1TZ1A

Solution structure of the pb1 domain of cdc24p (short form)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
GAMGSIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division control protein 24
publication title Solution structure of the PB1 domain of CDC24P (short form)
rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1tz1A00
3DBHI 2MSED 4BKSD 4WJQA 2LI5A 4FN2A 4XZ4A 4JL9A 4NNJB 4G3XB 3V6EB 4B6WA 3H7SA 3UIOB 1A5RA 3L16A 2GBNA 2L8JA 3L17A 3ZVVA 1UGMA 2D07B 5IA7A 3OAWA 3NZUA 3SHQA 2ZPNA 3CF6E 3DVNU 2M0XA 5LXHA 1M94A 4KSKC 2O6VB 4DDID 3ZLZA 2DYMA 1WJ6A 3B1LX 2ZCBA 3PZDA 4A3PA 3VDZA 1RAXA 5JHBA 1HE8A 3N3KB 1LQBA 2O2VB 2LJ5A 4EKUA 4NAWB 1KJTA 3TCAA 3R7QA 2KLCA 4RMAA 4JGHB 2KJ6A 2LASA 2MBOA 4ZYNA 1WJUA 4DHZE 3T8MA 2CR5A 2G4SA 4AJYB 4FADA 4HVBA 3AI5A 3QC8B 2MP2A 4HXDA 4KZ0A 1WZ0A 1GG3A 4G11A 4NPNA 2EMTA 2KX0A 4FJYA 3Q3FA 1TTNA 1WF9A 3DVNV 2XK5B 4ICUA 3H1UA 5DPSA 4DHZB 2DHZA 2PE9A 1MG8A 5CHWA 4I6LB 3VUYA 4BFRA 2K6DB 4E74A 2L0FA 3DVGX 3ALBA 1NBFC 3UIPB 2JVCA 4NJ6A 1E8WA 4N9F4 2KFKB 1V6EA 4DWFA 1P3QU 3QQ8B 4MDKE 2BWFA 4ANWA 4G0NB 2DX5B 2MBHA 3H6NA 1GJZA 3R3MA 2KJRA 3RZWC 4HCNB 4RM9A 2Z0DB 1LFDA 3VHTC 2Y5BB 3ML9A 3ZNID 4AP4C 2IYDB 4BBNC 2KFJA 2O2VA 4GDKB 2CHWA 2WX0A 2CS4A 2NBVB 3A9JB 4TQ1A 5DCNA 3NS8A 4W9FA 3VFKA 3AU5A 2A5UA 1KLVA 4B95A 3H9DA 1SGHA 1WXSA 4HDOA 4OVUA 5D2MB 2FCNA 2IO2B 2PJHA 1UBQA 4PS7A 3S2AA 1PQSA 4LDTB 2GBMA 3EECA 2B3AA 4A3OA 4TKNA 2CHZA 1E7UA 2XK5A 5AZHA 4MSMB 2MRPA 3L0WB 1VD2A 2MBBB 1V86A 4HPLB 2D3GA 2C7HA 2DYBA 4MELA 3CMMB 1D3ZA 1I42A 4OVVA 5JH5C 5LLIA 2KO3A 3ZUNA 4ANVA 1SE9A 4F1SA 4MEMA 3ZTCA 3UQAA 2N9XA 1V2YA 4TQ0A 3HHMA 3W1YA 2RPQA 2RSUA 4AOFA 2ZCCA 2KMCA 1RFAA 2CKHB 4W9GA 1SIFA 4DHJD 1C3TA 4EEWA 2NR2A 4IM3A 4W9EA 4EZLA 2K8BA 5CHVC 3ZW3A 1F9JA 1OTRB 1EO6A 2KVRA 1H8CA 1WZ3A 5HKHA 2DZMA 2MQJA 4TUUA 4DBGA 4GOCA 4W9KA 5AEKB 4GDLA 2D2QA 2KQSA 3NZSA 3V62A 2KN5A 2R2QA 3PRPB 1J8CA 3PVLA 4I6PA 2UYZB 2PPHA 3ZKJC 4PYZA 2YLMA 3PPAA 3KW5B 4HDQA 3V61A 2KX3A 1WY8A 5BO4B 2BKRB 4BOSC 2MP2B 1JRUA 2EMSA 3A9KA 3ZIMA 5J18A 2ZPYA 4W9LA 4GSWA 5DPWA 2JRIB 3SD5A 1X1MA 2ZEQA 4EZJA 3PGEA 3Q3JA 4AUQC 1Z2MA 1KOTA 3AU4A 1Y8RC 3KVFB 2Z59B 3A1QA 1EF1A 1WGGA 3HM3A 4HLEA 3TMPB 3VTWA 2IO1B 4W9DA 4IG7B 3GOEA 2KANA 4TV3A 3KUCB 1EF5A 1OGWA 3VVWB 2NS5A 3L13A 4CYEA 1WGHA 3H7PA 2KTRA 4FHKA 3QIJA 4E71A 4JIOU 4ZRKA 2KOXA 5DPTA 2R2OA 2HTHA 3ZDTA 4KV2A 1E8ZA 5AZFA 3AXCA 4F8CB 3UGBB 2JRHA 3IHPC 2DZJA 2IBIB 5DPRA 2KKCA 4K7SA 3SDLC 3PRMB 3GZNI 3DCGA 2BKFA 3IVFA 2N1WA 3K9OB 3KH0A 3IG3A 5J2RA 2GMIC 5E6OA 2KDBA 1S3SG 4IWQA 4EOYA 1V9JA 2C60A 2BGFA 2BWES 4X57B 2KD0A 3M62B 5JZEB 4HCPB 3DOWA 3R66C 2M4NA 2LGYA 3ZDMC 2L00B 2KDEB 4MM3A 2MX2A 4W9HA 2NBWB 3M63B 2C9WB 4LCDE 3PT2B 2PE6B 4WWPA 4ZRIA 2LXCA 4PS3A 2N4FA 3QCAA 4ASWC 2IY1B 2FAZA 1WM3A 1WR6E 4WJOA 2BYEA 3D32A 4IWPA 4FHJA 4W9IA 2CHXA 3WANA 2K1FA 1WIAA 3A4SC 2G45B 1WH3A 1AARA 2VRRB 2DZIA 4NY0A 2KWUB 4W9CA 3U8ZA 4K7WA 4AJWA 2K8CA 1P0RA 3TIXA 5L95C 4KVGB 4M0WB 3ZRCA 4MGYE 2ZVNA 4GDLB 1OEYJ 2KDIA 2MW5A 1NDDA 1YD8U 3QX1A 1V80A 3R7RA 2KXJA 4BKTA 2N7EA 3K9PB 3IFWB 2LRWA 1WX7A 2AWTA 3A9KB 3M95A 3PHXB 4KSLC 2K8HA 5D6JB 2O6VD 1UELA 4GN1A 1E8XA 3OLMD 5CX3A 3KUZA 3DQVA 1WXVA 1XT9B 2XEWA 1WJ4A 3W1SC 3CSFA 4BVUC 2L3ZA 3IBEA 3T9LA 4MGZE 3MHSD 3VAWA 2BYFA 1J19A 2K39A 2IO3B 1YX6B 3RYTA 3A1QB 2AL3A 4IM2A 5E6NA 1YIWA 2AL6A 2FCQA 2J0MA 3PRZA 4MJSB 4MGKE 3ZRFA 4CO7A 1WMHA 3JYUA 2C7NB 2MCNB 5L83A 4KIKA 1G6JA 3WA0A 2J0KA 2PEAA 3ZNZB 2ZNVC 2FNJB 5E6PA 2KQ7A 4DK5A 1EUVB 1XQQA 3BY4B 4FA6A 1FXTB 2FCSA 3DDCB 3V60A 4E3CA 3H7PB 1GUAB 2KTRB 2NVUI 4YL8A 1L2NA 1WYWB 1NI2A 4WJNA 4K1RB 3X0WA 3P2BA 1WRDB 1ZW7A 3A4RA 1Z5SB 2I1KA 1OQYA 3QA8A 4NQKE 2FIFA 4LJPB 4M8MA 3VQIA 2C5LC 2FCMA 2KK8A 2IY0B 2ZNVB 2I1JA 1ZGUB 3LDZE 5D7GA 1H4RA 3MTNB 3QJZA 2V3SA 3JW0X 4GIVA 1WM2A 1Q0WB 2NBUA 3QK0A 2BPSA 2LRUA 2L05A 1WFYA 2UWQA 2XBBC 3DBSA 3L10B 4G50A 3PSEB 1WR1A 5C1ZA 2G3QB 2N1VA 2N7DA 3OJ4B 3U30A 1ISNA 2JPHA 3EFUA 5TR5A 3RZFA 3VUWA 3ZNHB 2WYQA 5J17A 5CTRC 2GBRA 4BKSA 2HD5B 3JSVA 1UBIA 2DAFA 3B08A 2M17A 3JVZX 2V4LA 4MJSA 4AWJA 4WWNA 3APCA 1ZKHA 4XC2A 3VTUA 1WGRA 2HJ8A 4XX5A 4A20A 4IW0A 2D11A 3ECIA 4LDTD 3W1SA 2N9PC 2LUEA 3RCZA 3NHEB 3PLUA 4GXBA 1WE7A 3UINB 2AYOB 4JLCA 1V49A 2WWZA 3RT3B 3DBLI 3APDA 1OEYA 1UD7A 1Q1OA 1WX8A 2LVQA 2KWVB 1LXDA 2MBQA 4WAAA 2AEHA 1T0YA 1UZXB 3C0RB 3ENEA 3PREA 3QAQA 3TJPA 3L08A 3N30A 3EHVA 4ZRJA 3AULA 1IPGA 3MJWA 3N32A 3PV1A 4HPMB 2WDTB 4B9KA 2FUHB 4DXAB 2D10A 4NJ7A 1I35A 1YJ1A 2KNBA 1IP9A 2J0JA 1WXAA 2KC2A 4EFOA 1IYFA 3QHTA 3O65B 2ZZPB 1GC7A 3PLVA 4HK2A 4F7ZA 1QZEA 2LWPA 3HIZA 2L76A 1R4NI 2NPTA 4RM8A 2M1MA 4ANUA 2JZZA 4CHKA 3ML8A 3UQBA 2N9EB 2HE7A 4GU2A 1K8RB 1UH6A 3ZTDA 3KYDD 4KDLB 2RGFA 4P7IA 4FJVB 2RR9A 3HM6X 1GNUA 2WX1A 5GMVA 4DHJB 1WMHB 1YX5B 3VH4B 2IO0B 4KIKB 1BT0A 3VH3B 1WJNA 4J6IA 4FJZA 4IC7B 4WQOB 4GMVA 2LGXA 1TBEA 2K6QA 1WGYA 2DENB 2K25A 4MGIE 4BBNF 3L54A 2C7MB 3TL5A 2JT4B 2GBJA 3U7DA 4EZKA 1E7VA 2MWSB 2ZVOA 1V5TA 2KMAA 4K7UA 4KZCA 3TBLD 2O6VA 4DDGD 3HK0A 4IM0A 2L7RA 4II3B 2OJRA 2MBEA 2QHOA 3I3TB 5EDSA 3LJ3A 1E90A 1LM8B 1J0GA 4NAWA 3V6CB 2V1YA 4WWOA 3WALA 2JUOA 3APFA 2LD9A 2CU1A 2MLBA 2A4ZA 2KTFA 3JSVB 1P9DU 3BINA 3VXWA 3WAOA 4IUMB 2JZ3B 3DPDA 4HWIB 1E8YA 1P98A 4EUTA 3VTVA 2KHWB 2LVPA 2KWCA 2DYOA 4GGQA 3CSTA 2NCNA 3OJ3A 2KJHB 3DBRI 5D94A 2L0TA 1WX9A 3X23A 1WGDA 5C23A 2GOWA 2KLGA 3WIMA 1V5OA 5KHQA 2OOBB 2ZJDA 3EC8A 1GC6A 2JWZA 1C1YB 4K81A 4NQLB 4ANXA 1RRBA 1WE6A 3UF8A 3KYCD 1WI0A 2LXAA 5IAAC 2KFKA 1Q5WB 1E5WA 3B0AA 5JHAA 2REXA 4WJPA 2MA9B 5KHOA 1YQBA 4HJKA 3KUDB 4LJOB 1S1QB 5G2NA 2DAJA 3DVGY 3QARA 2J7QB 3SU8X 4ICVA 3PS6A 2KC1A 2Z0EB 4I6NB 3VUXA 1L7YA 3WAMA 4ZDVA 2IZVB 1TZ1A 4M8NA 5G55A 4FLHA 3NOBA 2JY6A 3PHWB 1CMXB 2KDFB 2JF5A 2YVCA 4GB9A 1WXMA 1TGZB 5CHFA 4GDKA 4W9JA 3PTFC 1RLFA 2NPTB 3RD2A 5AZGA 3A9JA 4BKGA 1KM7A 4BOZB 2LVOA 3QWZB 1P1AA 2W9NA 2G4DB 1R4MI 2DZKA 2KZRA 2RD0A 3ZO5B 1XD3B 4URKA 2BYVE 2LZ6A 3M3JA 3WAPA 3NY5A 4FULA 4KDIC 4IWOA 3RULA 2ASQA 4II2B 2GBKA 2FIDA 2M8SA 3A33B 4PS8A 2EKEC 4MSQB 5LXIB 4JQWC 4PYUA 5FR6A 4MH0E 2BF8B 2LGDA 3RUIB 3ONSA 1VCBA 3ZNGC 1V81A 2JXXA 4FBJB 1U4AA
chains in the Genus database with same CATH superfamily
2LI5A 2CU3A 4JL9A 4C80A 3ZVVA 4FXCA 5IA7A 3OAWA 4ZRPA 3SHQA 2ZPNA 3CF6E 5LXHA 2M0XA 3OWEB 4KSKC 3ZLZA 1WJ6A 3VDZA 1RAXA 5JHBA 5FKAC 3N3KB 2O2VB 2JX5A 1KJTA 1PUTA 1FO4A 2W82A 2WS3B 3TCAA 1V1PA 4JGHB 2KJ6A 4ZYNA 2WXIA 1C77A 4AJYB 2G4SA 3Q8AA 4FADA 1F2RI 2MP2A 3N1XC 1GG3A 2KX0A 3Q3FA 2I38A 4US9A 4L1BA 3Q14C 2MHJA 2X8XX 1K52A 1I4HA 1ESFA 4I6LB 2RDHA 2SEBD 1ZXHA 1E8WA 1L6VA 1V6EA 4DWFA 4G0NB 3IXSA 2KJRA 2G9HD 2Z0DB 1T0RC 1B9RA 3GE8C 1WRIA 3Q8CA 3NJTA 5DCNA 3NS8A 1FNUA 1SB3C 1KLVA 2A5UA 4YTMB 4OVUA 1SGHA 4HDOA 2PJHA 3S2AA 1BMLC 4PS7A 2SAKA 2GBMA 3P4PB 4A3OA 3CIRB 1D3ZA 2D3GA 2C7HA 3CMMB 3AE8B 3UQAA 1N61A 1V2YA 4TQ0A 2FUG1 2ZCCA 1RFAA 4DHJD 1C3TA 4EEWA 2LGSA 1OTRB 1UWMA 2KVRA 5TSSA 2J42A 4TUUA 3V62A 1J8CA 3ZKJC 4PYZA 1V1PB 3PPAA 4HDQA 3V61A 1WY8A 3RI7C 3DWGC 2MP2B 1JRUA 5JXVA 2ZPYA 4GSWA 4ZHOA 5DPWA 4MH8A 2L83A 4EZJA 3Q3JA 3AV8A 4AUQC 2Z59B 4C56C 1C79A 4HLEA 3VTWA 5BMHA 2QCZA 3BK1A 2LGIA 2NS5A 4CYEA 1WGHA 4K3BA 2EKIA 3QIJA 4ZRKA 1R4MB 2R2OA 2HTHA 4KV2A 1E8ZA 1I4RA 1PDXA 3PRMB 2GB1A 2N1WA 3KH0A 1S3SG 2C60A 1I4QA 4HCPB 1VDVA 3DBHB 3DOWA 5EE1A 2M4NA 3ZDMC 1MHHE 2L00B 5IO9A 2M19A 2KDEB 2NBWB 2WXOA 2UU7A 2LXCA 4ASWC 4WJOA 4IWPA 1N62A 4W9IA 2QDFA 1WIAA 3C8YA 4OZAA 1ZE3D 2QSDA 2H89B 1MJDA 4P6VF 2ZVNA 1Q10A 1NDDA 1SSNA 3R7RA 2KXJA 2CJOA 1PGAA 1AWDA 1WX7A 3FAHA 1UELA 2WXRA 4GN1A 1YJIA 3KUZA 2V0GA 1ROEA 2KQ4X 3AE2B 1WJ4A 5HG2A 3CSFA 4MGZE 1J7BA 2K39A 1RWSA 3UI3A 4P1CC 4IM2A 5E6NA 1EM7A 1YIWA 3MC9A 4MGKE 1WMHA 1VJKA 4KIKA 4ZOHC 3P63A 2FNJB 4OW0A 3U52E 1EUVB 1XQQA 2FCSA 4J3OD 1L2NA 1TS5A 1WYWB 3RMKC 4B0EA 1SE3A 2GRIA 4NQKE 4M02A 4LNFA 1HEZE 3TSSA 1FPYA 2LJIA 3LDZE 1KLUD 4GIVA 4TSSA 3QK0A 1F1HA 2KAJA 1DOIA 3DBSA 1M4VA 1LGRA 4G50A 2N1VA 2N7DA 2RDGA 3U30A 5BYSA 5J17A 3DHGC 5CTRC 2GBRA 4BKSA 2HD5B 3NRZA 1UBIA 3RN9C 1ZP0B 3GB1A 1ZKHA 2PKOA 4QAYA 4A20A 1VLBA 3ECIA 2WXHA 3RNEC 1C76A 4GXBA 1PYWD 3Q8BA 1FXIA 1OEYA 2KWVB 5G5HA 3TJPA 2AEHA 1T0YA 3C0RB 3ENEA 3QAQA 3L08A 4ZRJA 3AULA 4IKGA 1IPGA 3PV1A 1KRHA 2DBYA 3I5JC 1IP9A 2J0JA 1WXAA 2KC2A 1IYFA 3QHTA 4C4VA 3PLVA 3Q8EA 2WXNA 2L76A 2NPTA 3IAM1 2M56B 2JZZA 2HE7A 1D6EC 2LUMA 3KYDD 3BK2A 2V3PA 4KDLB 4FJVB 2ACZB 3HM6X 2WX1A 4DHJB 1WMHB 2QMTA 4KIKB 3VH3B 2BVCA 3GZNB 2IGHA 2INPE 1XCTL 1TBEA 2K6QA 1WGYA 1TJEA 1YN4A 1EWYC 2BBCA 2ON8A 3NVWA 3ZXVA 3AEGB 2K3UA 1E7PB 3P4SB 1JWUD 3TBLD 4HJGE 3HK0A 2L7RA 5BYQA 3I3TB 3B2FA 3LJ3A 3WALA 2JUOA 3APFA 2LD9A 1EWCA 1FM0D 3EA6A 3BVGA 2DYOA 4GGQA 2L0TA 1WGDA 4H2AA 5C23A 3NS1A 2GOWA 2KLGA 4A6QA 2JWZA 2WXPA 1RRBA 1QT9A 3UF8A 1WI0A 1Q5WB 1E5WA 3I9V1 3AECB 5KHOA 2MA9B 1L5PA 3AEBB 1JCKB 4HJKA 3QARA 1GB1A 3WAMA 1L7YA 2IZVB 2BS3B 4C4VB 2NPTB 1XLNA 2JQRB 1P1AA 4R3DA 1R4MI 2DZKA 3ZO5B 3P4RB 1XD3B 1B1ZA 2V4IB 3WAPA 4KDIC 2YEPB 4IWOA 1SIJA 2ASQA 3I57A 1YN5A 1N60A 1L0XB 5FR6A 4MH0E 4C7YA 3ONSA 1VCBA 3U7ZA 1VZ7A 3DBHI 3AE4B 3TEWA 1R7SA 1UGJA 3L16A 2L8JA 3NZUA 1C4CA 4A3PA 3HVDA 2BB6A 1HE8A 2LJ5A 4JWUC 1QQRA 4RMAA 2LASA 1WJUA 3T8MA 3AI5A 3QC8B 1WZ0A 3DBLB 4FJYA 2BS2B 2RDBC 2WU2B 3DVNV 3HRDD 4ICUA 3MFGA 2IGGA 4DHZB 2PE9A 4E74A 5CHWA 2K6DB 4OZCA 2L0FA 4NJCA 3ALBA 3UIPB 2JVCA 4N9F4 4WWMA 2ZW1A 1P3QU 2BWFA 4ANWA 1DYQA 2Y5BB 2O2VA 2WX0A 2CS4A 3W5VB 1JROA 4TQ1A 4XDCA 1VRAB 4KX6B 4W9FA 4IDIA 3H9DA 3V3XA 1QOBA 1PQSA 1JWAD 2B3AA 4US8A 2CHZA 1KH0A 1VD2A 2MBBB 2DYBA 5JH5C 4LNOA 5LLIA 3ZUNA 4F1SA 4NAMA 4MEMA 3ZTCA 3RFZB 1XXGA 3PZ7A 3HHMA 3W1YA 2RPQA 2KMCA 1SIFA 2D3CA 2NR2A 2K8BA 3AH7A 1FNVA 5CHVC 3VR9B 1F9JA 1EO6A 1H8CA 1TY2A 2MQJA 4DBGA 1TS3A 1WXQA 3ZQ4A 2KQSA 1NENB 2KN5A 2R2QA 2YEPF 5BO4B 4N59A 2JYTA 4BOSC 3A9KA 4ZRQA 4S0RA 1UUPA 1L6UA 1X1MA 2W3RA 3PGEA 3LYYA 3AU4A 2LHEA 4KGSA 1EF1A 2TSSA 3TMPB 1FEHA 2WXQA 2K0PA 3KUCB 3L13A 3H7PA 4FHKA 2AQ1B 5DPTA 5BYRA 3CWIA 3ZDTA 3AXCA 2JRHA 5DPRA 2KKCA 1IUEA 3GZNI 3K9OB 3IG3A 2GMIC 2PMVA 5E6OA 1TZOA 4EOYA 4RNAA 3M62B 3PZ8A 2D3BA 4HKQA 1XLPA 2AQ2B 4MM3A 1GAQB 1MI0A 3M63B 4LCDE 4WWPA 2IY1B 2FAZA 2N9LA 1OQQA 1HTOA 1WM3A 2XN9C 3FKYA 2BYTA 3D32A 3N1YC 3U4EG 2CHXA 1OFFA 2INNE 1XO3A 4AJWA 5IKCM 5L95C 4KVGB 2Y3AA 3BIID 1ZXIA 3AEAB 1FRRA 1NVID 2MW5A 3URYA 1YD8U 1V80A 3EGRA 3LB8C 2LHDA 2LRWA 3A9KB 4KSLC 1SF0A 2O6VD 5D6JB 2JYEA 2VZKD 1E8XA 3OLMD 3R2IA 5CX3A 3SFDB 3DQVA 1XT9B 2WXMA 2JZPA 3W1SC 3IBEA 3P1MA 2BYFA 1J19A 3BYYB 4A55A 2IO3B 2AL3A 4YTPB 2FCQA 4MJSB 2J0MA 3ZRFA 4CO7A 5L83A 1E0ZA 1F52A 2WGSA 5E6PA 2KQ7A 1YOVB 2IPKD 3H7PB 4YL8A 3W2DA 1K50A 1WRDB 4AS1A 2I1KA 4UDUC 2K5PA 1I4PA 2FIFA 4LJPB 2C5LC 1ZGUB 3QJZA 2V3SA 4A90A 1P7FA 3L10B 5C1ZA 1KFYB 4RCOA 5TR5A 3EFUA 2AX5A 4MM3B 3B2GA 1L4ZB 3BYTB 3RNAC 4EE2A 3EUB2 4AWJA 2JU6X 4XC2A 1GOZA 1HQRD 4IW0A 2D11A 1HZ6A 3PLUA 2E6XA 1WE7A 3UINB 2AYOB 4JLCA 2N7JA 1DGJA 2WWZA 3DBLI 1WX8A 2LVQA 4WAAA 3O13A 3EHVA 4HPMB 3ZYYX 2D10A 4NJ7A 1YJ1A 2KNBA 1QOFA 5E6JA 4EFOA 1NEKB 1NYRA 4HK2A 1GC7A 3ABVB 1RFKA 3ML8A 5HHDG 1UH6A 3SFEB 2IGDA 3E9SA 2EELA 3U2SC 2N9KA 3VH4B 1BT0A 3TUOA 4YSXB 4HROA 4NZLB 2LGXA 2VH2A 5AUIA 4MGIE 3L54A 2GBJA 3DWMA 2KACA 2MWSB 3WCQA 1V5TA 2KMAA 2O6VA 4IM0A 3AEDB 2MBEA 2QHOA 2VH1A 1C4PA 2V1YA 2A4ZA 2KTFA 3BINA 4LNIA 3WAOA 2WDVB 2JZ3B 2PTLA 4HWIB 4RF0A 4YT0B 4N58A 4JE3B 4ACFA 3AE1B 3DHHC 1OQRA 3N9YC 3ZJVA 1I4XA 3X23A 1HXYD 1V5OA 1GC6A 4NQLB 1WE6A 2LXAA 5IAAC 2KFKA 3SR6A 3FC4A 4IOIE 2REXA 4LJOB 1S1QB 2DAJA 1YNTE 1QOGA 1D4BA 1WGKA 2KC1A 4ZDVA 1YQ4B 4FLHA 1N5WA 4HPPA 1IGDA 2JF5A 2YVCA 4CQNA 4GDKA 3PTFC 3RD2A 3A9JA 4BKGA 1MVKA 2LVOA 2W9NA 1N6ZA 4WH4A 3Q3NC 3NY5A 3NG0A 1MG4A 1V1OA 2GBKA 2FIDA 5LXIB 2BF8B 2LGDA 3RUIB 5HI1A 3ZNGC 1V81A 3AE7B 4FBJB 3AMZA 1J7AA 1U4AA 2MSED 2WXJA 4WJQA 4FN2A 4XZ4A 1KTKA 3FILA 4G3XB 3V6EB 3H7SA 2GBNA 3L17A 1UGMA 2D07B 3DVNU 1VR9A 1ZDVA 1M94A 2O6VB 2LEKA 1PFDA 2ZCBA 4WURA 3V05A 5T8IA 4EKUA 1LQBA 1KF6B 2KLCA 4DHZE 4XWWA 4G11A 4NPNA 2EMTA 1IBXA 4LNKA 5IOIA 1TTNA 3KWVA 2XK5B 3H1UA 4ITKA 1TS2A 3VUYA 1NBFC 4NJ6A 1F2RC 2KFKB 1FIQA 2WXKA 4MDKE 4LLGM 1R4NB 1L0YB 5FR3A 3E56A 1FCLA 2DX5B 3H6NA 2ZW0A 4RM9A 3VHTC 1LFDA 3ZNID 4BBNC 2KFJA 1P7EA 4RFBA 4PK1A 4GDKB 2CHWA 2GLSA 4RGMA 3RNCC 2NBVB 3A9JB 4OZBA 3VFKA 2WNMA 2FCNA 2IO2B 2OHFA 2QJLA 1IGCA 3EECA 4TKNA 1UNSA 1E7UA 4KGRA 4MSMB 1SEBD 3MJ5A 3L0WB 4OVVA 2WXLA 4ANVA 1SE9A 2Z8LA 1E9MA 3AE9B 4ARIA 5D3DA 1T6BX 1E10A 3FILB 2WHIA 4L2YA 4EZLA 3AE3B 3ZW3A 1FCCC 4HEA1 2V3NA 1WZ3A 3NVVA 5HKHA 4HKZE 2Y5CA 4GDLA 3NZSA 5EE0A 1JWBD 3PRPB 2UYZB 2PPHA 2YLMA 1ZOYB 1SJHD 3ZIMA 5J18A 2EMSA 3B9JA 4W9LA 1IBXB 1UWXA 3AN1A 1J7CA 2ZEQA 3EFCA 3AB5A 1KOTA 2QEJC 3KVFB 1KLGD 1WGGA 3HM3A 4DXFA 4K3CA 4XDDA 1SBBB 4W9DA 2KANA 1EF5A 3VVWB 2KTRA 4JIOU 1MPEA 2KOXA 2Q5WD 4F8CB 2IBIB 4K7SA 2L1AA 3SDLC 1YN3A 4LNNA 1T5XD 1TKYA 3Q6BA 1BXTA 4IWQA 1V9JA 3H8HA 5JZEB 1TIFA 4X57B 1SXTA 2KD0A 3GS2A 3OG5A 1VZ8A 3KLSX 2MX2A 4W9HA 2C9WB 3PT2B 2PE6B 3RNGC 4ZRIA 2N4FA 3QCAA 4YWGG 1WR6E 4FHJA 3WANA 2K1FA 2MJ3A 3A4SC 1JWSD 1QILA 2VRRB 2DZIA 4NY0A 4W9CA 3U8ZA 4K7WA 2K8CA 1P0RA 3HVZA 1PGBA 2KMMA 3J9CA 4C7ZA 4MGYE 4GDLB 3BWUD 4BKTA 1JQ4A 3IFWB 2AWTA 1FXAA 1TKGA 2K8HA 3ZGZA 2KYWA 3MP9A 5AUKA 1WXVA 2QILA 2L3ZA 1XLOA 3MHSD 3VAWA 1GB4A 3RYTA 1YX6B 2AL6A 1TS4A 1I4GA 4PT5A 2C7NB 1G6JA 1ZDXA 4RGNA 3ZNZB 2PW9A 2ZNVC 3BVMA 4DK5A 3BY4B 3IT4B 2ICIA 5HFYA 1FXTB 3DDCB 2KTRB 2NVUI 4RH6A 4WJNA 4K1RB 3X0WA 1ZW7A 3BVZA 2MJDA 3A4RA 1L4DB 5I4DA 1OQYA 3QA8A 2WQYB 3C19A 4M8MA 1JMLA 3VQIA 3ZJUA 2FCMA 2WU5B 2KK8A 2ZNVB 2AQ3B 2H88B 5D7GA 1H4RA 2NBUA 2BPSA 1WFYA 4LTUA 5H92C 2ONQA 3PSEB 2G3QB 1ISNA 2NTTA 4P1BC 2DAFA 3B08A 2M17A 3JVZX 2V4LA 1T3QA 4MJSA 4XGAB 3APCA 1WGRA 2HJ8A 4C00A 4XWTA 2IDYA 5C2TB 4LDTD 4XYCA 3W1SA 2N9PC 2LUEA 1JWMD 3RT3B 3APDA 4KKJA 1EU4A 1UD7A 1Q1OA 2KT7A 1LXDA 1UZXB 3TEZA 3MJWA 1MFWA 4RGOS 2BT6A 4B9KA 2NMQA 1ACCA 2PLPA 3O65B 3VRBB 2ZZPB 2JXTA 3HIZA 4RM8A 1R4NI 4ANUA 4CHKA 2N9EB 4GU2A 3MHZA 1XLQA 2OJWA 4ARCA 4YTNB 2RGFA 4P7IA 2RR9A 2W54A 1XF5L 4O1NA 5D3IB 1GNUA 5GMVA 1YX5B 4TMAB 1WJNA 1JW9D 4J6IA 2RPVA 3L4PA 4FJZA 1AYFA 4WQOB 4GMVA 1A70A 2E3TA 2C7MB 2WP9B 1E7VA 1XEEA 2ZVOA 3RNFC 5C3JB 2L32A 3VRAB 4II3B 2OJRA 5EDSA 1LM8B 1TYGB 1J0GA 4NAWA 2J53A 2M0AA 4WWOA 2HDEA 1FFUA 2MLBA 1P9DU 4IUMB 4XE0A 4BAXA 2XNAC 1E8YA 4A8XC 1TT5B 3VTVA 4YSZB 2LVPA 2KWCA 1D5MC 5EE3A 4A9AA 3CSTA 2NCNA 3OJ3A 5D94A 2MJEA 1AW7A 1BUIC 3WIMA 5KHQA 2ZJDA 1K53A 2DLBA 1CK1A 3EC8A 4ANXA 3KYCD 4JWSC 5IP4D 3B0AA 3PO0A 4GLSC 4WQMA 3NVYA 4WJPA 1YQBA 3KWLA 3KUDB 1FNWA 1DOXA 2J7QB 4ICVA 3PS6A 3VUXA 1F0ZA 1HTQA 4M8NA 5G55A 3NOBA 3R2TA 2KDFB 5CHFA 4YXDB 1RLFA 5AZGA 4BOZB 2G4DB 2RD0A 2BYVE 3M3JA 4FULA 2FBWB 4II2B 2M8SA 3A33B 1AN8A 4PS8A 4MSQB 4JQWC 1ET9A 1C78A 2JXXA 4BKSD 5BMIA 4P16A 4NNJB 2BS4B 1K51A 4B6WA 1A5RA 3UIOB 1V97A 2W3SA 2K9XA 4DDID 2DYMA 2D5GA 3B1LX 4L23A 3PZDA 2WXGA 4LK0M 3Q3MC 4NAWB 3R7QA 2MBOA 2CR5A 4HVBA 1CZPA 4KZ0A 4HXDA 1Y56A 1WF9A 3AE5B 3HUIA 5DPSA 2DHZA 1QKZA 1MG8A 4BFRA 3DVGX 2J4XA 3I63C 4KKIA 2KDMA 3QQ8B 1QOAA 3NZ3A 4B0MA 3MC0B 2MBHA 1GJZA 3R3MA 4ZHPA 1RYJA 3RZWC 2PIAA 3VR8B 4HCNB 4AP4C 3Q8FA 3ML9A 2IYDB 1L0VB 3AU5A 4B95A 1WWTA 1WXSA 5D2MB 2R61A 2D3AA 3AM9A 1UBQA 4LDTB 2WXFA 2XK5A 5AZHA 3IAS1 2MRPA 1EU3A 1STEA 2MEKA 4OHJA 1V86A 4HPLB 4MELA 1I42A 2CJNA 2KO3A 3Q2AC 2N9XA 4AOFA 2RSUA 2CKHB 1NI3A 4W9GA 4MT5A 3NUHB 2HJ1A 4IM3A 4W9EA 2HTME 4MACA 1T0QC 1SE4A 4M0WA 1D5ZC 2DZMA 3P42A 4GOCA 4W9KA 5AEKB 2D2QA 3DBRB 1YQ3B 3PVLA 4I6PA 4JPSA 3KW5B 2KX3A 1ZUD2 2BKRB 3W5UB 2BTEA 1TY0A 2JRIB 3SD5A 4S17A 1Z2MA 1HZ5A 1Y8RC 3T3NA 1T0SC 2DWQA 3A1QA 2IO1B 3GE3C 1CJEA 1FRDA 4IG7B 3GOEA 4TV3A 3RPFC 5H8YE 1OGWA 3N20C 2X38A 2GI9A 2J52A 4E71A 2INDC 4ZYSA 2VZKB 5AZFA 2KWDA 3UGBB 3IHPC 2DZJA 4WIPA 3TEXA 3DCGA 2BKFA 2WDRB 3IVFA 5J2RA 1I7HA 2KDBA 1HA5A 1TKEA 2BGFA 2BWES 3R66C 2LGYA 1DOYA 1GPXA 2LMCA 4JX1C 4PS3A 1C4AA 4AQ7A 5GXGB 1WYGA 2RMMA 3GP7A 3TEYA 2BYEA 4OVZA 1QF6A 1FFVA 1CQVA 2G45B 1WH3A 1AARA 1NYQA 2KWUB 3LXFA 3RNBC 2MH7A 3TIXA 1MHXA 4M0WB 3ZRCA 1N63A 2FE8A 1OEYJ 2NTSA 2KDIA 3QX1A 2N7EA 3K9PB 2INCC 3M95A 3PHXB 1PGXA 1LO5D 4D2KA 4USAA 2QIEB 2XEWA 1F77A 5LNK1 1C9FA 4Q2JA 4BVUC 3T9LA 1ZPSA 3A1QB 2K22A 3PRZA 3IT6B 3JYUA 2MCNB 3WA0A 2J0KA 2PEAA 3P4QB 3SEBA 4FA6A 4DQOC 3V60A 3R8BA 4E3CA 1GUAB 1WSPA 4REZA 1NI2A 1QLBB 3P2BA 1Z5SB 2W55A 2IY0B 3AEFB 2I1JA 3MTNB 3AEEB 3JW0X 1UF0A 3N1ZC 1WM2A 3Q3OC 1Q0WB 1N5XA 2LRUA 2L05A 2UWQA 2XBBC 3T3OA 5BMGA 1WR1A 1YMHE 1JRPA 3OJ4B 2JPHA 3RZFA 3ZNHB 3VUWA 2BW2A 2WYQA 4HRSA 3JSVA 3BZDB 4WWNA 3VTUA 4XX5A 2KVZA 3RCZA 3NHEB 1RM6C 1V49A 3NVZA 2DNFA 2QC8A 2LFIA 1ET6A 2MBQA 3PREA 3Q69A 4M01A 2G1EA 3N30A 3ZXRA 4RF1A 1JALA 3N32A 4N6EB 2WDTB 4DXGA 2OEDA 2FUHB 4DXAB 1I35A 4BZAA 2BB5A 4F7ZA 1QZEA 2LWPA 2M1MA 5G5GA 3UQBA 2V9HA 1K8RB 3ZTDA 2WDQB 2JSVX 2JWUA 5FK9C 2IO0B 5MPOA 4IC7B 3ZJTA 2DENB 5EE9A 2K25A 4BBNF 3TL5A 2JT4B 5IN7A 1VZ6A 3ETRA 3U7DA 4EZKA 1SJED 4K7UA 4KZCA 4DDGD 2KN4A 2Y5PA 1E90A 2I2YA 3AE6B 1YJJA 3V6CB 2CU1A 3JSVB 3VXWA 1XCQL 1FMAD 3DPDA 1P98A 4EUTA 2KHWB 2IJ0A 2KJHB 3DBRI 1WX9A 2PVOD 1ENFA 1D5XC 2L52A 2OOBB 2BQQA 1V8CA 3KQ4A 4M00A 4KGTA 1C1YB 4K81A 5JHAA 3W9CB 2PVGC 3MC8A 5G2NA 3DVGY 3SU8X 4I6NB 2Z0EB 1E6EB 1TZ1A 4WAFA 2JY6A 3PHWB 1CMXB 4GB9A 1WXMA 4RGTA 1TGZB 2WLBA 1SE2A 4YSYB 4W9JA 1KM7A 3DHIC 3QWZB 4URKA 2KZRA 2LZ6A 2N0SB 3RULA 1FD6A 2EKEC 4PYUA 2B76B
chains in the Genus database with same CATH topology
3DBHI 2MSED 4BKSD 4WJQA 2LI5A 4FN2A 4XZ4A 4JL9A 4NNJB 4G3XB 3V6EB 4B6WA 3H7SA 3UIOB 1A5RA 3L16A 2GBNA 2L8JA 3L17A 3ZVVA 1UGMA 2D07B 5IA7A 3OAWA 3NZUA 3SHQA 2ZPNA 3CF6E 3DVNU 2M0XA 5LXHA 1M94A 4KSKC 2O6VB 4DDID 3ZLZA 2DYMA 1WJ6A 3B1LX 2ZCBA 3PZDA 4A3PA 3VDZA 1RAXA 5JHBA 1HE8A 3N3KB 1LQBA 2O2VB 2LJ5A 4EKUA 4NAWB 1KJTA 3TCAA 3R7QA 2KLCA 4RMAA 4JGHB 2KJ6A 2LASA 2MBOA 4ZYNA 1WJUA 4DHZE 3T8MA 2CR5A 2G4SA 4AJYB 4FADA 4HVBA 3AI5A 3QC8B 2MP2A 4HXDA 4KZ0A 1WZ0A 1GG3A 4G11A 4NPNA 2EMTA 2KX0A 4FJYA 3Q3FA 1TTNA 1WF9A 3DVNV 2XK5B 4ICUA 3H1UA 5DPSA 4DHZB 2DHZA 2PE9A 1MG8A 5CHWA 4I6LB 3VUYA 4BFRA 2K6DB 4E74A 2L0FA 3DVGX 3ALBA 1NBFC 3UIPB 2JVCA 4NJ6A 1E8WA 4N9F4 2KFKB 1V6EA 4DWFA 1P3QU 3QQ8B 4MDKE 2BWFA 4ANWA 4G0NB 2DX5B 2MBHA 3H6NA 1GJZA 3R3MA 2KJRA 3RZWC 4HCNB 4RM9A 2Z0DB 1LFDA 3VHTC 2Y5BB 3ML9A 3ZNID 4AP4C 2IYDB 4BBNC 2KFJA 2O2VA 4GDKB 2CHWA 2WX0A 2CS4A 2NBVB 3A9JB 4TQ1A 5DCNA 3NS8A 4W9FA 3VFKA 3AU5A 2A5UA 1KLVA 4B95A 3H9DA 1SGHA 1WXSA 4HDOA 4OVUA 5D2MB 2FCNA 2IO2B 2PJHA 1UBQA 4PS7A 3S2AA 1PQSA 4LDTB 2GBMA 3EECA 2B3AA 4A3OA 4TKNA 2CHZA 1E7UA 2XK5A 5AZHA 4MSMB 2MRPA 3L0WB 1VD2A 2MBBB 1V86A 4HPLB 2D3GA 2C7HA 2DYBA 4MELA 3CMMB 1D3ZA 1I42A 4OVVA 5JH5C 5LLIA 2KO3A 3ZUNA 4ANVA 1SE9A 4F1SA 4MEMA 3ZTCA 3UQAA 2N9XA 1V2YA 4TQ0A 3HHMA 3W1YA 2RPQA 2RSUA 4AOFA 2ZCCA 2KMCA 1RFAA 2CKHB 4W9GA 1SIFA 4DHJD 1C3TA 4EEWA 2NR2A 4IM3A 4W9EA 4EZLA 2K8BA 5CHVC 3ZW3A 1F9JA 1OTRB 1EO6A 2KVRA 1H8CA 1WZ3A 5HKHA 2DZMA 2MQJA 4TUUA 4DBGA 4GOCA 4W9KA 5AEKB 4GDLA 2D2QA 2KQSA 3NZSA 3V62A 2KN5A 2R2QA 3PRPB 1J8CA 3PVLA 4I6PA 2UYZB 2PPHA 3ZKJC 4PYZA 2YLMA 3PPAA 3KW5B 4HDQA 3V61A 2KX3A 1WY8A 5BO4B 2BKRB 4BOSC 2MP2B 1JRUA 2EMSA 3A9KA 3ZIMA 5J18A 2ZPYA 4W9LA 4GSWA 5DPWA 2JRIB 3SD5A 1X1MA 2ZEQA 4EZJA 3PGEA 3Q3JA 4AUQC 1Z2MA 1KOTA 3AU4A 1Y8RC 3KVFB 2Z59B 3A1QA 1EF1A 1WGGA 3HM3A 4HLEA 3TMPB 3VTWA 2IO1B 4W9DA 4IG7B 3GOEA 2KANA 4TV3A 3KUCB 1EF5A 1OGWA 3VVWB 2NS5A 3L13A 4CYEA 1WGHA 3H7PA 2KTRA 4FHKA 3QIJA 4E71A 4JIOU 4ZRKA 2KOXA 5DPTA 2R2OA 2HTHA 3ZDTA 4KV2A 1E8ZA 5AZFA 3AXCA 4F8CB 3UGBB 2JRHA 3IHPC 2DZJA 2IBIB 5DPRA 2KKCA 4K7SA 3SDLC 3PRMB 3GZNI 3DCGA 2BKFA 3IVFA 2N1WA 3K9OB 3KH0A 3IG3A 5J2RA 2GMIC 5E6OA 2KDBA 1S3SG 4IWQA 4EOYA 1V9JA 2C60A 2BGFA 2BWES 4X57B 2KD0A 3M62B 5JZEB 4HCPB 3DOWA 3R66C 2M4NA 2LGYA 3ZDMC 2L00B 2KDEB 4MM3A 2MX2A 4W9HA 2NBWB 3M63B 2C9WB 4LCDE 3PT2B 2PE6B 4WWPA 4ZRIA 2LXCA 4PS3A 2N4FA 3QCAA 4ASWC 2IY1B 2FAZA 1WM3A 1WR6E 4WJOA 2BYEA 3D32A 4IWPA 4FHJA 4W9IA 2CHXA 3WANA 2K1FA 1WIAA 3A4SC 2G45B 1WH3A 1AARA 2VRRB 2DZIA 4NY0A 2KWUB 4W9CA 3U8ZA 4K7WA 4AJWA 2K8CA 1P0RA 3TIXA 5L95C 4KVGB 4M0WB 3ZRCA 4MGYE 2ZVNA 4GDLB 1OEYJ 2KDIA 2MW5A 1NDDA 1YD8U 3QX1A 1V80A 3R7RA 2KXJA 4BKTA 2N7EA 3K9PB 3IFWB 2LRWA 1WX7A 2AWTA 3A9KB 3M95A 3PHXB 4KSLC 2K8HA 5D6JB 2O6VD 1UELA 4GN1A 1E8XA 3OLMD 5CX3A 3KUZA 3DQVA 1WXVA 1XT9B 2XEWA 1WJ4A 3W1SC 3CSFA 4BVUC 2L3ZA 3IBEA 3T9LA 4MGZE 3MHSD 3VAWA 2BYFA 1J19A 2K39A 2IO3B 1YX6B 3RYTA 3A1QB 2AL3A 4IM2A 5E6NA 1YIWA 2AL6A 2FCQA 2J0MA 3PRZA 4MJSB 4MGKE 3ZRFA 4CO7A 1WMHA 3JYUA 2C7NB 2MCNB 5L83A 4KIKA 1G6JA 3WA0A 2J0KA 2PEAA 3ZNZB 2ZNVC 2FNJB 5E6PA 2KQ7A 4DK5A 1EUVB 1XQQA 3BY4B 4FA6A 1FXTB 2FCSA 3DDCB 3V60A 4E3CA 3H7PB 1GUAB 2KTRB 2NVUI 4YL8A 1L2NA 1WYWB 1NI2A 4WJNA 4K1RB 3X0WA 3P2BA 1WRDB 1ZW7A 3A4RA 1Z5SB 2I1KA 1OQYA 3QA8A 4NQKE 2FIFA 4LJPB 4M8MA 3VQIA 2C5LC 2FCMA 2KK8A 2IY0B 2ZNVB 2I1JA 1ZGUB 3LDZE 5D7GA 1H4RA 3MTNB 3QJZA 2V3SA 3JW0X 4GIVA 1WM2A 1Q0WB 2NBUA 3QK0A 2BPSA 2LRUA 2L05A 1WFYA 2UWQA 2XBBC 3DBSA 3L10B 4G50A 3PSEB 1WR1A 5C1ZA 2G3QB 2N1VA 2N7DA 3OJ4B 3U30A 1ISNA 2JPHA 3EFUA 5TR5A 3RZFA 3VUWA 3ZNHB 2WYQA 5J17A 5CTRC 2GBRA 4BKSA 2HD5B 3JSVA 1UBIA 2DAFA 3B08A 2M17A 3JVZX 2V4LA 4MJSA 4AWJA 4WWNA 3APCA 1ZKHA 4XC2A 3VTUA 1WGRA 2HJ8A 4XX5A 4A20A 4IW0A 2D11A 3ECIA 4LDTD 3W1SA 2N9PC 2LUEA 3RCZA 3NHEB 3PLUA 4GXBA 1WE7A 3UINB 2AYOB 4JLCA 1V49A 2WWZA 3RT3B 3DBLI 3APDA 1OEYA 1UD7A 1Q1OA 1WX8A 2LVQA 2KWVB 1LXDA 2MBQA 4WAAA 2AEHA 1T0YA 1UZXB 3C0RB 3ENEA 3PREA 3QAQA 3TJPA 3L08A 3N30A 3EHVA 4ZRJA 3AULA 1IPGA 3MJWA 3N32A 3PV1A 4HPMB 2WDTB 4B9KA 2FUHB 4DXAB 2D10A 4NJ7A 1I35A 1YJ1A 2KNBA 1IP9A 2J0JA 1WXAA 2KC2A 4EFOA 1IYFA 3QHTA 3O65B 2ZZPB 1GC7A 3PLVA 4HK2A 4F7ZA 1QZEA 2LWPA 3HIZA 2L76A 1R4NI 2NPTA 4RM8A 2M1MA 4ANUA 2JZZA 4CHKA 3ML8A 3UQBA 2N9EB 2HE7A 4GU2A 1K8RB 1UH6A 3ZTDA 3KYDD 4KDLB 2RGFA 4P7IA 4FJVB 2RR9A 3HM6X 1GNUA 2WX1A 5GMVA 4DHJB 1WMHB 1YX5B 3VH4B 2IO0B 4KIKB 1BT0A 3VH3B 1WJNA 4J6IA 4FJZA 4IC7B 4WQOB 4GMVA 2LGXA 1TBEA 2K6QA 1WGYA 2DENB 2K25A 4MGIE 4BBNF 3L54A 2C7MB 3TL5A 2JT4B 2GBJA 3U7DA 4EZKA 1E7VA 2MWSB 2ZVOA 1V5TA 2KMAA 4K7UA 4KZCA 3TBLD 2O6VA 4DDGD 3HK0A 4IM0A 2L7RA 4II3B 2OJRA 2MBEA 2QHOA 3I3TB 5EDSA 3LJ3A 1E90A 1LM8B 1J0GA 4NAWA 3V6CB 2V1YA 4WWOA 3WALA 2JUOA 3APFA 2LD9A 2CU1A 2MLBA 2A4ZA 2KTFA 3JSVB 1P9DU 3BINA 3VXWA 3WAOA 4IUMB 2JZ3B 3DPDA 4HWIB 1E8YA 1P98A 4EUTA 3VTVA 2KHWB 2LVPA 2KWCA 2DYOA 4GGQA 3CSTA 2NCNA 3OJ3A 2KJHB 3DBRI 5D94A 2L0TA 1WX9A 3X23A 1WGDA 5C23A 2GOWA 2KLGA 3WIMA 1V5OA 5KHQA 2OOBB 2ZJDA 3EC8A 1GC6A 2JWZA 1C1YB 4K81A 4NQLB 4ANXA 1RRBA 1WE6A 3UF8A 3KYCD 1WI0A 2LXAA 5IAAC 2KFKA 1Q5WB 1E5WA 3B0AA 5JHAA 2REXA 4WJPA 2MA9B 5KHOA 1YQBA 4HJKA 3KUDB 4LJOB 1S1QB 5G2NA 2DAJA 3DVGY 3QARA 2J7QB 3SU8X 4ICVA 3PS6A 2KC1A 2Z0EB 4I6NB 3VUXA 1L7YA 3WAMA 4ZDVA 2IZVB 1TZ1A 4M8NA 5G55A 4FLHA 3NOBA 2JY6A 3PHWB 1CMXB 2KDFB 2JF5A 2YVCA 4GB9A 1WXMA 1TGZB 5CHFA 4GDKA 4W9JA 3PTFC 1RLFA 2NPTB 3RD2A 5AZGA 3A9JA 4BKGA 1KM7A 4BOZB 2LVOA 3QWZB 1P1AA 2W9NA 2G4DB 1R4MI 2DZKA 2KZRA 2RD0A 3ZO5B 1XD3B 4URKA 2BYVE 2LZ6A 3M3JA 3WAPA 3NY5A 4FULA 4KDIC 4IWOA 3RULA 2ASQA 4II2B 2GBKA 2FIDA 2M8SA 3A33B 4PS8A 2EKEC 4MSQB 5LXIB 4JQWC 4PYUA 5FR6A 4MH0E 2BF8B 2LGDA 3RUIB 3ONSA 1VCBA 3ZNGC 1V81A 2JXXA 4FBJB 1U4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DBH I;  2MSE D;  4BKS D;  4WJQ A;  2LI5 A;  4FN2 A;  4XZ4 A;  4JL9 A;  4NNJ B;  4G3X B;  3V6E B;  4B6W A;  3H7S A;  3UIO B;  1A5R A;  3L16 A;  2GBN A;  2L8J A;  3L17 A;  3ZVV A;  1UGM A;  2D07 B;  5IA7 A;  3OAW A;  3NZU A;  3SHQ A;  2ZPN A;  3CF6 E;  3DVN U;  2M0X A;  5LXH A;  1M94 A;  4KSK C;  2O6V B;  4DDI D;  3ZLZ A;  2DYM A;  1WJ6 A;  3B1L X;  2ZCB A;  3PZD A;  4A3P A;  3VDZ A;  1RAX A;  5JHB A;  1HE8 A;  3N3K B;  1LQB A;  2O2V B;  2LJ5 A;  4EKU A;  4NAW B;  1KJT A;  3TCA A;  3R7Q A;  2KLC A;  4RMA A;  4JGH B;  2KJ6 A;  2LAS A;  2MBO A;  4ZYN A;  1WJU A;  4DHZ E;  3T8M A;  2CR5 A;  2G4S A;  4AJY B;  4FAD A;  4HVB A;  3AI5 A;  3QC8 B;  2MP2 A;  4HXD A;  4KZ0 A;  1WZ0 A;  1GG3 A;  4G11 A;  4NPN A;  2EMT A;  2KX0 A;  4FJY A;  3Q3F A;  1TTN A;  1WF9 A;  3DVN V;  2XK5 B;  4ICU A;  3H1U A;  5DPS A;  4DHZ B;  2DHZ A;  2PE9 A;  1MG8 A;  5CHW A;  4I6L B;  3VUY A;  4BFR A;  2K6D B;  4E74 A;  2L0F A;  3DVG X;  3ALB A;  1NBF C;  3UIP B;  2JVC A;  4NJ6 A;  1E8W A;  4N9F 4;  2KFK B;  1V6E A;  4DWF A;  1P3Q U;  3QQ8 B;  4MDK E;  2BWF A;  4ANW A;  4G0N B;  2DX5 B;  2MBH A;  3H6N A;  1GJZ A;  3R3M A;  2KJR A;  3RZW C;  4HCN B;  4RM9 A;  2Z0D B;  1LFD A;  3VHT C;  2Y5B B;  3ML9 A;  3ZNI D;  4AP4 C;  2IYD B;  4BBN C;  2KFJ A;  2O2V A;  4GDK B;  2CHW A;  2WX0 A;  2CS4 A;  2NBV B;  3A9J B;  4TQ1 A;  5DCN A;  3NS8 A;  4W9F A;  3VFK A;  3AU5 A;  2A5U A;  1KLV A;  4B95 A;  3H9D A;  1SGH A;  1WXS A;  4HDO A;  4OVU A;  5D2M B;  2FCN A;  2IO2 B;  2PJH A;  1UBQ A;  4PS7 A;  3S2A A;  1PQS A;  4LDT B;  2GBM A;  3EEC A;  2B3A A;  4A3O A;  4TKN A;  2CHZ A;  1E7U A;  2XK5 A;  5AZH A;  4MSM B;  2MRP A;  3L0W B;  1VD2 A;  2MBB B;  1V86 A;  4HPL B;  2D3G A;  2C7H A;  2DYB A;  4MEL A;  3CMM B;  1D3Z A;  1I42 A;  4OVV A;  5JH5 C;  5LLI A;  2KO3 A;  3ZUN A;  4ANV A;  1SE9 A;  4F1S A;  4MEM A;  3ZTC A;  3UQA A;  2N9X A;  1V2Y A;  4TQ0 A;  3HHM A;  3W1Y A;  2RPQ A;  2RSU A;  4AOF A;  2ZCC A;  2KMC A;  1RFA A;  2CKH B;  4W9G A;  1SIF A;  4DHJ D;  1C3T A;  4EEW A;  2NR2 A;  4IM3 A;  4W9E A;  4EZL A;  2K8B A;  5CHV C;  3ZW3 A;  1F9J A;  1OTR B;  1EO6 A;  2KVR A;  1H8C A;  1WZ3 A;  5HKH A;  2DZM A;  2MQJ A;  4TUU A;  4DBG A;  4GOC A;  4W9K A;  5AEK B;  4GDL A;  2D2Q A;  2KQS A;  3NZS A;  3V62 A;  2KN5 A;  2R2Q A;  3PRP B;  1J8C A;  3PVL A;  4I6P A;  2UYZ B;  2PPH A;  3ZKJ C;  4PYZ A;  2YLM A;  3PPA A;  3KW5 B;  4HDQ A;  3V61 A;  2KX3 A;  1WY8 A;  5BO4 B;  2BKR B;  4BOS C;  2MP2 B;  1JRU A;  2EMS A;  3A9K A;  3ZIM A;  5J18 A;  2ZPY A;  4W9L A;  4GSW A;  5DPW A;  2JRI B;  3SD5 A;  1X1M A;  2ZEQ A;  4EZJ A;  3PGE A;  3Q3J A;  4AUQ C;  1Z2M A;  1KOT A;  3AU4 A;  1Y8R C;  3KVF B;  2Z59 B;  3A1Q A;  1EF1 A;  1WGG A;  3HM3 A;  4HLE A;  3TMP B;  3VTW A;  2IO1 B;  4W9D A;  4IG7 B;  3GOE A;  2KAN A;  4TV3 A;  3KUC B;  1EF5 A;  1OGW A;  3VVW B;  2NS5 A;  3L13 A;  4CYE A;  1WGH A;  3H7P A;  2KTR A;  4FHK A;  3QIJ A;  4E71 A;  4JIO U;  4ZRK A;  2KOX A;  5DPT A;  2R2O A;  2HTH A;  3ZDT A;  4KV2 A;  1E8Z A;  5AZF A;  3AXC A;  4F8C B;  3UGB B;  2JRH A;  3IHP C;  2DZJ A;  2IBI B;  5DPR A;  2KKC A;  4K7S A;  3SDL C;  3PRM B;  3GZN I;  3DCG A;  2BKF A;  3IVF A;  2N1W A;  3K9O B;  3KH0 A;  3IG3 A;  5J2R A;  2GMI C;  5E6O A;  2KDB A;  1S3S G;  4IWQ A;  4EOY A;  1V9J A;  2C60 A;  2BGF A;  2BWE S;  4X57 B;  2KD0 A;  3M62 B;  5JZE B;  4HCP B;  3DOW A;  3R66 C;  2M4N A;  2LGY A;  3ZDM C;  2L00 B;  2KDE B;  4MM3 A;  2MX2 A;  4W9H A;  2NBW B;  3M63 B;  2C9W B;  4LCD E;  3PT2 B;  2PE6 B;  4WWP A;  4ZRI A;  2LXC A;  4PS3 A;  2N4F A;  3QCA A;  4ASW C;  2IY1 B;  2FAZ A;  1WM3 A;  1WR6 E;  4WJO A;  2BYE A;  3D32 A;  4IWP A;  4FHJ A;  4W9I A;  2CHX A;  3WAN A;  2K1F A;  1WIA A;  3A4S C;  2G45 B;  1WH3 A;  1AAR A;  2VRR B;  2DZI A;  4NY0 A;  2KWU B;  4W9C A;  3U8Z A;  4K7W A;  4AJW A;  2K8C A;  1P0R A;  3TIX A;  5L95 C;  4KVG B;  4M0W B;  3ZRC A;  4MGY E;  2ZVN A;  4GDL B;  1OEY J;  2KDI A;  2MW5 A;  1NDD A;  1YD8 U;  3QX1 A;  1V80 A;  3R7R A;  2KXJ A;  4BKT A;  2N7E A;  3K9P B;  3IFW B;  2LRW A;  1WX7 A;  2AWT A;  3A9K B;  3M95 A;  3PHX B;  4KSL C;  2K8H A;  5D6J B;  2O6V D;  1UEL A;  4GN1 A;  1E8X A;  3OLM D;  5CX3 A;  3KUZ A;  3DQV A;  1WXV A;  1XT9 B;  2XEW A;  1WJ4 A;  3W1S C;  3CSF A;  4BVU C;  2L3Z A;  3IBE A;  3T9L A;  4MGZ E;  3MHS D;  3VAW A;  2BYF A;  1J19 A;  2K39 A;  2IO3 B;  1YX6 B;  3RYT A;  3A1Q B;  2AL3 A;  4IM2 A;  5E6N A;  1YIW A;  2AL6 A;  2FCQ A;  2J0M A;  3PRZ A;  4MJS B;  4MGK E;  3ZRF A;  4CO7 A;  1WMH A;  3JYU A;  2C7N B;  2MCN B;  5L83 A;  4KIK A;  1G6J A;  3WA0 A;  2J0K A;  2PEA A;  3ZNZ B;  2ZNV C;  2FNJ B;  5E6P A;  2KQ7 A;  4DK5 A;  1EUV B;  1XQQ A;  3BY4 B;  4FA6 A;  1FXT B;  2FCS A;  3DDC B;  3V60 A;  4E3C A;  3H7P B;  1GUA B;  2KTR B;  2NVU I;  4YL8 A;  1L2N A;  1WYW B;  1NI2 A;  4WJN A;  4K1R B;  3X0W A;  3P2B A;  1WRD B;  1ZW7 A;  3A4R A;  1Z5S B;  2I1K A;  1OQY A;  3QA8 A;  4NQK E;  2FIF A;  4LJP B;  4M8M A;  3VQI A;  2C5L C;  2FCM A;  2KK8 A;  2IY0 B;  2ZNV B;  2I1J A;  1ZGU B;  3LDZ E;  5D7G A;  1H4R A;  3MTN B;  3QJZ A;  2V3S A;  3JW0 X;  4GIV A;  1WM2 A;  1Q0W B;  2NBU A;  3QK0 A;  2BPS A;  2LRU A;  2L05 A;  1WFY A;  2UWQ A;  2XBB C;  3DBS A;  3L10 B;  4G50 A;  3PSE B;  1WR1 A;  5C1Z A;  2G3Q B;  2N1V A;  2N7D A;  3OJ4 B;  3U30 A;  1ISN A;  2JPH A;  3EFU A;  5TR5 A;  3RZF A;  3VUW A;  3ZNH B;  2WYQ A;  5J17 A;  5CTR C;  2GBR A;  4BKS A;  2HD5 B;  3JSV A;  1UBI A;  2DAF A;  3B08 A;  2M17 A;  3JVZ X;  2V4L A;  4MJS A;  4AWJ A;  4WWN A;  3APC A;  1ZKH A;  4XC2 A;  3VTU A;  1WGR A;  2HJ8 A;  4XX5 A;  4A20 A;  4IW0 A;  2D11 A;  3ECI A;  4LDT D;  3W1S A;  2N9P C;  2LUE A;  3RCZ A;  3NHE B;  3PLU A;  4GXB A;  1WE7 A;  3UIN B;  2AYO B;  4JLC A;  1V49 A;  2WWZ A;  3RT3 B;  3DBL I;  3APD A;  1OEY A;  1UD7 A;  1Q1O A;  1WX8 A;  2LVQ A;  2KWV B;  1LXD A;  2MBQ A;  4WAA A;  2AEH A;  1T0Y A;  1UZX B;  3C0R B;  3ENE A;  3PRE A;  3QAQ A;  3TJP A;  3L08 A;  3N30 A;  3EHV A;  4ZRJ A;  3AUL A;  1IPG A;  3MJW A;  3N32 A;  3PV1 A;  4HPM B;  2WDT B;  4B9K A;  2FUH B;  4DXA B;  2D10 A;  4NJ7 A;  1I35 A;  1YJ1 A;  2KNB A;  1IP9 A;  2J0J A;  1WXA A;  2KC2 A;  4EFO A;  1IYF A;  3QHT A;  3O65 B;  2ZZP B;  1GC7 A;  3PLV A;  4HK2 A;  4F7Z A;  1QZE A;  2LWP A;  3HIZ A;  2L76 A;  1R4N I;  2NPT A;  4RM8 A;  2M1M A;  4ANU A;  2JZZ A;  4CHK A;  3ML8 A;  3UQB A;  2N9E B;  2HE7 A;  4GU2 A;  1K8R B;  1UH6 A;  3ZTD A;  3KYD D;  4KDL B;  2RGF A;  4P7I A;  4FJV B;  2RR9 A;  3HM6 X;  1GNU A;  2WX1 A;  5GMV A;  4DHJ B;  1WMH B;  1YX5 B;  3VH4 B;  2IO0 B;  4KIK B;  1BT0 A;  3VH3 B;  1WJN A;  4J6I A;  4FJZ A;  4IC7 B;  4WQO B;  4GMV A;  2LGX A;  1TBE A;  2K6Q A;  1WGY A;  2DEN B;  2K25 A;  4MGI E;  4BBN F;  3L54 A;  2C7M B;  3TL5 A;  2JT4 B;  2GBJ A;  3U7D A;  4EZK A;  1E7V A;  2MWS B;  2ZVO A;  1V5T A;  2KMA A;  4K7U A;  4KZC A;  3TBL D;  2O6V A;  4DDG D;  3HK0 A;  4IM0 A;  2L7R A;  4II3 B;  2OJR A;  2MBE A;  2QHO A;  3I3T B;  5EDS A;  3LJ3 A;  1E90 A;  1LM8 B;  1J0G A;  4NAW A;  3V6C B;  2V1Y A;  4WWO A;  3WAL A;  2JUO A;  3APF A;  2LD9 A;  2CU1 A;  2MLB A;  2A4Z A;  2KTF A;  3JSV B;  1P9D U;  3BIN A;  3VXW A;  3WAO A;  4IUM B;  2JZ3 B;  3DPD A;  4HWI B;  1E8Y A;  1P98 A;  4EUT A;  3VTV A;  2KHW B;  2LVP A;  2KWC A;  2DYO A;  4GGQ A;  3CST A;  2NCN A;  3OJ3 A;  2KJH B;  3DBR I;  5D94 A;  2L0T A;  1WX9 A;  3X23 A;  1WGD A;  5C23 A;  2GOW A;  2KLG A;  3WIM A;  1V5O A;  5KHQ A;  2OOB B;  2ZJD A;  3EC8 A;  1GC6 A;  2JWZ A;  1C1Y B;  4K81 A;  4NQL B;  4ANX A;  1RRB A;  1WE6 A;  3UF8 A;  3KYC D;  1WI0 A;  2LXA A;  5IAA C;  2KFK A;  1Q5W B;  1E5W A;  3B0A A;  5JHA A;  2REX A;  4WJP A;  2MA9 B;  5KHO A;  1YQB A;  4HJK A;  3KUD B;  4LJO B;  1S1Q B;  5G2N A;  2DAJ A;  3DVG Y;  3QAR A;  2J7Q B;  3SU8 X;  4ICV A;  3PS6 A;  2KC1 A;  2Z0E B;  4I6N B;  3VUX A;  1L7Y A;  3WAM A;  4ZDV A;  2IZV B;  1TZ1 A;  4M8N A;  5G55 A;  4FLH A;  3NOB A;  2JY6 A;  3PHW B;  1CMX B;  2KDF B;  2JF5 A;  2YVC A;  4GB9 A;  1WXM A;  1TGZ B;  5CHF A;  4GDK A;  4W9J A;  3PTF C;  1RLF A;  2NPT B;  3RD2 A;  5AZG A;  3A9J A;  4BKG A;  1KM7 A;  4BOZ B;  2LVO A;  3QWZ B;  1P1A A;  2W9N A;  2G4D B;  1R4M I;  2DZK A;  2KZR A;  2RD0 A;  3ZO5 B;  1XD3 B;  4URK A;  2BYV E;  2LZ6 A;  3M3J A;  3WAP A;  3NY5 A;  4FUL A;  4KDI C;  4IWO A;  3RUL A;  2ASQ A;  4II2 B;  2GBK A;  2FID A;  2M8S A;  3A33 B;  4PS8 A;  2EKE C;  4MSQ B;  5LXI B;  4JQW C;  4PYU A;  5FR6 A;  4MH0 E;  2BF8 B;  2LGD A;  3RUI B;  3ONS A;  1VCB A;  3ZNG C;  1V81 A;  2JXX A;  4FBJ B;  1U4A A; 
#chains in the Genus database with same CATH topology
 2LI5 A;  2CU3 A;  4JL9 A;  4C80 A;  3ZVV A;  4FXC A;  5IA7 A;  3OAW A;  4ZRP A;  3SHQ A;  2ZPN A;  3CF6 E;  5LXH A;  2M0X A;  3OWE B;  4KSK C;  3ZLZ A;  1WJ6 A;  3VDZ A;  1RAX A;  5JHB A;  5FKA C;  3N3K B;  2O2V B;  2JX5 A;  1KJT A;  1PUT A;  1FO4 A;  2W82 A;  2WS3 B;  3TCA A;  1V1P A;  4JGH B;  2KJ6 A;  4ZYN A;  2WXI A;  1C77 A;  4AJY B;  2G4S A;  3Q8A A;  4FAD A;  1F2R I;  2MP2 A;  3N1X C;  1GG3 A;  2KX0 A;  3Q3F A;  2I38 A;  4US9 A;  4L1B A;  3Q14 C;  2MHJ A;  2X8X X;  1K52 A;  1I4H A;  1ESF A;  4I6L B;  2RDH A;  2SEB D;  1ZXH A;  1E8W A;  1L6V A;  1V6E A;  4DWF A;  4G0N B;  3IXS A;  2KJR A;  2G9H D;  2Z0D B;  1T0R C;  1B9R A;  3GE8 C;  1WRI A;  3Q8C A;  3NJT A;  5DCN A;  3NS8 A;  1FNU A;  1SB3 C;  1KLV A;  2A5U A;  4YTM B;  4OVU A;  1SGH A;  4HDO A;  2PJH A;  3S2A A;  1BML C;  4PS7 A;  2SAK A;  2GBM A;  3P4P B;  4A3O A;  3CIR B;  1D3Z A;  2D3G A;  2C7H A;  3CMM B;  3AE8 B;  3UQA A;  1N61 A;  1V2Y A;  4TQ0 A;  2FUG 1;  2ZCC A;  1RFA A;  4DHJ D;  1C3T A;  4EEW A;  2LGS A;  1OTR B;  1UWM A;  2KVR A;  5TSS A;  2J42 A;  4TUU A;  3V62 A;  1J8C A;  3ZKJ C;  4PYZ A;  1V1P B;  3PPA A;  4HDQ A;  3V61 A;  1WY8 A;  3RI7 C;  3DWG C;  2MP2 B;  1JRU A;  5JXV A;  2ZPY A;  4GSW A;  4ZHO A;  5DPW A;  4MH8 A;  2L83 A;  4EZJ A;  3Q3J A;  3AV8 A;  4AUQ C;  2Z59 B;  4C56 C;  1C79 A;  4HLE A;  3VTW A;  5BMH A;  2QCZ A;  3BK1 A;  2LGI A;  2NS5 A;  4CYE A;  1WGH A;  4K3B A;  2EKI A;  3QIJ A;  4ZRK A;  1R4M B;  2R2O A;  2HTH A;  4KV2 A;  1E8Z A;  1I4R A;  1PDX A;  3PRM B;  2GB1 A;  2N1W A;  3KH0 A;  1S3S G;  2C60 A;  1I4Q A;  4HCP B;  1VDV A;  3DBH B;  3DOW A;  5EE1 A;  2M4N A;  3ZDM C;  1MHH E;  2L00 B;  5IO9 A;  2M19 A;  2KDE B;  2NBW B;  2WXO A;  2UU7 A;  2LXC A;  4ASW C;  4WJO A;  4IWP A;  1N62 A;  4W9I A;  2QDF A;  1WIA A;  3C8Y A;  4OZA A;  1ZE3 D;  2QSD A;  2H89 B;  1MJD A;  4P6V F;  2ZVN A;  1Q10 A;  1NDD A;  1SSN A;  3R7R A;  2KXJ A;  2CJO A;  1PGA A;  1AWD A;  1WX7 A;  3FAH A;  1UEL A;  2WXR A;  4GN1 A;  1YJI A;  3KUZ A;  2V0G A;  1ROE A;  2KQ4 X;  3AE2 B;  1WJ4 A;  5HG2 A;  3CSF A;  4MGZ E;  1J7B A;  2K39 A;  1RWS A;  3UI3 A;  4P1C C;  4IM2 A;  5E6N A;  1EM7 A;  1YIW A;  3MC9 A;  4MGK E;  1WMH A;  1VJK A;  4KIK A;  4ZOH C;  3P63 A;  2FNJ B;  4OW0 A;  3U52 E;  1EUV B;  1XQQ A;  2FCS A;  4J3O D;  1L2N A;  1TS5 A;  1WYW B;  3RMK C;  4B0E A;  1SE3 A;  2GRI A;  4NQK E;  4M02 A;  4LNF A;  1HEZ E;  3TSS A;  1FPY A;  2LJI A;  3LDZ E;  1KLU D;  4GIV A;  4TSS A;  3QK0 A;  1F1H A;  2KAJ A;  1DOI A;  3DBS A;  1M4V A;  1LGR A;  4G50 A;  2N1V A;  2N7D A;  2RDG A;  3U30 A;  5BYS A;  5J17 A;  3DHG C;  5CTR C;  2GBR A;  4BKS A;  2HD5 B;  3NRZ A;  1UBI A;  3RN9 C;  1ZP0 B;  3GB1 A;  1ZKH A;  2PKO A;  4QAY A;  4A20 A;  1VLB A;  3ECI A;  2WXH A;  3RNE C;  1C76 A;  4GXB A;  1PYW D;  3Q8B A;  1FXI A;  1OEY A;  2KWV B;  5G5H A;  3TJP A;  2AEH A;  1T0Y A;  3C0R B;  3ENE A;  3QAQ A;  3L08 A;  4ZRJ A;  3AUL A;  4IKG A;  1IPG A;  3PV1 A;  1KRH A;  2DBY A;  3I5J C;  1IP9 A;  2J0J A;  1WXA A;  2KC2 A;  1IYF A;  3QHT A;  4C4V A;  3PLV A;  3Q8E A;  2WXN A;  2L76 A;  2NPT A;  3IAM 1;  2M56 B;  2JZZ A;  2HE7 A;  1D6E C;  2LUM A;  3KYD D;  3BK2 A;  2V3P A;  4KDL B;  4FJV B;  2ACZ B;  3HM6 X;  2WX1 A;  4DHJ B;  1WMH B;  2QMT A;  4KIK B;  3VH3 B;  2BVC A;  3GZN B;  2IGH A;  2INP E;  1XCT L;  1TBE A;  2K6Q A;  1WGY A;  1TJE A;  1YN4 A;  1EWY C;  2BBC A;  2ON8 A;  3NVW A;  3ZXV A;  3AEG B;  2K3U A;  1E7P B;  3P4S B;  1JWU D;  3TBL D;  4HJG E;  3HK0 A;  2L7R A;  5BYQ A;  3I3T B;  3B2F A;  3LJ3 A;  3WAL A;  2JUO A;  3APF A;  2LD9 A;  1EWC A;  1FM0 D;  3EA6 A;  3BVG A;  2DYO A;  4GGQ A;  2L0T A;  1WGD A;  4H2A A;  5C23 A;  3NS1 A;  2GOW A;  2KLG A;  4A6Q A;  2JWZ A;  2WXP A;  1RRB A;  1QT9 A;  3UF8 A;  1WI0 A;  1Q5W B;  1E5W A;  3I9V 1;  3AEC B;  5KHO A;  2MA9 B;  1L5P A;  3AEB B;  1JCK B;  4HJK A;  3QAR A;  1GB1 A;  3WAM A;  1L7Y A;  2IZV B;  2BS3 B;  4C4V B;  2NPT B;  1XLN A;  2JQR B;  1P1A A;  4R3D A;  1R4M I;  2DZK A;  3ZO5 B;  3P4R B;  1XD3 B;  1B1Z A;  2V4I B;  3WAP A;  4KDI C;  2YEP B;  4IWO A;  1SIJ A;  2ASQ A;  3I57 A;  1YN5 A;  1N60 A;  1L0X B;  5FR6 A;  4MH0 E;  4C7Y A;  3ONS A;  1VCB A;  3U7Z A;  1VZ7 A;  3DBH I;  3AE4 B;  3TEW A;  1R7S A;  1UGJ A;  3L16 A;  2L8J A;  3NZU A;  1C4C A;  4A3P A;  3HVD A;  2BB6 A;  1HE8 A;  2LJ5 A;  4JWU C;  1QQR A;  4RMA A;  2LAS A;  1WJU A;  3T8M A;  3AI5 A;  3QC8 B;  1WZ0 A;  3DBL B;  4FJY A;  2BS2 B;  2RDB C;  2WU2 B;  3DVN V;  3HRD D;  4ICU A;  3MFG A;  2IGG A;  4DHZ B;  2PE9 A;  4E74 A;  5CHW A;  2K6D B;  4OZC A;  2L0F A;  4NJC A;  3ALB A;  3UIP B;  2JVC A;  4N9F 4;  4WWM A;  2ZW1 A;  1P3Q U;  2BWF A;  4ANW A;  1DYQ A;  2Y5B B;  2O2V A;  2WX0 A;  2CS4 A;  3W5V B;  1JRO A;  4TQ1 A;  4XDC A;  1VRA B;  4KX6 B;  4W9F A;  4IDI A;  3H9D A;  3V3X A;  1QOB A;  1PQS A;  1JWA D;  2B3A A;  4US8 A;  2CHZ A;  1KH0 A;  1VD2 A;  2MBB B;  2DYB A;  5JH5 C;  4LNO A;  5LLI A;  3ZUN A;  4F1S A;  4NAM A;  4MEM A;  3ZTC A;  3RFZ B;  1XXG A;  3PZ7 A;  3HHM A;  3W1Y A;  2RPQ A;  2KMC A;  1SIF A;  2D3C A;  2NR2 A;  2K8B A;  3AH7 A;  1FNV A;  5CHV C;  3VR9 B;  1F9J A;  1EO6 A;  1H8C A;  1TY2 A;  2MQJ A;  4DBG A;  1TS3 A;  1WXQ A;  3ZQ4 A;  2KQS A;  1NEN B;  2KN5 A;  2R2Q A;  2YEP F;  5BO4 B;  4N59 A;  2JYT A;  4BOS C;  3A9K A;  4ZRQ A;  4S0R A;  1UUP A;  1L6U A;  1X1M A;  2W3R A;  3PGE A;  3LYY A;  3AU4 A;  2LHE A;  4KGS A;  1EF1 A;  2TSS A;  3TMP B;  1FEH A;  2WXQ A;  2K0P A;  3KUC B;  3L13 A;  3H7P A;  4FHK A;  2AQ1 B;  5DPT A;  5BYR A;  3CWI A;  3ZDT A;  3AXC A;  2JRH A;  5DPR A;  2KKC A;  1IUE A;  3GZN I;  3K9O B;  3IG3 A;  2GMI C;  2PMV A;  5E6O A;  1TZO A;  4EOY A;  4RNA A;  3M62 B;  3PZ8 A;  2D3B A;  4HKQ A;  1XLP A;  2AQ2 B;  4MM3 A;  1GAQ B;  1MI0 A;  3M63 B;  4LCD E;  4WWP A;  2IY1 B;  2FAZ A;  2N9L A;  1OQQ A;  1HTO A;  1WM3 A;  2XN9 C;  3FKY A;  2BYT A;  3D32 A;  3N1Y C;  3U4E G;  2CHX A;  1OFF A;  2INN E;  1XO3 A;  4AJW A;  5IKC M;  5L95 C;  4KVG B;  2Y3A A;  3BII D;  1ZXI A;  3AEA B;  1FRR A;  1NVI D;  2MW5 A;  3URY A;  1YD8 U;  1V80 A;  3EGR A;  3LB8 C;  2LHD A;  2LRW A;  3A9K B;  4KSL C;  1SF0 A;  2O6V D;  5D6J B;  2JYE A;  2VZK D;  1E8X A;  3OLM D;  3R2I A;  5CX3 A;  3SFD B;  3DQV A;  1XT9 B;  2WXM A;  2JZP A;  3W1S C;  3IBE A;  3P1M A;  2BYF A;  1J19 A;  3BYY B;  4A55 A;  2IO3 B;  2AL3 A;  4YTP B;  2FCQ A;  4MJS B;  2J0M A;  3ZRF A;  4CO7 A;  5L83 A;  1E0Z A;  1F52 A;  2WGS A;  5E6P A;  2KQ7 A;  1YOV B;  2IPK D;  3H7P B;  4YL8 A;  3W2D A;  1K50 A;  1WRD B;  4AS1 A;  2I1K A;  4UDU C;  2K5P A;  1I4P A;  2FIF A;  4LJP B;  2C5L C;  1ZGU B;  3QJZ A;  2V3S A;  4A90 A;  1P7F A;  3L10 B;  5C1Z A;  1KFY B;  4RCO A;  5TR5 A;  3EFU A;  2AX5 A;  4MM3 B;  3B2G A;  1L4Z B;  3BYT B;  3RNA C;  4EE2 A;  3EUB 2;  4AWJ A;  2JU6 X;  4XC2 A;  1GOZ A;  1HQR D;  4IW0 A;  2D11 A;  1HZ6 A;  3PLU A;  2E6X A;  1WE7 A;  3UIN B;  2AYO B;  4JLC A;  2N7J A;  1DGJ A;  2WWZ A;  3DBL I;  1WX8 A;  2LVQ A;  4WAA A;  3O13 A;  3EHV A;  4HPM B;  3ZYY X;  2D10 A;  4NJ7 A;  1YJ1 A;  2KNB A;  1QOF A;  5E6J A;  4EFO A;  1NEK B;  1NYR A;  4HK2 A;  1GC7 A;  3ABV B;  1RFK A;  3ML8 A;  5HHD G;  1UH6 A;  3SFE B;  2IGD A;  3E9S A;  2EEL A;  3U2S C;  2N9K A;  3VH4 B;  1BT0 A;  3TUO A;  4YSX B;  4HRO A;  4NZL B;  2LGX A;  2VH2 A;  5AUI A;  4MGI E;  3L54 A;  2GBJ A;  3DWM A;  2KAC A;  2MWS B;  3WCQ A;  1V5T A;  2KMA A;  2O6V A;  4IM0 A;  3AED B;  2MBE A;  2QHO A;  2VH1 A;  1C4P A;  2V1Y A;  2A4Z A;  2KTF A;  3BIN A;  4LNI A;  3WAO A;  2WDV B;  2JZ3 B;  2PTL A;  4HWI B;  4RF0 A;  4YT0 B;  4N58 A;  4JE3 B;  4ACF A;  3AE1 B;  3DHH C;  1OQR A;  3N9Y C;  3ZJV A;  1I4X A;  3X23 A;  1HXY D;  1V5O A;  1GC6 A;  4NQL B;  1WE6 A;  2LXA A;  5IAA C;  2KFK A;  3SR6 A;  3FC4 A;  4IOI E;  2REX A;  4LJO B;  1S1Q B;  2DAJ A;  1YNT E;  1QOG A;  1D4B A;  1WGK A;  2KC1 A;  4ZDV A;  1YQ4 B;  4FLH A;  1N5W A;  4HPP A;  1IGD A;  2JF5 A;  2YVC A;  4CQN A;  4GDK A;  3PTF C;  3RD2 A;  3A9J A;  4BKG A;  1MVK A;  2LVO A;  2W9N A;  1N6Z A;  4WH4 A;  3Q3N C;  3NY5 A;  3NG0 A;  1MG4 A;  1V1O A;  2GBK A;  2FID A;  5LXI B;  2BF8 B;  2LGD A;  3RUI B;  5HI1 A;  3ZNG C;  1V81 A;  3AE7 B;  4FBJ B;  3AMZ A;  1J7A A;  1U4A A;  2MSE D;  2WXJ A;  4WJQ A;  4FN2 A;  4XZ4 A;  1KTK A;  3FIL A;  4G3X B;  3V6E B;  3H7S A;  2GBN A;  3L17 A;  1UGM A;  2D07 B;  3DVN U;  1VR9 A;  1ZDV A;  1M94 A;  2O6V B;  2LEK A;  1PFD A;  2ZCB A;  4WUR A;  3V05 A;  5T8I A;  4EKU A;  1LQB A;  1KF6 B;  2KLC A;  4DHZ E;  4XWW A;  4G11 A;  4NPN A;  2EMT A;  1IBX A;  4LNK A;  5IOI A;  1TTN A;  3KWV A;  2XK5 B;  3H1U A;  4ITK A;  1TS2 A;  3VUY A;  1NBF C;  4NJ6 A;  1F2R C;  2KFK B;  1FIQ A;  2WXK A;  4MDK E;  4LLG M;  1R4N B;  1L0Y B;  5FR3 A;  3E56 A;  1FCL A;  2DX5 B;  3H6N A;  2ZW0 A;  4RM9 A;  3VHT C;  1LFD A;  3ZNI D;  4BBN C;  2KFJ A;  1P7E A;  4RFB A;  4PK1 A;  4GDK B;  2CHW A;  2GLS A;  4RGM A;  3RNC C;  2NBV B;  3A9J B;  4OZB A;  3VFK A;  2WNM A;  2FCN A;  2IO2 B;  2OHF A;  2QJL A;  1IGC A;  3EEC A;  4TKN A;  1UNS A;  1E7U A;  4KGR A;  4MSM B;  1SEB D;  3MJ5 A;  3L0W B;  4OVV A;  2WXL A;  4ANV A;  1SE9 A;  2Z8L A;  1E9M A;  3AE9 B;  4ARI A;  5D3D A;  1T6B X;  1E10 A;  3FIL B;  2WHI A;  4L2Y A;  4EZL A;  3AE3 B;  3ZW3 A;  1FCC C;  4HEA 1;  2V3N A;  1WZ3 A;  3NVV A;  5HKH A;  4HKZ E;  2Y5C A;  4GDL A;  3NZS A;  5EE0 A;  1JWB D;  3PRP B;  2UYZ B;  2PPH A;  2YLM A;  1ZOY B;  1SJH D;  3ZIM A;  5J18 A;  2EMS A;  3B9J A;  4W9L A;  1IBX B;  1UWX A;  3AN1 A;  1J7C A;  2ZEQ A;  3EFC A;  3AB5 A;  1KOT A;  2QEJ C;  3KVF B;  1KLG D;  1WGG A;  3HM3 A;  4DXF A;  4K3C A;  4XDD A;  1SBB B;  4W9D A;  2KAN A;  1EF5 A;  3VVW B;  2KTR A;  4JIO U;  1MPE A;  2KOX A;  2Q5W D;  4F8C B;  2IBI B;  4K7S A;  2L1A A;  3SDL C;  1YN3 A;  4LNN A;  1T5X D;  1TKY A;  3Q6B A;  1BXT A;  4IWQ A;  1V9J A;  3H8H A;  5JZE B;  1TIF A;  4X57 B;  1SXT A;  2KD0 A;  3GS2 A;  3OG5 A;  1VZ8 A;  3KLS X;  2MX2 A;  4W9H A;  2C9W B;  3PT2 B;  2PE6 B;  3RNG C;  4ZRI A;  2N4F A;  3QCA A;  4YWG G;  1WR6 E;  4FHJ A;  3WAN A;  2K1F A;  2MJ3 A;  3A4S C;  1JWS D;  1QIL A;  2VRR B;  2DZI A;  4NY0 A;  4W9C A;  3U8Z A;  4K7W A;  2K8C A;  1P0R A;  3HVZ A;  1PGB A;  2KMM A;  3J9C A;  4C7Z A;  4MGY E;  4GDL B;  3BWU D;  4BKT A;  1JQ4 A;  3IFW B;  2AWT A;  1FXA A;  1TKG A;  2K8H A;  3ZGZ A;  2KYW A;  3MP9 A;  5AUK A;  1WXV A;  2QIL A;  2L3Z A;  1XLO A;  3MHS D;  3VAW A;  1GB4 A;  3RYT A;  1YX6 B;  2AL6 A;  1TS4 A;  1I4G A;  4PT5 A;  2C7N B;  1G6J A;  1ZDX A;  4RGN A;  3ZNZ B;  2PW9 A;  2ZNV C;  3BVM A;  4DK5 A;  3BY4 B;  3IT4 B;  2ICI A;  5HFY A;  1FXT B;  3DDC B;  2KTR B;  2NVU I;  4RH6 A;  4WJN A;  4K1R B;  3X0W A;  1ZW7 A;  3BVZ A;  2MJD A;  3A4R A;  1L4D B;  5I4D A;  1OQY A;  3QA8 A;  2WQY B;  3C19 A;  4M8M A;  1JML A;  3VQI A;  3ZJU A;  2FCM A;  2WU5 B;  2KK8 A;  2ZNV B;  2AQ3 B;  2H88 B;  5D7G A;  1H4R A;  2NBU A;  2BPS A;  1WFY A;  4LTU A;  5H92 C;  2ONQ A;  3PSE B;  2G3Q B;  1ISN A;  2NTT A;  4P1B C;  2DAF A;  3B08 A;  2M17 A;  3JVZ X;  2V4L A;  1T3Q A;  4MJS A;  4XGA B;  3APC A;  1WGR A;  2HJ8 A;  4C00 A;  4XWT A;  2IDY A;  5C2T B;  4LDT D;  4XYC A;  3W1S A;  2N9P C;  2LUE A;  1JWM D;  3RT3 B;  3APD A;  4KKJ A;  1EU4 A;  1UD7 A;  1Q1O A;  2KT7 A;  1LXD A;  1UZX B;  3TEZ A;  3MJW A;  1MFW A;  4RGO S;  2BT6 A;  4B9K A;  2NMQ A;  1ACC A;  2PLP A;  3O65 B;  3VRB B;  2ZZP B;  2JXT A;  3HIZ A;  4RM8 A;  1R4N I;  4ANU A;  4CHK A;  2N9E B;  4GU2 A;  3MHZ A;  1XLQ A;  2OJW A;  4ARC A;  4YTN B;  2RGF A;  4P7I A;  2RR9 A;  2W54 A;  1XF5 L;  4O1N A;  5D3I B;  1GNU A;  5GMV A;  1YX5 B;  4TMA B;  1WJN A;  1JW9 D;  4J6I A;  2RPV A;  3L4P A;  4FJZ A;  1AYF A;  4WQO B;  4GMV A;  1A70 A;  2E3T A;  2C7M B;  2WP9 B;  1E7V A;  1XEE A;  2ZVO A;  3RNF C;  5C3J B;  2L32 A;  3VRA B;  4II3 B;  2OJR A;  5EDS A;  1LM8 B;  1TYG B;  1J0G A;  4NAW A;  2J53 A;  2M0A A;  4WWO A;  2HDE A;  1FFU A;  2MLB A;  1P9D U;  4IUM B;  4XE0 A;  4BAX A;  2XNA C;  1E8Y A;  4A8X C;  1TT5 B;  3VTV A;  4YSZ B;  2LVP A;  2KWC A;  1D5M C;  5EE3 A;  4A9A A;  3CST A;  2NCN A;  3OJ3 A;  5D94 A;  2MJE A;  1AW7 A;  1BUI C;  3WIM A;  5KHQ A;  2ZJD A;  1K53 A;  2DLB A;  1CK1 A;  3EC8 A;  4ANX A;  3KYC D;  4JWS C;  5IP4 D;  3B0A A;  3PO0 A;  4GLS C;  4WQM A;  3NVY A;  4WJP A;  1YQB A;  3KWL A;  3KUD B;  1FNW A;  1DOX A;  2J7Q B;  4ICV A;  3PS6 A;  3VUX A;  1F0Z A;  1HTQ A;  4M8N A;  5G55 A;  3NOB A;  3R2T A;  2KDF B;  5CHF A;  4YXD B;  1RLF A;  5AZG A;  4BOZ B;  2G4D B;  2RD0 A;  2BYV E;  3M3J A;  4FUL A;  2FBW B;  4II2 B;  2M8S A;  3A33 B;  1AN8 A;  4PS8 A;  4MSQ B;  4JQW C;  1ET9 A;  1C78 A;  2JXX A;  4BKS D;  5BMI A;  4P16 A;  4NNJ B;  2BS4 B;  1K51 A;  4B6W A;  1A5R A;  3UIO B;  1V97 A;  2W3S A;  2K9X A;  4DDI D;  2DYM A;  2D5G A;  3B1L X;  4L23 A;  3PZD A;  2WXG A;  4LK0 M;  3Q3M C;  4NAW B;  3R7Q A;  2MBO A;  2CR5 A;  4HVB A;  1CZP A;  4KZ0 A;  4HXD A;  1Y56 A;  1WF9 A;  3AE5 B;  3HUI A;  5DPS A;  2DHZ A;  1QKZ A;  1MG8 A;  4BFR A;  3DVG X;  2J4X A;  3I63 C;  4KKI A;  2KDM A;  3QQ8 B;  1QOA A;  3NZ3 A;  4B0M A;  3MC0 B;  2MBH A;  1GJZ A;  3R3M A;  4ZHP A;  1RYJ A;  3RZW C;  2PIA A;  3VR8 B;  4HCN B;  4AP4 C;  3Q8F A;  3ML9 A;  2IYD B;  1L0V B;  3AU5 A;  4B95 A;  1WWT A;  1WXS A;  5D2M B;  2R61 A;  2D3A A;  3AM9 A;  1UBQ A;  4LDT B;  2WXF A;  2XK5 A;  5AZH A;  3IAS 1;  2MRP A;  1EU3 A;  1STE A;  2MEK A;  4OHJ A;  1V86 A;  4HPL B;  4MEL A;  1I42 A;  2CJN A;  2KO3 A;  3Q2A C;  2N9X A;  4AOF A;  2RSU A;  2CKH B;  1NI3 A;  4W9G A;  4MT5 A;  3NUH B;  2HJ1 A;  4IM3 A;  4W9E A;  2HTM E;  4MAC A;  1T0Q C;  1SE4 A;  4M0W A;  1D5Z C;  2DZM A;  3P42 A;  4GOC A;  4W9K A;  5AEK B;  2D2Q A;  3DBR B;  1YQ3 B;  3PVL A;  4I6P A;  4JPS A;  3KW5 B;  2KX3 A;  1ZUD 2;  2BKR B;  3W5U B;  2BTE A;  1TY0 A;  2JRI B;  3SD5 A;  4S17 A;  1Z2M A;  1HZ5 A;  1Y8R C;  3T3N A;  1T0S C;  2DWQ A;  3A1Q A;  2IO1 B;  3GE3 C;  1CJE A;  1FRD A;  4IG7 B;  3GOE A;  4TV3 A;  3RPF C;  5H8Y E;  1OGW A;  3N20 C;  2X38 A;  2GI9 A;  2J52 A;  4E71 A;  2IND C;  4ZYS A;  2VZK B;  5AZF A;  2KWD A;  3UGB B;  3IHP C;  2DZJ A;  4WIP A;  3TEX A;  3DCG A;  2BKF A;  2WDR B;  3IVF A;  5J2R A;  1I7H A;  2KDB A;  1HA5 A;  1TKE A;  2BGF A;  2BWE S;  3R66 C;  2LGY A;  1DOY A;  1GPX A;  2LMC A;  4JX1 C;  4PS3 A;  1C4A A;  4AQ7 A;  5GXG B;  1WYG A;  2RMM A;  3GP7 A;  3TEY A;  2BYE A;  4OVZ A;  1QF6 A;  1FFV A;  1CQV A;  2G45 B;  1WH3 A;  1AAR A;  1NYQ A;  2KWU B;  3LXF A;  3RNB C;  2MH7 A;  3TIX A;  1MHX A;  4M0W B;  3ZRC A;  1N63 A;  2FE8 A;  1OEY J;  2NTS A;  2KDI A;  3QX1 A;  2N7E A;  3K9P B;  2INC C;  3M95 A;  3PHX B;  1PGX A;  1LO5 D;  4D2K A;  4USA A;  2QIE B;  2XEW A;  1F77 A;  5LNK 1;  1C9F A;  4Q2J A;  4BVU C;  3T9L A;  1ZPS A;  3A1Q B;  2K22 A;  3PRZ A;  3IT6 B;  3JYU A;  2MCN B;  3WA0 A;  2J0K A;  2PEA A;  3P4Q B;  3SEB A;  4FA6 A;  4DQO C;  3V60 A;  3R8B A;  4E3C A;  1GUA B;  1WSP A;  4REZ A;  1NI2 A;  1QLB B;  3P2B A;  1Z5S B;  2W55 A;  2IY0 B;  3AEF B;  2I1J A;  3MTN B;  3AEE B;  3JW0 X;  1UF0 A;  3N1Z C;  1WM2 A;  3Q3O C;  1Q0W B;  1N5X A;  2LRU A;  2L05 A;  2UWQ A;  2XBB C;  3T3O A;  5BMG A;  1WR1 A;  1YMH E;  1JRP A;  3OJ4 B;  2JPH A;  3RZF A;  3ZNH B;  3VUW A;  2BW2 A;  2WYQ A;  4HRS A;  3JSV A;  3BZD B;  4WWN A;  3VTU A;  4XX5 A;  2KVZ A;  3RCZ A;  3NHE B;  1RM6 C;  1V49 A;  3NVZ A;  2DNF A;  2QC8 A;  2LFI A;  1ET6 A;  2MBQ A;  3PRE A;  3Q69 A;  4M01 A;  2G1E A;  3N30 A;  3ZXR A;  4RF1 A;  1JAL A;  3N32 A;  4N6E B;  2WDT B;  4DXG A;  2OED A;  2FUH B;  4DXA B;  1I35 A;  4BZA A;  2BB5 A;  4F7Z A;  1QZE A;  2LWP A;  2M1M A;  5G5G A;  3UQB A;  2V9H A;  1K8R B;  3ZTD A;  2WDQ B;  2JSV X;  2JWU A;  5FK9 C;  2IO0 B;  5MPO A;  4IC7 B;  3ZJT A;  2DEN B;  5EE9 A;  2K25 A;  4BBN F;  3TL5 A;  2JT4 B;  5IN7 A;  1VZ6 A;  3ETR A;  3U7D A;  4EZK A;  1SJE D;  4K7U A;  4KZC A;  4DDG D;  2KN4 A;  2Y5P A;  1E90 A;  2I2Y A;  3AE6 B;  1YJJ A;  3V6C B;  2CU1 A;  3JSV B;  3VXW A;  1XCQ L;  1FMA D;  3DPD A;  1P98 A;  4EUT A;  2KHW B;  2IJ0 A;  2KJH B;  3DBR I;  1WX9 A;  2PVO D;  1ENF A;  1D5X C;  2L52 A;  2OOB B;  2BQQ A;  1V8C A;  3KQ4 A;  4M00 A;  4KGT A;  1C1Y B;  4K81 A;  5JHA A;  3W9C B;  2PVG C;  3MC8 A;  5G2N A;  3DVG Y;  3SU8 X;  4I6N B;  2Z0E B;  1E6E B;  1TZ1 A;  4WAF A;  2JY6 A;  3PHW B;  1CMX B;  4GB9 A;  1WXM A;  4RGT A;  1TGZ B;  2WLB A;  1SE2 A;  4YSY B;  4W9J A;  1KM7 A;  3DHI C;  3QWZ B;  4URK A;  2KZR A;  2LZ6 A;  2N0S B;  3RUL A;  1FD6 A;  2EKE C;  4PYU A;  2B76 B; 
#chains in the Genus database with same CATH homology
 3DBH I;  2MSE D;  4BKS D;  4WJQ A;  2LI5 A;  4FN2 A;  4XZ4 A;  4JL9 A;  4NNJ B;  4G3X B;  3V6E B;  4B6W A;  3H7S A;  3UIO B;  1A5R A;  3L16 A;  2GBN A;  2L8J A;  3L17 A;  3ZVV A;  1UGM A;  2D07 B;  5IA7 A;  3OAW A;  3NZU A;  3SHQ A;  2ZPN A;  3CF6 E;  3DVN U;  2M0X A;  5LXH A;  1M94 A;  4KSK C;  2O6V B;  4DDI D;  3ZLZ A;  2DYM A;  1WJ6 A;  3B1L X;  2ZCB A;  3PZD A;  4A3P A;  3VDZ A;  1RAX A;  5JHB A;  1HE8 A;  3N3K B;  1LQB A;  2O2V B;  2LJ5 A;  4EKU A;  4NAW B;  1KJT A;  3TCA A;  3R7Q A;  2KLC A;  4RMA A;  4JGH B;  2KJ6 A;  2LAS A;  2MBO A;  4ZYN A;  1WJU A;  4DHZ E;  3T8M A;  2CR5 A;  2G4S A;  4AJY B;  4FAD A;  4HVB A;  3AI5 A;  3QC8 B;  2MP2 A;  4HXD A;  4KZ0 A;  1WZ0 A;  1GG3 A;  4G11 A;  4NPN A;  2EMT A;  2KX0 A;  4FJY A;  3Q3F A;  1TTN A;  1WF9 A;  3DVN V;  2XK5 B;  4ICU A;  3H1U A;  5DPS A;  4DHZ B;  2DHZ A;  2PE9 A;  1MG8 A;  5CHW A;  4I6L B;  3VUY A;  4BFR A;  2K6D B;  4E74 A;  2L0F A;  3DVG X;  3ALB A;  1NBF C;  3UIP B;  2JVC A;  4NJ6 A;  1E8W A;  4N9F 4;  2KFK B;  1V6E A;  4DWF A;  1P3Q U;  3QQ8 B;  4MDK E;  2BWF A;  4ANW A;  4G0N B;  2DX5 B;  2MBH A;  3H6N A;  1GJZ A;  3R3M A;  2KJR A;  3RZW C;  4HCN B;  4RM9 A;  2Z0D B;  1LFD A;  3VHT C;  2Y5B B;  3ML9 A;  3ZNI D;  4AP4 C;  2IYD B;  4BBN C;  2KFJ A;  2O2V A;  4GDK B;  2CHW A;  2WX0 A;  2CS4 A;  2NBV B;  3A9J B;  4TQ1 A;  5DCN A;  3NS8 A;  4W9F A;  3VFK A;  3AU5 A;  2A5U A;  1KLV A;  4B95 A;  3H9D A;  1SGH A;  1WXS A;  4HDO A;  4OVU A;  5D2M B;  2FCN A;  2IO2 B;  2PJH A;  1UBQ A;  4PS7 A;  3S2A A;  1PQS A;  4LDT B;  2GBM A;  3EEC A;  2B3A A;  4A3O A;  4TKN A;  2CHZ A;  1E7U A;  2XK5 A;  5AZH A;  4MSM B;  2MRP A;  3L0W B;  1VD2 A;  2MBB B;  1V86 A;  4HPL B;  2D3G A;  2C7H A;  2DYB A;  4MEL A;  3CMM B;  1D3Z A;  1I42 A;  4OVV A;  5JH5 C;  5LLI A;  2KO3 A;  3ZUN A;  4ANV A;  1SE9 A;  4F1S A;  4MEM A;  3ZTC A;  3UQA A;  2N9X A;  1V2Y A;  4TQ0 A;  3HHM A;  3W1Y A;  2RPQ A;  2RSU A;  4AOF A;  2ZCC A;  2KMC A;  1RFA A;  2CKH B;  4W9G A;  1SIF A;  4DHJ D;  1C3T A;  4EEW A;  2NR2 A;  4IM3 A;  4W9E A;  4EZL A;  2K8B A;  5CHV C;  3ZW3 A;  1F9J A;  1OTR B;  1EO6 A;  2KVR A;  1H8C A;  1WZ3 A;  5HKH A;  2DZM A;  2MQJ A;  4TUU A;  4DBG A;  4GOC A;  4W9K A;  5AEK B;  4GDL A;  2D2Q A;  2KQS A;  3NZS A;  3V62 A;  2KN5 A;  2R2Q A;  3PRP B;  1J8C A;  3PVL A;  4I6P A;  2UYZ B;  2PPH A;  3ZKJ C;  4PYZ A;  2YLM A;  3PPA A;  3KW5 B;  4HDQ A;  3V61 A;  2KX3 A;  1WY8 A;  5BO4 B;  2BKR B;  4BOS C;  2MP2 B;  1JRU A;  2EMS A;  3A9K A;  3ZIM A;  5J18 A;  2ZPY A;  4W9L A;  4GSW A;  5DPW A;  2JRI B;  3SD5 A;  1X1M A;  2ZEQ A;  4EZJ A;  3PGE A;  3Q3J A;  4AUQ C;  1Z2M A;  1KOT A;  3AU4 A;  1Y8R C;  3KVF B;  2Z59 B;  3A1Q A;  1EF1 A;  1WGG A;  3HM3 A;  4HLE A;  3TMP B;  3VTW A;  2IO1 B;  4W9D A;  4IG7 B;  3GOE A;  2KAN A;  4TV3 A;  3KUC B;  1EF5 A;  1OGW A;  3VVW B;  2NS5 A;  3L13 A;  4CYE A;  1WGH A;  3H7P A;  2KTR A;  4FHK A;  3QIJ A;  4E71 A;  4JIO U;  4ZRK A;  2KOX A;  5DPT A;  2R2O A;  2HTH A;  3ZDT A;  4KV2 A;  1E8Z A;  5AZF A;  3AXC A;  4F8C B;  3UGB B;  2JRH A;  3IHP C;  2DZJ A;  2IBI B;  5DPR A;  2KKC A;  4K7S A;  3SDL C;  3PRM B;  3GZN I;  3DCG A;  2BKF A;  3IVF A;  2N1W A;  3K9O B;  3KH0 A;  3IG3 A;  5J2R A;  2GMI C;  5E6O A;  2KDB A;  1S3S G;  4IWQ A;  4EOY A;  1V9J A;  2C60 A;  2BGF A;  2BWE S;  4X57 B;  2KD0 A;  3M62 B;  5JZE B;  4HCP B;  3DOW A;  3R66 C;  2M4N A;  2LGY A;  3ZDM C;  2L00 B;  2KDE B;  4MM3 A;  2MX2 A;  4W9H A;  2NBW B;  3M63 B;  2C9W B;  4LCD E;  3PT2 B;  2PE6 B;  4WWP A;  4ZRI A;  2LXC A;  4PS3 A;  2N4F A;  3QCA A;  4ASW C;  2IY1 B;  2FAZ A;  1WM3 A;  1WR6 E;  4WJO A;  2BYE A;  3D32 A;  4IWP A;  4FHJ A;  4W9I A;  2CHX A;  3WAN A;  2K1F A;  1WIA A;  3A4S C;  2G45 B;  1WH3 A;  1AAR A;  2VRR B;  2DZI A;  4NY0 A;  2KWU B;  4W9C A;  3U8Z A;  4K7W A;  4AJW A;  2K8C A;  1P0R A;  3TIX A;  5L95 C;  4KVG B;  4M0W B;  3ZRC A;  4MGY E;  2ZVN A;  4GDL B;  1OEY J;  2KDI A;  2MW5 A;  1NDD A;  1YD8 U;  3QX1 A;  1V80 A;  3R7R A;  2KXJ A;  4BKT A;  2N7E A;  3K9P B;  3IFW B;  2LRW A;  1WX7 A;  2AWT A;  3A9K B;  3M95 A;  3PHX B;  4KSL C;  2K8H A;  5D6J B;  2O6V D;  1UEL A;  4GN1 A;  1E8X A;  3OLM D;  5CX3 A;  3KUZ A;  3DQV A;  1WXV A;  1XT9 B;  2XEW A;  1WJ4 A;  3W1S C;  3CSF A;  4BVU C;  2L3Z A;  3IBE A;  3T9L A;  4MGZ E;  3MHS D;  3VAW A;  2BYF A;  1J19 A;  2K39 A;  2IO3 B;  1YX6 B;  3RYT A;  3A1Q B;  2AL3 A;  4IM2 A;  5E6N A;  1YIW A;  2AL6 A;  2FCQ A;  2J0M A;  3PRZ A;  4MJS B;  4MGK E;  3ZRF A;  4CO7 A;  1WMH A;  3JYU A;  2C7N B;  2MCN B;  5L83 A;  4KIK A;  1G6J A;  3WA0 A;  2J0K A;  2PEA A;  3ZNZ B;  2ZNV C;  2FNJ B;  5E6P A;  2KQ7 A;  4DK5 A;  1EUV B;  1XQQ A;  3BY4 B;  4FA6 A;  1FXT B;  2FCS A;  3DDC B;  3V60 A;  4E3C A;  3H7P B;  1GUA B;  2KTR B;  2NVU I;  4YL8 A;  1L2N A;  1WYW B;  1NI2 A;  4WJN A;  4K1R B;  3X0W A;  3P2B A;  1WRD B;  1ZW7 A;  3A4R A;  1Z5S B;  2I1K A;  1OQY A;  3QA8 A;  4NQK E;  2FIF A;  4LJP B;  4M8M A;  3VQI A;  2C5L C;  2FCM A;  2KK8 A;  2IY0 B;  2ZNV B;  2I1J A;  1ZGU B;  3LDZ E;  5D7G A;  1H4R A;  3MTN B;  3QJZ A;  2V3S A;  3JW0 X;  4GIV A;  1WM2 A;  1Q0W B;  2NBU A;  3QK0 A;  2BPS A;  2LRU A;  2L05 A;  1WFY A;  2UWQ A;  2XBB C;  3DBS A;  3L10 B;  4G50 A;  3PSE B;  1WR1 A;  5C1Z A;  2G3Q B;  2N1V A;  2N7D A;  3OJ4 B;  3U30 A;  1ISN A;  2JPH A;  3EFU A;  5TR5 A;  3RZF A;  3VUW A;  3ZNH B;  2WYQ A;  5J17 A;  5CTR C;  2GBR A;  4BKS A;  2HD5 B;  3JSV A;  1UBI A;  2DAF A;  3B08 A;  2M17 A;  3JVZ X;  2V4L A;  4MJS A;  4AWJ A;  4WWN A;  3APC A;  1ZKH A;  4XC2 A;  3VTU A;  1WGR A;  2HJ8 A;  4XX5 A;  4A20 A;  4IW0 A;  2D11 A;  3ECI A;  4LDT D;  3W1S A;  2N9P C;  2LUE A;  3RCZ A;  3NHE B;  3PLU A;  4GXB A;  1WE7 A;  3UIN B;  2AYO B;  4JLC A;  1V49 A;  2WWZ A;  3RT3 B;  3DBL I;  3APD A;  1OEY A;  1UD7 A;  1Q1O A;  1WX8 A;  2LVQ A;  2KWV B;  1LXD A;  2MBQ A;  4WAA A;  2AEH A;  1T0Y A;  1UZX B;  3C0R B;  3ENE A;  3PRE A;  3QAQ A;  3TJP A;  3L08 A;  3N30 A;  3EHV A;  4ZRJ A;  3AUL A;  1IPG A;  3MJW A;  3N32 A;  3PV1 A;  4HPM B;  2WDT B;  4B9K A;  2FUH B;  4DXA B;  2D10 A;  4NJ7 A;  1I35 A;  1YJ1 A;  2KNB A;  1IP9 A;  2J0J A;  1WXA A;  2KC2 A;  4EFO A;  1IYF A;  3QHT A;  3O65 B;  2ZZP B;  1GC7 A;  3PLV A;  4HK2 A;  4F7Z A;  1QZE A;  2LWP A;  3HIZ A;  2L76 A;  1R4N I;  2NPT A;  4RM8 A;  2M1M A;  4ANU A;  2JZZ A;  4CHK A;  3ML8 A;  3UQB A;  2N9E B;  2HE7 A;  4GU2 A;  1K8R B;  1UH6 A;  3ZTD A;  3KYD D;  4KDL B;  2RGF A;  4P7I A;  4FJV B;  2RR9 A;  3HM6 X;  1GNU A;  2WX1 A;  5GMV A;  4DHJ B;  1WMH B;  1YX5 B;  3VH4 B;  2IO0 B;  4KIK B;  1BT0 A;  3VH3 B;  1WJN A;  4J6I A;  4FJZ A;  4IC7 B;  4WQO B;  4GMV A;  2LGX A;  1TBE A;  2K6Q A;  1WGY A;  2DEN B;  2K25 A;  4MGI E;  4BBN F;  3L54 A;  2C7M B;  3TL5 A;  2JT4 B;  2GBJ A;  3U7D A;  4EZK A;  1E7V A;  2MWS B;  2ZVO A;  1V5T A;  2KMA A;  4K7U A;  4KZC A;  3TBL D;  2O6V A;  4DDG D;  3HK0 A;  4IM0 A;  2L7R A;  4II3 B;  2OJR A;  2MBE A;  2QHO A;  3I3T B;  5EDS A;  3LJ3 A;  1E90 A;  1LM8 B;  1J0G A;  4NAW A;  3V6C B;  2V1Y A;  4WWO A;  3WAL A;  2JUO A;  3APF A;  2LD9 A;  2CU1 A;  2MLB A;  2A4Z A;  2KTF A;  3JSV B;  1P9D U;  3BIN A;  3VXW A;  3WAO A;  4IUM B;  2JZ3 B;  3DPD A;  4HWI B;  1E8Y A;  1P98 A;  4EUT A;  3VTV A;  2KHW B;  2LVP A;  2KWC A;  2DYO A;  4GGQ A;  3CST A;  2NCN A;  3OJ3 A;  2KJH B;  3DBR I;  5D94 A;  2L0T A;  1WX9 A;  3X23 A;  1WGD A;  5C23 A;  2GOW A;  2KLG A;  3WIM A;  1V5O A;  5KHQ A;  2OOB B;  2ZJD A;  3EC8 A;  1GC6 A;  2JWZ A;  1C1Y B;  4K81 A;  4NQL B;  4ANX A;  1RRB A;  1WE6 A;  3UF8 A;  3KYC D;  1WI0 A;  2LXA A;  5IAA C;  2KFK A;  1Q5W B;  1E5W A;  3B0A A;  5JHA A;  2REX A;  4WJP A;  2MA9 B;  5KHO A;  1YQB A;  4HJK A;  3KUD B;  4LJO B;  1S1Q B;  5G2N A;  2DAJ A;  3DVG Y;  3QAR A;  2J7Q B;  3SU8 X;  4ICV A;  3PS6 A;  2KC1 A;  2Z0E B;  4I6N B;  3VUX A;  1L7Y A;  3WAM A;  4ZDV A;  2IZV B;  1TZ1 A;  4M8N A;  5G55 A;  4FLH A;  3NOB A;  2JY6 A;  3PHW B;  1CMX B;  2KDF B;  2JF5 A;  2YVC A;  4GB9 A;  1WXM A;  1TGZ B;  5CHF A;  4GDK A;  4W9J A;  3PTF C;  1RLF A;  2NPT B;  3RD2 A;  5AZG A;  3A9J A;  4BKG A;  1KM7 A;  4BOZ B;  2LVO A;  3QWZ B;  1P1A A;  2W9N A;  2G4D B;  1R4M I;  2DZK A;  2KZR A;  2RD0 A;  3ZO5 B;  1XD3 B;  4URK A;  2BYV E;  2LZ6 A;  3M3J A;  3WAP A;  3NY5 A;  4FUL A;  4KDI C;  4IWO A;  3RUL A;  2ASQ A;  4II2 B;  2GBK A;  2FID A;  2M8S A;  3A33 B;  4PS8 A;  2EKE C;  4MSQ B;  5LXI B;  4JQW C;  4PYU A;  5FR6 A;  4MH0 E;  2BF8 B;  2LGD A;  3RUI B;  3ONS A;  1VCB A;  3ZNG C;  1V81 A;  2JXX A;  4FBJ B;  1U4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...