1TZYA

Crystal structure of the core-histone octamer to 1.90 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A-IV
publication title High-resolution structure of the native histone octamer.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 32
structure length 106
sequence length 106
chains with identical sequence E
ec nomenclature
pdb deposition date 2004-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1tzyA00
5JRGD 3MGSC 4WV4B 4NE6A 3V9RB 1P3KB 2NZDD 3KUYC 2F8NA 3W96C 4J8WB 3LZ0A 1P34C 5DNMA 3KXBC 3KWQC 1P3ID 1M1AB 3A6NC 3AZKA 5B2IC 1P3FC 5B31D 5B0YA 5B1LC 2NZDB 5GXQD 3AZNA 3AV2A 2IO5C 1HQ3A 4Z5TA 3C1CD 4G91C 3X1UB 5E5AC 1ZLAA 4HGAC 3MGSD 5CPIB 4QLCC 3VH6W 3TU4A 3AN2C 4KUDB 5GXQB 1P34D 3KXBD 3KWQD 3AZHC 3A6ND 3AZJA 5FUGA 5B2JB 5B1LD 3KUYB 3W96B 5B40C 3MNNC 3LELA 3KXBB 5CP6A 3LZ1C 4XZQA 3KWQB 3A6NB 4YS3A 5E5AD 3WKJC 5B1MC 5B2IB 4EO5C 1P3FB 5GT3A 3RELA 1KX4C 2NQBC 5B1LB 5JRGA 3AN2D 5B32B 2IO5B 2NZDA 4G91B 3AZHD 5E5AB 1TZYD 4HGAB 1P3IA 5AY8C 3AV1B 3AZLC 4YM6B 5B33C 4QLCB 3AN2B 5B40D 3MNND 5B31A 5AVBC 3LZ1D 3WKJD 5GXQA 1U35D 5B1MD 3C1CA 2YFWA 4H9PB 1KX4D 2NQBD 3MGSA 4J8UC 1KX3C 5BO0B 1F1EA 5AV6D 4UUZB 3WTPC 3LZ1B 5B0ZD 1KX5C 3WKJB 1F66C 5B1MB 1P34A 3KXBA 5B0YC 3KWQA 5AY8D 3A6NA 3AZLD 5B33D 5AV5B 3AZNC 1P3AC 2NQBB 4Z5TC 2AROB 4Z2MG 5B1LA 5AVBD 3UTBD 1ZLAC 2FJ7B 4J8VC 2PYOB 5AY8B 3TU4C 5E5AA 3AZLB 4J8UD 1KX3D 5BNXB 1S32B 5AVBB 3WTPD 3AN2A 1KX5D 3MGQC 3AZHA 1P3AD 1TZYA 5GT0C 5DNMB 1KX3B 3VH5T 3WTPB 3AZKB 5BO0A 5B40A 4J8VD 1F66B 3MNNA 4UUZA 3LZ1A 5B0YB 3WKJA 1U35A 5B1MA 5AV9C 3AZNB 3AZFC 4Z5TB 1KX4A 1P3OD 2NQBA 1ZLAB 3REID 3MGQD 1P3IC 4J8VB 4E45A 5B0ZA 3TU4B 3AZGC 3VH5A 5GT0D 4Z2MH 1JFIA 4G92B 5AY8A 3AZLA 5B33A 4R8PC 4NE5A 3WTPE 2JSSA 3MGQB 3AYWC 5BNXA 5AVBA 3UTBA 3O62C 2HUEC 5AV9D 3AZFD 1N1JA 5GT0B 1WWSA 1M18C 3LELB 5CP6B 4XZQB 3UT9C 4YS3B 4J8UA 1KX3A 2F8NK 5GT3B 3RELB 3W99C 3WTPA 5JRGB 1KX5A 3AZGD 3X1VC 1F66A 5AV9B 3AZFB 3NQUA 4CAYB 4R8PD 1P3AA 2F8NG 4E44A 3X1SC 1B6WA 2BYMA 3AYWD 1P3IB 1EQZC 1WWIA 3O62D 4J8VA 3AZGB 3B6GC 5B31B 1M18D 3UT9D 4R8PB 3C1CB 2YFWB 3AYWB 1P3OA 4LD9C 3W99D 1TZYC 3REIA 3MGQA 3MGSB 3AZMC 2HUEB 3X1VD 3B0CW 1M19C 1M18B 4AWLC 4CSRB 5GT0A 3X1SD 1P34B 4J8XD 1EQZD 1U35C 3W99B 4JJNC 3RELD 3B6GD 5AV9A 3AZFA 1KU5A 4X23C 4CAYA 5AV6C 5B0ZC 4LD9D 3AZMD 2F8NH 4DRAA 2L5AA 1M19D 3WA9C 1P3LD 4ZUXD 3AZGA 5GSUC 3B0CT 3UTBC 3AZHB 4XUJD 4R8PA 4LD9B 3C1BC 1TZYB 4JJND 5DNNC 3AYWA 4KGCC 4H9OB 3UTAC 3O62A 1A7WA 3W98D 5B40B 3MNNB 4X23D 3AZIC 1M18A 4CSRA 3UT9A 1U35B 4WU9C 4JJNB 4EO5B 3VH5W 1P3GD 1KX4B 3W99A 3WA9D 3X1VA 5GSUD 4X23B 5AV6B 5B0ZB 3X1SA 3C1BD 1JFIB 5CPJD 5DNND 4KGCD 4J8XA 5CPKC 1EQZA 3MGRC 5B33B 3UTAD 4H9NA 3WAAD 4WU8C 5C3IC 3R45A 1P3OC 3B6GA 3AZID 3UTBB 5JA4A 3REIC 3B0DC 5B32G 1N1JB 4WU9D 5F99D 3C1BB 3W97C 5AVCC 4LD9A 3LJAC 3UTAB 4WZSB 1P3MC 4J8UB 3AZMA 4H9OA 1M19A 3AZIB 1KX5B 4ZUXA 3NQUB 3X1TC 5CPKD 4XUJA 3MGRD 4WNNA 3MVDC 1P3AB 4JJNA 2BYMB 1P3PC 4WU8D 1TAFA 2LY8A 3B6FC 1ID3C 3W98A 1HTAA 4H9QB 2YFVA 4X23A 3W97D 5AV6A 5AVCD 2HIOC 3AV2D 3LJAD 3AFAD 1P3MD 4WU8B 5C3IB 1P3GA 1P3OB 3NQJB 3WA9A 1B67A 5BT1C 3B0DB 5GSUA 3REIB 1BH9A 3X1TD 3W97B 3MVDD 3C1BA 3LJAB 5CPJA 5DNNA 1P3PD 4KGCA 5G49A 3REJC 3UTAA 3B6FD 1ID3D 3X1UC 3AZIA 2HIOD 3MVDB 4WU9A 4H9RA 1P3KD 5F99A 1P3PB 1BFMA 4M6BA 4J8WD 1ID3B 5BT1D 4J8XC 1M1AD 3MGPC 4H9SC 2CV5C 4H9QA 2HIOB 3REKC 5B2JC 5CPKA 3REJD 3MGRA 4NFTA 3B0BA 3X1UD 4WU8A 3NQJA 3O62B 5AV8C 5CPID 3W97A 5AVCA 4KUDD 5B32C 3REJB 4ZUXC 4DRBA 3UT9B 3LJAA 1P3LC 3AFAA 1P3MA 3MGPD 2CWEA 4XUJC 2CV5D 4NE3A 1P3BC 5BS7C 3REKD 3AV1C 5B2JD 2BYKB 4YM6C 2RVQC 3X1VB 3KUYD 3X1TA 3W98C 3W96D 3MVDA 3X1SB 5KDMA 1P3PA 4J8XB 3MGPB 2CV5B 1EQZB 3B6FA 5B2ID 4H9NB 1ID3A 5AV8D 1P3FD 4KHAA 3REKB 3R45B 1P3GC 3B6GB 1BH8B 5JA4B 5B32D 4Z66C 2HIOA 3V9RA 1P3KA 3AZEC 4J8WA 5B24C 1P3BD 5CPJC 5AV8B 3AZMB 3AV1D 1M1AA 4YM6D 2RVQD 5AV5C 4QLCD 1M19B 1AOIC 3WAAC 2AROC 1ULYA 4AWLB 1P3LB 4ZUXB 3VH6T 5B31G 4XUJB 3REJA 2FJ7C 2PYOC 4WNNB 5F99C 1P3BB 3X1UA 1TAFB 4Z66D 3REHC 3W98B 2BYKA 1S32C 5CPIA 3AZED 2YFVB 4KUDA 5B24D 3MGPA 4H9SA 2CV5A 5AV5D 1P3GB 1AOID 3LZ0C 3WA9B 2AROD 4Z66B 5DNMC 3VH6A 3REKA 5GSUB 5B2JA 5CHLB 3KUYA 3AZEB 1BH8A 1BH9B 3KSYA 3AZKC 1H3OB 3W96A 2FJ7D 2PYOD 5B24B 5BNVB 5CPJB 5DNNB 4KGCB 5G49B 3AV2C 1AOIB 1HQ3C 5B2IA 3WAAB 3AFAC 3REHD 5AV8A 1P3FA 1S32D 1Q9CA 5B32A 1P3LA 4ZBJC 4H9RB 4WU9B 5F99B 2F8ND 3LZ0D 1P3BA 4G92C 5BS7A 5DNMD 3REHB 3AV1A 4YM6A 4QLCA 3AZKD 3AZJC 1F66D 5B0YD 5CPKB 2F8NB 3MGRB 3AZND 4Z5TD 1HQ3D 3LZ0B 1P3KC 4H9PA 3LELC 5CP6C 4XZQC 4YS3C 4J8WC 1ZLAD 4Z66A 1M1AC 5GT3C 3RELC 3AZEA 5JRGC 5AVCB 1H3OA 3TU4D 5B24A 3AV2B 5BNVA 1HQ3B 2NZDC 3AFAB 1P3MB 5AV5A 1AOIA 3WAAA 3AZJD 2AROA 4ZBJB 3X1TB 2FJ7A 2PYOA 5CPIC 5KDMB 5B31C 3LELD 5CP6D 4XZQD 4KUDC 4YS3D 1R4VA 5GXQC 3B6FB 3C1CC 3AZJB 3REHA 1S32A 5GT3D 4KHAB 5FUGB
chains in the Genus database with same CATH superfamily
5JRGD 3MGSC 4WV4B 4NE6A 3V9RB 1P3KB 2NZDD 3KUYC 2F8NA 3W96C 4J8WB 3LZ0A 1P34C 5DNMA 3KXBC 3KWQC 1P3ID 1M1AB 3A6NC 2DQNC 3AZKA 5B2IC 1P3FC 5B31D 5B0YA 5B1LC 2NZDB 5GXQD 3AZNA 3AV2A 2IO5C 1HQ3A 4Z5TA 3C1CD 4G91C 3X1UB 5E5AC 1ZLAA 4HGAC 3MGSD 2BG1A 5CPIB 4QLCC 3VH6W 3TU4A 3AN2C 4KUDB 3A1IA 5GXQB 1P34D 3KXBD 3KWQD 3AZHC 3A6ND 2Y2HA 3AZJA 2RIQA 5FUGA 5B2JB 5B1LD 3KUYB 3W96B 5B40C 3MNNC 3LELA 2ZY2A 3KXBB 5CP6A 3LZ1C 4XZQA 3KWQB 3A6NB 4YS3A 5E5AD 3WKJC 5B1MC 4DQYB 2Y2MA 5B2IB 4EO5C 1P3FB 5GT3A 3RELA 1KX4C 2NQBC 5B1LB 5JRGA 3EPLA 3AN2D 2Y2KA 5B32B 2IO5B 2NZDA 4G91B 3AZHD 2Y2OA 5E5AB 1TZYD 1PZRA 4HGAB 1P3IA 5AY8C 3AV1B 3AZLC 4YM6B 5B33C 4QLCB 3AN2B 5B40D 3MNND 5B31A 5AVBC 3LZ1D 3WKJD 5GXQA 1U35D 5B1MD 3C1CA 2YFWA 2Y2JA 4H9PB 1KX4D 2NQBD 3MGSA 4J8UC 1KX3C 5BO0B 1F1EA 5AV6D 4UUZB 3WTPC 3LZ1B 5B0ZD 1KX5C 3WKJB 1F66C 5B1MB 1P34A 3KXBA 5B0YC 3KWQA 5AY8D 3A6NA 3AZLD 2J8PA 5B33D 5AV5B 3AZNC 1P3AC 2NQBB 4Z5TC 2VQRA 2AROB 3P5JB 4Z2MG 5B1LA 5AVBD 3UTBD 1ZLAC 2FJ7B 4J8VC 2PYOB 2ZY3A 5AY8B 3TU4C 5E5AA 3AZLB 4J8UD 1KX3D 5BNXB 1S32B 5AVBB 3WTPD 3AN2A 1KX5D 3MGQC 3AZHA 1P3AD 1TZYA 5GT0C 5DNMB 1KX3B 3VH5T 3WTPB 3AZKB 5BO0A 5B40A 4J8VD 1F66B 3MNNA 4UUZA 3LZ1A 5B0YB 3WKJA 1U35A 5B1MA 5AV9C 3AZNB 3AZFC 4Z5TB 1KX4A 1P3OD 2NQBA 1ZLAB 3REID 3MGQD 1P3IC 4J8VB 4WJ3C 4E45A 5B0ZA 1Z2CB 3TU4B 3AZGC 3VH5A 5GT0D 4Z2MH 1JFIA 4G92B 5AY8A 3AZLA 5B33A 4R8PC 4NE5A 3WTPE 2JSSA 3MGQB 3AYWC 5BNXA 5AVBA 3UTBA 3O62C 2DF4C 2HUEC 5AV9D 3AZFD 1N1JA 5GT0B 1WWSA 1M18C 3LELB 5CP6B 4XZQB 3UT9C 4YS3B 2FFFB 4J8UA 1KX3A 2F8NK 5GT3B 3RELB 3W99C 3EG5B 3WTPA 5JRGB 1KX5A 3AZGD 3X1VC 1F66A 5AV9B 3AZFB 3NQUA 4CAYB 2ZY4A 4R8PD 1P3AA 2F8NG 4E44A 3X1SC 1B6WA 2BYMA 4UPKA 3AYWD 1P3IB 1EQZC 1WWIA 3O62D 4J8VA 3AZGB 3B6GC 5B31B 1M18D 3UT9D 4R8PB 2Y2IA 3C1CB 2YFWB 3AYWB 1P3OA 4LD9C 3W99D 1TZYC 3REIA 3MGQA 3MGSB 3AZMC 2HUEB 3X1VD 3B0CW 1M19C 1M18B 4AWLC 4CSRB 5GT0A 3X1SD 1P34B 4J8XD 1EQZD 2Y2GA 1U35C 3W99B 4JJNC 3RELD 3H0MC 2XD1A 3B6GD 5AV9A 3AZFA 1KU5A 4X23C 4CAYA 5AV6C 5B0ZC 4LD9D 3AZMD 2F8NH 4DRAA 2L5AA 1M19D 3WA9C 1P3LD 3EPHA 4ZUXD 3AZGA 5GSUC 3B0CT 3UTBC 3AZHB 4XUJD 4R8PA 4LD9B 3C1BC 1TZYB 4JJND 5DNNC 3AYWA 4KGCC 4H9OB 3UTAC 3O62A 1A7WA 2UWXA 3W98D 5B40B 3MNNB 4X23D 3AZIC 1M18A 4CSRA 3UT9A 1U35B 2Y2PA 4WU9C 4JJNB 4EO5B 3VH5W 1P3GD 1KX4B 3W99A 3WA9D 3X1VA 5GSUD 3AL0C 4X23B 5AV6B 5B0ZB 3X1SA 3C1BD 1JFIB 5CPJD 2Y2QA 5DNND 4KGCD 4J8XA 5CPKC 1EQZA 3MGRC 5B33B 3UTAD 4H9NA 3WAAD 4WU8C 5C3IC 3R45A 1P3OC 3B6GA 3AZID 3UTBB 5JA4A 3REIC 3B0DC 5B32G 1N1JB 4WU9D 5F99D 3IP4C 3C1BB 3W97C 5AVCC 4LD9A 3LJAC 3UTAB 4WZSB 1P3MC 4J8UB 3AZMA 4H9OA 1M19A 3AZIB 1KX5B 4ZUXA 2G5HC 3NQUB 3X1TC 5CPKD 4XUJA 3MGRD 4WNNA 3MVDC 1P3AB 4JJNA 2BYMB 1P3PC 4WU8D 1TAFA 2LY8A 3B6FC 1ID3C 3W98A 1HTAA 4H9QB 2YFVA 4X23A 3W97D 5AV6A 5AVCD 2HIOC 3AV2D 3LJAD 3AFAD 1P3MD 4WU8B 5C3IB 2JCHA 1P3GA 1P3OB 3NQJB 3WA9A 1B67A 5BT1C 3B0DB 5GSUA 3REIB 3A1KA 1W2EA 1BH9A 3X1TD 3W97B 2Y2LA 3MVDD 3C1BA 3LJAB 5CPJA 5DNNA 1P3PD 4KGCA 5G49A 3REJC 3UTAA 3B6FD 1ID3D 3X1UC 3AZIA 2HIOD 3MVDB 4WU9A 4H9RA 1P3KD 5F99A 1P3PB 1BFMA 4M6BA 4J8WD 1ID3B 5BT1D 2F2AC 4J8XC 1M1AD 3MGPC 4H9SC 2CV5C 2JE5A 4H9QA 2HIOB 3REKC 5B2JC 5CPKA 2ZM5A 3MGRA 3REJD 4NFTA 3B0BA 3X1UD 4WU8A 3NQJA 3O62B 5AV8C 5CPID 2W8SA 3W97A 5AVCA 4KUDD 5B32C 3REJB 4ZUXC 4DRBA 3UT9B 3LJAA 1P3LC 3AFAA 1P3MA 3MGPD 2CWEA 4XUJC 2CV5D 4NE3A 2XD5A 1P3BC 5BS7C 3REKD 3AV1C 5B2JD 2BYKB 4YM6C 2RVQC 3X1VB 3KUYD 3X1TA 3W98C 3W96D 3MVDA 3X1SB 5KDMA 1P3PA 4J8XB 3MGPB 2CV5B 1EQZB 3B6FA 3F6TA 4H9NB 5B2ID 1ID3A 5AV8D 1P3FD 4KHAA 3REKB 3R45B 1P3GC 3B6GB 1BH8B 5JA4B 5B32D 4Z66C 2HIOA 3V9RA 1P3KA 3AZEC 3H0RC 4J8WA 5B24C 1P3BD 5CPJC 5AV8B 3AZMB 3AV1D 1M1AA 4YM6D 2RVQD 5AV5C 4QLCD 1M19B 1AOIC 3WAAC 2AROC 1T3UA 1ULYA 4AWLB 1P3LB 4ZUXB 3KFUG 3VH6T 5B31G 4XUJB 3REJA 2FJ7C 2PYOC 4WNNB 5F99C 1P3BB 3X1UA 1TAFB 4Z66D 3REHC 3W98B 2BYKA 1S32C 5CPIA 3AZED 2YFVB 4KUDA 5B24D 3MGPA 4H9SA 2CV5A 5AV5D 1P3GB 1AOID 3LZ0C 2G5IC 3WA9B 2AROD 4Z66B 5DNMC 3VH6A 3REKA 5GSUB 5B2JA 5CHLB 3KUYA 3AZEB 1BH8A 1BH9B 3KSYA 3AZKC 1H3OB 3W96A 2FJ7D 2PYOD 5B24B 5BNVB 5CPJB 5DNNB 4KGCB 5G49B 3AV2C 1AOIB 1HQ3C 5B2IA 3WAAB 3AFAC 3REHD 5AV8A 1P3FA 1S32D 1Q9CA 5B32A 1P3LA 4ZBJC 4H9RB 4WU9B 5F99B 2F8ND 3LZ0D 3H0LC 1P3BA 4G92C 5BS7A 5DNMD 3REHB 3AV1A 4YM6A 4QLCA 3AZKD 3AZJC 1F66D 5B0YD 5CPKB 3EPKA 3FDDA 2F8NB 3MGRB 3AZND 4Z5TD 1HQ3D 3LZ0B 1P3KC 4H9PA 3LELC 5CP6C 4XZQC 4YS3C 4J8WC 1ZLAD 4Z66A 1M1AC 5GT3C 3RELC 3AZEA 5JRGC 2Y2NA 5AVCB 1H3OA 3TU4D 5B24A 2ZY5A 5BNVA 3AV2B 1HQ3B 3EPJA 2NZDC 3AFAB 1P3MB 5AV5A 1AOIA 3WAAA 3AZJD 2AROA 4ZBJB 3X1TB 2FJ7A 2PYOA 5CPIC 5KDMB 5B31C 3LELD 5CP6D 4XZQD 4KUDC 4YS3D 1R4VA 5GXQC 3B6FB 3C1CC 3AZJB 3REHA 1S32A 5GT3D 4KHAB 5FUGB
chains in the Genus database with same CATH topology
5JRGD 3MGSC 4WV4B 4NE6A 3V9RB 1P3KB 2NZDD 3KUYC 2F8NA 3W96C 4J8WB 3LZ0A 1P34C 5DNMA 3KXBC 3KWQC 1P3ID 1M1AB 3A6NC 2DQNC 3AZKA 5B2IC 1P3FC 5B31D 5B0YA 5B1LC 2NZDB 5GXQD 3AZNA 3AV2A 2IO5C 1HQ3A 4Z5TA 3C1CD 4G91C 3X1UB 5E5AC 1ZLAA 4HGAC 3MGSD 2BG1A 5CPIB 4QLCC 3VH6W 3TU4A 3AN2C 4KUDB 3A1IA 5GXQB 1P34D 3KXBD 3KWQD 3AZHC 3A6ND 2Y2HA 3AZJA 2RIQA 5FUGA 5B2JB 5B1LD 3KUYB 3W96B 5B40C 3MNNC 3LELA 2ZY2A 3KXBB 5CP6A 3LZ1C 4XZQA 3KWQB 3A6NB 4YS3A 5E5AD 3WKJC 5B1MC 4DQYB 2Y2MA 5B2IB 4EO5C 1P3FB 5GT3A 3RELA 1KX4C 2NQBC 5B1LB 5JRGA 3EPLA 3AN2D 2Y2KA 5B32B 2IO5B 2NZDA 4G91B 3AZHD 2Y2OA 5E5AB 1TZYD 1PZRA 4HGAB 1P3IA 5AY8C 3AV1B 3AZLC 4YM6B 5B33C 4QLCB 3AN2B 5B40D 3MNND 5B31A 5AVBC 3LZ1D 3WKJD 5GXQA 1U35D 5B1MD 3C1CA 2YFWA 2Y2JA 4H9PB 1KX4D 2NQBD 3MGSA 4J8UC 1KX3C 5BO0B 1F1EA 5AV6D 4UUZB 3WTPC 3LZ1B 5B0ZD 1KX5C 3WKJB 1F66C 5B1MB 1P34A 3KXBA 5B0YC 3KWQA 5AY8D 3A6NA 3AZLD 2J8PA 5B33D 5AV5B 3AZNC 1P3AC 2NQBB 4Z5TC 2VQRA 2AROB 3P5JB 4Z2MG 5B1LA 5AVBD 3UTBD 1ZLAC 2FJ7B 4J8VC 2PYOB 2ZY3A 5AY8B 3TU4C 5E5AA 3AZLB 4J8UD 1KX3D 5BNXB 1S32B 5AVBB 3WTPD 3AN2A 1KX5D 3MGQC 3AZHA 1P3AD 1TZYA 5GT0C 5DNMB 1KX3B 3VH5T 3WTPB 3AZKB 5BO0A 5B40A 4J8VD 1F66B 3MNNA 4UUZA 3LZ1A 5B0YB 3WKJA 1U35A 5B1MA 5AV9C 3AZNB 3AZFC 4Z5TB 1KX4A 1P3OD 2NQBA 1ZLAB 3REID 3MGQD 1P3IC 4J8VB 4WJ3C 4E45A 5B0ZA 1Z2CB 3TU4B 3AZGC 3VH5A 5GT0D 4Z2MH 1JFIA 4G92B 5AY8A 3AZLA 5B33A 4R8PC 4NE5A 3WTPE 2JSSA 3MGQB 3AYWC 5BNXA 5AVBA 3UTBA 3O62C 2DF4C 2HUEC 5AV9D 3AZFD 1N1JA 5GT0B 1WWSA 1M18C 3LELB 5CP6B 4XZQB 3UT9C 4YS3B 2FFFB 4J8UA 1KX3A 2F8NK 5GT3B 3RELB 3W99C 3EG5B 3WTPA 5JRGB 1KX5A 3AZGD 3X1VC 1F66A 5AV9B 3AZFB 3NQUA 4CAYB 2ZY4A 4R8PD 1P3AA 2F8NG 4E44A 3X1SC 1B6WA 2BYMA 4UPKA 3AYWD 1P3IB 1EQZC 1WWIA 3O62D 4J8VA 3AZGB 3B6GC 5B31B 1M18D 3UT9D 4R8PB 2Y2IA 3C1CB 2YFWB 3AYWB 1P3OA 4LD9C 3W99D 1TZYC 3REIA 3MGQA 3MGSB 3AZMC 2HUEB 3X1VD 3B0CW 1M19C 1M18B 4AWLC 4CSRB 5GT0A 3X1SD 1P34B 4J8XD 1EQZD 2Y2GA 1U35C 3W99B 4JJNC 3RELD 3H0MC 2XD1A 3B6GD 5AV9A 3AZFA 1KU5A 4X23C 4CAYA 5AV6C 5B0ZC 4LD9D 3AZMD 2F8NH 4DRAA 2L5AA 1M19D 3WA9C 1P3LD 3EPHA 4ZUXD 3AZGA 5GSUC 3B0CT 3UTBC 3AZHB 4XUJD 4R8PA 4LD9B 3C1BC 1TZYB 4JJND 5DNNC 3AYWA 4KGCC 4H9OB 3UTAC 3O62A 1A7WA 2UWXA 3W98D 5B40B 3MNNB 4X23D 3AZIC 1M18A 4CSRA 3UT9A 1U35B 2Y2PA 4WU9C 4JJNB 4EO5B 3VH5W 1P3GD 1KX4B 3W99A 3WA9D 3X1VA 5GSUD 3AL0C 4X23B 5AV6B 5B0ZB 3X1SA 3C1BD 1JFIB 5CPJD 2Y2QA 5DNND 4KGCD 4J8XA 5CPKC 1EQZA 3MGRC 5B33B 3UTAD 4H9NA 3WAAD 4WU8C 5C3IC 3R45A 1P3OC 3B6GA 3AZID 3UTBB 5JA4A 3REIC 3B0DC 5B32G 1N1JB 4WU9D 5F99D 3IP4C 3C1BB 3W97C 5AVCC 4LD9A 3LJAC 3UTAB 4WZSB 1P3MC 4J8UB 3AZMA 4H9OA 1M19A 3AZIB 1KX5B 4ZUXA 2G5HC 3NQUB 3X1TC 5CPKD 4XUJA 3MGRD 4WNNA 3MVDC 1P3AB 4JJNA 2BYMB 1P3PC 4WU8D 1TAFA 2LY8A 3B6FC 1ID3C 3W98A 1HTAA 4H9QB 2YFVA 4X23A 3W97D 5AV6A 5AVCD 2HIOC 3AV2D 3LJAD 3AFAD 1P3MD 4WU8B 5C3IB 2JCHA 1P3GA 1P3OB 3NQJB 3WA9A 1B67A 5BT1C 3B0DB 5GSUA 3REIB 3A1KA 1W2EA 1BH9A 3X1TD 3W97B 2Y2LA 3MVDD 3C1BA 3LJAB 5CPJA 5DNNA 1P3PD 4KGCA 5G49A 3REJC 3UTAA 3B6FD 1ID3D 3X1UC 3AZIA 2HIOD 3MVDB 4WU9A 4H9RA 1P3KD 5F99A 1P3PB 1BFMA 4M6BA 4J8WD 1ID3B 5BT1D 2F2AC 4J8XC 1M1AD 3MGPC 4H9SC 2CV5C 2JE5A 4H9QA 2HIOB 3REKC 5B2JC 5CPKA 2ZM5A 3MGRA 3REJD 4NFTA 3B0BA 3X1UD 4WU8A 3NQJA 3O62B 5AV8C 5CPID 2W8SA 3W97A 5AVCA 4KUDD 5B32C 3REJB 4ZUXC 4DRBA 3UT9B 3LJAA 1P3LC 3AFAA 1P3MA 3MGPD 2CWEA 4XUJC 2CV5D 4NE3A 2XD5A 1P3BC 5BS7C 3REKD 3AV1C 5B2JD 2BYKB 4YM6C 2RVQC 3X1VB 3KUYD 3X1TA 3W98C 3W96D 3MVDA 3X1SB 5KDMA 1P3PA 4J8XB 3MGPB 2CV5B 1EQZB 3B6FA 3F6TA 4H9NB 5B2ID 1ID3A 5AV8D 1P3FD 4KHAA 3REKB 3R45B 1P3GC 3B6GB 1BH8B 5JA4B 5B32D 4Z66C 2HIOA 3V9RA 1P3KA 3AZEC 3H0RC 4J8WA 5B24C 1P3BD 5CPJC 5AV8B 3AZMB 3AV1D 1M1AA 4YM6D 2RVQD 5AV5C 4QLCD 1M19B 1AOIC 3WAAC 2AROC 1T3UA 1ULYA 4AWLB 1P3LB 4ZUXB 3KFUG 3VH6T 5B31G 4XUJB 3REJA 2FJ7C 2PYOC 4WNNB 5F99C 1P3BB 3X1UA 1TAFB 4Z66D 3REHC 3W98B 2BYKA 1S32C 5CPIA 3AZED 2YFVB 4KUDA 5B24D 3MGPA 4H9SA 2CV5A 5AV5D 1P3GB 1AOID 3LZ0C 2G5IC 3WA9B 2AROD 4Z66B 5DNMC 3VH6A 3REKA 5GSUB 5B2JA 5CHLB 3KUYA 3AZEB 1BH8A 1BH9B 3KSYA 3AZKC 1H3OB 3W96A 2FJ7D 2PYOD 5B24B 5BNVB 5CPJB 5DNNB 4KGCB 5G49B 3AV2C 1AOIB 1HQ3C 5B2IA 3WAAB 3AFAC 3REHD 5AV8A 1P3FA 1S32D 1Q9CA 5B32A 1P3LA 4ZBJC 4H9RB 4WU9B 5F99B 2F8ND 3LZ0D 3H0LC 1P3BA 4G92C 5BS7A 5DNMD 3REHB 3AV1A 4YM6A 4QLCA 3AZKD 3AZJC 1F66D 5B0YD 5CPKB 3EPKA 3FDDA 2F8NB 3MGRB 3AZND 4Z5TD 1HQ3D 3LZ0B 1P3KC 4H9PA 3LELC 5CP6C 4XZQC 4YS3C 4J8WC 1ZLAD 4Z66A 1M1AC 5GT3C 3RELC 3AZEA 5JRGC 2Y2NA 5AVCB 1H3OA 3TU4D 5B24A 2ZY5A 5BNVA 3AV2B 1HQ3B 3EPJA 2NZDC 3AFAB 1P3MB 5AV5A 1AOIA 3WAAA 3AZJD 2AROA 4ZBJB 3X1TB 2FJ7A 2PYOA 5CPIC 5KDMB 5B31C 3LELD 5CP6D 4XZQD 4KUDC 4YS3D 1R4VA 5GXQC 3B6FB 3C1CC 3AZJB 3REHA 1S32A 5GT3D 4KHAB 5FUGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRG D;  3MGS C;  4WV4 B;  4NE6 A;  3V9R B;  1P3K B;  2NZD D;  3KUY C;  2F8N A;  3W96 C;  4J8W B;  3LZ0 A;  1P34 C;  5DNM A;  3KXB C;  3KWQ C;  1P3I D;  1M1A B;  3A6N C;  3AZK A;  5B2I C;  1P3F C;  5B31 D;  5B0Y A;  5B1L C;  2NZD B;  5GXQ D;  3AZN A;  3AV2 A;  2IO5 C;  1HQ3 A;  4Z5T A;  3C1C D;  4G91 C;  3X1U B;  5E5A C;  1ZLA A;  4HGA C;  3MGS D;  5CPI B;  4QLC C;  3VH6 W;  3TU4 A;  3AN2 C;  4KUD B;  5GXQ B;  1P34 D;  3KXB D;  3KWQ D;  3AZH C;  3A6N D;  3AZJ A;  5FUG A;  5B2J B;  5B1L D;  3KUY B;  3W96 B;  5B40 C;  3MNN C;  3LEL A;  3KXB B;  5CP6 A;  3LZ1 C;  4XZQ A;  3KWQ B;  3A6N B;  4YS3 A;  5E5A D;  3WKJ C;  5B1M C;  5B2I B;  4EO5 C;  1P3F B;  5GT3 A;  3REL A;  1KX4 C;  2NQB C;  5B1L B;  5JRG A;  3AN2 D;  5B32 B;  2IO5 B;  2NZD A;  4G91 B;  3AZH D;  5E5A B;  1TZY D;  4HGA B;  1P3I A;  5AY8 C;  3AV1 B;  3AZL C;  4YM6 B;  5B33 C;  4QLC B;  3AN2 B;  5B40 D;  3MNN D;  5B31 A;  5AVB C;  3LZ1 D;  3WKJ D;  5GXQ A;  1U35 D;  5B1M D;  3C1C A;  2YFW A;  4H9P B;  1KX4 D;  2NQB D;  3MGS A;  4J8U C;  1KX3 C;  5BO0 B;  1F1E A;  5AV6 D;  4UUZ B;  3WTP C;  3LZ1 B;  5B0Z D;  1KX5 C;  3WKJ B;  1F66 C;  5B1M B;  1P34 A;  3KXB A;  5B0Y C;  3KWQ A;  5AY8 D;  3A6N A;  3AZL D;  5B33 D;  5AV5 B;  3AZN C;  1P3A C;  2NQB B;  4Z5T C;  2ARO B;  4Z2M G;  5B1L A;  5AVB D;  3UTB D;  1ZLA C;  2FJ7 B;  4J8V C;  2PYO B;  5AY8 B;  3TU4 C;  5E5A A;  3AZL B;  4J8U D;  1KX3 D;  5BNX B;  1S32 B;  5AVB B;  3WTP D;  3AN2 A;  1KX5 D;  3MGQ C;  3AZH A;  1P3A D;  1TZY A;  5GT0 C;  5DNM B;  1KX3 B;  3VH5 T;  3WTP B;  3AZK B;  5BO0 A;  5B40 A;  4J8V D;  1F66 B;  3MNN A;  4UUZ A;  3LZ1 A;  5B0Y B;  3WKJ A;  1U35 A;  5B1M A;  5AV9 C;  3AZN B;  3AZF C;  4Z5T B;  1KX4 A;  1P3O D;  2NQB A;  1ZLA B;  3REI D;  3MGQ D;  1P3I C;  4J8V B;  4E45 A;  5B0Z A;  3TU4 B;  3AZG C;  3VH5 A;  5GT0 D;  4Z2M H;  1JFI A;  4G92 B;  5AY8 A;  3AZL A;  5B33 A;  4R8P C;  4NE5 A;  3WTP E;  2JSS A;  3MGQ B;  3AYW C;  5BNX A;  5AVB A;  3UTB A;  3O62 C;  2HUE C;  5AV9 D;  3AZF D;  1N1J A;  5GT0 B;  1WWS A;  1M18 C;  3LEL B;  5CP6 B;  4XZQ B;  3UT9 C;  4YS3 B;  4J8U A;  1KX3 A;  2F8N K;  5GT3 B;  3REL B;  3W99 C;  3WTP A;  5JRG B;  1KX5 A;  3AZG D;  3X1V C;  1F66 A;  5AV9 B;  3AZF B;  3NQU A;  4CAY B;  4R8P D;  1P3A A;  2F8N G;  4E44 A;  3X1S C;  1B6W A;  2BYM A;  3AYW D;  1P3I B;  1EQZ C;  1WWI A;  3O62 D;  4J8V A;  3AZG B;  3B6G C;  5B31 B;  1M18 D;  3UT9 D;  4R8P B;  3C1C B;  2YFW B;  3AYW B;  1P3O A;  4LD9 C;  3W99 D;  1TZY C;  3REI A;  3MGQ A;  3MGS B;  3AZM C;  2HUE B;  3X1V D;  3B0C W;  1M19 C;  1M18 B;  4AWL C;  4CSR B;  5GT0 A;  3X1S D;  1P34 B;  4J8X D;  1EQZ D;  1U35 C;  3W99 B;  4JJN C;  3REL D;  3B6G D;  5AV9 A;  3AZF A;  1KU5 A;  4X23 C;  4CAY A;  5AV6 C;  5B0Z C;  4LD9 D;  3AZM D;  2F8N H;  4DRA A;  2L5A A;  1M19 D;  3WA9 C;  1P3L D;  4ZUX D;  3AZG A;  5GSU C;  3B0C T;  3UTB C;  3AZH B;  4XUJ D;  4R8P A;  4LD9 B;  3C1B C;  1TZY B;  4JJN D;  5DNN C;  3AYW A;  4KGC C;  4H9O B;  3UTA C;  3O62 A;  1A7W A;  3W98 D;  5B40 B;  3MNN B;  4X23 D;  3AZI C;  1M18 A;  4CSR A;  3UT9 A;  1U35 B;  4WU9 C;  4JJN B;  4EO5 B;  3VH5 W;  1P3G D;  1KX4 B;  3W99 A;  3WA9 D;  3X1V A;  5GSU D;  4X23 B;  5AV6 B;  5B0Z B;  3X1S A;  3C1B D;  1JFI B;  5CPJ D;  5DNN D;  4KGC D;  4J8X A;  5CPK C;  1EQZ A;  3MGR C;  5B33 B;  3UTA D;  4H9N A;  3WAA D;  4WU8 C;  5C3I C;  3R45 A;  1P3O C;  3B6G A;  3AZI D;  3UTB B;  5JA4 A;  3REI C;  3B0D C;  5B32 G;  1N1J B;  4WU9 D;  5F99 D;  3C1B B;  3W97 C;  5AVC C;  4LD9 A;  3LJA C;  3UTA B;  4WZS B;  1P3M C;  4J8U B;  3AZM A;  4H9O A;  1M19 A;  3AZI B;  1KX5 B;  4ZUX A;  3NQU B;  3X1T C;  5CPK D;  4XUJ A;  3MGR D;  4WNN A;  3MVD C;  1P3A B;  4JJN A;  2BYM B;  1P3P C;  4WU8 D;  1TAF A;  2LY8 A;  3B6F C;  1ID3 C;  3W98 A;  1HTA A;  4H9Q B;  2YFV A;  4X23 A;  3W97 D;  5AV6 A;  5AVC D;  2HIO C;  3AV2 D;  3LJA D;  3AFA D;  1P3M D;  4WU8 B;  5C3I B;  1P3G A;  1P3O B;  3NQJ B;  3WA9 A;  1B67 A;  5BT1 C;  3B0D B;  5GSU A;  3REI B;  1BH9 A;  3X1T D;  3W97 B;  3MVD D;  3C1B A;  3LJA B;  5CPJ A;  5DNN A;  1P3P D;  4KGC A;  5G49 A;  3REJ C;  3UTA A;  3B6F D;  1ID3 D;  3X1U C;  3AZI A;  2HIO D;  3MVD B;  4WU9 A;  4H9R A;  1P3K D;  5F99 A;  1P3P B;  1BFM A;  4M6B A;  4J8W D;  1ID3 B;  5BT1 D;  4J8X C;  1M1A D;  3MGP C;  4H9S C;  2CV5 C;  4H9Q A;  2HIO B;  3REK C;  5B2J C;  5CPK A;  3REJ D;  3MGR A;  4NFT A;  3B0B A;  3X1U D;  4WU8 A;  3NQJ A;  3O62 B;  5AV8 C;  5CPI D;  3W97 A;  5AVC A;  4KUD D;  5B32 C;  3REJ B;  4ZUX C;  4DRB A;  3UT9 B;  3LJA A;  1P3L C;  3AFA A;  1P3M A;  3MGP D;  2CWE A;  4XUJ C;  2CV5 D;  4NE3 A;  1P3B C;  5BS7 C;  3REK D;  3AV1 C;  5B2J D;  2BYK B;  4YM6 C;  2RVQ C;  3X1V B;  3KUY D;  3X1T A;  3W98 C;  3W96 D;  3MVD A;  3X1S B;  5KDM A;  1P3P A;  4J8X B;  3MGP B;  2CV5 B;  1EQZ B;  3B6F A;  5B2I D;  4H9N B;  1ID3 A;  5AV8 D;  1P3F D;  4KHA A;  3REK B;  3R45 B;  1P3G C;  3B6G B;  1BH8 B;  5JA4 B;  5B32 D;  4Z66 C;  2HIO A;  3V9R A;  1P3K A;  3AZE C;  4J8W A;  5B24 C;  1P3B D;  5CPJ C;  5AV8 B;  3AZM B;  3AV1 D;  1M1A A;  4YM6 D;  2RVQ D;  5AV5 C;  4QLC D;  1M19 B;  1AOI C;  3WAA C;  2ARO C;  1ULY A;  4AWL B;  1P3L B;  4ZUX B;  3VH6 T;  5B31 G;  4XUJ B;  3REJ A;  2FJ7 C;  2PYO C;  4WNN B;  5F99 C;  1P3B B;  3X1U A;  1TAF B;  4Z66 D;  3REH C;  3W98 B;  2BYK A;  1S32 C;  5CPI A;  3AZE D;  2YFV B;  4KUD A;  5B24 D;  3MGP A;  4H9S A;  2CV5 A;  5AV5 D;  1P3G B;  1AOI D;  3LZ0 C;  3WA9 B;  2ARO D;  4Z66 B;  5DNM C;  3VH6 A;  3REK A;  5GSU B;  5B2J A;  5CHL B;  3KUY A;  3AZE B;  1BH8 A;  1BH9 B;  3KSY A;  3AZK C;  1H3O B;  3W96 A;  2FJ7 D;  2PYO D;  5B24 B;  5BNV B;  5CPJ B;  5DNN B;  4KGC B;  5G49 B;  3AV2 C;  1AOI B;  1HQ3 C;  5B2I A;  3WAA B;  3AFA C;  3REH D;  5AV8 A;  1P3F A;  1S32 D;  1Q9C A;  5B32 A;  1P3L A;  4ZBJ C;  4H9R B;  4WU9 B;  5F99 B;  2F8N D;  3LZ0 D;  1P3B A;  4G92 C;  5BS7 A;  5DNM D;  3REH B;  3AV1 A;  4YM6 A;  4QLC A;  3AZK D;  3AZJ C;  1F66 D;  5B0Y D;  5CPK B;  2F8N B;  3MGR B;  3AZN D;  4Z5T D;  1HQ3 D;  3LZ0 B;  1P3K C;  4H9P A;  3LEL C;  5CP6 C;  4XZQ C;  4YS3 C;  4J8W C;  1ZLA D;  4Z66 A;  1M1A C;  5GT3 C;  3REL C;  3AZE A;  5JRG C;  5AVC B;  1H3O A;  3TU4 D;  5B24 A;  3AV2 B;  5BNV A;  1HQ3 B;  2NZD C;  3AFA B;  1P3M B;  5AV5 A;  1AOI A;  3WAA A;  3AZJ D;  2ARO A;  4ZBJ B;  3X1T B;  2FJ7 A;  2PYO A;  5CPI C;  5KDM B;  5B31 C;  3LEL D;  5CP6 D;  4XZQ D;  4KUD C;  4YS3 D;  1R4V A;  5GXQ C;  3B6F B;  3C1C C;  3AZJ B;  3REH A;  1S32 A;  5GT3 D;  4KHA B;  5FUG B; 
#chains in the Genus database with same CATH topology
 5JRG D;  3MGS C;  4WV4 B;  4NE6 A;  3V9R B;  1P3K B;  2NZD D;  3KUY C;  2F8N A;  3W96 C;  4J8W B;  3LZ0 A;  1P34 C;  5DNM A;  3KXB C;  3KWQ C;  1P3I D;  1M1A B;  3A6N C;  2DQN C;  3AZK A;  5B2I C;  1P3F C;  5B31 D;  5B0Y A;  5B1L C;  2NZD B;  5GXQ D;  3AZN A;  3AV2 A;  2IO5 C;  1HQ3 A;  4Z5T A;  3C1C D;  4G91 C;  3X1U B;  5E5A C;  1ZLA A;  4HGA C;  3MGS D;  2BG1 A;  5CPI B;  4QLC C;  3VH6 W;  3TU4 A;  3AN2 C;  4KUD B;  3A1I A;  5GXQ B;  1P34 D;  3KXB D;  3KWQ D;  3AZH C;  3A6N D;  2Y2H A;  3AZJ A;  2RIQ A;  5FUG A;  5B2J B;  5B1L D;  3KUY B;  3W96 B;  5B40 C;  3MNN C;  3LEL A;  2ZY2 A;  3KXB B;  5CP6 A;  3LZ1 C;  4XZQ A;  3KWQ B;  3A6N B;  4YS3 A;  5E5A D;  3WKJ C;  5B1M C;  4DQY B;  2Y2M A;  5B2I B;  4EO5 C;  1P3F B;  5GT3 A;  3REL A;  1KX4 C;  2NQB C;  5B1L B;  5JRG A;  3EPL A;  3AN2 D;  2Y2K A;  5B32 B;  2IO5 B;  2NZD A;  4G91 B;  3AZH D;  2Y2O A;  5E5A B;  1TZY D;  1PZR A;  4HGA B;  1P3I A;  5AY8 C;  3AV1 B;  3AZL C;  4YM6 B;  5B33 C;  4QLC B;  3AN2 B;  5B40 D;  3MNN D;  5B31 A;  5AVB C;  3LZ1 D;  3WKJ D;  5GXQ A;  1U35 D;  5B1M D;  3C1C A;  2YFW A;  2Y2J A;  4H9P B;  1KX4 D;  2NQB D;  3MGS A;  4J8U C;  1KX3 C;  5BO0 B;  1F1E A;  5AV6 D;  4UUZ B;  3WTP C;  3LZ1 B;  5B0Z D;  1KX5 C;  3WKJ B;  1F66 C;  5B1M B;  1P34 A;  3KXB A;  5B0Y C;  3KWQ A;  5AY8 D;  3A6N A;  3AZL D;  2J8P A;  5B33 D;  5AV5 B;  3AZN C;  1P3A C;  2NQB B;  4Z5T C;  2VQR A;  2ARO B;  3P5J B;  4Z2M G;  5B1L A;  5AVB D;  3UTB D;  1ZLA C;  2FJ7 B;  4J8V C;  2PYO B;  2ZY3 A;  5AY8 B;  3TU4 C;  5E5A A;  3AZL B;  4J8U D;  1KX3 D;  5BNX B;  1S32 B;  5AVB B;  3WTP D;  3AN2 A;  1KX5 D;  3MGQ C;  3AZH A;  1P3A D;  1TZY A;  5GT0 C;  5DNM B;  1KX3 B;  3VH5 T;  3WTP B;  3AZK B;  5BO0 A;  5B40 A;  4J8V D;  1F66 B;  3MNN A;  4UUZ A;  3LZ1 A;  5B0Y B;  3WKJ A;  1U35 A;  5B1M A;  5AV9 C;  3AZN B;  3AZF C;  4Z5T B;  1KX4 A;  1P3O D;  2NQB A;  1ZLA B;  3REI D;  3MGQ D;  1P3I C;  4J8V B;  4WJ3 C;  4E45 A;  5B0Z A;  1Z2C B;  3TU4 B;  3AZG C;  3VH5 A;  5GT0 D;  4Z2M H;  1JFI A;  4G92 B;  5AY8 A;  3AZL A;  5B33 A;  4R8P C;  4NE5 A;  3WTP E;  2JSS A;  3MGQ B;  3AYW C;  5BNX A;  5AVB A;  3UTB A;  3O62 C;  2DF4 C;  2HUE C;  5AV9 D;  3AZF D;  1N1J A;  5GT0 B;  1WWS A;  1M18 C;  3LEL B;  5CP6 B;  4XZQ B;  3UT9 C;  4YS3 B;  2FFF B;  4J8U A;  1KX3 A;  2F8N K;  5GT3 B;  3REL B;  3W99 C;  3EG5 B;  3WTP A;  5JRG B;  1KX5 A;  3AZG D;  3X1V C;  1F66 A;  5AV9 B;  3AZF B;  3NQU A;  4CAY B;  2ZY4 A;  4R8P D;  1P3A A;  2F8N G;  4E44 A;  3X1S C;  1B6W A;  2BYM A;  4UPK A;  3AYW D;  1P3I B;  1EQZ C;  1WWI A;  3O62 D;  4J8V A;  3AZG B;  3B6G C;  5B31 B;  1M18 D;  3UT9 D;  4R8P B;  2Y2I A;  3C1C B;  2YFW B;  3AYW B;  1P3O A;  4LD9 C;  3W99 D;  1TZY C;  3REI A;  3MGQ A;  3MGS B;  3AZM C;  2HUE B;  3X1V D;  3B0C W;  1M19 C;  1M18 B;  4AWL C;  4CSR B;  5GT0 A;  3X1S D;  1P34 B;  4J8X D;  1EQZ D;  2Y2G A;  1U35 C;  3W99 B;  4JJN C;  3REL D;  3H0M C;  2XD1 A;  3B6G D;  5AV9 A;  3AZF A;  1KU5 A;  4X23 C;  4CAY A;  5AV6 C;  5B0Z C;  4LD9 D;  3AZM D;  2F8N H;  4DRA A;  2L5A A;  1M19 D;  3WA9 C;  1P3L D;  3EPH A;  4ZUX D;  3AZG A;  5GSU C;  3B0C T;  3UTB C;  3AZH B;  4XUJ D;  4R8P A;  4LD9 B;  3C1B C;  1TZY B;  4JJN D;  5DNN C;  3AYW A;  4KGC C;  4H9O B;  3UTA C;  3O62 A;  1A7W A;  2UWX A;  3W98 D;  5B40 B;  3MNN B;  4X23 D;  3AZI C;  1M18 A;  4CSR A;  3UT9 A;  1U35 B;  2Y2P A;  4WU9 C;  4JJN B;  4EO5 B;  3VH5 W;  1P3G D;  1KX4 B;  3W99 A;  3WA9 D;  3X1V A;  5GSU D;  3AL0 C;  4X23 B;  5AV6 B;  5B0Z B;  3X1S A;  3C1B D;  1JFI B;  5CPJ D;  2Y2Q A;  5DNN D;  4KGC D;  4J8X A;  5CPK C;  1EQZ A;  3MGR C;  5B33 B;  3UTA D;  4H9N A;  3WAA D;  4WU8 C;  5C3I C;  3R45 A;  1P3O C;  3B6G A;  3AZI D;  3UTB B;  5JA4 A;  3REI C;  3B0D C;  5B32 G;  1N1J B;  4WU9 D;  5F99 D;  3IP4 C;  3C1B B;  3W97 C;  5AVC C;  4LD9 A;  3LJA C;  3UTA B;  4WZS B;  1P3M C;  4J8U B;  3AZM A;  4H9O A;  1M19 A;  3AZI B;  1KX5 B;  4ZUX A;  2G5H C;  3NQU B;  3X1T C;  5CPK D;  4XUJ A;  3MGR D;  4WNN A;  3MVD C;  1P3A B;  4JJN A;  2BYM B;  1P3P C;  4WU8 D;  1TAF A;  2LY8 A;  3B6F C;  1ID3 C;  3W98 A;  1HTA A;  4H9Q B;  2YFV A;  4X23 A;  3W97 D;  5AV6 A;  5AVC D;  2HIO C;  3AV2 D;  3LJA D;  3AFA D;  1P3M D;  4WU8 B;  5C3I B;  2JCH A;  1P3G A;  1P3O B;  3NQJ B;  3WA9 A;  1B67 A;  5BT1 C;  3B0D B;  5GSU A;  3REI B;  3A1K A;  1W2E A;  1BH9 A;  3X1T D;  3W97 B;  2Y2L A;  3MVD D;  3C1B A;  3LJA B;  5CPJ A;  5DNN A;  1P3P D;  4KGC A;  5G49 A;  3REJ C;  3UTA A;  3B6F D;  1ID3 D;  3X1U C;  3AZI A;  2HIO D;  3MVD B;  4WU9 A;  4H9R A;  1P3K D;  5F99 A;  1P3P B;  1BFM A;  4M6B A;  4J8W D;  1ID3 B;  5BT1 D;  2F2A C;  4J8X C;  1M1A D;  3MGP C;  4H9S C;  2CV5 C;  2JE5 A;  4H9Q A;  2HIO B;  3REK C;  5B2J C;  5CPK A;  2ZM5 A;  3MGR A;  3REJ D;  4NFT A;  3B0B A;  3X1U D;  4WU8 A;  3NQJ A;  3O62 B;  5AV8 C;  5CPI D;  2W8S A;  3W97 A;  5AVC A;  4KUD D;  5B32 C;  3REJ B;  4ZUX C;  4DRB A;  3UT9 B;  3LJA A;  1P3L C;  3AFA A;  1P3M A;  3MGP D;  2CWE A;  4XUJ C;  2CV5 D;  4NE3 A;  2XD5 A;  1P3B C;  5BS7 C;  3REK D;  3AV1 C;  5B2J D;  2BYK B;  4YM6 C;  2RVQ C;  3X1V B;  3KUY D;  3X1T A;  3W98 C;  3W96 D;  3MVD A;  3X1S B;  5KDM A;  1P3P A;  4J8X B;  3MGP B;  2CV5 B;  1EQZ B;  3B6F A;  3F6T A;  4H9N B;  5B2I D;  1ID3 A;  5AV8 D;  1P3F D;  4KHA A;  3REK B;  3R45 B;  1P3G C;  3B6G B;  1BH8 B;  5JA4 B;  5B32 D;  4Z66 C;  2HIO A;  3V9R A;  1P3K A;  3AZE C;  3H0R C;  4J8W A;  5B24 C;  1P3B D;  5CPJ C;  5AV8 B;  3AZM B;  3AV1 D;  1M1A A;  4YM6 D;  2RVQ D;  5AV5 C;  4QLC D;  1M19 B;  1AOI C;  3WAA C;  2ARO C;  1T3U A;  1ULY A;  4AWL B;  1P3L B;  4ZUX B;  3KFU G;  3VH6 T;  5B31 G;  4XUJ B;  3REJ A;  2FJ7 C;  2PYO C;  4WNN B;  5F99 C;  1P3B B;  3X1U A;  1TAF B;  4Z66 D;  3REH C;  3W98 B;  2BYK A;  1S32 C;  5CPI A;  3AZE D;  2YFV B;  4KUD A;  5B24 D;  3MGP A;  4H9S A;  2CV5 A;  5AV5 D;  1P3G B;  1AOI D;  3LZ0 C;  2G5I C;  3WA9 B;  2ARO D;  4Z66 B;  5DNM C;  3VH6 A;  3REK A;  5GSU B;  5B2J A;  5CHL B;  3KUY A;  3AZE B;  1BH8 A;  1BH9 B;  3KSY A;  3AZK C;  1H3O B;  3W96 A;  2FJ7 D;  2PYO D;  5B24 B;  5BNV B;  5CPJ B;  5DNN B;  4KGC B;  5G49 B;  3AV2 C;  1AOI B;  1HQ3 C;  5B2I A;  3WAA B;  3AFA C;  3REH D;  5AV8 A;  1P3F A;  1S32 D;  1Q9C A;  5B32 A;  1P3L A;  4ZBJ C;  4H9R B;  4WU9 B;  5F99 B;  2F8N D;  3LZ0 D;  3H0L C;  1P3B A;  4G92 C;  5BS7 A;  5DNM D;  3REH B;  3AV1 A;  4YM6 A;  4QLC A;  3AZK D;  3AZJ C;  1F66 D;  5B0Y D;  5CPK B;  3EPK A;  3FDD A;  2F8N B;  3MGR B;  3AZN D;  4Z5T D;  1HQ3 D;  3LZ0 B;  1P3K C;  4H9P A;  3LEL C;  5CP6 C;  4XZQ C;  4YS3 C;  4J8W C;  1ZLA D;  4Z66 A;  1M1A C;  5GT3 C;  3REL C;  3AZE A;  5JRG C;  2Y2N A;  5AVC B;  1H3O A;  3TU4 D;  5B24 A;  2ZY5 A;  5BNV A;  3AV2 B;  1HQ3 B;  3EPJ A;  2NZD C;  3AFA B;  1P3M B;  5AV5 A;  1AOI A;  3WAA A;  3AZJ D;  2ARO A;  4ZBJ B;  3X1T B;  2FJ7 A;  2PYO A;  5CPI C;  5KDM B;  5B31 C;  3LEL D;  5CP6 D;  4XZQ D;  4KUD C;  4YS3 D;  1R4V A;  5GXQ C;  3B6F B;  3C1C C;  3AZJ B;  3REH A;  1S32 A;  5GT3 D;  4KHA B;  5FUG B; 
#chains in the Genus database with same CATH homology
 5JRG D;  3MGS C;  4WV4 B;  4NE6 A;  3V9R B;  1P3K B;  2NZD D;  3KUY C;  2F8N A;  3W96 C;  4J8W B;  3LZ0 A;  1P34 C;  5DNM A;  3KXB C;  3KWQ C;  1P3I D;  1M1A B;  3A6N C;  2DQN C;  3AZK A;  5B2I C;  1P3F C;  5B31 D;  5B0Y A;  5B1L C;  2NZD B;  5GXQ D;  3AZN A;  3AV2 A;  2IO5 C;  1HQ3 A;  4Z5T A;  3C1C D;  4G91 C;  3X1U B;  5E5A C;  1ZLA A;  4HGA C;  3MGS D;  2BG1 A;  5CPI B;  4QLC C;  3VH6 W;  3TU4 A;  3AN2 C;  4KUD B;  3A1I A;  5GXQ B;  1P34 D;  3KXB D;  3KWQ D;  3AZH C;  3A6N D;  2Y2H A;  3AZJ A;  2RIQ A;  5FUG A;  5B2J B;  5B1L D;  3KUY B;  3W96 B;  5B40 C;  3MNN C;  3LEL A;  2ZY2 A;  3KXB B;  5CP6 A;  3LZ1 C;  4XZQ A;  3KWQ B;  3A6N B;  4YS3 A;  5E5A D;  3WKJ C;  5B1M C;  4DQY B;  2Y2M A;  5B2I B;  4EO5 C;  1P3F B;  5GT3 A;  3REL A;  1KX4 C;  2NQB C;  5B1L B;  5JRG A;  3EPL A;  3AN2 D;  2Y2K A;  5B32 B;  2IO5 B;  2NZD A;  4G91 B;  3AZH D;  2Y2O A;  5E5A B;  1TZY D;  1PZR A;  4HGA B;  1P3I A;  5AY8 C;  3AV1 B;  3AZL C;  4YM6 B;  5B33 C;  4QLC B;  3AN2 B;  5B40 D;  3MNN D;  5B31 A;  5AVB C;  3LZ1 D;  3WKJ D;  5GXQ A;  1U35 D;  5B1M D;  3C1C A;  2YFW A;  2Y2J A;  4H9P B;  1KX4 D;  2NQB D;  3MGS A;  4J8U C;  1KX3 C;  5BO0 B;  1F1E A;  5AV6 D;  4UUZ B;  3WTP C;  3LZ1 B;  5B0Z D;  1KX5 C;  3WKJ B;  1F66 C;  5B1M B;  1P34 A;  3KXB A;  5B0Y C;  3KWQ A;  5AY8 D;  3A6N A;  3AZL D;  2J8P A;  5B33 D;  5AV5 B;  3AZN C;  1P3A C;  2NQB B;  4Z5T C;  2VQR A;  2ARO B;  3P5J B;  4Z2M G;  5B1L A;  5AVB D;  3UTB D;  1ZLA C;  2FJ7 B;  4J8V C;  2PYO B;  2ZY3 A;  5AY8 B;  3TU4 C;  5E5A A;  3AZL B;  4J8U D;  1KX3 D;  5BNX B;  1S32 B;  5AVB B;  3WTP D;  3AN2 A;  1KX5 D;  3MGQ C;  3AZH A;  1P3A D;  1TZY A;  5GT0 C;  5DNM B;  1KX3 B;  3VH5 T;  3WTP B;  3AZK B;  5BO0 A;  5B40 A;  4J8V D;  1F66 B;  3MNN A;  4UUZ A;  3LZ1 A;  5B0Y B;  3WKJ A;  1U35 A;  5B1M A;  5AV9 C;  3AZN B;  3AZF C;  4Z5T B;  1KX4 A;  1P3O D;  2NQB A;  1ZLA B;  3REI D;  3MGQ D;  1P3I C;  4J8V B;  4WJ3 C;  4E45 A;  5B0Z A;  1Z2C B;  3TU4 B;  3AZG C;  3VH5 A;  5GT0 D;  4Z2M H;  1JFI A;  4G92 B;  5AY8 A;  3AZL A;  5B33 A;  4R8P C;  4NE5 A;  3WTP E;  2JSS A;  3MGQ B;  3AYW C;  5BNX A;  5AVB A;  3UTB A;  3O62 C;  2DF4 C;  2HUE C;  5AV9 D;  3AZF D;  1N1J A;  5GT0 B;  1WWS A;  1M18 C;  3LEL B;  5CP6 B;  4XZQ B;  3UT9 C;  4YS3 B;  2FFF B;  4J8U A;  1KX3 A;  2F8N K;  5GT3 B;  3REL B;  3W99 C;  3EG5 B;  3WTP A;  5JRG B;  1KX5 A;  3AZG D;  3X1V C;  1F66 A;  5AV9 B;  3AZF B;  3NQU A;  4CAY B;  2ZY4 A;  4R8P D;  1P3A A;  2F8N G;  4E44 A;  3X1S C;  1B6W A;  2BYM A;  4UPK A;  3AYW D;  1P3I B;  1EQZ C;  1WWI A;  3O62 D;  4J8V A;  3AZG B;  3B6G C;  5B31 B;  1M18 D;  3UT9 D;  4R8P B;  2Y2I A;  3C1C B;  2YFW B;  3AYW B;  1P3O A;  4LD9 C;  3W99 D;  1TZY C;  3REI A;  3MGQ A;  3MGS B;  3AZM C;  2HUE B;  3X1V D;  3B0C W;  1M19 C;  1M18 B;  4AWL C;  4CSR B;  5GT0 A;  3X1S D;  1P34 B;  4J8X D;  1EQZ D;  2Y2G A;  1U35 C;  3W99 B;  4JJN C;  3REL D;  3H0M C;  2XD1 A;  3B6G D;  5AV9 A;  3AZF A;  1KU5 A;  4X23 C;  4CAY A;  5AV6 C;  5B0Z C;  4LD9 D;  3AZM D;  2F8N H;  4DRA A;  2L5A A;  1M19 D;  3WA9 C;  1P3L D;  3EPH A;  4ZUX D;  3AZG A;  5GSU C;  3B0C T;  3UTB C;  3AZH B;  4XUJ D;  4R8P A;  4LD9 B;  3C1B C;  1TZY B;  4JJN D;  5DNN C;  3AYW A;  4KGC C;  4H9O B;  3UTA C;  3O62 A;  1A7W A;  2UWX A;  3W98 D;  5B40 B;  3MNN B;  4X23 D;  3AZI C;  1M18 A;  4CSR A;  3UT9 A;  1U35 B;  2Y2P A;  4WU9 C;  4JJN B;  4EO5 B;  3VH5 W;  1P3G D;  1KX4 B;  3W99 A;  3WA9 D;  3X1V A;  5GSU D;  3AL0 C;  4X23 B;  5AV6 B;  5B0Z B;  3X1S A;  3C1B D;  1JFI B;  5CPJ D;  2Y2Q A;  5DNN D;  4KGC D;  4J8X A;  5CPK C;  1EQZ A;  3MGR C;  5B33 B;  3UTA D;  4H9N A;  3WAA D;  4WU8 C;  5C3I C;  3R45 A;  1P3O C;  3B6G A;  3AZI D;  3UTB B;  5JA4 A;  3REI C;  3B0D C;  5B32 G;  1N1J B;  4WU9 D;  5F99 D;  3IP4 C;  3C1B B;  3W97 C;  5AVC C;  4LD9 A;  3LJA C;  3UTA B;  4WZS B;  1P3M C;  4J8U B;  3AZM A;  4H9O A;  1M19 A;  3AZI B;  1KX5 B;  4ZUX A;  2G5H C;  3NQU B;  3X1T C;  5CPK D;  4XUJ A;  3MGR D;  4WNN A;  3MVD C;  1P3A B;  4JJN A;  2BYM B;  1P3P C;  4WU8 D;  1TAF A;  2LY8 A;  3B6F C;  1ID3 C;  3W98 A;  1HTA A;  4H9Q B;  2YFV A;  4X23 A;  3W97 D;  5AV6 A;  5AVC D;  2HIO C;  3AV2 D;  3LJA D;  3AFA D;  1P3M D;  4WU8 B;  5C3I B;  2JCH A;  1P3G A;  1P3O B;  3NQJ B;  3WA9 A;  1B67 A;  5BT1 C;  3B0D B;  5GSU A;  3REI B;  3A1K A;  1W2E A;  1BH9 A;  3X1T D;  3W97 B;  2Y2L A;  3MVD D;  3C1B A;  3LJA B;  5CPJ A;  5DNN A;  1P3P D;  4KGC A;  5G49 A;  3REJ C;  3UTA A;  3B6F D;  1ID3 D;  3X1U C;  3AZI A;  2HIO D;  3MVD B;  4WU9 A;  4H9R A;  1P3K D;  5F99 A;  1P3P B;  1BFM A;  4M6B A;  4J8W D;  1ID3 B;  5BT1 D;  2F2A C;  4J8X C;  1M1A D;  3MGP C;  4H9S C;  2CV5 C;  2JE5 A;  4H9Q A;  2HIO B;  3REK C;  5B2J C;  5CPK A;  2ZM5 A;  3MGR A;  3REJ D;  4NFT A;  3B0B A;  3X1U D;  4WU8 A;  3NQJ A;  3O62 B;  5AV8 C;  5CPI D;  2W8S A;  3W97 A;  5AVC A;  4KUD D;  5B32 C;  3REJ B;  4ZUX C;  4DRB A;  3UT9 B;  3LJA A;  1P3L C;  3AFA A;  1P3M A;  3MGP D;  2CWE A;  4XUJ C;  2CV5 D;  4NE3 A;  2XD5 A;  1P3B C;  5BS7 C;  3REK D;  3AV1 C;  5B2J D;  2BYK B;  4YM6 C;  2RVQ C;  3X1V B;  3KUY D;  3X1T A;  3W98 C;  3W96 D;  3MVD A;  3X1S B;  5KDM A;  1P3P A;  4J8X B;  3MGP B;  2CV5 B;  1EQZ B;  3B6F A;  3F6T A;  4H9N B;  5B2I D;  1ID3 A;  5AV8 D;  1P3F D;  4KHA A;  3REK B;  3R45 B;  1P3G C;  3B6G B;  1BH8 B;  5JA4 B;  5B32 D;  4Z66 C;  2HIO A;  3V9R A;  1P3K A;  3AZE C;  3H0R C;  4J8W A;  5B24 C;  1P3B D;  5CPJ C;  5AV8 B;  3AZM B;  3AV1 D;  1M1A A;  4YM6 D;  2RVQ D;  5AV5 C;  4QLC D;  1M19 B;  1AOI C;  3WAA C;  2ARO C;  1T3U A;  1ULY A;  4AWL B;  1P3L B;  4ZUX B;  3KFU G;  3VH6 T;  5B31 G;  4XUJ B;  3REJ A;  2FJ7 C;  2PYO C;  4WNN B;  5F99 C;  1P3B B;  3X1U A;  1TAF B;  4Z66 D;  3REH C;  3W98 B;  2BYK A;  1S32 C;  5CPI A;  3AZE D;  2YFV B;  4KUD A;  5B24 D;  3MGP A;  4H9S A;  2CV5 A;  5AV5 D;  1P3G B;  1AOI D;  3LZ0 C;  2G5I C;  3WA9 B;  2ARO D;  4Z66 B;  5DNM C;  3VH6 A;  3REK A;  5GSU B;  5B2J A;  5CHL B;  3KUY A;  3AZE B;  1BH8 A;  1BH9 B;  3KSY A;  3AZK C;  1H3O B;  3W96 A;  2FJ7 D;  2PYO D;  5B24 B;  5BNV B;  5CPJ B;  5DNN B;  4KGC B;  5G49 B;  3AV2 C;  1AOI B;  1HQ3 C;  5B2I A;  3WAA B;  3AFA C;  3REH D;  5AV8 A;  1P3F A;  1S32 D;  1Q9C A;  5B32 A;  1P3L A;  4ZBJ C;  4H9R B;  4WU9 B;  5F99 B;  2F8N D;  3LZ0 D;  3H0L C;  1P3B A;  4G92 C;  5BS7 A;  5DNM D;  3REH B;  3AV1 A;  4YM6 A;  4QLC A;  3AZK D;  3AZJ C;  1F66 D;  5B0Y D;  5CPK B;  3EPK A;  3FDD A;  2F8N B;  3MGR B;  3AZN D;  4Z5T D;  1HQ3 D;  3LZ0 B;  1P3K C;  4H9P A;  3LEL C;  5CP6 C;  4XZQ C;  4YS3 C;  4J8W C;  1ZLA D;  4Z66 A;  1M1A C;  5GT3 C;  3REL C;  3AZE A;  5JRG C;  2Y2N A;  5AVC B;  1H3O A;  3TU4 D;  5B24 A;  2ZY5 A;  5BNV A;  3AV2 B;  1HQ3 B;  3EPJ A;  2NZD C;  3AFA B;  1P3M B;  5AV5 A;  1AOI A;  3WAA A;  3AZJ D;  2ARO A;  4ZBJ B;  3X1T B;  2FJ7 A;  2PYO A;  5CPI C;  5KDM B;  5B31 C;  3LEL D;  5CP6 D;  4XZQ D;  4KUD C;  4YS3 D;  1R4V A;  5GXQ C;  3B6F B;  3C1C C;  3AZJ B;  3REH A;  1S32 A;  5GT3 D;  4KHA B;  5FUG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...