7A 2PBDA 2P9PA 1P90A 3CJCA 2NRHA 1V4SA 3EKSA 4YOYA 4LC9B 2NRZA 1VQLN 1HUXA 3LDPA 1VQKN 2YHXA 3D7EO 4MLEA 5JLHA 3O9QA 2P9KB 3E9PA 1YITN 1RDUA 1K8KA 5AQVA 4A2AA 2CH5A 3F2KA 3MN5A 2BUPA 5AR0A 1NLVA 3O9TA 2NRVA 5KPZA 4JD2A 3HTVA 4WQ5A 3JS6A 3CF5L 3K9KA 4B1VA 3C7NA 4H0VB 4O8KA 3ZEUA 3SAFA 5BRDA 1K8KB 2IVOA 1VQ5N 2P9IA 3OBYA 4OPHA 2WBNA 2YJFA 3D2EB 3OBWA 5M1QA 3SMPA 1XQSC 2VGNA 4IJAA 4EIAA 3L6QA 3CCLN 2VYPA 3DJCA 3CETA 2V51B 5M1PA 3G71N 3C6HA 4O5FA 3DXMA 3FGUA 3D2FA 5AQQA 4ISFA 3VESA 4FPBA 3B8AX 3O08A 1J6ZA 1BA0A 1BG3A 5BPMA 1BUPA 3G25A 3GBTA 3EZWA 3CQYA 4FVUA 4YOTA 1JCFA 2P9LA 2FF6A 3R1XA 3DXMB 1ZC6A 3I55N 1V4TA 1U6ZA 3NVKA 4H5VA 4BRCA 5BRFA 3HBTA 4QS8A 4CZLA 1YJNN 5AZIB 4I6MB 5AQPA 3VETA 3T69A 3BF3A 3C65A 1H1VA 3D6RA 4BR0A 1X3MA 5C12A 2NRXA 3QB0A 1BOTO 3FR0A 1NWKA 3MWPA 5AQGA 5AQYA 3VF6A 2NLXA 1ATNA 3MDQA 2GEMA 1HX1A 4BECA 3GOIA 2F7TA 4BRLA 2Q0UA 5AQMA 3TTFA 3CJ1A 1QVFM 3LM9A 1HKCA 1XC3A 1NGEA 2HBMA 1EQYA 5EOYA 4H0XB 5KPRA 5LJWA 3VF2A 3AGRA 3HI0A 2OTLN 1HJOA 4YOUA 3RSEB 2VGMA 5EXWA 4CZKA 5CE3A 5C15A 3FLCO 1U2VA 4MDBA 3SLCA 2D0OA 3SK3A 2Q31A 5JVHL 2HOEA 4JN4A 4JKBA 3ZETA 4E1JA 3UKRB 1QQOA 2QWMA 2QWOA 3Q7BA 4KBOA 1E4GT 4H0OA 5JMVA 4FWKA 3DLLL 2V7YA 3E66A 4L3QA 3O9SA 4GY2B 3AARA 3H3NO 5BPLA 1K9MO 5M1KA 2D0PA 2OANA 3MX5A 4JKFA 2KHOA 4BRDA 1TYQB 2P9UB 3LDLA 4JAXA 3A5MC 5JLFA 1KAXA 1T3VA 3G4SN 3WUHA 1XUPO 4K41A 1SS6A 1T6DA 4YOXA 4A5AA 4EHTA 3ZX0A 4FWOA 2A5XA 3DAWA 4JKGB 2KLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFR A;  5AQS A;  4JNE A;  4B1W B;  2QWL A;  5AQX A;  5AQJ A;  5AQN A;  4CZI A;  2QWP A;  3A5L C;  2FSK A;  2E2Q A;  3EL2 A;  3F9M A;  3VEW A;  5I9E B;  4ISG A;  1BU6 O;  4CBU A;  2QW9 A;  5AZJ B;  5E84 A;  4H5R A;  4BRM A;  1QZ5 A;  2P9S A;  1BDG A;  4NB4 A;  2EWS A;  4J8F A;  4H5N A;  2D4W A;  5BR9 A;  4K42 A;  4C23 A;  3WQU A;  4AM6 A;  4CJ7 A;  4BRK A;  3VEO A;  2P9K A;  3L4I A;  1NGI A;  3L0Q A;  3VER A;  3HM8 A;  5ADX H;  1NGC A;  1X3N A;  2Q36 A;  3ATU A;  4JHD B;  3WXL A;  1Z6R A;  2HF3 A;  3TPQ A;  4A61 A;  5TKY A;  5EVZ A;  4FOE A;  4BGB A;  1NGB A;  5BRE A;  1HKG A;  4CZM A;  3H6E A;  2E1Z A;  4RTF D;  3UE5 A;  4BR7 A;  3EKU A;  3LL3 A;  1BO5 O;  1DEJ A;  3D2E A;  3FZK A;  3EO3 A;  3CHW A;  5FPD A;  3I33 A;  1OKJ A;  2HF4 A;  2BTF A;  1SZ2 A;  3O4W A;  2E2P A;  2PAV A;  4GNI A;  3MN6 A;  5F1X A;  3VEN A;  2I7N A;  4Y0W A;  4FOI A;  1QZ6 A;  1Q18 A;  2ITM A;  3A8Y A;  4BRP A;  3SJH A;  3QIC A;  4K25 A;  3GE1 A;  5BN8 A;  3ZX2 A;  3O8M A;  5KPT A;  2A40 A;  2ZGZ A;  3AAP A;  5FPN A;  2UYT A;  4CZE A;  3GL1 A;  3QBX A;  1RDW X;  3S41 A;  3UB5 A;  4BRA A;  2QWQ A;  4BRI A;  5AZI A;  4A2B A;  3VPZ A;  4H0P A;  4I6M A;  2FF3 B;  5AFU A;  2E2O A;  3BF1 A;  3KHY A;  4BRN A;  4IO8 A;  1GLE G;  3VGK A;  1IJJ A;  3WEE B;  4BC5 A;  1E4F T;  1RGI A;  1TUY A;  3AY9 A;  4PL8 A;  1D4X A;  2HMP A;  3R9P A;  2ASO A;  3JXU A;  5B8H A;  4FWM A;  3RSE A;  3C0B A;  1DKG D;  3WT0 A;  4B1Z A;  3CIP A;  4B1X B;  3CJB A;  4XH4 A;  4A62 A;  3GG4 A;  1BWF O;  2E88 A;  3UKR A;  3WXI A;  1R59 O;  5AQF A;  3QFU A;  5EX5 A;  2H3G X;  3O5B A;  3GDQ A;  1MDU B;  1TYQ A;  2P9U A;  5E26 A;  2GWK A;  2YHY A;  4BVO A;  2ZGY A;  4B9Q A;  3ZX3 A;  3EN9 A;  3A5O C;  2IIR A;  4DCH A;  3M3Z A;  1KAY A;  3R8E A;  3CJ7 A;  2I7P A;  1NGH A;  1TUU A;  1X9J A;  2P9N B;  4XH1 A;  3VEV A;  5AQH A;  4FO0 A;  5F0X A;  1KXP A;  1NGA A;  1QHA A;  1WUA A;  2CGL A;  2VWB A;  4MO4 A;  4PKI A;  3BEX A;  3BUZ B;  4BRF A;  4CD3 A;  2V7Z A;  3MMV A;  1YXQ A;  3FFK B;  3M6G A;  2ASM A;  3MK6 A;  4H0Y B;  5AZJ A;  4HWI A;  1CZA N;  1T44 A;  4BC4 A;  1LOT B;  2Q1N A;  4H0T B;  4QS9 A;  1T6C A;  4BRE A;  3VEX A;  3LDQ A;  4IWV A;  1NGG A;  5BN9 A;  3HSC A;  3H1Q A;  2Q0R A;  4CZF A;  3J8A A;  1KAZ A;  3TU5 A;  3OHR A;  4CBW A;  2WUS A;  5AQT A;  2ZF5 O;  3BP8 A;  4JHD A;  2E8A A;  3ENO A;  1ATR A;  4RCH A;  3H1V X;  3IDH A;  3QML A;  1Z05 A;  5ELZ A;  1ESV A;  4EAH D;  2YI1 A;  4FL9 A;  3VF4 A;  3U8X A;  4M7Y A;  4WYB A;  3O6W A;  2E1Y A;  3CQX A;  3KZB A;  1P8Z A;  1MA9 B;  1GLL O;  3O1W A;  5EY4 A;  1IG8 A;  4BVP A;  2ASP A;  1ATS A;  1GLF O;  1QQM A;  3H3O B;  3QFP A;  2CGK A;  4BQL A;  5FPM A;  3CJA A;  4BRO A;  4DQ8 A;  2FLO A;  5LY3 A;  3MN7 A;  4EFH A;  4F9O A;  2E20 A;  3VEZ A;  1S3X A;  2V52 B;  4DHY A;  1YVN A;  4FWQ A;  3CJ9 A;  4HTL A;  3LDO A;  4H5T A;  2YHW A;  3R6M A;  2AP1 A;  2P9P B;  2IVP A;  3VOV A;  3LM2 A;  3ULE A;  3FZM A;  3UKU A;  4IJN A;  1NGJ A;  4NO7 A;  4EHU A;  2A41 A;  2VCP A;  2D1K A;  1HLU A;  2W41 A;  3WEE A;  3IUC A;  5AQU A;  3WXK A;  4FWP A;  4CZJ A;  3SMS A;  3ULE B;  4BR5 A;  3HZ6 A;  3UKU B;  5AQZ A;  3ATV A;  4JD2 B;  4BQZ A;  1GLB G;  3ID8 A;  3CI5 A;  4IZ9 A;  3C7N B;  3P4I A;  3ZEU B;  1G99 A;  5AQW A;  3ENH A;  1GLC G;  1ZXO A;  2IVN A;  2QWR A;  3A0I X;  4FWL A;  3WQT A;  2P9I B;  4BRH A;  5BRH A;  3CER A;  3QBW A;  4WQ4 C;  5AFU H;  2ZWH A;  3KVG A;  3MN9 A;  4K43 A;  4YDU C;  3W0L A;  5BPN A;  4M63 C;  4CBX A;  3D2F B;  4B1U B;  2A42 A;  1BA1 A;  2Q97 A;  4PKH A;  2CGJ A;  2YJE A;  3H46 O;  2P9L B;  2GUP A;  4QS7 A;  1NMD A;  3MCP A;  2AA4 A;  3O80 A;  3VEY A;  2GEL A;  4B1Y B;  2W40 A;  4FSV A;  2QM1 A;  4MLH A;  1GLD G;  4IXC A;  4BR2 A;  1JCE A;  4CZH A;  1NGF A;  4ISE A;  3FZF A;  2GWJ A;  2P9N A;  4BG9 A;  1MWK A;  2F9T A;  1C0F A;  4H5W A;  3O1B A;  2FXU A;  3U9Z A;  5AQK A;  3DXK A;  5AQI A;  1YAG A;  3FZL A;  2DPN A;  4M7X A;  4Z94 A;  2QWN A;  5AQR A;  4BRQ A;  1NBW A;  3DXK B;  5LJV A;  1U2V B;  3IMX A;  4BGA A;  4PKG A;  1JCG A;  5KQD A;  3M1F A;  3AAQ A;  1RFQ A;  4WQ4 A;  3ZET B;  3VGM A;  2FSN A;  2QXL A;  3FZH A;  1YUW A;  3H45 C;  1LCU A;  4YDU A;  3DWL A;  4BC3 A;  5F2R A;  1QQN A;  5AQL A;  4BC2 A;  4BRG A;  5JIC A;  4BG8 A;  1SAZ A;  4WQ5 C;  3VGL A;  2Q2R A;  4FWN A;  1MWM A;  4MO5 A;  2F9W A;  4H03 B;  3WXJ A;  5KQ8 A;  1C0G A;  1WOQ A;  3I8B A;  4BR9 A;  4DB3 A;  4FWS A;  2FSJ A;  3LDN A;  1Y64 A;  4XEI A;  1ZBS A;  2GTD A;  5AQO A;  4FPA A;  4XH5 A;  3A5N C;  1HPM A;  4CI6 A;  4FWR A;  2A6A A;  1SQK A;  1S22 A;  3W3D A;  2CH6 A;  1GLA G;  4RWT A;  2YCH A;  5ADX A;  1NM1 A;  4CD1 A;  4PL7 A;  2J4R A;  1HKB A;  3FE1 A;  3QDK A;  4CZG A;  3U9D A;  2NZT A;  3U4L A;  2P9S B;  1NGD A;  1GLJ O;  5FPE A;  1DGK N;  2A3Z A;  2E2N A;  4AM7 A;  2PBD A;  2P9P A;  3CJC A;  2NRH A;  1V4S A;  3EKS A;  4LC9 B;  1HUX A;  3LDP A;  2YHX A;  3D7E O;  4MLE A;  5JLH A;  2P9K B;  1K8K A;  5AQV A;  4A2A A;  2CH5 A;  3MN5 A;  2BUP A;  5AR0 A;  1NLV A;  5KPZ A;  4JD2 A;  3HTV A;  4WQ5 A;  3JS6 A;  4B1V A;  3C7N A;  4H0V B;  4O8K A;  3ZEU A;  5BRD A;  1K8K B;  2IVO A;  2P9I A;  2YJF A;  3SMP A;  3D2E B;  1XQS C;  4IJA A;  4EIA A;  3L6Q A;  2VYP A;  3DJC A;  3CET A;  2V51 B;  4O5F A;  3DXM A;  3FGU A;  3D2F A;  5AQQ A;  4ISF A;  3VES A;  4FPB A;  3B8A X;  3O08 A;  1J6Z A;  1BA0 A;  1BG3 A;  5BPM A;  1BUP A;  3G25 A;  3GBT A;  3EZW A;  3CQY A;  1JCF A;  2P9L A;  2FF6 A;  3DXM B;  1ZC6 A;  1V4T A;  1U6Z A;  4H5V A;  4BRC A;  5BRF A;  3HBT A;  4QS8 A;  4CZL A;  5AZI B;  4I6M B;  5AQP A;  3VET A;  3BF3 A;  1H1V A;  4BR0 A;  1X3M A;  3QB0 A;  1BOT O;  3FR0 A;  1NWK A;  5AQG A;  5AQY A;  3VF6 A;  2NLX A;  1ATN A;  3MDQ A;  2GEM A;  1HX1 A;  3GOI A;  4BRL A;  2Q0U A;  5AQM A;  3CJ1 A;  3LM9 A;  1HKC A;  1XC3 A;  1NGE A;  5KPR A;  1EQY A;  5EOY A;  4H0X B;  5LJW A;  3VF2 A;  3HI0 A;  1HJO A;  3RSE B;  5EXW A;  5CE3 A;  4CZK A;  3FLC O;  1U2V A;  3SLC A;  2D0O A;  3SK3 A;  2Q31 A;  2HOE A;  4JN4 A;  3ZET A;  4E1J A;  3UKR B;  1QQO A;  2QWM A;  2QWO A;  4KBO A;  1E4G T;  4H0O A;  5JMV A;  4FWK A;  2V7Y A;  4L3Q A;  4GY2 B;  3AAR A;  3H3N O;  5BPL A;  2D0P A;  2OAN A;  2KHO A;  4BRD A;  1TYQ B;  2P9U B;  3LDL A;  4JAX A;  3A5M C;  5JLF A;  1KAX A;  3WUH A;  1XUP O;  4K41 A;  1T6D A;  4EHT A;  3ZX0 A;  4FWO A;  2A5X A;  3DAW A;  4BR4 A; 
#chains in the Genus database with same CATH topology
 3IFR A;  3KLH A;  3S3N A;  1HMV A;  3TWH A;  1RBU A;  4G1Q A;  4CZI A;  2QWP A;  1REV A;  1QHT A;  1WNS A;  5E84 A;  4OKJ A;  1QZ5 A;  1RBV A;  3F73 A;  4NB4 A;  2HHU A;  1OH6 A;  3AVA A;  4LF8 K;  3O4N A;  1RT1 A;  5BR9 A;  5DMR A;  4FW2 A;  2UU9 K;  1LW0 A;  4BRK A;  1NMN A;  1XI1 A;  2JWK A;  3O9R A;  3SUN A;  1NGC A;  3HP6 A;  4JHD B;  4M42 A;  5TKY A;  4LD0 A;  3G6E N;  4FOE A;  4BGB A;  3NCI A;  3ZYY X;  4JI0 K;  3SUP A;  2E1Z A;  2KFZ A;  1JLQ A;  3D2E A;  1FKO A;  3R3L A;  1SZ2 A;  2UXC K;  3AA4 A;  3MN6 A;  1M1K O;  3J7A P;  1ZBU A;  5F1X A;  4AHU A;  3UIQ A;  3GE1 A;  4X66 K;  1YF5 L;  4IFE A;  4HTU A;  3ALY A;  2BDP A;  2HVH A;  1NNE A;  4BRA A;  4BRI A;  3VPZ A;  1S9E A;  1SKW A;  4QCL A;  5AFU A;  3BF1 A;  4G9Z A;  3TAF A;  3ZLJ A;  4JI1 K;  3DLG A;  5GIP A;  3P31 A;  1RGI A;  4OKK A;  4WFA L;  4O0I A;  3EY1 A;  2O8C B;  1JKH A;  4RW7 A;  5B8H A;  4FWM A;  1VQP N;  2W6L A;  3CIP A;  4OKE A;  4XH4 A;  4JKA A;  4A62 A;  3RMC A;  4KRF A;  4JI5 K;  4JKC A;  1ASW A;  3N4Q A;  3CME N;  3I0R A;  3WXI A;  1WN7 A;  1S1V A;  3VQQ A;  1IKW A;  3HOT A;  4B9L A;  5E26 A;  1BI4 B;  3TSQ A;  3NBP A;  4BVO A;  1UAX A;  4FZY A;  3EN9 A;  4AHT A;  5M1F A;  4F4K A;  3OTO K;  3M3Z A;  1KAY A;  4JI2 K;  4PQU A;  1X9J A;  3AVF A;  4B3T K;  5F0X A;  2VWB A;  3AO3 A;  3OYG A;  2XY7 A;  2GUI A;  3B6O A;  4MO4 A;  4PKI A;  3BEX A;  4B08 A;  4IKF A;  1C0M A;  4BRF A;  4ZTJ A;  3N4P A;  2V7Z A;  3SAH A;  3IG1 A;  1S1U A;  3FFK B;  4JK8 A;  3SPY A;  1ITG A;  4H0Y B;  1FKP A;  2PY5 A;  1VQO N;  4NXN K;  1T44 A;  4BC4 A;  2Q1N A;  3CFO A;  1VAZ A;  1Q8I A;  3JYT A;  3LDQ A;  4OGE A;  1J54 A;  4CGF A;  4KTZ A;  2OA8 A;  1S1X A;  3SBT A;  1EXQ A;  3P83 D;  3SQ2 A;  2X6N A;  4E0D A;  2O8F B;  3CD6 N;  5C0Y A;  3V1O A;  3O9U A;  1NK7 A;  1SKR A;  3BP8 A;  4N47 A;  4KV8 A;  4ILG B;  3QEV A;  4HCC A;  3M8P A;  3P38 A;  3J7Y P;  5ELZ A;  1ESV A;  5J2M A;  2IAJ A;  4E7I A;  1BHL A;  3O6W A;  3L2W A;  2EX3 A;  4DV5 K;  3LDS A;  3AA5 X;  3CQX A;  1TL1 A;  5EY4 A;  4BVP A;  4ZTF A;  1ATS A;  1ZBI A;  1GLF O;  1QQM A;  3QFP A;  2CGK A;  5FPM A;  3AO5 A;  5LY3 A;  2C1G A;  4X65 K;  4WFB L;  3MN7 A;  4EFH A;  1NK6 A;  2NNW A;  3OYK A;  4JI3 K;  5CR4 A;  4FLW A;  2RE2 A;  3KK7 A;  2AP1 A;  4OPJ A;  3PO4 A;  2GX9 A;  3FZM A;  4IJN A;  4I9L A;  2VCP A;  1HLU A;  5AQU A;  4BDP A;  5C2D A;  4NCB A;  3HZ6 A;  1HPZ A;  4JD2 B;  4DR7 K;  4W5Q A;  2RKI A;  3DI6 A;  3VTH A;  3WQT A;  1YIJ N;  1QSS A;  3O3H A;  3AVB A;  3RMA A;  4KB1 A;  2ATQ A;  1JLG A;  1F21 A;  5GAE P;  2WOM A;  1N6Q A;  4RW8 A;  2ZWH A;  3KVG A;  4PA1 A;  2VG5 A;  5IT9 O;  4C8L A;  4YDU C;  4CBX A;  1UA0 A;  1J5E K;  2UXD K;  4DG1 A;  2CGJ A;  4CF0 A;  4EP4 A;  2WFB A;  2FC0 A;  4B3S K;  1SV5 A;  2F4V K;  1NMD A;  4J2D A;  4CJW A;  2GEL A;  2W40 A;  2QM1 A;  4IXC A;  4FYD A;  4FK2 A;  3VA3 A;  1WSJ A;  2NRT A;  4JKE A;  4ISE A;  1A5W A;  3P1G A;  3SV3 A;  4CJT A;  4LFC K;  3S5T A;  4JKH A;  2F9T A;  1W7A A;  4BY9 C;  1FW6 A;  3ENB A;  1SKS A;  1YAG A;  2DPN A;  5JS1 A;  4AQY K;  4Z94 A;  3KKS A;  3KWG A;  3RMD A;  2DFH A;  4KPY A;  1NBW A;  1OVQ A;  5GIN A;  2JGU A;  1U2V B;  1TKT A;  1Q7Y O;  3IMX A;  4BGA A;  3OYN A;  5FRO A;  3M1F A;  4Q5V A;  1RFQ A;  4IOX A;  2HHT A;  4EP5 A;  3CCS N;  3RRG A;  4CGI A;  1LCU A;  4YDU A;  3L3U A;  2KZM A;  3NVM A;  4IBN A;  5F2R A;  4IG0 A;  1QQN A;  3DMJ A;  4BC2 A;  1R0A A;  1SAZ A;  4U7B A;  2F9W A;  3BDP A;  4Z4I A;  3WXJ A;  2HVI A;  2BE2 A;  4YY3 K;  1WOQ A;  1K6Y A;  4CFC A;  4FLX A;  1J5O A;  4H8K A;  3ZT1 A;  3QIN A;  1J9A A;  1ZBS A;  2O8D B;  3SUO A;  4WF9 L;  2GTD A;  4FWR A;  4NXM K;  1A5X A;  1N5Y A;  4CD1 A;  5SWM A;  4XIU A;  3C6A A;  5JEN A;  4CZG A;  3U9D A;  3J7Z O;  2P9S B;  1NGD A;  3HXM A;  3THV A;  4KO0 A;  1GLJ O;  2HBL A;  4MDA A;  2E2N A;  2YNG A;  2P9P A;  2IDO A;  4OVL A;  1HUX A;  4M41 A;  2YHX A;  3D7E O;  3O9Q A;  1YIT N;  4B9T A;  5AQV A;  4A2A A;  3F2K A;  4KI6 A;  1NLV A;  3HPO A;  4B1V A;  3C7N A;  4CER A;  3ZEU A;  4HUE A;  2P9I A;  4OPH A;  1DTQ A;  2YJF A;  3MED A;  3OBW A;  3SMP A;  1XQS C;  2VGN A;  2VYP A;  3DJC A;  2HHI A;  4FK4 A;  2O4G A;  4O5F A;  1QE1 A;  2YKM A;  1BA0 A;  5BPM A;  4CE9 A;  1RNH A;  2A1R A;  3GBT A;  1NOZ A;  1KTQ A;  3NF9 A;  3LAK A;  4YFU A;  1T8E A;  4BRC A;  5BRF A;  3QNO A;  3HBT A;  3BY5 A;  4CZL A;  1YJN N;  4N41 A;  4MFB A;  4I6M B;  5AQP A;  2HNY A;  4BR0 A;  2NRX A;  1Z26 A;  4GMJ B;  2IC3 A;  5AQG A;  4CJU A;  3VQC A;  3HST B;  5C42 A;  4BEC A;  5AQM A;  4Z4C A;  3K57 A;  4K8Z A;  1KSP A;  1QVF M;  1D5A A;  3KIO A;  2QKK A;  1HKC A;  1Q9Y A;  1HNX K;  1XC3 A;  1EQY A;  4PUO A;  1VSI A;  3VF2 A;  4JRP A;  1HJO A;  5EXW A;  3KLE A;  1IH7 A;  3AVN A;  4MDB A;  2D0O A;  5JVH L;  4IFY A;  4CES A;  3QEP A;  5KRT A;  3ZET A;  4DTX A;  1IKY A;  4H0O A;  2X74 A;  3E66 A;  4L3Q A;  1RIL A;  4RW4 A;  1VK0 A;  5M1K A;  3K5M A;  2D0P A;  4JKF A;  2KHO A;  3D0P A;  2P9U B;  3LDL A;  3THY B;  4JAX A;  1KAX A;  4B8A B;  3WUH A;  1XUP O;  1OH8 A;  2HHS A;  1S6P A;  4K41 A;  4CEO A;  1N33 K;  1ZBL A;  4K8X A;  5AQS A;  1KVA A;  2Y1I A;  4B1W B;  5AQN A;  4EZ6 A;  1N36 K;  4CJF A;  3EL2 A;  5C2F A;  3QEW A;  4GVE A;  4KTW A;  2P5O A;  4ISG A;  1BU6 O;  3K5O A;  3CMA N;  4IOA L;  4J2E A;  4LH5 A;  4JK7 A;  1W97 L;  4N76 A;  1TAU A;  4BE2 A;  1VSF A;  4H5N A;  3LP0 A;  4NCA A;  4LF6 K;  4K42 A;  3U3G A;  3WNE A;  1S1W A;  2C1I A;  5JVG L;  4WFN L;  3DM2 A;  1KLN A;  1X3N A;  3LPU A;  1Z6R A;  2HF3 A;  3IKM A;  1HKG A;  1YTU A;  4DSK A;  1Q86 O;  4DR5 K;  3EKU A;  4F8R A;  1BO5 O;  3EZ5 A;  3OYD A;  3OJS A;  3I33 A;  4RG8 A;  2OYQ A;  2VWJ A;  2I5J A;  1LWE A;  2DY4 A;  1QZ6 A;  2ITM A;  3A8Y A;  4W5O A;  3QIC A;  4KH6 A;  4CGD A;  5BN8 A;  4JYA K;  2OTJ N;  3O8M A;  4CJK A;  5KPT A;  2A40 A;  3AVH A;  2QTD A;  3GL1 A;  3QBX A;  4MQ3 A;  2KQ2 A;  5LMN K;  4LH4 A;  5C10 A;  4BEB A;  3CCU N;  4ELV A;  2E2O A;  4DFK A;  4DS5 A;  4IO8 A;  4GV9 A;  3WEE B;  2OPQ A;  3EE8 A;  1A5V A;  1E4F T;  4O0J A;  4DV6 K;  1TUY A;  4ILH A;  3HVT A;  3ZSY A;  4PL8 A;  4UY8 O;  3RRH A;  3R9P A;  1L3U A;  3AO2 A;  3RSE A;  3E1Y A;  3CPE A;  4B1Z A;  1M90 O;  1Y97 A;  1QS4 A;  4B1X B;  3CJB A;  2YHB A;  5DK5 A;  3UKR A;  3TAR A;  3K2P A;  3QFU A;  3LP2 A;  1X1P A;  3LP1 A;  3LPT A;  3M8S A;  1MDU B;  1WBD A;  1TYQ A;  2NUB A;  3PIO L;  4B9Q A;  3O3F A;  3ZX3 A;  3ISN C;  2RN2 A;  3A5O C;  2PFU A;  3CC4 N;  2IIR A;  4DCH A;  5HP1 A;  3DLR A;  4M3Y A;  3CJ7 A;  2I7P A;  1NGH A;  1TUU A;  1DT9 A;  1KCF A;  1S9G A;  4JKG A;  3TAN A;  4DQQ A;  4GKK K;  1E3M A;  2P9N B;  1LAV A;  1KXP A;  1KVB A;  1QHA A;  1TL3 A;  1WUA A;  4JKD A;  4U67 L;  3JSM A;  4W5T A;  3SQ1 A;  4ELU A;  1RT3 A;  4JV5 K;  3OYF A;  3MK6 A;  4UQG A;  1IO2 A;  1IKX A;  4HWI A;  2A1S A;  3K5N A;  3BGR A;  3NMU A;  3S3M A;  1JLB A;  1W0H A;  4DTU A;  4QS9 A;  1T6C A;  4N56 A;  2X78 A;  4XJX A;  5IWA K;  3H1Q A;  4Q0B A;  2Q0R A;  1YI2 N;  1YJW N;  4CF2 A;  4M3T A;  1JXE A;  1TK8 A;  1HYS A;  5D3G A;  3M8Q A;  4CBW A;  3SZ2 A;  5AQT A;  2AJQ A;  3L2Q A;  4JHD A;  3ENO A;  4JK9 A;  4E7L A;  1O13 A;  4IDH A;  4RCH A;  3QIO A;  1KRP A;  3H1V X;  3THX B;  2Z1G A;  3IDH A;  1RTD A;  4FM0 A;  3SBG A;  3ZSX A;  1WBB A;  2WC9 A;  4OLA A;  4M7Y A;  4O44 A;  4OGC A;  2E1Y A;  4LF5 K;  2E4L A;  1P8Z A;  5FRN A;  1IG8 A;  5C24 A;  2ASP A;  5HOO A;  3THW A;  2HBK A;  4A59 A;  1XWL A;  1NK0 A;  5KI6 A;  4BQL A;  4BRO A;  3CPW M;  4F2S A;  2HHV A;  3SV4 A;  3THW B;  2ZJQ L;  4F9O A;  3VEZ A;  1BQN A;  3KWI A;  4FJN A;  1S3X A;  1YVN A;  4HTL A;  1HJR A;  3CJ9 A;  2YHW A;  3T3F A;  4FJM A;  2IVP A;  3LM2 A;  3NE6 A;  4PWD A;  1NGJ A;  4EHU A;  3CCQ N;  2A41 A;  2D1K A;  4CFB A;  4FWP A;  2FBV A;  4CZJ A;  3MWT A;  4YOV A;  3RVC A;  2O8C A;  5GAG P;  4IOC L;  1KC8 O;  1GLB G;  4IZ9 A;  1NK8 A;  1ZXO A;  1VQ6 N;  4CEB A;  1DLO A;  3KD1 E;  1CZ9 A;  1VRU A;  2G8H A;  4WQ4 C;  3MN9 A;  4B9U A;  4LFA K;  1I39 A;  4K43 A;  4CIF A;  3P39 A;  3OYB A;  2G8K A;  3D2F B;  1XHZ A;  4DTS A;  3SJJ A;  5J2N A;  3VTI A;  2A42 A;  1N8R O;  4FM2 A;  5LL6 Z;  4M3W A;  4PKH A;  1Q82 O;  2YJE A;  1RCH A;  5M1O A;  2GUP A;  1BI4 A;  1RDB A;  2D0C A;  4GV6 A;  4CVN E;  1UOC A;  3A2F A;  4MLH A;  1L3V A;  1HYZ A;  2YV0 X;  1NGF A;  3FZF A;  5JS2 A;  3TAQ A;  4CJR A;  3VQ7 A;  4FZX C;  3O3G A;  1MWK A;  3PUF A;  3LZJ A;  3PV8 A;  3O1B A;  2FXU A;  3U9Z A;  3K58 A;  3DXK A;  5AQI A;  4LF4 K;  3VQB A;  3VN5 A;  2Z1J A;  4M7X A;  5AQR A;  5C25 A;  4B3R K;  1RDA A;  2QA4 N;  3DXK B;  2XY8 A;  2W00 A;  3HVR A;  3NAE A;  4CIE A;  4KHW A;  4AF1 A;  3AAQ A;  4WQ4 A;  3KKR A;  3VGM A;  1YUW A;  3C94 A;  1D8Y A;  1QQC A;  4OPA A;  4C1N K;  5HRO A;  2O8F A;  1TAQ A;  2QK9 A;  3M5R A;  4IO9 L;  4KH4 A;  3ZSR A;  5AQL A;  4BDZ A;  3EYZ A;  2Q2R A;  5DM7 L;  2O8E A;  2RHK A;  1MWM A;  3LAL A;  4H03 B;  4MO5 A;  3CFR A;  5KQ8 A;  3T1H K;  4DB3 A;  3TAP A;  4FWS A;  3LDN A;  1Y64 A;  4LSL A;  2O8E B;  3G10 A;  5AQO A;  4FPA A;  3A5N C;  4KH5 A;  1JXB A;  1S6Q A;  1HQE A;  3KJV A;  2YNH A;  4I2P A;  1S22 A;  1RTJ A;  5KRS A;  2YCH A;  2DFF A;  3JAM O;  2DFE A;  3TTD A;  1TKZ A;  4DR6 K;  4J2A A;  5KGX A;  1ASU A;  5FPE A;  5HRR A;  4JS5 A;  3AA3 A;  1V4S A;  2IGI A;  4YOY A;  4FLT A;  4LC9 B;  2GBZ A;  2NRZ A;  3LDP A;  1VQK N;  3PX4 A;  1XC9 A;  1U48 A;  2P9K B;  4N5S A;  3MN5 A;  4R5P A;  3K59 A;  3ZT4 A;  4HCB A;  1WSH A;  4JD2 A;  3AV9 A;  3VQE A;  3JS6 A;  1SUQ A;  3SAF A;  4O8K A;  4DUY K;  5BRD A;  4DLE A;  4KI4 A;  3OBY A;  4CCH A;  4EIA A;  3L6Q A;  4Z4E A;  3CET A;  5M1P A;  3VQD A;  3G71 N;  3DXM A;  4E1N A;  1Q9X A;  5AQQ A;  1SL2 A;  4FPB A;  3B8A X;  3O08 A;  3ZSW A;  1J6Z A;  3MXI A;  3J80 O;  3J81 O;  1OH5 A;  3DXM B;  1ZC6 A;  4NYN A;  3O4Q A;  3CM6 A;  4QS8 A;  5AZI B;  4B9V A;  4I9Q A;  5BR8 K;  3T69 A;  1X3M A;  1BOT O;  3DYA A;  1C1C A;  1NWK A;  3QLH A;  5AQY A;  2NLX A;  2O8B A;  2GEM A;  3GOI A;  4BRL A;  3TTF A;  4B9M A;  4CJV A;  4CEC A;  4IFV A;  1EWR A;  2O8B B;  1WSI A;  5LJW A;  3AGR A;  3HI0 A;  1HNV A;  2VGM A;  1S1T A;  4AHV A;  3FLC O;  1U2V A;  3SLC A;  2Q31 A;  4Z4G A;  5FDL A;  3AVK A;  4JN4 A;  3ZT0 A;  4JLH A;  2UUA K;  1LAW A;  2QWO A;  3Q7B A;  4FJX A;  4FWK A;  3DLL L;  3O9S A;  4FM1 A;  3AAR A;  1K9M O;  3OYE A;  1IG9 A;  2OAN A;  4KKO A;  1NKC A;  2QKB A;  1G15 A;  3A5M C;  1U04 A;  3G4S N;  5CYM A;  1OH7 A;  1SS6 A;  2GV9 A;  3ZX0 A;  2O8D A;  4XH1 A;  4BR4 A;  3NH0 A;  4HVJ A;  1VSD A;  4I2Q A;  4JNE A;  3KLF A;  3HJF A;  2W6K A;  5AQJ A;  4OLB A;  5MLC Q;  2EHG A;  4KHS A;  2E2Q A;  5I9E B;  3VQ8 A;  4CBU A;  1VSM A;  2QW9 A;  5AZJ B;  4NCG A;  4PY5 A;  4BRM A;  5H1S Q;  2P9S A;  2KTQ A;  4NYF A;  2EWS A;  4GVM A;  4J8F A;  3ASM A;  3CC2 N;  4HHT A;  3V9U A;  4C23 A;  3WQU A;  4C8K A;  4CJ7 A;  4CF9 A;  3VEO A;  4C8M A;  4JS4 A;  2Z1I A;  3L0Q A;  4DFP A;  1BIS A;  4CGJ A;  3WXL A;  3TPQ A;  4A61 A;  4KRE A;  3VMF B;  5BRE A;  1NGB A;  1UA1 A;  2NRW A;  4CZM A;  3E9L A;  1YJ9 N;  2UUC K;  3RR8 A;  1YVU A;  3H6E A;  5TKW A;  1RT4 A;  4RTF D;  3UE5 A;  4CJL A;  3LL3 A;  1HYV A;  1OKJ A;  2BTF A;  4GNI A;  4E3S A;  2PAV A;  3VEN A;  1C0U A;  1KLM A;  4Y0W A;  1IV0 A;  1BIZ A;  1NK4 A;  4BRP A;  4ZHR A;  1NJW A;  3PX0 A;  1IBK K;  2ZD1 A;  3PSI A;  4KHP K;  1RBT A;  2ZJR L;  5HRP A;  2ZGZ A;  5FPN A;  4CZE A;  3QO9 A;  1RDW X;  3UB5 A;  4DUZ K;  2QWQ A;  4DTM A;  4CJP A;  4QOZ B;  4I6M A;  1JJ2 M;  3E9O A;  1YTA A;  4H4O A;  5AJ3 K;  4BRN A;  4FJL A;  1NJY A;  1X9W A;  1IJJ A;  4OPK A;  1JL2 A;  2O4I A;  4H4M A;  4DQP A;  1Z25 A;  3AY9 A;  1N32 K;  5SZT A;  1D4X A;  1NU0 A;  2ASO A;  3JXU A;  2HNZ A;  3VQ4 A;  3HK2 A;  3AVI A;  1DKG D;  1U45 A;  4CJQ A;  3S3O A;  2B6A A;  1IBL K;  1BWF O;  2JLE A;  5AQF A;  4AIL C;  5EX5 A;  3O5B A;  3PY8 A;  4KHN A;  3GDQ A;  2P9U A;  3F5T A;  3THY A;  2GWK A;  2XRI A;  3VQP A;  2YHY A;  1L5U A;  2ZGY A;  4DR2 K;  2WTU A;  5T7B A;  4ELT A;  4CGH A;  4W5N A;  3R8E A;  1JLA A;  3MAQ A;  3VEV A;  3NFA A;  1W2B M;  4W5R A;  4FJ5 A;  4ICL A;  4DWI A;  4CD3 A;  2KKZ A;  1YXQ A;  3MX2 A;  3WNH A;  4JEP A;  1CZA N;  2QI2 A;  1LOT B;  3TAE A;  1GOC A;  1T03 A;  1BCM A;  3VEX A;  4DTP A;  3V81 A;  1NGG A;  5BN9 A;  3HSC A;  4WCE L;  1C0T A;  2B4J A;  2VQF K;  3J8A A;  1KAZ A;  4E19 A;  3CFP A;  4AHR A;  3OYA A;  4GV3 A;  3TU5 A;  3OJU A;  5HRS A;  1XNR K;  3CYM A;  1XHX A;  3VQ5 A;  3ZCM A;  4DQR A;  1DTT A;  3CXC M;  4M3R A;  1ATR A;  1OVY A;  4CHY A;  3Q7C A;  4E7K A;  4OJR A;  4DV1 K;  3V9W A;  2Y1J A;  2VG7 A;  4EAH D;  3VF4 A;  1U4B A;  1CLQ A;  3U8X A;  3BZC A;  4C1N I;  3WXM B;  3O1W A;  3KZB A;  1GLL O;  1MA9 B;  3I56 N;  1RT5 A;  4IDK A;  5GAD P;  1NJX A;  3NF7 A;  3H3O B;  3SPZ A;  4YNQ A;  4DQ8 A;  5HL7 L;  5HBM A;  4X64 K;  3KLI A;  2F8S A;  3ZSV A;  4E7J A;  3NF6 A;  4CHP A;  4CF1 A;  1TK5 A;  4H5T A;  3R6M A;  3L4Q A;  1W9H A;  2OZM A;  3VOV A;  3ZSQ A;  3ULE A;  1NJZ A;  1L3S A;  3UKU A;  4FLV A;  5FRM A;  3AO4 A;  3VA0 A;  3WEE A;  3HM9 A;  2E5L K;  3IUC A;  5GIO A;  3DLE A;  3ULE B;  4BR5 A;  3CCR N;  1VSH A;  5AQZ A;  3UKU B;  3ATV A;  3U6F A;  1FK9 A;  3P4I A;  3D45 A;  3TAG A;  3ENH A;  1GLC G;  1D9F A;  4BRH A;  4DR3 K;  4F3O A;  3CM5 A;  3NF8 A;  3W0L A;  4KTQ A;  4B1U B;  4KHQ A;  3ID6 A;  1KFD A;  1RDD A;  2UXB K;  3RWU A;  3OVN A;  2LSN A;  3H46 O;  2P9L B;  1LWC A;  3PSF A;  2YNF A;  4QS7 A;  4IEE A;  1NJI O;  3VEY A;  4B1Y B;  4A5B A;  1XMQ K;  4CF8 A;  1JCE A;  4CZH A;  3VQ6 A;  1VQM N;  2GWJ A;  2OPS A;  4IEI A;  4LFB K;  2P9N A;  4OX9 K;  1C6V A;  3HRG A;  1C0F A;  3SAG A;  2VWK A;  4H5W A;  3V9S A;  1VSJ A;  5J1E A;  2KW4 A;  3FZL A;  3CG7 A;  4FJG A;  2G8V A;  5CYQ A;  2QWN A;  4DV7 K;  2HW3 A;  4FLU A;  3HPH A;  1WAJ A;  3L3V A;  3MEE A;  4BRQ A;  3RTV A;  5LJV A;  3HP9 A;  4PKG A;  1EKE A;  1HRH A;  4LF7 K;  4CHO A;  3FZH A;  4FZZ A;  4DR1 K;  5CHI A;  3G0Z A;  4E1M A;  3IAY A;  4BWJ A;  4BRG A;  5JIC A;  3MXJ A;  3VQ9 A;  3VGL A;  4FWN A;  3OW2 M;  1JL1 A;  3RMB A;  4E7H A;  2E6M A;  4DTO A;  3MCA B;  3I8B A;  3THX A;  3RR7 A;  4XEI A;  4EZ9 A;  4CHZ A;  4CJE A;  1UWB A;  3DOK A;  4L8R B;  1KVC A;  4JI8 K;  1B9D A;  4RWT A;  2CH6 A;  1NM1 A;  4PL7 A;  3QER A;  1BIU A;  3HPG A;  1S72 N;  1HKB A;  3FE1 A;  3QNN A;  3U4L A;  3OA9 A;  4K0K K;  4JI7 K;  4AM7 A;  2PBD A;  1BCO A;  1P90 A;  1I94 K;  1C1B A;  3DRR A;  3SYZ A;  5JLH A;  3E9P A;  3LZI A;  1NK9 A;  2P1J A;  4DTR A;  4DV3 K;  3O9T A;  5KPZ A;  2UUB K;  2FBT A;  3HTV A;  1C1A A;  3CF5 L;  3K9K A;  4O4G A;  1RBR A;  3LP3 A;  2IVO A;  1VQ5 N;  2WBN A;  5M1Q A;  3D2E B;  3NDK A;  4IJA A;  3CCL N;  4KHU A;  1RT6 A;  4FW1 A;  1CXU A;  2V51 B;  5K14 A;  1TGO A;  3C6H A;  2G8F A;  3D2F A;  3KLG A;  4FJ7 A;  2D0B A;  4J2B A;  1BG3 A;  1BUP A;  4DV2 K;  4FVU A;  3EZW A;  3CQY A;  2WON A;  3ZT3 A;  4DU3 A;  3I55 N;  1V4T A;  3NVK A;  4I7F A;  3C65 A;  3D6R A;  1H1V A;  2VG6 A;  3L2R A;  5C12 A;  4FVM A;  3BZK A;  4CHN A;  2P5G A;  4M45 A;  3MWP A;  4KFB A;  3OYM A;  1ATN A;  2P51 A;  1HX1 A;  2F7T A;  4DFM A;  3V1R A;  3LAN A;  1XMO K;  3OYL A;  3LM9 A;  2D5R A;  4H0X B;  5HLF A;  2RF2 A;  3AA2 A;  1VSL A;  3LAM A;  5CE3 A;  3FFI A;  4CZK A;  2HHH K;  4RW9 A;  5C15 A;  3SK3 A;  2HOE A;  2XY6 A;  4JKB A;  1QQO A;  2QWM A;  3I8D A;  4Y1C A;  1RTI A;  4DSJ A;  3H3N O;  5BPL A;  4BE1 A;  2ITG A;  3V9Z A;  3MX5 A;  1TKX A;  4BRD A;  1HNI A;  4AH9 A;  5JLF A;  3M8R A;  2PYL A;  1T3V A;  4KB0 A;  4CJ5 A;  3S9H A;  3B6P A;  4YOX A;  4C8O A;  4A5A A;  2KZZ A;  2A5X A;  4B8C A;  2KLA A;  1QTM A;  1VQ9 N;  2QWL A;  2ETJ A;  5AQX A;  3PIP L;  3A5L C;  1VHX A;  1ILY A;  2FSK A;  3F9M A;  3VEW A;  4DSL A;  3SI6 A;  1WLJ A;  3CCM N;  1TK0 A;  1KQS M;  4Y1D A;  4H5R A;  4O5B A;  3KD5 E;  1D9D A;  2ZJP L;  1BDG A;  2HHX A;  4O8U A;  1T05 A;  1KD1 O;  2OCE A;  5A2Q O;  3DLB A;  3ZSO A;  4DR4 K;  2D4W A;  3TI0 A;  4F3T A;  3LWL A;  4AM6 A;  5CZ1 A;  3TSP A;  3V6D A;  3V9X A;  3E01 A;  4DLG A;  2P9K A;  3NGY A;  3IRX A;  1NGI A;  3L4I A;  5LMU K;  3VER A;  3SCX A;  3HM8 A;  4AHS A;  5ADX H;  3SUQ A;  3ZSZ A;  4CK1 A;  3ATU A;  2Q36 A;  4B3O A;  5KGW A;  3OYH A;  5EVZ A;  1VSE A;  3KK3 A;  3T1A A;  4BR7 A;  3HO1 A;  1DEJ A;  3FZK A;  1ZBH A;  3EO3 A;  3CHW A;  5FPD A;  3I0S A;  2HF4 A;  3O4W A;  2QEX N;  4CIG A;  2E2P A;  2I7N A;  3AVM A;  4FOI A;  2PZS A;  1Q18 A;  4DU1 A;  3SJH A;  4CGG A;  3CYG A;  2QXF A;  4K25 A;  2HHQ A;  2D0A A;  1ZBF A;  3ZX2 A;  5FLX O;  3AAP A;  3T7Z A;  2UYT A;  4NLB A;  3S41 A;  3AVC A;  2IOC A;  5AZI A;  4A2B A;  3KK2 A;  4H0P A;  2FF3 B;  4PHT X;  1I3A A;  3T19 A;  4CK3 A;  3VQA A;  3NH1 A;  3KHY A;  1GLE G;  4TSX A;  3VGK A;  4BC5 A;  4CHQ A;  4DSI A;  1VQ4 N;  4FLZ A;  3NHG A;  4DV0 K;  1EX4 A;  2F96 A;  2HMP A;  4DMN A;  4E89 A;  4WE1 A;  2R7Y A;  3C0B A;  3WT0 A;  4FJ9 A;  2OPP A;  1GOB A;  4FXD A;  1X9S A;  3SQ4 A;  3GG4 A;  2E88 A;  1R59 O;  1EO1 A;  5CZ2 A;  4OO1 J;  3IS9 A;  5I42 A;  2H3G X;  1NKE A;  2YNI A;  3U3Y A;  1L3T A;  2OZS A;  1BQM A;  4FCY A;  4AHC A;  1EWQ A;  4DSE A;  4FJ8 A;  2B5J A;  4NLC A;  2BH1 A;  1VQ7 N;  2Z1H A;  1U49 A;  5AQH A;  3CCJ N;  4FO0 A;  1NGA A;  2CGL A;  3BUZ B;  3QET A;  3MMV A;  4QAG A;  3K9J A;  3CCE N;  1IKV A;  1NK5 A;  3M6G A;  2ASM A;  3HYF A;  4B3M K;  5AZJ A;  2JWL A;  2NRR A;  1VQN N;  4H0T B;  4BAC A;  2G8W A;  4DV4 K;  4BRE A;  3OYC A;  3MEC A;  5HRN A;  4IWV A;  4LY7 A;  2HB5 A;  4FJJ A;  2YHA A;  4BDY A;  2XHB A;  4CZF A;  1YHQ N;  3AVL A;  3DOL A;  4GW6 A;  4A57 A;  3OHR A;  1IBM K;  2WUS A;  3C6T A;  2ZF5 O;  4O55 A;  5CY4 A;  2E8A A;  3OYI A;  4CJS A;  1HNZ K;  2X6S A;  3QML A;  1Z05 A;  4JI4 K;  2YI1 A;  2YKN A;  4FL9 A;  1VQ8 N;  4M3U A;  3AVJ A;  3C6U A;  3TAM A;  3TR8 A;  4WYB A;  4CFD A;  1B92 A;  3KK1 A;  4LSN A;  1LV5 A;  3QEI A;  1CXQ A;  2HBJ A;  3TSU A;  1X9M A;  1N34 K;  1Q81 O;  1K8A O;  1RT2 A;  1TKD A;  5DM6 L;  2XO7 A;  1LWF A;  3CJA A;  3SNN A;  2FLO A;  2E20 A;  1NG9 A;  2V52 B;  4DHY A;  4FWQ A;  3OY9 A;  3LDO A;  3MXM A;  1TV6 A;  1K73 O;  2PYJ A;  2HST A;  3ITH A;  2G8I A;  1RTH A;  5EU7 A;  2P9P B;  1RT7 A;  4IG3 A;  4CED A;  4HUF A;  4DQI A;  4CJ3 A;  4NO7 A;  3T1Y K;  5I3U A;  2W41 A;  2F8T A;  4CK2 A;  3WNF A;  3WXK A;  2DTU A;  3SMS A;  1ASV A;  4DKW A;  4BQZ A;  3ID8 A;  3CI5 A;  2BGG A;  2E6L A;  3C7N B;  3ZEU B;  1G99 A;  5AQW A;  4E72 A;  3A0I X;  2IVN A;  2QWR A;  4FWL A;  5BRH A;  2P9I B;  3TTC A;  3CER A;  3QBW A;  5J2Q A;  2YX6 A;  4BWM A;  1QVG M;  5AFU H;  3HT3 A;  4CEF A;  4YOW A;  4BE0 A;  5BPN A;  4M63 C;  4FLY A;  4FK0 A;  3AGK A;  1BA1 A;  2Q97 A;  3QIP A;  1WAF A;  3EE9 A;  4KAZ A;  1WB9 A;  3MCP A;  4YHH K;  3NGI A;  2AA4 A;  3O80 A;  2ZM6 K;  4FSV A;  5E41 A;  1GLD G;  1KFS A;  4BR2 A;  4HUG A;  1JLF A;  3QEX A;  4DF4 A;  4R79 A;  4BG9 A;  3WNG A;  2W42 A;  3MEG A;  1SL1 A;  4CEE A;  5M1N A;  5AQK A;  3OS2 A;  1HR0 K;  1FXX A;  3ULD A;  4ILJ A;  1RBS A;  4YOR A;  3V4I A;  4CW7 B;  4Z4H A;  3LWM A;  1JCG A;  5KQD A;  3V1Q A;  4CJ4 A;  1RDC A;  3HOS A;  3ZET B;  4F2R A;  2FSN A;  2QXL A;  3H45 C;  3K0S A;  3DWL A;  4BC3 A;  3L8B A;  4LF9 K;  1TVR A;  3PO5 A;  4JI6 K;  1T7P A;  4B9S A;  4BG8 A;  4WQ5 C;  1SL0 A;  1NOY A;  5J2P A;  4Z0U A;  2XY5 A;  4DFJ A;  1QSY A;  3CC7 N;  1C0G A;  4BR9 A;  2FSJ A;  1XNQ K;  2FBX A;  1VSK A;  4RW6 A;  3AVG A;  3HL8 A;  3PLA A;  4XH5 A;  3PX6 A;  1HPM A;  5GAH P;  4CI6 A;  1GOA A;  2A6A A;  4DSF A;  1SQK A;  3DLK A;  1O1W A;  3F9K A;  3W3D A;  3CCV N;  1GLA G;  4DF8 A;  5ADX A;  3DLH A;  4FJH A;  2FBY A;  1B9F A;  4C8N A;  1BL3 A;  1EP4 A;  2J4R A;  3KTQ A;  1MU2 A;  3QDK A;  4BE7 B;  1BGX T;  2NZT A;  2G8U A;  3CQ8 A;  2HHW A;  3AO1 A;  1DGK N;  2A3Z A;  1VRT A;  2Q3S A;  1LW2 A;  1FJG K;  3CJC A;  2NRH A;  4DU4 A;  2IS3 A;  2ZE2 A;  3EKS A;  4FJK A;  1VQL N;  1HQU A;  1WSG A;  4CEQ A;  4MLE A;  3OYJ A;  1RDU A;  1K8K A;  1J53 A;  2CH5 A;  2BUP A;  5AR0 A;  4DTJ A;  2NRV A;  4WQ5 A;  2ZQB A;  3SQ0 A;  1CZB A;  4H0V B;  4CEZ A;  1K8K B;  4X62 K;  4CFA A;  3NGZ A;  3H08 A;  1S5J A;  2OPR A;  3DRP A;  3DRS A;  4M3Z A;  3FGU A;  4ISF A;  3VES A;  1JLE A;  4ID1 A;  3G25 A;  3OS0 A;  4YOT A;  1JCF A;  2P9L A;  2FF6 A;  3R1X A;  1U6Z A;  4H5V A;  4B9N A;  5KTQ A;  3EEQ A;  1QSL A;  4Z4F A;  3VET A;  3C95 A;  3BF3 A;  3ZT2 A;  2RPI A;  3QB0 A;  3FR0 A;  3P5J A;  1HNW K;  3VF6 A;  3MDQ A;  2Q0U A;  3CJ1 A;  3OS1 A;  1ZYQ A;  4GKJ K;  1YT3 A;  4DTN A;  2HBM A;  1NGE A;  5KPR A;  5EOY A;  4KHY A;  2OTL N;  3QES A;  4YOU A;  3RSE B;  3L2V A;  1EET A;  4ID5 A;  2HND A;  4E1J A;  3UKR B;  4KBO A;  1E4G T;  5JMV A;  4V19 S;  2V7Y A;  4GY2 B;  1JLC A;  2BAN A;  4JRQ A;  2HMI A;  3K5L A;  1TYQ B;  4DS4 A;  4DQS A;  3L2U A;  1WSF A;  1U47 A;  4FJI A;  4M3X A;  1T6D A;  1WSE A;  1NKB A;  3NH2 A;  3TAB A;  4EHT A;  4CEA A;  2KFN A;  4FWO A;  3DAW A;  4JKG B;  2VQE K; 
#chains in the Genus database with same CATH homology
 1VQ9 N;  3IFR A;  5AQS A;  4JNE A;  4B1W B;  2QWL A;  5AQX A;  5AQJ A;  5AQN A;  4CZI A;  3PIP L;  2QWP A;  3A5L C;  5MLC Q;  1ILY A;  5C2F A;  2FSK A;  2E2Q A;  3EL2 A;  3F9M A;  4GVE A;  3VEW A;  5I9E B;  4ISG A;  1BU6 O;  4CBU A;  2QW9 A;  3CMA N;  5AZJ B;  3CCM N;  1KQS M;  4IOA L;  5E84 A;  4H5R A;  4BRM A;  4YOV A;  1QZ5 A;  5H1S Q;  2ZJP L;  2P9S A;  1BDG A;  1W97 L;  4JK7 A;  4NB4 A;  4O8U A;  2EWS A;  4J8F A;  1KD1 O;  3CC2 N;  4H5N A;  4BR4 A;  2D4W A;  5BR9 A;  4K42 A;  4C23 A;  3WQU A;  4AM6 A;  4CJ7 A;  4BRK A;  3TSP A;  2JWK A;  3VEO A;  2C1I A;  2P9K A;  5JVG L;  3O9R A;  4WFN L;  3L4I A;  1NGI A;  3L0Q A;  3VER A;  3HM8 A;  5ADX H;  1NGC A;  1X3N A;  2Q36 A;  3ATU A;  4JHD B;  3WXL A;  1Z6R A;  2HF3 A;  3IKM A;  3TPQ A;  5TKY A;  3VMF B;  5EVZ A;  4FOE A;  4A61 A;  1NGB A;  4BGB A;  5BRE A;  1HKG A;  3G6E N;  2NRW A;  4CZM A;  3E9L A;  3ZYY X;  1YJ9 N;  3H6E A;  5TKW A;  1Q86 O;  2E1Z A;  4RTF D;  3UE5 A;  4BR7 A;  3EKU A;  3LL3 A;  1BO5 O;  1DEJ A;  3D2E A;  3FZK A;  3EO3 A;  3CHW A;  5FPD A;  3I33 A;  3R3L A;  1OKJ A;  2HF4 A;  2BTF A;  1SZ2 A;  3O4W A;  2E2P A;  2PAV A;  4GNI A;  3MN6 A;  1M1K O;  2QEX N;  5F1X A;  3VEN A;  2I7N A;  4Y0W A;  4FOI A;  1QZ6 A;  1Q18 A;  2ITM A;  3A8Y A;  4BRP A;  3SJH A;  3QIC A;  4K25 A;  3GE1 A;  4KH6 A;  5BN8 A;  3ZX2 A;  2OTJ N;  3O8M A;  5KPT A;  1YF5 L;  2ZJR L;  2A40 A;  4IFE A;  2QTD A;  2ZGZ A;  3AAP A;  5FPN A;  2UYT A;  4NLB A;  3T7Z A;  3GL1 A;  3QBX A;  4CZE A;  1RDW X;  3S41 A;  3UB5 A;  4BRA A;  2QWQ A;  4BRI A;  5AZI A;  4A2B A;  3VPZ A;  4H0P A;  4I6M A;  1JJ2 M;  5C10 A;  2FF3 B;  5AFU A;  3E9O A;  4PHT X;  4BEB A;  3CCU N;  2E2O A;  3BF1 A;  4G9Z A;  3KHY A;  4BRN A;  4IO8 A;  1GLE G;  4GV9 A;  3VGK A;  1IJJ A;  3EE8 A;  3WEE B;  3P31 A;  1E4F T;  4BC5 A;  5GIP A;  1RGI A;  1VQ4 N;  1TUY A;  4ILH A;  3AY9 A;  4PL8 A;  4WFA L;  4UY8 O;  1D4X A;  2HMP A;  3R9P A;  2ASO A;  3JXU A;  5B8H A;  4FWM A;  3RSE A;  3C0B A;  3E1Y A;  1DKG D;  3WT0 A;  3CPE A;  1VQP N;  4B1Z A;  1M90 O;  3CIP A;  4B1X B;  3CJB A;  4XH4 A;  4JKA A;  4A62 A;  3GG4 A;  4JKC A;  1BWF O;  3N4Q A;  2E88 A;  3UKR A;  3CME N;  3WXI A;  1R59 O;  1EO1 A;  5AQF A;  3QFU A;  4OO1 J;  5EX5 A;  2H3G X;  3O5B A;  3GDQ A;  1MDU B;  3HOT A;  1TYQ A;  2P9U A;  3F5T A;  5E26 A;  2GWK A;  3PIO L;  3TSQ A;  2YHY A;  4BVO A;  2ZGY A;  4B9Q A;  3ZX3 A;  3EN9 A;  3A5O C;  2PFU A;  3CC4 N;  4NLC A;  2IIR A;  4DCH A;  5M1F A;  3M3Z A;  1KAY A;  3R8E A;  2BH1 A;  3CJ7 A;  1VQ7 N;  2I7P A;  1NGH A;  1TUU A;  1DT9 A;  4JKG A;  1X9J A;  2P9N B;  4XH1 A;  3VEV A;  5AQH A;  1W2B M;  3CCJ N;  4FO0 A;  5F0X A;  1KXP A;  1NGA A;  1QHA A;  1WUA A;  2CGL A;  2VWB A;  4JKD A;  4U67 L;  4MO4 A;  4PKI A;  3BEX A;  3BUZ B;  4BRF A;  4CD3 A;  2KKZ A;  3N4P A;  2V7Z A;  3MMV A;  3K9J A;  1YXQ A;  3CCE N;  3SAH A;  4JK8 A;  3FFK B;  3M6G A;  2ASM A;  3MX2 A;  3MK6 A;  4H0Y B;  5AZJ A;  2JWL A;  4HWI A;  4JEP A;  1CZA N;  1VQO N;  1T44 A;  2NRR A;  4BC4 A;  2QI2 A;  1LOT B;  2Q1N A;  1VQN N;  4H0T B;  3NMU A;  1VAZ A;  4QS9 A;  1T6C A;  4BRE A;  3VEX A;  3LDQ A;  4IWV A;  1NGG A;  5BN9 A;  4XJX A;  3HSC A;  3H1Q A;  4WCE L;  2Q0R A;  3SBT A;  1YI2 N;  1YJW N;  4CZF A;  1YHQ N;  3J8A A;  1KAZ A;  4A57 A;  3CD6 N;  4GV3 A;  5C0Y A;  3TU5 A;  3OHR A;  4CBW A;  2WUS A;  3O9U A;  5AQT A;  2ZF5 O;  3BP8 A;  4JHD A;  2E8A A;  3ENO A;  4JK9 A;  3CXC M;  4ILG B;  1ATR A;  1O13 A;  1OVY A;  4IDH A;  4RCH A;  3Q7C A;  3H1V X;  3P38 A;  3IDH A;  3QML A;  1Z05 A;  5ELZ A;  1ESV A;  3SBG A;  2YI1 A;  4EAH D;  2WC9 A;  4FL9 A;  3VF4 A;  1VQ8 N;  3U8X A;  4M7Y A;  4WYB A;  3O6W A;  2E1Y A;  4C1N I;  3WXM B;  3CQX A;  3KZB A;  1P8Z A;  1MA9 B;  1GLL O;  3O1W A;  2HBJ A;  1IG8 A;  5EY4 A;  3TSU A;  4BVP A;  2ASP A;  5HOO A;  3I56 N;  2HBK A;  4A59 A;  1Q81 O;  1ATS A;  5GAD P;  1GLF O;  1K8A O;  1QQM A;  3H3O B;  3QFP A;  2CGK A;  4BQL A;  5FPM A;  5DM6 L;  3CJA A;  4BRO A;  4DQ8 A;  3CPW M;  2FLO A;  5HL7 L;  5LY3 A;  2C1G A;  4WFB L;  3MN7 A;  2ZJQ L;  4EFH A;  4F9O A;  2E20 A;  3VEZ A;  2NNW A;  3KWI A;  1S3X A;  2V52 B;  5CR4 A;  4DHY A;  1YVN A;  4FWQ A;  3CJ9 A;  4HTL A;  3LDO A;  4H5T A;  1K73 O;  2YHW A;  2RE2 A;  2HST A;  3R6M A;  3L4Q A;  3KK7 A;  2AP1 A;  2P9P B;  2IVP A;  3VOV A;  3LM2 A;  3ULE A;  2GX9 A;  3FZM A;  3UKU A;  4IJN A;  1NGJ A;  4NO7 A;  4EHU A;  3CCQ N;  2A41 A;  2VCP A;  2D1K A;  1HLU A;  2W41 A;  3WEE A;  3IUC A;  5AQU A;  3WXK A;  4FWP A;  4CZJ A;  3SMS A;  5GIO A;  3MWT A;  5C2D A;  3RVC A;  3ULE B;  4BR5 A;  3HZ6 A;  3UKU B;  5AQZ A;  4DKW A;  3ATV A;  4JD2 B;  5GAG P;  4BQZ A;  3CCR N;  1GLB G;  3ID8 A;  4IOC L;  1KC8 O;  3CI5 A;  4IZ9 A;  3C7N B;  3P4I A;  3ZEU B;  1G99 A;  5AQW A;  3ENH A;  1GLC G;  1ZXO A;  2IVN A;  3A0I X;  2QWR A;  4FWL A;  3VTH A;  2P9I B;  3TTC A;  3WQT A;  4BRH A;  3CER A;  5BRH A;  1YIJ N;  3QBW A;  2YX6 A;  4WQ4 C;  5GAE P;  1QVG M;  5AFU H;  2ZWH A;  3KVG A;  3MN9 A;  4K43 A;  4YDU C;  3W0L A;  3P39 A;  5BPN A;  4M63 C;  4YOW A;  4CBX A;  3D2F B;  4B1U B;  3ID6 A;  3AGK A;  3VTI A;  2A42 A;  1BA1 A;  1N8R O;  2Q97 A;  4PKH A;  2CGJ A;  1Q82 O;  2YJE A;  2WFB A;  3H46 O;  2P9L B;  3EE9 A;  5M1O A;  2GUP A;  4QS7 A;  1NMD A;  4IEE A;  3MCP A;  2AA4 A;  1NJI O;  4GV6 A;  3O80 A;  3VEY A;  2GEL A;  4B1Y B;  2W40 A;  4FSV A;  2QM1 A;  4MLH A;  1GLD G;  4IXC A;  4A5B A;  1JCE A;  4BR2 A;  2NRT A;  4CZH A;  4JKE A;  1NGF A;  4ISE A;  3FZF A;  1VQM N;  2GWJ A;  4IEI A;  4R79 A;  2P9N A;  4BG9 A;  1MWK A;  3HRG A;  4JKH A;  2F9T A;  4BY9 C;  1C0F A;  3SAG A;  4H5W A;  3O1B A;  2FXU A;  3ENB A;  3U9Z A;  5M1N A;  5AQK A;  3DXK A;  5AQI A;  1YAG A;  3FZL A;  2DPN A;  4ILJ A;  4M7X A;  4Z94 A;  2QWN A;  5AQR A;  3KWG A;  4YOR A;  1VQ6 N;  4BRQ A;  1NBW A;  5GIN A;  3DXK B;  2QA4 N;  5LJV A;  1U2V B;  1Q7Y O;  3IMX A;  4BGA A;  2W00 A;  4PKG A;  1JCG A;  5KQD A;  3M1F A;  4AF1 A;  3AAQ A;  1RFQ A;  4IOX A;  3HOS A;  4WQ4 A;  3ZET B;  3VGM A;  2FSN A;  2QXL A;  3FZH A;  1YUW A;  3H45 C;  5CHI A;  4OPA A;  4C1N K;  3CCS N;  1LCU A;  4YDU A;  3DWL A;  4BC3 A;  3M5R A;  4IO9 L;  3NVM A;  5F2R A;  4KH4 A;  1QQN A;  5AQL A;  4BC2 A;  4BRG A;  5JIC A;  4BG8 A;  1SAZ A;  4WQ5 C;  3VGL A;  2Q2R A;  5DM7 L;  4U7B A;  4FWN A;  2RHK A;  1MWM A;  4MO5 A;  2F9W A;  4H03 B;  3OW2 M;  3WXJ A;  5KQ8 A;  3CC7 N;  1C0G A;  1WOQ A;  3MCA B;  3I8B A;  4BR9 A;  4DB3 A;  4FWS A;  2FSJ A;  3LDN A;  1Y64 A;  4XEI A;  1ZBS A;  4WF9 L;  2GTD A;  5AQO A;  3PLA A;  4FPA A;  4XH5 A;  3A5N C;  1HPM A;  5GAH P;  4KH5 A;  4CI6 A;  4FWR A;  2A6A A;  1SQK A;  3CCV N;  1S22 A;  3W3D A;  2CH6 A;  1GLA G;  4RWT A;  2YCH A;  5ADX A;  1NM1 A;  4CD1 A;  4PL7 A;  3TTD A;  2J4R A;  1S72 N;  1HKB A;  3C6A A;  3FE1 A;  3QDK A;  4BE7 B;  4CZG A;  3U9D A;  2NZT A;  3U4L A;  2P9S B;  1NGD A;  3J7Z O;  3OA9 A;  1GLJ O;  5FPE A;  1DGK N;  2A3Z A;  2HBL A;  4MDA A;  2E2N A;  4AM7 A;  2PBD A;  2P9P A;  1P90 A;  3CJC A;  2NRH A;  1V4S A;  3EKS A;  4YOY A;  4LC9 B;  2NRZ A;  1VQL N;  1HUX A;  3LDP A;  1VQK N;  2YHX A;  3D7E O;  4MLE A;  5JLH A;  3O9Q A;  2P9K B;  3E9P A;  1YIT N;  1RDU A;  1K8K A;  5AQV A;  4A2A A;  2CH5 A;  3F2K A;  3MN5 A;  2BUP A;  5AR0 A;  1NLV A;  3O9T A;  2NRV A;  5KPZ A;  4JD2 A;  3HTV A;  4WQ5 A;  3JS6 A;  3CF5 L;  3K9K A;  4B1V A;  3C7N A;  4H0V B;  4O8K A;  3ZEU A;  3SAF A;  5BRD A;  1K8K B;  2IVO A;  1VQ5 N;  2P9I A;  3OBY A;  4OPH A;  2WBN A;  2YJF A;  3D2E B;  3OBW A;  5M1Q A;  3SMP A;  1XQS C;  2VGN A;  4IJA A;  4EIA A;  3L6Q A;  3CCL N;  2VYP A;  3DJC A;  3CET A;  2V51 B;  5M1P A;  3G71 N;  3C6H A;  4O5F A;  3DXM A;  3FGU A;  3D2F A;  5AQQ A;  4ISF A;  3VES A;  4FPB A;  3B8A X;  3O08 A;  1J6Z A;  1BA0 A;  1BG3 A;  5BPM A;  1BUP A;  3G25 A;  3GBT A;  3EZW A;  3CQY A;  4FVU A;  4YOT A;  1JCF A;  2P9L A;  2FF6 A;  3R1X A;  3DXM B;  1ZC6 A;  3I55 N;  1V4T A;  1U6Z A;  3NVK A;  4H5V A;  4BRC A;  5BRF A;  3HBT A;  4QS8 A;  4CZL A;  1YJN N;  5AZI B;  4I6M B;  5AQP A;  3VET A;  3T69 A;  3BF3 A;  3C65 A;  1H1V A;  3D6R A;  4BR0 A;  1X3M A;  5C12 A;  2NRX A;  3QB0 A;  1BOT O;  3FR0 A;  1NWK A;  3MWP A;  5AQG A;  5AQY A;  3VF6 A;  2NLX A;  1ATN A;  3MDQ A;  2GEM A;  1HX1 A;  4BEC A;  3GOI A;  2F7T A;  4BRL A;  2Q0U A;  5AQM A;  3TTF A;  3CJ1 A;  1QVF M;  3LM9 A;  1HKC A;  1XC3 A;  1NGE A;  2HBM A;  1EQY A;  5EOY A;  4H0X B;  5KPR A;  5LJW A;  3VF2 A;  3AGR A;  3HI0 A;  2OTL N;  1HJO A;  4YOU A;  3RSE B;  2VGM A;  5EXW A;  4CZK A;  5CE3 A;  5C15 A;  3FLC O;  1U2V A;  4MDB A;  3SLC A;  2D0O A;  3SK3 A;  2Q31 A;  5JVH L;  2HOE A;  4JN4 A;  4JKB A;  3ZET A;  4E1J A;  3UKR B;  1QQO A;  2QWM A;  2QWO A;  3Q7B A;  4KBO A;  1E4G T;  4H0O A;  5JMV A;  4FWK A;  3DLL L;  2V7Y A;  3E66 A;  4L3Q A;  3O9S A;  4GY2 B;  3AAR A;  3H3N O;  5BPL A;  1K9M O;  5M1K A;  2D0P A;  2OAN A;  3MX5 A;  4JKF A;  2KHO A;  4BRD A;  1TYQ B;  2P9U B;  3LDL A;  4JAX A;  3A5M C;  5JLF A;  1KAX A;  1T3V A;  3G4S N;  3WUH A;  1XUP O;  4K41 A;  1SS6 A;  1T6D A;  4YOX A;  4A5A A;  4EHT A;  3ZX0 A;  4FWO A;  2A5X A;  3DAW A;  4JKG B;  2KLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...