1TYQA

Crystal structure of arp2/3 complex with bound atp and calcium
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
417
structure length
399
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Actin-related protein 3
total genus 126
structure length 399
sequence length 417
ec nomenclature
pdb deposition date 2004-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1tyqA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1tyqA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1tyqA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1tyqA04
3SJHA 4H0TB 4BR9A 2FXUA 4FWLA 4ISGA 4B1YB 3WXKA 4H0XB 1TYQB 4BR4A 2KHOA 1KAYA 4BRIA 2D1KA 5AZIA 5JMVA 1XQSC 4BR5A 5AQIA 4PKGA 3QBWA 2ZWHA 1GLJO 1NGIA 4JN4A 2P9SA 3O80A 3HZ6A 1GLBG 4BC5A 3HBTA 3HI0A 3ID8A 5BN8A 3CETA 1DKGD 3CJBA 4HWIA 2ASMA 4L3QA 2Q97A 3GL1A 1NGGA 3LM2A 5AQOA 4FWRA 4HTLA 1NBWA 3ATVA 3CIPA 2P9NB 2QWOA 4M63C 3CJCA 1KAXA 4H0OA 1BG3A 4BRHA 3HSCA 2BTFA 2VYPA 5E84A 5BR9A 3EKSA 2W40A 4B1XB 2CH5A 3FZLA 4QS9A 4BG9A 4DCHA 2QWNA 1T44A 3LDQA 1QZ6A 4H0PA 5AZJA 2HOEA 3JS6A 3WEEA 3A0IX 3D2EA 3WXJA 2Q36A 2IIRA 3ZX3A 3WQUA 4FOIA 4F9OA 5KPTA 4JHDB 3DWLA 3EN9A 4I6MB 1NGBA 3VENA 3FE1A 4EAHD 2P9KA 1JCEA 4BVOA 3D2EB 1NLVA 5AR0A 3A5OC 2GUPA 1Q18A 1X9JA 2QWLA 1MWMA 3F9MA 2P9PB 5AQPA 4BQZA 1ATNA 3ENHA 5B8HA 2QXLA 1NWKA 3FGUA 3MN5A 3G25A 4CZLA 5F1XA 3AAQA 3LDOA 1BU6O 4EHTA 5AQHA 3P4IA 1YXQA 5TKYA 4J8FA 2P9IB 3UB5A 2E88A 3GBTA 3VEVA 3FR0A 3CI5A 1NGEA 3D2FB 3WXLA 4ISEA 4DQ8A 1LCUA 3MN6A 4LC9B 3O4WA 4B1WB 3H46O 3OHRA 4H5TA 3B8AX 5JLHA 3LDPA 5AQGA 5BRHA 4KBOA 3WUHA 3BP8A 4BRQA 2ZGYA 4JAXA 5F2RA 1U2VB 4JD2B 2P9UB 4H03B 3MMVA 3A5LC 2YHYA 4H5RA 4BRGA 3C7NB 5AQXA 2EWSA 5EVZA 4DHYA 3VESA 3CJ1A 2E2PA 5AQNA 4M7YA 2YHWA 3VEOA 3EKUA 1NGCA 1GLDG 1TUYA 1X3MA 4NO7A 2GELA 4IJAA 4B1ZA 4BVPA 2NRHA 5EOYA 3H6EA 3QBXA 5AFUA 4FWKA 1U2VA 2DPNA 3LM9A 1ZXOA 1RDWX 2P9UA 4CJ7A 2V7YA 3O1WA 2ZGZA 2ITMA 4CZJA 3SMSA 3M1FA 2ASPA 1BUPA 1NGDA 2A40A 2YJFA 3L4IA 1K8KB 1JCFA 1GLFO 1R59O 1Z05A 3FLCO 3BEXA 3FZHA 1TUUA 3RSEA 1HX1A 4JHDA 3SK3A 3MCPA 4Y0WA 4YDUC 1G99A 4MO4A 2IVNA 2A41A 3VGKA 3WQTA 2QW9A 2D4WA 3CHWA 3LL3A 4FWMA 1ZBSA 2E2OA 3KVGA 3O5BA 3U9ZA 3CJ9A 1QHAA 1KXPA 1HJOA 4BQLA 2P9PA 4MLHA 1EQYA 2IVOA 2F9WA 3O8MA 1V4TA 3WXIA 3DXMB 5EXWA 4MO5A 5AQLA 4FO0A 2I7PA 1XUPO 3AAPA 3GOIA 4XH5A 3CERA 3A5NC 1HPMA 1U6ZA 2W41A 3MN9A 3CQYA 3SLCA 4CZIA 5AQVA 2FF6A 5AZIB 5BRFA 3SMPA 2YI1A 3UKUA 1HKGA 1NGJA 3VGMA 3U9DA 3I33A 4BGAA 5ADXA 3O08A 3VETA 1GLCG 4QS8A 1BDGA 2V52B 4IJNA 4FWQA 4IZ9A 1C0FA 5KQDA 3IDHA 4BRLA 1NGAA 5AQZA 4E1JA 2J4RA 3FZMA 3D2FA 4WQ5A 3UKUB 3QMLA 4BRCA 1XC3A 4IWVA 3H1QA 2WUSA 3DXMA 1YVNA 3MK6A 4CZHA 3HTVA 3C0BA 1NGHA 4FPAA 4IXCA 1TYQA 3DXKA 5KPRA 1CZAN 2YCHA 4BC3A 3TU5A 5AFUH 5AQYA 1BOTO 3HM8A 4RCHA 5AQTA 1GLLO 2P9SB 1HUXA 4FWOA 4B1UB 2Q2RA 2A5XA 3DJCA 4BC4A 4BRMA 4H0VB 3AY9A 1D4XA 2GTDA 4B9QA 4CBWA 3ULEA 2UYTA 2V7ZA 2H3GX 2E2QA 3QDKA 3FFKB 1MDUB 2P9NA 2CGKA 3FZFA 5ADXH 4WYBA 3QFPA 5F0XA 3AARA 2FSJA 4CD3A 1ZC6A 4H5VA 2YJEA 4BG8A 3BF3A 3ZX0A 3VPZA 4BR7A 2CGJA 4A61A 5FPDA 5LJVA 1MWKA 2CGLA 2E8AA 3VF6A 4YDUA 1QZ5A 5BPLA 2Q0RA 3VEZA 5KPZA 4BGBA 3EL2A 3C7NA 4PKHA 3IFRA 3ENOA 1SAZA 2ZF5O 3TPQA 4RWTA 1ESVA 1NM1A 3MDQA 3R6MA 2FF3B 2QWRA 4BRPA 3IUCA 3ZETA 4A2AA 5FPNA 2E1YA 4CD1A 4EFHA 1HLUA 2F9TA 3BF1A 3LDNA 1QQNA 5AQJA 1HKCA 4EHUA 2E20A 4I6MA 5AQSA 4DB3A 2AA4A 2P9KB 1DGKN 4H0YB 3QB0A 3ZEUB 2QWMA 1QQOA 1ATSA 1GLEG 1S3XA 4PL8A 4A62A 3DAWA 2NLXA 3M3ZA 4K43A 2FLOA 2FSNA 1YUWA 2NZTA 4GY2B 1H1VA 4ISFA 1IG8A 2Q31A 3ZETB 2IVPA 3KZBA 5KQ8A 3R8EA 3O6WA 3H1VX 4H5WA 1T6CA 5LJWA 2QWQA 3GDQA 3GE1A 3GG4A 1BWFO 4BRAA 3I8BA 4BR2A 4BROA 2P9LA 3S41A 1E4FT 1C0GA 1V4SA 4K42A 4MLEA 1WOQA 2E2NA 1E4GT 2HF4A 4M7XA 2QM1A 3A8YA 4XH1A 1NMDA 1BA1A 1RFQA 4K41A 4WQ4C 4FWSA 3H3NO 4CZEA 4CI6A 4O8KA 5AQMA 3ZX2A 4B1VA 1P8ZA 5EX5A 2D0OA 3ULEB 4FWPA 3U4LA 2GEMA 4JD2A 5AZJB 4JNEA 2FSKA 3WEEB 4BRNA 2CH6A 3VGLA 2VWBA 1WUAA 4QS7A 4GNIA 1IJJA 4CZGA 5AQRA 4C23A 2GWKA 1SZ2A 1BO5O 1DEJA 3D7EO 5ELZA 4EIAA 1ATRA 4BR0A 4PL7A 2V51B 1LOTB 2A3ZA 3VF2A 1S22A 4PKIA 2AP1A 4BRKA 5JLFA 4FSVA 3VF4A 4XH4A 3O1BA 4RTFD 4A2BA 2GWJA 5BN9A 3RSEB 4FPBA 3VEWA 3R9PA 3UE5A 2VCPA 5JICA 3A5MC 4AM7A 1J6ZA 4K25A 4WQ5C 1BA0A 4FOEA 5E26A 3QICA 3IMXA 3UKRB 3FZKA 5BPNA 5BPMA 5FPEA 2Q1NA 5AQWA 3W3DA 1GLAG 3J8AA 4FL9A 5LY3A 4XEIA 2D0PA 4CZFA 2YHXA 3CJ7A 1X3NA 5I9EB 1OKJA 2HF3A 3H45C 5AQUA 3W0LA 3EZWA 1JCGA 5AQKA 3BUZB 1Y64A 4AM6A 4BC2A 1NGFA 2PBDA 2A6AA 3U8XA 3JXUA 4FWNA 5AQFA 2P9LB 3M6GA 3QFUA 3LDLA 3ZEUA 3DXKB 4O5FA 3CJAA 4BRFA 4CBUA 3L6QA 3MN7A 1MA9B 2A42A 1SQKA 1HKBA 3VEYA 4H5NA 2I7NA 5EY4A 3VEXA 4WQ4A 2PAVA 2OANA 4IO8A 1YAGA 1QQMA 1T6DA 4CBXA 3EO3A 2BUPA 2Q0UA 3H3OB 5CE3A 4NB4A 5BRDA 2P9IA 1KAZA 2ASOA 4BRDA 3UKRA 3VERA 5FPMA 2E1ZA 3CQXA 3WT0A 4CZKA 4Z94A 3ATUA 5AQQA 2QWPA 4CZMA 5BREA 1Z6RA 1K8KA 1RGIA 2HMPA 3VOVA 3L0QA 3KHYA 4BREA
chains in the Genus database with same CATH superfamily
4H0TB 5FRNA 4FWLA 4Y1DA 4B1YB 4H0XB 1TYQB 2YKMA 4BR4A 2FBYA 3OYFA 3ZSVA 4FZXC 1QQCA 3CCLN 2D1KA 5AZIA 1LV5A 1XQSC 4BR5A 4DV7K 3QBWA 2ZWHA 1GLJO 4UY8O 4CJ3A 1C1CA 4RW9A 2NRVA 4F2SA 5BN8A 1NK4A 3IG1A 3G0ZA 4CW7B 2X6NA 3RRGA 2Q97A 3VQCA 3GL1A 1C1BA 2RE2A 3HO1A 1NMNA 3S5TA 4KHNA 4HTLA 4PHTX 4FLTA 4FLVA 4WFBL 5CZ2A 1KAXA 1C0TA 1VQPN 1C0UA 4BWMA 2VYPA 5BR9A 2F8TA 3HJFA 4DV4K 2W40A 3DI6A 4B1XB 3JSMA 1E3MA 4QS9A 4CHQA 4BG9A 3BY5A 1BL3A 3ZT2A 2GV9A 4W5NA 4BDPA 5AZJA 2HOEA 1LWCA 3ASMA 2W42A 1QSLA 1L3VA 3HPGA 3EYZA 4FOIA 3PLAA 3O9SA 3VENA 4N56A 1N36K 3AVKA 1JCEA 5IT9O 4BVOA 3TTCA 2HHQA 1YJNN 3D2EB 2E5LK 2D0AA 3VMFB 5AR0A 1EO1A 4CJSA 2JGUA 4DR1K 3RMAA 1ATNA 4FVUA 4FJLA 2QXLA 4NCAA 3FGUA 4CZLA 5F1XA 4K8XA 1SV5A 5C15A 3L3VA 3VA3A 4AHVA 5I42A 3GBTA 3FR0A 3D2FB 4JKEA 4IBNA 4DQ8A 3MN6A 3NGIA 4DTNA 1FKOA 3HVRA 5DMRA 2XY5A 3OYBA 1T03A 3AO4A 4B1WB 3OHRA 4B9SA 4H5TA 3I55N 3HPOA 5BRHA 2NRTA 5IWAK 4DTPA 2ZGYA 4L8RB 4JAXA 4WE1A 4K8ZA 4H03B 2HBMA 2Z1JA 3NE6A 3E9LA 3A5LC 2YHYA 4KI6A 2EWSA 3KK1A 1Q9XA 4H8KA 3CCSN 1TKDA 1W0HA 3KLEA 4DQQA 3L2VA 5AFUA 4F8RA 3LM9A 4CVNE 2P9UA 2KQ2A 1BQMA 3ZT1A 1RCHA 2ZGZA 1VSEA 1WN7A 3SMSA 4OPHA 3SPZA 4WFNL 1RILA 4E7HA 3CM5A 3MCAB 3SBTA 2QA4N 5M1PA 4E7JA 4GV9A 3FLCO 4DLGA 1TUUA 1K8AO 3O9QA 5M1QA 4J2EA 4OLBA 2O8EA 2QI2A 4Y0WA 4YDUC 4DF4A 3WQTA 4MO4A 2A41A 3VGKA 3E9OA 1TKTA 4M3UA 1RTDA 4U7BA 1BGXT 1ZBSA 2E2OA 3KVGA 3U9ZA 2DY4A 1RBVA 3PX4A 1KXPA 1K73O 1JLAA 3WXMB 2YHAA 3AVLA 3TSUA 4MLHA 3CD6N 2OPRA 4I2QA 2XRIA 3OBYA 4BEBA 2JWKA 3AAPA 1J5EK 4BE7B 3KJVA 3G4SN 3VTIA 5GADP 3FFIA 3UIQA 4O4GA 4JI4K 3CERA 4BDYA 4X66K 3A5NC 2KZMA 4N76A 2P51A 1KVBA 4FJ9A 1XMQK 5AZIB 1HKGA 1FK9A 4CJLA 5C10A 2KLAA 3U9DA 4CFCA 4E7IA 4CK2A 4J2DA 1UA0A 3WNGA 4CEZA 3QIOA 4FWQA 3T7ZA 5KQDA 5HRNA 4DTRA 2J4RA 4O55A 2UXBK 2WTUA 1VQON 1EXQA 3UKUB 1TKZA 4BRCA 1OH7A 2WUSA 3AVBA 4LF6K 2VG7A 4CIFA 3F73A 4KI4A 4GVEA 1Q81O 3ZSYA 1U4BA 3C0BA 2QEXN 2YHBA 4FPAA 5KPRA 4C8MA 5JVGL 5HROA 5KTQA 3U3GA 3K58A 5AFUH 5AQYA 3VTHA 3I8DA 4N5SA 4FM1A 2YNIA 3H08A 5HRSA 4FXDA 4ICLA 1HUXA 3R3LA 2RHKA 3HM9A 2EHGA 1ZYQA 2A5XA 1MU2A 4BC4A 2WFBA 3AVFA 5J2NA 3ULEA 2OPQA 3OYNA 4K0KK 1SKSA 3NVMA 4FJ7A 2CGKA 1CLQA 4JKBA 2XHBA 5F0XA 1U45A 3LPTA 3OYGA 4OKJA 2FSJA 4CD3A 4E1MA 2HBJA 3SI6A 1C6VA 4BG8A 4BR7A 4KAZA 4A61A 1RTIA 1N32K 2E8AA 5M1FA 5GIOA 5KPZA 3TI0A 4C8LA 4PKHA 4Z4EA 4DQIA 3MDQA 3DLBA 2QWRA 3KLIA 1HYVA 2PFUA 2E1YA 4EFHA 1HLUA 4DTMA 1JL2A 1NOYA 3LZJA 3LDNA 4CJQA 5AQJA 5AQSA 2AA4A 2P9KB 1DGKN 4B3RK 1HYSA 2QWMA 2DFFA 3L2QA 1D9DA 4B8CA 2NLXA 2BANA 5SWMA 4K43A 1I3AA 1S1VA 2FLOA 2NZTA 1CZBA 4DFMA 4ISFA 1C1AA 1IG8A 4CF0A 3R8EA 4A5BA 1T6CA 3SUPA 4Z4FA 4BRAA 3V9SA 1C0GA 4CJ5A 3L4QA 3B6OA 4CJKA 2QK9A 1VSKA 4MLEA 4KO0A 2QM1A 4J2AA 1RFQA 4K41A 4OGEA 4WQ4C 4JKAA 1EKEA 4FW2A 3G10A 4CJTA 4CFBA 4B1VA 1P8ZA 5EX5A 1N34K 4ILHA 4FLXA 3OYJA 2GEMA 3AVMA 4JD2A 3V81A 3CPWM 3C65A 3SPYA 1RTJA 4GVMA 4DMNA 1WLJA 1VQ4N 4BRNA 3VGLA 3SQ4A 1WUAA 2G8KA 4C23A 3AVIA 1BO5O 2IC3A 5ELZA 3HK2A 4FJXA 5CZ1A 2YNHA 4JI1K 4PL7A 2IGIA 1LOTB 3DLLL 2VQEK 4Y1CA 2AP1A 3RMBA 4CJUA 4LH4A 5JLFA 3VF4A 5JENA 4XH4A 3O1BA 4A2BA 4QOZB 4DV3K 4LFCK 3CCRN 1QTMA 3DLKA 2HSTA 4K25A 4WQ5C 4OLAA 4CE9A 2G8UA 5SZTA 3FZKA 1RT1A 3LP2A 5BPMA 3LALA 1GOAA 2HHTA 3T69A 3J8AA 3EE8A 1JLGA 1FW6A 4C8OA 3PX6A 1XHXA 3CJ7A 2OZMA 1J9AA 4CHPA 2WBNA 3H45C 5AQUA 3K5NA 3RMCA 1UA1A 4XJXA 3KK7A 5AQKA 1Y64A 4I9LA 4IOCL 1NGFA 3NF9A 1HQUA 2PBDA 3QNOA 3JXUA 1VK0A 3QFUA 3ZEUA 4DWIA 3TR8A 3EZ5A 4O5FA 1YF5L 3CJAA 1IBLK 2B4JA 3AGKA 3ENBA 4WQ4A 4IO8A 1YAGA 4YOWA 4DU1A 2IDOA 2Q0UA 2C1GA 4CECA 5BRDA 5CY4A 1LWFA 3VQ7A 4F4KA 3TARA 4CJPA 4KTWA 4N47A 5BREA 1RGIA 1RDCA 2HMPA 3CMAN 3OS1A 2QTDA 2OPPA 2Y1JA 3OYKA 1ZBUA 3S3NA 4ISGA 1ZBFA 1NNEA 4ELUA 5TKWA 4M3XA 4DTOA 1QVFM 2W6KA 4JKDA 2VGMA 4FVMA 4PKGA 4HCBA 2XY7A 3SBGA 4JN4A 3HZ6A 1HNVA 4CEEA 3PIPL 4B3MK 3HI0A 4NXNK 2E6LA 3CETA 3OYDA 4BDZA 4L3QA 3O3HA 1NGGA 3LM2A 4FK0A 3TANA 1NBWA 4DU3A 4O44A 4F3TA 3VQ5A 3CM6A 4H0OA 4YHHK 3VQAA 2UUCK 4FLWA 4JI0K 3EKSA 4NXMK 4FJ5A 2HHUA 4DS5A 3HSTB 4H0PA 1XNRK 3HPHA 3A0IX 3D2EA 4JKFA 3WXJA 4Q5VA 2IIRA 1GOBA 1B9DA 3ZX3A 4F9OA 5KPTA 4JHDB 1S9EA 3DWLA 4CFDA 1NGBA 3TTFA 3MWTA 4F3OA 3R1XA 3THWB 3WNFA 1BIUA 2W00A 4I2PA 5DM7L 1WBBA 3THYA 2GUPA 4ZTJA 1WNSA 2QWLA 2P9PB 4KREA 1EWQA 4JI8K 3U6FA 3MN5A 3G25A 4ELVA 1XWLA 3LDOA 4KPYA 3P4IA 1YXQA 1RBUA 4RW7A 5TKYA 4J8FA 2P9IB 3UB5A 3J81O 4DV5K 3CI5A 2OPSA 3LP1A 4LC9B 4JEPA 3O4WA 1RDBA 3KWGA 3TWHA 4O0JA 3KK2A 3B8AX 4KHQA 2YX6A 4MDAA 4BRQA 3WUHA 4WF9L 4ILJA 5E41A 4R5PA 3I0RA 5HRPA 4PA1A 4HUFA 1TGOA 3C7NB 5AQXA 3KD1E 3OBWA 4JRPA 4DTSA 3VESA 5AQNA 3OW2M 3OYEA 1X3MA 2GELA 4IJAA 1N8RO 1T05A 3CC2N 1JLBA 3QEWA 1YHQN 3Q7CA 3U3YA 2DPNA 3OYAA 2D0BA 1VSHA 4ELTA 3O1WA 1NJYA 4CK1A 1I39A 1RT6A 2XY8A 1HPZA 3TAGA 4NCBA 1GLFO 1Z05A 1RBSA 3BEXA 3FZHA 3NGZA 1HX1A 4JK8A 4Z4GA 2D4WA 3CHWA 3LL3A 4FWMA 1N33K 1TK0A 5J2MA 2OCEA 3O5BA 3OA9A 3CJ9A 3LP0A 4AF1A 4KH6A 4LF4K 3ZSRA 4BE2A 3O9RA 4BQLA 2F7TA 2NRXA 3MEEA 2F9WA 3ZCMA 3O8MA 1NOZA 3DXMB 3BZCA 4M45A 2I7PA 5GAHP 1XUPO 3K9JA 4GW6A 3NF8A 3B6PA 1K9MO 3QIPA 3GOIA 1WSIA 1TL3A 3N4PA 4XH5A 1U6ZA 2W41A 4ID1A 5AQVA 2FF6A 4Z4HA 3UKUA 1WSEA 3N4QA 5C2DA 1U47A 4BGAA 3AO5A 2FBTA 3VETA 2ZJPL 5DM6L 1BDGA 2V52B 3EY1A 3NMUA 1C0FA 4AHUA 5KI6A 1Q86O 2HW3A 5LL6Z 3IDHA 4BRLA 2NNWA 1S72N 1SL2A 4C1NI 3E01A 1HNIA 3AVJA 3MX5A 5C0YA 4LY7A 2KKZA 3H1QA 1EX4A 3DXMA 3T1AA 3O4QA 3TAQA 3MXIA 3V4IA 1NK8A 4DSEA 4IXCA 1TYQA 3V1QA 4BC3A 1U49A 3NH0A 3TU5A 2YV0X 2GBZA 1BOTO 2IOCA 5D3GA 2BH1A 5AQTA 1VSDA 2GX9A 1RBTA 4YORA 1FJGK 4BRMA 4B3TK 2HBKA 2V7ZA 2H3GX 1VSMA 3QDKA 1BIZA 3THWA 4WYBA 3QFPA 2G8VA 4RW8A 5MLCQ 2O8CA 2HHWA 1RT3A 3J80O 3PIOL 3ZX0A 3P1GA 4AILC 5FPDA 3MECA 1MWKA 2CGLA 3M5RA 1QZ5A 5BPLA 2Q0RA 3VEZA 3EL2A 3C7NA 2Q3SA 3CPEA 5K14A 1RTHA 3LWMA 3IFRA 1SAZA 1S5JA 1T3VA 3TPQA 1HQEA 3TAEA 3HXMA 1OH5A 4BRPA 4CESA 5KRTA 3KLHA 3ZETA 1YI2N 4A2AA 4CD1A 4KB0A 3E9PA 3VQEA 3BF1A 2JLEA 1QQNA 1J54A 4I6MA 4H0YB 4CERA 3ZEUB 4Q0BA 4PL8A 4CGGA 4M42A 4M3RA 4CJVA 3OYMA 1YTAA 4DSIA 2KFZA 4HTUA 4E72A 1IKWA 2Q31A 2Y1IA 1BCOA 2ZD1A 3QLHA 4N41A 2KTQA 4FW1A 3GE1A 1X9MA 1RT5A 2WONA 3I8BA 3TSQA 2ZE2A 4CFAA 5M1NA 4DSFA 2P9LA 1J5OA 4JI3K 4KRFA 3VN5A 3MAQA 1V4SA 2VGNA 4YFUA 1JLCA 4FJ8A 1WOQA 2E2NA 4FK2A 2HF4A 2PY5A 1NMDA 4H4OA 4EZ6A 3RVCA 1JLFA 2D0OA 1DTQA 4FWPA 1SKWA 4FLUA 1I94K 5AZJB 1TAUA 4YOTA 4CEOA 2FSKA 5C12A 4DQPA 2CH6A 3SNNA 4CZGA 1JJ2M 5FDLA 2GWKA 4FJKA 3VQ4A 1B92A 1Y97A 3SUQA 1IBKK 3E66A 4YNQA 3PSIA 3AO1A 3OJSA 3SYZA 3DLRA 3DMJA 2V51B 1QVGM 1S1TA 1WSGA 1SL0A 4QCLA 4H4MA 3LAKA 3RSEB 4JI7K 4FPBA 3VEWA 3QEVA 3UE5A 1WSFA 5I3UA 1VQ9N 2O8EB 4CIGA 4KHWA 2ITGA 3IMXA 3UKRB 4J2BA 5FPEA 1GLAG 4IG3A 4M3WA 4JI5K 3AA2A 5LY3A 1YJWN 1TK5A 5FROA 1X3NA 2HHHK 1W2BM 3CCVN 1WBDA 1JCGA 1KFDA 3BUZB 4AHCA 4KHUA 2PYJA 1CZ9A 4BC2A 1ZBLA 1YVUA 4PY5A 3QINA 3C6UA 5M1KA 3K2PA 1NKBA 3O3FA 1XNQK 1SL1A 3L6QA 3MN7A 3QETA 3D45A 1HKBA 2VWJA 5JS2A 4H5NA 2I7NA 4DSKA 2O4GA 5EY4A 2HNZA 2HVHA 4AH9A 4A57A 1OVQA 2OANA 3ZSOA 1S9GA 3EO3A 2D0CA 2BUPA 3H3OB 1LW2A 2O8BB 3AVGA 2ASOA 4MDBA 5FPMA 3WT0A 4CZKA 3AVAA 5AQQA 1BI4B 2QWPA 4OX9K 1K8KA 3SAFA 4CIEA 3F2KA 4I7FA 3L0QA 1UAXA 4ID5A 3VQBA 3M8PA 2P5GA 1U48A 4BREA 5CHIA 4JK7A 3JYTA 1CXQA 4BR9A 1KLMA 2FXUA 3SCXA 3WXKA 3J7ZO 1YITN 3L2RA 2Z1HA 2KHOA 1KAYA 1XMOK 5JMVA 1ILYA 4A59A 3C6AA 1NGIA 2ETJA 1FXXA 3RWUA 4DR5K 4CGHA 1GLBG 4BC5A 3HBTA 3CCMN 1XHZA 1M90O 3V6DA 4HUGA 1RT2A 3D0PA 4RW6A 5AQOA 4DR6K 4WCEL 3ATVA 1IKVA 1BCMA 3CIPA 1BI4A 2QWOA 4M63C 3ITHA 4DLEA 4W5TA 4BRHA 3G71N 1BG3A 2BTFA 2Z1IA 5E84A 1VSFA 3CXCM 1VHXA 2F96A 2OYQA 3FZLA 3NH1A 4FJIA 4CHZA 1RDDA 3LDQA 3TABA 1QZ6A 1W9HA 4JKGA 3WEEA 3NF6A 3IRXA 2VWKA 3NH2A 4BWJA 3WQUA 1Q9YA 3OVNA 4O0IA 2O8FB 4CGFA 3EN9A 4I6MB 3FE1A 2FBVA 4IFYA 2P9KA 1D5AA 2KZZA 4C1NK 4CF8A 1S1UA 3ISNC 1F21A 1NLVA 1D9FA 3A5OC 1Q18A 2HB5A 1KTQA 3OYCA 3F9MA 3F5TA 3LAMA 4BQZA 3OYHA 1IV0A 4IEEA 4KFBA 5B8HA 3CFOA 2ATQA 1JLEA 4EHTA 3DLEA 5AQHA 4X64K 1VQMN 2E88A 3DOLA 1NGEA 1X9SA 3WXLA 4ISEA 3AV9A 4IO9L 1LCUA 4MFBA 3OY9A 3HP6A 2QKKA 4GV3A 1VQLN 4B9MA 1JKHA 3V1OA 1EWRA 2O8FA 5AQGA 2O4IA 1QS4A 4KBOA 4O8UA 5F2RA 1U2VB 3EEQA 5CR4A 4Z4CA 4E7LA 4H5RA 1VSLA 3OTOK 2X78A 5EVZA 4C8KA 3CJ1A 1IKYA 1Q7YO 1IKXA 2YHWA 3QESA 3SUOA 3EKUA 1WB9A 1GLDG 2F4VK 2NRHA 3H6EA 3QBXA 1U2VA 3DM2A 3TAMA 1RDAA 1T7PA 1K6YA 1KVAA 1ZXOA 3LP3A 2V7YA 3LZIA 1BUPA 4NYFA 1NGDA 2A40A 2YJFA 4CGDA 1K8KB 1JCFA 3THXB 2HHSA 3RSEA 1HNZK 4JHDA 4AHTA 3DLHA 3MCPA 1G99A 2IVNA 4RG8A 4DFPA 4OPKA 4KHYA 3LPUA 4FZYA 2G8WA 1ASUA 2DFHA 1NJIO 1X9WA 1HJOA 3KTQA 3OJUA 2P9PA 1EQYA 4XIUA 2IVOA 4FJMA 3WXIA 3L8BA 5AQLA 4FO0A 3SAHA 1SUQA 3IAYA 4YOUA 1S1WA 2BDPA 3IS9A 5J2PA 3AVCA 4OPJA 4C8NA 4YOYA 1JL1A 5BRFA 2YI1A 3THXA 5KGXA 1NGJA 4KHSA 3I33A 5CYMA 3S3OA 5CYQA 1GLCG 1UWBA 3MXJA 5HL7L 4IZ9A 1D8YA 3V1RA 5AQZA 4E1JA 3OYIA 3FZMA 3HOTA 4WQ5A 3QEIA 3QMLA 1VQ7N 1XC3A 4IWVA 1YVNA 1TV6A 3TAPA 5J1EA 4OPAA 4CZHA 5HLFA 4JRQA 1QSSA 4EZ9A 2B5JA 1XI1A 1NGHA 2XY6A 4OGCA 2YCHA 3KIOA 3ZLJA 3P31A 4CHNA 4JV5K 1Z25A 4DR2K 4RCHA 1GLLO 3RR7A 1IO2A 3AVNA 2Q2RA 4JK9A 1KC8O 1IG9A 4RW4A 3RMDA 1WAFA 3DJCA 4MQ3A 4H0VB 3AY9A 4B9QA 2GTDA 4CBWA 2UYTA 3ZSZA 3I0SA 4HVJA 5GAGP 1MDUB 5ADXH 3VQ6A 4YY3K 3AARA 4CEBA 3HOSA 1J53A 4YOXA 2YJEA 1ASVA 3BF3A 2CGJA 5HP1A 3TSPA 1VQ5N 2E4LA 3VF6A 4YDUA 2HHXA 1HMVA 4BGBA 3KKRA 5C42A 3PO4A 2DFEA 1NM1A 3R6MA 3SJJA 4FJJA 5FPNA 1FKPA 3VQPA 3V9XA 2F9TA 4DG1A 4FLYA 3TTDA 4EHUA 1G15A 4DB3A 1WAJA 4LSLA 3QB0A 4DKWA 5HBMA 1Z26A 2WC9A 1GLEG 2NRWA 3DAWA 2FSNA 1YUWA 2NUBA 4IEIA 2P5OA 1H1VA 1U04A 3ZETB 4BE0A 3QEXA 1L3SA 2IVPA 1NK0A 2UUAK 3KZBA 5KQ8A 3LWLA 3O6WA 3CC7N 3H1VX 1OH8A 4JI2K 5LJWA 3GDQA 4B8AB 3GG4A 1BWFO 2RN2A 3AO3A 4BROA 3S41A 4DR4K 4KH5A 3TAFA 1YT3A 2EX3A 2WOMA 1N5YA 4R79A 3NVKA 3A8YA 4KH4A 4XH1A 1L3TA 4DV1K 4CZEA 4FM2A 4O8KA 5AQMA 4O5BA 3U4LA 5DK5A 2C1IA 1KD1O 4E3SA 1HYZA 3THYB 5M1OA 5BR8K 1TK8A 3QEPA 4I9QA 4FM0A 1B9FA 4GNIA 5AQRA 2RPIA 3AA4A 1SZ2A 2OZSA 4LSNA 4EIAA 3C6TA 4BR0A 5T7BA 4BACA 5HRRA 3ULDA 4DU4A 1NJXA 4B9TA 4KHPK 4W5OA 1O13A 3Q7BA 1S22A 1VRTA 4JI6K 4FJGA 3JAMO 2GWJA 3NFAA 5BN9A 3DRRA 2NRZA 4DTJA 3BDPA 3A5MC 1J6ZA 5C25A 4GKJK 1BA0A 5E26A 1RT7A 4LF7K 3A2FA 2G8IA 4LF8K 3SZ2A 5AQWA 3HL8A 4M3TA 4FL9A 4Z4IA 4CZFA 4ZTFA 2YHXA 1N6QA 4PWDA 1NK5A 1OKJA 2HF3A 4KKOA 1LWEA 1NJWA 3W0LA 4BECA 4DQSA 3NGYA 5GAEP 5KRSA 1NKEA 1VQ8N 4AM6A 3DYAA 2A6AA 4FWNA 5LMNK 2P9LB 4OVLA 3SQ1A 3LDLA 4CBUA 3K59A 4BRFA 2IAJA 1MA9B 2A42A 1SQKA 3VEYA 3MEDA 4B9NA 1Q82O 4OJRA 4CJFA 3RRHA 2B6AA 1QQMA 4FLZA 4CBXA 2RF2A 2DTUA 4CHYA 3VERA 4CEAA 2E1ZA 3CQXA 1HRHA 4CF1A 4CZMA 4OKEA 2QKBA 4BY9C 3O9TA 4JS4A 4FK4A 4DTXA 2D5RA 4M3ZA 3SJHA 4YOVA 2LSNA 2I5JA 4BRIA 4LFAK 3L3UA 3WNHA 5AQIA 3L2UA 2P9SA 3O80A 2A1SA 1C0MA 3P83D 3ZYYX 3ID8A 1VAZA 1DKGD 3CJBA 1QE1A 1KSPA 4HWIA 2ASMA 1L5UA 4DQRA 3ZT3A 4WFAL 4CHOA 3CCEN 4FWRA 3AA5X 1NJZA 2P1JA 2P9NB 3KLFA 1JXEA 3CJCA 2HNYA 4CCHA 4CJEA 1KQSM 4JKHA 3HSCA 3IKMA 3SUNA 4KTQA 1WSHA 3NDKA 3DLGA 2CH5A 4DCHA 3CFRA 2QWNA 3QNNA 4X65K 1T44A 5LMUK 2OA8A 2W6LA 3JS6A 4IDKA 5GIPA 3C95A 4DTUA 2Q36A 4IFVA 3QERA 2BGGA 3PY8A 2ZM6K 3P39A 5J2QA 4DFJA 3T1HK 4EAHD 3RR8A 3O4NA 4IFEA 3V9ZA 3SQ0A 2A1RA 3MX2A 4DSLA 1X9JA 2O8CB 4CGJA 1MWMA 5AQPA 4CEDA 3AO2A 3ENHA 1NWKA 3KK3A 4CK3A 3D6RA 2HVIA 3MEGA 3AA3A 3AAQA 3AGRA 3VQ8A 2JWLA 1BU6O 1RBRA 1TKXA 3VA0A 2O8BA 4NLBA 3S9HA 4DV2K 3VEVA 2UXCK 4B3SK 2VG5A 2AJQA 5FLXO 3THVA 1JXBA 1P90A 2ZJQL 1OVYA 4IG0A 4CJ4A 1CXUA 3ZT0A 4KB1A 4JKCA 1QHTA 4IOXA 3H46O 1QSYA 2KFNA 5JLHA 3LDPA 3MXMA 3F9KA 3BP8A 3HT3A 4JD2B 1HJRA 2P9UB 2PYLA 3MMVA 3K9KA 4BRGA 2RKIA 2BE2A 2ZQBA 4AQYK 3PUFA 2HHIA 5EU7A 4DHYA 1VQKN 2E2PA 4M7YA 3VQQA 3VEOA 3O9UA 1NGCA 1TUYA 4NO7A 4BVPA 4B1ZA 4M3YA 4DR7K 1VSJA 3SAGA 5EOYA 2GUIA 4FWKA 4IDHA 3CC4N 4CJRA 3CMEN 1RDWX 4CJ7A 3CFPA 3ZSQA 4PQUA 4U67L 1ZBIA 1TL1A 4B08A 4CZJA 2ITMA 4OO1J 3M1FA 2ASPA 4LF9K 3L4IA 5AJ3K 4G1QA 3EE9A 1R59O 3P5JA 3WNEA 4G9ZA 3ZSWA 4FZZA 3SK3A 4CF2A 4DV6K 3ZSXA 1WSJA 4CGIA 2QW9A 4GMJB 1KRPA 3K0SA 1NKCA 4Z0UA 2Z1GA 1QHAA 1X1PA 3OYLA 4AHRA 1VQNN 4FCYA 3V9WA 2KW4A 3K5MA 1OH6A 1V4TA 5EXWA 3MWPA 3CCUN 4MO5A 4HUEA 2G8FA 1VQ6N 3O3GA 3HYFA 3K5LA 1HNXK 5KGWA 1SKRA 3NAEA 2ZJRL 2HNDA 1HPMA 3MN9A 3CQYA 3SLCA 2XO7A 4CZIA 3SMPA 5HOOA 5FRMA 1BHLA 3VGMA 5ADXA 3O08A 1TVRA 1VRUA 1M1KO 4UQGA 4QS8A 2O8DA 4E89A 4IJNA 3SV4A 1NU0A 1LAWA 3CF5L 3CYMA 1NGAA 5JS1A 3D2FA 3HVTA 2G8HA 2F8SA 3ZT4A 3MK6A 3BZKA 3AVHA 3HTVA 3ID6A 4BE1A 4CF9A 4GKKK 3V9UA 4HCCA 3OS2A 4JYAK 3DXKA 1CZAN 4M41A 3CG7A 4B9LA 4ZHRA 3M8QA 3PO5A 4CEFA 1VSIA 3HM8A 1YTUA 2P9SB 4FWOA 3RTVA 1IH7A 1ZBHA 4B1UB 4DV0K 4E1NA 4DF8A 1D4XA 3NHGA 3NBPA 1REVA 4GV6A 2O8DB 2YNFA 2E2QA 3CYGA 3FFKB 4E7KA 2P9NA 1NK9A 3T3FA 3FZFA 3SQ2A 3NCIA 1RNHA 4A5AA 4NLCA 2HBLA 1ZC6A 1RT4A 1YJ9N 4H5VA 1IBMK 3VPZA 4FJHA 5LJVA 3HP9A 2FBXA 2HHVA 4ILGB 2YNGA 3KKSA 3ENOA 2ZF5O 4RWTA 4V19S 1ESVA 4LH5A 2FF3B 2R7YA 3T19A 2UUBK 3IUCA 3P38A 1KCFA 4IKFA 4E19A 2HMIA 3ALYA 3LANA 1HKCA 2E20A 1LAVA 1QQOA 1ATSA 3J7AP 4HHTA 4IOAL 3QO9A 1T8EA 4KV8A 1S3XA 4A62A 3K5OA 3M3ZA 4GY2B 3T1YK 1ASWA 4NYNA 3KD5E 2YKNA 1L3UA 4H5WA 1KVCA 1S6PA 3CCJN 2E6MA 2QWQA 4LFBK 3DRSA 2OTLN 1A5XA 1S6QA 4JKGB 1XC9A 4BR2A 1JLQA 5C2FA 4OKKA 1E4FT 4E0DA 4K42A 1Q8IA 1YIJN 1E4GT 2QXFA 4M7XA 3LDSA 1BA1A 4F2RA 3VQ9A 4FWSA 3H3NO 4CI6A 1A5WA 3ZX2A 1HR0K 3ULEB 1RDUA 3S3MA 1W97L 3CQ8A 3PSFA 3OS0A 1UOCA 4JNEA 3WEEB 3L2WA 2X74A 3SV3A 2VWBA 4QS7A 1IJJA 1NG9A 1EP4A 5JVHL 1DEJA 3D7EO 3K57A 4AHSA 3DRPA 1SS6A 3VQDA 1ATRA 3DOKA 1LW0A 1DLOA 4W5RA 2PZSA 2A3ZA 3C94A 2IS3A 3VF2A 1NK7A 4PKIA 4JS5A 4KTZA 3PX0A 1R0AA 1NK6A 3M8RA 4BRKA 3I56N 3KLGA 4DUYK 4FSVA 4B9VA 3HRGA 4RTFD 1ITGA 3CCQN 4DUZK 3R9PA 2NRRA 4FJNA 2VCPA 5JICA 4AM7A 4FOEA 3QICA 4W5QA 3E1YA 3NF7A 4EP4A 5BPNA 5C24A 4QAGA 5GINA 3G6EN 2Q1NA 4DR3K 3W3DA 4DSJA 4FYDA 2UU9K 4XEIA 2D0PA 4X62K 1DT9A 3C6HA 3J7YP 5H1SQ 5I9EB 3EZWA 4NCGA 4LD0A 4B9UA 3U8XA 1BISA 1W7AA 3M8SA 1TAQA 5AQFA 1BQNA 1EETA 3M6GA 2FC0A 3DXKB 4LF5K 2OTJN 3PV8A 1O1WA 3VEXA 1GOCA 3KWIA 2PAVA 1DTTA 2VQFK 1T6DA 4B3OA 1S1XA 2X6SA 2UXDK 5CE3A 4NB4A 4TSXA 2P9IA 2VG6A 1KAZA 4BRDA 3UKRA 4DFKA 4PUOA 4Z94A 1A5VA 3ATUA 5A2QO 1KFSA 1Z6RA 3BGRA 4CJWA 4EP5A 1KLNA 3VOVA 4JLHA 3KHYA 1HNWK 4CEQA 4DS4A
chains in the Genus database with same CATH topology
3SJHA 4YOVA 4H0TB 4BR9A 2FXUA 4FWLA 4ISGA 4B1YB 3WXKA 4H0XB 1TYQB 4BR4A 3J7ZO 5TKWA 1YITN 2KHOA 3CCLN 1KAYA 4BRIA 2D1KA 1QVFM 5AZIA 4JKDA 2VGMA 1XQSC 4BR5A 5JMVA 1ILYA 5AQIA 4A59A 3C6AA 4PKGA 3QBWA 2ZWHA 1GLJO 1NGIA 4UY8O 3SBGA 4JN4A 2P9SA 3O80A 3HZ6A 2NRVA 3ZYYX 3PIPL 1GLBG 4BC5A 3HBTA 3HI0A 3ID8A 3CCMN 5BN8A 1VAZA 3CETA 1DKGD 3CJBA 1M90O 4HWIA 2ASMA 4L3QA 2Q97A 3GL1A 4WFAL 1NGGA 2RE2A 3LM2A 5AQOA 3CCEN 4FWRA 4WCEL 4HTLA 1NBWA 3ATVA 3CIPA 2P9NB 2QWOA 4M63C 4PHTX 3CJCA 4WFBL 1KAXA 4H0OA 1BG3A 4BRHA 4JKHA 3G71N 1KQSM 3HSCA 1VQPN 2BTFA 3IKMA 2VYPA 5E84A 5BR9A 3CXCM 3EKSA 2W40A 4B1XB 2CH5A 3FZLA 4QS9A 4BG9A 4DCHA 2QWNA 1T44A 3LDQA 1QZ6A 4H0PA 5AZJA 2HOEA 4JKGA 3JS6A 3WEEA 3A0IX 3D2EA 4JKFA 3WXJA 5GIPA 2Q36A 2IIRA 3ZX3A 3WQUA 3P39A 4FOIA 4F9OA 5KPTA 4JHDB 3CCRN 3DWLA 3EN9A 4I6MB 3PLAA 1NGBA 3O9SA 3VENA 3FE1A 3TTFA 3MWTA 4EAHD 2P9KA 3R1XA 1JCEA 4IFEA 4C1NK 4BVOA 3TTCA 2W00A 1YJNN 3D2EB 1NLVA 5DM7L 3VMFB 3MX2A 3A5OC 2GUPA 5AR0A 1Q18A 1EO1A 1X9JA 2QWLA 1MWMA 3F9MA 2P9PB 3F5TA 5AQPA 4BQZA 1ATNA 4IEEA 4FVUA 3ENHA 5B8HA 2QXLA 1NWKA 3FGUA 3MN5A 3D6RA 3G25A 4CZLA 5F1XA 3AAQA 3AGRA 2JWLA 3LDOA 1BU6O 4EHTA 5AQHA 3P4IA 1YXQA 5C15A 5TKYA 4J8FA 2P9IB 3UB5A 4NLBA 1VQMN 2E88A 3GBTA 3VEVA 3FR0A 3CI5A 1NGEA 3D2FB 4JKEA 4ISEA 3WXLA 4IO9L 4DQ8A 1LCUA 3MN6A 4JEPA 4LC9B 1P90A 3O4WA 2ZJQL 1OVYA 4GV3A 1VQLN 3KWGA 4JKCA 4B1WB 4IOXA 3H46O 3OHRA 4H5TA 3B8AX 5JLHA 3LDPA 5AQGA 3I55N 5BRHA 2NRTA 2YX6A 3BP8A 4KBOA 2ZGYA 4MDAA 4O8UA 3WUHA 4ILJA 4JAXA 5F2RA 1U2VB 4JD2B 2P9UB 4H03B 2HBMA 5CR4A 3E9LA 3MMVA 3A5LC 2YHYA 3K9KA 4H5RA 3C7NB 5AQXA 4BRGA 2EWSA 3OBWA 5EVZA 4DHYA 3VESA 3CJ1A 1VQKN 2E2PA 5AQNA 4M7YA 2YHWA 3OW2M 1Q7YO 3CCSN 3VEOA 3O9UA 3EKUA 1NGCA 1GLDG 1TUYA 1X3MA 4NO7A 2GELA 4IJAA 4B1ZA 4BVPA 1N8RO 2NRHA 3CC2N 3SAGA 5EOYA 3H6EA 3QBXA 5AFUA 4FWKA 1U2VA 1YHQN 3Q7CA 4IDHA 3CC4N 2DPNA 3LM9A 3CMEN 1ZXOA 1RDWX 2P9UA 4CJ7A 4U67L 2V7YA 3O1WA 2ZGZA 2ITMA 4CZJA 4OO1J 3SMSA 3M1FA 4OPHA 2ASPA 1BUPA 4BRQA 1NGDA 2A40A 2YJFA 3L4IA 4WFNL 1K8KB 3EE9A 1JCFA 1GLFO 1R59O 3MCAB 5M1PA 1Z05A 3SBTA 3FLCO 2QA4N 4GV9A 3BEXA 3FZHA 1TUUA 4G9ZA 3RSEA 1HX1A 1K8AO 3O9QA 4JK8A 5M1QA 4JHDA 3SK3A 2QI2A 3MCPA 4Y0WA 4YDUC 1G99A 4MO4A 2IVNA 2A41A 3VGKA 3E9OA 3WQTA 2QW9A 2D4WA 3CHWA 3LL3A 4FWMA 4U7BA 1ZBSA 2E2OA 3KVGA 3O5BA 3OA9A 3U9ZA 3CJ9A 1QHAA 4AF1A 4KH6A 1KXPA 1NJIO 1HJOA 1K73O 3O9RA 4BQLA 2F7TA 3WXMB 1VQNN 2NRXA 3TSUA 2P9PA 4MLHA 1EQYA 3CD6N 2IVOA 2F9WA 3O8MA 1V4TA 3WXIA 3DXMB 5EXWA 3MWPA 3CCUN 4MO5A 3OBYA 5AQLA 4FO0A 2I7PA 3SAHA 5GAHP 1XUPO 3K9JA 4BEBA 1K9MO 1VQ6N 2JWKA 3AAPA 4YOUA 4BE7B 3GOIA 3G4SN 3VTIA 5GADP 3N4PA 2ZJRL 4XH5A 3CERA 3A5NC 1HPMA 1U6ZA 4YOYA 2W41A 3MN9A 3CQYA 3SLCA 4CZIA 5AQVA 2FF6A 5AZIB 5BRFA 3SMPA 5HOOA 2YI1A 3UKUA 1HKGA 3N4QA 1NGJA 3VGMA 5C10A 2KLAA 3U9DA 5C2DA 3I33A 4BGAA 5ADXA 3O08A 3VETA 1GLCG 2ZJPL 1M1KO 4QS8A 5DM6L 1BDGA 2V52B 4IJNA 4FWQA 5HL7L 4IZ9A 3T7ZA 1C0FA 3CF5L 1Q86O 3NMUA 5KQDA 3IDHA 4BRLA 1NGAA 2NNWA 1S72N 4C1NI 5AQZA 4E1JA 2J4RA 3FZMA 3D2FA 3HOTA 1VQON 3MX5A 4WQ5A 3UKUB 3QMLA 2KKZA 4BRCA 5C0YA 1VQ7N 1XC3A 4IWVA 3H1QA 2WUSA 3DXMA 1YVNA 3MK6A 4OPAA 4CZHA 3HTVA 3ID6A 4GVEA 1Q81O 3C0BA 1NGHA 4FPAA 2QEXN 4IXCA 1TYQA 3DXKA 5KPRA 1CZAN 2YCHA 5JVGL 4BC3A 3P31A 3TU5A 5AFUH 5AQYA 3VTHA 1BOTO 2BH1A 3HM8A 4RCHA 5AQTA 1GLLO 2P9SB 1HUXA 3R3LA 2GX9A 4FWOA 2RHKA 4B1UB 2Q2RA 4JK9A 1KC8O 2A5XA 3DJCA 4YORA 4BC4A 2WFBA 4H0VB 4BRMA 3AY9A 1D4XA 2GTDA 4B9QA 4CBWA 3ULEA 2HBKA 2UYTA 2H3GX 2V7ZA 4GV6A 2E2QA 3NVMA 3QDKA 3FFKB 5GAGP 1MDUB 2P9NA 2CGKA 3FZFA 5ADXH 4JKBA 4WYBA 3QFPA 5F0XA 3AARA 5MLCQ 4A5AA 2FSJA 4NLCA 4CD3A 2HBLA 3HOSA 1ZC6A 1YJ9N 2HBJA 4H5VA 4YOXA 2YJEA 4BG8A 3BF3A 3ZX0A 3VPZA 4BR7A 2CGJA 3PIOL 3TSPA 4A61A 5FPDA 5LJVA 1MWKA 2CGLA 2E8AA 1VQ5N 3VF6A 4YDUA 5M1FA 3M5RA 1QZ5A 5BPLA 5GIOA 2Q0RA 3VEZA 5KPZA 4BGBA 3EL2A 3C7NA 3CPEA 4ILGB 4PKHA 3IFRA 1SAZA 3ENOA 1T3VA 2ZF5O 3TPQA 4RWTA 1ESVA 1NM1A 3MDQA 3R6MA 2FF3B 2QWRA 4BRPA 3IUCA 3ZETA 1YI2N 4A2AA 5FPNA 2PFUA 2E1YA 3P38A 4CD1A 4EFHA 1HLUA 3E9PA 2F9TA 3BF1A 3LDNA 1QQNA 3TTDA 5AQJA 1HKCA 4EHUA 2E20A 4I6MA 5AQSA 4DB3A 2AA4A 2P9KB 1DGKN 4H0YB 3QB0A 4DKWA 3ZEUB 2QWMA 1QQOA 1ATSA 2WC9A 4IOAL 1GLEG 1S3XA 4PL8A 2NRWA 4A62A 3DAWA 2NLXA 3M3ZA 4K43A 2FLOA 2FSNA 1YUWA 2NZTA 4GY2B 4IEIA 1H1VA 4ISFA 1IG8A 2Q31A 3ZETB 2IVPA 3CC7N 3KZBA 5KQ8A 3R8EA 3O6WA 3H1VX 4H5WA 4A5BA 3CCJN 1T6CA 5LJWA 4WF9L 2QWQA 3GDQA 3GE1A 3GG4A 2OTLN 1BWFO 4JKGB 3I8BA 4BRAA 3TSQA 4BR2A 4BROA 5C2FA 5M1NA 2P9LA 3S41A 1E4FT 4KH5A 1C0GA 3L4QA 1V4SA 2VGNA 3NVKA 4R79A 4K42A 4MLEA 1YIJN 1WOQA 2E2NA 1E4GT 2HF4A 4M7XA 2QM1A 3A8YA 4KH4A 4XH1A 1NMDA 1BA1A 1RFQA 4K41A 4WQ4C 4JKAA 4FWSA 3H3NO 4CZEA 4CI6A 3RVCA 4O8KA 5AQMA 3ZX2A 4B1VA 1P8ZA 5EX5A 2D0OA 4ILHA 3ULEB 4FWPA 1RDUA 3U4LA 2GEMA 4JD2A 2C1IA 1W97L 3CPWM 3C65A 1KD1O 5AZJB 5M1OA 4YOTA 4JNEA 2FSKA 3WEEB 5C12A 1VQ4N 4BRNA 2CH6A 3VGLA 2VWBA 1WUAA 4QS7A 4GNIA 1IJJA 4CZGA 5AQRA 4C23A 2GWKA 1JJ2M 1SZ2A 5JVHL 1BO5O 1DEJA 3D7EO 5ELZA 3E66A 4EIAA 1SS6A 1ATRA 4BR0A 4PL7A 2V51B 1QVGM 1LOTB 3DLLL 2A3ZA 3VF2A 1O13A 3Q7BA 1S22A 4PKIA 2AP1A 4BRKA 3I56N 5JLFA 4FSVA 3VF4A 4XH4A 3HRGA 3O1BA 4RTFD 4A2BA 2GWJA 5BN9A 3CCQN 3RSEB 4FPBA 3VEWA 3R9PA 2NRRA 2NRZA 2VCPA 3UE5A 5JICA 2HSTA 3A5MC 4AM7A 1VQ9N 1J6ZA 4K25A 4WQ5C 1BA0A 4FOEA 5E26A 3QICA 3IMXA 3UKRB 3E1YA 3FZKA 5BPNA 5BPMA 5FPEA 5GINA 3G6EN 2Q1NA 5AQWA 3W3DA 1GLAG 3T69A 3J8AA 3EE8A 4FL9A 5LY3A 4XEIA 2D0PA 4CZFA 1YJWN 2YHXA 3CJ7A 1DT9A 3C6HA 1X3NA 5H1SQ 5I9EB 1OKJA 2HF3A 2WBNA 3H45C 5AQUA 3W0LA 4BECA 3EZWA 1W2BM 3CCVN 4XJXA 1JCGA 3KK7A 5AQKA 5GAEP 3BUZB 1Y64A 1VQ8N 4AM6A 4IOCL 4BC2A 1NGFA 2PBDA 2A6AA 3U8XA 3JXUA 4FWNA 5AQFA 5M1KA 2P9LB 3M6GA 3QFUA 3LDLA 3ZEUA 3DXKB 4O5FA 1YF5L 3CJAA 4BRFA 4CBUA 5CHIA 3L6QA 3MN7A 2OTJN 1MA9B 2A42A 1SQKA 1HKBA 3VEYA 4H5NA 2I7NA 5EY4A 3VEXA 1Q82O 3KWIA 3AGKA 3ENBA 4WQ4A 2PAVA 4A57A 2OANA 4IO8A 1YAGA 1QQMA 1T6DA 4YOWA 4CBXA 3EO3A 2BUPA 2Q0UA 3H3OB 5CE3A 4NB4A 2C1GA 5BRDA 2P9IA 1KAZA 2ASOA 4BRDA 4MDBA 3UKRA 3VERA 5FPMA 2E1ZA 3CQXA 3WT0A 4CZKA 4Z94A 3ATUA 5AQQA 2QWPA 4CZMA 5BREA 1Z6RA 1K8KA 1RGIA 3SAFA 4BY9C 2HMPA 3O9TA 3CMAN 3F2KA 3VOVA 3L0QA 3KHYA 2QTDA 4BREA 4JK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJH A;  4H0T B;  4BR9 A;  2FXU A;  4FWL A;  4ISG A;  4B1Y B;  3WXK A;  4H0X B;  1TYQ B;  4BR4 A;  2KHO A;  1KAY A;  4BRI A;  2D1K A;  5AZI A;  5JMV A;  1XQS C;  4BR5 A;  5AQI A;  4PKG A;  3QBW A;  2ZWH A;  1GLJ O;  1NGI A;  4JN4 A;  2P9S A;  3O80 A;  3HZ6 A;  1GLB G;  4BC5 A;  3HBT A;  3HI0 A;  3ID8 A;  5BN8 A;  3CET A;  1DKG D;  3CJB A;  4HWI A;  2ASM A;  4L3Q A;  2Q97 A;  3GL1 A;  1NGG A;  3LM2 A;  5AQO A;  4FWR A;  4HTL A;  1NBW A;  3ATV A;  3CIP A;  2P9N B;  2QWO A;  4M63 C;  3CJC A;  1KAX A;  4H0O A;  1BG3 A;  4BRH A;  3HSC A;  2BTF A;  2VYP A;  5E84 A;  5BR9 A;  3EKS A;  2W40 A;  4B1X B;  2CH5 A;  3FZL A;  4QS9 A;  4BG9 A;  4DCH A;  2QWN A;  1T44 A;  3LDQ A;  1QZ6 A;  4H0P A;  5AZJ A;  2HOE A;  3JS6 A;  3WEE A;  3A0I X;  3D2E A;  3WXJ A;  2Q36 A;  2IIR A;  3ZX3 A;  3WQU A;  4FOI A;  4F9O A;  5KPT A;  4JHD B;  3DWL A;  3EN9 A;  4I6M B;  1NGB A;  3VEN A;  3FE1 A;  4EAH D;  2P9K A;  1JCE A;  4BVO A;  3D2E B;  1NLV A;  5AR0 A;  3A5O C;  2GUP A;  1Q18 A;  1X9J A;  2QWL A;  1MWM A;  3F9M A;  2P9P B;  5AQP A;  4BQZ A;  1ATN A;  3ENH A;  5B8H A;  2QXL A;  1NWK A;  3FGU A;  3MN5 A;  3G25 A;  4CZL A;  5F1X A;  3AAQ A;  3LDO A;  1BU6 O;  4EHT A;  5AQH A;  3P4I A;  1YXQ A;  5TKY A;  4J8F A;  2P9I B;  3UB5 A;  2E88 A;  3GBT A;  3VEV A;  3FR0 A;  3CI5 A;  1NGE A;  3D2F B;  3WXL A;  4ISE A;  4DQ8 A;  1LCU A;  3MN6 A;  4LC9 B;  3O4W A;  4B1W B;  3H46 O;  3OHR A;  4H5T A;  3B8A X;  5JLH A;  3LDP A;  5AQG A;  5BRH A;  4KBO A;  3WUH A;  3BP8 A;  4BRQ A;  2ZGY A;  4JAX A;  5F2R A;  1U2V B;  4JD2 B;  2P9U B;  4H03 B;  3MMV A;  3A5L C;  2YHY A;  4H5R A;  4BRG A;  3C7N B;  5AQX A;  2EWS A;  5EVZ A;  4DHY A;  3VES A;  3CJ1 A;  2E2P A;  5AQN A;  4M7Y A;  2YHW A;  3VEO A;  3EKU A;  1NGC A;  1GLD G;  1TUY A;  1X3M A;  4NO7 A;  2GEL A;  4IJA A;  4B1Z A;  4BVP A;  2NRH A;  5EOY A;  3H6E A;  3QBX A;  5AFU A;  4FWK A;  1U2V A;  2DPN A;  3LM9 A;  1ZXO A;  1RDW X;  2P9U A;  4CJ7 A;  2V7Y A;  3O1W A;  2ZGZ A;  2ITM A;  4CZJ A;  3SMS A;  3M1F A;  2ASP A;  1BUP A;  1NGD A;  2A40 A;  2YJF A;  3L4I A;  1K8K B;  1JCF A;  1GLF O;  1R59 O;  1Z05 A;  3FLC O;  3BEX A;  3FZH A;  1TUU A;  3RSE A;  1HX1 A;  4JHD A;  3SK3 A;  3MCP A;  4Y0W A;  4YDU C;  1G99 A;  4MO4 A;  2IVN A;  2A41 A;  3VGK A;  3WQT A;  2QW9 A;  2D4W A;  3CHW A;  3LL3 A;  4FWM A;  1ZBS A;  2E2O A;  3KVG A;  3O5B A;  3U9Z A;  3CJ9 A;  1QHA A;  1KXP A;  1HJO A;  4BQL A;  2P9P A;  4MLH A;  1EQY A;  2IVO A;  2F9W A;  3O8M A;  1V4T A;  3WXI A;  3DXM B;  5EXW A;  4MO5 A;  5AQL A;  4FO0 A;  2I7P A;  1XUP O;  3AAP A;  3GOI A;  4XH5 A;  3CER A;  3A5N C;  1HPM A;  1U6Z A;  2W41 A;  3MN9 A;  3CQY A;  3SLC A;  4CZI A;  5AQV A;  2FF6 A;  5AZI B;  5BRF A;  3SMP A;  2YI1 A;  3UKU A;  1HKG A;  1NGJ A;  3VGM A;  3U9D A;  3I33 A;  4BGA A;  5ADX A;  3O08 A;  3VET A;  1GLC G;  4QS8 A;  1BDG A;  2V52 B;  4IJN A;  4FWQ A;  4IZ9 A;  1C0F A;  5KQD A;  3IDH A;  4BRL A;  1NGA A;  5AQZ A;  4E1J A;  2J4R A;  3FZM A;  3D2F A;  4WQ5 A;  3UKU B;  3QML A;  4BRC A;  1XC3 A;  4IWV A;  3H1Q A;  2WUS A;  3DXM A;  1YVN A;  3MK6 A;  4CZH A;  3HTV A;  3C0B A;  1NGH A;  4FPA A;  4IXC A;  1TYQ A;  3DXK A;  5KPR A;  1CZA N;  2YCH A;  4BC3 A;  3TU5 A;  5AFU H;  5AQY A;  1BOT O;  3HM8 A;  4RCH A;  5AQT A;  1GLL O;  2P9S B;  1HUX A;  4FWO A;  4B1U B;  2Q2R A;  2A5X A;  3DJC A;  4BC4 A;  4BRM A;  4H0V B;  3AY9 A;  1D4X A;  2GTD A;  4B9Q A;  4CBW A;  3ULE A;  2UYT A;  2V7Z A;  2H3G X;  2E2Q A;  3QDK A;  3FFK B;  1MDU B;  2P9N A;  2CGK A;  3FZF A;  5ADX H;  4WYB A;  3QFP A;  5F0X A;  3AAR A;  2FSJ A;  4CD3 A;  1ZC6 A;  4H5V A;  2YJE A;  4BG8 A;  3BF3 A;  3ZX0 A;  3VPZ A;  4BR7 A;  2CGJ A;  4A61 A;  5FPD A;  5LJV A;  1MWK A;  2CGL A;  2E8A A;  3VF6 A;  4YDU A;  1QZ5 A;  5BPL A;  2Q0R A;  3VEZ A;  5KPZ A;  4BGB A;  3EL2 A;  3C7N A;  4PKH A;  3IFR A;  3ENO A;  1SAZ A;  2ZF5 O;  3TPQ A;  4RWT A;  1ESV A;  1NM1 A;  3MDQ A;  3R6M A;  2FF3 B;  2QWR A;  4BRP A;  3IUC A;  3ZET A;  4A2A A;  5FPN A;  2E1Y A;  4CD1 A;  4EFH A;  1HLU A;  2F9T A;  3BF1 A;  3LDN A;  1QQN A;  5AQJ A;  1HKC A;  4EHU A;  2E20 A;  4I6M A;  5AQS A;  4DB3 A;  2AA4 A;  2P9K B;  1DGK N;  4H0Y B;  3QB0 A;  3ZEU B;  2QWM A;  1QQO A;  1ATS A;  1GLE G;  1S3X A;  4PL8 A;  4A62 A;  3DAW A;  2NLX A;  3M3Z A;  4K43 A;  2FLO A;  2FSN A;  1YUW A;  2NZT A;  4GY2 B;  1H1V A;  4ISF A;  1IG8 A;  2Q31 A;  3ZET B;  2IVP A;  3KZB A;  5KQ8 A;  3R8E A;  3O6W A;  3H1V X;  4H5W A;  1T6C A;  5LJW A;  2QWQ A;  3GDQ A;  3GE1 A;  3GG4 A;  1BWF O;  4BRA A;  3I8B A;  4BR2 A;  4BRO A;  2P9L A;  3S41 A;  1E4F T;  1C0G A;  1V4S A;  4K42 A;  4MLE A;  1WOQ A;  2E2N A;  1E4G T;  2HF4 A;  4M7X A;  2QM1 A;  3A8Y A;  4XH1 A;  1NMD A;  1BA1 A;  1RFQ A;  4K41 A;  4WQ4 C;  4FWS A;  3H3N O;  4CZE A;  4CI6 A;  4O8K A;  5AQM A;  3ZX2 A;  4B1V A;  1P8Z A;  5EX5 A;  2D0O A;  3ULE B;  4FWP A;  3U4L A;  2GEM A;  4JD2 A;  5AZJ B;  4JNE A;  2FSK A;  3WEE B;  4BRN A;  2CH6 A;  3VGL A;  2VWB A;  1WUA A;  4QS7 A;  4GNI A;  1IJJ A;  4CZG A;  5AQR A;  4C23 A;  2GWK A;  1SZ2 A;  1BO5 O;  1DEJ A;  3D7E O;  5ELZ A;  4EIA A;  1ATR A;  4BR0 A;  4PL7 A;  2V51 B;  1LOT B;  2A3Z A;  3VF2 A;  1S22 A;  4PKI A;  2AP1 A;  4BRK A;  5JLF A;  4FSV A;  3VF4 A;  4XH4 A;  3O1B A;  4RTF D;  4A2B A;  2GWJ A;  5BN9 A;  3RSE B;  4FPB A;  3VEW A;  3R9P A;  3UE5 A;  2VCP A;  5JIC A;  3A5M C;  4AM7 A;  1J6Z A;  4K25 A;  4WQ5 C;  1BA0 A;  4FOE A;  5E26 A;  3QIC A;  3IMX A;  3UKR B;  3FZK A;  5BPN A;  5BPM A;  5FPE A;  2Q1N A;  5AQW A;  3W3D A;  1GLA G;  3J8A A;  4FL9 A;  5LY3 A;  4XEI A;  2D0P A;  4CZF A;  2YHX A;  3CJ7 A;  1X3N A;  5I9E B;  1OKJ A;  2HF3 A;  3H45 C;  5AQU A;  3W0L A;  3EZW A;  1JCG A;  5AQK A;  3BUZ B;  1Y64 A;  4AM6 A;  4BC2 A;  1NGF A;  2PBD A;  2A6A A;  3U8X A;  3JXU A;  4FWN A;  5AQF A;  2P9L B;  3M6G A;  3QFU A;  3LDL A;  3ZEU A;  3DXK B;  4O5F A;  3CJA A;  4BRF A;  4CBU A;  3L6Q A;  3MN7 A;  1MA9 B;  2A42 A;  1SQK A;  1HKB A;  3VEY A;  4H5N A;  2I7N A;  5EY4 A;  3VEX A;  4WQ4 A;  2PAV A;  2OAN A;  4IO8 A;  1YAG A;  1QQM A;  1T6D A;  4CBX A;  3EO3 A;  2BUP A;  2Q0U A;  3H3O B;  5CE3 A;  4NB4 A;  5BRD A;  2P9I A;  1KAZ A;  2ASO A;  4BRD A;  3UKR A;  3VER A;  5FPM A;  2E1Z A;  3CQX A;  3WT0 A;  4CZK A;  4Z94 A;  3ATU A;  5AQQ A;  2QWP A;  4CZM A;  5BRE A;  1Z6R A;  1K8K A;  1RGI A;  2HMP A;  3VOV A;  3L0Q A;  3KHY A;  4BRE A; 
#chains in the Genus database with same CATH topology
 4H0T B;  5FRN A;  4FWL A;  4Y1D A;  4B1Y B;  4H0X B;  1TYQ B;  2YKM A;  4BR4 A;  2FBY A;  3OYF A;  3ZSV A;  4FZX C;  1QQC A;  3CCL N;  2D1K A;  5AZI A;  1LV5 A;  1XQS C;  4BR5 A;  4DV7 K;  3QBW A;  2ZWH A;  1GLJ O;  4UY8 O;  4CJ3 A;  1C1C A;  4RW9 A;  2NRV A;  4F2S A;  5BN8 A;  1NK4 A;  3IG1 A;  3G0Z A;  4CW7 B;  2X6N A;  3RRG A;  2Q97 A;  3VQC A;  3GL1 A;  1C1B A;  2RE2 A;  3HO1 A;  1NMN A;  3S5T A;  4KHN A;  4HTL A;  4PHT X;  4FLT A;  4FLV A;  4WFB L;  5CZ2 A;  1KAX A;  1C0T A;  1VQP N;  1C0U A;  4BWM A;  2VYP A;  5BR9 A;  2F8T A;  3HJF A;  4DV4 K;  2W40 A;  3DI6 A;  4B1X B;  3JSM A;  1E3M A;  4QS9 A;  4CHQ A;  4BG9 A;  3BY5 A;  1BL3 A;  3ZT2 A;  2GV9 A;  4W5N A;  4BDP A;  5AZJ A;  2HOE A;  1LWC A;  3ASM A;  2W42 A;  1QSL A;  1L3V A;  3HPG A;  3EYZ A;  4FOI A;  3PLA A;  3O9S A;  3VEN A;  4N56 A;  1N36 K;  3AVK A;  1JCE A;  5IT9 O;  4BVO A;  3TTC A;  2HHQ A;  1YJN N;  3D2E B;  2E5L K;  2D0A A;  3VMF B;  5AR0 A;  1EO1 A;  4CJS A;  2JGU A;  4DR1 K;  3RMA A;  1ATN A;  4FVU A;  4FJL A;  2QXL A;  4NCA A;  3FGU A;  4CZL A;  5F1X A;  4K8X A;  1SV5 A;  5C15 A;  3L3V A;  3VA3 A;  4AHV A;  5I42 A;  3GBT A;  3FR0 A;  3D2F B;  4JKE A;  4IBN A;  4DQ8 A;  3MN6 A;  3NGI A;  4DTN A;  1FKO A;  3HVR A;  5DMR A;  2XY5 A;  3OYB A;  1T03 A;  3AO4 A;  4B1W B;  3OHR A;  4B9S A;  4H5T A;  3I55 N;  3HPO A;  5BRH A;  2NRT A;  5IWA K;  4DTP A;  2ZGY A;  4L8R B;  4JAX A;  4WE1 A;  4K8Z A;  4H03 B;  2HBM A;  2Z1J A;  3NE6 A;  3E9L A;  3A5L C;  2YHY A;  4KI6 A;  2EWS A;  3KK1 A;  1Q9X A;  4H8K A;  3CCS N;  1TKD A;  1W0H A;  3KLE A;  4DQQ A;  3L2V A;  5AFU A;  4F8R A;  3LM9 A;  4CVN E;  2P9U A;  2KQ2 A;  1BQM A;  3ZT1 A;  1RCH A;  2ZGZ A;  1VSE A;  1WN7 A;  3SMS A;  4OPH A;  3SPZ A;  4WFN L;  1RIL A;  4E7H A;  3CM5 A;  3MCA B;  3SBT A;  2QA4 N;  5M1P A;  4E7J A;  4GV9 A;  3FLC O;  4DLG A;  1TUU A;  1K8A O;  3O9Q A;  5M1Q A;  4J2E A;  4OLB A;  2O8E A;  2QI2 A;  4Y0W A;  4YDU C;  4DF4 A;  3WQT A;  4MO4 A;  2A41 A;  3VGK A;  3E9O A;  1TKT A;  4M3U A;  1RTD A;  4U7B A;  1BGX T;  1ZBS A;  2E2O A;  3KVG A;  3U9Z A;  2DY4 A;  1RBV A;  3PX4 A;  1KXP A;  1K73 O;  1JLA A;  3WXM B;  2YHA A;  3AVL A;  3TSU A;  4MLH A;  3CD6 N;  2OPR A;  4I2Q A;  2XRI A;  3OBY A;  4BEB A;  2JWK A;  3AAP A;  1J5E K;  4BE7 B;  3KJV A;  3G4S N;  3VTI A;  5GAD P;  3FFI A;  3UIQ A;  4O4G A;  4JI4 K;  3CER A;  4BDY A;  4X66 K;  3A5N C;  2KZM A;  4N76 A;  2P51 A;  1KVB A;  4FJ9 A;  1XMQ K;  5AZI B;  1HKG A;  1FK9 A;  4CJL A;  5C10 A;  2KLA A;  3U9D A;  4CFC A;  4E7I A;  4CK2 A;  4J2D A;  1UA0 A;  3WNG A;  4CEZ A;  3QIO A;  4FWQ A;  3T7Z A;  5KQD A;  5HRN A;  4DTR A;  2J4R A;  4O55 A;  2UXB K;  2WTU A;  1VQO N;  1EXQ A;  3UKU B;  1TKZ A;  4BRC A;  1OH7 A;  2WUS A;  3AVB A;  4LF6 K;  2VG7 A;  4CIF A;  3F73 A;  4KI4 A;  4GVE A;  1Q81 O;  3ZSY A;  1U4B A;  3C0B A;  2QEX N;  2YHB A;  4FPA A;  5KPR A;  4C8M A;  5JVG L;  5HRO A;  5KTQ A;  3U3G A;  3K58 A;  5AFU H;  5AQY A;  3VTH A;  3I8D A;  4N5S A;  4FM1 A;  2YNI A;  3H08 A;  5HRS A;  4FXD A;  4ICL A;  1HUX A;  3R3L A;  2RHK A;  3HM9 A;  2EHG A;  1ZYQ A;  2A5X A;  1MU2 A;  4BC4 A;  2WFB A;  3AVF A;  5J2N A;  3ULE A;  2OPQ A;  3OYN A;  4K0K K;  1SKS A;  3NVM A;  4FJ7 A;  2CGK A;  1CLQ A;  4JKB A;  2XHB A;  5F0X A;  1U45 A;  3LPT A;  3OYG A;  4OKJ A;  2FSJ A;  4CD3 A;  4E1M A;  2HBJ A;  3SI6 A;  1C6V A;  4BG8 A;  4BR7 A;  4KAZ A;  4A61 A;  1RTI A;  1N32 K;  2E8A A;  5M1F A;  5GIO A;  5KPZ A;  3TI0 A;  4C8L A;  4PKH A;  4Z4E A;  4DQI A;  3MDQ A;  3DLB A;  2QWR A;  3KLI A;  1HYV A;  2PFU A;  2E1Y A;  4EFH A;  1HLU A;  4DTM A;  1JL2 A;  1NOY A;  3LZJ A;  3LDN A;  4CJQ A;  5AQJ A;  5AQS A;  2AA4 A;  2P9K B;  1DGK N;  4B3R K;  1HYS A;  2QWM A;  2DFF A;  3L2Q A;  1D9D A;  4B8C A;  2NLX A;  2BAN A;  5SWM A;  4K43 A;  1I3A A;  1S1V A;  2FLO A;  2NZT A;  1CZB A;  4DFM A;  4ISF A;  1C1A A;  1IG8 A;  4CF0 A;  3R8E A;  4A5B A;  1T6C A;  3SUP A;  4Z4F A;  4BRA A;  3V9S A;  1C0G A;  4CJ5 A;  3L4Q A;  3B6O A;  4CJK A;  2QK9 A;  1VSK A;  4MLE A;  4KO0 A;  2QM1 A;  4J2A A;  1RFQ A;  4K41 A;  4OGE A;  4WQ4 C;  4JKA A;  1EKE A;  4FW2 A;  3G10 A;  4CJT A;  4CFB A;  4B1V A;  1P8Z A;  5EX5 A;  1N34 K;  4ILH A;  4FLX A;  3OYJ A;  2GEM A;  3AVM A;  4JD2 A;  3V81 A;  3CPW M;  3C65 A;  3SPY A;  1RTJ A;  4GVM A;  4DMN A;  1WLJ A;  1VQ4 N;  4BRN A;  3VGL A;  3SQ4 A;  1WUA A;  2G8K A;  4C23 A;  3AVI A;  1BO5 O;  2IC3 A;  5ELZ A;  3HK2 A;  4FJX A;  5CZ1 A;  2YNH A;  4JI1 K;  4PL7 A;  2IGI A;  1LOT B;  3DLL L;  2VQE K;  4Y1C A;  2AP1 A;  3RMB A;  4CJU A;  4LH4 A;  5JLF A;  3VF4 A;  5JEN A;  4XH4 A;  3O1B A;  4A2B A;  4QOZ B;  4DV3 K;  4LFC K;  3CCR N;  1QTM A;  3DLK A;  2HST A;  4K25 A;  4WQ5 C;  4OLA A;  4CE9 A;  2G8U A;  5SZT A;  3FZK A;  1RT1 A;  3LP2 A;  5BPM A;  3LAL A;  1GOA A;  2HHT A;  3T69 A;  3J8A A;  3EE8 A;  1JLG A;  1FW6 A;  4C8O A;  3PX6 A;  1XHX A;  3CJ7 A;  2OZM A;  1J9A A;  4CHP A;  2WBN A;  3H45 C;  5AQU A;  3K5N A;  3RMC A;  1UA1 A;  4XJX A;  3KK7 A;  5AQK A;  1Y64 A;  4I9L A;  4IOC L;  1NGF A;  3NF9 A;  1HQU A;  2PBD A;  3QNO A;  3JXU A;  1VK0 A;  3QFU A;  3ZEU A;  4DWI A;  3TR8 A;  3EZ5 A;  4O5F A;  1YF5 L;  3CJA A;  1IBL K;  2B4J A;  3AGK A;  3ENB A;  4WQ4 A;  4IO8 A;  1YAG A;  4YOW A;  4DU1 A;  2IDO A;  2Q0U A;  2C1G A;  4CEC A;  5BRD A;  5CY4 A;  1LWF A;  3VQ7 A;  4F4K A;  3TAR A;  4CJP A;  4KTW A;  4N47 A;  5BRE A;  1RGI A;  1RDC A;  2HMP A;  3CMA N;  3OS1 A;  2QTD A;  2OPP A;  2Y1J A;  3OYK A;  1ZBU A;  3S3N A;  4ISG A;  1ZBF A;  1NNE A;  4ELU A;  5TKW A;  4M3X A;  4DTO A;  1QVF M;  2W6K A;  4JKD A;  2VGM A;  4FVM A;  4PKG A;  4HCB A;  2XY7 A;  3SBG A;  4JN4 A;  3HZ6 A;  1HNV A;  4CEE A;  3PIP L;  4B3M K;  3HI0 A;  4NXN K;  2E6L A;  3CET A;  3OYD A;  4BDZ A;  4L3Q A;  3O3H A;  1NGG A;  3LM2 A;  4FK0 A;  3TAN A;  1NBW A;  4DU3 A;  4O44 A;  4F3T A;  3VQ5 A;  3CM6 A;  4H0O A;  4YHH K;  3VQA A;  2UUC K;  4FLW A;  4JI0 K;  3EKS A;  4NXM K;  4FJ5 A;  2HHU A;  4DS5 A;  3HST B;  4H0P A;  1XNR K;  3HPH A;  3A0I X;  3D2E A;  4JKF A;  3WXJ A;  4Q5V A;  2IIR A;  1GOB A;  1B9D A;  3ZX3 A;  4F9O A;  5KPT A;  4JHD B;  1S9E A;  3DWL A;  4CFD A;  1NGB A;  3TTF A;  3MWT A;  4F3O A;  3R1X A;  3THW B;  3WNF A;  1BIU A;  2W00 A;  4I2P A;  5DM7 L;  1WBB A;  3THY A;  2GUP A;  4ZTJ A;  1WNS A;  2QWL A;  2P9P B;  4KRE A;  1EWQ A;  4JI8 K;  3U6F A;  3MN5 A;  3G25 A;  4ELV A;  1XWL A;  3LDO A;  4KPY A;  3P4I A;  1YXQ A;  1RBU A;  4RW7 A;  5TKY A;  4J8F A;  2P9I B;  3UB5 A;  3J81 O;  4DV5 K;  3CI5 A;  2OPS A;  3LP1 A;  4LC9 B;  4JEP A;  3O4W A;  1RDB A;  3KWG A;  3TWH A;  4O0J A;  3KK2 A;  3B8A X;  4KHQ A;  2YX6 A;  4MDA A;  4BRQ A;  3WUH A;  4WF9 L;  4ILJ A;  5E41 A;  4R5P A;  3I0R A;  5HRP A;  4PA1 A;  4HUF A;  1TGO A;  3C7N B;  5AQX A;  3KD1 E;  3OBW A;  4JRP A;  4DTS A;  3VES A;  5AQN A;  3OW2 M;  3OYE A;  1X3M A;  2GEL A;  4IJA A;  1N8R O;  1T05 A;  3CC2 N;  1JLB A;  3QEW A;  1YHQ N;  3Q7C A;  3U3Y A;  2DPN A;  3OYA A;  2D0B A;  1VSH A;  4ELT A;  3O1W A;  1NJY A;  4CK1 A;  1I39 A;  1RT6 A;  2XY8 A;  1HPZ A;  3TAG A;  4NCB A;  1GLF O;  1Z05 A;  1RBS A;  3BEX A;  3FZH A;  3NGZ A;  1HX1 A;  4JK8 A;  4Z4G A;  2D4W A;  3CHW A;  3LL3 A;  4FWM A;  1N33 K;  1TK0 A;  5J2M A;  2OCE A;  3O5B A;  3OA9 A;  3CJ9 A;  3LP0 A;  4AF1 A;  4KH6 A;  4LF4 K;  3ZSR A;  4BE2 A;  3O9R A;  4BQL A;  2F7T A;  2NRX A;  3MEE A;  2F9W A;  3ZCM A;  3O8M A;  1NOZ A;  3DXM B;  3BZC A;  4M45 A;  2I7P A;  5GAH P;  1XUP O;  3K9J A;  4GW6 A;  3NF8 A;  3B6P A;  1K9M O;  3QIP A;  3GOI A;  1WSI A;  1TL3 A;  3N4P A;  4XH5 A;  1U6Z A;  2W41 A;  4ID1 A;  5AQV A;  2FF6 A;  4Z4H A;  3UKU A;  1WSE A;  3N4Q A;  5C2D A;  1U47 A;  4BGA A;  3AO5 A;  2FBT A;  3VET A;  2ZJP L;  5DM6 L;  1BDG A;  2V52 B;  3EY1 A;  3NMU A;  1C0F A;  4AHU A;  5KI6 A;  1Q86 O;  2HW3 A;  5LL6 Z;  3IDH A;  4BRL A;  2NNW A;  1S72 N;  1SL2 A;  4C1N I;  3E01 A;  1HNI A;  3AVJ A;  3MX5 A;  5C0Y A;  4LY7 A;  2KKZ A;  3H1Q A;  1EX4 A;  3DXM A;  3T1A A;  3O4Q A;  3TAQ A;  3MXI A;  3V4I A;  1NK8 A;  4DSE A;  4IXC A;  1TYQ A;  3V1Q A;  4BC3 A;  1U49 A;  3NH0 A;  3TU5 A;  2YV0 X;  2GBZ A;  1BOT O;  2IOC A;  5D3G A;  2BH1 A;  5AQT A;  1VSD A;  2GX9 A;  1RBT A;  4YOR A;  1FJG K;  4BRM A;  4B3T K;  2HBK A;  2V7Z A;  2H3G X;  1VSM A;  3QDK A;  1BIZ A;  3THW A;  4WYB A;  3QFP A;  2G8V A;  4RW8 A;  5MLC Q;  2O8C A;  2HHW A;  1RT3 A;  3J80 O;  3PIO L;  3ZX0 A;  3P1G A;  4AIL C;  5FPD A;  3MEC A;  1MWK A;  2CGL A;  3M5R A;  1QZ5 A;  5BPL A;  2Q0R A;  3VEZ A;  3EL2 A;  3C7N A;  2Q3S A;  3CPE A;  5K14 A;  1RTH A;  3LWM A;  3IFR A;  1SAZ A;  1S5J A;  1T3V A;  3TPQ A;  1HQE A;  3TAE A;  3HXM A;  1OH5 A;  4BRP A;  4CES A;  5KRT A;  3KLH A;  3ZET A;  1YI2 N;  4A2A A;  4CD1 A;  4KB0 A;  3E9P A;  3VQE A;  3BF1 A;  2JLE A;  1QQN A;  1J54 A;  4I6M A;  4H0Y B;  4CER A;  3ZEU B;  4Q0B A;  4PL8 A;  4CGG A;  4M42 A;  4M3R A;  4CJV A;  3OYM A;  1YTA A;  4DSI A;  2KFZ A;  4HTU A;  4E72 A;  1IKW A;  2Q31 A;  2Y1I A;  1BCO A;  2ZD1 A;  3QLH A;  4N41 A;  2KTQ A;  4FW1 A;  3GE1 A;  1X9M A;  1RT5 A;  2WON A;  3I8B A;  3TSQ A;  2ZE2 A;  4CFA A;  5M1N A;  4DSF A;  2P9L A;  1J5O A;  4JI3 K;  4KRF A;  3VN5 A;  3MAQ A;  1V4S A;  2VGN A;  4YFU A;  1JLC A;  4FJ8 A;  1WOQ A;  2E2N A;  4FK2 A;  2HF4 A;  2PY5 A;  1NMD A;  4H4O A;  4EZ6 A;  3RVC A;  1JLF A;  2D0O A;  1DTQ A;  4FWP A;  1SKW A;  4FLU A;  1I94 K;  5AZJ B;  1TAU A;  4YOT A;  4CEO A;  2FSK A;  5C12 A;  4DQP A;  2CH6 A;  3SNN A;  4CZG A;  1JJ2 M;  5FDL A;  2GWK A;  4FJK A;  3VQ4 A;  1B92 A;  1Y97 A;  3SUQ A;  1IBK K;  3E66 A;  4YNQ A;  3PSI A;  3AO1 A;  3OJS A;  3SYZ A;  3DLR A;  3DMJ A;  2V51 B;  1QVG M;  1S1T A;  1WSG A;  1SL0 A;  4QCL A;  4H4M A;  3LAK A;  3RSE B;  4JI7 K;  4FPB A;  3VEW A;  3QEV A;  3UE5 A;  1WSF A;  5I3U A;  1VQ9 N;  2O8E B;  4CIG A;  4KHW A;  2ITG A;  3IMX A;  3UKR B;  4J2B A;  5FPE A;  1GLA G;  4IG3 A;  4M3W A;  4JI5 K;  3AA2 A;  5LY3 A;  1YJW N;  1TK5 A;  5FRO A;  1X3N A;  2HHH K;  1W2B M;  3CCV N;  1WBD A;  1JCG A;  1KFD A;  3BUZ B;  4AHC A;  4KHU A;  2PYJ A;  1CZ9 A;  4BC2 A;  1ZBL A;  1YVU A;  4PY5 A;  3QIN A;  3C6U A;  5M1K A;  3K2P A;  1NKB A;  3O3F A;  1XNQ K;  1SL1 A;  3L6Q A;  3MN7 A;  3QET A;  3D45 A;  1HKB A;  2VWJ A;  5JS2 A;  4H5N A;  2I7N A;  4DSK A;  2O4G A;  5EY4 A;  2HNZ A;  2HVH A;  4AH9 A;  4A57 A;  1OVQ A;  2OAN A;  3ZSO A;  1S9G A;  3EO3 A;  2D0C A;  2BUP A;  3H3O B;  1LW2 A;  2O8B B;  3AVG A;  2ASO A;  4MDB A;  5FPM A;  3WT0 A;  4CZK A;  3AVA A;  5AQQ A;  1BI4 B;  2QWP A;  4OX9 K;  1K8K A;  3SAF A;  4CIE A;  3F2K A;  4I7F A;  3L0Q A;  1UAX A;  4ID5 A;  3VQB A;  3M8P A;  2P5G A;  1U48 A;  4BRE A;  5CHI A;  4JK7 A;  3JYT A;  1CXQ A;  4BR9 A;  1KLM A;  2FXU A;  3SCX A;  3WXK A;  3J7Z O;  1YIT N;  3L2R A;  2Z1H A;  2KHO A;  1KAY A;  1XMO K;  5JMV A;  1ILY A;  4A59 A;  3C6A A;  1NGI A;  2ETJ A;  1FXX A;  3RWU A;  4DR5 K;  4CGH A;  1GLB G;  4BC5 A;  3HBT A;  3CCM N;  1XHZ A;  1M90 O;  3V6D A;  4HUG A;  1RT2 A;  3D0P A;  4RW6 A;  5AQO A;  4DR6 K;  4WCE L;  3ATV A;  1IKV A;  1BCM A;  3CIP A;  1BI4 A;  2QWO A;  4M63 C;  3ITH A;  4DLE A;  4W5T A;  4BRH A;  3G71 N;  1BG3 A;  2BTF A;  2Z1I A;  5E84 A;  1VSF A;  3CXC M;  1VHX A;  2F96 A;  2OYQ A;  3FZL A;  3NH1 A;  4FJI A;  4CHZ A;  1RDD A;  3LDQ A;  3TAB A;  1QZ6 A;  1W9H A;  4JKG A;  3WEE A;  3NF6 A;  3IRX A;  2VWK A;  3NH2 A;  4BWJ A;  3WQU A;  1Q9Y A;  3OVN A;  4O0I A;  2O8F B;  4CGF A;  3EN9 A;  4I6M B;  3FE1 A;  2FBV A;  4IFY A;  2P9K A;  1D5A A;  2KZZ A;  4C1N K;  4CF8 A;  1S1U A;  3ISN C;  1F21 A;  1NLV A;  1D9F A;  3A5O C;  1Q18 A;  2HB5 A;  1KTQ A;  3OYC A;  3F9M A;  3F5T A;  3LAM A;  4BQZ A;  3OYH A;  1IV0 A;  4IEE A;  4KFB A;  5B8H A;  3CFO A;  2ATQ A;  1JLE A;  4EHT A;  3DLE A;  5AQH A;  4X64 K;  1VQM N;  2E88 A;  3DOL A;  1NGE A;  1X9S A;  3WXL A;  4ISE A;  3AV9 A;  4IO9 L;  1LCU A;  4MFB A;  3OY9 A;  3HP6 A;  2QKK A;  4GV3 A;  1VQL N;  4B9M A;  1JKH A;  3V1O A;  1EWR A;  2O8F A;  5AQG A;  2O4I A;  1QS4 A;  4KBO A;  4O8U A;  5F2R A;  1U2V B;  3EEQ A;  5CR4 A;  4Z4C A;  4E7L A;  4H5R A;  1VSL A;  3OTO K;  2X78 A;  5EVZ A;  4C8K A;  3CJ1 A;  1IKY A;  1Q7Y O;  1IKX A;  2YHW A;  3QES A;  3SUO A;  3EKU A;  1WB9 A;  1GLD G;  2F4V K;  2NRH A;  3H6E A;  3QBX A;  1U2V A;  3DM2 A;  3TAM A;  1RDA A;  1T7P A;  1K6Y A;  1KVA A;  1ZXO A;  3LP3 A;  2V7Y A;  3LZI A;  1BUP A;  4NYF A;  1NGD A;  2A40 A;  2YJF A;  4CGD A;  1K8K B;  1JCF A;  3THX B;  2HHS A;  3RSE A;  1HNZ K;  4JHD A;  4AHT A;  3DLH A;  3MCP A;  1G99 A;  2IVN A;  4RG8 A;  4DFP A;  4OPK A;  4KHY A;  3LPU A;  4FZY A;  2G8W A;  1ASU A;  2DFH A;  1NJI O;  1X9W A;  1HJO A;  3KTQ A;  3OJU A;  2P9P A;  1EQY A;  4XIU A;  2IVO A;  4FJM A;  3WXI A;  3L8B A;  5AQL A;  4FO0 A;  3SAH A;  1SUQ A;  3IAY A;  4YOU A;  1S1W A;  2BDP A;  3IS9 A;  5J2P A;  3AVC A;  4OPJ A;  4C8N A;  4YOY A;  1JL1 A;  5BRF A;  2YI1 A;  3THX A;  5KGX A;  1NGJ A;  4KHS A;  3I33 A;  5CYM A;  3S3O A;  5CYQ A;  1GLC G;  1UWB A;  3MXJ A;  5HL7 L;  4IZ9 A;  1D8Y A;  3V1R A;  5AQZ A;  4E1J A;  3OYI A;  3FZM A;  3HOT A;  4WQ5 A;  3QEI A;  3QML A;  1VQ7 N;  1XC3 A;  4IWV A;  1YVN A;  1TV6 A;  3TAP A;  5J1E A;  4OPA A;  4CZH A;  5HLF A;  4JRQ A;  1QSS A;  4EZ9 A;  2B5J A;  1XI1 A;  1NGH A;  2XY6 A;  4OGC A;  2YCH A;  3KIO A;  3ZLJ A;  3P31 A;  4CHN A;  4JV5 K;  1Z25 A;  4DR2 K;  4RCH A;  1GLL O;  3RR7 A;  1IO2 A;  3AVN A;  2Q2R A;  4JK9 A;  1KC8 O;  1IG9 A;  4RW4 A;  3RMD A;  1WAF A;  3DJC A;  4MQ3 A;  4H0V B;  3AY9 A;  4B9Q A;  2GTD A;  4CBW A;  2UYT A;  3ZSZ A;  3I0S A;  4HVJ A;  5GAG P;  1MDU B;  5ADX H;  3VQ6 A;  4YY3 K;  3AAR A;  4CEB A;  3HOS A;  1J53 A;  4YOX A;  2YJE A;  1ASV A;  3BF3 A;  2CGJ A;  5HP1 A;  3TSP A;  1VQ5 N;  2E4L A;  3VF6 A;  4YDU A;  2HHX A;  1HMV A;  4BGB A;  3KKR A;  5C42 A;  3PO4 A;  2DFE A;  1NM1 A;  3R6M A;  3SJJ A;  4FJJ A;  5FPN A;  1FKP A;  3VQP A;  3V9X A;  2F9T A;  4DG1 A;  4FLY A;  3TTD A;  4EHU A;  1G15 A;  4DB3 A;  1WAJ A;  4LSL A;  3QB0 A;  4DKW A;  5HBM A;  1Z26 A;  2WC9 A;  1GLE G;  2NRW A;  3DAW A;  2FSN A;  1YUW A;  2NUB A;  4IEI A;  2P5O A;  1H1V A;  1U04 A;  3ZET B;  4BE0 A;  3QEX A;  1L3S A;  2IVP A;  1NK0 A;  2UUA K;  3KZB A;  5KQ8 A;  3LWL A;  3O6W A;  3CC7 N;  3H1V X;  1OH8 A;  4JI2 K;  5LJW A;  3GDQ A;  4B8A B;  3GG4 A;  1BWF O;  2RN2 A;  3AO3 A;  4BRO A;  3S41 A;  4DR4 K;  4KH5 A;  3TAF A;  1YT3 A;  2EX3 A;  2WOM A;  1N5Y A;  4R79 A;  3NVK A;  3A8Y A;  4KH4 A;  4XH1 A;  1L3T A;  4DV1 K;  4CZE A;  4FM2 A;  4O8K A;  5AQM A;  4O5B A;  3U4L A;  5DK5 A;  2C1I A;  1KD1 O;  4E3S A;  1HYZ A;  3THY B;  5M1O A;  5BR8 K;  1TK8 A;  3QEP A;  4I9Q A;  4FM0 A;  1B9F A;  4GNI A;  5AQR A;  2RPI A;  3AA4 A;  1SZ2 A;  2OZS A;  4LSN A;  4EIA A;  3C6T A;  4BR0 A;  5T7B A;  4BAC A;  5HRR A;  3ULD A;  4DU4 A;  1NJX A;  4B9T A;  4KHP K;  4W5O A;  1O13 A;  3Q7B A;  1S22 A;  1VRT A;  4JI6 K;  4FJG A;  3JAM O;  2GWJ A;  3NFA A;  5BN9 A;  3DRR A;  2NRZ A;  4DTJ A;  3BDP A;  3A5M C;  1J6Z A;  5C25 A;  4GKJ K;  1BA0 A;  5E26 A;  1RT7 A;  4LF7 K;  3A2F A;  2G8I A;  4LF8 K;  3SZ2 A;  5AQW A;  3HL8 A;  4M3T A;  4FL9 A;  4Z4I A;  4CZF A;  4ZTF A;  2YHX A;  1N6Q A;  4PWD A;  1NK5 A;  1OKJ A;  2HF3 A;  4KKO A;  1LWE A;  1NJW A;  3W0L A;  4BEC A;  4DQS A;  3NGY A;  5GAE P;  5KRS A;  1NKE A;  1VQ8 N;  4AM6 A;  3DYA A;  2A6A A;  4FWN A;  5LMN K;  2P9L B;  4OVL A;  3SQ1 A;  3LDL A;  4CBU A;  3K59 A;  4BRF A;  2IAJ A;  1MA9 B;  2A42 A;  1SQK A;  3VEY A;  3MED A;  4B9N A;  1Q82 O;  4OJR A;  4CJF A;  3RRH A;  2B6A A;  1QQM A;  4FLZ A;  4CBX A;  2RF2 A;  2DTU A;  4CHY A;  3VER A;  4CEA A;  2E1Z A;  3CQX A;  1HRH A;  4CF1 A;  4CZM A;  4OKE A;  2QKB A;  4BY9 C;  3O9T A;  4JS4 A;  4FK4 A;  4DTX A;  2D5R A;  4M3Z A;  3SJH A;  4YOV A;  2LSN A;  2I5J A;  4BRI A;  4LFA K;  3L3U A;  3WNH A;  5AQI A;  3L2U A;  2P9S A;  3O80 A;  2A1S A;  1C0M A;  3P83 D;  3ZYY X;  3ID8 A;  1VAZ A;  1DKG D;  3CJB A;  1QE1 A;  1KSP A;  4HWI A;  2ASM A;  1L5U A;  4DQR A;  3ZT3 A;  4WFA L;  4CHO A;  3CCE N;  4FWR A;  3AA5 X;  1NJZ A;  2P1J A;  2P9N B;  3KLF A;  1JXE A;  3CJC A;  2HNY A;  4CCH A;  4CJE A;  1KQS M;  4JKH A;  3HSC A;  3IKM A;  3SUN A;  4KTQ A;  1WSH A;  3NDK A;  3DLG A;  2CH5 A;  4DCH A;  3CFR A;  2QWN A;  3QNN A;  4X65 K;  1T44 A;  5LMU K;  2OA8 A;  2W6L A;  3JS6 A;  4IDK A;  5GIP A;  3C95 A;  4DTU A;  2Q36 A;  4IFV A;  3QER A;  2BGG A;  3PY8 A;  2ZM6 K;  3P39 A;  5J2Q A;  4DFJ A;  3T1H K;  4EAH D;  3RR8 A;  3O4N A;  4IFE A;  3V9Z A;  3SQ0 A;  2A1R A;  3MX2 A;  4DSL A;  1X9J A;  2O8C B;  4CGJ A;  1MWM A;  5AQP A;  4CED A;  3AO2 A;  3ENH A;  1NWK A;  3KK3 A;  4CK3 A;  3D6R A;  2HVI A;  3MEG A;  3AA3 A;  3AAQ A;  3AGR A;  3VQ8 A;  2JWL A;  1BU6 O;  1RBR A;  1TKX A;  3VA0 A;  2O8B A;  4NLB A;  3S9H A;  4DV2 K;  3VEV A;  2UXC K;  4B3S K;  2VG5 A;  2AJQ A;  5FLX O;  3THV A;  1JXB A;  1P90 A;  2ZJQ L;  1OVY A;  4IG0 A;  4CJ4 A;  1CXU A;  3ZT0 A;  4KB1 A;  4JKC A;  1QHT A;  4IOX A;  3H46 O;  1QSY A;  2KFN A;  5JLH A;  3LDP A;  3MXM A;  3F9K A;  3BP8 A;  3HT3 A;  4JD2 B;  1HJR A;  2P9U B;  2PYL A;  3MMV A;  3K9K A;  4BRG A;  2RKI A;  2BE2 A;  2ZQB A;  4AQY K;  3PUF A;  2HHI A;  5EU7 A;  4DHY A;  1VQK N;  2E2P A;  4M7Y A;  3VQQ A;  3VEO A;  3O9U A;  1NGC A;  1TUY A;  4NO7 A;  4BVP A;  4B1Z A;  4M3Y A;  4DR7 K;  1VSJ A;  3SAG A;  5EOY A;  2GUI A;  4FWK A;  4IDH A;  3CC4 N;  4CJR A;  3CME N;  1RDW X;  4CJ7 A;  3CFP A;  3ZSQ A;  4PQU A;  4U67 L;  1ZBI A;  1TL1 A;  4B08 A;  4CZJ A;  2ITM A;  4OO1 J;  3M1F A;  2ASP A;  4LF9 K;  3L4I A;  5AJ3 K;  4G1Q A;  3EE9 A;  1R59 O;  3P5J A;  3WNE A;  4G9Z A;  3ZSW A;  4FZZ A;  3SK3 A;  4CF2 A;  4DV6 K;  3ZSX A;  1WSJ A;  4CGI A;  2QW9 A;  4GMJ B;  1KRP A;  3K0S A;  1NKC A;  4Z0U A;  2Z1G A;  1QHA A;  1X1P A;  3OYL A;  4AHR A;  1VQN N;  4FCY A;  3V9W A;  2KW4 A;  3K5M A;  1OH6 A;  1V4T A;  5EXW A;  3MWP A;  3CCU N;  4MO5 A;  4HUE A;  2G8F A;  1VQ6 N;  3O3G A;  3HYF A;  3K5L A;  1HNX K;  5KGW A;  1SKR A;  3NAE A;  2ZJR L;  2HND A;  1HPM A;  3MN9 A;  3CQY A;  3SLC A;  2XO7 A;  4CZI A;  3SMP A;  5HOO A;  5FRM A;  1BHL A;  3VGM A;  5ADX A;  3O08 A;  1TVR A;  1VRU A;  1M1K O;  4UQG A;  4QS8 A;  2O8D A;  4E89 A;  4IJN A;  3SV4 A;  1NU0 A;  1LAW A;  3CF5 L;  3CYM A;  1NGA A;  5JS1 A;  3D2F A;  3HVT A;  2G8H A;  2F8S A;  3ZT4 A;  3MK6 A;  3BZK A;  3AVH A;  3HTV A;  3ID6 A;  4BE1 A;  4CF9 A;  4GKK K;  3V9U A;  4HCC A;  3OS2 A;  4JYA K;  3DXK A;  1CZA N;  4M41 A;  3CG7 A;  4B9L A;  4ZHR A;  3M8Q A;  3PO5 A;  4CEF A;  1VSI A;  3HM8 A;  1YTU A;  2P9S B;  4FWO A;  3RTV A;  1IH7 A;  1ZBH A;  4B1U B;  4DV0 K;  4E1N A;  4DF8 A;  1D4X A;  3NHG A;  3NBP A;  1REV A;  4GV6 A;  2O8D B;  2YNF A;  2E2Q A;  3CYG A;  3FFK B;  4E7K A;  2P9N A;  1NK9 A;  3T3F A;  3FZF A;  3SQ2 A;  3NCI A;  1RNH A;  4A5A A;  4NLC A;  2HBL A;  1ZC6 A;  1RT4 A;  1YJ9 N;  4H5V A;  1IBM K;  3VPZ A;  4FJH A;  5LJV A;  3HP9 A;  2FBX A;  2HHV A;  4ILG B;  2YNG A;  3KKS A;  3ENO A;  2ZF5 O;  4RWT A;  4V19 S;  1ESV A;  4LH5 A;  2FF3 B;  2R7Y A;  3T19 A;  2UUB K;  3IUC A;  3P38 A;  1KCF A;  4IKF A;  4E19 A;  2HMI A;  3ALY A;  3LAN A;  1HKC A;  2E20 A;  1LAV A;  1QQO A;  1ATS A;  3J7A P;  4HHT A;  4IOA L;  3QO9 A;  1T8E A;  4KV8 A;  1S3X A;  4A62 A;  3K5O A;  3M3Z A;  4GY2 B;  3T1Y K;  1ASW A;  4NYN A;  3KD5 E;  2YKN A;  1L3U A;  4H5W A;  1KVC A;  1S6P A;  3CCJ N;  2E6M A;  2QWQ A;  4LFB K;  3DRS A;  2OTL N;  1A5X A;  1S6Q A;  4JKG B;  1XC9 A;  4BR2 A;  1JLQ A;  5C2F A;  4OKK A;  1E4F T;  4E0D A;  4K42 A;  1Q8I A;  1YIJ N;  1E4G T;  2QXF A;  4M7X A;  3LDS A;  1BA1 A;  4F2R A;  3VQ9 A;  4FWS A;  3H3N O;  4CI6 A;  1A5W A;  3ZX2 A;  1HR0 K;  3ULE B;  1RDU A;  3S3M A;  1W97 L;  3CQ8 A;  3PSF A;  3OS0 A;  1UOC A;  4JNE A;  3WEE B;  3L2W A;  2X74 A;  3SV3 A;  2VWB A;  4QS7 A;  1IJJ A;  1NG9 A;  1EP4 A;  5JVH L;  1DEJ A;  3D7E O;  3K57 A;  4AHS A;  3DRP A;  1SS6 A;  3VQD A;  1ATR A;  3DOK A;  1LW0 A;  1DLO A;  4W5R A;  2PZS A;  2A3Z A;  3C94 A;  2IS3 A;  3VF2 A;  1NK7 A;  4PKI A;  4JS5 A;  4KTZ A;  3PX0 A;  1R0A A;  1NK6 A;  3M8R A;  4BRK A;  3I56 N;  3KLG A;  4DUY K;  4FSV A;  4B9V A;  3HRG A;  4RTF D;  1ITG A;  3CCQ N;  4DUZ K;  3R9P A;  2NRR A;  4FJN A;  2VCP A;  5JIC A;  4AM7 A;  4FOE A;  3QIC A;  4W5Q A;  3E1Y A;  3NF7 A;  4EP4 A;  5BPN A;  5C24 A;  4QAG A;  5GIN A;  3G6E N;  2Q1N A;  4DR3 K;  3W3D A;  4DSJ A;  4FYD A;  2UU9 K;  4XEI A;  2D0P A;  4X62 K;  1DT9 A;  3C6H A;  3J7Y P;  5H1S Q;  5I9E B;  3EZW A;  4NCG A;  4LD0 A;  4B9U A;  3U8X A;  1BIS A;  1W7A A;  3M8S A;  1TAQ A;  5AQF A;  1BQN A;  1EET A;  3M6G A;  2FC0 A;  3DXK B;  4LF5 K;  2OTJ N;  3PV8 A;  1O1W A;  3VEX A;  1GOC A;  3KWI A;  2PAV A;  1DTT A;  2VQF K;  1T6D A;  4B3O A;  1S1X A;  2X6S A;  2UXD K;  5CE3 A;  4NB4 A;  4TSX A;  2P9I A;  2VG6 A;  1KAZ A;  4BRD A;  3UKR A;  4DFK A;  4PUO A;  4Z94 A;  1A5V A;  3ATU A;  5A2Q O;  1KFS A;  1Z6R A;  3BGR A;  4CJW A;  4EP5 A;  1KLN A;  3VOV A;  4JLH A;  3KHY A;  1HNW K;  4CEQ A;  4DS4 A; 
#chains in the Genus database with same CATH homology
 3SJH A;  4YOV A;  4H0T B;  4BR9 A;  2FXU A;  4FWL A;  4ISG A;  4B1Y B;  3WXK A;  4H0X B;  1TYQ B;  4BR4 A;  3J7Z O;  5TKW A;  1YIT N;  2KHO A;  3CCL N;  1KAY A;  4BRI A;  2D1K A;  1QVF M;  5AZI A;  4JKD A;  2VGM A;  1XQS C;  4BR5 A;  5JMV A;  1ILY A;  5AQI A;  4A59 A;  3C6A A;  4PKG A;  3QBW A;  2ZWH A;  1GLJ O;  1NGI A;  4UY8 O;  3SBG A;  4JN4 A;  2P9S A;  3O80 A;  3HZ6 A;  2NRV A;  3ZYY X;  3PIP L;  1GLB G;  4BC5 A;  3HBT A;  3HI0 A;  3ID8 A;  3CCM N;  5BN8 A;  1VAZ A;  3CET A;  1DKG D;  3CJB A;  1M90 O;  4HWI A;  2ASM A;  4L3Q A;  2Q97 A;  3GL1 A;  4WFA L;  1NGG A;  2RE2 A;  3LM2 A;  5AQO A;  3CCE N;  4FWR A;  4WCE L;  4HTL A;  1NBW A;  3ATV A;  3CIP A;  2P9N B;  2QWO A;  4M63 C;  4PHT X;  3CJC A;  4WFB L;  1KAX A;  4H0O A;  1BG3 A;  4BRH A;  4JKH A;  3G71 N;  1KQS M;  3HSC A;  1VQP N;  2BTF A;  3IKM A;  2VYP A;  5E84 A;  5BR9 A;  3CXC M;  3EKS A;  2W40 A;  4B1X B;  2CH5 A;  3FZL A;  4QS9 A;  4BG9 A;  4DCH A;  2QWN A;  1T44 A;  3LDQ A;  1QZ6 A;  4H0P A;  5AZJ A;  2HOE A;  4JKG A;  3JS6 A;  3WEE A;  3A0I X;  3D2E A;  4JKF A;  3WXJ A;  5GIP A;  2Q36 A;  2IIR A;  3ZX3 A;  3WQU A;  3P39 A;  4FOI A;  4F9O A;  5KPT A;  4JHD B;  3CCR N;  3DWL A;  3EN9 A;  4I6M B;  3PLA A;  1NGB A;  3O9S A;  3VEN A;  3FE1 A;  3TTF A;  3MWT A;  4EAH D;  2P9K A;  3R1X A;  1JCE A;  4IFE A;  4C1N K;  4BVO A;  3TTC A;  2W00 A;  1YJN N;  3D2E B;  1NLV A;  5DM7 L;  3VMF B;  3MX2 A;  3A5O C;  2GUP A;  5AR0 A;  1Q18 A;  1EO1 A;  1X9J A;  2QWL A;  1MWM A;  3F9M A;  2P9P B;  3F5T A;  5AQP A;  4BQZ A;  1ATN A;  4IEE A;  4FVU A;  3ENH A;  5B8H A;  2QXL A;  1NWK A;  3FGU A;  3MN5 A;  3D6R A;  3G25 A;  4CZL A;  5F1X A;  3AAQ A;  3AGR A;  2JWL A;  3LDO A;  1BU6 O;  4EHT A;  5AQH A;  3P4I A;  1YXQ A;  5C15 A;  5TKY A;  4J8F A;  2P9I B;  3UB5 A;  4NLB A;  1VQM N;  2E88 A;  3GBT A;  3VEV A;  3FR0 A;  3CI5 A;  1NGE A;  3D2F B;  4JKE A;  4ISE A;  3WXL A;  4IO9 L;  4DQ8 A;  1LCU A;  3MN6 A;  4JEP A;  4LC9 B;  1P90 A;  3O4W A;  2ZJQ L;  1OVY A;  4GV3 A;  1VQL N;  3KWG A;  4JKC A;  4B1W B;  4IOX A;  3H46 O;  3OHR A;  4H5T A;  3B8A X;  5JLH A;  3LDP A;  5AQG A;  3I55 N;  5BRH A;  2NRT A;  2YX6 A;  3BP8 A;  4KBO A;  2ZGY A;  4MDA A;  4O8U A;  3WUH A;  4ILJ A;  4JAX A;  5F2R A;  1U2V B;  4JD2 B;  2P9U B;  4H03 B;  2HBM A;  5CR4 A;  3E9L A;  3MMV A;  3A5L C;  2YHY A;  3K9K A;  4H5R A;  3C7N B;  5AQX A;  4BRG A;  2EWS A;  3OBW A;  5EVZ A;  4DHY A;  3VES A;  3CJ1 A;  1VQK N;  2E2P A;  5AQN A;  4M7Y A;  2YHW A;  3OW2 M;  1Q7Y O;  3CCS N;  3VEO A;  3O9U A;  3EKU A;  1NGC A;  1GLD G;  1TUY A;  1X3M A;  4NO7 A;  2GEL A;  4IJA A;  4B1Z A;  4BVP A;  1N8R O;  2NRH A;  3CC2 N;  3SAG A;  5EOY A;  3H6E A;  3QBX A;  5AFU A;  4FWK A;  1U2V A;  1YHQ N;  3Q7C A;  4IDH A;  3CC4 N;  2DPN A;  3LM9 A;  3CME N;  1ZXO A;  1RDW X;  2P9U A;  4CJ7 A;  4U67 L;  2V7Y A;  3O1W A;  2ZGZ A;  2ITM A;  4CZJ A;  4OO1 J;  3SMS A;  3M1F A;  4OPH A;  2ASP A;  1BUP A;  4BRQ A;  1NGD A;  2A40 A;  2YJF A;  3L4I A;  4WFN L;  1K8K B;  3EE9 A;  1JCF A;  1GLF O;  1R59 O;  3MCA B;  5M1P A;  1Z05 A;  3SBT A;  3FLC O;  2QA4 N;  4GV9 A;  3BEX A;  3FZH A;  1TUU A;  4G9Z A;  3RSE A;  1HX1 A;  1K8A O;  3O9Q A;  4JK8 A;  5M1Q A;  4JHD A;  3SK3 A;  2QI2 A;  3MCP A;  4Y0W A;  4YDU C;  1G99 A;  4MO4 A;  2IVN A;  2A41 A;  3VGK A;  3E9O A;  3WQT A;  2QW9 A;  2D4W A;  3CHW A;  3LL3 A;  4FWM A;  4U7B A;  1ZBS A;  2E2O A;  3KVG A;  3O5B A;  3OA9 A;  3U9Z A;  3CJ9 A;  1QHA A;  4AF1 A;  4KH6 A;  1KXP A;  1NJI O;  1HJO A;  1K73 O;  3O9R A;  4BQL A;  2F7T A;  3WXM B;  1VQN N;  2NRX A;  3TSU A;  2P9P A;  4MLH A;  1EQY A;  3CD6 N;  2IVO A;  2F9W A;  3O8M A;  1V4T A;  3WXI A;  3DXM B;  5EXW A;  3MWP A;  3CCU N;  4MO5 A;  3OBY A;  5AQL A;  4FO0 A;  2I7P A;  3SAH A;  5GAH P;  1XUP O;  3K9J A;  4BEB A;  1K9M O;  1VQ6 N;  2JWK A;  3AAP A;  4YOU A;  4BE7 B;  3GOI A;  3G4S N;  3VTI A;  5GAD P;  3N4P A;  2ZJR L;  4XH5 A;  3CER A;  3A5N C;  1HPM A;  1U6Z A;  4YOY A;  2W41 A;  3MN9 A;  3CQY A;  3SLC A;  4CZI A;  5AQV A;  2FF6 A;  5AZI B;  5BRF A;  3SMP A;  5HOO A;  2YI1 A;  3UKU A;  1HKG A;  3N4Q A;  1NGJ A;  3VGM A;  5C10 A;  2KLA A;  3U9D A;  5C2D A;  3I33 A;  4BGA A;  5ADX A;  3O08 A;  3VET A;  1GLC G;  2ZJP L;  1M1K O;  4QS8 A;  5DM6 L;  1BDG A;  2V52 B;  4IJN A;  4FWQ A;  5HL7 L;  4IZ9 A;  3T7Z A;  1C0F A;  3CF5 L;  1Q86 O;  3NMU A;  5KQD A;  3IDH A;  4BRL A;  1NGA A;  2NNW A;  1S72 N;  4C1N I;  5AQZ A;  4E1J A;  2J4R A;  3FZM A;  3D2F A;  3HOT A;  1VQO N;  3MX5 A;  4WQ5 A;  3UKU B;  3QML A;  2KKZ A;  4BRC A;  5C0Y A;  1VQ7 N;  1XC3 A;  4IWV A;  3H1Q A;  2WUS A;  3DXM A;  1YVN A;  3MK6 A;  4OPA A;  4CZH A;  3HTV A;  3ID6 A;  4GVE A;  1Q81 O;  3C0B A;  1NGH A;  4FPA A;  2QEX N;  4IXC A;  1TYQ A;  3DXK A;  5KPR A;  1CZA N;  2YCH A;  5JVG L;  4BC3 A;  3P31 A;  3TU5 A;  5AFU H;  5AQY A;  3VTH A;  1BOT O;  2BH1 A;  3HM8 A;  4RCH A;  5AQT A;  1GLL O;  2P9S B;  1HUX A;  3R3L A;  2GX9 A;  4FWO A;  2RHK A;  4B1U B;  2Q2R A;  4JK9 A;  1KC8 O;  2A5X A;  3DJC A;  4YOR A;  4BC4 A;  2WFB A;  4H0V B;  4BRM A;  3AY9 A;  1D4X A;  2GTD A;  4B9Q A;  4CBW A;  3ULE A;  2HBK A;  2UYT A;  2H3G X;  2V7Z A;  4GV6 A;  2E2Q A;  3NVM A;  3QDK A;  3FFK B;  5GAG P;  1MDU B;  2P9N A;  2CGK A;  3FZF A;  5ADX H;  4JKB A;  4WYB A;  3QFP A;  5F0X A;  3AAR A;  5MLC Q;  4A5A A;  2FSJ A;  4NLC A;  4CD3 A;  2HBL A;  3HOS A;  1ZC6 A;  1YJ9 N;  2HBJ A;  4H5V A;  4YOX A;  2YJE A;  4BG8 A;  3BF3 A;  3ZX0 A;  3VPZ A;  4BR7 A;  2CGJ A;  3PIO L;  3TSP A;  4A61 A;  5FPD A;  5LJV A;  1MWK A;  2CGL A;  2E8A A;  1VQ5 N;  3VF6 A;  4YDU A;  5M1F A;  3M5R A;  1QZ5 A;  5BPL A;  5GIO A;  2Q0R A;  3VEZ A;  5KPZ A;  4BGB A;  3EL2 A;  3C7N A;  3CPE A;  4ILG B;  4PKH A;  3IFR A;  1SAZ A;  3ENO A;  1T3V A;  2ZF5 O;  3TPQ A;  4RWT A;  1ESV A;  1NM1 A;  3MDQ A;  3R6M A;  2FF3 B;  2QWR A;  4BRP A;  3IUC A;  3ZET A;  1YI2 N;  4A2A A;  5FPN A;  2PFU A;  2E1Y A;  3P38 A;  4CD1 A;  4EFH A;  1HLU A;  3E9P A;  2F9T A;  3BF1 A;  3LDN A;  1QQN A;  3TTD A;  5AQJ A;  1HKC A;  4EHU A;  2E20 A;  4I6M A;  5AQS A;  4DB3 A;  2AA4 A;  2P9K B;  1DGK N;  4H0Y B;  3QB0 A;  4DKW A;  3ZEU B;  2QWM A;  1QQO A;  1ATS A;  2WC9 A;  4IOA L;  1GLE G;  1S3X A;  4PL8 A;  2NRW A;  4A62 A;  3DAW A;  2NLX A;  3M3Z A;  4K43 A;  2FLO A;  2FSN A;  1YUW A;  2NZT A;  4GY2 B;  4IEI A;  1H1V A;  4ISF A;  1IG8 A;  2Q31 A;  3ZET B;  2IVP A;  3CC7 N;  3KZB A;  5KQ8 A;  3R8E A;  3O6W A;  3H1V X;  4H5W A;  4A5B A;  3CCJ N;  1T6C A;  5LJW A;  4WF9 L;  2QWQ A;  3GDQ A;  3GE1 A;  3GG4 A;  2OTL N;  1BWF O;  4JKG B;  3I8B A;  4BRA A;  3TSQ A;  4BR2 A;  4BRO A;  5C2F A;  5M1N A;  2P9L A;  3S41 A;  1E4F T;  4KH5 A;  1C0G A;  3L4Q A;  1V4S A;  2VGN A;  3NVK A;  4R79 A;  4K42 A;  4MLE A;  1YIJ N;  1WOQ A;  2E2N A;  1E4G T;  2HF4 A;  4M7X A;  2QM1 A;  3A8Y A;  4KH4 A;  4XH1 A;  1NMD A;  1BA1 A;  1RFQ A;  4K41 A;  4WQ4 C;  4JKA A;  4FWS A;  3H3N O;  4CZE A;  4CI6 A;  3RVC A;  4O8K A;  5AQM A;  3ZX2 A;  4B1V A;  1P8Z A;  5EX5 A;  2D0O A;  4ILH A;  3ULE B;  4FWP A;  1RDU A;  3U4L A;  2GEM A;  4JD2 A;  2C1I A;  1W97 L;  3CPW M;  3C65 A;  1KD1 O;  5AZJ B;  5M1O A;  4YOT A;  4JNE A;  2FSK A;  3WEE B;  5C12 A;  1VQ4 N;  4BRN A;  2CH6 A;  3VGL A;  2VWB A;  1WUA A;  4QS7 A;  4GNI A;  1IJJ A;  4CZG A;  5AQR A;  4C23 A;  2GWK A;  1JJ2 M;  1SZ2 A;  5JVH L;  1BO5 O;  1DEJ A;  3D7E O;  5ELZ A;  3E66 A;  4EIA A;  1SS6 A;  1ATR A;  4BR0 A;  4PL7 A;  2V51 B;  1QVG M;  1LOT B;  3DLL L;  2A3Z A;  3VF2 A;  1O13 A;  3Q7B A;  1S22 A;  4PKI A;  2AP1 A;  4BRK A;  3I56 N;  5JLF A;  4FSV A;  3VF4 A;  4XH4 A;  3HRG A;  3O1B A;  4RTF D;  4A2B A;  2GWJ A;  5BN9 A;  3CCQ N;  3RSE B;  4FPB A;  3VEW A;  3R9P A;  2NRR A;  2NRZ A;  2VCP A;  3UE5 A;  5JIC A;  2HST A;  3A5M C;  4AM7 A;  1VQ9 N;  1J6Z A;  4K25 A;  4WQ5 C;  1BA0 A;  4FOE A;  5E26 A;  3QIC A;  3IMX A;  3UKR B;  3E1Y A;  3FZK A;  5BPN A;  5BPM A;  5FPE A;  5GIN A;  3G6E N;  2Q1N A;  5AQW A;  3W3D A;  1GLA G;  3T69 A;  3J8A A;  3EE8 A;  4FL9 A;  5LY3 A;  4XEI A;  2D0P A;  4CZF A;  1YJW N;  2YHX A;  3CJ7 A;  1DT9 A;  3C6H A;  1X3N A;  5H1S Q;  5I9E B;  1OKJ A;  2HF3 A;  2WBN A;  3H45 C;  5AQU A;  3W0L A;  4BEC A;  3EZW A;  1W2B M;  3CCV N;  4XJX A;  1JCG A;  3KK7 A;  5AQK A;  5GAE P;  3BUZ B;  1Y64 A;  1VQ8 N;  4AM6 A;  4IOC L;  4BC2 A;  1NGF A;  2PBD A;  2A6A A;  3U8X A;  3JXU A;  4FWN A;  5AQF A;  5M1K A;  2P9L B;  3M6G A;  3QFU A;  3LDL A;  3ZEU A;  3DXK B;  4O5F A;  1YF5 L;  3CJA A;  4BRF A;  4CBU A;  5CHI A;  3L6Q A;  3MN7 A;  2OTJ N;  1MA9 B;  2A42 A;  1SQK A;  1HKB A;  3VEY A;  4H5N A;  2I7N A;  5EY4 A;  3VEX A;  1Q82 O;  3KWI A;  3AGK A;  3ENB A;  4WQ4 A;  2PAV A;  4A57 A;  2OAN A;  4IO8 A;  1YAG A;  1QQM A;  1T6D A;  4YOW A;  4CBX A;  3EO3 A;  2BUP A;  2Q0U A;  3H3O B;  5CE3 A;  4NB4 A;  2C1G A;  5BRD A;  2P9I A;  1KAZ A;  2ASO A;  4BRD A;  4MDB A;  3UKR A;  3VER A;  5FPM A;  2E1Z A;  3CQX A;  3WT0 A;  4CZK A;  4Z94 A;  3ATU A;  5AQQ A;  2QWP A;  4CZM A;  5BRE A;  1Z6R A;  1K8K A;  1RGI A;  3SAF A;  4BY9 C;  2HMP A;  3O9T A;  3CMA N;  3F2K A;  3VOV A;  3L0Q A;  3KHY A;  2QTD A;  4BRE A;  4JK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...