1U0JA

Crystal structure of aav2 rep40-adp complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
267
structure length
261
Chain Sequence
GMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of adeno-associated virus type 2 Rep40-ADP complex: Insight into nucleotide recognition and catalysis by superfamily 3 helicases
pubmed doi rcsb
source organism Adeno-associated virus - 2
molecule tags Replication
molecule keywords DNA replication protein
total genus 83
structure length 261
sequence length 267
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.950 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1u0jA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0jA02
5BWMA 4HB3A 3SS8A 1GKUB 3P26A 1ZUIA 1NI3A 1NP6A 1SHZA 4KSBA 2F55A 2ZI9A 3KKMA 2JIZA 1E9FA 4DRZA 2BMFA 3VKHA 3OE7D 2GF9A 4YXWA 5JSZA 4DUGA 2IA5A 1N0VC 3LLMA 5AWFC 3KQNA 1VG0B 1SXJD 1X3SA 3F8TA 5KOYA 1WRBA 1NNEA 2CEAA 1NMZA 4Q48A 2X1VA 3RABA 4B3XA 3T1OA 1NIJA 1XTQA 2IL1A 2REXB 5KNBA 3CX7A 2WJGA 5D3QA 1LF5A 4EJSC 4B74A 2JCSA 3EIEA 4LWZA 2XZOA 5G53C 3HWSA 1IHUA 4A8JC 5KSOA 1OH6A 1GFIA 1QHIA 1KTVA 1AQUA 2LKCA 3EG5A 1S0UA 4UXIA 3EWAA 4LBZA 2ZJZA 3EPKA 1KJZA 1GRQA 1II8A 1JB1A 4M1OA 3KFXA 4D4MA 5H8WA 3K0EA 1ODFA 2YOFA 3ZH9B 3VR4A 1E9BA 3QKUA 2KSQA 2ZE8A 2ODNA 3I3SR 2JJ2A 4KYIB 4BE7B 5HKKD 2JLVA 1NIPA 4EIWA 2BEKA 2A5GA 1CS4C 2PEYA 1E9DA 1G8HA 4JLMA 3CRMA 1D8TA 1W0JD 3VR1A 1DBSA 3FB4A 3KFVA 1KI6A 1EESA 3ADDA 1W0JA 3O8DA 5FOUA 4AK9A 5IRCD 1UKYA 3CPHA 3GLGB 4DLVA 2XEXA 4XWKA 3PUYA 3CX8A 4NDZA 2KB0A 2F3RA 4FCVA 3GLIA 1LS6A 4HZUA 1WE2A 4KYUA 3HJNA 1UKZA 3A1UA 1NVXQ 3AH8A 4GP7A 4XWAA 1CR4A 1KSFX 1HQCA 3TAHA 1YZQA 1D9ZA 2AFIE 2Z4SA 4KXFB 4TWZA 2O8DA 2ZR9A 3FYHA 3SJBA 1ZP6A 2G0NA 1OYYA 4QNMA 3PUZA 1D2EA 3FGNA 3SZRA 2JLYA 2YWEA 4D81A 3IHWA 2D7CA 1Z6YA 1VG9B 4GNKA 5FUVA 4RSGA 2QAGA 2PBRA 4LSGA 4Q47A 1KOFA 2QI9C 5JCPA 2OBNA 1TF7A 4OQMA 1XD2A 3LBIA 1E69A 1OXXK 4OHWA 5EUMA 5CB6A 3REFA 3ZVRA 2HXYA 1NVUQ 1F60A 1T8UA 2H92A 2HCJB 521PA 4BEBA 3SOPA 5L3SA 2F43B 2HDNB 1Q44A 3NC0C 4H1UA 1ZVQA 2GCOB 4HAVA 4N0DA 2CL6X 3P32A 4E09A 1RE0A 3CPJB 4NU0A 1P61B 5AK0A 5JWOA 2Q9CA 1AKEA 4ZDIA 1YKSA 1KK2A 4DBLC 1MT0A 4FCWA 1YR7A 4QGAA 3CF0A 3KXIA 1Z8FA 1SXJC 5KSPA 1SVLA 2BBSA 4HAYA 4QBGB 2WWWA 5DH9A 2GJKA 4B3FX 4F4JA 3EPLA 5JJIA 4CDGA 3BJIC 2J5XA 1JECA 1US8A 2J0UA 4HUTA 1Q21A 3B1WA 2DB3A 2VP9A 1SVMA 3WNBA 2CL0X 3VU9A 1FP7A 5JEDA 3K8YA 2ZVPX 3CX6A 4P32A 3AVWA 3QKSA 3HR7A 3M1IA 5G3YA 5TB5A 4DEXA 4JLBA 1V5WA 4B76A 621PA 5HZKA 1M34E 4Q9LA 1S4QA 2QZ4A 1QHNA 4GT1A 4D2IA 5K8LA 1OXTA 3TUIC 1LVGA 4DLYA 2QM8A 4R7ZA 1H65A 2ZSAA 1G7TA 3LVQE 3GJXC 2P2LA 1XEXA 721PA 3HU1A 2EW1A 1C9KA 4RKFA 3L0OA 4C0JA 2H57A 4OQXA 4Z1MD 2CVHA 3KQKA 4TL6A 1BS1A 4BRWA 4WZAE 3AKDA 2IEYA 1QHXA 4LHVA 2R6DA 3TE6A 4BWYA 3FOZA 2JJ1A 2IYLD 1GKYA 4KBFA 3CPEA 1NRJB 3FMOB 4BZXA 1HA3A 1Z07A 1RRGA 1CEEA 1NKSA 1H8HA 1E9CA 5JSZB 1WBDA 2VL7A 3B8HA 1IY1A 1E4YA 3MMPA 5FOVA 1E9AA 3F0TA 2W6ID 4V03A 2X19A 2QBYA 4FIDA 4C0QC 5JECA 4GI7A 3K9HA 4W7SA 3UKDA 1HTWA 3OEHA 4G5QA 4OK6A 5GJWC 3GJ5A 4KU4A 1ZIPA 4MYCA 4D6PA 3B1ZA 2ZU0C 1KO5A 4FXPA 4AI6A 2ORIA 1YZNA 3CLVA 4EFMA 3KDSE 1D2NA 2QRNA 2WZQA 1GL6A 3UXMA 4M22A 4O2LA 4ZO4A 3I1FA 2WOJA 2ZITA 4JBXA 1QHSA 4ARZB 4LYAA 5HE9A 2GHIA 4PO9A 4OI4A 1T0JB 4U5XA 2B7BA 2GA8A 4MKGA 1J8YF 1LW7A 3U6KA 3OHMA 2W2VA 3NBFA 4MDFA 3TSOA 4R2IA 1OW3B 1PLJA 3IIKA 4P33A 4U02A 1W1WA 2O5VA 4Q4JB 1GNPA 4Q4JA 4XSGA 3C5HA 1E2NA 4QXAA 1NLZA 1OIWA 4V0KA 1WA5A 1CP2A 1NSFA 2AR7A 3AP2A 3MWYW 2GEUA 5AUPB 1K5GA 1Z6GA 4N3NA 4KI0A 4HB0A 2FGJA 1UM8A 4PAQA 2RCNA 2QE7D 5KTYA 1JR3D 2AHOA 3B1XA 4FMDB 2AXPA 2WAXA 3PVSA 3D8BA 4NH0A 5K8TA 3RRNA 1VYTA 4TLCA 1OFTA 1MABB 1R0WA 1YVDA 4EJSB 4OKSA 4OBEA 2O8FA 1OHHA 1R0YA 1KK0A 1G1MA 4TMKA 1BYIA 3TKLA 1T3HA 1XEFA 1XTIA 1QDEA 2FH5B 1GRRA 4GOJA 3RNLA 1GRNA 3AVYA 3LRPA 3IDQA 2F1RA 1ZYUA 2FA9A 1P72A 2WIAA 1BO6A 5EP2A 4POAA 5JI2E 4AD8A 2ZROA 1X1RA 2YOGA 4B32A 2ZJAA 4PC7A 2QNRA 2F43A 1JQLB 2E1RA 4Z54A 1G3RA 4Q02A 4IVRA 4KBGA 3NXSA 3A8TA 1CJTC 4A4DA 2NMVA 1EGAA 2FJUA 2ZS7A 2IEZA 4Q1AA 2AL7A 2QP3A 4R2HA 3K0AB 1IAQA 2VEDA 1U94A 2IW3A 2WKQA 3EZ7A 2QMOA 4US0R 3TGPA 1N6PA 4UKDA 3ICQB 3FKQA 1T5IA 5IDVA 3D31A 1P75A 1WF3A 4YDSA 4EPXA 4OHZA 2JASA 1I4DD 1N2CE 1FUKA 2ORWA 3VTKA 4E07A 3PR1A 2ZRBA 4A0RA 1OXSC 3CH4B 4BECA 1KGDA 4TZ6A 2LCFA 4X8HA 3U7FB 2CHGA 1P2SA 1RRFA 2CMKA 5EXTA 2CCGA 2R62A 2NO0A 3C5CA 4TMXA 1OFUX 1WCV1 4JLAA 1GIAA 3GMTA 5FBVB 3ZZUA 1NBME 2ANCA 4AWXA 5DN6A 4LV5B 2B21A 4JMPA 3R9IA 3LQQA 5EP3A 3KJEA 1G291 1II8B 2R44A 4TLAA 1UBCA 3GFOA 1G5PA 3N2EA 3PUWA 4ACAA 1MO4A 3B82A 5EJEA 4LYFA 3PITA 3T35A 1N6KA 3WY9A 2ZXUA 5CK4A 3DL0A 5LPNA 1XCMA 4RZ3A 3K70C 1T6NA 3K0FA 2D7DA 1GILA 1EX7A 2QMHA 2XX3A 4TYQA 4D82A 3U4QB 2ZM5A 2V54A 4NYIR 4CF7A 2WKPA 4IXNA 5JWHA 4ESHA 4MRRA 4BLSA 2OCYC 3GEEA 4Q1BA 3S1AA 4LJ8A 4GFDA 1VMAA 4AKHA 1ZC4A 2A5YB 2W6JD 1JXMA 2RAPA 4DVGA 3UWOA 5FOTA 1P7CA 1SVKA 1JJVA 2X2FA 2XNDA 5CM8B 2H7VA 3WP0A 4LC0A 3KUDA 3KQHA 2YWHA 2D3WA 1KDPA 2HCBA 4M1TA 3SJCA 3VAAA 2OFWA 1FFHA 3X2SA 3GJ8A 1CR0A 1COWA 1M7GA 2PLRA 5TY0A 2GBLC 2J1LA 2GVZC 2OBLA 2ZRGA 2GZHA 4TTRA 3DOEA 4RD2A 3OIWA 2W0MA 4TSFD 4DCNA 3LFUA 4M9SA 4H1VA 2I3BA 2C8VA 2OXRA 2WWXA 1YR8A 2XZPA 3LBHA 4I1UA 2VHUA 3R8CA 3IEUA 4URXR 2BDTA 1ZIOA 4PC1A 3LO5A 1NN3A 5L3VA 1AN0A 1NN1A 2ZVQX 5C1BA 2ZIAA 3B6EA 3NVAA 3RVBA 4A8JB 5C18A 1J99A 3U3JA 1SVWA 1ZCBA 2OXCA 2PH1A 4MITA 2ZAMA 2FGKA 4DWJA 4G01B 1WP9A 3ZQ6A 2Q3FA 3T1QA 4MDEA 2GJ9A 3SN6A 3A1SA 2VIIA 2IWRA 4UXJA 3T15A 3SU8A 4GDFA 2XOKD 4MKIA 2BKUA 2ORVA 2PX3A 4TL9A 2IYWA 3O8BA 1KKMA 2IYUA 2KJQA 2VRWA 2G1JA 4C0AC 3O8CA 2H1LA 1KI2A 4L15A 3CRRA 1Q22A 3QG1A 5D3MB 3WMGA 2RHDA 4C0SA 5KSZA 1Q1BA 5BYJA 2JDIA 3FHTA 2EFHB 2ZE5A 3UG7A 3CONA 1EWQA 2Z5FA 4QRHA 4A6PA 1OB5A 4BRUA 1UBFA 2OCAA 3T1VA 4ARZA 4XJXA 2EFGA 2YHSA 2WJYA 4JSYA 3AEZA 4GRAA 3RS2A 2YKGA 2QAGC 5CITA 1SGWA 3THYA 2DFLA 1MKYA 4KO8A 3QKRB 1RYHA 3QVVA 3QBTA 1S2MA 3SQXA 1ANKA 1II9A 3MD0A 1B23P 4LHZA 2CNWD 1XCGB 2P6UA 4B44A 1EXMA 4F91B 3OZXA 4RD6A 1QF9A 4RZ2A 3VR6A 1AJEA 1LY1A 4NTZA 3BXZA 2D2FA 3QEJA 4BLPA 2RGXA 4B6EA 2RH5A 2G9NA 2BJVA 2YOHA 4OHVA 4JKIA 3PENA 4ZIRA 2O0KA 3GLHE 1TEVA 3NIBA 3SEAA 2V1XA 2VSXA 1I2MA 2CLCX 3SQWA 3NC1C 3CWQA 3AVPA 1OB2A 4EFLA 5TVKA 1DO0A 4R9UC 2PZGA 3U3MA 4H9GA 2Q6TA 2HLDA 2ONJA 2VLIA 4OI0A 1S8FA 1IM2A 4NYJR 3RWOA 4DT1B 1DEKA 4IEEA 3WYGA 2REOA 1FNNA 1MV5A 2QPAA 1TAGA 3HPRA 1XTSA 1IY2A 4C7OA 4ZI3A 4Q7MB 2UKDA 1FQKA 5KNCA 3U44A 1E4VA 3A1TA 1FPMA 1MRNA 3UWKA 1XDBA 3MUFA 2CVFA 1LTQA 3TQCA 3DM5A 5CDFE 2J3EA 1E79A 1AIPA 1EFRA 4RD3A 4Q00A 4B2PA 5KU1A 3CF2A 1D9XA 4Q1CA 5J4LA 1ZAKA 1ZM7A 2RGDA 3FKSD 3QF7A 2P5SA 3WRXC 1YRBA 3IUYA 4LOAA 3DHWC 1ZNWA 1NLYA 3TW4A 4D80A 3KQUA 3AQ4A 4DUGD 4ZI2A 4KAXA 2WSMA 5DYGA 3BBPA 1NVVR 3KX2A 1R0XA 1COWD 4IW3B 3P1JA 2ATVA 5SZHB 2OLJA 2QGZA 3C8UA 1RRPA 1M7BA 3FKSA 4KITB 3LBNA 4HB2A 3BE4A 2IWHA 4DJTA 3K9NA 2PL3A 1OIVA 5FI0B 4US1R 1PJRA 2XSZA 2D06A 4GOKA 4GMXA 2J0QA 3G82C 3CB4A 3WXMA 2RGBA 2JJ8A 3GLIE 3AGPA 3TLXA 4QHYA 3AVXA 5D3MA 4DZZA 1ZNZA 1G7RA 3QSYA 5H1YA 5F3WB 1CJMA 3C16C 4IKEA 4DSNA 4I4LA 1XD2B 2NQ2C 4LDJA 2FWRA 2A3RA 1N0WA 5IK2D 3SI7A 2OCBA 1U0JA 5HKKA 4A15A 4PPQA 3VFDA 5CJ2A 3UATA 1UJ2A 2G88A 3RS0A 3B9PA 1MH1A 3QNUA 3L8ZA 4IOJA 3TK1A 3U6BA 5AJXA 2WWIA 3LWNA 2ZRJA 3W8RA 1MO3A 1BMFA 3CR8A 2GNOA 3D6TB 1ZCAA 2RGEA 3NH6A 2AKYA 3FDIA 4WXPA 3WYAA 4QBIA 3BB1A 4BEJA 5EUQB 1PZNA 5CB8A 8OHMA 1YU9A 4NPHA 4DLSA 4WOPA 1XXHA 1O3YA 2R6CA 2SHKA 3CF6R 4M8NE 4OJKA 2D2EA 4QGGA 3VKWA 4M4SA 1NY5A 4LJ7A 2IS2A 3GFTA 4QJ4A 3CZQA 5DI9A 2WICA 3EZ2A 3QXSA 5JMTA 3B13B 4OJQA 1N6HA 2WWHA 2A5JA 3H4MA 3LX5A 3P20A 4LV8B 4QHTA 4F38A 5LD2B 6Q21A 5KUTA 2K5UA 4EPWA 1SXJB 2G3YA 2GF0A 2WMNB 3MGCA 1MOZA 1N0UA 1G7SA 1EFTA 4V0NA 3QKSB 1GNRA 1F2UA 2RGCA 4IRUB 4EQ6B 4C2TA 2FPMA 4PX9A 3V4RA 1LV7A 5EXXA 2ZI6A 2NO9A 1NG1A 2BCGY 2BM1A 1DTSA 3M6AA 4HSEA 5FBLB 4G3XA 4LJ4A 4EPTA 3U7GA 5EZ5A 4I1OA 4YQFA 1KO4A 4NKRA 1NF3A 4D0GA 3OESA 5BN3A 1XEWX 1YR6A 2CBZA 1R6BX 3AF4A 4A1FA 2GJSA 4JLDA 3MCAA 3SFZA 4D0NA 2ZE7A 4L5BA 4Q5IA 1Q20A 1JXOA 2GAOA 3U5ZB 3SNHA 5TXGA 2JLQA 3E5HA 3DMNA 3QPWA 4A2QA 4AY2A 3K0CA 2WV9A 2W2TA 3B9QA 4DT1A 4M0LA 2HT1A 1ZC3A 1Q57A 1W47A 3THWA 1XB2A 2ZPTX 2QBYB 2BOVA 4JBYA 3KTAB 1XCPA 3B85A 4I1VA 4Y0VA 3LW8A 3WRYC 2RGNC 1FQJA 1UEJA 2C99A 1E0JA 1Z0IA 5FTMA 4YMVA 2VSFA 1MO6A 4JLNA 1E2DA 3OAAA 2ZJYA 3BGWA 4HYYA 3W5JA 2F9LA 4LPSA 4B3DA 4F93B 5FPKA 5FBQB 5TV2A 4HLCA 1W4BA 5FUWA 3ZD7A 1XWIA 2AWOA 1G5RA 3FHOA 5AUQA 4CEIA 1Z6TA 4QM7A 1E2MA 5F9HA 1KDOA 2BMEA 2OV2A 4TTPA 1R10A 5B57C 1F2TB 1OKKA 3MWKA 2ZI7A 5B58C 2REBA 4EAQA 5DIFA 5L3QA 2C77A 2CE2X 2O52A 1XTJA 2V4ZA 4B3BA 3WBJA 3SHFA 2O8CB 3K09C 3VX3A 1HH4A 3KQLA 1FW6A 1YZTA 1VG1A 2ZEJA 4G5OA 4JJZA 5KYKA 2B8TA 2J87A 3WMEA 1P62B 4CT4B 2NPFA 2NO7A 3BFKA 1CIPA 2NO6A 3C4JA 2PX0A 3F5FA 3RS7A 1KKLA 3W34A 1G17A 3GFPA 2GK7A 4R98A 4TQUS 3I62A 2QTFA 3BH7A 1NKTA 2IYQA 4LY6A 3GJ3A 1N6RA 4TQAA 1XD9A 4MQBA 4QL3A 4OQNA 1PVOA 1S3SA 4TT3D 3ADBA 2XXAB 1N5JA 3UANA 1KNXA 2F6RA 2QGNA 5TDHA 1OIXA 4TT3A 1CR1A 1YJ5A 5BQ5A 2QRZA 2WIBA 1A4RA 2GVDC 2FV8A 2Q21A 3BRWD 2BMDA 2JIZD 4Q9HA 1IOZA 4EFNA 2DWPA 2WWGA 3SBEA 5EXSA 5JI3E 3GLIB 2JLWA 2CJWB 1ZM9A 2GRJA 2Q9BA 2ZI3A 4MRNA 3JVUA 4RFSB 2G83A 3T34A 4MRPA 2QQEA 4UJ5A 1K5DA 4WA7A 1GUAA 1JR3A 2A7QA 2O0HA 3DDCA 1XZQA 4QBFA 3ZVNA 2C96A 5E4FA 4F4IA 2BBOA 4EDHA 2FFAA 2HV8A 3WNDA 2FOLA 2GAAA 3FPAA 5GJBA 1MR3F 1Q1EA 4W5HA 1M2OB 2IYRA 4E03A 1RPZA 4IFEA 4PHFA 1AS2A 4NYMQ 3A37A 4PSAA 4AKEA 3GJ4A 2P0EA 2IHBA 4DSUA 2RKOA 1HYQA 2NOAA 1G18A 3ZQJA 4ESVA 4MGYR 2GZDA 1A2KC 1P2TA 1XTKA 4V0LA 3A6PC 2VP2A 5EE3A 2R2AA 1GSIA 1Q3HA 3QPVA 4RJLA 5LB2A 3Q7QA 4FMBB 1FMLA 2JLUA 2OAQ1 2ODEA 3NHBA 5HR5A 3FVQA 3N70A 3SFVA 2HT6A 1IXRC 4OYHA 2V6IA 3RYTC 3RC8A 2HEIA 3RSOA 4GBMA 2H5EA 3CR7A 4TYNA 1L4YA 5JFGA 4Q18A 3U3OA 1XRJA 3KJGA 3UMRA 3VNVA 3FE2A 2XSZD 1E96A 4M53A 4U00A 4BFTA 2Z0MA 1KI4A 3KXKA 5BN5A 3PEVA 1NN5A 5UKDA 2ZANA 4DCVA 1CJVC 3W3ZB 3CIOA 4HUQB 4DB4A 3QUSA 1UADA 4QBHA 3GEIA 1KIMA 4Y0AA 2CLDX 1XMVA 1A1VA 1TQ6A 1NBMA 1XTRA 4ILEA 1W48A 1G3UA 1SULA 4DDUA 1ZBDA 2OAP1 4QJ3A 5DI3B 3FFAA 5HCNA 3QXXA 4Q7LA 4JT4A 3VX4A 4BFSA 4ZCIA 2W00A 4XTRA 3HDTA 1U99A 3IPYA 3VR3A 1E2PA 1GDDA 1UFQA 4MUAA 4A2WA 4V0OA 2ZRNA 1BYUA 4Z51A 3I73A 3FMFA 3R20A 4N1AA 3T06B 1U8AA 1KJYA 4NP6A 3H84A 1JALA 3CRQA 4X8MA 3MG9A 4B73A 1F6BA 1E99A 3DZ8A 4WZBE 4FMCF 3I61A 3GQBA 4PZLA 3K53A 4B3CA 5EE0A 5CJPA 1XZPA 3K70B 3FMIA 1ZM4A 4W5JA 3EA0A 3KKOA 4L8GA 5FTNA 1Z63A 2WJHA 3PEWA 2ZI4A 3MAAC 2WMOB 3ZVMA 4DLXA 1KZGB 3K09A 3R9WA 2QN6A 1M6NA 4Q1FA 5GADl 2VP4A 2YWGA 4KFSA 5KDOA 3PV0A 1E2HA 1G6OA 5K8UA 2WTUA 2C03A 3PFIA 3ZJYA 4KODA 1Z29A 3BB4A 4C9BA 4AURA 5JLJA 421PA 1C4OA 1U9IA 3T5GA 4DLTA 2IYZA 4PQRA 2QE7A 5DISB 1SKYE 1KHTA 2B8WA 2QY9A 3NG1A 1Q1ZA 4RD1A 4R71A 1GL9B 1RZ3A 1G8YA 2AKAB 2QP9X 2C9YA 5TMPA 4AC9A 2V7QD 3CRW1 3ZDQA 1XEXB 1TQDA 2VBCA 3OE7A 2P3SA 1S96A 2WAYA 3QF4B 3TSZA 1UEIA 1RYFA 4IVPA 1IBRA 1II0A 1A5TA 1TADA 1E2QA 1E9SA 1DAKA 1ZINA 5CIQA 3M0EA 1UDWA 1YZLA 1WB9A 2VH5R 3PEUA 3MJHA 2VP6A 5KPJA 5BYKA 2XB2A 4ACBA 2GTPA 4BFVA 2V7QA 1OF1A 1GNQA 2G77B 4D26A 1CTQA 1CU1A 2P65A 1DELA 3CNNA 4B2IA 1IN8A 1P6XA 3ZLJA 4YC7A 4ZKDA 4IDQA 4P4SA 4RFSA 3HP1A 2CLSA 3QENA 1GVNB 2ATXA 3K9GA 3P27A 4JVNA 5KPDA 4F4CA 1F2UB 3RC3A 2F7SA 1G8PA 4LHYA 3HPQA 4B33A 2CCJA 4I1SA 5EP1A 1GWNA 4LV6A 3WYFA 2CNWA 3TR5A 4DCTA 1E6CA 2PJZA 3QIAA 4BLRA 1E2LA 4L9WA 3X1WA 1EK0A 1YZGA 3W5IA 1IN7A 2ZUCA 4IOLA 4DDWA 4HDQB 2V9PA 4KFTA 4D4KA 1I2DA 1XPUA 2ZE6A 2V8OA 1VTKA 1R2QA 3LNCA 4FMCB 3VR2A 4RCYA 1R5BA 5IT5A 1GKIA 1N6LA 2GBLA 1E9EA 1XMJA 2ZU6A 4NONA 4AYXA 2OM2A 1OH8A 2VF7A 4URUR 1H8EA 2UZIR 2TMKA 3FFBA 2FEMA 1IJFA 4US2R 3EX7C 4C3ZA 2WHXA 2IYTA 1Z0AA 4K8OA 5F98A 3NH9A 3AP1A 4CT5A 1U8YA 3BK7A 2JLSA 4CVNA 4JKYA 3B78A 3BWDD 2GXAA 4QHSA 3MJRA 1UAAA 3THWB 1EFCA 4NYMR 1B0UA 1CKEA 4LI0A 1D5CA 2QL6A 3MWJA 4HATA 2VHJA 1H8ED 3UMFA 1HEIA 4TLEA 3V9PA 4JT2A 1F5NA 3SYNA 3DZDA 3NTUA 4LBVA 4Z8XA 4ZCLA 4JZKA 3PJRA 1OHHD 1XD8A 3L0SA 5HE8A 1PUJA 1R7RA 1VIYA 2PT5A 3K70D 3DPUA 4OHXA 3H86A 4CYMA 1OJLA 5JJKA 4MYTA 4YMSA 1DAFA 2OBMA 1OPXA 3EZ6A 2A5DA 3BORA 2QORA 4BFXA 2OLKA 4BGDA 1NJGA 4ZKEA 3B2EA 1D6JA 3LA6A 4PQFA 3QPUA 4GOXA 4MA4A 2IF0A 1VCIA 2FX3A 4F7WA 1E98A 1AKYA 1F48A 1XU4A 1DAGA 1DAEA 4L9SA 4NCHA 3TIFA 1UBEA 5JZVA 1C1YA 1RKBA 2CK3A 1Z0FA 3ZD6A 2PT7A 2DFKB 1PV4A 1HT2E 4TL7A 4QOSA 3SDZA 2ERXA 3U60B 4Q4AB 3NWJA 1XP8A 4P4UA 2EYQA 3PEYA 3LDAA 3U7EB 4B71A 3VKGA 2NZJA 2KBEA 2AWNA 1R5NA 2IYXA 4L4UA 5KSYA 1G9XA 1N5KA 1MRSA 1XMSA 1E1QA 1Z22A 2VSOA 3CO5A 1QG2A 5F9FA 3W3AA 1AQYA 2XJ9A 2C98A 2H16A 1VCOA 2QMEA 2WPDA 1PLKA 2FNAA 3TMKA 4XSHA 4M9XA 4LJYA 4RZXA 4BFUA 2UVQA 1XBTA 4DSTA 4KLZA 2MSCB 2ZRCA 2YZ2A 2O8DB 2NTYC 3LXRA 4B6FA 4KVAA 4LPKA 3T61A 3X1DA 1OE0A 2XITA 5DGXA 1XXHB 1QG4A 1ZU5A 2H17A 4IDPA 1AA9A 3GLHA 2ZETA 2HF8A 3AKEA 4A0GA 1NLFA 3JVVA 2X2EA 1E2KA 1T9HA 3EC2A 4HLUC 4NMMA 1Z5ZA 5HPYB 1MO5A 2P67A 1J70A 1CJKC 5TARA 5F2EA 1TMKA 1BIFA 1BOFA 3QKTA 2AXNA 4Q4AA 4TMWA 1NMYA 4G1UC 3EPHA 1U2RA 3A4MA 3RRYA 1G5TA 3Q5DA 4X8OA 1JI0A 4JVSB 5E3HA 4QNRA 3Q8XB 5EXPA 3TVTA 3E70C 1W5TA 1JJ7A 4HLQB 1DADA 5B2ZA 4DDTA 3SJAA 2F1HA 1L8QA 2BIFA 2FE4A 5P21A 3ZZ0A 2B92A 1ESNA 2ZRMA 3BAFA 3ETLA 1JAIA 5FUYA 5AR1A 5IF9A 2WVJA 2QA5A 4C0KA 4OI1A 5A5GA 3G0HA 4Z8YA 3B7GA 1GZSA 1CR2A 1E2IA 3DVLA 4IDNA 2NO1A 2E9SA 2EWVA 3C14C 2C5LA 1G64A 4Q01A 3TUZC 4LYJA 3CRVA 1TNDA 2ZYVX 4NCIA 2W83A 1ELOA 1Y3AA 1KAGA 2YC4C 2QAJA 1HE1C 1CXZA 1W49A 3GLFB 1N6NA 1RJ9B 1SHKA 4MRSA 5SZIA 1OXUA 2Q9AA 5IHPA 2MSEB 5J4HA 1ETUA 3UPUA 1KI7A 4BLOA 2XOKA 4PANA 2DPXA 2AD5A 5GVRA 2EFDB 4PXAA 3I5XA 1XJ0A 4GMDA 1R5OA 1D2MA 2G6BA 4PQYA 4N0EA 4KVGA 3DKPA 1Z83A 2XGJA 2B6HA 5KO2A 2AFHE 2VTKA 5CYPA 1ZNYA 1SZPA 3IQWA 2IXEA 3K0AA 2KE5A 1L7VC 1P4SA 2HJGA 3QEOA 5FOXA 4DCUA 2OT3B 2BKEA 2QUZA 4BFWA 4F92B 1AS0A 1TUEA 5AJZA 1G19A 3RWMB 1HE8B 2CXXA 2VYFA 3LH5A 2PMDA 2BJWA 2GXUA 4B3GA 3H1TA 3AUXA 3U44B 3QXCA 4DLUA 4PSVA 1WBBA 1W36D 1T3SA 1EFUA 1P9NA 2OZEA 4AYWA 2BEJA 3TRFA 4DLWA 3T1TA 2FSGA 2XTZA 2Z43A 1ONBA 1E9RA 2GZAA 3EW9A 1Z0DA 4X8LA 1ZD8A 3KTAA 1TF5A 4AKGA 1U81A 3IILA 1WDTA 1DE0A 5L3RA 1TU3A 4LJ5A 1VYVA 5FR2A 1GOTA 4JL5A 4PC3A 1TUIA 4IXMA 3PQCA 3RSLA 3AV0B 1X8KA 2R6FA 4GSYA 1VHTA 4ASUA 4UJ3A 3THYB 4KJZA 1P2UA 3AVTA 3EPJA 1JQJC 1P2VA 5M04A 1DARA 2QENA 5JBQA 2GXQA 1RW4A 3QXHA 1W7AA 3ICEA 2F3TA 5JWRA 3C41J 3ZGXA 4JVLA 2FDCA 4Q9IA 1XPRA 1L4UA 4WW0A 2PEZA 5LDDC 2DR3A 1OSNA 4QGFA 1G20E 2JEOA 1KMHA 1J90A 2I1VB 1UKVY 3AKCA 4GP6A 2YV5A 4ASUD 4CW7A 1M8PA 3TAUA 2V6JA 5KHOC 2PCLA 3ZIAD 3CZPA 4KCGA 4TZ0A 5KNDA 4C30A 2DYKA 1PUIA 3SJZA 2FSFA 1U98A 3IPXA 3M4YA 4EPYA 4C2UA 3HU3A 3UG6A 4RZUA 221PA 3QBVA 3HYTA 3GJ0A 3WNCA 3EIQA 2ZJ8A 3KKPA 1KNQA 2WJIA 4MKHA 1EFRD 4MKFA 5CYOA 1ZUNB 5C46F 1O87A 3TJZA 1NY6A 2QU8A 1CRQA 2RGGA 3ADCA 3LAWA 3A4NA 3PUVA 4PPGA 4BPBA 2J41A 2GEDA 4C4PA 3SC3A 1CRPA 1IN5A 1G6HA 4ERNA 2ZRKA 1N6IA 1KY3A 3VNUA 1YE8A 2HXSA 4ITRC 3Q85A 5FTLA 2ONKA 5JS7A 1SXJE 2KBFA 1Z0JA 1XEWY 3MSXA 2G0TA 4FMDF 2JJ1D 5H68A 4TYPA 5L3SB 4B47A 4OK3A 4G5GA 3VMFA 2RHMA 2QT0A 1K6MA 2KI5A 1DAIA 4LJAA 1YRAA 2EFEB 2IK8A 2J59A 2VHCA 3NDPA 4FW9A 4OK5A 1ZRHA 4G5SA 3I4LA 2IBMA 2ZSEA 1IXZA 2QAGB 4URYR 5FL3A 1ZM2A 3AF0A 1JNYA 2DBYA 1E2JA 4JL8A 4XVUA 5GJVC 3G5UA 2DY1A 5FBRB 3AP3A 2JJ2D 1G8GA 2ANBA 1G21E 4TMVA 2RGAA 5LB4A 3HYRA 4RFVA 3E2IA 1KJWA 1DVRA 3FTQA 4ZDKA 5JHGB 3IEVA 1K8RA 2FFBA 3QE0A 4OQLA 3TVDA 3U4QA 1CJUC 2YYZA 1N3BA 4HB4A 4HAUA 5JCZA 2QG6A 1QHYA 1GL7A 4ZPXA 1P9WA 2YC2C 3AF3A 1S9DA 2OESA 3V4FA 3CNOA 4ZIRB 4E22A 4V02A 4XD7A 2J0VA 1E94E 1TQ2A 2R9VA 1S3GA 3BC1A 1Z2AA 2WBLC 1KI3A 4XD7D 1KK3A 1KI8A 4CEJB 3FMPB 821PA 3E1SA 1IQPA 1U90A 3TH5A 1I4LD 2VQSA 3WMFA 2MMGA 1YZUA 1U9IC 3N2IA 4LCBA 4YMUA 1BMFD 1M1YE 3DKVA 2OFOA 4Q7JB 4ZDJA 2JLZA 4NYIQ 1NG9A 3W8NA 4XIGS 1WMSA 3KL4A 4G0NA 3A36A 3LD9A 4LRWA 4QJ5A 3ZYCA 3PG5A 2XXAA 1P9RA 1VCMA 2AX4A 1BH2A 2WJVA 4RY2A 4YLGA 5EZ6B 5DSZA 2Y8EA 2W2XA 4PZZA 4TMZA 1QHGA 2FN4A 2NZ8A 2OO7A 3ZS9A 1M74A 2GCNA 4K46A 1W5SA 5HTKA 2H8KA 3VU9B 1U8ZA 4DLRA 4CZ2A 1LB1B 3D7MA 2N42A 3NEYA 3DEFA 3W6PA 4A36A 5AJWA 3H2YA 3I72A 3OIYA 3EARA 4LUCA 2GKSA 5ELXA 1EX6A 2WM9B 1W4RA 2ZTSA 1GAJA 4UNRA 1R8SA 4Q1EA 3B60A 2ECKA 4LC1A 4WVFA 1KSGA 1EG7A 1SVSA 4CIDA 4URWR 2F1JA 2OUKA 2ZYWX 4XVQA 3TW8B 2Q3HA 3EAQA 4MGKR 4Q21A 4BUJA 5DHAA 2FG5A 4PSKA 1RVDA 5E95A 5EE5B 4GPTA 3A1VA 3CWZA 4URVR 1E1RA 4WAUA 2BMJA 2QPTA 4LHWA 4A92A 2J7KA 3C7KA 4AG6A 2O8FB 2ZYUX 4XVRA 2HYIC 1T8TA 2IUUA 3PIRA 2ZRFA 1Q0UA 1ZJ6A 5FL7D 2YINC 2AD1A 2QSZA 2JATA 3BB3A 3CKLA 4P3YA 5E7JA 3TQFA 2IX3A 2FF7A 4UNNA 4UQOA 1W36B 4WZ6A 2GILA 4GZLA 5J47A 3Q9LA 4J0QA 4TN1A 5CDFA 3NEJA 3ECCA 3GLHB 3RS4A 2CJWA 4YXWD 1E1RD 2CE7A 3QOFA 4PC2A 4QFMA 3IBGA 1LNZA 3TNFA 4O25A 4Q4HA 5J4YA 3W6NA 4IDOA 3W6OA 3MFYA 1FP6A 2NPIA 2VHTA 4M1MA 3EXAA 2FEOA 5FPHA 1HURA 4BQSA 1H8HD 5FTKA 4JLPA 3O8RA 2VP0A 2VHQA 3GJ7A 1YHNA 4G5RA 2IHYA 2PCJA 4Z1MA 1VHLA 2Z6VA 4NCJA 3H0KA 1W2HA 1DG3A 1KMHB 1OV4A 4A0FA 2GEVA 1BKDR 1FTNA 1I4TD 2IYYA 2XNDD 4JVMA 4WBSA 3U3KA 1KSJA 4D25A 1SQ5A 1W44A 5FR1A 3TUJC 2WWFA 2RGNA 2ZRDA 2DFNA 4NL4H 4PPFA 4DXAA 1Z6XA 1DAHA 2ZJOA 2Q0HA 3FHCB 3P4YA 3MWLA 4IHQA 4NCNA 1ZW6A 4HDCA 1P3JA 4C7OB 2HYDA 4Q9KA 1AGRA 2QT1A 3OIUA 3QF4A 4AG5A 3BH6A 1W4CA 1F3OA 2CCKA 2ZRPA 4JYCA 4Q4HB 3RLFA 3KUCA 2IS6A 1AGPA 4MH0R 1E2GA 1AZSC 1T91A 2JA1A 2UZ3A 4JBWA 4IOKA 2EYUA 2AN9A 3ADKA 4LHXA 1DS6A 1IONA 3L82B 4MYHA 3IBYA 4S35A 1TEXA 2EVWX 3GD7A 2WSSA 2JLRA 4II7A 3JZMA 2KWIA 4A8JA 2IUSA 1Z28A 4XTCS 4KFRA 2BM0A 3AM1A 1TQ4A 4EKDA 3GPLA 1TX4B 4KSCA 3QG5A 1YR9A 5FTJA 2XZLA 5FBWB 2FZ4A 3DMDA 5IK2A 5L3QB 1TF2A 2D62A 4FWTA 4PC6A 1PLLA 1XXHE 5BN4A 1OH7A 1X6VA 1TL7C 2ZSBA 1W4AA 4LGMA 1FNMA 1XMIA 3QJYA 4AYTA 4UNSA 1NN0A 4B43A 2OEPA 3CW2A 2XJ4A 2BV3A 4NYJQ 4CGZA 3Q3JB 1N6OA 3CM0A 4YDHB 2BVNA 2IXGA 5SZKB 3SYLA 1Q3TA 2ZUDA 1J7KA 3UMSA 4HI0E 4O2RA 1RJ9A 1WQ1R 3EC1A 4XOIA 3L8YA 3LX8A 4RVCA 4BLTA 5CM9C 3TBKA 4KHZA 2VPPA 1VECA 1US8B 3THOA 3JZAA 1RRCA 3WBKA 2IYVA 4NE2A 3AGQA 3LY5A 3X1ZA 2NG1A 1AK2A 1J2JA 1ZU4A 2EFCB 2W6IA 3GLFE 3I5YA 1DG1G 1S1CA 4Q9JA 5CLQA 2J45A 4FWIB 4HLDA 5EP4A 5SZJA 1DO2A 2A2ZA 5JRZA 3GP8A 3Q72A 2N1BA 4M2LA 4JS0A 1P60A 3GLFA 1GTVA 5J4VA 2QP4A 1NVVQ 4HAXA 4RD4A 1A82A 4CRWB 1U0HC 5DI3A 4ZCMA 2O0JA 1XPOA 2I4IA 3U2QA 3QXJA 2EU8A 2GXSA 3A4LA 4LYHA 1RIFA 4RCZA 5FL7A 2BCJQ 2YJTD 1FX0A 5DN6D 5BXQC 1ZNXA 4GZMA 4TQ9A 2ZRAA 1KO8A 5FFMA 3GEHA 5KDDA 5FUXA 1GM5A 4HZIA 1OFIA 2ZJ5A 1TU4A 4PHHA 4OL0A 4PHGA 4JLKA 3RANA 3AVQA 4NCKA 5LBIA 3TSWA 1KZ7B 1KO1A 3K1JA 3RS3A 4C0LA 2BBWA 3IIJA 4PPNA 3BD9A 3RRZA 3AF1A 3IO5A 1E2FA 5H70A 1XJQA 2R8RA 3OFNA 4WIAA 4DC9A 5AUOB 5HCIA 1KAOA 2YWFA 1VKJA 2OSBA 1JEDA 2WPDD 4ON9A 3OIVA 5L8VA 4CEIB 3CBQA 121PA 3ONWA 1FX0B 2C78A 1M7HA 5A4JA 3NBYC 1T0HB 1NVWQ 2G1KA 5CLLA 4DIDA 1Z0KA 1ZMXA 2ZYTX 1VPLA 5G40A 4D4JA 3MRSA 5LD2C 2FPKA 3VHXA 1DOAA 5EQTA 3J81k 1W0KA 2ZRLA 2XB4A 1EFHA 1W0KD 3BS4A 3R7WB 4KLNA 3KB1A 5FOWA 3T12A 4UNPA 3U3RA 3W9YA 2PLFA 2ZUBA 4LJ6A 1G3IA 3WHLA 1AZTA 4EJSA 1T3LA 3BH0A 4RD0A 5KDLA 2ZSDA 2VO1A 4LK2A 2CHVA 3DO6A 4K81B 4IEIA 3OF5A 2LWIA 3SR0A 1MABA 3PXGA 1RFLA 2YVUA 1QVRA 2J0UB 3DM9B 2O8BA 2BHRA 4ZV4A 1HUQA 2A9KA 5B64A 1P5ZB 2C9CA 2JLXA 1E0AA 3W90A 3IQXA 2MMCA 4PHTA 2R6GA 3ZVLA 5JEEA 1JR3E 1UKEA 4HLUA 1AS3A 4A2PA 3LLUA 1YQTA 4AKIA 3A58B 3PUXA 4NHOA 2ZI5A 1CULC 4WXRA 4DCSA 4YMTA 1NJFA 1QZXA 2XTNA 2X8AA 5J4KA 4PAMA 3R7WA 1V43A 2ODWA 2DWOA 1HT1E 3HR8A 3P4XA 4OQFA 1FL9A 1DAMA 1GG2A 2OHFA 1OH5A 4BZQA 2I1QA 3LVRE 2FMXA 1U0LA 4Q1DA 4PO1A 5GVSA 2HJVA 2JGNA 2VA8A 2FPLA 2FU5C 2V55B 4BFZA 2A78A 1S1MA 4BFYA 5EE9A 4OHYA 1P73A 3BERA 4O3MA 4QM6A 1JPJA 1FMJA 3VQTA 1JAHA 3BFVA 4JLOA 2FFHA 3REGA 2ZRHA 4TTQA 4L16A 3Q7PA 3CNLA 1NL3A 1TTTA 3L2OB 2XTMA 1Z3IX 4NBSA 3I8XA 1XX6A 3OEHD 3VR5A 5GJCA 2H18A 1WXQA 2CL7X 4TLDA 3R8FA 1FOEB 4JSTA 1UDXA 2ASEA 3IHLA 3L0IB 4HAWA 1OFHA 3EIHA 3A1WA 3BFXA 3QQ5A 2W6JA 3N5CA 1G3QA 4NZYA 5DE3A 4Q03A 1W46A 3QVUA 2W0SA 5AJVB 4IVQA 1KI1A 4DSOA 2EQBA 4C0BA 4V0ME 4UNQA 1R0ZA 4FD2A 3F3YA 5FPSA 4Q66C 1ZM3A 1G8FA 1KK1A 4A6XA 3B1VA 4V0MA 4MYUA 1ZD9A 4B35A 1KMQA 1J8MF 1ZUHA 2C04A 2F9MA 3K9LA 3O47A 2P6NA 3SHWA 3WHKA 4B34A 1QBKC 5FI1B 2OE2A 3PCRB 3CUEF 3NBZC 1KO7A 1Z06A 1JPNA 2XNSA 1NMXA 5DHFA 4Q4LA 2P5TB 1E79D 1R8QA 1NBMD 1UF9A 2EWWA 2GETA 3OAAD 4DIEA 3K0SA 4GL2A 4PFSA 1XNJA 1Q1QA 1Z2CA 5CIWA 3KB2A 3NKVA 2O8EA 4PR0A 1X1SA 3LV8A 2RB4A 1LS1A 4IJMA 4FI3C 4S2EA 2ZS8A 1RC8A 2WOOA 4EPVA 1SXJA 1N25A 1SKQA 4RKEA 4C0HA 4QKQA 4AIIA 2GK6A 1G4AE 4A9AA 1F2TA 2QQ0A 2HF9A 3X1YA 3HU2A 4I99A 2CDNA 2A5FA 1CBUA 2X77A 3RRMA 3EZ9A 4CEHB 2IS4A 2F1IA 2DWQA 3BIFA 2ZR7A 2GCPA 2IS1A 1IXSB 4HEJA 3AB3A 1OYWA 1UBGA 2QROA 4D0LB 4LBWA 1EWRA 2J9RA 2J46A 4JJKA 1KDTA 4PO8A 2E87A 3IKJA 1GITA 2V1UA 2QPOA 3B1YA 5HZHA 2C2HA 5K8IA 1IY0A 2IXFA 3D3QA 3R9XA 3IGFA 2O8CA 5JHHB 2PZEA 1A7JA 2CK3D 5J40A 4DDVA 2JAQA 3TR0A 5JS8A 1KDRA 3L43A 3K0FB 2NIPA 1NSTA 1FTSA 5DNYB 2VP5A 1Y63A 1VYUA 4B2LA 2RMKA 2FFQA 3I8SA 4M9QA 3RDPA 4TYWA 1X86B 2QTHA 5FPYA 1E1QD 1X8LA 2WKRA 3QKRA 1ZD1A 2N46A 2Q3MA 3IIMA 3KJIA 3U61B 2ZRIA 2QMUA 1HY3A 1KY2A 3L0PA 4P4SB 2NGRA 3KJHA 2GDJA 3AVOA 4P0TA 4IFBA 3BOSA 1T4GA 4JLJA 4Q19A 1KI6B 4FN5A 4QC2A 2HUPA 1QVAA 3B5JA 1E32A 2ZJBA 2QM7A 2GJ8A 5G3ZA 4YONB 2OG2A 3S1AB 4DB2A 2QEQA 3OFND 3Q5EA 4UXHA 1G7CA 3EZFA 4PZYA 2WJJA 4TL8A 3RS5A 3ZS8A 3GCGA 4B48A 1XF9A 1QHHA 2PMKA 4TLBA 1LF0A 1ESMA 2JDID 3KZ1E 4JYBA 2AK2A 4DHEA 5B30A 3C15C 2ZSFA 2FZLA 2V3CC 4PAOA 3ND8A 3QI2A 4FINA 2BBTA 4U7DA 1HQYE 1E2EA 3IO3A 2GWHA 1OLOA 2ZQ5A 3QY0A 2ZJ2A 2DFTA 1DPFA 2IYSA 3OEED 1AM4D 5FH9A 2GJAA 2LKDA 3EA5A 4JIMA 4MGZR 3K0CC 3KKNA 1X8JA 3OEEA 5ANRB 4TYYA 2BWJA 1FUUA 2IC5A 2O8BB 5CK5A 1G4UR 3RHFA 1CLUA 1E0SA 2A30A 1XFAA 2FSIA 3ASYA 1G16A 1KSHA 2C9OA 2ERYA 2IT1A 4TSFA 5FOSA 2L0XA 4E5UA 2YNMA 4QG7A 2AK3A 2FSHA 4HDOB 2OFXA 3MLEA 2PZFA 2BC9A 1OT3A 4PTLA 1W2GA 4JL6A 3X1XA 2ZREA 4M1WA 4D4LA 2R65A 2PJRA 4CEHA 4I81A 3THXA 2GCOA 4P31A 4M1YA 4ABYA 4IOMA 4M1SA 1GP2A 1IJEA 4P4TA 3SYKA 4DEYA 4URZR 3KKQA 4LJ9A 3SE0A 5FPTA 3VHLB 3CH5A 1SKYB 3WP1B 2J7PD 4HZUB 1E3MA 4BLQA 1SVIA 3UIEA 5EE1A 4DLZA 3V00A 4M21A 1L2TA 3GLGA 2O8EB 1Z08A 2Z83A 2W58A 2IF2A 4HAZA 1N5LA 5C4GB 3AUYA 4FCTA 5G41A 2P6RA 2XAUA 1TPZA 4KFUA 2J7PA 1QRAA 1KI9A 1VDZA 3EWSA 1OXVA 4O0MA 5A0FA 3GLGE 2ODBA 4EPRA 1JR6A 5J5CA 2WWYA 3T5DA 5BW8A 3AVUA 2HLDD 1G41A 4M1KA 5DYIA 1Q12A 4LX0A 3LW7A 4IDHA 4A0HA 4MGIR 1UPTA 4QGHA 1S9HA 1VG8A 1VIAA 2IUTA 2ZS9A 3SBDA 4B75A 5C2JB 2CHQA 4TMTA 4W9MC 3NDBB 1VCNA 2DHRA 3UK6A 1YZKA 3U7HB 1JBKA 2GESA 4CEJA 4LBYA 1T5LA 3AKYA 2R6AA 4BASA 4LZZA 4M9ZA 4BZPA 3LQRA 4KV9A 1IN6A 1XJCA 2D4HA 1HV8A 5DLQC 4EQ6A 4XH9B 3NHAA 5JRJA 4HUQA 1LFDB 3ZIAA 2ZAOA 1Z6AA 4YMWA 5AJYA 4EUNA 1W36C 5E7IA 2C95A 3THXB 3AF2A 5AUNB 1N5IA 3ASZA 4XWOA 1OKKD 4A82A 4OI2A 4ZDWA 1SVOA 2QSYA 2Z4RA 2D74A 1QHHB 1E0KA 3EASA 5C4MA 3AVVA 3ND9A 3FWYA 1CF4A 2QTVB 1JEEA 4DKXA 3GJ6A 3I92A 4MRVA 1A2BA 2WSSD 3I32A 1IN4A 3DOFA 3KXLA 3LXXA 3NBXX 3ZZTA 1FZQA 2B7CA 1Z47A 4W5WA 1R4AA 4JLVA 2MSDB 5E7MA 2VF8A 1G3MA 2J0SA 4Q7KA 5JJLA 4MUBA 5DO9A 3RAPR 2OCPA 1KYIA 2DCUA 2ZR0A 2OILA
chains in the Genus database with same CATH superfamily
3ND7A 2EL7A 3BOQA 1X7HA 1R64A 2DR0A 3MT7A 1V37A 3VBEA 1WJEA 3QFFA 2B25A 3SS8A 5C81A 3SC6A 4MS3B 5GZ3A 4BNYA 3CE6A 1TD1A 4BTVA 4GP9A 2DK5A 2JGMA 2CQNA 1YB5A 3KKMA 2IDJA 1PT8A 2XHEA 2BMFA 2YS6A 3G5AA 5TX7A 4XKVA 4PGAA 5K01A 1RNLA 3VKHA 4W97A 5JSZA 4H0FA 4DUGA 1GTRA 3W2GA 1LJ9A 1VG0B 4EHNA 3KQNA 3H19A 1ORIA 3RZOJ 3PRYA 4GYWA 3F8TA 2X2PA 3HI4A 3UWMA 5KOYA 1FNDA 1NNEA 2CEAA 2ID8A 1SCJA 1Y5MA 3T5PA 4AYBA 2WAAA 4QVGA 1SD6A 1N0IA 1DRKA 1NIJA 2PRJA 3ENZA 2HMVA 4TTVA 4FN4A 1XZIA 3QEKA 4WFKA 5K51A 2QVOA 2JPCA 3ITNA 2YPRA 4KKXB 1XQXA 4AU1A 3ZMZA 2AE1A 4HN4B 4LWZA 2R3SA 1X9GA 2XZOA 5LXTF 1OA1A 3PA8A 4LZPA 4YH1A 5TJ9A 4KR3A 3UV3A 4AJ2A 3ECHA 1QHIA 2FHPA 5GQSA 5IJXA 5LQAA 1AQUA 1MX9A 1WUJS 5E1BA 3ICWA 1T6ZA 1W0UA 1FB5A 4I01A 4BY1J 4LBZA 2ZJZA 4OMCA 4UXIA 4EA6A 5B3LA 4M98A 5HFAA 4M1OA 3OS1A 1JGTA 3KFXA 3NASA 5AO9A 3H0DA 4KW7A 1T33A 4D4MA 1UWVA 5DT9A 2GD1O 4GS5A 1JU4A 1NQXA 3IFSA 3QKUA 2JLVA 4FKZA 2ODNA 2Q1XA 4KYIB 4ZYTA 3TB6A 4RKRA 4Y2YA 5CH3A 1L0BA 5EEHA 1MBEA 4MIOA 2BEKA 4P38A 3WU1B 4HC4A 3N2KB 3P71T 4UNIA 4XCXA 3GIWA 2QS9A 3CRMA 1RT9A 3GLKA 5EMKA 5HFNA 3VR1A 2DDBA 2C3PA 2C4NA 2Y1KA 2J5OA 3S8MA 4AK9A 5I7FA 1UKYA 5IRCD 3QLEA 1TM7E 1Y7TA 4D9IA 4L0YB 3WU2C 2XVMA 3TPCA 3UUFA 4XWKA 2KM1A 4H3VA 3PUYA 1XZKA 1B8IA 3V4GA 2E18A 2VJMA 3HCDA 2TMGA 3GLIA 1EAYA 2ID3A 1NASA 1WE2A 3HFGA 3LKDA 2BGCA 3JQ7B 2AZMA 2ZT5A 3LQ4A 3OIGA 2KW5A 3PU6A 4K1LA 4NC9A 2GTHA 4KE7A 2CDCA 4XWAA 1STZA 1GZDA 1E59A 1I14A 1XMAA 1KSFX 2FQXA 2PZLA 1YZQA 2AFIE 2E5FA 1X7DA 2Z4SA 3JCUC 1EBBA 2Z58A 4CM8B 4HXGA 2ZR9A 1TQHA 4DMFA 3PX7A 3P5BA 4JBIA 3SJBA 2G0NA 1OYYA 2YFQA 2WHEA 1D2EA 4V39A 3ABQB 3SZRA 3ULQB 1U8XX 4YASA 2D7CA 4GNKA 1VG9B 3KBBA 1ZGJA 1RKTA 1KOFA 4MWEA 3TQQA 5D8DA 1GVHA 3ZW8A 5EIHA 4KIFA 1I9GA 1OXXK 4RYDA 5E9JA 4A2CA 5CB6A 3ILXA 5ARBA 2H1CA 1I50J 1NVUQ 1T8UA 1V9SA 2HXYA 2PJDA 3TW6A 3VOEA 3C97A 3PKZA 4RNCA 1WXFA 2F43B 2WIGA 1EXWA 4FFNA 3NC0C 4JX8A 2HCFA 4H1UA 3LL7A 1T1SA 4HLXA 2X9QA 4LXYA 1UC9A 3P32A 4E09A 1C9YA 4JQCA 3BYZA 5ALEA 2DYRH 4NU0A 4I9HA 4DUZB 1P61B 2VHZA 5ITZA 1ATZA 2QJFA 2GERA 1SOVA 3N8DA 3LMKA 3IT1A 4F12A 5BSWA 4DBLC 1C81A 1U04A 4YP7A 5I4KA 2A7XA 3LLSA 4FCWA 4BMOB 1Z68A 2W11A 3E9YA 4Q7QA 3CF0A 2AQFA 3DZKA 1Q0QA 2H2GA 4BGEA 1DRUA 2BBSA 2YR0A 3ELWA 4QBGB 3TCXB 3D6HA 4EG8A 4RQAA 4F4JA 3DPLC 3PQEA 5JJIA 1U9YA 4IGIA 3UFXA 4CKXA 5EA2A 3N39C 3ZOZA 1DJLA 1JECA 2JKVA 3ESXA 2WYHA 3HKDB 1SHLA 1Q21A 3B1WA 4WCDA 2VP9A 1VKNA 3AEQB 4MV1A 4AWBA 1PJ3A 3ADPA 4DXDA 3U7FB 3JRHA 3VSLA 1FP7A 4M3EA 1HFWA 3CX6A 1QAMA 4N6OA 4CMKA 1AK9A 4R8SA 4UUMA 3GW8A 3U7RA 4YIFA 1YJ9I 1U3TA 1V5WA 1VGQA 4IH9A 1M34E 4JLBA 3U62A 4OGKA 2WHYA 4GT1A 4I46A 5ESRA 4KPFC 2X3YA 3RFXA 4D2IA 5IAAA 2E1CA 1LVGA 3OZEA 4F11A 3QU3A 1GGMA 4JI1B 5KVRA 3L8DA 1H65A 2AJLI 2HEGA 2ZSAA 4N76A 4L78A 3EEOA 3KR2A 2WSBA 2ZKIA 3D1LA 3ET5A 1NI4A 3C3EA 3HU1A 1TCCA 2DFEA 1C9KA 5HOQA 4RKFA 1M0TA 3CISA 2JI9A 3SHQA 4YDRA 2Q07A 2WTAA 1E7QA 4XLCA 4F46A 1I6WA 3HEFA 4N4OB 2CVHA 4LRQA 5H16A 3ZV3A 2EW2A 2YH2A 1NW5A 1JKJB 4TVKA 1H2EA 2QE6A 3TLAA 3BJOA 3OM8A 3FOZA 5DBEX 2DU8A 1JHHA 3TS1A 3NAZA 1WXHA 3LSJA 3M49A 1GKYA 4KBFA 3T9BA 3CPEA 1NRJB 3BXPA 4UTPA 5LLTA 3G89A 3H3FA 1JTYA 3V8KA 3TW7A 3IQIX 4QUHA 5FCDA 3UN1A 2IGOA 2IEKA 1E9CA 5JSZB 1G2HA 1NF2A 4R2LA 1M8GA 4JUAA 1WBDA 3OX4A 4L8LA 1O2DA 3AU8A 3MF4A 5FOVA 1GAWA 2IITA 4LS3A 4C0QC 1IPEA 2IZ1A 2R7MA 4DAOA 2C5BA 3UPDA 2KZGA 3I2FA 3K9HA 3PJGA 5FKJA 2IYEA 3OSZA 4FHTA 1HTWA 1OAOA 1N2GA 3OEHA 5J2TF 4OAYA 1CUIA 5HS8A 1JV2B 3AESA 4KO2S 5EHNA 2CVQA 3TRDA 1YW7A 1KO5A 1UH5A 3AEKA 3TKYA 3K92A 3Q7TA 4HX4A 4FXPA 1ETWA 2ON6A 3CLVA 3LYHA 4EFMA 4AQYB 3KDSE 4KN9S 2QRNA 3ZY6A 4Y6OA 3UXMA 4M6VA 1S7EA 1GL6A 1E0EA 1TLHB 2CKDA 4M22A 1P1HA 4BAGA 1YMVA 2DPGA 5D5HA 2L2QA 5L3BA 1EJ9A 2WOJA 4M0UA 3ETNA 5KJFA 5KTNA 5CNKA 4LYAA 5HE9A 4PO9A 4OI4A 1T0JB 4U5XA 2QTLA 1DUIA 3NHJA 4KVFA 5H83A 2JFZA 4HSRA 3OHMA 2HPHA 4DIFA 1QX4A 2ATEA 2W2VA 4TKLA 3UT6A 3T9CA 3RHSA 4KOAA 2H4HA 1CFZA 1TC2A 2J5QA 4HQKA 5D85A 1QYDA 1U9NA 1RPJA 1LU9A 1W1WA 1NAIA 2O5VA 2DA1A 1BXGB 1GAXA 5FA5A 4O4JB 1EXDA 1DOZA 4Q4JA 1DBWA 3G6WA 4DNPA 5DYWA 1ETXA 3MJSA 1NLZA 4JHXA 3MBOA 2OYRA 1HOTA 4IL5A 4J7UA 4L08A 4LXXA 4YAUA 1I7QB 2IOYA 2ZTVA 3N28A 3TTYA 1WA5A 3FCUB 2Q6OA 3PNYA 1I2AA 3S44A 2HO4A 4H0EA 3DW1X 4OU4A 1PQWA 1K5GA 4TTJA 4KI0A 1MB2A 4KXNA 2XECA 1F51E 4ZAGA 2FQ4A 1IDYA 2RCNA 5KTYA 4UTZA 1GV5A 3LHDA 2AXPA 1YB6A 4WXCA 4M0KA 4HZFA 2KX7A 4D9NA 2ZCVA 1T9ZA 2BFPA 1Q1NA 3FBWA 5I9BA 5F2NA 1W4ZA 2B20A 1R0WA 3M3YJ 1MABB 5D3ZA 4FDVA 4L5CA 3JR3A 3KPJA 4OKSA 4OBEA 3I59B 1ACLA 2OKGA 4WCFA 1ZH5A 4U7PB 2A05A 1BYIA 3K20A 4LRXA 4BKOA 4B46A 7REQA 2W9XA 4KE6A 1UBUS 2K2WA 2XGEA 1EWKA 4E21A 4YROA 2PAAA 2DWCA 1JJFA 3N8NA 2F1RA 1ZYUA 4R84A 1V96A 5EXDA 2HIMA 4HV6A 3TDUC 3HSEA 3L00A 2AJDA 2A5WA 1BO6A 3TQIA 3HJRA 5JI2E 1MJHA 4H7EA 2ZROA 2Q46A 4RO0A 3KB6A 2XNHA 3JVEA 2H59A 3MW8A 4H3KB 3L6UA 3ZY2A 1T08B 2E1RA 2G9RA 1CYDA 2IZ6A 3A1NA 3BKWA 5KNCH 1KVTA 2QRMA 3QWFA 2IA1A 4G8BA 4MP8A 3AL0C 1BA3A 2VI5A 3EYIA 4NS1A 4PY2A 4YNBA 4C88A 1ULYA 1WH7A 3HVRA 3PJDA 4FKMA 2VDJA 4FD3A 1DIAA 2GZSA 3RB8A 4BGUA 1T2VA 5FX2A 3FPHA 3E3MA 5JD3A 1X2BA 5LZ9A 3O93A 2BH2A 5MF6A 3C43A 3HSYA 3TJMA 4C4TA 5JIBA 3TOAA 1ZZGA 2AL7A 3ZOKA 4MI6A 3IOBA 3ZI4A 1FU7A 4C5AA 4N41A 2QRPA 2Q1TA 3SZPA 1IAQA 3K0AB 1U94A 4JVOA 3UJPA 5BN1A 1C7RA 1I2ZA 2B35A 5AVVA 4LF9B 1MJNA 5HJ2A 4PX2A 2DA7A 1NW7A 4K5QA 1G3WA 4XQ9A 2Q8KA 1MGPA 2Q9UA 4A8HA 4DM4A 5CH8A 1MORA 4JX4A 5C4IA 3ICQB 1KIFA 4RGUA 2F5CA 3JRCA 3S15J 1TTHA 2CLKB 2RGUA 5K20A 1EP2B 4EPXA 4RLQA 1FW8A 4RKQA 3O1LA 5WRFA 5CA1B 3F73A 1XGKA 2O7NA 1NVAA 2Q6VA 4GAEA 4CA0A 1BXRA 2CKMA 2O9JA 3NS7A 3RVKA 5D4RA 1PBTA 4JI3B 1FP1D 4NARA 3N6RA 4E07A 1THGA 4HV4A 3ECSA 3C8HA 4YMGA 4BECA 3GTGJ 3OWHA 4KI7A 1SQGA 4YPVA 4EGZA 3EF0A 2FG6C 3IBTA 4CWAA 3EQLF 3ZN1A 1RRFA 2CHGA 2D00A 4ZODA 5BQOA 5T6MA 2I6UA 3HB0A 1SMKA 2C42A 3C5CA 1J33A 3UK7A 2DA4A 3KYIB 3WKDA 5K7HA 1WCV1 4O6JA 3EGDB 4X1IB 5FQNA 1CK4A 2KMLA 2OBYA 1N34B 2EA4A 1A31A 1J2TA 1R0LA 1XKQA 3S0JA 4AWXA 1K1EA 4HY3A 4XWYA 5IKPA 2MYUA 2Q2QA 4L9JA 3ESZA 3PHHA 4U9HS 1IDOA 5D3KA 4H59A 4LWQA 3KAPA 4A93J 5EP3A 2PVPA 2Z9CA 3CJQA 1R5GA 3OKAA 2NPOA 4CZZA 4XMYA 2CMGA 2OKCA 3ONNA 3PUWA 1V8DA 2FAXA 3DVSX 5I5GA 3GPIA 1TW3A 3T35A 3WYBA 5LN1A 4UULA 5THQA 2IH5A 4CTNA 1YCDA 3H35A 4H6XA 1N5MA 2BRUC 1JILA 3EBOA 2D7DA 4D82A 3PHLA 3WYDA 2ZAIA 1P17A 4R0MA 5EQFA 1HDXA 2JCGA 4FFOA 1MP0A 2P2GA 4L22A 4HNGA 1V47A 5A03A 4B40A 4ZC3A 5I51A 5KTOA 4ESHA 2B99A 3S2YA 1GFSA 4CCMA 2OHHA 4DMUB 5C3MA 3D3NA 4ZO8A 3A7EA 4Q1BA 4ANFA 4RJKA 3DQQA 3ZXSA 1KBOA 3FSEA 2NU7B 1JXMA 3KAKA 2PQ6A 4H6PA 3IBSA 4B6QA 3QOWA 5DYYA 2AYXA 3L7YA 4DVGA 1P7CA 3HCPA 3PQFA 4PTZA 5GONA 1Y8RB 4TV9A 4C04A 4CKCA 4UVAA 2EHJA 2CMPA 3PGXA 3TBIA 2UVPA 1BXKA 4LC0A 6REQB 1KRWA 1Y6IA 4AM3A 1NSYA 4JGGA 1ODKA 2II6A 4RIEA 5IMSA 5FKNA 1WABA 5HUJA 1KDPA 2HCBA 1MHPA 1UJ4A 3SJCA 3UTCA 3RSNA 3OYMA 1YI0A 4NPCA 5G1OA 3O0DA 1H1LA 3QMMA 1Q0HA 1NUAA 1QM5A 2ZPAA 2XKPA 2V65A 3GJ8A 4LZOA 5F73A 4AJOA 1D3AA 5KYWA 2J1LA 1VBKA 2V45A 2QZZA 5CCEA 1BTOA 2GZHA 4TTRA 3ZZNA 2LTAA 5I7VA 2W2KA 1TM5E 2W0MA 3A6EA 2G7ZA 3OIWA 3OLVA 4TSFD 2IW1A 1I39A 4MRPA 2I3BA 2C8VA 3VI4B 5JSFA 1YR8A 2C97A 1JG3A 2ES4A 1O9HA 1GYPA 4IDDA 5F1OA 3L01A 1UQRA 3IEUA 2IPMA 3R8CA 2HHCA 3VPAA 3IWFA 3HJCA 2AG8A 2AOWA 4IMPA 3OSUA 3UY4A 1L8OA 4D4IA 1O95D 1AN0A 3QYPA 4MNTA 1VE9A 5ES3A 4ZYHA 5C18A 2XMDA 5T4HA 2WA2A 2BHLA 3WIBA 3EZLA 1IZZA 1SVWA 2ZSUA 1X1CA 3ZRGA 2X6YA 2DTEA 1ZGZA 2GCIA 2FGKA 2O9LA 1Y8QA 3GCDA 4G01B 3ZQ6A 4DYDA 2Q3FA 5JATA 3T1QA 2C3YA 3GGDA 3EXHC 2Z8XA 4MR9A 1GJRA 1ZIDA 4PFQA 1EDBA 2XOKD 3IHKA 4MKIA 2CWDA 4ZOAA 1I6XA 3I58A 2E82A 3BN3A 4TL9A 3T3EA 3TLCA 4QBKA 4D9EA 3LZDA 3LO8A 2ZQZA 5KHLB 2IYWA 2M8GX 2F00A 1G3YA 1K7AA 2KJQA 2PFGA 1L9KA 2G1JA 2Z5VA 1L8XA 4BBZA 1RJDA 1DRVA 4CM6A 3T3NA 2HU5A 3UMYA 4U5QA 2ZNZA 1Q22A 3WMGA 2RHDA 4C0SA 4DRXA 3AOGA 3C98A 4KXUA 3V7NA 5ALOA 1FXUA 2RNJA 4BIMA 4CTOA 2LDUA 1YOBA 3WXMA 1I13A 1VHJA 3GNLA 4MUFA 2EFHB 3D5SC 2ZE5A 3ZDEA 4NUBA 2A1IA 3ZQGA 1QGUB 3IP4B 1DMRA 1X1EA 2VUTA 3WYEA 4A6PA 2M4GA 2TCTA 1UBFA 1USUA 3ZGKA 1U28A 4XJXA 4KX5A 1EK6A 3H65A 4BXUA 3TNDA 3ZE9A 1A96A 3ESWB 3DEKA 4NBNA 4R0NA 2AEMA 5TMDA 3G1LA 2BFOA 3U0VA 3BMCA 5JVDB 4B6OA 2DFLA 1MKYA 4KO8A 3QKRB 2VQEB 2XROA 3FUVA 3DPTA 2XUDA 3BHNA 1II9A 3MD0A 4ABTA 4XEUA 2JGEA 3UMVA 3HUEA 2UAGA 3BWEA 4LHZA 4QEZA 4BNLA 3JTGA 2JIQA 5FJJA 3HB7A 4E5KA 1W75A 3KQTA 3CN9A 3WLQA 4IAOA 3OMYA 5BY2A 2XRMA 1SXHA 2O3RA 2ZTLA 4LJRA 1LY1A 1ZNQO 4H6WA 4L4SA 4NTZA 4EI7A 2LOOA 1Q1GA 3NQOA 2D2FA 2Z8YA 5CT6A 3HYIA 2RGXA 4B6EA 4HYTA 4BOYA 1XRPA 2BJVA 2FW8A 3ONEA 4RJTA 3MLAA 1C0IA 1H4TA 3PENA 5TS2A 3RF7A 4HG2A 5CVCA 4ZIRA 4R16A 3GLHE 3GEBA 3NIBA 4BKPA 4G6ZA 1TMOA 3SEAA 2YQZA 2CUNA 3LRXA 3ZDRA 4KYWA 4CCJA 1YAHA 4IIJA 3F3KA 2OSVA 3DWIA 3O31A 4OHUA 3SEQA 2RG1A 5KNCD 4L76A 1MMNA 2I1WA 3CWQA 1FOYA 3CMMA 1B26A 2WHPA 3JU3A 5D5PA 1YB7A 2HXGA 1DO0A 1RXVA 1A4UA 2AI3A 1UXKA 3BMNA 4H9GA 2Q6TA 3IAM1 3U3MA 1MQSA 3SYTA 3NETA 2J0QA 1IM2A 3P0EA 4CFSA 1CQZA 4Y1GA 3TL6A 3WYGA 5FJ8J 4C4SA 2XB5A 3EDMA 2B7EA 2EJRA 1H6AA 3F97A 1YIJI 1VZ3A 2IZ0A 5E6UB 4EG7A 1RC1A 4ZI3A 1FQKA 1Z5NA 1ENZA 2QT9A 3O1IC 3A1TA 5KHDA 1D7OA 3MGAA 3UWKA 3OE1A 4UEJA 3F8MA 3MUFA 3RYFA 4P83A 2JLAA 2PRIA 3V3TA 1VMDA 1KEKA 1C8VB 2HRQA 2J3EA 3QWIA 5LNK6 1EFRA 1THTA 1XK6A 2JJQA 4ALLA 4YHHB 1FNSA 5E1XA 4BU1A 5AVQA 3DNFA 2RGDA 4PG7A 5ED4A 3FKSD 3RSCA 1EA5A 4ARUA 4ZHSA 4LISA 2XNCA 4LDNA 4PONA 1YRBA 2COBA 3Q3HA 1J0CA 2R8EA 2HGCA 3PGMA 3TW4A 3KQUA 2PFSA 1LQ2A 3G23A 3ELUA 3FHLA 1LLQA 3DFMA 5JCJA 4MRMB 3M6VA 4JGBA 2IY8A 1VRVA 5CW1A 3OLWA 2WD7B 4BJ6A 2ZUWA 3BBPA 3ZV7A 2YMPA 3BCAA 1COWD 1F9EA 3P1JA 1TW2A 3FG9A 1I3QJ 5SZHB 1RRPA 1FTWA 5KSWB 4ENMA 2VJLA 3LBNA 1V7ZA 1WKMA 3CUYA 4PYOA 1ZSVA 3KP7A 3DAHA 3QVXA 1OIVA 3HBJA 2R6ZA 3MKYB 4J07A 2O03A 1PJRA 4OJNA 3MAJA 4MIMA 1PEKE 3LDHA 3HC7A 2BGIA 1JG1A 4AWXB 1WPRA 3WTXC 2JCVA 3PTLA 4GE0A 4KPGA 3T7TA 3FYCA 1D2GA 3HH8A 2ZULA 2O1XA 3GLIE 1TQIA 2DJIA 1AOYA 1OFGA 3TLXA 3AVXA 3ZKWB 1UBOS 1G7RA 2FX0A 1DPUA 4AVZA 1ZNZA 5H1YA 3QSYA 4ALIA 4BVEA 4J75A 3BZWA 3HPGA 2NQ2C 2BY3A 4LDJA 1G9TA 2C2GA 1E4EA 2XODA 4DQDA 2GWRA 2XUHA 5JH7F 1EXVA 1J2XA 3SI7A 3HNOA 2BHYA 2Q5CA 2I3ZA 1WM1A 3KP1A 3ZE2B 1YDEA 4PN3A 3DT6A 3RS0A 1YI1A 2OV1A 3EF3A 3QNUA 3T3IA 4B85A 5ALNA 2YWBA 3WADA 1YLFA 4BDYA 1ZO8A 2W48A 2NU6B 2ZRJA 4NAUA 4AUKA 1CDOA 4HLYA 2G76A 2X6XA 1KR5A 3GFGA 2JAUA 1ADJA 2Q5HA 3FDIA 3EVDA 3UGJA 3QP5A 3OJ0A 4JP1A 1H0KA 3L4SO 2E1NA 1SCIA 4QBIA 1R4NA 4QZVA 1YE3A 2UXCB 3AO0B 1A2OA 1PZNA 5BR4A 5JANA 3C3XA 3CU5A 1ZVVA 3T0GA 3RI4A 1JSCA 4JOBA 1SXPA 1I80A 1QNTA 1CUEA 3I0ZA 2AN4A 4NPHA 1ESEA 1HYBA 1QFXA 3GCWA 2JA2A 1WW2A 1O3YA 3G17A 3I5MA 3RH0A 3UAVA 2I3DA 2YZ7A 5H3LA 4AROA 2A6HF 2ORYA 1ZXXA 1Y9JA 3X1JA 3GFTA 4GVPA 3RRJA 4DL9A 2X1MA 4I1RA 1BZYA 1C2YA 2B3DA 2P3OA 3FR7A 4J7XA 4TS1A 4F5DA 5JMTA 4H31A 4AIJA 4F5EA 3HCCA 4BMCA 1TAUA 2VDPB 2OA4A 5FPQA 2VZLA 4H15A 1ZFNA 2ZMEA 2R86A 2LMDA 2XMQA 3D0QA 3ZE6A 4NZMA 5U1PA 5KUTA 2G3YA 3BZBA 4EO9A 3WK6A 1A4XA 1N0UA 2Q5QA 3D5TA 4QWMA 3HUUA 1BA5A 1M2KA 1L5HA 4IY1A 3OIPA 3SG0A 4IRUB 4CU5A 3ZMDA 2FPMA 2LCIA 2G71A 4PX9A 3IV7A 4ZARA 1GTZA 1MCZA 2NO9A 2W84A 2B1QA 1E17A 2COUA 3KLMX 3W2WA 3M6AA 4ZC8A 3A27A 4EPTA 3U7GA 3MS2A 4I1OA 3ZE7A 1KO4A 4ODIA 3OL3A 3AHEA 3DWFA 2KRFA 1NF3A 4ZCQA 3VPCA 2FW6A 1VL0A 2NOJB 5C32A 1T8IA 2E6KA 3WTVC 3GQVA 2X6QA 1WFXA 3OESA 5BN3A 1TJ3A 2BXYA 2Y9YA 3TQSA 2J3DA 4LIVA 3PQ4A 3PQ5A 2Q4TA 3E1KA 3ESCA 3TOVA 5LDHA 2ZE7A 1EVYA 1U11A 2DBRA 2YYYA 1VQ1A 2H1SA 4Q5IA 3U5ZB 4BXOB 1YFHA 1C4XA 1ECBA 4P7GA 3OTHA 4FT8A 3IE1A 2RC4A 3N8KA 4FYVA 3INYA 3HP7A 3VNSA 1CQTA 3AFMA 3QUCA 3VOBA 3N3BC 4UDXX 5SY6A 3PT5A 1RPNA 2MDTA 3HGGA 3THWA 3A01A 1XB2A 2ZPTX 2QBYB 5C34B 5IUKC 3KTAB 3KQOA 1IEWA 2A57A 4P7FA 1AZWA 3AERA 4M89A 3CJTA 3M6XA 1MJBA 2NVYJ 1QIEA 2EKZA 3FWZA 3GPBA 1RCTE 2VJQA 4MHOA 4R6WA 3M4NA 1SG0A 2PI0A 1E0JA 1Z0IA 3SHTA 2QYOA 1GYRA 4X62B 2G4LA 5FTMA 1NJ8A 1Z39A 4J7AA 2C4TA 1L1FA 5DX0A 3KTDA 3NATA 4ANJA 4NPAA 4PLHA 1MO6A 2V59A 4JLNA 4CN8A 2JVIA 4NXMB 4CCKA 4YLEA 3WIDA 4P96A 1C9EA 3JQQA 2EWNA 4LPSA 3C6ZA 3NGMA 4ZQIA 5FPKA 4HLCA 3E0QA 3IQFA 3I54A 2QJOA 4EP1A 3RQSA 1QRYA 1R66A 3FHOA 1NYRA 4LXTA 2HQSA 3DCYA 5ELMA 4CEIA 3G0GA 4QPJC 5EESA 5HNHA 1MB3A 1Z4QA 1AHIA 4ZT3A 2NSLA 4TRRA 3OY7A 3HLKA 4UDYX 2BMEA 4PCUA 4TTPA 4X3OA 5ISMA 1AMUA 3F3XA 1HDEA 2R8YA 5ITZB 3BSYA 4WGFA 4INZA 3IKLA 5AHXA 2VNJA 5K3DA 4ETMA 2ZI7A 3G7UA 2YHIB 3G88A 1EK2A 4JEMA 4QWWA 5K5QA 1KMNA 2O8CB 3K09C 5DDIP 1KEZA 4J1TC 5B7GA 3KQLA 3MGKA 1FW6A 1YZTA 1VG1A 2ZEJA 1KR2A 4U2BA 2C4VA 4G36A 2P41A 6PAXA 2Y77A 4CT4B 3UC5A 1E1CA 2L0KA 2JZCA 4PGFA 2OCLA 3Q8WA 1OPRA 3OQNA 5CXQA 4MXDA 4R01A 5AK4A 2JGJA 2KRCA 3JQ8B 2XAGA 3GFPA 4X92A 2FWMX 3FD8A 2QTFA 3JSXA 4TQUS 1NKTA 1O5TA 4ZU1X 4JI7B 2GN9A 4XLPF 4LY6A 1YZFA 1WI9A 3BE8A 4OATA 5K0SA 4HRVA 5KNBH 3K94A 1M76A 4OQNA 1I2BA 1S3SA 2LP0A 2XXAB 1DV1A 1QR6A 1RXEA 3C39A 3UANA 3GN1A 2RAFA 2NAZA 1QIMA 1W4MA 3ISPA 2P9EA 4KKVA 4CETA 3PK0A 1LBIA 4S04A 4OIRF 2GVDC 5CT8A 4YTEA 3ZTWA 1XTZA 2QN1A 9LDTA 2BMDA 2HK7A 4CL2A 1FU4A 4Q9HA 2VDVE 4ENVA 3SBEA 5EXSA 2JLWA 1N2BA 2ZI3A 1XAHA 1KEVA 5EI5A 3VGJA 1EM8B 4G2NA 1ESDA 3C2QA 2QW1A 1ZUNA 1Y4DE 3EFHA 1U8CB 1OCTC 3HR4A 2O0HA 2F67A 1MGOA 1OASA 2OCIA 4QREA 2XAHA 4G07A 5D51S 1EGMB 4YJGA 3F7MA 2C96A 2WJWA 5HF6A 4CG2A 2ID6A 4LKOA 4OLHA 5E4FA 2H0AA 2QD1A 1IUNA 2GAAA 2TS1A 2OK8A 4DLKA 2HHLA 4BGVA 2XPUA 3I2KA 4PEVA 4W5HA 4R1TA 1L3CA 1J0RA 3EUWA 1AZLA 3K32A 4ESJA 2GD6A 5FO1A 4BEHB 1XPJA 4R1PA 4A8PA 4DGWB 2LBFB 1NKVA 4MV5A 4I8IA 3TEMA 1RYYA 1AOXA 3GA0A 2RKOA 3MWDA 4EG6A 4ESVA 3UCXA 1G18A 1EI9A 3ZWQA 4NATA 1CIVA 1SANA 4B0OA 2GZDA 4IHSA 2C4MA 1FTGA 1O5IA 5AW4A 1VL5A 5JJBA 2KDOA 5FAKA 2Z8YM 3QPVA 1QGED 2ZIUB 4JLWA 1DRWA 3AETA 4FEEA 5K0ZA 2NP7A 1FX1A 2ODEA 3WL5A 2R60A 2AFVA 3OWOA 3EN0A 4Q9DA 5KINB 4KIUA 1M6HA 3AR2A 4W8GA 4EYGA 3CRNA 1KVQA 2PKXA 4LRTB 3OQIB 5BSEA 1O0CA 4WK4B 1P6UA 1T5OA 3OTGA 1USVA 4CCSA 2LF8A 2H94A 1L3LA 2G36A 3CR7A 4KZPA 4KIGA 1SK9A 4UE6A 3BMQA 1S3IA 1TMGE 2XMPA 2Z2IA 3R3WA 1MSEC 3DJYA 4QODA 5DZSA 5KQRA 5JFGA 4Q18A 3QWBA 4IX7A 1RC9A 2BDEA 1PE0A 1DNPA 2UVDA 3GRYA 3WHCA 1MC8A 3KJGA 3MJDA 3L4KA 2D1FA 2YHIA 4Y0NA 3FE2A 1P5JA 4TKZA 2GT1A 2ECOA 5G0UA 1FS4A 4U00A 5F1YA 4BFTA 3MOGA 5CX4A 2HQAA 2X4HA 3PEVA 1AU7A 3CLUD 5UKDA 4EZBA 4C14A 1CJVC 4KT5C 3CIOA 3GO5A 3A0HC 1MC5A 1LDBA 3W3ZB 3MZHA 1JA1A 4OB7A 3LT2A 3L41A 2FUG6 1BN5A 1I7PA 4I09A 4UU7A 4DWVA 2CLDX 3OM1A 3BR5A 1B8IB 1JDPA 1OAOC 3CE9A 3ZV6A 1TQ6A 3ZN2A 4ILEA 1SKAA 4Z1OA 1DEHA 2ZBKA 3T5BA 4MTDA 2D7JA 3LBFA 3HP4A 3WE7A 3RKYA 1VI5A 1W48A 1KORA 4QGSA 5IHXA 1SULA 2H7YA 3HBAA 3K2AA 1DUVG 2DXIA 2NVBA 1X77A 4W1RA 4CLOB 4QJ3A 3GEDA 1RWOA 1JSZA 2FY8A 2IYAA 3K35A 1C7QA 4K03A 3WG7H 4MW7A 2OCGA 5TS3A 3WFZA 3ETJA 1PR2A 3NBAA 3VX4A 4F5WA 1BE8A 2W00A 2XMRA 4XTRA 3KZMA 1U99A 4YP9A 4DNFA 1QCYA 5GPCA 3SK0A 4AY3A 1VP3A 3GD5A 3EDPA 3KP2A 1NRIA 1G5FA 2IYFA 3UVEA 2AOVA 4FDMA 3VR3A 1GQFA 3QOYA 5LDGA 1E2PA 4BX9A 3SYNA 2VPZA 1A5ZA 1YHQI 3KV3O 1HE4A 1FRFS 2AQEA 3R20A 3K5WA 1TZBA 4N1AA 4KGVA 3T06B 3BJRA 4KISA 2A35A 1BDBA 1O03A 3BWCA 4NP6A 4O2BB 4X8MA 3UC9A 3WGOA 1G1AA 1RWPA 5CVDA 3MINB 1P4JA 4B73A 5TQVA 3W6ZA 3WDSA 1Y8QB 3QWAA 2CWWA 4FMCF 3GQBA 3JYHA 1DCTA 1ZEMA 4H7IA 4AJEA 5CJPA 1CUCA 3K70B 2LGJA 4IJWA 2WY2D 2V6CA 3OQ6A 1MVOA 3KKOA 1FP4A 1S89A 3MHPA 3KZNA 2WJHA 2J4FA 4ZYAA 2KIUA 2EP7A 1MBKA 3P19A 4IQGA 3SKVA 3UAOA 3UH0A 3FVRA 1OXKB 4WWCA 2C4HA 2CXQA 3PPIA 5FJIA 5SY9A 3W5CA 1XWWA 3O7WA 1EVJA 3OP4A 4QFCA 1JQDA 5KTPA 4S1PA 2PGIA 2L54A 3R9WA 3BF8A 2QN6A 1TAQA 2ADOA 1YQ9A 1NK2P 1M6VB 3LMMA 1BWQA 1SAYA 1UBHS 1D1SA 1VSTA 2O0LA 1JKOC 1NNUA 4KFSA 4M8LA 3SM9A 2YJ3A 3PV0A 2WA1A 5K8UA 3ABOB 1MBZA 4M0FA 2DT5A 3FFXA 4CKBB 1IHXA 1ZN9A 3G7SA 1WCMJ 4EUKA 3BB4A 4RQUA 3PR3A 3RKSA 1N92A 4HNSA 1V6CA 4BCBA 1NMSA 2W57A 2AEEA 3HEMA 4A6EA 2P2YA 3DW3X 4ND8B 3QZUA 5LJIA 3WGGA 2P5LC 2IYZA 4H77A 1HPLA 2PSHA 5AQ1A 1TQ8A 3OYJA 2GZRA 3E9RA 3TQRA 1RMTA 3NG1A 1Q1ZA 4RB0A 3MINA 4ROSA 5E1MA 4DM7A 5IASA 3LT0A 3M1EA 1D09A 1PGOA 4PNPA 4AC9A 2V7QD 4KREA 1V8PA 2NTNA 2IA0A 2VBCA 2C83A 4BDTA 4YAWA 1ZG1A 3EODA 3OX3A 4D44A 3GJRA 2WNIA 5ARCA 4YP6A 3OQ1A 2AIRA 1UPCA 4IVPA 1PL7A 1ZAOA 2H8RA 5KWEA 3OOJA 4KE9A 4RIFA 2IV2X 2HQRA 1DAKA 1H22A 3NYIA 5K6AA 5CYVA 4IJKA 1K4YA 2GCGA 4PO3X 3PEUA 2PH3A 1NR5A 3GWGA 3MJHA 2VP6A 4NG5A 3KHSA 1X7WA 2JFQA 3QHQA 3RV3A 2M34A 4PRYA 2WV1A 1WF6A 2L17A 3MNFA 4PHCA 3B9BA 4IDAA 5IJZA 1PKEA 4D26A 1KPHA 1NE7A 3GTMJ 3R5KA 2P65A 5KTSA 3WQRA 1MZBA 1BW9A 1SELA 1Z5WA 3O84A 1A6IA 3E97A 5KNLA 3U9TA 2B36A 1D2RA 2BFNA 4G1CA 2XUKA 3FPKA 1D5WA 3O4HA 3OBIA 4FHFA 3JWEA 3ZHYA 3AJAA 3FDZB 5U4XA 4CXMA 4E6EA 4OAPA 2G70A 2W8BA 3HP1A 4Z6YA 2MLGA 3W3CA 3NHLA 1TK2A 2CLSA 2ZC2A 4BNCA 1OBHA 4HCJA 2A9RA 1VQ8I 2R93J 3K9GA 3P27A 4TROA 4XD2A 2VXZA 5KPDA 1L5WA 2ZCUA 2F7SA 3ZMSA 3CGWA 2E5LB 1NH3A 5C52B 4B33A 4ID3A 1Y1PA 4N82A 2ZSJA 3VZDA 2JQ7A 4I1SA 1QF7A 1MXHA 4AYBN 4KXYA 3WYFA 1GTMA 3CMEI 1DPGA 3WRXA 2JCBA 1W30A 4FEAA 3TOXA 4G37A 4CM4B 4UMDA 2VNAA 5JAHA 4JUIA 2OZ6A 1EK0A 2QN9A 3D7LA 1CUYA 1KL7A 2NSHA 2JIRA 3EPPA 5NULA 3C7JA 2NZYA 1XO1A 1QO0D 4KFTA 1ZQ1A 3CUQB 4BS9A 1I2DA 3C2GA 3RARA 1MW9X 2V8OA 2WJ3A 3REQA 3S6JA 1FP4B 4PRKA 4S12A 2V58A 3B6AA 3OQVA 4B4UA 3JW4A 3JQDA 2LVSA 3VZCA 4XFJA 2GN1A 3U37A 5IT5A 3T1YB 4GKKB 2A4MA 2GBLA 3NEUA 1E9EA 4J4TA 4Z99A 5FLXA 1ULHA 4JQFA 3SSAA 4UUBA 4W5OA 2YCBA 3FFBA 2Y1DA 4PYNA 2C29D 3P0RA 2QR3A 3UF0A 1NLMA 1BDIA 4C06A 3NIDB 3VVLA 3EX7C 4C3ZA 2WSIA 1WXDA 4OJMX 4X00A 1MJ5A 4FR2A 1I3MA 3KOWA 4QXRA 2H08A 1U8YA 3TO5A 4HDSA 4IIGA 3L0ZA 1DAPA 4FMPA 4QHSA 3NONA 1EFCA 4AVYA 1X3ZB 1B0UA 2X1LA 4LI0A 5LP6B 4MVYA 4QYWA 3FWPA 2ZIXB 2R7SA 4B4KA 2P4EA 3BR1A 3NTVA 1H8ED 5AKGA 3KT3A 4TLEA 2NNNA 3FPGA 4Y4RA 1CD5A 1VQMI 3H36A 3G6KA 3CLUC 3GRVA 3NTUA 4RLFA 1I3CA 4KN4X 1XD8A 4OGWA 4P3OA 1H3NA 4F7DA 1EJ2A 2W6CX 4PCQA 1EJBA 3IVRA 1NOIA 1AGXA 1R7RA