1U0JA

Crystal structure of aav2 rep40-adp complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
267
structure length
261
Chain Sequence
GMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication protein
publication title Structure of adeno-associated virus type 2 Rep40-ADP complex: Insight into nucleotide recognition and catalysis by superfamily 3 helicases
pubmed doi rcsb
source organism Adeno-associated virus - 2
molecule tags Replication
total genus 83
structure length 261
sequence length 267
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.950 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1u0jA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0jA02
1NF3A 1RJ9B 1OHHD 3RVBA 1DTSA 3EPKA 2O5VA 2OCBA 4B34A 4DEXA 5TDHA 1JAHA 4HLUC 2ZJ5A 3LX5A 1MO3A 3AF3A 3GLGE 3ZVMA 3RC8A 4IDHA 4DCUA 1GAJA 4QGGA 4ACAA 1YR8A 1GIAA 3MCAA 4DCNA 1W4RA 1UKZA 1JJ7A 3QNUA 4BPBA 2ZANA 3CX7A 2WPDA 2FSIA 2VYFA 3BORA 1QHYA 2XEXA 1F5NA 2XJ9A 5IK2A 1OXUA 3UMFA 3LW8A 4ZCIA 5BYJA 4LRWA 2P5TB 5L3SB 2QAGA 4PO1A 1NNEA 1JALA 1U98A 1HQCA 1VYUA 1E0SA 3TK1A 4DHEA 5F9HA 3AUXA 1TQDA 1ZUNB 2GZDA 1IY1A 3CW2A 3UK6A 4Q47A 4PPNA 2C78A 2Z0MA 1KI3A 2NQ2C 4BFTA 4ESVA 4TYWA 4DZZA 3FVQA 2DWOA 3QENA 4EPTA 4C2UA 2B8TA 4LHYA 4XSHA 4N0EA 4TTRA 2ZS8A 2HXSA 1KSHA 5FL7A 5JHGB 3EXAA 1GKUB 3MWKA 1OW3B 1Z2CA 2ZJ8A 4LC0A 3VKHA 1R8QA 3D7MA 1XMIA 1RRFA 4JLAA 721PA 4GOJA 4F4CA 1OH8A 2VHCA 2PJRA 3RC3A 2IA5A 3LLUA 1T3SA 1G6OA 1R5BA 3AVVA 2ORWA 1KDPA 2ZJ2A 3K1JA 3TRFA 5FI1B 3EW9A 1E9BA 1DAKA 4DSTA 3QY0A 4QNMA 5FOXA 3X1DA 1QVAA 2FPLA 2FN4A 4GOXA 1W5TA 2J3EA 1J8YF 3EZ7A 3K9HA 1QG4A 1IAQA 1XD8A 4DLYA 1VYTA 2YVUA 821PA 1J99A 3CRQA 2RGCA 2PMKA 1Q12A 2ZVPX 3HYRA 1P60A 2WTUA 5KSYA 2C99A 1U94A 2ASEA 4GDFA 3QXHA 1AS3A 2AN9A 4M1SA 1IN5A 4M4SA 3TSOA 4ASUD 2NO9A 2ZITA 4TLCA 3DVLA 5BXQC 1FOEB 1DO2A 3RABA 2B7BA 2AHOA 3QPWA 4A0GA 1QF9A 4B3XA 3LVQE 1GVNB 1IOZA 4H1VA 2V7QD 3NC0C 3A36A 1TF7A 1UF9A 3QVUA 3REFA 2FG5A 1EGAA 4URUR 3LA6A 2WMOB 2ZPTX 2JIZD 1NMXA 2Z43A 1N6RA 1T8TA 4IEIA 1X8LA 4OQFA 3W9YA 4PXAA 3PJRA 2OLKA 4UXHA 5FPYA 3THWB 4L5BA 2F43B 2QMOA 5CJPA 3DZDA 3GEEA 3K0SA 1E4VA 1IJFA 2F9MA 1NBMD 4YDSA 4RSGA 4KSCA 5F2EA 1XU4A 4GZLA 3G0HA 2O8CB 1CR4A 1TEVA 2JLSA 3JVVA 1ZRHA 3KXLA 4GZMA 4Q9JA 1XTQA 1Q44A 5LDDC 3I3SR 1KO5A 2KI5A 5GADl 3MGCA 1YR9A 3DL0A 3NG1A 2GZHA 1C9KA 3PIRA 5AUNB 4ZDJA 4B74A 521PA 4ZIRB 3KKOA 2BWJA 1RKBA 1TUEA 4WZBE 2G3YA 1AQYA 3K53A 5FOUA 4JKIA 3BFVA 1VG0B 4TYPA 1E2NA 3QF4A 3THYB 1HT2E 3Q8XB 4B44A 4MUAA 6Q21A 2GKSA 2QPOA 2FPMA 4FN5A 1TU3A 2F3TA 3ASZA 1CTQA 4G1UC 4PC1A 2V9PA 2CL6X 1ZJ6A 1DAIA 1XTIA 2DB3A 1Z3IX 1KYIA 3PUXA 3EWSA 1KZGB 1X1SA 2FSGA 2P65A 3NKVA 5G40A 3U3RA 4KVAA 3WMGA 4R9UC 3UG7A 4UKDA 3GJ6A 1W48A 4C0QC 3BH7A 4XD7D 2JAQA 3TSZA 3GLFB 1XEFA 4BWYA 1NMYA 2P5SA 1U81A 5JJLA 1DAEA 1XZPA 2W2TA 4WBSA 4L15A 1DAMA 3B1WA 2WWWA 3VU9B 5M04A 4LBZA 3T34A 4DT1A 2V8OA 3KTAA 3AKEA 1E69A 2IYVA 4A0FA 2Q0HA 2WKRA 1Q1EA 1Z0DA 4AYTA 3HR7A 3THXA 4Q4AB 2XZOA 4M53A 4UJ3A 5L8VA 3CM0A 3RRZA 5CM9C 1UJ2A 2JJ2D 4UNRA 5FI0B 2ZRFA 1OHHA 1KK2A 1UDWA 3RWOA 4CRWB 1Z0JA 1R10A 4QHYA 3PITA 3I8XA 2QZ4A 3WYGA 3AKCA 5HKKD 2AKAB 3QBVA 2GAOA 5KNCA 1YHNA 5D3MB 1KZ7B 2FZ4A 1Z22A 5JBQA 3CX8A 1N2CE 1W4AA 4DLSA 3U60B 3IHWA 4IDPA 4MKGA 2J5XA 4CYMA 4FWIB 2ZRMA 4PHGA 2IYZA 2DFKB 5DI3B 5D3QA 2GA8A 1E1QD 2CLCX 1ZCBA 2ZSBA 3H86A 4QC2A 4XVQA 3MJHA 3O8DA 1GKIA 2KSQA 1F3OA 1Z29A 5HCIA 3VFDA 3RDPA 3KKQA 4UNQA 1FNNA 1W36C 4PHTA 2DY1A 5JI2E 1U0HC 3DHWC 1Z6GA 4C0SA 1GTVA 1LNZA 1WF3A 1IHUA 1YJ5A 2CK3D 3J81k 1Z83A 2F55A 1LF0A 1Z6XA 5JWOA 2P2LA 3ICEA 2B92A 3WMEA 2LKCA 5BQ5A 2ZVQX 3B82A 5C1BA 2CCKA 4IOLA 5FBVB 1NY6A 5J4KA 5DNYB 5EXXA 3FMPB 4BASA 1AN0A 1NSTA 4P32A 4XWAA 3DZ8A 4HLQB 1E2IA 4LYFA 2DCUA 3IGFA 1XPOA 3B5JA 5EE0A 4BE7B 2GCOB 4D2IA 5JEDA 2O8BB 1D2MA 1XB2A 2PCLA 2VP9A 4BRUA 3KDSE 2IYTA 3NBFA 4DLZA 4D81A 1ZM3A 2XZPA 1KDOA 2FH5B 3AP1A 1JNYA 3CH5A 4HI0E 1M74A 2VA8A 2OO7A 2D2EA 1PZNA 1II8B 4NU0A 1N6PA 3A4NA 1YR7A 2P3SA 1IN4A 4MKIA 5P21A 4Q19A 2H92A 3WNBA 1EG7A 1PLKA 5KPDA 3SEAA 1IXSB 4DJTA 1E9FA 2PL3A 3SJCA 1JJVA 1MKYA 1F2UB 1NJGA 2ZE5A 3CZQA 3DOFA 1KDTA 4JVSB 5FBWB 2ZAOA 3SDZA 5EUQB 4AC9A 5KPJA 4WIAA 2O8FA 1G8FA 2RGEA 3R8FA 1BIFA 2IYRA 4D4KA 1E9DA 3PUVA 3AEZA 4V0KA 4ASUA 2BEKA 1K5DA 2ZI7A 4PQFA 4GMXA 3CKLA 3FMOB 3FHCB 5ANRB 2V7QA 3K0AA 4OK6A 4BFZA 4CEIA 1W5SA 3ZYCA 1KTVA 2JIZA 3FPAA 4JT4A 1GRNA 1Q0UA 2WHXA 2XNDD 4XJXA 1T9HA 1VMAA 4F93B 2H7VA 1R0YA 2DWQA 3RRNA 3NEYA 3PQCA 3GMTA 5HCNA 2IUUA 4BUJA 2V54A 4DXAA 4M2LA 5AJYA 1XD2A 3KQKA 1WXQA 2EFCB 4URVR 1NBMA 4P3YA 2NMVA 1N5JA 1NY5A 2PEZA 2IC5A 3A1VA 4OHVA 3F8TA 1XEWX 3Q7PA 5FL3A 3D31A 4UXJA 5LB4A 5JFGA 3RSOA 4KFSA 1JB1A 2R6AA 2XTNA 4HAWA 4Q21A 3ZD7A 1NIJA 4LYAA 1DBSA 1LB1B 1XXHB 3IPYA 3SHWA 3BFXA 4KITB 5K8TA 1XNJA 5JS7A 1ZD8A 3VQTA 3MD0A 2W0MA 2ZE6A 2H57A 2RAPA 2A5JA 2ZRNA 4LV8B 5EE5B 1GM5A 4A8JB 1Q1QA 1KNQA 1CIPA 5AJXA 2CHGA 1TADA 2R62A 1CJTC 2ZAMA 1DG1G 3QEJA 4ON9A 1R0XA 1BKDR 4CF7A 5TB5A 2J0SA 4OQLA 1H8ED 1U2RA 1XCPA 2AFHE 1ZM4A 2Z6VA 2ZRPA 3X1YA 3PEUA 4A6XA 2QAGC 3VKWA 2JJ1D 3QBTA 4TYQA 5JZVA 1WB9A 4Q1DA 3W90A 2R6CA 3TVDA 1W44A 2WV9A 4XD7A 3WY9A 4B32A 4BLRA 4DDTA 2EU8A 4BRWA 1NBME 1YZLA 5C46F 2WSMA 3EX7C 2ZRHA 2ZRJA 4OJQA 5FOTA 2W0SA 5KSOA 1VPLA 1XWIA 4OBEA 4TZ6A 4Q4JA 4PSVA 1GWNA 1I4DD 4EFNA 1CRPA 1ESNA 2FFAA 3CWZA 5L3RA 2F7SA 3C4JA 4M1TA 2DFTA 2Q21A 2JDID 3M4YA 4IEEA 4MGYR 2O8DB 1CR1A 2IYYA 2B7CA 1Z6YA 3ONWA 2JJ2A 1XTJA 3WHLA 1US8B 1P2UA 4CDGA 2QA5A 2IEZA 4P4SB 3NTUA 4LYHA 5FUWA 2AXNA 1AZTA 2OFOA 3IIKA 5EZ6B 2J0UA 1T91A 4TL7A 1G3UA 2RH5A 2G0TA 5CITA 4PAMA 1TTTA 4QHSA 3B9PA 4OI4A 3RAPR 3VAAA 3LBHA 1NSFA 4A2PA 5HE9A 4AURA 4R71A 1BYUA 4PANA 5FOVA 5EE1A 2HYIC 4DCTA 3GJ8A 4JSYA 2LCFA 2ONJA 3OAAD 4LBYA 1E1QA 4E09A 3LW7A 4N1AA 3A4MA 4M0LA 4X8OA 1E2QA 4DB4A 2JATA 1G3MA 4G5SA 4EPRA 1S96A 2ZIAA 5J4HA 1ZNYA 1UBCA 4HDQB 3RANA 4C0HA 2YINC 2WKQA 5ELXA 1Q21A 1U9IA 2WICA 4Q9KA 1IN7A 2C03A 4MRNA 2WM9B 4DB2A 1M34E 2O0KA 1W4CA 5IK2D 3IO5A 3FFAA 4BLSA 1G16A 2FDCA 1WMSA 4LJ4A 4B2PA 5J4LA 4M1KA 3ZVNA 2CK3A 2VTKA 4MDFA 2IS1A 2EFDB 3A58B 2ZUBA 1D2EA 4Q18A 3FYHA 5KDOA 5IF9A 3CNOA 2GF0A 2J7PD 4A6PA 2ZSAA 3FOZA 3RS7A 3W6OA 3U4QA 1KSJA 2PJZA 3SZRA 4RZXA 2DWPA 3KUCA 4AKGA 4W5WA 3K0CA 2TMKA 4GL2A 2W2VA 5FL7D 3T06B 5CLQA 3L0SA 5B2ZA 2HEIA 4M22A 5EXTA 3PUWA 1U0LA 2GF9A 2RMKA 2VQSA 3IBGA 4B3GA 1I4TD 4O25A 2L0XA 1SVIA 2QMUA 1GZSA 5GJCA 2IWHA 1VHLA 2ZYTX 3OE7D 2OFXA 4OHYA 4AIIA 5CB8A 2JJ8A 3HJNA 4Z54A 3LNCA 3VKGA 1LW7A 1QHHA 2K5UA 5JJKA 4URYR 1WE2A 3LBIA 1RYHA 1XFAA 2Q3FA 1N5IA 3NDBB 3CUEF 3SFVA 4TLDA 1JXOA 2HDNB 1UAAA 2IS4A 4FW9A 3F0TA 2H16A 3M0EA 4DLTA 2D7CA 1KIMA 5GJWC 2IF0A 3KJGA 5TVKA 3BC1A 3CF6R 2ZJBA 3IIJA 1VKJA 5TMPA 5J5CA 3EASA 2A9KA 2RCNA 4G5GA 3FFBA 1W46A 3UIEA 4JL8A 1ZW6A 3E70C 2PEYA 2JCSA 3W3AA 4W5HA 4CEHA 1AKYA 1LF5A 2C5LA 3FDIA 2OBNA 3QKSA 1DAFA 2FU5C 5C4MA 1T5IA 1H8HD 3KKMA 1JR6A 5JCPA 2ZREA 3LBNA 3U3JA 2CEAA 4RCYA 4RY2A 1ELOA 4LCBA 4MRPA 5DH9A 5HR5A 1W2GA 4KO8A 3GLIE 2ZYVX 3I1FA 4MA4A 2XNDA 4QFMA 4MKFA 4Q48A 1N0VC 4BZPA 1F6BA 4D6PA 3CZPA 2GXAA 2MSDB 3ZDQA 1MOZA 1E1RD 2CBZA 1TUIA 1MABA 5IRCD 4TL9A 3EZ9A 4C0BA 3HR8A 2A78A 1QG2A 1NJFA 4JLDA 2YKGA 3WMFA 3K0FA 4PZZA 4F92B 4KJZA 2IWRA 1OXTA 3U7EB 2VSOA 4V03A 3T1TA 2NTYC 5CJ2A 1R0ZA 4G5QA 2DFNA 5J4YA 1AK2A 2ZU0C 4FMDB 1OFTA 1XPUA 1Z08A 4ACBA 4ABYA 2GXQA 1KNXA 3C5CA 1E9RA 3T12A 4B47A 5AUQA 1IBRA 2GJ9A 4F4IA 1I2MA 2NO6A 1NN3A 1OJLA 3OIVA 2BMJA 1XTSA 2QT1A 4ZDIA 4CEJB 4JBXA 4KXFB 3BAFA 1KI6A 3CR8A 3HU1A 3I5YA 2FFHA 1F48A 4HATA 2RGXA 1NRJB 1J70A 4PSKA 3R7WB 5C18A 4X8MA 2G88A 4TQ9A 4C0KA 4NCKA 1MT0A 5JRZA 4UXIA 3TBKA 1O87A 1MV5A 2VHTA 1NN5A 3H1TA 3DMNA 2MSCB 4IXNA 3BFKA 4LBVA 1YRBA 4FI3C 1D6JA 1RYFA 1OYWA 4HAUA 2BCGY 5C4GB 3TQFA 1UKYA 3GFOA 1H8EA 2FWRA 2DPXA 4JBWA 2HV8A 1Z6TA 1GG2A 1II9A 2JJ1A 1VCIA 3G5UA 2JA1A 1SKYE 3THXB 2MMCA 3LV8A 3I62A 4U7DA 1W49A 2FZLA 3IKJA 2JEOA 1MH1A 1HTWA 3CPJB 4AYWA 4ZO4A 4NPHA 4IOMA 1YZNA 4LHWA 3LQRA 4JLKA 3DOEA 4PO9A 5KTYA 1X3SA 2BV3A 4FIDA 4HAVA 2JDIA 2PT5A 2IS2A 1L8QA 1OPXA 2FSHA 1J7KA 4RZ2A 4US2R 1KK3A 2EWVA 3AUYA 3AGPA 1VCNA 5F9FA 2WJGA 4KHZA 1ZP6A 3VR4A 4QJ4A 3DDCA 1KJYA 2PLRA 3IPXA 3TLXA 2CCJA 3VMFA 3JZAA 2YZ2A 4W9MC 3AV0B 1S0UA 3DKVA 2R6GA 2ECKA 3K70B 4QKQA 5EXPA 2NPFA 1SHZA 2CE2X 1FZQA 3QQ5A 4S2EA 1RE0A 4HYYA 2ZE7A 3NVAA 4MGIR 1D9XA 2WJYA 2VP2A 2CHQA 2C9OA 3QVVA 4WAUA 1D2NA 4FCTA 4EFMA 4OHZA 5KO2A 1OH7A 3OAAA 3K9GA 1GL7A 2ZJAA 4MH0R 1FPMA 3ADDA 2R2AA 5KU1A 1G8PA 1QHGA 5DGXA 2PT7A 2CJWA 4CW7A 2ZRCA 4BZQA 1E99A 2HT6A 4BFUA 2PZGA 3PUYA 3CH4B 4XTRA 5IT5A 1T0JB 4HUQA 1N6IA 1IQPA 3L8YA 1N5KA 4GNKA 4AWXA 2GEVA 2YC2C 3MWLA 5H70A 2QP9X 3I4LA 4ITRC 4PQYA 3SNHA 3T5GA 1Z2AA 1XBTA 4PC3A 1FX0A 2GRJA 1K8RA 1CU1A 1X8JA 2J7PA 5K8UA 1YU9A 2AFIE 4G01B 1AZSC 1YKSA 2VF7A 2AR7A 3PXGA 1AS2A 4B6EA 1CEEA 3SBEA 4MGKR 1N0WA 1P3JA 2J7KA 2QAJA 2OEPA 4RFSB 4A9AA 4BZXA 3AF1A 4A0HA 3KKNA 3VNVA 2BMFA 2FE4A 3IDQA 4Q02A 3FMFA 3UATA 4N3NA 1CR2A 1XX6A 4JVMA 1R7RA 1XP8A 2REXB 2RHMA 3RHFA 4IOJA 4JBYA 3WNCA 4ESHA 1T3LA 1P75A 3BB3A 3OE7A 4NONA 5CLLA 4H9GA 4DLVA 1OXXK 4GP7A 1TF2A 4NDZA 4QJ5A 4IJMA 2AWOA 3WNDA 4JYCA 3BERA 1IY0A 4IVQA 4L9WA 3L0IB 5A5GA 4CEIB 1OH6A 4MKHA 3JVUA 2EW1A 4K8OA 4HEJA 3OIUA 5EE9A 4DVGA 5CYOA 2BKEA 2PZFA 4M1MA 4QXAA 1B23P 2ZI5A 3B1YA 1XEXA 3UMRA 1OH5A 1A7JA 4FMDF 2XSZD 2GJSA 2ZRDA 3AH8A 1KY3A 2GVDC 3KXIA 4URXR 1F2TB 3P20A 2P6UA 5EUMA 1H8HA 1IM2A 4N0DA 1SKQA 3B13B 4GPTA 4EQ6A 1Q3TA 2Q6TA 3L0PA 2ERYA 4MYCA 1E1RA 4P31A 5AJWA 5J4VA 3B9QA 3GLHB 1N5LA 1P2VA 4IOKA 3CX6A 4HLDA 1VCOA 1Z06A 4ARZA 3U6BA 1VYVA 4LK2A 3DM9B 4HZUA 2EYQA 1P2TA 3H2YA 3PR1A 1HE1C 4PR0A 4LJ5A 2ZSDA 5L3QA 5E7JA 1E6CA 4TLBA 1QHNA 4M1WA 4JL6A 4TQUS 3T61A 2KB0A 4FD2A 3RS3A 4D4MA 2HF8A 2F3RA 3HDTA 3QKTA 5BN3A 5CIWA 4DDUA 4D80A 2LWIA 1EESA 2A5YB 1LY1A 4V0LA 2QT0A 2BJVA 1V43A 1XTRA 2NIPA 2ZE8A 1XTKA 1U99A 1IN6A 3U61B 4C0LA 3F5FA 1VG9B 3QUSA 3IO3A 4LWZA 2C9CA 3EPJA 3A1SA 4EFLA 1P61B 4TTPA 3KB2A 2F1JA 1BMFD 2J0VA 2EFHB 1CKEA 3MFYA 3CR7A 3UG6A 1U9IC 4KI0A 5AWFC 3AVUA 2PH1A 2EYUA 4P0TA 1EWRA 1P73A 2BEJA 4OQMA 2ZRIA 4BLOA 2FEMA 2IYLD 1KK0A 3S1AB 4EJSA 4LJ9A 2QP4A 3K9NA 1XF9A 2EWWA 2IYWA 4W5JA 2BJWA 5DN6A 1Z5ZA 4Q7JB 2ZI3A 4JVLA 4WZ6A 3RRYA 1KJZA 4POAA 4EPVA 1DAHA 3A4LA 4PPQA 4TTQA 2SHKA 2PMDA 4DUGA 3VR3A 3PFIA 1OYYA 2W6ID 1BS1A 3O8BA 1W7AA 2GETA 3K0CC 2ZQ5A 2XZLA 3AKYA 4I1OA 4LHVA 1P6XA 4C30A 3AM1A 3BB4A 2WKPA 4EDHA 2FGJA 2XAUA 1J90A 1Z63A 1SZPA 3MSXA 1Z07A 1SXJE 4PHFA 4XWKA 1G41A 4U5XA 1BH2A 5AK0A 1EFHA 4JIMA 2QQ0A 2BCJQ 4R2HA 5A4JA 4QBHA 4Z8YA 1KI4A 2WIBA 4Q1BA 2AK3A 5JEEA 1GRRA 1PVOA 2YOHA 2P67A 3V4RA 3MMPA 4Q7KA 4LYJA 4GRAA 3B60A 4BLTA 2FPKA 2KBEA 1NL3A 1E9EA 2BBSA 4BEBA 1FMLA 5JECA 3U4QB 2GBLA 3W5IA 3G82C 2UZ3A 4CVNA 1IN8A 2CVHA 2XB4A 3X1ZA 4IRUB 1OIXA 2G1KA 1PLJA 3KFXA 1CJVC 3EZFA 4M9ZA 2I3BA 1NVVQ 1Y63A 3N2IA 2ODBA 1MR3F 3B1ZA 4BLPA 1ZUIA 2X1VA 2QBYA 3AF4A 3U7FB 2OUKA 5H8WA 1G8GA 1YZKA 1ZU5A 2C77A 4A0RA 4EAQA 1G19A 1N6NA 2GJAA 1Q20A 3E2IA 1LS6A 5K8IA 3FGNA 1MO4A 1RJ9A 3GJ4A 4BFXA 1V5WA 1E98A 2V4ZA 3TR0A 1GKYA 5TARA 2C98A 2GWHA 2GK7A 4TL6A 1Y3AA 5FPSA 2WWYA 1X8KA 4HLCA 2OAP1 1XCMA 2IYQA 1A2KC 3D3QA 2CNWD 5F98A 3KUDA 2NZJA 3EZ2A 4Q1AA 2IT1A 3I92A 4UNPA 5JLJA 2IXEA 2O52A 2QE7D 1CULC 1G7TA 4NTZA 5EQTA 1W1WA 2J41A 3T35A 2IXGA 1R2QA 3I32A 2WSSD 1UPTA 3EIEA 5FOSA 1W36B 2Q3HA 1WBDA 4CEHB 1SULA 3VX3A 2JLZA 8OHMA 421PA 1E3MA 1ZMXA 1UBEA 3ZS9A 1A5TA 1NMZA 4P33A 2WIAA 1R5OA 5JSZB 5K8LA 3AVTA 2CMKA 1E9CA 5L3SA 1A4RA 4B3CA 4K81B 4I81A 4AY2A 5SZIA 4TLAA 5CM8B 2QQEA 3AVQA 1MABB 2AWNA 2VP5A 4O2LA 2XSZA 2HUPA 2MMGA 3SBDA 5C2JB 5HZHA 3U44B 2IX3A 3AF2A 1HUQA 1LV7A 3K0FB 2V55B 2YOFA 3DEFA 1KSFX 1S3SA 4PAOA 2WWFA 2QM7A 4YDHB 4Z1MD 4D82A 4UNNA 2Y8EA 3ZLJA 1R6BX 2ZRAA 1DS6A 1EX7A 4OYHA 2IHYA 1G4AE 1TX4B 3BK7A 2PX3A 5CK4A 1HA3A 2WBLC 1ZIPA 1TMKA 3Q72A 2E9SA 2XOKD 3HPQA 1GILA 1XRJA 1NN1A 2BBTA 2RGNC 3T1QA 3TIFA 4D4JA 3I5XA 4U00A 3U7HB 3W34A 3QKRB 1CF4A 1ZD1A 3SS8A 1GRQA 4Y0AA 2OT3B 4F38A 1Q57A 4BQSA 3HU2A 2IYXA 4GP6A 5CYPA 1EX6A 4KV9A 2F1IA 3ZD6A 1U0JA 3UMSA 4IDOA 2AL7A 4QNRA 1S9DA 3RS5A 2N46A 2R6FA 5B57C 1E2EA 5HE8A 1KI7A 1BO6A 3Q9LA 1GOTA 4TMTA 1FQJA 3GLGB 2WJJA 1OXVA 2GXUA 1EFUA 2C96A 4JLNA 2QRZA 1L2TA 3AVYA 3B2EA 3LLMA 3I8SA 4F7WA 3EAQA 1XMVA 4LJ7A 3FE2A 4TWZA 2GZAA 3C41J 2P6NA 3QIAA 3ZH9B 1BMFA 4PHHA 4TMZA 2IS6A 1FQKA 4I1VA 3LXRA 1P7CA 1LTQA 1S2MA 4B48A 1TL7C 3WBJA 1N3BA 5TY0A 3SQXA 2WVJA 4JJKA 3WYAA 4DSOA 3EPLA 5KSZA 2C9YA 1MO6A 2ZYWX 1ODFA 4P4UA 1DG3A 4FINA 2VP6A 2GK6A 3GFPA 4D4LA 3AP2A 2R8RA 1E94E 3AVWA 2FA9A 3ND9A 2V6JA 2O0JA 1IXRC 3IBYA 5AR1A 3X1WA 1S8FA 1JBKA 4OKSA 3QSYA 1E79D 1RW4A 3PEVA 4Q4HA 3R9IA 1G1MA 1NVUQ 3CF0A 5JWHA 4Q7LA 2WWXA 2RGBA 1EFCA 1UDXA 2QM8A 4IFBA 4JLOA 2W6IA 3MUFA 2O8CA 3IUYA 3LO5A 4TSFD 4AK9A 2P6RA 2BVNA 1P62B 2FF7A 4ILEA 3RS4A 3L0OA 1OLOA 4IDQA 2YC4C 1LFDB 3LDAA 3HU3A 3BH6A 5JRJA 1KJWA 2A3RA 5L3VA 5FBRB 2YWHA 4MUBA 3CRVA 1AGRA 5G3ZA 2ZJOA 4ZIRA 4M9XA 1KO7A 5GJVC 4S35A 1D8TA 4DDWA 3GJ5A 4NYIQ 3THYA 2QAGB 2E87A 2HF9A 3ETLA 2AXPA 1T0HB 2HCJB 4E5UA 5JCZA 2UKDA 2CE7A 2D06A 1E2JA 3W3ZB 4BLQA 3H84A 3AVOA 1OFUX 2G77B 2VF8A 1Z47A 4RVCA 2GHIA 4D25A 1VIAA 3LX8A 4LOAA 4NKRA 5AJZA 4YMVA 3N70A 3ADBA 4FMCB 4Q9IA 5LD2C 3CB4A 4JZKA 1ZCAA 1G7CA 5G53C 2XX3A 2P0EA 3LVRE 4RKFA 1DARA 4GT1A 3VU9A 1G5TA 3VX4A 2XTZA 5KUTA 1N25A 4Q1EA 1Q1ZA 4YMUA 1EFRA 3VNUA 4Y0VA 4OK5A 5E7MA 1FP6A 2J59A 4Q4AA 4B3FX 4DSUA 4AYXA 4PFSA 4C2TA 2RGDA 1COWD 1CBUA 3BJIC 1KSGA 1NVVR 3TUZC 2VRWA 3AP3A 2PLFA 3VR6A 1OE0A 4ZKDA 1KK1A 5FFMA 4AG5A 3TW8B 1Q1BA 2VP4A 2WAXA 4LPSA 1E2DA 1KO8A 3KZ1E 1QBKC 4RD0A 4RZ3A 4LHZA 4E07A 3LFUA 5D3MA 3ZJYA 1M2OB 1G8YA 4KBGA 2CNWA 2JLYA 2ZS9A 3PG5A 4MRVA 1Q3HA 3T5DA 2QE7A 5AUOB 2BMDA 1JR3E 1KO4A 3GLIA 4V0NA 4XVUA 1JQJC 2CL7X 3OIYA 5DI3A 5LPNA 2IK8A 2WSSA 2JLQA 3CIOA 4NCJA 3GLFE 1WBBA 4DIDA 2C04A 3GJ7A 4LZZA 4AG6A 3A1WA 2H5EA 1ESMA 2OM2A 3VR2A 1H65A 2ZI4A 3M1IA 4YMTA 2VEDA 4XSGA 2D7DA 1SVMA 1VHTA 1OFIA 1T3HA 2GCPA 4EQ6B 1ZD9A 1AQUA 4HSEA 1XJCA 3IQWA 1GNRA 3W8RA 2YWGA 1VCMA 5KDDA 2R6DA 3KB1A 1N0UA 1FL9A 2ZUDA 2VHJA 1RRGA 1E2MA 4PC6A 1PJRA 2W6JD 2A7QA 1VG8A 4IXMA 5EJEA 2PBRA 1NLYA 3ND8A 3PENA 3U7GA 4Z1MA 4EJSC 4IKEA 1NVWQ 3TJZA 2QU8A 3NBXX 1CXZA 2X2EA 3Q5DA 4GSYA 2QI9C 4BFWA 4DC9A 3B8HA 1XPRA 1E2GA 1XZQA 1Z28A 5KSPA 1J2JA 1T5LA 2WOOA 3IEVA 1R5NA 4Q03A 1RPZA 2XOKA 5A0FA 3BWDD 3I73A 1ETUA 3ZQJA 4DKXA 2O8BA 4QGHA 2BOVA 4JSTA 1N6HA 2XNSA 2YYZA 1DEKA 1WP9A 2AD5A 2ZJYA 1SVLA 2FGKA 5HZKA 4QGAA 1U90A 3FHOA 5G3YA 3QF4B 1M8PA 1OV4A 1II8A 1FMJA 5BYKA 2AK2A 3C16C 2PX0A 1KI8A 1OKKD 2VPPA 1S4QA 3FTQA 2GXSA 5EXSA 4CT4B 1TQ6A 1D5CA 1T6NA 4MRRA 4H1UA 4KYUA 1F2UA 2PZEA 1AA9A 4C9BA 2GCNA 2WMNB 4LDJA 1HH4A 1KKLA 4FCVA 4XIGS 1GNPA 1E9SA 4KSBA 2JLWA 3CO5A 5DYGA 3ECCA 4DT1B 4Q00A 2UZIR 2GBLC 3KTAB 2DBYA 1SXJD 2HYDA 1E9AA 1NKTA 1TU4A 3TAUA 4TMWA 2ORVA 4C0JA 2JLXA 1IJEA 2QORA 1C1YA 1L4YA 3UKDA 4R98A 1ZIOA 1YZUA 2GAAA 5FPHA 1W0KD 1MO5A 3KJHA 4TMVA 2GDJA 1HYQA 3ASYA 1M7GA 4IHQA 3TSWA 1AJEA 3K8YA 4O2RA 3GJ0A 2Q9AA 1E79A 4V0MA 3QF7A 1LVGA 3GJXC 2N1BA 3N5CA 1NN0A 2VHUA 2ZRBA 4AKIA 1HQYE 2OESA 3CONA 1GNQA 1N6LA 3A6PC 2EQBA 5DN6D 2HLDD 3O8RA 4LX0A 1P72A 4MYTA 4NCNA 4TSFA 4OL0A 2RGNA 4DRZA 3T1VA 4DUGD 1G17A 1Z0KA 4HUTA 4FMCF 2D4HA 2ZRLA 1QZXA 3MRSA 2O0HA 4DBLC 4ZCLA 2D62A 4QM7A 3OHMA 1JEDA 4ZKEA 2G83A 4LBWA 1XXHA 1UADA 4KFUA 2R9VA 3EWAA 3TGPA 1XCGB 1FTNA 2VH5R 5BN5A 3GP8A 2VBCA 3BD9A 3P4XA 1KAOA 3R9WA 1Z0FA 4K46A 4G5RA 2JLUA 1XJQA 4A8JA 4BECA 1KMHA 4C0AC 4D26A 3BXZA 3CRMA 2ZUCA 4JLBA 2N42A 1VG1A 3QXXA 4NYIR 4PZLA 2ATVA 5FUVA 2W58A 4V0ME 3ZZUA 1RFLA 5G41A 3AKDA 4A36A 2FFQA 1ZVQA 4I1UA 1JEEA 3NC1C 1TQ4A 4MYUA 4F4JA 2F1HA 2QMHA 3EG5A 3DM5A 1U8YA 2ANBA 4TMKA 4DDVA 2ZJZA 4WVFA 2W83A 1UBGA 3QEOA 2CVFA 1S1MA 3KQNA 2O8DA 2PCJA 1P9NA 2UVQA 2WJHA 2REBA 5UKDA 2RB4A 3PCRB 4C4PA 4PC7A 4I4LA 2GEDA 1XXHE 4XTCS 1COWA 5FH9A 2GNOA 2A5DA 3VHXA 1CLUA 2QMEA 1US8A 4MQBA 3HWSA 2Q9BA 3GFTA 4P4SA 1ZC3A 4Q9LA 1KGDA 1NKSA 1X6VA 1E2LA 1SHKA 5KHOC 2V6IA 3LH5A 2XITA 3K70D 2IXFA 3IQXA 1FUUA 1N6OA 2QPTA 4A1FA 3L82B 5JHHB 3K0EA 1G5RA 3AVXA 4Z8XA 5DIFA 3TUJC 1IXZA 4DIEA 4EKDA 1KMQA 1AKEA 3KJEA 4G0NA 4JMPA 2HJVA 3GEHA 4E03A 4EPXA 2J46A 4ERNA 2O8FB 2XXAA 4V02A 1HT1E 4PPFA 1GL6A 2X2FA 3HPRA 5AJVB 3OEED 2JLRA 1G8HA 2ZR0A 2Q3MA 3BE4A 3HP1A 3SU8A 4JLPA 1J8MF 4O3MA 4JS0A 4Q5IA 2BM0A 4W7SA 5CIQA 4D0GA 2IYSA 4WA7A 1I2DA 3GEIA 3MLEA 4B43A 4II7A 3V4FA 5GVSA 1DELA 2CCGA 3F3YA 3HYTA 3K0AB 1YZQA 3FWYA 3C15C 4IFEA 2XGJA 4NL4H 4EPWA 4DLXA 5EP2A 3RLFA 2C8VA 2IW3A 4MDEA 2W6JA 1QHSA 3QJYA 1K5GA 1ZUHA 3SJBA 4QL3A 1KDRA 4M9QA 2D74A 1KO1A 3MWJA 3AVPA 2OCAA 1GUAA 4KODA 1P9RA 4OHWA 2QTHA 1UBFA 1XD2B 1EXMA 5EP1A 3CF2A 2GEUA 3Q5EA 4A15A 3U3MA 1XMJA 3WXMA 1PUJA 4V0OA 4ZV4A 4NHOA 4Q4LA 4AI6A 1GL9B 2OE2A 2XB2A 1KI1A 4KFRA 4TZ0A 2DFLA 4L9SA 4XVRA 1P4SA 3TQCA 4ZCMA 3U6KA 1WQ1R 2B6HA 1UM8A 3WP0A 5F3WB 3O8CA 2ODWA 2BHRA 3P1JA 3RNLA 4PSAA 1CRQA 2YOGA 3P27A 2FMXA 1JECA 2FFBA 1M7HA 5DHFA 1A2BA 3FB4A 3QXSA 5FTKA 1EK0A 4PQRA 2QSZA 3C14C 4PTLA 4ZI2A 1ZNXA 2JGNA 2QENA 4LI0A 1OKKA 1T8UA 2H1LA 4M8NE 2Z4SA 621PA 2J45A 3NBZC 1NI3A 1ZAKA 5FPTA 3EIHA 1JXMA 2BBWA 1Z0AA 3GCGA 3WRYC 1UEJA 3TNFA 4D0NA 1TAGA 4WXPA 1ANKA 2WWHA 4DWJA 4US0R 5FUXA 1DE0A 3FKSD 3GQBA 4CT5A 1OIVA 3OF5A 3SOPA 1G6HA 1CS4C 1LS1A 2QTFA 2YNMA 4A4DA 4KLZA 4Q4HB 4A82A 4Q4JB 3B7GA 1NLFA 4PX9A 5B30A 4NYJQ 1DOAA 2IBMA 2HJGA 1SVOA 1SXJA 4RD4A 3EC2A 1KKMA 4GBMA 3X2SA 3AQ4A 4YONB 4I99A 2V3CC 2C95A 4WXRA 1W0KA 3FMIA 2BDTA 1VDZA 2QNRA 3T15A 2KJQA 3ZVLA 4DLRA 5TXGA 4A2WA 3B6EA 2QGNA 2J0UB 1R8SA 5DSZA 1KHTA 2QUZA 4WOPA 3SFZA 3W5JA 2BBOA 3QPVA 1NG1A 4LJAA 3V00A 2J0QA 5JJIA 3ZS8A 5E7IA 2HLDA 1GFIA 3A1UA 3QOFA 4RD6A 4XWOA 4F91B 3OIWA 2GVZC 4US1R 1CJUC 1JI0A 1ZINA 221PA 2IYUA 2ZYUX 3DO6A 4DLUA 4NP6A 1JPNA 2CL0X 3A1TA 1SGWA 2WJIA 1C4OA 1OXSC 2ZSFA 1QDEA 1VTKA 4CEJA 2WOJA 3UWOA 2OFWA 2ZR7A 4B76A 4C7OA 4Z51A 3THOA 2OBLA 4WZAE 5J40A 1Q22A 1G3QA 3KQUA 3P26A 3R7WA 2LKDA 5BW8A 4L4UA 4YLGA 1XMSA 3UWKA 1FW6A 3LD9A 1E0AA 1ZM2A 2X77A 3K09A 4E22A 3IILA 4MYHA 4B3DA 4Q1FA 3KFVA 4M21A 4LV6A 3CNLA 3SQWA 4EIWA 2B8WA 3CRW1 3L2OB 5FOWA 1GSIA 2OG2A 1XJ0A 1KY2A 2BKUA 4ZDWA 1D9ZA 5DHAA 3LQQA 3RRMA 3I61A 1TEXA 4FMBB 3TVTA 4R2IA 2J1LA 3SYLA 4BEJA 5B58C 2BC9A 1G9XA 4JT2A 1JR3D 3CRRA 2WAYA 2OILA 1KI2A 3NHBA 3RWMB 4NCHA 1G21E 5EE3A 2O8EA 2OLJA 3MWYW 3TR5A 1B0UA 2GESA 5IDVA 3ZZ0A 4OI2A 2HXYA 3UXMA 3CWQA 2VSFA 1ZM9A 5FBQB 3AB3A 1DPFA 2ERXA 2ZETA 4FWTA 2G9NA 2YV5A 4M1OA 2WWGA 4KVGA 4B2LA 3GLIB 1EFRD 4NBSA 4YMSA 2VHQA 1GDDA 1U8ZA 3D8BA 4FXPA 4AD8A 1G3IA 5HPYB 1NG9A 3KQLA 3BGWA 1QHHB 2WWIA 1G5PA 1I4LD 121PA 4NZYA 4PC2A 1OB5A 4UQOA 5KDLA 5DI9A 4WW0A 4CIDA 1WDTA 4TYYA 3ZGXA 1E2FA 1GITA 3NDPA 5SZHB 1M1YE 2VSXA 1UKVY 5HTKA 3SN6A 1G64A 4OQNA 2QROA 2CHVA 1G18A 3ICQB 4DSNA 1FP7A 5B64A 1PV4A 3OEEA 3W6NA 2QN6A 4QM6A 1ZNWA 5FR2A 5EP4A 3BH0A 4NH0A 1DO0A 5JWRA 4RD1A 1HV8A 3BS4A 5JS8A 3QKSB 2NPIA 4QBIA 1W4BA 5FR1A 2IL1A 4URZR 1YE8A 1G3RA 1TPZA 3AF0A 4KLNA 2OCYC 2Z4RA 4IVRA 4RD3A 3LWNA 5EP3A 1VIYA 1HEIA 1HURA 1SKYB 2I1VB 2ZI9A 3U3KA 2YWEA 1S1CA 3CLVA 4JLJA 2DR3A 3CPEA 4OI1A 1NVXQ 4NYMQ 4GMDA 1Z0IA 4HLUA 3UANA 4B73A 3NWJA 1ZM7A 3IEUA 3E5HA 4TN1A 1QVRA 3KX2A 4RFSA 1OF1A 4HB0A 3LXXA 3QXCA 2FV8A 2AD1A 3OEHD 2EFGA 3MJRA 4JLVA 5FUYA 1PLLA 3QG5A 4PAQA 3EA0A 1G4UR 4QHTA 1YVDA 3RS0A 3ZIAD 4UJ5A 1RC8A 2B21A 3CPHA 1CJMA 3AGQA 3QG1A 4B75A 1TQ2A 3T1OA 4UNSA 1KI6B 2R44A 2X19A 4FCWA 4KBFA 4DLWA 3QXJA 1P5ZB 2GJ8A 3V9PA 1SVWA 4QBFA 3NH9A 2F6RA 1KI9A 1G7RA 1L4UA 3L43A 4TT3D 2CLSA 2Q9CA 3SHFA 1X86B 2GTPA 3DPUA 4Q66C 1W36D 3C5HA 4JLMA 1NLZA 4QGFA 1YZTA 3PVSA 2C2HA 3RS2A 2NO0A 1OT3A 3A8TA 4M9SA 3A37A 1II0A 3X1XA 1YZGA 2ANCA 3PUZA 2EVWX 4A8JC 1AIPA 1R4AA 2FSFA 3FKSA 4XH9B 4QJ3A 2G1JA 5KNBA 4I1SA 1ZC4A 2A30A 1TF5A 1Z6AA 1F2TA 2A2ZA 5CDFA 5KNDA 1G291 2IHBA 4JYBA 3NIBA 3LAWA 4RD2A 3OFND 3VR1A 5BWMA 1DVRA 2RGAA 2W00A 1UKEA 1YR6A 1BYIA 1QRAA 1TNDA 2AX4A 2IUTA 3EZ6A 4HAXA 4Q7MB 1P9WA 1WRBA 4DCVA 2BIFA 3QE0A 3L8ZA 1E2PA 1E32A 4NYJR 5EZ5A 2QSYA 3GLHA 4YXWD 4AKHA 3TH5A 1W2HA 5H1YA 3B78A 3EPHA 5E95A 3ZQ6A 4ZPXA 3THWA 4LJYA 5DLQC 4EUNA 1OB2A 2F43A 2QTVB 3NEJA 5FTMA 3U5ZB 2XTMA 1RVDA 3LY5A 1W0JD 3BRWD 4TL8A 1O3YA 3C7KA 4IW3B 4MGZR 1KMHB 2W2XA 4HB2A 3SYNA 1G20E 4CGZA 1UEIA 2ONKA 4AKEA 1JAIA 5LBIA 1A82A 3BOSA 1E2KA 2HT1A 3TUIC 2G6BA 3KL4A 1OFHA 1FTSA 2NOAA 3WRXC 2CJWB 3SYKA 4B6FA 4DEYA 1R0WA 4X8LA 4Q01A 4B71A 2QL6A 3WHKA 5CDFE 3BIFA 2VP0A 1YRAA 2OXRA 4LC1A 4M1YA 1XEWY 4R7ZA 2KE5A 4BFVA 4TQAA 1S3GA 4X8HA 5E3HA 2FX3A 4HUQB 4RJLA 3IIMA 3SI7A 1ZNZA 4CZ2A 2RHDA 3LRPA 2H17A 5DE3A 3GLHE 3TW4A 4TYNA 2NGRA 2RGGA 1IY2A 1FX0B 3VTKA 4BFSA 4LSGA 1RRPA 5CK5A 2V1UA 2ZTSA 3S1AA 3TAHA 1JR3A 3B85A 5SZKB 3TE6A 1OIWA 2RKOA 4A2QA 2QP3A 4XOIA 3GLFA 2NG1A 2ODNA 4JVNA 4TLEA 5HKKA 4QG7A 3IHLA 1EWQA 1RIFA 2GJKA 2A5GA 3ZVRA 3R8CA 4RCZA 5FPKA 2D2FA 4KAXA 4RZUA 3U3OA 4D0LB 1GP2A 4J0QA 3TMKA 3B1XA 1OSNA 4HAZA 3SR0A 2ORIA 4OI0A 2ZU6A 2ZSEA 1MRSA 4LGMA 4MRSA 2R65A 2XJ4A 3OESA 1E4YA 1SVSA 4LUCA 5SZJA 3SJAA 2XXAB 3UPUA 3Q85A 1SQ5A 5FTLA 4LPKA 2J9RA 4L8GA 2ZS7A 4B33A 3PEYA 3CBQA 3CNNA 2DHRA 2WPDD 4ZI3A 1W47A 1N6KA 2EFEB 3REGA 3N2EA 2WZQA 2NO1A 5KOYA 2FEOA 1DADA 2Z5FA 1EFTA 4B35A 2ZRGA 3NH6A 3VR5A 2JLVA 2J87A 1E2HA 3H4MA 1XEXB 4PPGA 4RKEA 5LD2B 4TMXA 1M7BA 1XDBA 3MG9A 2ZROA 2FJUA 1JQLB 1UFQA 4OHXA 4HDOB 2OV2A 2OXCA 4PO8A 2FNAA 2E1RA 3KXKA 2IUSA 5JMTA 1K6MA 3P4YA 2BMEA 4HZIA 1T4GA 3EARA 4EPYA 2ZXUA 4C3ZA 4ZDKA 3FHTA 1L7VC 4NE2A 3C8UA 4JL5A 4URWR 1SXJC 5E4FA 4NCIA 4G3XA 3WP1B 4HAYA 3QPUA 3QKUA 4LJ6A 2QPAA 4ARZB 1JPJA 1M6NA 1PUIA 4HZUB 2OZEA 3B1VA 2OSBA 5LB2A 3SE0A 4B3BA 2VLIA 3WBKA 2IEYA 3P32A 1DAGA 2GILA 3E1SA 4LV5B 2QG6A 1XD9A 3OEHA 3WYFA 5L3QB 2OAQ1 1FFHA 1FUKA 1WCV1 2ATXA 4KYIB 4U02A 4A92A 2AKYA 3ZIAA 5IHPA 3ZZTA 4OJKA 4NYMR 3W8NA 4BFYA 4JJZA 4JKYA 2OHFA 3SC3A 4RFVA 4NMMA 2GCOA 1AGPA 2KWIA 2ZI6A 2I1QA 3QI2A 1Z8FA 3FKQA 4TT3A 4B2IA 4PZYA 3VHLB 3EIQA 2YJTD 4KU4A 5GVRA 3RSLA 5KYKA 2YWFA 3BB1A 2A5FA 2WJVA 3NXSA 1IONA 2HCBA 2ZEJA 1SXJB 1E0KA 5DYIA 4QRHA 2REOA 3Q3JB 4LY6A 4QBGB 2MSEB 5JSZA 1P2SA 1ZBDA 3K09C 3K9LA 2IF2A 2ZR9A 2QY9A 3OZXA 4EJSB 3PV0A 5FBLB 1AM4D 4QOSA 2VIIA 1F60A 3U44A 2F1RA 4KFTA 3M6AA 2JASA 3ADCA 2CDNA 5TV2A 5DISB 1ONBA 3DKPA 3KQHA 4KCGA 3PEWA 2ZRKA 3OFNA 4YC7A 5AUPB 1RRCA 2QGZA 4LHXA 1VECA 2OCPA 1NIPA 3GD7A 2KBFA 5CB6A 4LJ8A 2F9LA 4YXWA 1X1RA 2X8AA 2V1XA 4HB3A 5GJBA 4P4TA 1SVKA 3EC1A 4C7OB 3SJZA 5J47A 2OBMA 5FTNA 3R20A 2G0NA 2ZM5A 3QKRA 2ODEA 3MAAC 4GFDA 3GPLA 4HDCA 1FNMA 4L16A 1W0JA 4YQFA 1E96A 3RYTC 2H18A 1HE8B 4G5OA 4HB4A 3BBPA 4MITA 1BOFA 3NBYC 2QRNA 5DO9A 3TKLA 3U2QA 1E0JA 3ADKA 4BGDA 3K70C 1KAGA 1A1VA 3JZMA 3KKPA 2CLDX 4OK3A 3D6TB 2H8KA 2I4IA 3DMDA 3EA5A 5JI3E 2DYKA 2NZ8A 3GJ3A 5FTJA 3GLGA 4OQXA 2NO7A 3W6PA 2VL7A 2BM1A 4O0MA 1G7SA 2VO1A 3Q7QA 3I72A 2O8EB 1QHIA 4Q9HA 1ZU4A 2YHSA 1CJKC 2QEQA 2CXXA 1RZ3A 1NP6A 4Q1CA 4GOKA 5BN4A 3KJIA 1HY3A 2Z83A 4DCSA 3H0KA 1YQTA 3R9XA 1ZYUA 5H68A 4IVPA 1KOFA 4IDNA 1MRNA 4YMWA 2QBYB 1U8AA 1QHXA 3NHAA 3O47A 2D3WA 1WA5A 1CR0A 1AS0A 1S9HA 4GI7A 1CP2A 2FOLA
chains in the Genus database with same CATH superfamily
2OTLI 1TYBE 4DEXA 4ZEXA 2VZLA 1CUIA 2V4UA 5FB2A 3ZVMA 4DCUA 3AHEA 1L9XA 1TC1A 3R4VA 1S5PA 5ITWA 3ZGZA 3WK6A 1OXUA 3A3YA 2DO7A 4LRWA 2A0KA 1KRXA 4TS9A 4IRGA 1HQCA 1SANA 4JUIA 3H3VK 4ESVA 3QW4B 2BTOA 5FIUA 2R7KA 4B3SB 4IHAA 2HXSA 4JOSA 5H0IA 1Z6ZA 4E2ZA 5E1XA 1QIMA 2ZJ8A 1R8QA 3HLYA 1NVFA 1L7AA 2P8SA 3DBRA 1SKUA 2BEUA 2NSJA 5FI1B 4HFRA 2ECBA 5ADHA 4BY1J 4FJ0A 3AU8A 4G2TA 3HKCB 1T0PA 3SZ3A 4DLYA 1E1LA 1VC2A 3EQ2A 4HX9A 5JCJD 2ZVPX 2ZSUA 4M1SA 3OJCA 1TWAJ 3F9IA 4IF4A 1VZ2A 5IJ9B 2ZITA 4OLFA 3JYNA 4B3XA 3N75A 2NZUG 1TF7A 4K6OA 5JFRA 1FIPA 5EJMA 3IQEA 1KA8A 4D4GA 2WG1A 5FFXA 1Z5WA 5F2EA 2GN0A 3KXLA 5CDGA 5LDDC 4GGMX 4AG3A 4DZJA 4O4IF 4FJ1A 2XYHA 2XDAA 4NICA 4B74A 1YJWI 3WNZA 5DM7F 3EGXB 1CUSA 3DMFA 1KYIA 3KSMA 4GECA 1WZEA 5ALQA 4RULA 4RKYA 3LQ2A 1ILWA 3B6IA 5JJLA 1U8EA 1UT5A 1WXXA 1PL8A 1WEKA 5JD3A 1E69A 2IYVA 5DHTA 5GPBA 5EA2A 3NEUA 2ESHA 5CM9C 3GPCA 1OHHA 4F8YA 1Z0JA 5LRRA 2C7VA 4PSXA 3VUEA 1K7XB 1W4AA 3DJYA 3FB1A 4FDTA 4IDPA 5BMVB 4MKGA 4NG4A 4G24A 4CYMA 5GIPE 2F5VA 2NRAC 3LSRA 4LEIA 2CXNA 1E1QD 3UT5B 1FFEA 4IH9A 3H86A 1V16A 3DJFA 1T9GS 2NUTA 3ANTA 4HDSB 2CXQA 3LP6A 3CGWA 2HKXA 1Z83A 1RYNA 2HPZA 4FKZA 1DLJA 3WGVA 2QRVB 4WN3A 3KT8A 5ICEA 3B82A 5J4KA 3LUPA 3FMPB 2CUEA 1DB3A 3F21A 1BZYA 4E11A 3KP7A 4Y9RA 2R7ZJ 2WAFA 1MDBA 2XZPA 3NHLA 2D1SA 4TWBA 4H7KA 2IDKA 1IZ0A 2PXHA 3S2YA 1N32B 1WH7A 1II8B 1N6PA 4JEUA 1J07A 2F00A 1PLKA 4ZGWA 4KLRA 1JB9A 4WIAA 2ZYAA 3KB8A 3PUVA 4ASUA 2X0IA 1PSDA 2GPBA 3M33A 4CIAA 1C7IA 4GRDA 1Z6QA 4RF5A 2YJGA 1KBZA 4BUJA 4JYZA 3SE7A 2POCA 3F8TA 3Q7PA 3N58A 3L18A 3PUKA 5JFGA 3TJMA 4HEA2 3EQZA 5DKFA 2VPQA 1EH6A 4HAWA 2XB0X 3KTDA 4J4TA 5B5SA 2DJNA 3MD0A 1P31A 5IN4A 5KNLA 2CHUA 2GARA 2PG3A 1R0XA 1YLFA 2VF4X 4W82A 3X1YA 4BP8A 1TUGA 2G36A 4RK4A 4PLVA 3RUHA 1QP4A 5E1OA 1K8QA 4BRWA 2I03A 2HRCA 5FOTA 2HU9A 1JWBB 1YVEI 3NBMA 2FFAA 3GA5A 2QR2A 2XVYA 5JNTA 5ALVA 1EDOA 5L6LB 4O1HA 3B6AA 3GVCA 1TCCA 1CR6A 1V3UA 2CLLB 1YDFA 3UQYS 4P4SB 5LVAA 2AXNA 1AZTA 4LCJA 2OFOA 4ZCQA 2ID7A 1T91A 3KBOA 5JO9A 2RH5A 3IKLA 2FOWA 2FPXA 1TTPB 2X2PA 5C80A 1ULTA 2QQAA 3W2WA 4YJHA 2P4WA 5B1AH 1G3MA 4G0UA 1UBCA 4HDQB 4MRNA 1MD9A 3TW6A 1W4CA 2EQAA 3FFAA 5LQAA 2JH3A 3JQFA 2INGX 3HUFA 4M8SA 4R8HA 4WJKB 3O95A 3WKEA 4A6PA 3VAYA 5GOTA 1S89A 1DP4A 1D1BA 4CR7A 3EYWA 4GL2A 3HEAA 4M22A 1B8UA 1HMYA 2QRLA 1QQ6A 2CW0F 1WE2A 3G2NA 2Q3FA 1WUYA 2JPCA 1UAAA 2XIQA 4BCDA 1OZHA 3N87A 1YQEA 3KG2A 1KIMA 3G9UA 1PV2A 1WETA 3UKGA 2FSWA 13PKA 5J5CA 2B36A 4G5GA 3DBLB 3OCUA 3EN0A 3FDIA 1DV2A 1SA0A 2ZREA 1JAXA 2C5AA 5DH9A 4LCBA 2GI4A 4BNXA 3MB5A 3BULA 2P1ZA 1H4QA 4XFKA 4UNIA 2FQQA 2GO1A 4MVJD 2V58A 3C87A 3HGGA 3DCYA 1ABFA 3UHJA 1CYDA 4UDYX 4M87A 1VJDA 4N5DA 4HLNA 4UXNA 2R751 2PJPA 3H42B 4MLDA 4DY4A 2RGXA 5J2TB 1MT0A 3GP5A 1YULA 1RIOH 4QUHA 1PP7U 1YRBA 2BSAA 1WCIB 2JJ1A 1DFIA 2VLBA 1BJKA 1KEPA 2FZLA 5HOOA 5AW3A 1U8XX 4XNFA 3RPUA 1QTRA 2PT5A 1WMAA 2JAHA 3AGPA 4KQJA 1ZP6A 2OHOA 1ZD4A 5HFJA 4ZTJA 3L02A 3WGNA 3OYAA 3N05A 4WAUA 2VAVA 4K9NA 3QFHA 4EFMA 4MVJI 1W7PA 3ZMVA 4C2MJ 2VNKA 3UNGC 4MV4A 1V8BA 4UBNA 4ENSA 4MQ6A 4INAA 3MZ0A 1UJ8A 2HRQA 5IW8A 3TW0A 4JX4A 2XVMA 4FE3A 1HZZC 1X8JA 4OAQA 3I64A 1KEEB 1QA6A 4INJA 4Z86A 1KWKA 1EGHA 2WUVA 1VBKA 3SYRA 2VBYA 2VJDA 5HCUA 3LC7O 3ZI7A 2XMZA 4M46A 2XE4A 3LVBA 4A69C 1B6TA 1NASA 1FBTA 3DUFB 2R5FA 2XSZD 2WD8A 1UZMA 5JQGF 1LE8A 1NTRA 3CTPA 4ZC1A 4G1MB 2XB9A 4R2KA 4QYXA 4Q4DA 4I8DA 1O3RA 4QXPA 4GRIA 5LGTA 1EUYA 5DFAA 3IUMA 4YQZA 4U7WA 4HLDA 5KTMA 5H3HA 4LK2A 1OGJA 4MIYA 3VHQA 4TLBA 3JARA 2HF8A 2PGNA 3QKTA 2D6FA 4D8WA 4F4UA 3PNTA 3C2GA 3F5QA 4XDHA 3NBQA 4YAIA 3SICE 2D00A 1CF7A 2QN8A 3K1AA 3KB2A 1GQYA 1XTUA 1PU2A 3MFYA 1P0MA 2G7UA 4RORA 1P73A 4ID9A 4UM9D 2ZBKA 2PX9A 2QP4A 3KQSA 1GTZA 2V9VA 1PWZA 1LVUA 1MFZA 4BKMA 1JIIA 3PFIA 1OYYA 4LHVA 1P6XA 3TIVA 3VDXA 1EVIA 1T2CA 2OP0A 2BF4A 2B0JA 4XWKA 4HQ6A 1PFWA 5AM3A 2L4AA 2VHXA 3DLCA 1J8VA 5IP9J 4Q1BA 1UZAA 3MMPA 4G23A 2VQ3A 2CVHA 3RAEC 4YRKA 4PJ0C 5IH3A 3OX1A 2QBYA 4D1QA 2X1VA 4CLDA 5LZ7A 5L3EA 3GG9A 1KORA 2Q49A 5C4IA 2NT3A 4TT8A 2BEOA 4R4JA 3KUDA 2NZJA 2IT1A 2FRDC 5EJIA 5LYJA 1R5GA 1Z3XA 2IXGA 4GXOA 5FOSA 1Q15A 1E6WA 4TWAA 4L2IA 2GXGA 4BZWA 2R8PA 3EBPA 2A9FA 1OYVA 3IALA 4ZP1A 2WIAA 5ALPA 1E9CA 3GLSA 3L9XA 4K81B 4YPVA 4EX7A 5CM8B 5LZ9A 4B87A 4PS1A 5KWIA 4M3DA 1LV7A 4FUQA 4M98A 3DEFA 4YDHB 1B0AA 2FVXA 3TWOA 4U3JB 4UHJA 4R1PA 1UJCA 4PJMA 1SURA 1NBEA 4UZFA 5EGOA 2LBPA 1STZA 4NMLA 1GRQA 3MQ4A 4F38A 1M0EA 2K27A 1ACIA 2A7XA 1V7ZA 4CZZA 5DRTA 3W4JA 1A5ZA 4GYWA 4B5KA 3EYIA 5JFOA 4K3VA 3P52A 2WSBA 1RXEA 1FFGA 1S7AA 1JXAA 3JTGA 1L4EA 5KAIC 1LSSA 4NDNE 1J23A 1ODFA 1FU8A 1T9GR 4ZOQI 5HXAA 3AP2A 4RVOA 2NVWA 2BT4A 1KOGA 4QFCA 3QSYA 3AILA 3HUTA 2ME0A 4E12A 3EG9B 5I9MA 3G2QA 4YCCA 4TSFD 3J7AC 3L00A 4M73A 3VPDA 3PC6A 4JJFA 4S35A 2K4BA 1G9TA 2NP6A 3WRYA 2QAGB 2E87A 3OKCA 3SCZA 2Z33A 3QLJA 2A1IA 5FNVB 1S5LC 1YZVA 3FGOA 4RVCA 2ZW9A 4WH0A 1K7YA 3JD4A 4YMVA 5FOQA 1GR1A 4FYXA 2ACWA 2V5AA 3K10A 4MVXA 3VU9A 1LEHA 3T3OA 4F3TA 4RZHA 5I9IA 1KQ3A 4HNHA 3C70A 1EXVA 4I6ZA 2IHJA 2VASA 4NBLA 4OQPA 2MU1A 1SQ0A 3T5DA 3ELBA 1B3BA 1WSUA 4BV3A 4JUFA 1ESMA 3RGGA 2D7DA 2QIOA 2A9OA 1XJCA 1WJFA 1QQTA 3FAKA 1H6BA 1E2MA 1PJRA 4Y33A 3QXGA 3CJQA 3EXFB 1JHVA 4TUYB 4I99C 3RIXA 1PJSA 4F4FA 4Z1MA 4DLKA 1WV0A 4EFKA 4ECAA 2XOEA 5I48A 2HSEA 4QICA 4FXOA 3HRIA 5HZKA 2P0YA 3N1UA 1P3Y1 1CZRA 4DC1A 1U9ZA 5E8GA 2MLKA 4MARA 1XSEA 1PVEA 3DE0X 3FPLA 5B3AA 3RO7A 4CT4B 3WK4A 4HF2A 1OR7C 2ENWA 2VCHA 2QXTA 5EQFA 3GHHA 4HSGA 4L7VA 3ECCA 1JKMA 3JRNA 1E9AA 1LX6A 2H9YA 3R5TA 4C0JA 1YI1A 1F06A 1YZUA 5HSGA 3H87A 2M1ZA 3AL2A 3ASYA 4IHQA 5E3NA 2ZVDA 2PL5A 2ZIXB 4FETA 3HA7A 4AKIA 4CE6A 1ZH0A 3BL8A 5ALTA 1I6MA 5K05A 4DAEA 3G9TA 5EG5A 4IEFB 1JEDA 1OX6A 3TOCA 1YE3A 1FTNA 2VH5R 3FF1A 1ZXBA 2QL7A 3ZHOA 4ETMA 3IAM1 4AAYA 5J6XA 3PNMA 3L6DA 3QXXA 1IBLB 1JT9A 4DXHA 4F4JA 1VKZA 1OTHA 1GPLA 3DM5A 3FZVA 4XM3A 1UUFA 2GFQA 2WA1A 1H2HA 3KQNA 2REBA 5B6PA 5K6TA 1JJ8C 3DTVA 1IHYA 1UT8A 2YUSA 5A5VA 4QQ8A 3R6WA 5THXA 2IXFA 1YK0A 1N6OA 3MZ8A 1O89A 2PS3A 1MSEC 2PKWA 2YRXA 1F4VA 3UJPA 5DNCA 1JKFA 5H02A 3HPRA 2RKBA 2X2FA 3BE4A 4AJ4A 4O3MA 1J8MF 5AOBA 1RLMA 4B43A 2AA3A 5BQTA 3FWYA 3NTXA 5DX0A 2HD4A 4MDEA 2AFHB 1UC9A 2XE8A 1ZMTA 5KQSA 2PUDA 1ORIA 1GUAA 4NJMA 5E9JA 1XMJA 3WXMA 4TV8A 4CF3A 3TRHA 2O05A 1P4SA 5DLPA 3GR6A 4H0NA 3FWZA 2FFBA 5EPOA 3QXSA 3B48A 2PX2A 1TWHJ 1DQRA 3TO7A 1X7DA 3D7NA 5E3IA 3S1RJ 2BBWA 2EPFA 1ANKA 4AJOA 2XYQA 4YJ2F 3H2GA 1J0RA 2YNMA 4KLZA 5A06A 4R40A 2HK9A 4PX9A 3L4SO 4XM1A 2IBMA 1ETYA 4QT0A 5MN5A 4XQFA 1AB5A 4I99A 1CX9B 3JVEA 1EWYA 4YPFA 1GTG1 1L5GB 2QVCA 1UXKA 5DSZA 5FWYA 4IS3A 4CWAA 5BW4A 2YVLA 1RZ4A 1GFIA 1F12A 4XWOA 2BDUA 3EGCA 3OIWA 4US1R 4K9QA 4RA6B 4L0CA 1FTGA 4F3YA 4I6GA 5IAEA 4YUXA 2ECCA 4UDXX 5JXJA 4ZQBA 4IEJA 3IILA 3ANXA 4XDYA 1MAWA 3NS7A 1ZA2A 2XUJA 1GSIA 5T6MA 2ZQZA 3S2DJ 1TYEB 1RI2A 3K1ZA 1JR3D 2EHJA 5FRMA 3SZOA 1O6GA 4I3FA 2OLJA 3MWYW 3E7PA 1RHMA 1B6SA 2ERXA 2ZETA 4FVTA 5JHFA 3I58A 3WWPA 1EFRD 4BXXJ 3EPRA 2XW6A 2NUPB 4GYGA 3UWMA 4UUNA 1OKRA 4JX5A 2YR2A 1A71A 2AF3C 5J63A 2CHVA 5FGMA 2PFGA 1O9GA 3L8HA 1W4BA 4PRYA 2VYNA 4IGKA 2C2XA 1OYIA 1G42A 2RSLA 2ZI9A 4B1RA 1CEXA 1L4BA 1BS2A 1Z4NA 2JFVA 1DZ3A 3GLKA 3IP1A 3NWJA 2FPPA 1F8GA 3M3YJ 2DODA 1SWWA 5JAZA 1YVDA 3D1JA 2DQZA 2D0OB 3ONVA 4KMUX 4QTYA 3QVGB 1N34B 3NH9A 1X58A 1E3TA 1PNOA 5EWLA 1JFVA 3WZ2A 5ERGB 3AF5A 4DCPA 1MIJA 3HGMA 1G20A 2COBA 1AIPA 3DKKA 4AUMA 2V5UA 3UICA 1Y3HA 4ZZDA 4MDHA 3ZP5A 3NC4A 3LAWA 4HPJB 5BWMA 4Q7MB 3PLNA 1AK1A 3TM4A 4JC4A 2QSYA 2CL5A 4B40A 2FOXA 2FUG2 1UEIA 4E32A 3KC2A 4FDLA 1JAIA 1ZO8A 4K9SA 1OFHA 5ECDA 5BOVA 1R0WA 3W79A 3GLTA 5H6RA 1S3GA 1GL3A 4MUGA 2IW5A 2RHDA 3GLHE 4WBNB 2QZJA 1QK5A 3TTUA 1RRPA 4BVGA 3QPLA 2XGSA 4Y98A 3G5TA 1M8KA 1A5BB 2GJKA 3IVMA 3BWCA 1GP2A 1ZI6A 2JFOA 5HG0A 5JU6A 2L3DA 4QD3A 5DD4A 3KOUA 1J24A 3R5KA 2D8MA 3K9BA 4ZAFA 1JILA 2Z2KA 2UUOA 3NH6A 2PRKA 4YTEA 3AONB 4MAFA 3K30A 4PPGA 4FT2A 4IJUA 2ZROA 2VJKA 1UFQA 3K6KA 1MBKA 2FNAA 2LRHA 1U2GC 3KJQA 4P81A 1RU3A 3JD0A 1JKRC 4ZDKA 1O6CA 5D8KB 1MG0A 4L1KA 1CUFA 3U1DA 3IHKA 1HA8A 1H2WA 3GRZA 3HVJA 3ZOZA 4B3BA 4HDRA 2IH5A 4DUPA 1S8AA 5CXQA 3ZZTA 1N9GA 2W84A 1ERDA 2PTGA 4ARVA 4R16A 4D9HA 3U16A 2ZI6A 4E5NA 2BH9A 4BC0A 3RK0A 3ND7A 2QTGA 2WWTA 3GGCA 1N2XA 1SXJB 3OA2A 5HUJA 2H1IA 4QRHA 4Y9TA 1BH6A 3ENQA 1NF2A 3M3DA 1LPAB 1MUUA 1KONA 3KETA 2M9MA 4BGIA 4MPPA 5FPQA 3DHNA 1TKBA 2E4YA 5TV2A 1LPQA 5H83A 3J7ZI 4J94A 4K1XA 2DFFA 3K0KA 3HM9A 1WMFA 4JP3A 5CLJA 2DLDA 4D9BA 5DW3A 4YCAA 1FNMA 3OYCA 2FRXA 3PQ4A 3AYZB 4UM7A 2ZMEA 2IA2A 1JGTA 2FZCA 4OQXA 2CGEA 5IBPA 1BX0A 2F3PA 3NVKI 4B81A 1JSRA 1R6TA 5F1YA 1ZI8A 2HLPA 1JLHA 1B41A 2FOLA 1NF3A 3LUKA 1C7ZA 2VIXA 1B59A 1WZUA 4KAAA 1UBNA 4IXWA 3BXPA 2ZJ3A 1MO3A 4IR7A 4EEXA 2PX6A 2WMYA 3QX8A 2ZYSA 4ZK2A 4MQ9F 1T38A 2AQHA 1YR8A 4TV9B 4BPBA 2WPDA 2FPWA 4GPZA 1CVIA 3NWPA 3RBVA 4ZCIA 5KYUB 2JVHA 4HRYA 3IUPA 1YL7A 3QVJA 5HNKA 4OIOF 1IY1A 1YG2A 3QENA 4J90A 1CSEE 5AIBA 2B8TA 1HMPA 5DEIA 3C18A 2JJYA 1QIKA 3GGGA 3ORFA 4G4SP 4QOEA 4I50F 4W1UA 3QVOA 3D8SA 3C24A 5AVSA 1B6RA 2J3EA 4ZVNA 4EI9A 2DT8A 1M2OA 4D4IA 2F4OB 1WPGA 4HPXB 3ZXUB 1J99A 3CC7I 3KYDA 1RJWA 4JKOA 3M6VA 1SCDA 4PK4A 1A8IA 2ASEA 1OLXA 1SFRA 2Q9UA 1AUOA 1X3ZB 2B4KA 2IPMA 1WOYA 3NC0C 5I9SA 3P19A 3ORRA 1NMXA 1X8LA 2WY7Q 4LF5B 2COUA 1B8VA 4PXYA 1JQ5A 4GKAA 3Q8LA 4YDSA 2IBDA 2G76A 4JBGA 5KTKA 3HA3A 1SUIA 1I1QB 2HJSA 5AUNB 4ZDJA 5JY6A 4ZJUA 1TVKB 1MW7A 2OC6A 4GX0A 4IJQA 3OE4A 1CUEA 2RHRA 4PCAA 5DXAA 2QR5A 1XZEA 4Y2GA 2F3TA 1EVQA 2SICE 1Q0RA 5C81A 1KZGB 2P65A 3NKVA 5EJCA 3QVMA 1QVUA 3U3RA 4LZAA 1JKIA 3EXIB 1Y1WJ 3COAC 1M2KA 5JJ5A 3TDKA 2G9QA 3L2WA 2P5SA 3BF8A 1DG9A 4ND8B 2DKOA 2SBTA 3VPBA 2VT6A 2QXUA 2PG4A 2V8OA 4AULA 2GRAA 3NNDA 2I7TA 2I4MA 3AOGA 1UJ2A 3MXTA 2NYVA 3UHPA 1KK2A 4IINA 3G2BA 1B74A 5CP8A 4V39A 3HKDB 2FBHA 3FBNB 3WYBA 5JBQA 3TW7A 1YJ9I 3FUVA 4IKFA 2FQWA 1YFZA 2CLCX 4F72A 5IAAA 3QWAA 3K0BA 3M7GA 1TQ8A 4IILA 1UR5A 4CM4A 3K0HA 2K4JA 4FR2A 2ZAGA 4DV7B 4Q12A 2MWMA 2PGXA 4UZEA 1NDHA 1ETOA 1H1TA 4EG8A 4Q93A 1ZJ4A 5K51A 3STXA 1B15A 2VRNA 3C7TA 4JWKA 3S3TA 4YCMA 3NX4A 3OZCA 5EE0A 2O8BB 2W6ZA 5KWJA 4MPRA 3O2SB 2VA8A 4BNNA 2R0QC 3A9TA 4IWNA 1YS1X 3A4NA 2Z5GA 4CM7A 4IIFA 4Z1OA 2CQ7A 1F2UB 4DUZB 1KDTA 3SDZA 5EUQB 3LUCA 4QAQA 3U3DA 1GYPA 2HPVA 1I9CA 3WZMA 1A4UA 2KYRA 4J0FA 3WMRA 3LWDA 4BFZA 4MVYA 5BV2P 4BMSA 1QBGA 5DXFA 4CCYB 4PU0A 1VMAA 4PF1A 3TQRA 1O3TA 4DXAA 4DG8A 1T4MA 1AG9A 2G25A 1PQUA 5JLAA 1P4AA 3D31A 4G81A 5H2FC 1ZAYA 4KFSA 1UJ4A 1DBSA 3KPWA 1OLUA 2VNJA 4FMPA 3MUNA 5CH8A 5AIPA 5BN5B 1BW9A 4BXOA 1B8IB 2HPHA 3T3MB 1MHPA 4ER3A 4Q34A 4W63A 4NPAA 2TSYB 5JZVA 4DR1B 2YW2A 4OJQA 2ZTLA 4PSVA 1GWNA 5ARDA 2C3PA 1SMYF 1IUPA 3T54A 1K7CA 2Q3CA 2XWJI 3I05A 1RP1A 3SIWA 4XGRA 4LDZA 2IEZA 2G0TA 4OI4A 1NSFA 3B1JA 3GJSA 2XTJA 3KKZA 2VNHA 4OF4A 4Q37A 4GM1A 3DL7A 3TNJA 3UHOA 2HGCA 1C3EA 4YJKA 1TKCA 2CQNA 3RYHB 2ZUBA 4PNPA 3QFSA 2ZSAA 4ZTZB 1JUDA 1GEEA 5CG1A 3EQ6A 4I5FA 2K85A 5CLQA 3QVWA 3ENNA 3B6MA 3ENKA 2VQSA 5CT6A 1DEHA 2GYWA 4OHYA 2JJ8A 4Z54A 5JJKA 3A04A 1QHFA 4CU5A 2CJYA 4TV7A 1JA9A 1U3VA 3PDWA 3LT2A 1JIKA 4ISCA 2W9XA 1B3RA 4AWAA 3MYRA 5K3BA 3UIEA 4YCSA 2A6TA 5DTMA 4C20A 4F6CA 4BV8A 2AEMA 3BJMA 4J91A 5JR3A 4UAUA 2HDWA 2Q6KA 4A0SA 3UGKA 3T5AA 1FQWA 3VVCA 4HXGA 3OEWA 2YKGA 1L7OA 1VPEA 3DDWA 2VSOA 1LI4A 1AK2A 1JFSA 4ACBA 4GI5A 4B47A 4RZQA 4B4KA 4EJVA 2P7HA 1F7VA 3UUEA 1FA9A 1ZFNA 1K6XA 3AX6A 1LKZA 4F12A 4IHKA 1KVTA 1QYDA 4FI3C 2IOHA 4DLLA 1GQQA 4MIMA 1H8EA 2RBKA 2PYZA 5CNJA 1HTBA 3I2HA 4MR8A 3IKJA 5LEKA 3EJWA 1YZNA 3JQ9A 2VDPB 4LRSB 5H4HA 4YJ2B 5EGNA 3LWZA 4RZ2A 2DT7B 1YRWA 1I4OA 1GKKA 3ZBPA 3HB4X 1KJYA 3RIYA 3F46A 3RF7A 1EYZA 3IEIA 4NEQA 2WB1N 4MGIR 4IAOA 3KJNA 4FCTA 3OAAA 3L01A 1Y3CE 3T5BA 4EBBA 5DGXA 3NWSA 2DETA 3SNKA 3TO9A 4PV7A 1PP4A 3PL5A 1FYWA 1N5KA 2LNDA 3T5GA 3TOZA 3W2HA 3DAHA 4U0VA 3RUPA 5K6RA 4A9AA 1OZAA 2WFLA 3D64A 2FE4A 5H3CA 3UTCA 1CS0B 3AJAA 4IOCF 3REQB 4IOJA 1QPZA 4MCJA 3BB3A 3TTXA 4LNHA 1BR2A 2D1TA 3X44A 1DLIA 3KQYA 2EW1A 5HDGA 1EDEA 4Q1VA 2ZCUA 2F4NA 4CLRB 1I0ZA 1SK8A 2GVDC 3KXIA 1EFPB 1U0EA 4EEZA 4A5NA 3HG7A 3P20A 1MA3A 2XNJA 3I4NJ 1JJIA 1SKQA 2LREA 2V5VA 5J2TF 5J4VA 5KX5B 1QH0A 3N76A 1Z06A 1ULHA 3PR1A 4MMZB 1P44A 1ZGHA 2V0NA 1R6VA 4CMCA 4H1HA 4RJJA 4PCLA 2VSNA 4TMYA 1G8MA 4D4MA 5BN3A 4DDUA 3QE3A 4D80A 2BP7A 4L5IA 2OBYA 5C34B 3EYAA 3W1EA 2UZAA 4ATNA 1HSZA 4YRIA 3H65A 1KAEA 3WGHA 1T4CA 1R49A 2I6FA 4P0TA 4RB0A 5JUWA 2H2FA 4EA6A 4RQTA 4LJ9A 1EB8A 3CVOA 1ST2A 4W6ZA 4LY0A 3GFRA 4O1MA 3WG7H 3U4HA 4TTQA 2PMDA 1GTSA 4C05A 3RYRA 3SYTA 1Q0HA 1XNQB 1BE1A 1R3DA 3WGUA 4TLMB 4G7HF 3HJTA 4E30A 2Q7DA 4PHFA 4ZU3A 5DDIP 2BCJQ 4QBHA 2DPGA 5EIHA 1TZKA 3K5IA 1PVOA 2YOHA 4G67A 4Q7KA 5BWBA 3OU7A 4GRAA 4P5DA 4P4LA 2AHRA 2E1PA 5L3DA 1Y63A 2RV8A 2NZVG 3U7FB 1Z26A 5A7FA 5H8WA 5LQRA 1K9SA 4AZ3A 4UDOA 2GWHA 5GM1A 4YNBA 1WV1A 2WWYA 4OYLA 4HLCA 4QLOA 2CNWD 1V8FA 1G7TA 4PLHA 4XAQA 3O3KA 4UTNA 3FUXA 1KRWA 4F06A 2KJBA 1JVNA 1E3MA 4KUHA 4IVNA 3LFTA 1FVHA 4ZU6X 4RKRA 4OFXA 4IHYA 2P27A 3BIXA 1BL0A 3CH6A 3PTLA 5E3JA 5DM60 3K15A 4CIWA 2JBAB 2IHYA 3MFKA 4GMKA 3MILA 4WY2A 3WK7A 3Q72A 3OQIA 2BBTA 3H2JA 4YREA 4UFNA 4J2TA 5EYPA 3F49S 4X1KB 3FXOA 4D41A 5CYPA 3BD7A 3MERA 4EM0B 4AUNA 2NVOA 4I4TB 1GPDG 1S9DA 3EVBA 2JSPA 2YIVX 5IKMA 1BO6A 1YBFA 3CZCA 5CVDA 1U8RA 3G8DA 1RQXA 4W5TA 3AI7A 4P53A 4Z6KA 2X5KO 1CZKA 3SC2B 4QLBA 2Q4BA 1VI5A 5FFZA 3SC4A 3SQXA 4JHLA 2ECPA 3GFPA 3NO4A 1WDWB 1E94E 1A77A 2R8RA 3AVWA 1PX2A 4Q4HA 3T3GA 3LCRA 5B1EA 1ORWA 2IGKA 4CF5A 3RNOA 5JPCA 4F1WA 2LBFB 3OETA 4MUBA 2H4HA 5HEKA 4DDWA 5DCLA 3THYA 5L7WA 2AG5A 1R6XA 4G2NA 5FFNA 3OD1A 3LY9A 2ZJ7A 3JYHA 3HOTA 5JH7A 2IIBA 3MRTA 1F0NA 2H4XA 2O3FA 1UOPA 2VJJA 5E9WA 1TGVA 2QGFA 2XF6A 1AU7A 5GIOE 4KDFA 2XTZA 3PQEA 5E2AA 3P2YA 3ZHTA 1T1IA 4A3KJ 3DBRB 1BDBA 1FX1A 1Y7HA 3UXYA 1H2RS 5E9AA 4AG5A 3PE6A 2M2IA 5JG7A 2Z16A 3NWOA 5JSQA 1H0SA 1MDFA 4J8PA 2QLZA 4NCJA 4DIDA 5B4UA 3DOOA 3T3HA 2OM2A 3P71T 1PRYA 2GCPA 1JKQC 4EECA 1GNRA 2IXDA 3QVKA 2Q1WA 1N0UA 1DIBA 4B4DA 2VZ9A 2O3SA 5CHYA 2YXPX 5FHRA 3U7GA 1E6LA 3I09A 2R7FA 3S55A 2W42A 1R5NA 4BNCA 4FYYA 3NTQA 2BOVA 2WYIA 5FYQA 2FGKA 3SBOA 4FFDA 4H0CA 4IUYA 5AI9A 2CXPA 3PQKA 3QA9A 1CY2A 3EUAA 3WXBA 2RGRA 4FILA 1JG1A 2QX4A 5CLHA 4Q00A 2GBLC 1JX6A 2FEPA 4TMFA 2ES4A 3JPWA 1X3WB 1TU4A 4MA5A 5BR8B 2YZ7A 1IJEA 5ALGA 1NYRA 2CLIB 5FPHA 5HF9A 4YGXB 3M5WA 1V35A 2GDJA 2J32A 5EQJB 4TVSA 2Z3WA 2VXOA 5FNVF 4KNYA 1TW2A 2Y71A 2IRFG 2GS9A 4FFPA 4DUGD 4GHWA 1X7GA 3EMKA 2JRMA 1YC2A 4ZCLA 1PS9A 3KQQA 1V16B 1J8FA 2G40A 2NUTB 5LYYA 4OBBA 2OOKA 4ZHQA 1TZ2A 4D26A 4DWWA 3CRMA 1O94D 1CEYA 2W58A 1RFLA 2ZYIA 1WW3A 3MJEA 1ITZA 5A1JA 2NZWA 1OI2A 3HACA 1R9JA 2W83A 3SZPA 3AG5A 2WJHA 5A3QA 4C06A 3ZLTA 2JA7J 2QRHA 1XXHE 3G88A 2L7FP 4V1CA 2A5DA 3F3SA 1ZH4A 1KGDA 1G8JA 5AOAA 3PC2A 1X4OA 1YW9A 2XYPA 3L82B 1JQEA 4TUYF 1NI4A 4H6VA 3BKWA 5DIFA 1SQ6A 3WRXA 4PYNA 1TMOA 4BMPB 4RTSA 1C1XB 1UBKS 1JW9B 1HT1E 5ADUS 4CNQA 2L9RA 4K6HA 1M6VA 5ULLA 1DKLA 3FDZA 2ZJ0A 3ABIA 4L7QA 3V4FA 2CCGA 1PYVA 3TLJA 2NW6A 3PNLA 4Z0TA 3ER9A 2JD0A 5A6SA 1K5GA 2QRUA 4FU0A 5K0SA 1YASA 5EP1A 1SC3A 2M6KA 4H7IA 3I4FA 4DM4A 1KI1A 5IEBA 2WWVD 3W2FA 1QO9A 1VRWA 3WP0A 5F7OA 1QWSA 5CM2Z 3P1JA 3A4IA 1D0SA 1U3WA 4DV0B 1GVJA 4TKZA 5KI6A 1X8XA 4Z4HA 4LMAA 2J45A 3HSFA 8ABPA 5IVPA 3LC1O 2WWHA 4DWJA 3ECSA 2MSYA 3FKSD 3KLMX 1JQAA 2P6MA 1CS4C 1ZPDA 1XGSA 5IJWA 1ODJA 5B30A 3OX2A 3KZVA 3I3LA 4YONB 1U7XA 3OWTA 3E35A 2F67A 2WIJA 4DLRA 5TXGA 5AK3A 3NHUA 3HOVJ 1IYZA 3MCZA 2BZGA 1GN8A 1ZVJA 1VTKA 1PYOA 2CHEA 2JGIA 1B76A 2OBFA 2R8EA 3R7NA 4QU8A 2QKMB 3KFVA 4B6PA 1WAMA 5CYVA 4EHBA 2UUBB 3ZHUA 2RIRA 2DA3A 1WP4A 2NV2B 4BBAA 3NIGB 4IRHA 3SYLA 4RHUA 2GPSA 4JT2A 4XIFA 4AYBN 2OV3A 1HK7A 1K8ZB 1V4NA 2GD0A 4OI2A 5FBQB 1DPFA 2YUTA 2BUCA 2O2CA 4R41A 3ZV6A 4ADSG 1RSZA 2LDXA 2FR8A 4AP6A 1U8ZA 5IFKA 1ADFA 1L5NA 3ZWYA 2P41A 4WW0A 5AONA 2O2XA 1GITA 1L4GA 2H9AA 4FR5A 3RYCA 2D59A 3ISVA 4JP0A 1J1UA 4KK3A 4QM6A 3P9RA 2VQEB 4QO7A 2DG2A 4NH0A 1K89A 5FLXA 1SA0B 3RVNA 4BDSA 4X7PA 1U1FA 2OCYC 3WJAA 3O1JC 3DR3A 5AVQA 4CKWA 2DHEA 4LXGA 4C3VA 4CI9A 1DBIA 1OR8A 1S1CA 2ADOA 2JVIA 1H22A 4B73A 4GLOA 3FYSA 4B7CA 3LQYA 4E1BA 3LL4A 5E38A 4NESA 1W5CC 2V79A 4BIMA 2EZHA 3T1OA 3ML6A 1P5ZB 3ZE1B 3Q6IA 3SHFA 3U4DA 5G4LA 1ECFA 1VA4A 3SPXA 5ED0A 4ZTFA 4HG2A 3LUAA 1QVTA 3K8OE 4MQUA 3E3MA 1SUDA 1WW8A 3JQ7A 4COKA 4X9XA 1QHEA 4RU1A 4O4LA 1JDJA 1KU6A 1IHXA 2HHHB 1RUOA 4PSDA 5K3OA 2C92A 4QGFA 3E8XA 1NE2A 1KZ9A 1NNLA 3L8ZA 5I6DA 2WZDA 3ZQ6A 4A2UA 2F43A 2XTMA 3TQQA 4JC5A 4WESA 1BFDA 4BUZA 1W7PB 1E18A 4RPIA 2I55A 4UVCA 2VH1A 4GZ6A 1YJAA 5FXMA 4AM8A 3H1GA 3AF6A 4Q05A 2VP0A 3S28A 3ACDA 2ISZA 2FX3A 3LOQA 4H6WA 4I5EA 2H17A 4Q6BA 1RP7A 4MLOA 4LSGA 4DNFA 3DVAA 4CHGA 2I7XA 3LF2A 5HKKA 1EWQA 3EZXA 2Z6QA 2EGUA 4GBJA 2Z8YA 3A9RA 3ON5A 1UBHS 4GGOA 4AVZA 3UPUA 3SM3A 4IO1A 4L8GA 1XZNA 3C0KA 2NO1A 3M1LA 2O0MA 2XQKA 3VZSA 3H4MA 4J1TC 5E4TA 4UVEA 1LE8B 4PO8A 3KXKA 2PKXA 5LMZA 3LGAA 1PVDA 2VTVA 1T4GA 4JMLA 1Z7LA 3HXPA 3KLBA 1ULAA 5AW8A 3SEZA 2YH2A 3C4VA 4LJ6A 3RK1A 2RAFA 4W7HA 3V3TA 3L6RA 2PU7A 3W5DA 1OCPA 4LV5B 2H52A 3MPOA 2BMVA 4H3SA 3DE1X 1YO6A 3JARB 1OVMA 4JKYA 3Q11A 4RFVA 3I28A 2FMUA 1AGPA 3F78A 5C7LO 4ZQGA 1CF7B 2GA9A 5D1HA 3K1AB 2L2OA 1ODLA 5D6OA 4MB2A 5DGDA 4LHSA 2BFMA 4YRRA 3Q3HA 4RKWA 2X23A 3V7WA 2NXJA 2ZO4A 4FGSA 2CVZA 2F1RA 4P9UA 3C6BA 3IAAA 1I3QJ 1IRFA 4IY1A 2VCEA 1KC3A 5G0TA 2E1MB 3RJMA 5E1ZB 1SVKA 2CQQA 4DDMA 2Y1KA 1I3MA 4RESA 3O6VA 1DKQA 2C1EA 4WBNF 3U2QA 2D1HA 4HAMA 5DM0A 5C7OO 4WXHA 1GQRA 1RBQA 3KKPA 2A14A 4P84A 2LY2A 3FJOA 1DWOA 3G7UA 2FW6A 3D1LA 1XZLA 1FEXA 1XEAA 1K0FA 4LIVA 3OUTA 4Q1CA 3KJIA 2HRRA 1H9CA 4B84A 4OYYA 2YS7A 4BCBA 2I2WA 1JQBA 2QDKA 3COSA 2QBYB 4CICA 3DC2A 4IX7A 4POOA 3OJFA 2R1VA 3DV8A 4DLNA 2OUMA 3HZZA 2W2MA 4CQLA 3KZNA 3U3ZA 1TQMA 2ENUA 1T1GA 3GGOA 3SEQA 1AE1A 1COZA 3A6HA 1PFYA 1W9HA 3VISA 1YJBA 3BILA 1GNVA 5B1BH 1U3UA 1JJ7A 4L2IB 5LFAA 2G7MC 1E7YA 2WABA 3CDLA