1U0JA

Crystal structure of aav2 rep40-adp complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
267
structure length
261
Chain Sequence
b'GMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication protein
publication title Structure of adeno-associated virus type 2 Rep40-ADP complex: Insight into nucleotide recognition and catalysis by superfamily 3 helicases
pubmed doi rcsb
source organism Adeno-associated virus - 2
molecule tags Replication
total genus 83
structure length 261
sequence length 267
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.950 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1u0jA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0jA02
4I1UA 4ZCLA 1XEXA 1NRJB 2CHGA 1E1RA 1E2GA 3O47A 3SJZA 1ZIOA 1NJFA 1KI8A 5JS7A 4BZQA 1FX0A 1SXJB 1DPFA 1OKKD 4BRWA 2BJVA 3GD7A 4NL4H 5FL7A 2YOGA 2P65A 3PG5A 4DCNA 4WOPA 4C0QC 5FTLA 5C1BA 3SHWA 1XEWX 4GL2A 4HUTA 3K9NA 4B33A 4ZKDA 2ZRDA 1E32A 3FMFA 1X86B 2DFNA 2NGRA 1T5IA 2TMKA 4TYQA 4CEHA 4HZUA 2R6AA 4OYHA 3VX4A 4NYMQ 1QVAA 1NG1A 1FL9A 4P3YA 2ZRLA 3M1IA 1OH8A 4EUNA 2I4IA 2ZRFA 4PSAA 2ONJA 2QE7D 3QKSB 1GOTA 3THXA 2QGZA 5J5CA 3IQWA 1PZNA 2IXFA 2QAGB 2WOOA 3QF4A 1W47A 4Q4JA 3CH5A 1K8RA 1ZW6A 4D81A 1KKLA 2UKDA 1DG1G 1DELA 2QORA 2D74A 3DEFA 5FBLB 3UPUA 3KZ1E 1W0JD 4NTZA 4D2IA 5KO2A 2YWGA 3QIAA 4EJSB 2IS1A 5DI3A 4C30A 2QM7A 4CYMA 3VNUA 1RRFA 2RAPA 3UATA 4NYIR 3IDQA 4EIWA 5FBVB 3ADKA 1OF1A 3KFXA 3W9YA 5KTYA 2DPXA 1QHSA 1PJRA 2YOFA 3OIUA 1OH5A 2O8FA 4IOLA 5FPYA 4ESVA 5LD2C 1XWIA 3DL0A 3B78A 4JBYA 1K6MA 4IVRA 3CLVA 5IT5A 4DB4A 3E70C 1R5BA 1NBMA 4US2R 4TMTA 2O8EA 3A4LA 3U7FB 5JJKA 5JJLA 5B30A 1SXJC 1JR3D 2DWPA 1EESA 1MABB 5DH9A 1AZTA 2CVFA 3RS3A 1G1MA 4LJ6A 2ZUCA 4LHXA 1SVLA 3PXGA 2ZANA 5EZ5A 1EX7A 2V1UA 1E2IA 4X8HA 4XJXA 1OLOA 3GEHA 2YWEA 3PFIA 4MRSA 3WRXC 4HUQA 2HUPA 3BAFA 1SULA 2HT1A 4TSFD 2X8AA 5FPSA 4QGAA 5EE0A 3SYKA 5KU1A 2Z0MA 1JR3E 4BUJA 4IXNA 1VPLA 1AQYA 4YLGA 2W58A 4BASA 4D0NA 1GRNA 3I62A 2R9VA 2AK3A 1T6NA 4ITRC 2QN6A 3EPJA 2FX3A 5J4YA 1HYQA 4LYJA 1DAIA 2C98A 1DAHA 2DB3A 4B75A 4NYMR 1TNDA 3LBIA 1TTTA 3MGCA 4TMKA 3EXAA 4JBXA 3B8HA 2QAGC 1EX6A 3CPJB 2QAJA 2F55A 4PSVA 4MYUA 2BKEA 4P0TA 3CWZA 1RJ9B 4N0EA 4X8LA 4MKGA 2PJZA 1B0UA 1OW3B 3P4XA 4EJSC 3U6KA 4MDFA 4Z1MD 5JRZA 2PLFA 3CRMA 3K0EA 1NLFA 4OK6A 1GIAA 2BBSA 2XNSA 4M1WA 5E7JA 2GXSA 2ZJBA 1G64A 4LWZA 3EZFA 1G19A 2WM9B 2ZAMA 3DKPA 3ZZTA 5HKKA 3U4QB 1ODFA 2OUKA 2C96A 1ELOA 3EPKA 3AKCA 3SU8A 1R0ZA 3LLMA 3NXSA 5KDOA 3VTKA 5BN4A 4GP7A 4V0KA 1JAHA 1ZNXA 4DRZA 2V9PA 1WB9A 3AP3A 1D2EA 4LUCA 1MRNA 1OJLA 5GJCA 3ZD7A 2GK6A 4U00A 2OAQ1 3SYNA 3THYA 4MQBA 5EE9A 4MRVA 3BS4A 2CBZA 4M1SA 1GRRA 4NCNA 1QHHB 3QF7A 4A0GA 1OFTA 3CKLA 3EARA 1KO4A 3KQKA 2VHCA 4Q00A 5AJZA 4AKHA 2E87A 5FH9A 3QVUA 3HDTA 1I4TD 5ELXA 4AURA 2QPOA 4NCKA 3A4MA 3C5CA 3DM5A 1PLLA 4FIDA 3OEHD 4NBSA 2ZS7A 3WXMA 1R0XA 2XITA 5AR1A 1BKDR 4NMMA 4OHWA 1KI9A 1KJYA 3KKOA 2IA5A 3R9WA 1IOZA 5FPTA 4A2QA 4RZXA 1NY6A 2ZROA 4XVRA 5B64A 2JLWA 1JQJC 2PLRA 5F2EA 2X19A 1S8FA 1RYFA 1GNRA 4D4KA 3PJRA 3H0KA 1SVKA 1KI7A 2IEYA 1X8KA 2ZYUX 3CF0A 2ZSFA 3EC2A 4D82A 2FEOA 2XSZA 5HKKD 4WAUA 3ZLJA 4IW3B 5FUYA 2IUTA 3EIQA 1G8PA 3IIJA 3KKMA 4NU0A 4PC6A 2OEPA 4KXFB 3T1OA 1H8EA 4N0DA 3AP1A 3CO5A 3SZRA 4RD1A 4RCZA 2C77A 3BK7A 1H65A 1EWRA 1G3IA 4TN1A 1E2NA 3KTAB 1JXOA 2P67A 3CPEA 4EFNA 3AKYA 3ZS8A 2OESA 4LDJA 1QG2A 3PUXA 1UBCA 1MKYA 4FI3C 1B23P 2RB4A 3ZS9A 4TTRA 2IW3A 5G41A 2E1RA 1KZ7B 4LV8B 2PT7A 1Z6TA 1DAMA 1YVDA 3D3QA 1LF5A 1CR0A 2A5FA 2YJTD 4DHEA 1BYUA 2PX0A 3V9PA 4B2LA 5LB2A 4MITA 4DLTA 3H86A 1D2NA 3CZQA 1XD2B 2JDID 1VCIA 2ZIAA 1HE8B 2ZTSA 3R9XA 4KBGA 2HXSA 1SHZA 1E1QA 4HB4A 2QP3A 4MKIA 5E7IA 1SVWA 5AUQA 3VAAA 3K1JA 4TYWA 4LYFA 1CR2A 4Z54A 2Q21A 1ZCAA 5L3QB 1A4RA 5AJYA 3NVAA 1AKYA 1E0KA 1P9WA 1NY5A 3AKDA 4TMVA 2CE7A 3UWKA 2ZM5A 2QU8A 2N42A 4DLSA 3P1JA 4KYIB 3NEJA 2C03A 2WKPA 2BV3A 3NHBA 2ZE8A 5F98A 4E03A 2ZRNA 2ZVQX 4OI0A 1H8ED 1XB2A 3WNBA 1VG8A 4KCGA 2DBYA 4PAOA 4DLYA 3CONA 4DSTA 821PA 2JLRA 1S3GA 3KL4A 3UANA 1OT3A 5LDDC 2LKDA 4ERNA 2QI9C 1PUIA 2CJWB 3T12A 3QPUA 3S1AB 2F1IA 1UADA 1ZBDA 4B3DA 1OIWA 3WBJA 3ONWA 3AVPA 1AM4D 2IF0A 1E9FA 1IN5A 2I3BA 1FP7A 1G7SA 4LJ9A 1P62B 3SJCA 3ZH9B 1VECA 1Z83A 4QJ3A 4MDEA 3SI7A 5TV2A 1U9IA 2RH5A 2ZREA 1KIMA 1N6HA 5BN5A 3P32A 1E3MA 1NMZA 4HDOB 3IPYA 1XPOA 5EP2A 5FTJA 3TQCA 3F0TA 4DLVA 1MOZA 2VQSA 4HAYA 1XNJA 2D06A 2FZ4A 1KKMA 2FZLA 4NHOA 4RZ3A 1P61B 1DTSA 5E3HA 1Q21A 5B57C 4QXAA 3U6BA 3WBKA 3HR7A 4OHZA 4B3BA 1FTSA 4B3GA 3BIFA 4HB3A 1KK3A 1ZD9A 4B35A 4DSNA 3KKNA 3PENA 4I4LA 1QHYA 2ZRIA 2ZR7A 4K8OA 1GNQA 3ND9A 5EXPA 3GLIA 1P2VA 1P9RA 1M1YE 4G5SA 3LW8A 2ZI3A 2IYQA 3GJ4A 2D2EA 1PVOA 2ZRBA 1WF3A 4AG6A 2J87A 3OAAD 3RRMA 1N6RA 5FBWB 1GP2A 1IN6A 2OE2A 3R8FA 4MYTA 4C0LA 2VSFA 3NDPA 5DI9A 1AA9A 4NKRA 1KK2A 4Q03A 3A1WA 4M4SA 5CB6A 2PL3A 2IXEA 2VLIA 3HU3A 4KBFA 4DCTA 3LH5A 2QMEA 2XJ4A 2B8WA 5CK5A 5KUTA 2PT5A 1W2GA 3AVTA 1HY3A 1GL9B 4TZ6A 4F91B 1GSIA 1KNXA 4DIEA 3JVUA 5C4MA 2JLXA 4JLPA 1Q20A 1KI4A 1U8ZA 3EW9A 5FOUA 2EFEB 1C4OA 2X2FA 2YWFA 3AVOA 4M22A 2G9NA 3VKWA 1TQ6A 4O2RA 4A2PA 1XMIA 5AUOB 2XXAB 4P4TA 4O25A 3RRYA 1X6VA 1VYUA 3M0EA 5CITA 4KSBA 4CIDA 3VHXA 5EE5B 5FTKA 1LS1A 3I1FA 4V0OA 4GMXA 2IS6A 4I1VA 3W34A 1DADA 1U8YA 3ZD6A 2Z5FA 1G8HA 1Z0JA 4EFMA 3K8YA 1RZ3A 2R6FA 2ZI9A 3R7WA 1E69A 1Z6GA 5C4GB 1CIPA 2BM1A 2NZJA 4WXPA 2IYXA 1AJEA 4DDUA 2ZSBA 4GFDA 4Q9KA 3IQXA 1KI6B 3A37A 2JLVA 4II7A 2F9MA 5IHPA 2CK3A 1VKJA 4KI0A 4DCUA 4RY2A 2GCOA 3O8RA 3R9IA 4PZYA 1M7GA 3PITA 5CIQA 1EWQA 4X8OA 1XEWY 2HLDA 3EASA 4KJZA 5UKDA 4JSYA 5K8IA 3EX7C 3V4FA 3B1XA 1R2QA 1IAQA 3U3JA 1IM2A 1OFHA 4FW9A 2FFQA 3MWJA 2DFLA 4AIIA 4JJZA 5JWRA 1I4LD 1Z0IA 5DE3A 1G5RA 3DM9B 2WAYA 2BMEA 3KKPA 4PHGA 2OSBA 2V7QA 3LNCA 4IDQA 1XCPA 1BS1A 5EP1A 4RD0A 3VR5A 1OYWA 4AYXA 2EVWX 2XNDA 1KSGA 1C9KA 4GI7A 4LHZA 3AM1A 1F5NA 4KFTA 3WYAA 2H17A 2GHIA 3SFVA 3AUYA 4YMUA 2JLQA 1F2UA 3TUZC 4R9UC 3SJBA 1KO7A 4URYR 5EP4A 2OFOA 5HCIA 1YRAA 2WJVA 3BORA 2P0EA 4M1YA 2OAP1 2FWRA 3DPUA 4CT5A 1UDXA 3FVQA 4YONB 5EJEA 1X8JA 3PCRB 4Q1CA 2ZI7A 1CF4A 2B92A 3L0PA 1Z8FA 1KGDA 2AXPA 3VU9A 1HV8A 1KJWA 1KK0A 221PA 2FH5B 3GJ6A 3OFNA 4C0BA 2JIZA 3SE0A 2G83A 1E2JA 2YNMA 1N0VC 1CRQA 1TAGA 5KSYA 4LV5B 2ZQ5A 5BQ5A 4XWKA 4OI1A 2OV2A 2J0UB 4URWR 5FTMA 3ZZUA 4EPWA 3ADBA 1E9DA 2ZJZA 4RFVA 5D3QA 4I99A 5DHAA 1VMAA 2O0KA 1E98A 4EQ6A 1ZC4A 4IOKA 3AEZA 5DSZA 3KQNA 1PLKA 2YV5A 4LK2A 2IYVA 5F3WB 1V5WA 1Z29A 3GQBA 4B32A 4DUGA 5L3VA 2IWHA 2NO7A 5JHHB 2H57A 4NZYA 1Q1EA 1UEJA 1XPUA 3CM0A 2DCUA 3TR5A 1J7KA 2D7CA 3K0CA 2C04A 2WIAA 4M1TA 4D0LB 5AUPB 4NPHA 1VCOA 1CLUA 4FN5A 5CK4A 4IDOA 3T35A 1G41A 1JQLB 3VKGA 1E0SA 2AFHE 1XX6A 2EW1A 3QXHA 3LDAA 4F93B 3IIMA 2FV8A 4C7OB 3PEYA 2CMKA 1S0UA 4B48A 4B74A 2AK2A 1FQKA 1SVIA 1HTWA 4TYPA 2O52A 4URUR 3SHFA 1IN8A 3LAWA 3VR6A 5HPYB 2P6UA 3TKLA 1US8B 4XVQA 5IK2A 2GAAA 2WWWA 4BFZA 2GF9A 3THWB 1FUUA 3TSZA 5JECA 3GEEA 5F9HA 3GLHE 2ORWA 2PZGA 4A2WA 2CE2X 3K0FA 2MMGA 5G3ZA 3U3KA 4GOJA 3Q9LA 1L8QA 3WYFA 5B58C 2CL6X 2X1VA 3HU1A 4URVR 2CNWD 4AYTA 1EG7A 1GDDA 2B7BA 3TSWA 5CM9C 2CEAA 3NKVA 4A92A 3GLHB 1SXJA 2MSCB 1NKSA 3LXRA 4Q4HB 2WOJA 3U3OA 4B76A 2GVZC 3IHWA 3QKUA 4UXHA 4M9SA 1DS6A 2WMNB 3IGFA 3OESA 2F1HA 1UBFA 3BOSA 3ZQJA 1ZNYA 1P5ZB 4BGDA 3CF2A 1VCMA 3U3RA 5HTKA 4PPGA 4B43A 1HQCA 4MUAA 1W2HA 1IN4A 2Y8EA 4AG5A 4ZO4A 4Q5IA 2FG5A 3MG9A 3FE2A 1G7TA 2WMOB 4NH0A 2W00A 4WA7A 3EG5A 4M1MA 3QPVA 1S9DA 1SVSA 1IONA 1E6CA 5FI0B 1NP6A 1QHGA 2IEZA 1X8LA 1YZTA 4JYBA 5SZIA 3GEIA 1GFIA 5IK2D 3QKSA 1LB1B 2X2EA 4PO1A 1U8AA 3K0AB 2QAGA 2Z43A 5GVRA 3CZPA 2WVJA 4A0RA 2GWHA 1Z28A 2AKYA 3DZ8A 3UMFA 5CJPA 2ZUBA 5TARA 4EJSA 4ZDWA 2ECKA 2R2AA 2YC2C 1YZNA 2ZYTX 4QKQA 1JNYA 4JLDA 1RKBA 2ZRAA 3OF5A 3PV0A 1U0HC 4BZXA 4F4CA 1TUEA 2AD1A 1MO6A 1QHNA 4KITB 2QRNA 3B60A 5JRJA 3ZZ0A 1NI3A 4NYIQ 1J8YF 1DAKA 2W0SA 5CLLA 5CYPA 2QE7A 1W5TA 3RNLA 1AS0A 3VR4A 1YR8A 2ORVA 1W4BA 4R71A 3MFYA 4ARZB 3RS2A 4M8NE 4BLSA 1XTRA 2KJQA 2OBLA 4D80A 3ZVMA 3MJRA 4PO8A 4RCYA 1QG4A 3FFBA 2EQBA 3AF2A 4R2HA 3SJAA 1MABA 2ZSAA 4F4JA 3REFA 5DYIA 2FNAA 3VR1A 2P3SA 3PUYA 2J46A 2ZJ8A 4NONA 4DLRA 4RKFA 3L82B 3C41J 1U2RA 3JZMA 3RS4A 1XZPA 2VEDA 4IVQA 4B47A 2QL6A 1N6KA 1RVDA 4MGZR 3CRRA 1NKTA 1M7BA 2W6JD 3HYTA 4PC1A 1NLZA 4HEJA 5AJWA 3MCAA 2F43A 2O8DB 1I2DA 2YC4C 2FF7A 4U5XA 2FA9A 4P32A 4XTRA 2BIFA 4QGHA 4CW7A 1DARA 4V0NA 2J59A 2FGKA 3TNFA 3CX6A 4QM6A 1OFIA 4PSKA 1WRBA 4R98A 2ASEA 4WVFA 1TU3A 1JR3A 4M21A 2CHQA 4RKEA 2V6IA 1GZSA 3WNCA 1J99A 1W4CA 2C99A 4E09A 5FOXA 3K0CC 3VHLB 2ZUDA 1RE0A 1RJ9A 1R0WA 1W0KD 1H8HD 3A4NA 3FHOA 1QRAA 5EXSA 1TUIA 3VR2A 1XD8A 4HLUC 4LPKA 4TSFA 4B71A 3QXXA 3P26A 1LY1A 4N1AA 3SQXA 2ZSEA 2QTVB 5DHFA 2A7QA 2H18A 1Z6XA 3UG6A 1NMXA 2ERYA 2AX4A 4IFBA 3U4QA 4WBSA 1Z0FA 2QTHA 4Q9LA 4QRHA 2JAQA 2Q0HA 2GJ8A 1D5CA 1G3QA 1XZQA 1WQ1R 3ZDQA 3N2EA 2ZRGA 2SHKA 1S1MA 3E5HA 1W49A 1XJCA 1M6NA 1TADA 2IF2A 3I72A 1P4SA 1QZXA 4ZPXA 2C5LA 4TMWA 2BBOA 2XZPA 1E2PA 1D2MA 1QHHA 5JJIA 1G3MA 1ZM9A 2QM8A 1KJZA 3GJ5A 4QC2A 4Z1MA 3WP1B 2QT0A 3MAAC 4C4PA 3B13B 4ZCMA 2J45A 3TUIC 5KSOA 3FHTA 3A8TA 2NG1A 2JJ1A 3ZVLA 4NCIA 4D6PA 4BFSA 1GM5A 3NBZC 3X1XA 1QVRA 2QPTA 4LC1A 3VFDA 3U60B 2VP9A 2OBNA 2ZYWX 3PEVA 2IYYA 1U81A 2IYRA 2PH1A 2HF9A 5EUMA 4AKGA 3E1SA 1UPTA 1ESMA 1Q3HA 4KLNA 4W9MC 2RKOA 2C78A 4Y0VA 3K70D 2IL1A 2AN9A 5EZ6B 1HE1C 3GMTA 1FOEB 2GNOA 3PQCA 5E7MA 3TRFA 4Q1DA 1G5TA 2WPDA 1J90A 5JCZA 3KKQA 2B6HA 1Q0UA 4F38A 1W4AA 4OJQA 4IDHA 1EK0A 2REXB 4Z8XA 4OHVA 3I92A 4Q9JA 4YDHB 1YE8A 1G9XA 2P5SA 1G20E 3QBVA 2J0QA 4FD2A 5FBRB 2GJSA 3KB2A 4IDNA 4NYJQ 3IEUA 1XCGB 2P6NA 3T5GA 1XJ0A 3TR0A 5JI2E 3OEHA 1JXMA 4PTLA 2GA8A 1SVOA 2A30A 1N6NA 3KTAA 2QZ4A 5JEEA 1FP6A 2BMDA 2D7DA 1OE0A 4LJ5A 1CS4C 4DLUA 2VHUA 2FN4A 3K70B 5HZKA 3L43A 2DWQA 1KI1A 4BWYA 2OXCA 2WIBA 1GKIA 2CLSA 2R62A 4YMTA 5KNCA 4JMPA 2QG6A 1WDTA 3K9LA 2Z4RA 2IUUA 2JJ1D 1OB5A 4C0AC 4DVGA 3DDCA 2W2TA 4Q7LA 5TXGA 2VPPA 1XD2A 3F3YA 4BFUA 5EE1A 1ZRHA 4A6XA 5FFMA 4QHSA 5AUNB 1DAGA 1Z0KA 1OXVA 1T91A 2WKRA 2ZR0A 4OK5A 1KTVA 5L3QA 4Q9HA 5KSZA 5CIWA 2ZRJA 2ORIA 2OCYC 4TT3D 2YWHA 3HJNA 4G1UC 1EFUA 2OO7A 2WPDD 2WJGA 5DYGA 4KVGA 2X77A 3LLUA 1OH7A 1FPMA 3TVDA 1E9RA 2Q9AA 1IY1A 4KU4A 4D25A 1KSHA 1TL7C 4JLOA 2EYUA 4EPTA 2VH5R 3IEVA 4PPFA 3CRW1 3BH0A 3U5ZB 2YKGA 4ZI3A 5G40A 3I61A 3EPLA 2O0HA 4V02A 2IUSA 2JDIA 4A8JB 4TL9A 1Z08A 1XXHE 4IRUB 2CJWA 3S1AA 1ZVQA 4Q7KA 1NN5A 4IEIA 4QNMA 3OIYA 5KPDA 2JA1A 2P6RA 1LV7A 3KQLA 2GZHA 1DOAA 1E96A 4A9AA 4EPXA 3REGA 2JATA 1XMVA 1A2KC 3X1WA 1OPXA 1MO4A 2OG2A 3AVQA 1XXHB 3GFOA 1R7RA 4G5RA 4L8GA 3I3SR 4NYJR 2UZIR 4Q1EA 4V0MA 3SFZA 3SQWA 3ZIAA 4OI4A 2AWOA 4QOSA 4BLTA 4TYNA 3W5JA 3K70C 1GUAA 1WCV1 4DIDA 1SKYE 2HYDA 2VP5A 2QTFA 3LRPA 1GL7A 2DYKA 3C14C 2OXRA 5FPKA 4A36A 4QGGA 4Q9IA 1NVWQ 4XIGS 2F6RA 2JJ2A 5DISB 2EFHB 2QT1A 1AZSC 2GETA 2HJVA 4ZDIA 1QHIA 3T06B 4Q21A 2BOVA 2JCSA 1CR1A 2ZYVX 1NNEA 5TMPA 2WSSD 2PCJA 4TWZA 1VTKA 5AK0A 3BE4A 3OE7A 1NN1A 1SKYB 3LFUA 5HE9A 3GPLA 1OXTA 1UKZA 2E9SA 3LX8A 3IO3A 4TLEA 1BYIA 4EPVA 4TLDA 3K53A 3U61B 2VO1A 1XTSA 1Z07A 2NO0A 3RS7A 5EUQB 2IT1A 2J7PD 1KDTA 3NBXX 1MRSA 1AS2A 4DBLC 1VDZA 5J47A 1Z0DA 1Z63A 1R0YA 1OV4A 1BMFA 3FKSD 2ZRPA 3NIBA 4P31A 4S2EA 3CF6R 2GXQA 4LJ7A 1TEXA 4W5JA 2V4ZA 4YXWA 3EWAA 1OXUA 1WA5A 1II0A 2CDNA 4DT1B 2RGGA 2WWXA 1W36D 3TGPA 2QUZA 3BC1A 1ESNA 3QXJA 2H92A 4QBIA 3ZIAD 1E2HA 1YR7A 3NC1C 3NBFA 2QMOA 3RANA 2XXAA 4HLQB 2HEIA 1D8TA 2YHSA 1YRBA 4OQLA 3B1ZA 4QBHA 4UNPA 4HATA 3OAAA 3NWJA 3SC3A 3KDSE 4DLZA 2BM0A 4Q4AB 2NPFA 3X1YA 4KFUA 1YHNA 1P60A 2GK7A 1UM8A 3DO6A 3FKQA 4V0ME 1KSFX 1OXXK 1RFLA 2JJ2D 4G5GA 2ZJ5A 4BFXA 5JSZB 5LBIA 3QEOA 2PX3A 1T3LA 4R2IA 3A6PC 1QBKC 3OE7D 4A1FA 4URZR 2R6GA 4TL8A 1Z2AA 1W36B 1AK2A 3LBHA 4UJ5A 8OHMA 1P75A 1MR3F 4C9BA 1KI6A 1SVMA 4L5BA 4L4UA 3VR3A 2UVQA 2WAXA 5HZHA 4TYYA 3IPXA 2FFAA 3IO5A 5SZKB 1BMFD 1CJVC 1TQ4A 1HEIA 2O8BB 3AP2A 5CM8B 2XTNA 1TF2A 3FHCB 3U7HB 2RHDA 3SBDA 4JLBA 4MH0R 3EC1A 1IN7A 1NVVQ 2BBTA 3AF0A 1F2TB 4LHVA 4M1OA 4YXWD 1A7JA 3NDBB 2WWIA 2QROA 4DC9A 1TMKA 4J0QA 4IEEA 5E95A 1T3HA 1AIPA 4E22A 1TEVA 4PC7A 4B6FA 1R5NA 1TF7A 2W2VA 2KBEA 1G4UR 1R5OA 2XB4A 4M2LA 3T34A 1V43A 4AY2A 4LJ4A 2R65A 2IX3A 3RRZA 4AKIA 2J3EA 1W4RA 2RGDA 2QQ0A 3HR8A 4PAMA 3GP8A 1OB2A 6Q21A 3KXIA 3IBGA 1UKVY 4H1VA 4ON9A 4PPNA 1OIXA 4XH9B 1MV5A 1XDBA 4CT4B 1EFHA 3NH6A 3P20A 1G8GA 2NO9A 4JLMA 4Q7JB 3CX7A 1U98A 4HLDA 4M1KA 1Y63A 3KB1A 4B2PA 1NJGA 4DDVA 3GJ0A 3L0IB 4TLCA 2QA5A 2A2ZA 1FUKA 2JLSA 1IXSB 3P4YA 1WBBA 2HJGA 2OCAA 2BCGY 4LPSA 3DMDA 1S3SA 1ZU5A 4LOAA 3IKJA 2ONKA 4DJTA 4Z51A 1IY0A 1W36C 4BEBA 5J4HA 5DLQC 3D7MA 1ZU4A 3TW8B 3BJIC 2VA8A 1Z6AA 2VSOA 2W6IA 1OSNA 1YZLA 3L2OB 4KFRA 3EPHA 3QPWA 2YOHA 2D4HA 5AWFC 1UKYA 2XAUA 1UJ2A 5JBQA 1T0JB 2F1RA 2IYWA 2QSZA 5E4FA 5CJ2A 5L3SB 4GZLA 1JEEA 1ZUNB 1G7RA 2GCNA 4XSGA 3WHKA 2MSEB 1XTJA 2WV9A 2NTYC 2QBYB 1G17A 4OQFA 1SKQA 1YZKA 2GKSA 4RFSB 2LCFA 3TMKA 3FMOB 3WRYC 3J81k 1CRPA 4C7OA 1W5SA 1JJVA 1E2DA 4PR0A 5SZHB 1VG1A 4D4JA 1OIVA 3I4LA 2ZAOA 4EDHA 1NVVR 1IY2A 1UEIA 3GCGA 2NZ8A 4L16A 4UNNA 2PMDA 3BXZA 1US8A 4NCHA 3ASYA 1EXMA 4B6EA 3ZVRA 3THWA 1I2MA 4GDFA 1IJEA 3NG1A 5F9FA 2UZ3A 4LBVA 2ERXA 4JZKA 2J0VA 2ODNA 1Q57A 4L15A 2BKUA 2QMUA 4FCVA 1Z06A 3RRNA 3O8DA 3UWOA 3C15C 4BECA 5JHGB 3K9GA 5KYKA 4CGZA 2RGNC 3PVSA 4MRRA 3A1UA 1T9HA 3HU2A 4F7WA 4CF7A 3LQRA 1CJUC 4NDZA 2RGBA 3OEEA 2FGJA 3GLHA 1E2KA 3GLGB 1OH6A 5BN3A 4Q4HA 3T15A 2W6ID 1P2TA 3RSLA 4NE2A 4I81A 3AVWA 3T5DA 3A1TA 4QFMA 2MMCA 1DG3A 1VG9B 2CVHA 2G0TA 4HAZA 4BE7B 3BFVA 3SDZA 1FNNA 4JLJA 4DEYA 4PFSA 2RCNA 2HCBA 4WW0A 2FMXA 3Q7PA 2CL0X 2A5YB 4TLBA 1G4AE 3Q3JB 3MWYW 1Y3AA 3WMEA 4QGFA 2GEVA 2XJ9A 3X1DA 2GF0A 2ATXA 3PIRA 4B44A 1G8YA 2JASA 1HURA 4LC0A 2VHQA 3AGPA 4ZDJA 1W46A 2CNWA 3MJHA 1KHTA 2HDNB 2C9CA 3UXMA 1COWD 1NL3A 3KUCA 2QGNA 2P2LA 3K0AA 2WZQA 3G5UA 4YQFA 4UQOA 4OJKA 2IHYA 5C2JB 4Q48A 4ASUD 3DOFA 2FOLA 3AF3A 3I5XA 1HH4A 5H1YA 5D3MB 1BOFA 1TPZA 1VIAA 5DO9A 5GJWC 3GLFB 3AVUA 2IK8A 4HLUA 3B5JA 5TDHA 5H8WA 1M74A 3AUXA 3BFKA 3W6PA 1CULC 4KODA 2F9LA 1DBSA 5GADl 5FI1B 3OEED 5FR2A 4ZIRB 2IYZA 4EPYA 3DMNA 1R4AA 1CJMA 3AH8A 1JR6A 5JI3E 2WJYA 4W5WA 2IBMA 5FUVA 1JI0A 4A82A 4OHXA 1AQUA 2VF7A 4ACAA 4P4SB 3CR7A 2KWIA 1CR4A 1N2CE 3BH7A 5EE3A 1F60A 4P4UA 3P27A 4ARZA 4RZ2A 4M9ZA 3FMIA 4WZAE 4HLCA 2VSXA 4K46A 4Q1BA 2QRZA 3WYGA 1RRGA 1CXZA 4GMDA 3AF1A 4WZ6A 4DXAA 5EXTA 2ZSDA 4IJMA 5FOSA 2QMHA 4I1OA 2VP0A 1L7VC 2EFDB 3QG5A 3QI2A 5TB5A 3IUYA 4XOIA 3FB4A 3QVVA 2R44A 4NP6A 5IRCD 2P5TB 2IS2A 3CX8A 4UJ3A 4MKFA 2QY9A 2O8DA 2Q9CA 1QDEA 2VRWA 1II8B 2BCJQ 2OCPA 4OL0A 5BWMA 3U7EB 3CH4B 3E2IA 3KX2A 2VYFA 1DAEA 3B85A 1T3SA 1HT1E 1WE2A 5K8TA 3BRWD 3QG1A 1SGWA 4Q1FA 5JLJA 2VP2A 4IDPA 721PA 1N0UA 4MYCA 1RW4A 2AXNA 1GRQA 3KJGA 3NBYC 3SBEA 1W48A 1P2SA 1KDPA 2R6CA 3QNUA 3W8NA 4DSUA 4U02A 3D31A 3NC0C 2O8CB 2LWIA 4LYHA 4LHWA 2W6JA 1YZGA 3QKRB 4MA4A 1EFTA 3JZAA 2FSIA 4IHQA 4LY6A 3LQQA 3ADDA 1Q1ZA 4G01B 1AKEA 1G8FA 1MO5A 3B2EA 4DWJA 5CB8A 2HF8A 1LFDB 3AQ4A 4E5UA 1ZM7A 2G1JA 4LI0A 4GBMA 3B1VA 2HT6A 4V03A 3NHAA 4CEJB 2XOKA 1P3JA 2HCJB 3TBKA 1E99A 1JECA 2ZITA 4HAVA 3A1SA 3AKEA 2IWRA 1E9BA 4BQSA 3HPRA 3HWSA 1KI2A 1H8HA 1W0KA 1LNZA 1KAOA 4M0LA 3RABA 1YKSA 2OM2A 1C1YA 3DHWC 1Z6YA 5C46F 4DSOA 2FEMA 3RS5A 4AD8A 4DDTA 5K8UA 2IYTA 1NN0A 1RRCA 5JEDA 2DFTA 3TUJC 3EIHA 3KQHA 4AI6A 2GESA 3VKHA 2NIPA 3PEWA 3CNLA 2PZFA 3FOZA 1E4YA 1CKEA 3K09A 1GKUB 4YMVA 4QNRA 3MUFA 1P2UA 3CIOA 2NO6A 2I1QA 3BB4A 1L4UA 2GBLC 2WBLC 3BD9A 2REOA 3IBYA 3U44B 2FFBA 1G16A 3RS0A 2D3WA 4W5HA 1Z3IX 3GFPA 5TY0A 2DFKB 2ZI5A 1XD9A 4GNKA 4XD7A 1E79D 5KOYA 1OHHD 1U94A 3CUEF 3L0SA 4ZCIA 5LD2B 1NLYA 5BYKA 1QF9A 3MWLA 3UKDA 3X2SA 1G3RA 1KZGB 4HDCA 4KHZA 3W6OA 2JLYA 4Y0AA 2XOKD 2DHRA 4JS0A 4BRUA 4LGMA 2QNRA 4Q18A 3UMSA 3PUWA 4D4MA 2BDTA 3PUZA 4HAUA 4PQYA 3B9PA 5AJVB 3SR0A 2NMVA 4LJAA 4CEIB 1XU4A 4PC2A 2W0MA 1XMSA 2A5GA 2ZS8A 3FYHA 1G5PA 4US1R 3L8ZA 2F3TA 4DLWA 4KSCA 1R10A 1D9ZA 1NVUQ 1N6IA 121PA 4RVCA 2GVDC 1T4GA 3BB1A 3QKTA 1PLJA 1N6OA 3SNHA 4JVNA 4EAQA 1J2JA 3EZ2A 4LBZA 2WJHA 2GILA 2W2XA 4JVSB 3LW7A 1HUQA 1ZD1A 4PX9A 1E9EA 1P6XA 2OFWA 1U90A 4MYHA 4MUBA 3AF4A 1Q44A 2AL7A 2ZU6A 3OZXA 4Q4LA 4LRWA 2BHRA 1HA3A 4U7DA 1A2BA 1HT2E 3LV8A 4UNQA 1PV4A 3I73A 3F5FA 4Q19A 5L3RA 3CNNA 1Z0AA 4JL6A 1XEFA 4XD7D 3H84A 3RVBA 3Q5DA 5FTNA 4ZV4A 3T1VA 1M34E 1MH1A 4MRPA 4WXRA 4AK9A 4Q66C 4LJYA 1IXRC 4HAXA 2H5EA 1IXZA 3MD0A 2W83A 1E1RD 2R8RA 4PQFA 2GJ9A 4ZKEA 2ZI4A 5FUXA 4DKXA 4QM7A 1LF0A 1JALA 2QPAA 4A8JA 1UAAA 2QEQA 2FSFA 3A36A 2H7VA 3VQTA 4D26A 1JJ7A 4TZ0A 3TVTA 4ZI2A 3UK6A 5FL7D 4KAXA 1KO1A 1M7HA 3H1TA 1KMHB 2JLUA 5DN6A 4TT3A 1E2EA 4A6PA 3TSOA 2ZJYA 3QENA 4O0MA 3W90A 2EFGA 2KI5A 2VP6A 2GRJA 4P33A 3UMRA 4PHHA 4LSGA 1XXHA 2NO1A 5DNYB 3IILA 2G0NA 2G3YA 1XEXB 2C2HA 4E07A 2VTKA 4JIMA 1ZP6A 5KNDA 1FMLA 4EKDA 5FR1A 4H9GA 4MGKR 1EFRA 1E2FA 5FL3A 5KSPA 1SQ5A 1FX0B 4DZZA 1KY2A 3RWOA 1ZCBA 3FFAA 5JS8A 1E2QA 3ICEA 2VL7A 1NMYA 3RLFA 4URXR 2F43B 1XPRA 2O5VA 2B7CA 1XP8A 1T0HB 2Q9BA 5EP3A 4FWTA 3V00A 1E9AA 2GAOA 2OHFA 2RGXA 3IIKA 3OHMA 4DCSA 2ANCA 2ZU0C 4CEHB 4HZUB 1G18A 2QP4A 3QQ5A 2FDCA 4IOJA 3GJ8A 1QHXA 2FPMA 1F3OA 2ZE5A 2ZRCA 1E9CA 2Z6VA 3FDIA 2KB0A 3TW4A 4M9QA 1NN3A 1NSTA 1ZD8A 1TX4B 3GJ3A 4G5QA 4MRNA 3U2QA 3THXB 1UBGA 2ZEJA 3ETLA 3QF4B 4FMDF 4Q4JB 5DN6D 1NBMD 2OZEA 2G6BA 1AGRA 1CTQA 4GSYA 4QBFA 1NIPA 1XTIA 4LV6A 1ZM3A 4DT1A 1S1CA 3A1VA 2XZOA 3AGQA 2WSSA 3K09C 1D9XA 4UXJA 2FFHA 5DI3B 3MWKA 621PA 4FMBB 4IKEA 1KAGA 1YZUA 2WWGA 5CYOA 1NBME 2IYSA 2Z83A 2ZVPX 1U99A 2REBA 1F48A 1EFRD 3ASZA 1FQJA 2J9RA 4BFTA 1U0LA 3KUDA 2J41A 4Q4AA 2J7PA 1O87A 2YZ2A 3MSXA 2O8FB 3W8RA 1S2MA 1CEEA 4TTPA 1KK1A 1T8UA 3QJYA 2JGNA 5JSZA 2ZE7A 3SEAA 2G77B 2IXGA 3KJEA 3QEJA 2VF8A 1NF3A 3FKSA 3BGWA 3HPQA 2D62A 2O8EB 4C2TA 4Q01A 4AWXA 4CDGA 2GTPA 3LO5A 1ZIPA 5JCPA 1G3UA 2NOAA 3MRSA 4BLOA 3WNDA 4B34A 1VG0B 4TQUS 3OIWA 1ZMXA 1NVXQ 1DEKA 2IYUA 5DIFA 2A5DA 3LVQE 4DDWA 1VYVA 4HUQB 5L8VA 2LKCA 2PCLA 1G21E 1VYTA 4RD4A 2WKQA 2O8BA 1GG2A 1II9A 2HV8A 2ATVA 2OILA 2WWHA 1IBRA 4HAWA 1A1VA 4PQRA 4EFLA 2KBFA 1F2TA 4WIAA 4LBYA 5G3YA 1RC8A 3AVXA 2ZJ2A 1ZC3A 2WWYA 1NIJA 3CRQA 4O2LA 4PC3A 1YR9A 4GOKA 4US0R 1S9HA 2H8KA 4LJ8A 1ZUIA 2CHVA 3CR8A 3EZ7A 3H4MA 521PA 1MT0A 2ZRHA 4IXMA 4OKSA 3C4JA 5JFGA 4CRWB 1WXQA 4K81B 2CLCX 1P72A 3U3MA 4ABYA 1DE0A 5EXXA 4C0JA 3DOEA 3PR1A 1G291 3SS8A 1P7CA 1R8QA 2OCBA 1GTVA 5J4KA 2PJRA 2DY1A 1JPJA 5LB4A 2RGEA 2DR3A 1DO2A 3TLXA 4BFWA 5JMTA 1BO6A 1N25A 2RGNA 3WMGA 3W5IA 3X1ZA 4RSGA 5M04A 4RD3A 2CCKA 2Q6TA 2J1LA 5BYJA 4A8JC 2ZXUA 1KMQA 3TE6A 4XSHA 2FSGA 2WJIA 1KO8A 5KDDA 4B2IA 1ETUA 4QHTA 3ZQ6A 1OFUX 3SYLA 4DB2A 2ZETA 1CBUA 1N6LA 3O8BA 1U0JA 2XTMA 2VIIA 3FMPB 3I32A 3KQUA 2C9YA 3RC8A 2PEZA 5FBQB 3VX3A 2ZPTX 2V55B 1YZQA 2G1KA 4GPTA 4RZUA 4RD6A 2AFIE 1WP9A 2QENA 5J4VA 2C9OA 2XEXA 4WZBE 2F1JA 1Q12A 2GXUA 1OYYA 3THYB 4IVPA 2XZLA 4GP6A 1JBKA 1N3BA 1G7CA 3BERA 3RC3A 1RYHA 2JJ8A 1TF5A 3Q8XB 2A5JA 1X3SA 5AJXA 4I1SA 2XSZD 1EFCA 1KDOA 4KO8A 4Q7MB 1KY3A 3AVVA 3B1YA 2EFCB 2ZRKA 1W1WA 3HYRA 3GFTA 1TQ2A 3WMFA 1AGPA 4GT1A 4M9XA 4BLQA 2BEKA 5EQTA 1XRJA 1JB1A 4OQXA 5L3SA 4S35A 4O3MA 4RJLA 1DO0A 1M2OB 1ZYUA 4F92B 2QBYA 3I8SA 4OK3A 4PO9A 1ZNWA 3T1QA 4TL6A 4RFSA 1T8TA 2A9KA 2OT3B 1ZAKA 3ZJYA 3B1WA 1T5LA 2BEJA 1X1RA 3DKVA 2J0SA 4CZ2A 1FNMA 2ZS9A 3FWYA 2N1BA 3W3AA 2EYQA 1GILA 3JVVA 3BBPA 3LVRE 4B3FX 5HR5A 4FINA 2D2FA 5H68A 4MKHA 2PZEA 3TH5A 3W6NA 1JAIA 1UFQA 4G0NA 4PZLA 5J40A 1XCMA 3LD9A 1XMJA 2CLDX 1NSFA 2CCGA 4MGIR 3RDPA 1ZM2A 3EZ9A 4L9WA 1LS6A 1OXSC 1JPNA 2BMFA 1GL6A 1IJFA 2ZJOA 4L9SA 4FWIB 1E1QD 2AHOA 5IDVA 5KPJA 5GJBA 4JLNA 3TIFA 1FTNA 5G53C 3N5CA 3PUVA 4TTQA 1MO3A 5FOVA 4F4IA 4JT2A 4FMDB 4KYUA 4HYYA 4BZPA 2IYLD 1N5IA 3DVLA 2O0JA 4JKYA 3V4RA 5FOWA 3GLGA 4GRAA 1ANKA 4D4LA 2BC9A 3QY0A 4LX0A 2WHXA 4M53A 3B6EA 3BB3A 4JKIA 5CLQA 2DWOA 3WY9A 3R20A 4C0SA 2I1VB 2MSDB 4HDQB 3W3ZB 2FJUA 4ILEA 3H2YA 2PBRA 2XX3A 4TMZA 3T1TA 1X1SA 4UNRA 1P9NA 5BXQC 3QE0A 1KI3A 1YU9A 1YJ5A 4JVLA 4QL3A 3KJHA 3QXSA 3F8TA 3C16C 4BFYA 2WJJA 4JJKA 1F6BA 2Q3FA 3QXCA 3SN6A 421PA 2J0UA 5KHOC 4PANA 1KYIA 1GITA 1XF9A 3VNVA 4KVAA 4POAA 4C3ZA 5GVSA 1ZJ6A 3KJIA 1W7AA 1FW6A 2BVNA 1KOFA 1ZNZA 2CL7X 3B9QA 4GOXA 4C0HA 1IQPA 3CWQA 2FSHA 4LCBA 5A5GA 2GJKA 4BEJA 5D3MA 3Q7QA 4HSEA 1E4VA 2ZRMA 3G0HA 3GLFA 4HB2A 4PHFA 3AB3A 3N70A 2V1XA 4TLAA 5KDLA 2EU8A 2ZJAA 2ZI6A 4AYWA 2WSMA 3LX5A 3EA5A 4ZIRA 3AVYA 1RIFA 1XBTA 2FPKA 2PMKA 1NG9A 4DEXA 1ZUHA 3EZ6A 1ZM4A 2RGAA 3CB4A 1DVRA 4DLXA 1COWA 3TK1A 2HYIC 3BH6A 4P4SA 1BH2A 2QSYA 3FGNA 3L8YA 4FMCF 2VBCA 3A58B 3HP1A 4PHTA 2G88A 3GJ7A 1Q1BA 4W7SA 1VHTA 4ASUA 3GLGE 2WICA 3ICQB 2ODBA 4JSTA 4R7ZA 3TJZA 1M8PA 4OI2A 2GJAA 2ANBA 1E9SA 1XTQA 2Z4SA 3GLIE 5GJVC 4PAQA 2KSQA 3D8BA 4YDSA 5FUWA 1XJQA 4KV9A 2AWNA 5HCNA 1S4QA 1WBDA 1S96A 3L0OA 3MMPA 4LZZA 2V3CC 1N5KA 3ZVNA 2CXXA 3SOPA 4EPRA 2H16A 3IHLA 3GLIB 1DAFA 3G82C 1EGAA 1II8A 5P21A 4A4DA 2AR7A 4XWOA 1AN0A 5JWOA 3M6AA 3QOFA 1AS3A 4JYCA 3KFVA 5A0FA 4G3XA 2GBLA 4TQAA 3TQFA 3ZGXA 4JL8A 1BIFA 2C8VA 5SZJA 5C18A 4C2UA 2GEUA 1UBEA 2H1LA 4YC7A 5CDFA 3N2IA 3I5YA 4OHYA 1TU4A 1D6JA 4QJ5A 1UF9A 1Z5ZA 3MLEA 3NEYA 3K9HA 3WHLA 4OQMA 3GLFE 4BFVA 5KNBA 2WWFA 1HQYE 3Q72A 3QUSA 4IOMA 1Z2CA 5A4JA 4A0FA 2N46A 1Q1QA 2F7SA 4QBGB 2O8CA 2GXAA 1E2MA 3QKRA 2QP9X 4ACBA 2FE4A 1A5TA 3D6TB 3U7GA 1KO5A 3RHFA 1J70A 3UIEA 1N5LA 4JT4A 2B8TA 4X8MA 2CK3D 1CJKC 3K0SA 4HI0E 5FOTA 3NH9A 3EA0A 4FCWA 1FFHA 1P73A 4FCTA 4NCJA 4JLAA 4XWAA 2BMJA 4CEJA 2HLDD 1J8MF 1CP2A 1E2LA 4Z8YA 4G5OA 4FXPA 1U9IC 1O3YA 4XTCS 3THOA 1LW7A 3LBNA 1KNQA 3GJXC 1LTQA 1SZPA 4JLKA 4LHYA 3I8XA 2F3RA 3R7WB 3ADCA 4TMXA 1I4DD 4ESHA 3EWSA 2V7QD 2YYZA 5K8LA 2BWJA 2HXYA 1N5JA 1K5GA 4JLVA 2XNDD 5FPHA 5J4LA 4KFSA 2VP4A 3C5HA 2JLZA 1E0AA 3KXKA 2IC5A 2OLKA 3BWDD 4PXAA 1VIYA 4YMWA 2KE5A 2GCOB 2A78A 2GZDA 1N0WA 4MGYR 2NPIA 4JVMA 2RMKA 4QG7A 3T61A 1L4YA 2ZR9A 3FPAA 2NQ2C 3LWNA 3U44A 1Q22A 4UKDA 1GKYA 2EWVA 5CDFE 1VHLA 2GEDA 1SHKA 3EAQA 2YVUA 3PEUA 4TL7A 3C8UA 3LA6A 3RWMB 5DGXA 2C95A 4B73A 4ZDKA 4QJ4A 1KDRA 4A15A 3OFND 2JIZD 2GCPA 2ODEA 4UXIA 1PUJA 3R8CA 1L2TA 4PPQA 4B3CA 2OBMA 3NTUA 3QSYA 5IF9A 4Q02A 3B7GA 3O8CA 5TVKA 1GWNA 1IHUA 4AC9A 2ODWA 2R6DA 2BJWA 2YINC 1YR6A 5BW8A 1FMJA 2PEYA 1F2UB 1R8SA 1E94E 1R6BX 3LY5A 4DUGD 2EWWA 1WMSA 2QQEA 3RYTC 4CEIA 2XB2A 3RSOA 2L0XA 5HE8A 4TQ9A 2V6JA 5B2ZA 1CU1A 2RHMA 1RPZA 2K5UA 2CCJA 5JZVA 1UKEA 2ZE6A 1CJTC 4BPBA 1TQDA 2Q3HA 3VMFA 3C7KA 3VU9B 1E79A 5LPNA 1OHHA 2JEOA 2XGJA 4OBEA 2XTZA 1A82A 2A3RA 4QHYA 1RRPA 3M4YA 4A0HA 3OIVA 4BLRA 3Q5EA 1VCNA 1YQTA 2J5XA 4LYAA 3ECCA 3AV0B 3ND8A 4H1UA 4EQ6B 4HB0A 3EIEA 4XVUA 3ZYCA 1W44A 4D0GA 1OKKA 1JEDA 2GDJA 1FZQA 4V0LA 1GVNB 4FMCB 4JL5A 2J7KA 4Q1AA 3CBQA 4JBWA 1GAJA 3QBTA 1N6PA 2BBWA 2FU5C 2RGCA 2V8OA 3CW2A 4KLZA 1ONBA 1XFAA 1KSJA 2OFXA 1UDWA 5ANRB 1Z47A 2B21A 4CVNA 2WTUA 2IHBA 4HZIA 5JWHA 1G6OA 2IS4A 3CRVA 4Q47A 2GZAA 4UNSA 3RAPR 4OQNA 1SXJD 3UG7A 1XTKA 4IFEA 3WP0A 3KXLA 4PZZA 2Q3MA 1K5DA 4RD2A 1GNPA 3CPHA 5H70A 4BLPA 4AKEA 3B82A 1LVGA 2VHJA 4DCVA 1E0JA 1KMHA 2VHTA 3FTQA 3LXXA 3BFXA 1G6HA 3DZDA 3Q85A 2V54A 3CNOA 1Z22A 1SXJE 1ZINA 1Q3TA 3K0FB 1W0JA 2AKAB 3TAHA 2OLJA 4GZMA 4N3NA 4LBWA 4YMSA 2AD5A 2FPLA 3TAUA 4C0KA 4B3XA
chains in the Genus database with same CATH superfamily
1WMBA 2R7NA 4YJFA 3R7NA 2OMEA 1OKKD 4H7JA 4MQEB 2C6YA 4YJ2B 5FTLA 2H7XA 5A9TA 5CT6A 3ZQUA 5EERA 2I54A 1G4HA 1QVAA 2YW2A 2GXBA 1ATZA 2HJRA 1BL0A 1BWSA 1CDEA 4XVHA 3UGKA 3TWOA 1TKRA 2AI3A 3QVXA 4WXHA 1HLFA 1SCQA 3QEAZ 3T9AA 1PK7A 2Q1YA 3KPJA 3NETA 4MWGA 1TQMA 4F5ZA 2RARA 4Y7DA 5H7XA 1DKUA 5J2TB 3QPDA 1RWVA 2ZCWA 4ZZ3A 3PO2J 3PXGA 2AR0A 3PFIA 4M0FA 4HUQA 2JQ7A 1S5LC 5DXAA 4COOA 4RTQA 2FEKA 4YEJA 4AZSA 2FZVA 2ELKA 4D3YA 3WL3A 4NCBA 1ECJA 4MHTA 1YO5C 3NIGB 4LJSA 1FYWA 5B7QA 4F1JA 3EXG2 1WBJB 3GO5A 3I9MA 1XDDA 1I13A 3GRAA 1T1SA 4J94A 4EOGA 3LA8A 4NB5A 4L9VA 2PLFA 4OVKA 1K6IA 5JNTA 1N2ZA 2QRKA 5F7ZA 1NUUA 3JYOA 3AG2H 4DRZA 4I36A 1XZJA 4BBAA 1KQNA 3SYNA 1FY2A 1XZHA 4MQBA 3BS4A 1K7FB 2LRHA 2DTXA 5I7AA 1J5PA 4ZYAA 4AURA 2V5UA 3BGVA 2QLTA 3DMHA 5LQNA 2H5IA 4FS8A 5I01A 4L0ZB 3OLVA 1P7ZA 4A2QA 4F3TA 4I2OA 3L92A 2PKXA 2VSQA 2NP6A 2ZJFA 3EGCA 1YA4A 5HF9A 1O94A 3SXPA 5T8KC 1R23A 3L8DA 4CHTA 4WKOA 1IHPA 4Y9SA 4P0PB 4G89A 3SIWA 4LV8B 1Z6TA 1T5HX 3DPLC 4J03A 4UV9A 2K9QA 4HADA 5HJ7A 1XD2B 2ZIAA 1UXJA 3E27A 4KBGA 1CR2A 1BIBA 2WTNA 5IKOA 3EOBI 1QQ5A 2C03A 5E6SB 4HV4A 5DGHA 5F98A 5JZSA 2BR4A 1NASA 1YRQA 3UANA 5LDDC 1KYQA 1EUZA 3PPXA 5E7QA 3RB8A 4G63A 3VZQA 4CCOA 1UADA 2IHVA 3OYBA 3CLUD 3DTTA 4P83A 1AM4D 1RD4A 3CLRD 4OUDB 1VECA 3UW1A 3IP7A 2A68F 3RFXA 1U9IA 3P32A 2XRLA 3IPYA 5DSTA 5FTJA 2CXNA 4P1ZA 3UZUA 3VNAA 4HWSA 3A9WA 2OBYA 2AC2A 3WBKA 3G71I 3EAGA 4NRDA 3F2IA 4QG3A 3BIFA 3NXKA 5EHGA 2W2KA 5DBFA 1QHYA 1QFXA 5CCBA 4LCJA 4G9YA 2J87A 1J22A 3TZEA 3EXG1 2H63A 5J1TB 4KBFA 4Y2YA 4Y6LA 1E3JA 3JVUA 4O3FA 2JLXA 4JROA 3INGA 4X41A 5MN5A 4O25A 2Q46A 2C5GA 7AT1A 4QLBA 4N9WA 3GY0A 3I1FA 5LKRA 1YRLA 3I01M 5IABA 1DADA 4LVUA 1RCFA 1ADBA 2R6FA 4ZYEA 3R7WA 2C2BA 3E97A 4FX4A 2JIMA 3KQYA 3E22A 3GFQA 2HLDA 1VGRA 4EI8A 3V4FA 3GL9A 1BDMA 1QNFA 3VR4H 4UB8C 1V8ZA 3DBLB 5EJFA 1UBLS 2OSBA 5K0ZA 1KWGA 3WIOA 4D02A 3CS3A 1ABFA 3VO1A 2JBAA 3S32A 3A6FA 3AM1A 1U7WA 4A3IJ 1T0UA 3ZLVA 2PZLA 2OFOA 2B9SA 1GTZA 4IJUA 5JNLA 1X1QA 4EA7A 3CNQS 2VXYA 3IAS6 2AF3C 1YR3A 4Q1CA 3NARA 221PA 4JBNA 2WKWA 2I4OA 3ERMA 4YMIA 1E2JA 4D3ZA 3K35A 5EMMA 5IOYA 4RFVA 2LRDA 5DHAA 4KO1S 1Y8ZA 5F3WB 2X9DA 1OBCA 2WZDA 3HJBA 4Q34A 3S2DJ 4J1QA 3BJ6A 4HX4A 2GD1O 5AVJA 4WN9A 4PNEA 3R5TA 2AFHE 3CO6C 4X45A 4X3OA 3WGJA 1FLAA 1TO6A 4LXHA 3RD5A 2E5FA 1IN8A 3PBKA 5FRNA 3GRFA 3G0CA 2B9EA 1NQWA 3OJWA 3Q9LA 4U2KA 3SG0A 3AI1A 1YJXA 2I2AA 2G7UA 2ZYDA 4LX8A 4G2TA 5I7EA 2BFPA 4AIRA 4YHHB 2RJNA 2VJPA 3HZOA 5KWSA 3IHWA 3FUUA 1UBFA 2Y31A 2BVMA 2EC5A 4AZ0B 2I6UA 1ZJWA 2XF7A 4MW9A 3AJDA 2X6TA 4KV7A 3QYPA 3BZKA 1QPGA 3ZJ5A 2AF4C 1HK7A 4PO1A 2WVJA 3ABOB 3MS4A 2W1OA 1Z28A 2UAGA 4RV9A 4CKBA 1L7AA 2ID6A 4WI1A 4Q9DA 2YC2C 4QKQA 4FBLA 4NS1A 3E3VA 4M38A 1OXBB 4JB2A 3DWIA 1MUUA 1MJ5A 2GT1A 5IANA 2OQVA 1OLSB 4QJBA 4U7HA 4AWBA 4ARZB 2K4BA 1IAWA 4PFJA 4AZVA 4K86A 3REFA 4X7MA 3LSIA 4QQ8A 3G6EI 3L82B 4MUHA 3ZV7A 3ITDA 1VXOA 3WTSC 2EATA 1N6KA 1VI5A 4RIFA 2G1UA 5I7RA 1BXRA 5FAXA 4P32A 1JIJA 4BJ3A 4QGHA 5BR8B 1MFZA 2FGKA 1YRYE 4PSKA 1Y6JA 3F8BA 3SC4A 2FPGB 2D5AA 3ETGA 3BTIA 3OSFA 5EXSA 3WLKX 4F04A 5LUAA 4KQCA 1ZSNA 2RHTA 4XOPA 2JLAA 3I72A 3HIFA 3RVQA 1N4AA 1YACA 2J45A 1VRWA 3ZVLA 3H87A 1ULUA 4CQJA 1GPDG 1MAUA 2I03A 2PH1A 1UPTA 1PNQA 2FR8A 3K70D 3Q0WA 1JU3A 3GMTA 2AZMA 5E7MA 1G5TA 1KWKA 3OCVA 3P9RA 4MZDA 1MX3A 3D9QX 1AB5A 1W5CC 3RVLA 5JQWA 5FBRB 1R4NB 1S7OA 4BL0B 3GRRA 3OX2A 1OE0A 3OD1A 4IH4A 3CO7C 3EE6A 1G20B 3QEBZ 3CT6A 5CU7A 2YMPA 3FIJA 5IEBA 1RAFA 1MEEA 4A26A 1WNTA 1NE2A 1T1EA 3JAWA 1EFUA 4QWQA 1QR2A 4U9IS 4ML3A 3IAM6 2VH5R 2VPLA 3QX8A 5BVGB 2YKGA 2VAWA 1YB7A 1J2YA 3C3CA 5DM4A 5AKKA 3K8OE 3P0FA 3TSAA 3AFNA 3L1VA 2VDKB 2EJTA 2JATA 4UEJA 3X1WA 2XT6A 2YXEA 3VQTA 2UZIR 3SQWA 2E5WA 1I27A 4TXJA 2AWOA 1U0FA 4AO6A 2RC6A 2PD4A 1PP8F 2VP5A 3H2IA 5FPKA 3F67A 5LFAA 4FX5A 1EUQA 3KZOA 1LDEA 3C74A 2XPVA 2B25A 4DGQA 2QVXX 4F72A 2GPAA 3MVEA 1H8AC 2IT1A 1MRSA 5IJ9A 3WJAA 4LGVA 5LJLA 4GPBA 1DRJA 2O6GE 1CNMA 5LGUA 4PZPA 4G0WA 4EEXA 2XUJA 3CF6R 1MJNA 3H36A 1P1RA 3N7TA 3PQFA 3TGPA 2FP4A 1E2HA 2HQRA 4OREX 4HLQB 2FEAA 4ARVA 1CUJA 4JWKA 3H5NA 2BM0A 2NPFA 4Q4AB 1P60A 3DO6A 4MUGA 1OXXK 1RFLA 4GOOD 4XQGA 3A0UA 3ZWNA 1XTUA 3FVTA 4I5DA 4A93J 3NWTA 5GM1A 5K5RA 1VLVA 4CCLA 1H4QA 1T6YA 4EKYA 1KMMA 4PXSA 3KQMA 4BNKA 1UFOA 1XTTA 5SZKB 4QELA 4Z9FA 10MHA 2EK5A 4JLBA 5J63A 4CN9A 3N97A 1HEYA 1RAEA 1Z68A 4ZQEA 4C4AA 4KYVA 4OGLA 4UHEA 3TKAA 5CB0A 1QGUA 1U9NA 3IAEA 4AY2A 4GVXA 4U7BA 3C3EA 2MCFA 2N0SA 4YJHB 4MLOA 4BKQA 1UKVY 2G9QA 1R1DA 2NO9A 4JLMA 1P7WA 2GQQA 3NS7A 1HM5A 2Y1FA 3H11A 4Q5SF 5AT1A 4QTUB 2O2SA 1NHGA 1RETA 1BCRA 3W3AD 1CYEA 1M1NA 1FDUA 3D7MA 3VBCA 3BJIC 1OSNA 4X9XA 2WFAA 1VF9A 1W88B 3IR7A 4V1CI 4OQFA 2WUEA 1E92A 5SZHB 1X7YB 2PUCA 4KQEA 2KT0A 4I2VA 1V5GA 4XYBA 1ZBQA 1G9SA 1JEJA 1VP9A 2PMDA 2K6GA 1US8A 2FK7A 1Z5GA 1THZA 3JAKA 1ECGA 5KIAA 2FMHA 4JT8A 4P38A 3O8DA 1DKNA 4RPLA 1HOTA 2W98A 1V41E 4YAOA 4NC8A 4WCDA 4HN4B 4NDZA 3ZQQA 2VKHA 1BFKA 4DRXB 4Q4HA 1U8XX 2GEBA 2YY5A 5KAMA 4KGVA 5AH0A 5AVSA 3ZX5A 3UCEA 4JLJA 2HCBA 4KXQA 2Q5LA 2A5YB 2JC3A 4GPIB 2PZJA 1AV7A 1OZFA 3IT0A 3AWIA 1AGXA 1KHTA 2NU9B 1RMYA 2OP0A 4YP1A 4UQOA 2DOAA 2XC7A 4TKZA 3JQBA 2VKDA 3B5JA 4J4TA 2JK1A 3Q3GE 4XRFA 5DGDA 4IWYA 4KODA 1EWYA 1VP3A 5KJFA 2PUVA 5FR2A 4TXNA 1N4DA 2FDRA 2L7FP 4XK4A 5FUVA 4ZT6A 4YRGA 2KWIA 1CR4A 1UC4B 3GBSA 5EE3A 2VB6A 1F60A 3VDMA 1I10A 3I9LA 4YIRX 2LDXA 3QVVA 2RDMA 4ND7A 2WVHA 3NIFB 4F85A 3FTFA 2Y9ZA 3WADA 4G86A 3L6UA 3BR0A 2J48A 3B85A 4Y2VA 4A8TA 1ZZEA 1NOIA 4RLFA 2JPCA 5FA6A 4KQWA 1Y1TA 2JIRA 3NBYC 3O9VA 3T38A 1I5EA 1K4TA 3C8MA 2QUBA 1LJLA 1KYVA 3JZAA 2H06A 1GFWA 5MFPA 2G1JA 3QUBA 3G6WA 1T95A 1IW7F 1QVVA 4EMSA 1NQVA 2XOKA 1JECA 1HSJA 4Y2UA 4G5YA 1PX2A 1KI2A 1W0KA 1V4RA 4QUGA 3CMEI 1P18A 2OM2A 1WPKA 3DHWC 1Z6YA 4NWIA 3AERA 2HX1A 2JIDA 4I4TF 1ULAA 2VJYA 5DTMA 2YJ4A 1MHTA 2QYTA 2ZKLA 3BGIA 4AUKA 5EPOA 4OP3A 3CIOA 3IBYA 3U44B 4XD7A 4HDNA 4KDCA 2XAFA 2H2GA 4ZCIA 3L0SA 3HRUA 4L4RA 2GCEA 1G3RA 1RWPA 4QEKA 4NLLA 3BF8A 5F1YA 3LF2A 5CLIA 4YUVA 3PUJA 4HAUA 5AJVB 1ZMRA 3K6GA 2W43A 5A7FA 1JLLA 3RVSA 3PXUA 2O06A 4FOOA 1T4GA 4MHGA 2BEWA 4J1TA 4CCSA 1E9EA 1IUOA 3O1JC 1Q44A 2J3QA 4U7DA 3MTBA 3H1FA 4JHLA 1KR5A 1XEFA 2EF0A 1FB5A 4O4IB 3DAHA 4LJYA 3B2QA 3DZIA 3FZGA 4HH0A 1CZRA 4O4JB 2B2CA 4GZ3A 3K6KA 1VIDA 1IEQA 4W7HA 3KHUA 2WTEA 3AHGA 1ML3A 3D3EA 1TEHA 2KI5A 3RVJA 5THXA 3JQ9C 2R8YA 4IRXA 2G0NA 1WAMA 2DFIA 4W1PA 1EB8A 1KY2A 2RI6A 3RLFA 3I2GA 1XP8A 3ABQB 3M33A 1YQGA 4F55A 4NG4A 3ILSA 4AL4A 2C97A 1UZUA 2FPMA 4KJXA 3GAAA 2FXVA 4YCAA 3R74A 1K98A 3AEXA 2OZEA 1CTQA 5BNGA 3HCCA 3AGQA 1OTHA 4FFSA 1UJ5A 2GHRA 3F8FA 3L1IA 3SC6A 1NTCA 5KNDD 3IOMA 1EV7A 2F4OB 3X1KA 1RAIA 4XJSA 2EGUA 3DS8A 2O8FB 3R0XA 5ALNA 4CKEB 1C8VB 4B81A 3X1JA 2G77B 2VZLA 5D5WB 4C2TA 3HKDA 1PR0A 3H1CA 1H23A 3MRSA 3IBTA 4TRMA 2J6BA 2X6OA 5DIFA 4MV6A 5AI4A 4UTZA 2RGYA 4Y2HA 2HV8A 5FFZA 3KD3A 3MCTA 4D1QA 4LE0A 2IDJA 1NIJA 2ZYGA 2J3MA 2ZRHA 4N3GA 3NAZA 1DE0A 5G0WA 1G291 1DU0A 4EB3A 2I2WA 4BB0A 3K1TA 5J4KA 4HD8A 3HBLA 3ZXIA 5JMTA 3VVMA 1BO6A 4HMOA 5JIBA 4J2OA 1U2TA 3T9BA 4QYSA 3ZHSA 4ZCPA 4QHTA 2GA2A 5FLXA 1OI2A 3F1KA 1CBUA 4LY9A 1PGOA 4CA0A 2Q0XA 1V7PC 2BFMA 2FQWA 3LHDA 4D98A 4MULA 4CDMA 4AMZA 1O94D 3WMFA 3LT0A 3TDUC 1T8TA 2N75A 1SWWA 1XJ5A 1KEKA 4V38A 2ETHA 4X62B 5H68A 1OU0A 4BNNA 4GPAA 1IWBB 1XCMA 1LQ2A 4MGIR 2CCGA 4C6TB 2BMFA 2UUAB 3ORYA 3LSPA 2VXCA 2YS9A 4IG4A 2BE5F 2DYSH 3AW9A 4OLAA 4WF2A 4ALNA 2IYLD 4NESA 4BNDA 3SEFA 2O19A 4D4LA 2X9GA 4H7FA 4UNRA 1P9NA 3PRJA 3QE0A 2A6EF 5LJIA 2VN8A 3QXSA 4DIKA 3BSYA 4EBFA 421PA 1YI8A 3D43A 4X00A 3E2PA 2WIGA 3D7NA 1KOFA 4KQMA 4Z86A 3IE0A 4BEJA 3S8MA 3ZCPA 2VOJA 1GG5A 4FYIA 1JQBA 3GEDA 3ETHA 1WVMA 4AYWA 4RGYA 3OPYI 1VE3A 3L8FA 3P9XA 3TK1A 2F00A 4ZOQI 3KB8A 4Z7NB 1PW5A 3RSNA 5DHTA 1YB2A 3CWCA 2W84A 2NPOA 1M8PA 6REQB 3ELYA 1HDOA 1SIUA 3JYPA 2KSQA 4FB5A 4BOYA 4N39A 5AIBA 2H2WA 2CXXA 1XPJA 3MBIA 2HOSA 1H3EA 2YJ3A 3TQFA 1BIFA 4DR5B 5C18A 5CLFA 1FPQA 2H1LA 2JD1A 4RUKA 2ZSIB 1KJJA 2YQZA 4MX8A 1J9EA 3AIKA 3ZQFA 4UUBA 3EGIA 2WWFA 3HRMA 4IH9A 1EUDA 3V55A 3WO0A 4DA4A 2IEGA 5K01A 1WXGA 4ZYZA 3TOAA 2PR2A 4X1IA 4WOKA 2JFZA 4XJVA 4X8MA 3LZCA 1AURA 3NH9A 3TBHA 3IB3A 4XWAA 2HLDD 2WB4A 3RJZA 1BWRA 1UEXC 3SNKA 1LTQA 1BS9A 4G1FA 3EIWA 4MLCA 2V79A 4ZAZA 1XGOA 2RHHA 3FM5A 3C5HA 1YE5A 1PI3A 1GUBA 2X2PA 5AVVA 8LDHA 2VJJA 1JSCA 1L3CA 3KYCA 4QYIB 2OO5C 1CRWG 3AJEA 1CIVA 4P93A 1UPCA 4BMCA 2GHTA 1F6WA 5C53B 4FDTA 3T0IA 1JPUA 1T8YA 1FTQA 1E94E 1L7RA 3B9BA 2KDOA 4H27A 5T3UA 3CN9A 2AZXA 3MWMA 1I7SB 2HV9A 4AN0A 2XGJA 2MYNA 2F64A 4CG3A 3RYFA 3MKWB 3LCRA 2W8BA 1OKKA 1RQPA 3PD0A 4AX4A 2QQGA 3MQ2A 4U7FA 4JC4A 5ANRB 4TV7A 2GZAA 4UNSA 2AGVA 2CRGA 1O96B 4ONEA 2VKTA 1ZHHA 3IMEA 2VHJA 3EGOA 1F12A 1KMHA 2VHTA 4UFPA 1PVEA 2BFAA 1P6RA 1DEXA 2QGFA 5I7FA 1TECE 1L5MA 4YMSA 1HL7A 1HDZA 2BN4A 5CJJA 4LTNA 3SJZA 1XFDA 4FILA 3LBYA 1SXJB 2X9LA 3MCVA 3LQYA 3E6DA 3WBFA 3IEKA 4BRWA 1VE9A 2L9RA 3FW1A 1A8SA 3IRVA 3UICA 4AXXA 2CLEB 2EP5A 2WYVA 4B33A 1E32A 3FMFA 4XDHA 1L4FA 4AFNA 1E3EA 4ENMA 2JFOA 1RBZA 4YCBA 2ONJA 4EKIA 4OF4A 4CR8A 3CA8A 3DDSA 3SWWA 1PZNA 2F8SA 2D74A 3DEFA 4A3SA 5GPBA 3T1YB 4QPQA 5BSKA 4KE9A 3K72B 1AWCA 3A1CA 3L79A 4INAA 1N7HA 3DL0A 1SAXA 2GPYA 2P4QA 2HMTA 4ND8B 3D6HA 5JJLA 3C6YA 1SXJC 3I5UA 2CVFA 5H83A 4LJ6A 4LHXA 3VSKA 2V9CA 2J4CA 3JQPA 4W5OA 5ALVA 3I09A 4MRSA 5AW8A 3SF0A 4QGAA 4K05A 3R44A 3W05A 3F8NA 1OZGA 3OF2A 1NNSA 4LZWA 4RVNA 4LYJA 1GPNA 1DAHA 1HE2A 3LBIA 1H2BA 4EVRA 3S3TA 1K0FA 5HKBA 1JHFA 1X2EA 4M6YA 1D4FA 5E9WA 2PJZA 1VQ1A 4EYGA 3K4NA 2VE8A 3TLKA 1GTG1 3VSEA 2DPUA 4FNAA 1B9NA 4KLCA 1ON1A 3LQKA 3ASOH 5F12A 2DJNA 4XM1A 1Y4SA 3AP3A 1MW7A 1ZD4A 2YDXA 3EUEA 2PMEA 3THYA 4MRVA 2NAZA 1OFTA 5KS2A 5DK6A 4Q3OA 2PL1A 2PYZA 5ADUS 2IA5A 3R9WA 3NCTA 1V4NA 4QPJC 5FO5A 3ONNA 2H2HA 4GI1A 1A9QA 5JC8A 2STTA 1GGJA 3AP1A 3SZRA 4RABA 2IVFA 3AKYA 5B55A 3WWDA 3H92A 4DC1A 4R31A 4WADA 4DA0A 2MYTA 4QPNA 2DH5A 4D1YA 4DHEA 3EA4A 4B6RA 2B2XA 3RUPA 1ZK4A 2NVYJ 3W1EA 4IKFA 2P81A 3B3FA 1E1QA 4K0RA 5E9QA 1W75A 4QDOA 3AFIA 2IZ7A 3L7BA 4G36A 5AJYA 3N6XA 2ZM5A 4KIFA 3EH1A 5IXYA 3P2IA 3NEJA 2FPPA 4A7PA 1J59A 2ENUA 3GRUA 2JLRA 4QYTA 3VO9A 3S1AB 4F9GA 1L4EA 2IF0A 5D4SA 1JT0A 1UP4A 5BMVF 3R75A 3SI7A 4R54A 3RI3A 2ZREA 4RTLA 3WLLA 1JFTA 4PG4A 4GR5A 2FZLA 3VBEA 5TS2A 5HA5A 5A5VA 1MHPA 4M74A 4FOPA 2DT5A 4DR4B 1WEHA 3OQNA 2OFPA 2X8BA 3V2UA 1OLTA 3HUDA 1WJ5A 1ZARA 4Z3DA 1GZUA 3OF3A 5ITVA 3REQA 4EW1A 5DI9A 4KIUA 4RZSA 4EHLA 2B8WA 5CK5A 5LGNA 3AVTA 3LUPA 3TZQA 5C3MA 5JUWA 4M37A 3L4SO 1C4OA 4O2RA 5IT9Z 4J1SA 2DHEA 5JFOA 1O5TA 3VHXA 4B46A 5FTKA 4EGFA 3GIDA 3MXOA 1L5KA 1F6DA 2J5RA 4YRZA 3FNIA 1T4DA 2IYXA 3K4HA 1WI3A 3PC8C 5C4IA 2XAGA 1PJAA 1VKJA 4S05A 5EZYF 3FVVA 3B73A 3PJDA 3EX7C 1B0AA 2YCLA 2VXOA 1OFHA 1QCDA 2FWNA 2Z9OA 4X66B 3AG5A 1NM5A 4JELA 1I1OA 3EZGA 2IYOA 4HQMA 3M9LA 2F59A 2HBQA 3O83A 3OBBA 3N2KB 4QIWN 2GHIA 1B16A 1JHZA 3TUZC 2XMQA 3H13A 3WQSB 5SYMA 2QVZX 3KT0A 4IS2A 4ZXPA 2FKNA 1F5TA 2QN8A 3ORFA 1E17A 3F9KA 2WJ6A 3IEMA 4FGWA 4YRSA 5JXGA 3DT9A 5FTMA 3ADBA 1CX9B 4BC0A 3RS9A 3GDFA 3GQBA 5LM3A 2FSPA 3R0ZA 4BNMA 3EBLA 4NPHA 4ESBA 2UWMA 1Z9BA 2X41A 2EW1A 4INZA 3LDAA 3TQIA 4NAHA 4B48A 3S2ZA 1FQKA 2O52A 2I4TA 2QJRA 1Z4IA 4W5NA 2K7ZA 4JP0A 4O0LA 2FMIA 3HK2A 1QO7A 5E4JA 4DWWA 2O6HA 1WSDA 4TRNA 4JU8A 2P78A 4YT8A 1TK3A 1G8KA 2B7BA 4AMGA 1L7DA 2QOEA 4ALMA 3MNFA 3EXHA 1WMFA 4M9SA 2LFBA 1LJ8A 2HMWA 3E3LA 2DX7A 3E0JB 2Q2OA 1EVZA 2ODQA 3HN2A 2IZ6A 1YZTA 1GFIA 5MGBA 2FVXA 1L1RA 2ADFA 3RHZA 4EVIA 1YO6A 3WKBA 3HDGA 3WDSA 3R0JA 4UMVA 3UMGA 4BQOA 2ZYTX 2DUNA 2XDQB 3NGXA 2EW8A 4NOMA 3KZNA 3K5IA 2AD1A 4UM8B 2P2ZA 1MO6A 2O1SA 2C0QA 2FWBA 3QWHA 4BC1A 2ZUUA 4Y2TA 4FFWA 1FSEA 4X0EA 1N3YA 3VR1A 2VT6A 2EZUA 2VDVE 3NWEA 1MMDA 4Y2XA 3ZI0A 2I3GA 1VL5A 1SG6A 1ISPA 3QJGA 1OQAA 3NHSA 4M99A 1BR2A 3OSGA 2YZMA 3AIIA 2HMAA 2JCYA 2P3QA 1X7WB 4MUJA 5ILGA 4FYHA 1FW8A 4JXXA 1IC6A 4OYRA 1W0KD 3GFGA 2CW0F 4TSFA 3QHAA 2FAXA 3DV9A 1ETOA 1LWNA 3DTVA 1KVQA 2MABA 3RF7A 1ND6A 5JDCA 4N8SA 3RTCA 1CUZA 1VTNC 4HZGA 2OWEA 4OJNA 1U1IA 4DGWB 1BOOA 4MR9A 2BBOA 2XF8A 3H83A 3K2EA 1IY8A 5E9JA 3GZNA 1ETVA 2I4RA 4NCIA 2PT6A 4JJ7A 2GEKA 5HF8A 3H04A 3P7NA 4MDYA 1AF7A 2DUMA 1A98A 2R0QC 1NW9B 3A70A 4OD0A 4PZDA 5BT8A 3AW8A 2FX5A 4C07A 2H4HA 2WJZB 3T3GA 1K3UB 1L1FA 4FT8A 2MR6A 3EFBA 3HB9A 2VKVA 4LJ5A 4DLUA 1Z4LA 3DD1A 5JLAA 1KP2A 4QWWA 3NJ8A 2OTCA 2XDWA 3WAJA 5EKXA 1GARA 5B37A 1D6NA 3WV5A 3HVHA 2RK3A 5ADVA 1MC1A 3PWSA 1N1DA 4PGHA 5HIMA 1E9RA 1E9VA 4HF7A 2EYUA 5JLXA 3I61A 1Y7LA 4UU7A 1BW9B 3QUAA 3OCYA 1YQEA 5A9SA 3WZ2A 2ZNZA 3WTVC 4BS9A 3OIYA 5EC8A 1WHSA 4LF8B 3UCFA 3OOYA 3ZDDA 5CT9A 4M7RA 1A5JA 3BWMA 3OOSA 4C6TA 2X22A 1L5LA 2D1YA 2ZTVA 4LQCA 3LHFA 4A36A 1ZIYA 3O84A 5DISB 4ETNA 2HJVA 2IV3A 1XA0A 5E1ZB 1YHQI 1QA6A 3WDLA 4DCMA 3TTWA 3IO3A 1OUMA 3GUHA 3L0BA 2FJ1A 3D81A 4XGRA 3CVJA 1JDVA 2H51A 3FLEA 4EW6A 3OZWA 5JG7A 5JO9A 4E3WA 1WA5A 3NYIA 2RGGA 3C97A 3O03A 2Y0EA 2NACA 2WLSA 9ATCA 3EMKA 4E6PA 4IR7A 2JBHA 2O9LA 5EHZA 3V1LA 3X1YA 3G5LA 1YHNA 3FKQA 1X7HA 5TIIA 3HCEA 1AQLA 2NSYA 3NOXA 4BFXA 2XV4S 3CCRI 2PUEA 4LDAA 4OGFA 2R6GA 1Z82A 3AG4H 4L5BA 3ER8A 4DZJA 2QJOA 2I78A 2R92J 2XGXA 3U7HB 3Q5FA 3TD6A 1OZHA 1NVVQ 2BBTA 4M1OA 4KN8A 4KEAA 4TUYB 5HILA 1IZ7A 2C3PA 2OUMA 1N0IA 2NO5A 1PYGA 3RS8A 4FXOA 1YJNI 1FVXA 3RRZA 4FZ3A 1R0SA 5FKLA 1RABA 3G2LA 3O8QA 4COKA 1GDHA 6Q21A 5B3JC 3OHSX 3CCMI 4ON9A 4PPNA 2V6BA 1EFHA 2I6XA 2JFFA 2D7JA 2V58A 3GV0A 4DDVA 3GJ0A 4TLCA 4L74A 3ZU4A 4O8ZA 3DMDA 3RDIA 4BV8A 3V9AA 3F6BX 5J4HA 4R4JA 4GM0A 5IM4A 2D4HA 1UJ2A 4I9UA 5E4FA 1JKOC 2YMLA 1Z0UA 2PS1A 2QJFA 1XZBA 1XTJA 3MWDA 1TMYA 3J7AY 1GQFA 4XWTA 4C7OA 4EDHA 4PR0A 1GZVA 5JBNA 1OU4A 3I1YA 5LR6A 4QUJA 3PU6A 2C2YA 1IJEA 1O6BA 2M5WA 2PQMA 2BFEB 3UR3C 4MRRA 2XWBF 3LQRA 3IQDB 5ALIA 3CF4G 1PBTA 1AHIA 1M2KA 3OOJA 3DEJA 5HTOA 2G6TA 4AJPA 1ST2A 1ECPA 3NP7A 3QYJA 4R8SA 2R751 2GO7A 2VTBA 1EJ9A 4TN5A 1C7EA 3WLMA 1DQRA 4FR5A 2YZGA 1K5HA 2QWWA 5JVDB 4BHTA 1JG3A 1IJKA 4QBKA 4FW8A 2OY0A 4YAIA 3HXPA 3EF3A 4OM8A 4JX5A 4BVHA 5J2UA 5CG1A 5A6SB 1J2RA 3GT7A 4MTLA 4FDLA 2O2XA 4R9NA 3M1EA 2WC1A 4RIHA 2DERA 1A2QA 3E61A 3Q40A 1C3XA 1QQAA 5LP6F 2ESRA 2A6PA 2WZBA 4XM2A 4X20A 2VT7A 4TRJA 4PLPA 2GAFA 3UHFA 1YYVA 2HU7A 5CMLA 1AV6A 4HG2A 4G07A 2C5EA 4PG8A 2VYFA 1ZLKA 1NRXA 4XICA 1GUFA 4BNZA 1DEOA 5IFLA 1IRFA 2HWVA 3I54A 1Y5LA 3JYNA 1XZCA 2M4GA 2LDBA 3U49A 4LY6A 2JHGA 4DWJA 2K9LA 1DP3A 1HW5A 3P19A 1W96A 1OFGA 3B36A 4E70A 2WW8A 3LQ2A 1K8QA 1H8HA 4RFLA 1GG9A 1KOJA 5CXUA 3HM5A 2YJ6A 1RAAA 3I9OA 5LP6A 3SYMA 1A7UA 2FZCA 2DYRH 5KC9A 2H9IA 3KQHA 1IC8A 3NVKI 4C2MJ 3WGZA 5CVRA 1GKUB 1P2UA 2HQ1A 3K4BA 3IQIX 2X6YA 1V16A 3RS0A 4FIZA 3TQTA 2EBUA 3OETA 2LK2A 2X0KA 2CKMA 1NLYA 2GVNA 1SEPA 4QGBA 1I24A 2VZ8A 4JR1A 2EIKH 3CTAA 1H94A 3AF5A 2DO7A 3F4BA 1G5PA 4US1R 1POWA 1NVUQ 4M0EA 1ULBA 3QKTA 1UP6A 1DRVA 1J2JA 5AVZA 1S8NA 3QM1A 2DPGA 2V3VA 5BNIA 1HA3A 1HT2E 4UNQA 3A2KA 3KXDA 2B4QA 1Z0AA 1IK6A 4FS3A 4HLXA 5U4XA 5ICGA 3UJDA 5CDGA 3BG9A 3PGXA 3PXAA 4QUHA 4M8LA 3AM5A 1TCAA 4PQFA 4C04A 1LF0A 3ACCA 2XKOA 2H7VA 3H3XA 3H5LA 3TVTA 4KAXA 2R4QA 1M7HA 2P4WA 2JLUA 2IPAB 4R9RA 1HORA 2VP6A 4P33A 1CCWA 3UMRA 3VA7A 3PNSA 3V4GA 6ABPA 2O7VA 4E07A 3ND7A 1E6UA 3Q0EA 2XB5A 3BR1A 5KNDA 2V7UA 4MYSA 2FOXA 1M6YA 2PZKA 5F7JA 4ZPJA 3RWOA 3THSA 3MOSA 4J01A 1RPTA 4ZT5A 4YCCA 1X0VA 4FCYA 1NNI1 1ISGA 4QEDA 1KEVA 1IHOA 1GXQA 1QHXA 2VWQA 2ZRCA 1U2ZA 4B8WA 3I2HA 3U2QA 2Q2VA 2X51A 4XE5A 4XLHA 3DBRA 4Q4JB 2BM9A 3F7OA 4CIYA 3T5XA 4PYIA 1ZM3A 1NVAA 3WLAA 4YA6A 5IJWA 1D9XA 1FTGA 3HBFA 2MLKA 1CUHA 1OD6A 1J9IA 4F5WA 3LWBA 4OMYA 4MS1B 1S2MA 2NAFA 1P7YA 3FKSA 2HA5A 2O8EB 4AWXA 4AJEA 2VKQA 3QU5A 1ZA1A 3U62A 2W4IA 3BEOA 2WKQA 5GZ3A 1TE2A 2ATVA 2FTKE 2FOKA 2GN8A 2FMYA 4GS5A 1YS2X 2VQLA 3DQPA 4P81A 1UWLA 4O2LA 5IYZA 4BQEA 4YP9A 4U63A 3UAXA 1BEEA 1CE8A 4WK2B 1N2IA 4TVKA 3GC6A 5LDHA 2E4YA 2J1LA 1GLVA 1KMQA 2F8LA 2CY0A 4GR9A 2YBEA 5AKJA 1XYVA 1ZSVA 2VIIA 3KSUA 1QLHA 3A14A 4Y7CA 1D5WA 3HBNA 3F5QA 3RBXA 4GP6A 2E1MB 1PUXA 3FPLA 1T34A 3UH1A 3ZQLA 3H8WA 2HN9A 4BLQA 1Q17A 4F92B 1ZNWA 4D9EA 2BFBA 4R1SA 5K51A 3UB3A 5K4AA 3QZUA 2MH2A 1FYMA 1IHXA 4FDVA 4LNAA 3ABZA 4NHJA 4RX1A 2B1IA 1QVUA 2WV7A 1RU3A 3MK31 2CD9A 1HOXA 4LYYA 1A8HA 2ZJOA 1E1QD 4KWHA 4JLNA 4LOCA 4H6PA 4EY4A 4BZPA 1N5IA 2QRPA 2V59A 2PBFA 4MV9A 2WHXA 3R20A 2A5LA 5CRIA 1YK0A 2HREA 5JAPA 2ESNA 2E1MC 3WC4A 3IEXA 2B5OA 3F8TA 2HPMA 3SHTA 5HJ5A 3QXCA 2AA3A 1XF9A 3C3WA 3UUEA 5EUBA 4EMTA 3PA6A 4Y1FA 4BB6A 3RH0A 3M9AA 3DE3X 2V1XA 3LK6A 1YB1A 3R9KA 3N86A 3WE2A 2EU8A 4O2AA 2ZIEA 3PUIA 1YQDA 2FUEA 2DQZA 3LX5A 4LF5B 3K4LA 1RIFA 2PMKA 4YJKA 4HVTA 1D0VA 4L07A 4F2DA 3DPSA 5BN5B 1WRJA 2DMPA 4CF4A 1UJ6A 3TJZA 4O2BA 1KE2A 3S1RJ 2B8NA 4G8JA 4PYMA 4PAQA 5HDGA 3OOHA 1J6UA 5E3JA 3PR2B 1HX7A 2C4VA 1AQIA 4FYKA 4LZZA 2Z2JA 4D45A 1JG1A 2IP1A 3V42A 1BC5A 4DREA 4JYCA 3CW8X 3R5HA 5E9AA 3UW3A 4XARA 4E2FA 1IU9A 1NATA 4YCNA 4OHYA 4AUEA 5FLVA 2WG1A 1C80A 5D5QA 4M3FA 1YDEA 4ZTUB 1VLMA 1U4SA 5I9IA 2IODA 3Q11A 5F5NA 5ITZA 2M3AA 2CS3A 2WE8A 2WB1N 2OBXA 2Q2EB 4A0XA 1RZ4A 4ZARA 3GW2A 3FUXA 2WNHA 3KVNA 4PVDA 1PU2A 2VE9A 3OQJA 1N5JA 3G0BA 4JLVA 3UB2A 5J4LA 1WSAA 3F6RA 4DQKA 3K1MA 2LBFB 2A78A 2ISCA 1U5BB 2YJGA 1QKIA 5FA5A 4K1LA 4H17A 2NU7B 5ELMA 1X4PA 3KYDB 2E37A 2CLMB 1Y6RA 4TWRA 5KYWB 3HJUA 3DLAA 3D3NA 2A3NA 2I71A 4IDGA 3SBXA 1DO8A 3JR3A 1BFDA 3ZU3A 5BW8A 1C4KA 3H18A 4ZYDA 2H3EA 3UJNA 3RO7A 3S1MJ 2C9BA 1GPUA 5JZVA 2IZZA 1UKEA 3OC6A 1P1HA 3OWXA 1PFKA 4IJWA 2GBCA 1S8AA 1LRJA 1YDFA 4NC7A 3A9VA 1VHQA 3ND8A 1X80B 4L02A 2FX2A 4DMCA 1P4AA 4V0LA 1X3UA 3BRSA 2OAZA 1E3WA 2RGCA 4KLZA 1SU7A 3GLKA 1BVHA 3LKDA 3M6WA 3OM0A 3RAPR 1XTKA 1X42A 2WMDA 5H59A 4LZJA 2QGUA 1UBHS 4AKEA 2RB5A 3FNGA 3LXXA 2OCIA 3CNOA 1Z22A 1QX3A 1KS9A 1U8UA 3K0FB 4JNKA 2R3SA 1OT5A 4ZCLA 1NJFA 5IVHA 2NXNB 2ZB3A 3T4PA 2R47A 2W6OA 3BC8A 5K6RA 3LUKA 4HUTA 4UV8A 4B85A 2NGRA 1NG1A 2EHJA 5FRMA 3TOXA 1W5AA 4EUNA 4QDZA 4BV3A 1Z8HA 4HL6A 5J5CA 2WUFA