1U0JA

Crystal structure of aav2 rep40-adp complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
267
structure length
261
Chain Sequence
GMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of adeno-associated virus type 2 Rep40-ADP complex: Insight into nucleotide recognition and catalysis by superfamily 3 helicases
pubmed doi rcsb
source organism Adeno-associated virus - 2
molecule tags Replication
molecule keywords DNA replication protein
total genus 83
structure length 261
sequence length 267
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.950 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1u0jA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0jA02
2W6ID 3EZFA 1PLLA 3QNUA 4KODA 3GCGA 2GAOA 4Q4JB 5G40A 2ZAOA 3GLIB 3K70D 1YVDA 2IBMA 2ONKA 2ZYWX 4POAA 5ANRB 4FCVA 4DLZA 3CBQA 1OH6A 3FMPB 1JJ7A 4P4UA 1RRFA 5KUTA 3WRXC 3MJRA 1P73A 3PQCA 2QP3A 3R9IA 3M6AA 1UDXA 2CNWA 1T91A 2QZ4A 1KMQA 5F98A 3QXHA 2XGJA 3QKTA 1D9ZA 4CYMA 4C4PA 4GZLA 1X86B 1C1YA 2CVFA 2NO6A 3CNOA 4NZYA 4R71A 4G01B 3CF0A 1ZVQA 1VHTA 1ZIOA 1W36D 2ZI4A 4AYWA 4M1OA 1NN1A 1P9NA 5KSPA 4RD0A 4IXNA 4KLNA 1TQDA 2J87A 3I8XA 3TMKA 3GFOA 4URUR 2YC4C 5KDOA 2C77A 1ZM2A 1YU9A 4V0KA 3T1VA 3TUJC 3ICQB 2J59A 1E0AA 4M9XA 5DI9A 1L4UA 2JEOA 3U4QA 2JIZA 4Q1BA 5KSOA 2C04A 4Q9LA 3P20A 2VP2A 1N0UA 1ZBDA 1V5WA 2LKCA 3KZ1E 1VIAA 5FL7A 3THYB 1IY0A 1ESMA 4Q1AA 2QN6A 3EAQA 1G5RA 5FOTA 1EFTA 3MWKA 2ZSEA 3J81k 3AF4A 2ZS7A 2V3CC 2LCFA 2NZJA 4AKEA 4LBVA 2JLYA 1UBGA 2WWWA 4AKIA 1D8TA 2RGNA 5LBIA 1SXJB 4QBFA 1XMJA 2WKPA 4OHZA 1KMHB 1W47A 4M9QA 2GF9A 1UKZA 1IN5A 4ZIRA 1WBDA 4IFEA 3NG1A 2ZTSA 1NLZA 3TSOA 2GDJA 2IUUA 3UK6A 3VKGA 2R65A 1NJFA 1MV5A 4Q1CA 4YDHB 3K09A 2KWIA 5SZKB 1FPMA 3AVQA 3BC1A 2GTPA 2QAGA 1N6IA 1TUIA 3KXKA 1XJ0A 2D62A 3DM9B 3BE4A 1U8AA 3KTAB 1SHKA 2QBYA 1KGDA 2GXUA 2XXAA 1MRNA 4WOPA 4GRAA 4PO8A 5EXTA 1F2UA 221PA 3EIQA 3T06B 4HZUB 1XXHE 1K5GA 2DB3A 4M21A 5EJEA 4NCJA 1NVXQ 1XD2B 4ESHA 5JLJA 3DKPA 5UKDA 2LKDA 3N2EA 3NBFA 2DHRA 3JVUA 1YHNA 4DVGA 1W0KA 4HI0E 3ZQJA 5FL7D 3FDIA 3I5YA 1HYQA 1SVWA 2GJAA 1H8EA 2H16A 4MKGA 1XF9A 3C5HA 4UXJA 1Q1ZA 4Y0VA 2CCJA 1N6NA 2VP4A 3WY9A 3WMFA 2JIZD 3IUYA 2GJKA 2RAPA 1BKDR 1M8PA 2OFOA 2P6RA 4BFXA 4F4CA 1OKKA 1G16A 4Q4JA 2QI9C 5JSZA 2ODWA 4LY6A 2ZRAA 5G41A 4M1MA 4WIAA 3SC3A 3I92A 3U44A 3EIEA 2XEXA 1VKJA 1Z63A 4DLVA 5FH9A 3FFBA 2QSYA 4LJ4A 3BWDD 4FWTA 2FU5C 2ZJYA 2YOHA 4MYHA 3PENA 3AH8A 4UNQA 1XMIA 5FTMA 4F92B 2BIFA 5FTJA 1ZAKA 1W2GA 1S0UA 4KYUA 4BRWA 2H1LA 1CBUA 1P4SA 1OIXA 2H57A 2RGEA 3PG5A 1F3OA 1YE8A 4PC7A 3REGA 1LW7A 3VKHA 3FE2A 4MGYR 4DB4A 1ZJ6A 1FX0B 2BM0A 1NMZA 3TQFA 3CNLA 5KSZA 3GJ4A 4URYR 3B6EA 4LX0A 4D4MA 3QKUA 1OV4A 1BO6A 2GCNA 2QBYB 3UG6A 2UVQA 5LPNA 3OEEA 5AUNB 1SKYB 2I4IA 4NHOA 1CRPA 1KNQA 2F1HA 4ZKDA 1KSGA 1G7CA 1T8UA 5D3MA 1TEXA 2NO9A 4G1UC 3BH6A 4HDCA 2H7VA 3T12A 4DC9A 4ZI2A 3RS0A 1KYIA 1OXVA 1GNRA 2EWWA 1T0JB 3B78A 3OEED 4RZXA 5HCIA 3BH7A 4KBFA 5FUWA 1VPLA 2HEIA 3NDPA 4QJ5A 4YONB 3CR7A 1DAGA 3E1SA 1DAIA 2BMEA 1VG9B 2YINC 4UJ5A 4BFTA 2JDIA 4PXAA 3GP8A 2RGCA 2Z4RA 3C15C 3KFVA 3LW8A 2PEYA 3C16C 4QGHA 5DSZA 3WMGA 5JSZB 4Q03A 3CLVA 2X2FA 2YC2C 2VHUA 3K9LA 4JLMA 4BFWA 3SYLA 4C0QC 4D0NA 3VNVA 2AK2A 1SVLA 1NG9A 4A6XA 4L16A 3VR2A 1GRQA 4HAVA 4PO1A 1J2JA 4MRNA 3PITA 4BFZA 2FFQA 3AB3A 1OE0A 4HLCA 3W5JA 1OB2A 2O8EB 4MKHA 4C9BA 5FPTA 1IN6A 3M0EA 4HZIA 3A58B 2QEQA 1DAKA 3CPJB 2BHRA 1UEIA 3NXSA 4HLQB 1XEFA 4RKFA 3ASZA 4TT3D 3X1DA 3AKDA 3K09C 3IIJA 4LV8B 4LV5B 1AN0A 3A6PC 5BXQC 1KI1A 1YJ5A 1AS0A 2QG6A 4M1KA 4NCNA 3W8NA 2R8RA 4JJZA 2ZRPA 2E1RA 4EUNA 3U6KA 4MUAA 2WJJA 2R6FA 1XTIA 4TYQA 2O52A 4Q9JA 3PEYA 4KFRA 3WP1B 5IK2D 1R0YA 2EVWX 2QAGC 2WMNB 2WJYA 3Q7QA 3L0PA 4LOAA 1PVOA 2J0UB 4OK3A 3G0HA 4OI2A 2N42A 2ZXUA 1ZNWA 1X6VA 1Y63A 3F5FA 1WRBA 3OE7D 3CIOA 3Q5DA 3C41J 3IGFA 3X1WA 3K0AA 1SXJC 4DSOA 3IIKA 2V8OA 1FQJA 2VEDA 5BQ5A 3GJ0A 5C46F 1AKYA 1N6RA 2O0HA 2DWPA 1E9AA 1QHGA 1KSFX 3MJHA 3ND8A 4WZAE 3WNDA 4C0HA 2F1JA 3AKCA 2ZRKA 2ZANA 2D7CA 4DCUA 1WCV1 1P5ZB 2HJVA 5TMPA 4QBGB 1UF9A 1KI9A 4FCWA 2C9CA 1RJ9A 5CB6A 2JDID 1KSHA 4OQMA 1DBSA 4MYTA 4AWXA 2B7CA 2ODBA 1OIVA 4Q01A 3U6BA 1FQKA 1OLOA 1TNDA 2FSHA 4RFVA 4Q7LA 2YWFA 4B3CA 3KQKA 3HU1A 3D3QA 4G3XA 4TYWA 2W6IA 3QI2A 5DYGA 1G4UR 2NTYC 2OUKA 5TDHA 4UXIA 1XPOA 5JJLA 1SVSA 2MSDB 2GXSA 3GJ8A 1YQTA 5EXSA 1R5OA 4TMTA 4B2IA 2FX3A 3QXSA 3EZ9A 3ONWA 2BEKA 4QBIA 1TAGA 5FTNA 1S1MA 2OHFA 1NVVQ 4JSTA 1F2TA 2F43B 2GCOB 4TMWA 2ZRFA 4EIWA 4TYNA 3QPWA 4XWOA 2RKOA 5J4LA 2UZ3A 3TR0A 1RIFA 2FSIA 2VH5R 4LBZA 1W4BA 1Z2CA 4BLQA 2NIPA 4TLAA 1KO1A 4YMTA 3U2QA 4DEYA 3CM0A 3NEJA 2DWOA 3PJRA 2PJZA 4KFSA 3NVAA 1E9EA 1OB5A 1XD9A 3RSLA 2GESA 2FSFA 1J70A 3CX6A 5BN5A 1S3SA 4Q4HA 3RWMB 2WSSD 2WPDA 4PC1A 4BFUA 1UADA 3KJEA 2OCBA 2W2VA 5KHOC 3PEWA 1I4DD 1ZNYA 2W00A 4OJKA 2OG2A 2ZM5A 1IY1A 1X8KA 1AKEA 3LX8A 2QM8A 4XH9B 2OLKA 2DBYA 3GFTA 4RD4A 2O8DA 4KJZA 3N70A 4US0R 1J99A 3DVLA 3EX7C 1E99A 3QVVA 5AUPB 2IS4A 1OXSC 1GNQA 5CIWA 2CK3D 1RRPA 2F1IA 1ZMXA 1DO0A 2ZIAA 1KZ7B 3QF4B 1PV4A 1TQ4A 2BBSA 1DELA 1MR3F 4ZIRB 2QL6A 2ZQ5A 4EPTA 1G8FA 3NH6A 4OI0A 3A8TA 3VR6A 3KXIA 3SI7A 1C4OA 1G7TA 3GD7A 5JS7A 3KKPA 3ADCA 1XFAA 2ECKA 2Q3HA 2DWQA 2V1XA 4Q4AB 2VSFA 3SDZA 1TADA 2PLFA 4DSTA 4FMCF 1NY6A 3U3MA 4LJ6A 2IYXA 4X8MA 3OFND 4JKYA 2UZIR 3W6OA 3TAHA 5M04A 4AI6A 2FZ4A 3UMSA 3KQUA 4D26A 3KKNA 4UNPA 1UKEA 3GEHA 1R0WA 4KAXA 4CEHB 2D7DA 3ZS8A 1VYUA 3KFXA 4K46A 4V03A 3A37A 1KKMA 2FV8A 4PQFA 1N5JA 1QRAA 4AC9A 4KBGA 2PCLA 4DHEA 2R2AA 4E22A 3DZDA 2PCJA 1R8SA 5CK4A 3IHWA 4S35A 3EC1A 3PR1A 4H1UA 2ZSFA 3AUYA 3W6NA 1OYWA 3DZ8A 1RYHA 5IK2A 2IWHA 2A78A 4BWYA 2R6AA 3BK7A 5GJCA 3WBJA 2NO1A 3U3RA 3HPRA 1G6OA 2WWFA 1D9XA 1P60A 2PH1A 4NCIA 5EXPA 5HE9A 4ZDWA 2L0XA 3LO5A 4YMSA 4Q9HA 2WJHA 3VTKA 3KJGA 3K70B 3QXCA 1FP7A 5EE5B 4BRUA 3A1UA 4XWAA 2QU8A 5SZHB 3PUVA 1IAQA 2RGBA 4JBWA 4HUTA 2YKGA 1Q1EA 4FIDA 1KMHA 1OFTA 2YWEA 4MH0R 1OXXK 2C9YA 3HYTA 2IYRA 3SU8A 1WB9A 1D2NA 2OZEA 2HYIC 2J9RA 4HB3A 4A92A 1R7RA 2QENA 4ZCIA 5A4JA 2XOKD 4JLNA 5E7IA 5FOXA 3BD9A 3GFPA 3AEZA 3ZZ0A 4QM6A 1M74A 2FOLA 4JT2A 4B6FA 3SHFA 1FW6A 4F4IA 1Z83A 3ADDA 4FINA 4X8OA 3GLFA 4HLUA 4DCNA 1KO5A 1KDTA 4MYUA 5KNCA 2V6JA 2Z0MA 3CPHA 3SHWA 3IO3A 4TL7A 4FMDB 5L3SA 5FBWB 5EP1A 2CK3A 2OLJA 3LAWA 1NN0A 3AP2A 3U3KA 5JBQA 2FPKA 1ZRHA 1BYIA 4URXR 1QHHB 3AKYA 5BYKA 2WJIA 4GMXA 2IK8A 1Z6YA 4AG5A 2Q0HA 1P7CA 1TUEA 1IONA 2ZSDA 3UIEA 1N3BA 1JR3E 5DN6D 4UQOA 3NDBB 4WA7A 1ESNA 2PT7A 5DE3A 5FI0B 4BZXA 4C2UA 3U44B 821PA 3BB4A 1VTKA 4M1TA 3L82B 1YZKA 1P2TA 2ZRCA 1VYTA 5TY0A 3WP0A 2BCJQ 5FBVB 2JASA 2CHVA 1GOTA 3LNCA 1JEEA 3DM5A 1E94E 1ZINA 2WWIA 1SULA 2ZS8A 1F48A 1TPZA 1SVKA 3PVSA 1SHZA 5CITA 2BV3A 1I4TD 2ZR7A 3X2SA 2WMOB 5FUVA 3FKSA 3REFA 3H2YA 3L0OA 3Q3JB 4Q00A 4LPKA 3O8CA 3K53A 2FFBA 4FMDF 4HZUA 3CZPA 4L4UA 1Z0FA 5G3YA 1IN4A 3NHAA 3IHLA 3T1QA 4DDWA 4PAOA 2QRNA 4RZ2A 2ZRMA 3JZAA 3KTAA 2GZHA 3RRNA 1S9HA 1QHHA 1X8JA 2PLRA 2YNMA 2KE5A 4IDNA 1NI3A 2QAGB 1GNPA 2R6DA 3QJYA 5HKKD 1UBFA 2HJGA 3B5JA 1RW4A 2WIBA 3NBZC 3B13B 3RABA 5L3SB 1W0KD 4PC3A 1E79A 3O8RA 1EGAA 5JWOA 1E1QD 2ORIA 2QTHA 5HZHA 2ZE5A 5EUMA 1KJYA 4RD3A 1OXTA 1PUIA 2RHDA 1UBEA 1GILA 3LVRE 4A2WA 2O8CB 4C7OA 2YJTD 2HCJB 4IVPA 3C7KA 1CEEA 4EQ6A 3D31A 1XCGB 1KI4A 4OK5A 1FX0A 2WAYA 1ODFA 4XVUA 1OT3A 5EUQB 1DTSA 3TSZA 3PV0A 2AN9A 1HUQA 4CT4B 1RE0A 3M4YA 1KOFA 4HB0A 3QSYA 1W5SA 1G3UA 3BORA 4BFSA 4ZV4A 3LX5A 3BIFA 4FD2A 4IHQA 4TMXA 4Q9IA 4CW7A 2G0NA 4DKXA 1RC8A 2BJWA 3QBTA 3QPVA 1E9CA 1NRJB 2MMCA 1DAFA 1LF5A 1Z8FA 3FFAA 3VFDA 3SE0A 5AJXA 1OFUX 3MWJA 4RD6A 3CNNA 4PSVA 2CE7A 3TUIC 1KO4A 3THXB 4LWZA 2ZI9A 3OE7A 3DO6A 3SJBA 1XB2A 1XRJA 2P0EA 1E2JA 4PHHA 4BPBA 1KHTA 3A1WA 1VCOA 5KO2A 4F7WA 2BVNA 4MGKR 2CHGA 3O8BA 3VU9A 2WSMA 3VR4A 2I1QA 3EASA 4O0MA 1W4RA 3MSXA 5FBLB 1IN7A 2GF0A 4XTRA 4TLDA 1CR1A 3NIBA 4LC0A 2GXAA 3C8UA 4D25A 2B7BA 3CPEA 3KUCA 2ODNA 2MSEB 1KIMA 4HAWA 2QMOA 3OAAA 4FWIB 5CK5A 3H0KA 2JLQA 3SZRA 5GVSA 2GZAA 1OH7A 1S1CA 2WTUA 5G53C 2WM9B 4DBLC 1NJGA 5D3QA 1WXQA 3FKQA 3GQBA 3MWLA 1QDEA 3R7WB 4B32A 1GZSA 3QY0A 4U5XA 5KU1A 3B1XA 4OHVA 1JPJA 2P2LA 4B43A 2OCPA 1XCPA 4A6PA 3PUXA 1YZGA 4KFUA 1G8YA 1JAIA 4LSGA 4JJKA 1M7HA 5FPYA 3UPUA 1WE2A 2W6JD 1GL7A 2HLDA 2QRZA 5DHAA 5B30A 1PLKA 1XZPA 3BB3A 3TSWA 3QVUA 2FEOA 3HU2A 3UMFA 3IPXA 5BW8A 621PA 2GJ8A 4EPVA 2Y8EA 2CBZA 4JLPA 8OHMA 2OAQ1 3BH0A 4GZMA 1K5DA 2P3SA 4PFSA 1G5PA 3HJNA 4LHVA 4IFBA 3FGNA 2ZI3A 3PCRB 4NYMR 3QENA 4Q1FA 2HT6A 3QF4A 2QMUA 1JR3A 1NLFA 3DHWC 3L8YA 2JA1A 3LY5A 4KYIB 1SXJE 4B6EA 4XSHA 2CCKA 4MDFA 4Q7MB 3OIVA 1FMLA 4LJYA 2AKYA 2V55B 2VF7A 5SZIA 4DDTA 3FHTA 2XZLA 3WHLA 1CTQA 1VECA 4TL6A 1ONBA 2IYUA 1AQUA 1KI6B 2C78A 5E7MA 5LDDC 2A5DA 1OXUA 2WV9A 5E4FA 1KNXA 4GI7A 1HE1C 2ZJ8A 4M22A 3U61B 1GWNA 1CR2A 4ZDJA 1XTRA 5HZKA 2RGAA 5J4VA 2ZRDA 1QZXA 4B3GA 2XSZA 3V9PA 2XTMA 2IYQA 1RKBA 2WWYA 3U7GA 4CEJB 3A1SA 4FXPA 3QXXA 1N6HA 3HR8A 1X8LA 3QIAA 4QFMA 4YC7A 4R98A 2IYVA 4LHWA 3SOPA 4KSCA 4URWR 3HWSA 2JAQA 1ZIPA 1KZGB 3W34A 1OKKD 2EQBA 2KI5A 1G64A 4L15A 3WYFA 2QPOA 2O8CA 1H8HA 1LFDB 2WZQA 3OEHD 2CLSA 5EE0A 5F9HA 3ZIAA 1H8ED 1IBRA 3V4FA 1R4AA 3QEJA 1DAMA 4EJSA 4ON9A 1XEWX 4N1AA 2BKEA 3HP1A 1Z29A 4EPYA 1U98A 2VRWA 1YZNA 3M1IA 4D82A 3BRWD 2RB4A 1W0JA 3CRQA 3AQ4A 1LS6A 1E2DA 1SQ5A 1WMSA 2YWHA 2XB2A 1DE0A 3DKVA 1Z3IX 3BXZA 4D0GA 2O0JA 4D80A 1NMYA 5DYIA 5AWFC 2IL1A 1G7SA 4PX9A 2FSGA 2QTFA 1XXHB 4LBYA 4UJ3A 5AJZA 3W3ZB 1HURA 5LD2C 1ZYUA 1ZCAA 2JCSA 4PZZA 5J5CA 1K6MA 5B58C 4OBEA 4ZDIA 1D2EA 1FL9A 2XNDD 1Q21A 4X8HA 4AYTA 1Z2AA 2RMKA 4PHTA 1Q57A 1ELOA 1MRSA 4NP6A 3CZQA 4OHYA 2D4HA 3T34A 1GM5A 1HQCA 2OXCA 3IIMA 3EG5A 4ZKEA 4I4LA 4RCZA 4E09A 2ZUDA 1NG1A 2F43A 1ZD9A 3SFZA 5C1BA 1EFUA 4JLBA 3B1WA 3THOA 5AR1A 1T8TA 3BFVA 1US8A 3QF7A 5FL3A 4BLPA 2HXYA 4B73A 4RJLA 1LF0A 1WP9A 3KXLA 2YVUA 1A7JA 5GJVC 4JYBA 5J4HA 1KY2A 2E9SA 3Q85A 2J0SA 1YKSA 2GILA 3CW2A 2AX4A 4EPRA 2K5UA 1NBMA 1AGPA 4TLEA 4NYJQ 2ZSBA 4JL8A 2OSBA 3MGCA 4AD8A 1AGRA 4IOMA 4UNNA 5IF9A 2HT1A 2V7QD 4MRSA 2PZEA 4HAZA 5DHFA 1U90A 4QGAA 4AK9A 4DLTA 3P1JA 1VYVA 1JXMA 1YZQA 3I32A 5C2JB 3U7HB 2HF8A 4IEEA 3SYKA 2ZYTX 1UDWA 1ZC4A 2BMFA 4F91B 3TIFA 1CU1A 2QE7A 2F6RA 3TVDA 5JRJA 3SS8A 1QHXA 2W2TA 1X3SA 2Q9BA 5TV2A 3TR5A 4ABYA 2D2FA 4C0KA 2FPLA 4KVGA 1RRCA 3CONA 4L5BA 2I1VB 4D4KA 2C99A 1D2MA 1CP2A 2HDNB 2C98A 2CNWD 2C96A 1CR0A 4Q4AA 2NQ2C 1KO8A 4C0SA 2A7QA 3AVVA 2D74A 2FN4A 4XVQA 1KDOA 1MOZA 2CE2X 2VPPA 5H8WA 5JWRA 3RANA 2BEJA 3K0FB 5EQTA 3ZDQA 5H70A 4TTRA 1NVWQ 3ZYCA 2ZRGA 4DCSA 5KNBA 1DEKA 2XB4A 1GL6A 3LQRA 4PAQA 4HLUC 4ZI3A 3ECCA 1EXMA 2B8TA 3EPLA 2Q9AA 3GEIA 3B9QA 4DZZA 3AGPA 3D8BA 5BN4A 4DRZA 2CCGA 3U3JA 5KOYA 1FZQA 1Z22A 4AKGA 3OHMA 1TU3A 5H68A 3SBEA 1QVAA 2W2XA 2BOVA 1NNEA 1AS2A 3NHBA 5H1YA 2QTVB 1IJFA 1IM2A 2TMKA 1Z47A 2NPIA 4RFSA 2EWVA 4G5SA 1R8QA 1KO7A 1JXOA 4NCHA 1U9IC 1JAHA 2CMKA 4LGMA 5EE9A 1ZM7A 1W4AA 2GAAA 1RPZA 4NH0A 2W0SA 3CRRA 1E6CA 1E98A 1SGWA 5K8TA 4AIIA 1F60A 4A0RA 2B8WA 1OH8A 1S96A 1E32A 2VP5A 1YZLA 4Y0AA 4L9WA 1Z6XA 4MRPA 1IJEA 3GJXC 5KPJA 5CJ2A 4WZBE 4A0GA 3AVUA 4B71A 2ZITA 2J46A 3W90A 1E1RD 1LS1A 2ZAMA 3CO5A 4KSBA 1DS6A 1COWD 2WIAA 4DIDA 4V0ME 1ZP6A 4A8JB 1QG4A 1IY2A 2HYDA 5BWMA 4JIMA 4PHGA 4GBMA 4U02A 5EE1A 4IDPA 4QHYA 3FWYA 2YZ2A 2JLXA 2IUSA 2XXAB 2CEAA 4P31A 5J47A 2F7SA 4AYXA 4MGZR 2J0VA 2JJ2D 3H84A 5TARA 2O8FB 1XD2A 1CJVC 2GZDA 2ZROA 2VHCA 2ZETA 4EFNA 2O8BB 2IF0A 4EFMA 2IYLD 3ZZUA 4AKHA 2IYZA 4CEHA 3THWB 4V02A 4GL2A 1S4QA 2FJUA 2Q3MA 2DFLA 4M1SA 4OHXA 4Q5IA 1CXZA 3I1FA 1GAJA 4CVNA 4KITB 1QHSA 2J1LA 3SJZA 2CXXA 1F5NA 2G1JA 1XDBA 3LW7A 4US1R 4OK6A 2GRJA 4NTZA 2J45A 2AXNA 2NOAA 4NMMA 1Z0JA 4R9UC 3W3AA 1NIJA 2IX3A 4JKIA 2FEMA 1E2IA 3LDAA 1XPUA 2QP4A 1EFRA 4Q66C 1PJRA 4KFTA 4ASUD 1UEJA 4EFLA 4C7OB 1DOAA 2I3BA 4CEIB 2AD1A 1EWQA 1NBMD 4GOKA 3PXGA 2ZJ2A 2DPXA 1T5LA 4MDEA 2IEYA 2OESA 1J90A 4PO9A 4B76A 4ZCMA 2BC9A 3B1YA 1R0ZA 4WW0A 4BECA 5HR5A 2KJQA 1CF4A 5AUQA 2FGKA 4Q21A 2ZR9A 4GP6A 3KQLA 1HT1E 1DO2A 1E96A 1N6PA 1SVMA 3T5DA 1U99A 1G4AE 2H8KA 2A5GA 3P27A 4LK2A 3MLEA 1JALA 1HH4A 1IOZA 1LTQA 3GMTA 1WQ1R 4OI4A 1Q0UA 1NVUQ 2ORVA 5CDFA 5DO9A 2FA9A 3IPYA 3K70C 2OO7A 3RVBA 2IHBA 3HR7A 1DG1G 2AR7A 2BCGY 3H4MA 3RHFA 2OCYC 2IS2A 4YXWD 4DXAA 2FNAA 3AVPA 4JMPA 2IXFA 4EDHA 1BMFD 1CULC 1XU4A 3AP3A 4QGFA 4PPNA 1P2UA 1VDZA 4TLBA 4ZDKA 3V4RA 4NL4H 1KI8A 3CKLA 4Q18A 2V4ZA 2FFHA 4JVSB 1FP6A 1R2QA 4C0BA 1JI0A 4C0JA 3GLGA 3B82A 1R5NA 1FTNA 1QHYA 3RNLA 1SXJA 4XIGS 2ERYA 3IO5A 4B48A 5FFMA 1OHHD 4ACBA 1GDDA 3SBDA 1BYUA 1IXZA 3A1VA 3ZD7A 1OW3B 2JJ1A 1IQPA 1QF9A 3ASYA 4TN1A 4CIDA 4DEXA 2ZJOA 2FE4A 3GLIE 4LHXA 1XXHA 1CR4A 1COWA 4JBYA 3VMFA 1CJTC 3V00A 1XTJA 2F1RA 3U4QB 2O8BA 5CM9C 3CRMA 4GDFA 3ZLJA 4D4LA 2VA8A 2OM2A 4B3XA 4LC1A 1M6NA 3OZXA 3ZVMA 1G5TA 3EIHA 4PC6A 4CGZA 2IW3A 1MO6A 2A5YB 4W9MC 1RZ3A 2SHKA 1N6LA 3EPJA 3CF6R 3TJZA 1PLJA 1D6JA 3LRPA 2ZVQX 2OFWA 4OYHA 1UM8A 2DFNA 5EE3A 3T1TA 2ZJBA 4A0HA 1W4CA 4PANA 4PQRA 1ZM9A 3TLXA 1XCMA 3FTQA 1G3IA 4DLUA 4Q7JB 2JATA 3Q8XB 4NPHA 4R2IA 4WXRA 1A2BA 3S1AA 1E2MA 2QAJA 1Q22A 4MYCA 2QPTA 1ZUIA 4QKQA 3GLGB 2J7PA 1OF1A 3QOFA 1N5LA 4C30A 5KTYA 3T1OA 4LRWA 4O2LA 4CZ2A 4PPGA 4C0LA 3I61A 1ZNXA 3P4YA 2XITA 2JJ1D 1GUAA 2GBLC 1DARA 1CJUC 2IEZA 2YOFA 3UWOA 1GP2A 4RKEA 1EG7A 1TX4B 5CB8A 3SFVA 5HE8A 3D6TB 5E3HA 3CF2A 5FOUA 5G3ZA 4QNRA 421PA 3LH5A 4BZPA 2EYQA 1SVOA 2WWGA 2AKAB 2JLZA 1G1MA 4HDOB 2PJRA 1B23P 3WBKA 3LVQE 3BS4A 3SR0A 2WAXA 4TTPA 1EX7A 4N0DA 1OH5A 1MABB 4XD7A 1RRGA 3Q9LA 5FPSA 1ZM4A 2WKQA 1GVNB 2G83A 3EZ6A 4HEJA 2G88A 4NYIR 1E2FA 2KSQA 4QJ4A 4IDQA 3O8DA 4DUGA 1P2VA 4OJQA 5JEDA 2AWNA 2ZPTX 4BEBA 1U8YA 4YXWA 4US2R 2QSZA 4JVMA 3GJ5A 3PEUA 3B7GA 2ZUBA 3K9GA 1ZW6A 1TQ6A 5JJIA 3MRSA 5IDVA 3WMEA 4Q47A 2NG1A 4HATA 1KK3A 1TF2A 1Z07A 2V1UA 2J0UA 1KK2A 4BEJA 1JNYA 2PBRA 4U7DA 3CRVA 1VCIA 5JWHA 3TE6A 5FTLA 1GSIA 3MCAA 5GJBA 3A4LA 1HV8A 4IW3B 4JYCA 4JL6A 2AK3A 4UNRA 3P4XA 5EXXA 1IN8A 4TZ6A 1KAOA 4HUQA 4D6PA 2PMKA 3DEFA 2VYFA 1P72A 5DI3A 2NPFA 3EZ7A 2XJ9A 4YDSA 2J7PD 1BH2A 2FPMA 2C8VA 1FNNA 1VHLA 3QXJA 4I1VA 1NIPA 1KJWA 3NEYA 5FR2A 2Q9CA 3ADBA 2J3EA 5ELXA 1P9WA 4G5QA 5A0FA 2REXB 1A82A 3THWA 3ZGXA 3QKRB 2VHJA 2AXPA 4EPXA 1CLUA 3QUSA 1L2TA 2G3YA 3Q72A 3B9PA 5IHPA 4A8JC 4C2TA 4TSFA 2WHXA 4P3YA 3QQ5A 1II0A 1WDTA 1Z0DA 3TAUA 4AY2A 3DMDA 2ZYUX 4JLJA 2ANCA 1J8YF 1R10A 1S2MA 2QT1A 4CDGA 2OFXA 1MKYA 4LYAA 2P5SA 3SQWA 2RH5A 1KDRA 1QHNA 2P65A 2KBEA 2PT5A 5BYJA 4DLXA 5AJYA 4ESVA 2JLVA 5DGXA 1G20E 1T5IA 3NTUA 4N0EA 4D2IA 3I4LA 1O87A 1U0HC 3B1ZA 1E2HA 721PA 1O3YA 1E9RA 1JECA 2P6NA 4GT1A 3VHXA 2EFEB 1DPFA 1E2KA 1Z28A 5B2ZA 3EWSA 1OFHA 2QMEA 2VP9A 2XNSA 3K0CC 1NMXA 2P5TB 3LXXA 5DLQC 4B3DA 4F38A 1U81A 1ZD8A 4S2EA 2H18A 4J0QA 3I62A 5J4KA 3I72A 2X77A 2HCBA 1NP6A 2P6UA 1E2PA 1CIPA 1GTVA 1E9DA 5CJPA 2N46A 1NL3A 2ZJZA 2VHQA 2R9VA 1S8FA 3CWQA 5FUYA 4DJTA 2NGRA 1T9HA 2F9MA 2WOOA 1CJMA 3OF5A 5IRCD 1A1VA 5FPKA 5GJWC 1E2NA 3IDQA 1P75A 4DIEA 1UKVY 2AD5A 2IS6A 4QNMA 1Z6TA 3R9XA 2GA8A 3E2IA 1KI2A 1UKYA 4R7ZA 5K8IA 4MA4A 4NYJR 4KVAA 2ZE7A 4LJ5A 1E2LA 3K8YA 2C03A 2CJWA 1WA5A 4JLDA 1JR6A 1KDPA 4W5JA 1OYYA 5F2EA 4BZQA 1G291 3MFYA 3EXAA 4L9SA 4M0LA 4E07A 4PSAA 1GRRA 3VKWA 4I1OA 3QG5A 2AWOA 3PIRA 4I81A 4V0NA 3UMRA 3U60B 2RCNA 2RGNC 4A2PA 1TL7C 3I5XA 4U00A 2AFIE 3RS2A 4QJ3A 3B60A 5DNYB 4II7A 2ZI7A 4OHWA 4P4TA 5TXGA 3ZQ6A 5JECA 2IC5A 2C5LA 1QBKC 2KB0A 4M9SA 2D06A 3H1TA 4CEJA 3RC8A 4DT1A 4Q19A 4D0LB 5KPDA 2YHSA 1U8ZA 2LWIA 1EWRA 4B2PA 4BQSA 1VG0B 3GLHA 3NBXX 1HY3A 3T35A 1DAHA 2VLIA 3VU9B 1YRBA 1F2UB 5CYPA 2ZRBA 5KDDA 3Q5EA 4W5HA 3VX4A 4DDVA 4BGDA 2VP6A 1R6BX 3X1XA 3DOFA 1XMVA 1BS1A 1FFHA 2RGDA 4LJ7A 2QGZA 4MRRA 3NC0C 1SKQA 4PC2A 1EFCA 3VAAA 4QGGA 2JLWA 2O8FA 2F3RA 3RRZA 3THXA 1AA9A 1Q12A 2DYKA 4RSGA 2W6JA 4RZ3A 2D3WA 1QG2A 4URVR 5HCNA 2ORWA 2RGGA 1BMFA 4NU0A 1G8PA 4DUGD 2VQSA 1HE8B 3F0TA 2ZE6A 1ZUHA 4JSYA 3BBPA 1JJVA 3VQTA 2WBLC 4LJAA 1XTQA 4KCGA 4M2LA 1G18A 5J4YA 4G5GA 1LNZA 3TKLA 3KKOA 4LV6A 4B47A 2QT0A 3F3YA 2IUTA 4IKEA 3FB4A 3ETLA 3GLFB 4MGIR 4YMVA 4CT5A 4DCVA 4XTCS 4JS0A 4CEIA 3K0AB 3ZZTA 2MSCB 3HU3A 3OAAD 1A4RA 1LVGA 5EZ6B 4LYFA 1S9DA 5GADl 3SYNA 3KDSE 4JLKA 1X1RA 4P32A 1M2OB 1E2EA 3ZVLA 1MO3A 4JBXA 4Z8YA 2FMXA 4QC2A 3IEVA 3QKSA 4OQNA 2A9KA 2VSOA 1KAGA 2VSXA 2ZRHA 3SN6A 4Q4LA 4LYJA 4ASUA 1W1WA 1AJEA 3LQQA 4Q48A 3UKDA 1UPTA 3F8TA 5BN3A 2PZGA 4JL5A 1OJLA 4PSKA 5KNDA 3I73A 4TYPA 4Q1DA 4LJ9A 3NWJA 1Q3TA 4JVLA 5CYOA 4FW9A 2Q3FA 1KKLA 2ZYVX 2XZPA 4LUCA 3BERA 4GOXA 2GK7A 5L3VA 5AK0A 2GCPA 2GKSA 4DWJA 3A4NA 1XTKA 2Z43A 3PUYA 1ZD1A 1G17A 1RVDA 4UXHA 2ZRJA 2ZI5A 4QRHA 4TL9A 5JI2E 4V0OA 1TQ2A 2H92A 2W0MA 2IHYA 1II8A 3C4JA 2YYZA 1W36C 1NLYA 2EU8A 3RC3A 2X1VA 4M1WA 1NVVR 4MKIA 3X1YA 4BLOA 5LD2B 2ZJAA 4HDQB 3HYRA 3KB2A 1E2GA 1Z0IA 3DDCA 1N5IA 1JB1A 4IRUB 4K81B 2VTKA 1CRQA 4DT1B 2WVJA 3P26A 2F3TA 3LBIA 1NKTA 4C0AC 2QORA 4CRWB 5HKKA 3ZIAD 2PX0A 3AVYA 1DG3A 1OHHA 4L8GA 3Q7PA 2Z6VA 1UBCA 3G82C 4TL8A 1H8HD 2GVZC 1ETUA 1GITA 2VL7A 4B3BA 1M34E 2A5JA 2WPDD 2V9PA 3FMFA 5E95A 5FOWA 2CDNA 2GXQA 3L0IB 2FGJA 2DFKB 1M7GA 2HF9A 3JVVA 4UNSA 4KLZA 1T3LA 1A5TA 1YR9A 2YWGA 3LD9A 3VHLB 2EYUA 1Z6GA 1NKSA 3TW8B 4TYYA 4UKDA 1C9KA 4IXMA 4TMVA 3ZVRA 3L8ZA 2XSZD 4G5OA 4Z54A 4NKRA 3FMOB 5JFGA 3BFKA 2H17A 4TSFD 2ANBA 4P0TA 5FTKA 3ZJYA 3AV0B 1W46A 5JI3E 3BAFA 4O2RA 5JHGB 4GFDA 1GL9B 1GIAA 2JGNA 4NYMQ 1XWIA 3K0FA 1GFIA 1R0XA 1NBME 2WOJA 1G3QA 3FYHA 5KDLA 3RS4A 4DSNA 4DB2A 3MWYW 3EPHA 5L3QA 5E7JA 1TU4A 2FG5A 4BASA 2QQ0A 3VX3A 1QHIA 4KHZA 3QEOA 4M8NE 1VG8A 2REOA 4OL0A 4B75A 2QUZA 1T3HA 3AF2A 3CRW1 2MMGA 1JR3D 4D81A 4PZYA 5DISB 3WYGA 3IBGA 3SNHA 3R8FA 1E4YA 2OXRA 1B0UA 1JEDA 1G21E 2J5XA 4DLRA 1NN5A 2IT1A 3DMNA 3DL0A 2BMDA 1E9SA 1XMSA 1W7AA 4QBHA 3LLUA 4HAYA 2W58A 4LYHA 2OT3B 1F2TB 1P6XA 3TVTA 4NCKA 2KBFA 3N5CA 2F9LA 2O8EA 5DI3B 3TQCA 1UJ2A 2HLDD 3SEAA 3KL4A 4GPTA 4RD1A 4HUQB 4MUBA 1DAEA 2XNDA 3AUXA 3RSOA 1RYFA 4NE2A 2B21A 5JS8A 4A9AA 1CS4C 2ATXA 3SJCA 2QP9X 2PMDA 4W5WA 2FWRA 1BIFA 3K0EA 1OPXA 4XVRA 3WHKA 4CF7A 2ASEA 1E3MA 4QXAA 2DY1A 1V43A 1Q44A 4ZPXA 2GK6A 2C2HA 3QKRA 4MQBA 4N3NA 2XJ4A 3RYTC 5B64A 1UAAA 1YR7A 4MKFA 2JJ2A 2WWXA 1HTWA 1FUUA 2BKUA 1KK0A 4B74A 1VIYA 2R6GA 2WKRA 2QGNA 4I1SA 3GLIA 1NSFA 4G5RA 3THYA 2IYTA 1TMKA 2QQEA 5JJKA 5C4GB 1TTTA 1SVIA 3TW4A 3HPQA 3TH5A 121PA 2ZS9A 3ZS9A 1TF5A 3CUEF 2CJWB 5CLLA 2ERXA 4DLWA 1X1SA 2JLRA 2ZR0A 3FPAA 2ZVPX 1P2SA 4KXFB 3WRYC 1ANKA 1IXRC 1G19A 1P61B 4RZUA 4YMWA 5EP4A 4EPWA 3PFIA 3K9HA 3B2EA 4FMCB 2F55A 1AM4D 2IYYA 5LB2A 3LV8A 1GKUB 4QM7A 4E03A 2WJVA 5KSYA 1EK0A 1U2RA 3AF1A 4Z51A 4EJSB 2BBTA 3OIYA 4OQFA 4F93B 5C18A 4Q7KA 3EZ2A 2V54A 3BOSA 4QHSA 3CB4A 2ZRIA 4A15A 3UANA 2EFDB 4NYIQ 4BFYA 4DSUA 5FBQB 4Q02A 3KUDA 5TVKA 2VF8A 4A8JA 3VNUA 2EW1A 1XTSA 4HAXA 4Q1EA 2QM7A 2DFTA 1J7KA 1GKIA 2A3RA 3FVQA 5A5GA 1FOEB 1N6OA 4RY2A 2CLCX 3FHOA 5K8LA 2QMHA 4LJ8A 3PUWA 3CH4B 3IILA 3L2OB 4JT4A 2Q6TA 4LDJA 1G9XA 4KO8A 2ZRNA 4B3FX 4W7SA 3RS5A 1XJQA 1W0JD 4JLOA 5JMTA 4QG7A 4A4DA 4B44A 1E1QA 1ZCBA 3E70C 1Z0AA 5EZ5A 1AQYA 2X19A 4I99A 3KQHA 3ZD6A 4FCTA 1N5KA 1W44A 1JBKA 2JLSA 3W5IA 5JCPA 3OEHA 4RFSB 3AP1A 1SZPA 2D2EA 1DVRA 2J41A 4HYYA 1SXJD 2HV8A 2G9NA 4YQFA 1G6HA 2P67A 1KSJA 1T3SA 5FOVA 3EA0A 1NY5A 3FOZA 2WSSA 3TUZC 5DH9A 2EFCB 4ERNA 3WXMA 1WF3A 1KI7A 1II8B 3OIUA 3GPLA 3D7MA 4IEIA 2GBLA 2AHOA 4LHZA 2E87A 3EW9A 4ITRC 3PEVA 2ODEA 3W8RA 1VMAA 3P32A 5EP3A 2CHQA 1PZNA 3E5HA 5FUXA 1D5CA 3CX7A 4B2LA 1L8QA 4PPQA 1OFIA 4WVFA 2WWHA 4URZR 1N0VC 2QPAA 1MO4A 4ILEA 4LI0A 4TQAA 5SZJA 2QY9A 2GEUA 1MO5A 2V7QA 4Q4HB 1U9IA 2WICA 6Q21A 4M9ZA 2ATVA 4QL3A 3U3OA 4ACAA 1KI3A 3T15A 1G3MA 4DLYA 1LY1A 4PAMA 5LB4A 5KYKA 2REBA 4TTQA 2FFAA 3U7FB 3KJHA 3R9WA 4IDHA 4BE7B 2BJVA 3AVXA 2OCAA 1KTVA 2OBLA 1E4VA 1MABA 2BDTA 5CM8B 5B57C 2OEPA 1XNJA 1W36B 2ZJ5A 1L4YA 1T6NA 2H5EA 5P21A 4K8OA 1I2MA 1AS3A 4IJMA 4DDUA 4QOSA 1Q1BA 1P62B 1Z08A 1ZC3A 4PTLA 5FPHA 1I4LD 4AURA 3DPUA 1EFRD 4TWZA 1S3GA 4A2QA 2EFHB 4DLSA 2GVDC 1W5TA 4LPSA 2PZFA 4HLDA 4ZO4A 1E9FA 2R44A 2GEDA 3IQWA 3O47A 4GNKA 3T5GA 1AZSC 1QVRA 3A36A 3L43A 3U5ZB 2NMVA 1P3JA 1US8B 1XD8A 4B33A 4OQXA 1I2DA 2XOKA 5EP2A 1GKYA 1XBTA 3QBVA 5JZVA 1HA3A 4OI1A 1AIPA 3RS3A 4E5UA 1YZUA 4XD7D 3MG9A 4A36A 3CH5A 2Q21A 4BLTA 3W6PA 4A1FA 1HQYE 3OESA 2RGXA 4WBSA 4M4SA 1JQLB 3GJ3A 4TMKA 3S1AB 2RHMA 2HXSA 3T61A 3BJIC 3W9YA 4PZLA 1JPNA 1U0LA 3TK1A 1ZNZA 1M7BA 1E0JA 3RLFA 1VCMA 4IDOA 4MRVA 2ZREA 2ZSAA 1M1YE 2OAP1 2ZEJA 4XWKA 2XAUA 1XP8A 4GOJA 3AM1A 4A82A 4OKSA 1YZTA 4LCBA 5CLQA 1Z5ZA 1VCNA 1EESA 3U7EB 4P33A 4GSYA 2NZ8A 1N25A 3X1ZA 3IEUA 3QPUA 4GP7A 3H86A 2IWRA 2JLUA 3NBYC 2QNRA 2A2ZA 5FR1A 2GJ9A 4O3MA 5JHHB 4JLVA 4C3ZA 4ZCLA 4M53A 1HEIA 4FN5A 1TF7A 3IBYA 4AG6A 2FZLA 3HDTA 4EAQA 3MMPA 5FI1B 5TB5A 3UATA 4H9GA 3ADKA 1GRNA 4JVNA 1K8RA 3LA6A 3NH9A 3KQNA 2FF7A 1A2KC 2JJ8A 3KX2A 4WZ6A 4BFVA 3K0SA 2Z4SA 3LWNA 1KJZA 2G0TA 4GMDA 1KK1A 1F6BA 1Q3HA 1NN3A 2O8DB 2VIIA 4P4SB 4PQYA 3EWAA 4NBSA 1WBBA 1OSNA 4F4JA 4WXPA 4RVCA 4PHFA 5JCZA 3ZVNA 4IOKA 4IOLA 5JEEA 2IXGA 3CX8A 3EA5A 4TQ9A 3TGPA 3GLHE 3AVWA 1HT2E 4HAUA 3B1VA 1XEWY 2BWJA 3SQXA 1AK2A 1Q1QA 2AL7A 4JZKA 1E79D 2A5FA 2W83A 3ND9A 5L8VA 1XX6A 3CWZA 2FDCA 3EARA 4IVRA 4OQLA 5HTKA 1EFHA 1G3RA 1T4GA 2HUPA 1W48A 2PX3A 3BB1A 3GEEA 3AF3A 4D4JA 3C5CA 5C4MA 2J0QA 3NKVA 1Z0KA 1FMJA 3A4MA 1KI6A 2BMJA 4Z1MD 1OIWA 3WNCA 3AVOA 4NONA 1DADA 3VR1A 1MT0A 2VHTA 1N2CE 1W49A 1EX6A 4XJXA 4JLAA 2O0KA 4LBWA 3RRYA 2VO1A 1MH1A 4V0LA 3R8CA 3K9NA 1YR6A 1G8HA 2QE7D 1ZM3A 3RDPA 4M1YA 2R6CA 1KY3A 4G0NA 2IYSA 3MUFA 3PUZA 2GHIA 1BOFA 3LLMA 1U94A 1Z06A 4MITA 4TQUS 5L3RA 4R2HA 4YLGA 4DCTA 2IF2A 2BBOA 2G77B 2ZU0C 5GVRA 3UG7A 2OE2A 2GJSA 3JZMA 4BLRA 4TLCA 3RWOA 1R5BA 3LBNA 2QA5A 2XTZA 3WYAA 3CR8A 3UWKA 4EKDA 1E2QA 1LV7A 5DN6A 1G41A 1P9RA 2IS1A 4FI3C 1E0KA 2ZE8A 1RJ9B 5FOSA 1Y3AA 2C9OA 3QKSB 3R7WA 2CL7X 3NC1C 4HSEA 3B8HA 4LZZA 2IXEA 3GLFE 2B92A 3BGWA 4A0FA 3L0SA 5FBRB 1PUJA 3AGQA 1FTSA 2VBCA 3TBKA 2ZU6A 2UKDA 521PA 3AKEA 2VP0A 3ZH9B 4QHTA 1ZUNB 1ZU5A 4EJSC 1XPRA 3C14C 2PL3A 4RCYA 2OBNA 4PPFA 1E69A 1G8GA 1RFLA 2GCOA 3KB1A 5DIFA 2AFHE 3BFXA 1T0HB 4HB2A 1CKEA 2N1BA 1TEVA 2Z5FA 1XEXA 3OIWA 1IHUA 1U0JA 4FMBB 2IYWA 1LB1B 3I8SA 4H1VA 3IQXA 4Q9KA 3UXMA 3OFNA 3B85A 1FUKA 2R62A 2XTNA 3EC2A 3GJ6A 4KV9A 3IKJA 3LFUA 3EPKA 2WJGA 1Z6AA 2FH5B 3G5UA 2X8AA 1GG2A 1XZQA 3VR5A 2C95A 4BUJA 5CIQA 2NO0A 2O5VA 1II9A 2CVHA 5AJVB 2OV2A 3QE0A 2YOGA 5CDFE 2XX3A 2DCUA 1G7RA 2XZOA 5F9FA 1SKYE 4X8LA 2Z83A 4KU4A 1E9BA 2CL6X 2GNOA 2EFGA 2ZUCA 3FMIA 1W2HA 5L3QB 3DOEA 3LXRA 3I3SR 1L7VC 1AZTA 3RRMA 1XEXB 1XJCA 3R20A 4I1UA 5J40A 1E1RA 1JQJC 4V0MA 3TNFA 4EQ6B 4TMZA 5HPYB 4O25A 2A30A 3FHCB 3A1TA 5IT5A 5AJWA 3GJ7A 4Z8XA 4TT3A 2CLDX 3LBHA 2ONJA 2OBMA 4NDZA 4TZ0A 4P4SA 5AUOB 3GLGE 3KJIA 4IOJA 2ZRLA 3FKSD 3QG1A 4KI0A 3KKQA 2DR3A 1VG1A 4RD2A 4ARZA 4B35A 4BLSA 3WNBA 2YV5A 3MD0A 1CJKC 1UFQA 4IVQA 3RAPR 2J7KA 2PEZA 3AVTA 1J8MF 4ARZB 2BBWA 1Q20A 3SJAA 3MAAC 4HB4A 5K8UA 1H65A 4Z1MA 2V6IA 1FNMA 5D3MB 2ZI6A 5F3WB 2B6HA 1E0SA 3KKMA 4YMUA 2GWHA 2G1KA 1YRAA 5JRZA 2X2EA 1N0WA 4LHYA 3VR3A 3ICEA 1YR8A 2OILA 2CL0X 4B34A 2QROA 1N6KA 3RS7A 4XOIA 3AF0A 1NSTA 3K1JA 1NF3A 4WAUA 2G6BA 2IA5A 2GEVA 1IXSB 3TRFA 2BM1A 3GLHB 3N2IA 4PR0A 2NO7A 1ZU4A 3K0CA 2GETA 4XSGA
chains in the Genus database with same CATH superfamily
1CQZA 3EZFA 1RAAA 2VKQA 3QNUA 1P7IA 4KODA 5GY7A 1OFUA 2RDPA 2GAOA 4FOOA 1NJ6A 1ZCFA 4PCUA 4EWLA 4Q4JB 2ZAOA 4KQIA 4E2XA 3KBOA 2A5WA 4FCVA 2AOWA 3NHSA 3JATB 5LUBA 5FDFA 3FIWA 1U0NA 2IP1A 2POQX 3GRPA 4N65A 4NQRA 4XIFA 1KE1A 4LWPA 2DT6A 5IMBA 2WABA 2QP3A 1D4AA 2CDRA 5F33A 4WBNF 2CJJA 4UTNA 2ZT8A 3GAMA 1R6UA 3HBNA 3KBBA 4RF5A 1T9GS 2ZBDA 4PZAA 5DV9A 1D9ZA 3B9BA 4GMHA 3UV3A 3GVXA 4CICA 2ACJA 2NO5A 3PQ7A 3QWBA 5ILOA 5HNFA 4B4UA 5HKBA 4G01B 3RCOA 4E5DA 4H1HA 3PSAA 5KTTA 3A28A 3E6AA 4X7PA 4TKUA 1VHTA 2WU8A 1C50A 4F60A 1GU0A 5IDQA 1W36D 3UKOA 3ZYZA 4ARUA 5AH0A 4CU5A 1P9NA 1YUBA 1Y8ZA 1GXSB 4KLNA 1T35A 4Y18A 1PZFA 1Z5PA 2ZXEA 3OWOA 4BAGA 5KJ6A 4YCDA 3FXRA 16PKA 2O1EA 3CG0A 1ONNA 4FSDA 5JD4A 4PRZA 5D2CA 1R9JA 4URUR 1GCAA 2YC4C 3TSYA 5KYWB 1K2WA 1YU9A 2AJBA 4V0KA 3T1VA 3C39A 5B7NA 2I5PO 5D6FA 4EB0A 3CDLA 2B8NA 4D3FA 1ZUNA 5IU6A 4BX0A 1A5JA 2JEOA 4PCQA 2MR5A 2YJGA 3JAMZ 4NZ9A 2C04A 2H31A 3HYIA 4ZQHA 3ZIUA 2C8KA 5DT9A 3P20A 3PXCX 5F76A 3PD7A 4QULA 2QE6A 2LKCA 3IMFA 3KZ1E 3KU4A 1QIKA 4L75A 1ZRNA 1QVVA 2QRKA 4E5KA 4MPRA 1N7IA 4PJ0C 4LY3A 5FL7A 3THYB 1EXWA 4ILKA 3SWWA 5CIYA 4P53A 3MWKA 3F3MA 2VI5A 5C3EJ 5FWAA 3ZGVA 1EH7A 2WINI 3AF4A 1SAUA 1B2RA 4OOIA 1FJ2A 4LBVA 2NVUB 1AHHA 1U2PA 4K6KA 1SRQA 1V4BA 4QBFA 3LT1A 3WK6A 2R8ZA 5EVJA 4D79A 4F4JA 1LQ1A 2WFAA 2JZOA 3CINA 4M7WA 1FBTA 4WX2B 3VH3A 2LUOA 4OHZA 4BKQA 4D3ZA 4M9QA 4M3NA 4PN7A 2XMSA 1IN5A 2M7AA 2Y9ZA 4JENA 1ZEJA 1GPMA 2W6NA 4XGIA 5TSDA 3I55I 1ESCA 5BW4A 5A1TA 2C6YA 4LMPA 5KYGA 1CVIA 3QBEA 3MOSA 1DUXC 3GD5A 2M4GA 5CNIA 2GDJA 3IEXA 2IUUA 3UK6A 4D98A 4D4GA 5M5YJ 2Q3BA 4ECEA 1KH3A 2AVDA 3TINA 4XBFA 3CLSC 4TROA 3RU9A 3DTKA 4OXKA 4RK6A 3PU6A 5SZKB 1E7QA 3ZH2A 1FPMA 3MGKA 4RVFA 4GKAA 1HE5A 2QAGA 1XDWA 1TUIA 3J7AO 1OI7A 4XDGA 3DM9B 1JHQA 2EJWA 2DMQA 2I9PA 2RAVA 3V7WA 5FAKA 5BPDA 5BVHA 4HNAA 1SCQA 4DJAA 3KEMA 1KGDA 4HAOA 2O8XA 2LV8A 5CW1A 4IHVA 4A0QA 3FYDA 1HNNA 1T2AA 5EXTA 2YQZA 3TIGA 3OYNA 4Q4CA 2PWBA 3AUAA 3C3DA 4HZUB 2H6BA 1XXHE 1Z0UA 2GCGA 2ZDHA 4HTFA 5EJEA 2H0AA 2DB3A 1A9TA 2JGKA 2YJZA 1XD2B 4ESHA 4I1RA 4B8WA 3DKPA 5JLJA 4H6PA 1RM4A 3ANNA 4I5IA 4LKRA 3G02A 3FPSA 2QVLA 3KUUA 2R66A 3N2EA 3OZRA 5UKDA 5JQGF 2YBEA 3QYFA 1R66A 3C1TA 2M4KA 4I4TA 2D7JA 5C3MA 2FOIA 4QELA 1ZSVA 3K2QA 4MKGA 3E8XA 5JZSA 1B72A 2WC2A 2ZYRA 4J9UE 3TEJA 5M5WJ 1B6RA 1E1NA 1N6NA 1LE8A 4XUGB 2VQLA 4FFPA 2M7BA 1JUMA 3K1NA 3WMFA 3WY9A 2ZBRA 3V1LA 1BKDR 1YW7A 1HQDA 4BFXA 5CR9A 3TLCA 5JSZA 4FILA 4LY6A 4JQFA 4E70A 4WLVA 4KPGA 3EIEA 4N4AA 1VKJA 1NSYA 1U7WA 4QYWA 5BT8A 2PUHA 3I2HA 3ZY4A 4DZPA 4R1TA 3VPSA 3GN1A 1XQ1A 2FU5C 1GZ4A 3SOZA 4QPZA 2R8OA 5ARCA 4MYHA 3W2HA 2AQHA 3PENA 3QMWA 4UNQA 4C7BA 4X1IA 3RT1A 5FTMA 3KVVA 1ESEA 3GCDA 4JBIA 4W99A 2XQJA 2O9JA 3AEKB 2QUBA 4WK0B 1N9ZA 1ZI8A 1RI3A 2OR3A 1EHIA 2R8PA 2Q1XA 3Q8WA 3PG5A 4ZT4A 1N1GA 5LIPA 1Q0QA 1L4FA 2WD9A 1QYXA 2XRNA 3L4KA 3KYDA 4JK1X 1FX0B 1N32B 1V1MA 3W2GA 4BTVA 5C80A 1ORIA 3Q9UA 3ZJ4A 2QX7A 4DM3A 1OXKB 1L5ZA 3KR0A 3OEEA 3JQ8A 2DYRH 3M34A 3K92A 5AVYA 5K5EA 5DTRA 3H8VA 3IQZA 4ZKDA 1G7CA 1QMPA 3TD2A 1T8UA 3Q8LA 1ZONA 2QJOA 3ZCPA 2XSJC 3NGXA 1G6Q1 1XD7A 1R88A 5EOVA 1CDOA 2WU1A 4Z9BA 4O2BF 1XVLA 2EZKA 4C7VA 4RORA 1W34A 2O8EB 1OXVA 4GU5A 1JW9B 3OEED 2GBIA 4FGUA 4QO7A 1EUZA 7YASA 1B6SA 1FFGA 5FUWA 5LMCA 3OZ7A 1KYWA 2OTCA 5T6MA 2FOWA 1T9AA 4QJ5A 2F00A 3W2WA 2ENUA 4O8CA 2OD9A 3HGQA 2HIMA 1WJ5A 2HVRA 4PYQA 2XBLA 1MJ5A 2VJQA 3C15C 4QGHA 3H8JA 1WLYA 3ESRA 4XVHA 4TTJA 3DWIA 4OIMA 2EL7A 5GMOA 3WMGA 3UJCA 3AEUA 4F6CA 3Q7TA 4IGAA 4C0QC 2DULA 4XQ9A 3UPDA 1JMVA 4D0NA 1W7PA 4BP3A 1SVLA 3F8WA 3I9JA 4YASA 3UWSA 1UJMA 1H2EA 3EUEA 4I3HA 4A6XA 5TRTA 3CUWA 4L16A 1M6WA 2ABWA 2W90A 4PY2A 1IHDA 3GTJJ 1QH1A 4UHEA 1RETA 3GEPA 3O4JA 3IDFA 4Z99A 4BXOB 3I45A 3OZEA 4OMZA 5T8KA 3UMCA 1BL0A 3VYRB 3G9XA 1HLDA 1N2ZA 1YKGA 1ZK0A 3A58B 3M0EA 4HZIA 3TZQA 2C0CA 1DO8A 3CPJB 2I3DA 3WKEA 1REQB 3N4MA 4LS3A 4GQAA 3IIJA 2WJPA 2BGRA 4J94A 1AN0A 4AZSA 2DQKA 5BXQC 3I4MJ 2QG6A 1AS0A 3PUJA 4Z4FA 2D1TA 2E1RA 2IAIA 4MUAA 5T8KC 3DZFA 2WJJA 2PJDA 3GRCA 4E94A 3Q0IA 4JUBA 2VKDA 3DEJA 5JLAA 4GX0A 4B9EA 2W48A 4F7DA 3OMWA 4Q9JA 2ZG6A 2Z1DA 2VWHA 1E1LA 4GC5A 1CVLA 2WMNB 2EVWX 3GDGA 3I9MA 3JRFA 4LOAA 3X2FA 2IOFA 4BO7A 2PGJA 2WJ4A 5DUKA 1AOYA 2IHJA 4OHOA 4ZYXA 4KVZA 2L19A 2EBIA 1SPBS 4OI2A 3DBOB 3DUFA 5JD6A 3HDVA 5JISA 4Y9UA 3H1GA 1Y6JA 1BWRA 4MCIA 4QFDA 3C5WP 2HWWA 1E6KA 3Q5DA 2HCFA 1SMKA 1W0TA 4TKMA 5LJIA 1SXPA 3K0AA 1SXJC 4JBAA 4MW1A 2YJ5A 3MGGA 3DE7X 1R5JA 3L1PA 1FFBA 4XGNA 4TGLA 1XKXA 4J1TA 1TVKB 2OJED 3PF8A 2VDUE 4WCDA 1QHGA 1KSFX 3MJHA 2E4XA 4D9EA 2BTOA 2DPYA 3WNDA 5K2OA 1IRGA 4U3JA 3LSGA 4ZDOA 4BVEA 1QIJA 3GUCA 1X19A 2ZRKA 4GP9A 5EYPB 3DOOA 2HJVA 5EJ8A 4IMRA 1FSHA 4JB0A 5LU9A 1DXYA 4JAVC 4HRIA 1UF9A 4LVCA 1B7GO 2C9CA 1V6CA 4IY1A 5DHSA 2V7FA 1GKKA 3INGA 5BWNA 4OQMA 3OLQA 2G9WA 1TQ8A 1UK6A 3IE1A 1UZAA 1ACIA 2JVJA 4NBWA 5FA5A 2IITA 3OM1A 5DYNA 3QIVA 2OBPA 3ZTTA 1C41A 1OLOA 2GH1A 2HRDA 2HY7A 4BEWA 1YFLA 3HM5A 2G7UA 2HTEA 3M4JA 3X1MA 1QIEA 1VMEA 2FZWA 5BSFA 3KQKA 1E8DA 4K9RA 4QXQA 4DG8A 3PNSA 3QVSA 3HU1A 1MGPA 1JG7A 3WA6A 4K9OA 4TYWA 2HWVA 2W6IA 4QDXA 3W8FA 4HF7A 4XGQA 3GLUA 2VI6A 1EMDA 2NTYC 1XPOA 2W6QA 1CFZA 4KYWA 2DP4E 2GXSA 2OSVA 1YQTA 3HDGA 4C4RA 4EUSA 1EH8A 1R5OA 4TMTA 1R8JA 3EZ9A 1VPEA 3CZ4A 3K8OE 4RSMA 1TAGA 3RF7A 3EFHA 1TWFJ 2COUA 2RKWA 4JSTA 1TP4A 2QRVA 3U0VA 1T33A 3IAS6 4IUBS 1FRVA 2E5FA 1RABA 5AVJA 3P9IA 3WL6A 2VDLB 3A3YA 4GW3A 1K83J 2LY9A 1MDMB 4TYNA 1ZRCA 3R6SA 4XWOA 1NULA 2P27A 4FGWA 5DNAA 2UZ3A 1UT8A 1XGMA 4JJ6A 1T8PA 1UMCA 2VPXA 3V8PA 4PGHA 2AXLA 2NO4A 2VH5R 3QWHA 4M89A 4AL4A 2JAXA 4WERA 2TCTA 1Z2CA 4FGSA 2NIPA 1P6UA 2ID7A 1E3HA 4MR9A 4YMTA 5J1RA 5BRNA 1LVAA 3DFGA 3KAPA 3PNKA 3IUOA 4DCJA 4UHCA 1IJWC 1WEKA 3QVKA 3CTMA 3MMSA 1PIWA 4KFSA 2R7WA 1MBKA 3ICCA 1EDOA 4FZ3A 2JN6A 3BL5A 3CX6A 1N4AA 1W9HA 3CA8A 4J29A 4C01A 3UB2A 5BN5A 2LNDA 1NXVA 1JIJA 5IVKA 2H1OA 1QRSA 2WSSD 4L07A 2EAUA 2HK6A 4F2DA 4PC1A 2O19A 4BFUA 2CG4A 1SC6A 3M8FA 5LGTA 4NDLA 1IULA 1OR8A 2NSDA 2Q50A 2W2VA 3JWHA 2FXVA 2OV1A 1QIGA 2JCYA 3PQJA 2G07A 2UV8A 2W00A 5KHOC 3EXIB 4OJKA 2HJSA 2QRLA 1SB8A 3OYDA 3VO1A 1XKLA 3WL7A 3SC6A 3WQRA 5GTIC 5KJCA 3G2OA 4UV8A 3PC2A 4GKJB 3OQBA 4LHSA 3GV0A 3BRCA 1SD1A 3DV9A 3NNSA 2X14A 4RD4A 4WY5A 5K3DA 5B3LA 4EX7A 2X4GA 1YI1A 2DBBA 4NCXA 3QW2A 1VSVA 3BREA 3HWX1 2IS4A 1VBNA 3QSGA 2PGDA 3D59A 2HXGA 3N87A 2DA3A 3ZU4A 1X7XB 1Y6GA 1OWMA 3P9ZA 1DO0A 1IU9A 1KZ7B 3CZMA 3I9FA 5KINB 1A76A 2VTBA 1V9LA 3SBXA 4XEHA 5GZ3A 4ZIRB 4WOKA 2ZQ5A 3D6MA 3LFTA 4KXNA 1EQUA 1G8FA 2Z99A 3BGIA 4R1PA 2OYCA 3SZ3A 3KOOA 1P5FA 1NBWB 3A11A 3SI7A 3ZX5A 2QUJA 3BTOA 2G8NA 1E0AA 1DIOB 4X54A 1XFAA 2IEIA 1SPXA 2Q3HA 3CU5A 4MK4A 1YJQA 1FTWA 3EEBA 3L07A 4O4IA 2PLFA 3VTAA 3U3MA 1NY6A 4DSTA 4V24A 3D2CA 3OIGA 4CTNA 2C3PA 6PAXA 2IYXA 2WF6A 2FP3A 3EDRA 3N53A 4X8MA 1U2QA 1SMYF 1ZELA 1NYRA 1QWSA 2EKPA 3LE8A 3TAHA 2BGIA 4NVRA 3TTUA 3KDPA 4A2UA 2JAWA 5FFNA 3UB4A 5CD1A 3KQUA 3MMYB 3Q3SA 1O7JA 1IAWA 2X9GA 4U87A 3CT6A 5IN5A 1XZFA 2GBGA 1LEHA 1O7FA 3GEHA 4LJZF 1YMQA 3EVTA 5G0UA 5CT5A 1Q17A 1PL8A 3ANLA 3D7NA 4QECA 4BTEA 4D5GA 1JVBA 2GAFA 3L8HA 1U78A 4G0QA 1N5JA 1QRAA 2ZWIA 3BGSA 3G5LA 3GDFA 3SKVA 2JWTA 2VHYA 1OZHA 4R1HA 1WS6A 3K4LA 1TCBA 2WD7B 3GFSA 2QS9A 2NZ2A 3NJ4A 2PCJA 4X1KB 3WRVA 5LVAA 4UBNA 5K45A 3FM9A 5I7HA 1Y8RA 4UXNA 3EC1A 4C4TA 4N9QA 3QYJA 3SPXA 3S8EA 5FBKA 3W6NA 2WYUA 3F22A 2VUSA 3DD1A 5KYUB 2IWHA 3UW3A 2BEWB 4GWGA 1RRKA 5T41A 5CXUA 5GJCA 3WBJA 2BHTA 4BFCA 5DMHA 2EZ9A 3RYCB 2WIJA 3M83A 3FPKA 4QTZA 3MJVA 5EXPA 1YA4A 2EP8A 2FBIA 1H3NA 3DNMA 3EE6A 5HE9A 4ZDWA 1UOPA 2WJHA 4Q9HA 3KJGA 5CG1A 3ZMZA 2A9QA 1ETHA 3QXCA 2E5LB 3DPIA 1N5RA 1ZQ9A 4PR3A 4DJDC 2DO7A 4WWHA 5EE5B 3OPYI 2AJDA 2JVIA 5JG7A 1V3FA 2QQAA 1ORTA 5E9QA 5IFKA 1ZAOA 1XVAA 4UDNA 4C0XA 4AF7A 5JJ5A 2RGBA 2LW7A 3INNA 4GYGA 2YKGA 1T4BA 3AZQA 1HSOA 2P4EA 1A6QA 1R3UA 2PSDA 1BDIA 4RETA 3ZQ4A 5T5QA 2YWEA 3TQOA 1OXXK 2V7XA 1E3QA 3PGA1 1D2NA 3ETHA 2HYIC 1UK9A 2J9RA 5ERGB 1R4MA 2AW3A 3AOEA 3QBDA 2K9MA 4RE5A 4F9FA 4Y15A 5KBYA 4W1SA 5E7IA 1PSZA 2OWEA 3KZIC 3OZSA 5FOXA 1DJOA 1RT9A 2PD3A 3MF4A 2EEPA 3K5IA 3AEZA 1ISSA 4B7XA 3ZZ0A 4IZHA 2WAMA 4QM6A 2QY6A 1M74A 2AMFA 1M8FA 2FOLA 3JAWA 4JT2A 5DVZA 3UB3A 4EHHA 2G82A 1O0CA 2FP4A 2B1JA 1E89A 1JEYA 2F64A 2H7CA 1FW6A 4F4IA 1Z83A 1J49A 2DGDA 1XZAA 2PYZA 4ZXFA 3F5SA 2NNYA 2A3SA 3I4PA 4U6QA 3ZHZA 4DWVA 1A5SB 5IH3A 2FWAA 1TZCA 2XUFA 1I3LA 1YX5A 1TWAJ 4TZKA 3SHWA 5EIWA 1TNTA 1CUZA 1WB6A 3G6EI 1Y7PA 3WXBA 5CA0B 3F90A 3KO8A 3U3KA 3RU7A 3KIOA 4QATA 1YQAA 3PYLA 3VDXA 5JY1A 2Z8YM 1HKTA 2PGIA 3FGPA 4KREA 1QHHB 4LVUA 4LXGA 1YL6A 2WJIA 3VNSA 5BYKA 4FISA 4HX5A 1ZREA 1Z4JA 5D8DA 4AG5A 1JV2B 2EW8A 4C4YA 3UIEA 4EOGA 1N3BA 1JR3E 4ND2A 3VRHA 4D6XA 5HGXA 3ZWWA 4DW8A 3L6DA 1I1HA 4GECA 2R1VB 5B7QA 4Y2HA 1V8PA 3BYZA 3ZXIA 4DPLA 3RC7A 4BZXA 4EB6B 1I5EA 5KTRA 4KN6A 4DN6A 1YZKA 2A68F 4CLXA 3UGJA 2WB4A 2Y66A 1UKBA 3Q7EA 3JARB 4P4GA 2I4TA 1K3TA 3OKAA 2ZQZA 3LNCA 1FFXB 3DCJA 3VPHA 5G53C 4ENTA 1MT3A 2LK2A 1QK3A 3TW7A 1ZINA 1R8XA 5E6RB 3TGLA 2DT7B 1BN7A 1SHZA 3E48A 4M38A 1C7IA 1E0DA 3AJ8A 1YBFA 2OENG 2ZSHA 3O5AA 1VKZA 2A1TR 4LWOA 3VXKA 3FTEA 3WLHA 1MSFC 1NUPA 2BV3A 3E5RA 3TKYA 2NOJB 2EGUA 3O94A 4WCVA 1H5NA 2WMOB 5FUVA 3FKSA 2W7TA 3H2BA 3LOPA 1EINA 3H2YA 3L0OA 3JVEA 5AHRA 1Y6FA 5C81A 3H5TA 3Q3JB 4FNMA 4Q00A 4LPKA 1Z2EA 2MINA 4A23A 4F1WA 7ADHA 1F12A 1MBZA 1XN4A 5HF5A 3V9AA 2CUNA 1Z0FA 4IHYA 2GN1A 1YE9A 1TAHA 2VJBA 1JUPA 3T1QA 1IUFA 1WHTB 1JU4A 2H0RA 4L85A 4UEKA 2JLCA 3HJEA 2JD2A 4RZ2A 2ZRMA 4XB1A 1IRIA 1IO2A 5G0VA 3DW1X 5KREA 3RRNA 2AN3A 3WL4A 2VODA 1G3WA 2AO9A 1Y4SA 2B1RA 4RC9A 1ODIA 3JS5A 4R84A 3WTYC 4WINA 5ALNA 5IKEA 1IWPB 1NOJA 3C6MA 3F72A 3PNBA 4NNJA 3IP5A 2MOKA 3TLBA 1PNOA 3B13B 3FUWA 1E79A 1PFYA 4Y2TA 4DMHA 4UMDA 2GZ2A 3DCNA 4UHHA 1YJNI 1RP7A 4A6DA 1XLTA 1U8RA 1YS1X 2ORIA 2ZBEA 4HQLA 4J16A 1OXTA 1JAZA 3MQFA 2AUMA 1UBEA 5EA2A 3LQFA 1J6UA 4F5YA 2EFJA 1C0WA 4C7OA 3LF2A 2I7TA 4OIRF 1CEEA 4B3SB 1CUVA 2MYSA 1KU0A 4Q7EA 3RKQA 1A0OA 4V38A 4K28A 2FLVA 1FX0A 3LHFA 3VDQA 4YECA 3SF8B 1OT3A 1XVUA 1M1NA 5MGBA 5A05A 3TSZA 2ZYDA 4OYRA 2AN9A 5B1IA 1T6BY 4MLOA 1GARA 3U7QB 3SIPA 4QPNA 5HM8A 1KOFA 2YXDA 3CUUA 5HFJA 4LQDA 1JGGA 2ID3A 1QCCA 5DRTA 3BIFA 2P9ZA 3BKXA 1WSBA 1QP0A 1HETA 2G0NA 4OSPA 3JSOA 4QLCU 3QBTA 4X0EA 5CCDA 1NRJB 1TRKA 4TWJA 2YU3A 1XVVA 3VFDA 3QHQA 2AZDA 3SE0A 3AETB 5AJXA 3MWJA 3DU6A 4E5NA 3CNNA 1ETVA 2P90A 1KP3A 2UYHA 1INLA 5JVDF 5DTIA 3GVAA 3DO6A 1QA6A 1YR2A 1HTBA 1XRJA 4U2KA 4PHHA 2UYGA 5H7XA 3F5QA 5LOVB 1NK3P 3OWTA 3U4MA 1Q0PA 5JXGA 2ETVA 3W6ZA 1O95D 1P0FA 2WADA 2RHOA 4HV6A 1M54A 4N7BA 2CHGA 4ALMA 4BQQA 1DKOA 1ZMOA 1V3UA 2RK4A 2I1QA 3V1NA 1U7DA 1OA0A 4LZJA 2HTJA 1W4RA 4HJXA 1V2HE 5EPUA 3R74A 1NQWA 1NXXA 2ZDQA 3FHLA 1IN7A 3MHPA 2EC5A 4JX6A 2OZVA 5HP4A 3WBBA 5HJ5A 1K9SA 2MGQA 5EIXA 1AQIA 1DX4A 4JROA 4D25A 4HAWA 1KIMA 2C2WA 2OAGA 3ZD9A 1THZA 1OR7A 3TEDA 1PNTA 2G1AA 2XY4A 3R6TA 4HN9A 4RV5A 5DNEA 5FJJA 4EHNA 2X5OA 1TJ3A 1DJPA 4DBLC 3JQFA 4Y13A 1QIFA 1M1YB 1NJGA 1S7EA 3K0BA 3EDYA 3LBAA 1WXQA 3FKQA 3LDUA 4HTAA 3GQBA 1MBFA 1O5OA 4LQCA 2QN1A 5DJ5A 3WE3A 2K7FA 1GZSA 1CDDA 3QY0A 4U5XA 1MZBA 4TXHA 4HNTA 1RAGA 1XC7A 8AT1A 4Q4DA 4F3RA 1YOVB 4H18A 3RBXA 1FBNA 2OCPA 4GXTA 5A2GA 3CT4A 2RKBA 2WU3A 5JCOC 1G8YA 2BGJA 1UMBB 2IE8A 5ALJA 1QRRA 2ZMEC 1BA3A 2QI9F 2PGXA 3UPUA 5CEFA 4F2GA 2OM6A 2HLDA 5B30A 5K7HA 3HH8A 1H0SA 1CY4A 4CMGA 1H6AA 1XZPA 1NH3A 4EG3A 4MW4A 2JC3A 4YV0A 2O61A 4YAIA 3M3PA 2H5LA 2FEOA 1J2XA 3B1FA 3QVUA 1X94A 3LSRA 2B78A 4N5LA 3TZEA 3UMFA 2P11A 3FRHA 621PA 3ZOZA 2V9ZA 3OE5A 4TUYB 3W6KB 1G6KA 4R69A 1E5TA 4GZMA 2P3SA 2D59A 3ZPLA 2B4QA 1V4NA 5D7NA 1BQEA 4IFBA 4H7DA 4NYMR 2OHHA 4DANA 2OB1A 1DAPA 3IERA 2X1MA 3QENA 3RE1A 5BMVF 2YMLA 3QF4A 1Y6RA 1NLFA 1C30B 5HJEA 3L8YA 4KYIB 5JOQA 4B09A 5IP7J 2PQ0A 3JRNA 4B6EA 3AF6A 3T4EA 2EG5A 1ZS9A 1VJGA 3I2IA 4FQGA 5LLTA 2O6LA 1V47A 2A61A 3WHLA 4D41A 1VECA 1YBHA 1T2UA 1CEYA 2IYUA 4XA8A 3N2GA 3A2KA 4GI3A 5LDDC 3RW9A 2A5DA 4MVJD 3WYBA 3GCMA 1DJLA 2CDAA 1E63A 3G2QA 4GI7A 3T5MA 2EJVA 1EKXA 3ESCA 4FX2A 4M22A 1R0SA 3U61B 2RNGA 4D3XA 1XTRA 4ZDJA 4ZYVA 1MPXA 2RGAA 2Q2EB 1H2ZA 3ZDZB 5JYCA 4L0YB 3G1LA 2OCGA 4BGEA 4FQ8A 2IYQA 5DASA 3T4PA 5LZ8A 3N8DA 4L0QA 3BROA 2WWYA 1RKBA 3WLIA 4L78A 1YTYA 4E4YA 1CYDA 1PV2A 1Y4AE 3U7GA 4CQNA 3QK7A 3U48A 1NW8A 4EUKA 2GM4A 5LRRA 1E17A 1BG6A 2ZBUA 4QFMA 4YC7A 2IYVA 2FG6C 5SY9A 2ME0A 2RHHA 2NZYA 1MJGA 3P5BA 2M0MA 1BH6A 2HOQA 3STTA 4BB0A 5K8CA 5EJ7A 4I09A 1QJCA 3PSIA 1LBHA 1NPYA 1YVRA 4IX9A 4YCAA 4IBOA 1UFRA 4W82A 3AEYA 3M2PA 1G64A 1N5DA 1WZNA 2PX9A 2QN9A 4YWJA 3RROA 3WYFA 1MDMA 2O8CA 1APBA 2B4TO 1DKPA 1I7PA 1NYLA 2IQIA 4KQWA 4WXEA 5HDQA 1P2DA 1YHQI 3OEHD 4MYRA 1M0SA 4ZC8A 1D5WA 1DWUA 4FFBA 3ZIAA 1R4AA 2RI6A 1DAMA 3O26A 3QEJA 3TCKA 1SKMA 4ON9A 1I36A 3LQYA 3DLLF 2ECFA 2I7DA 4N1AA 1N8KA 2OQ2A 2I2WA 4OXXA 3CF4G 4H7JA 2FSVA 4RHTA 5AVOA 2IBTA 1TLFA 2RB4A 2VAPA 1PP8F 1XN1A 2LPMA 4FBLA 5HUHA 3AQ4A 4I2NA 4Z7JA 2PQ8A 1IIBA 1SKBA 4C04A 5DHQA 3H6HA 3WJAA 1IUYA 1GNSA 4IQ4A 2OCXA 1WHUA 3BJMA 4Z9YA 4CKCA 1LPAB 5CB0A 5CB4F 2VYND 4TUYA 4D0GA 2O0JA 3I5MA 4FE4A 3BTCA 3H2JA 4D80A 4JC0A 3GRRA 4MR8A 5DYIA 1JTXA 4ZZ1A 4EHIA 3KB6A 5KIAA 1H1DA 3NPAA 4X91A 1CRWG 2BHYA 2MHCA 2FEXA 4UBLA 1HURA 4OY3A 2COKA 5LD2C 1ZYUA 1OPCA 1E20A 5AQEA 2P0YA 2JCSA 1Q19A 1UDBA 3HY3A 4UVGA 4AB1A 1S2NA 4OBEA 4LDQA 3GLXA 4RESA 4Y6QA 5K6AC 1LFUP 4AYTA 1W19A 1Q74A 1FIPA 4JH0A 4MMYB 1FMCA 4PHTA 4BNMA 3ZQLA 1ELOA 2DUWA 2IVFA 1CD5A 2VBYA 1JNXX 1TA9A 3L4BC 4S2UA 5FRDA 5SYNA 4AMVA 3T34A 3EUHC 4BVLA 2ELKA 4AMGA 2DA7A 1KZ4A 1UPUA 1A6IA 1HQCA 1EEXB 5KJFA 5IT9Z 2OCKA 2VBFA 3EG5A 4I4LA 3WWYA 4OFXA 1U6GA 2ZUDA 1NG1A 3F8FA 3OOSA 4P58A 5A3VA 3AJRA 4WE3A 5CCBA 1QTQA 1ZD9A 4K9QA 4WV3A 2K4JA 4ZVQA 3OQHA 3B1WA 3WKAA 3IEMA 3MKZA 1BW9B 2W2LD 2XKAA 4YI5A 2VDNB 1CQIB 5ICSA 1FZPB 2VQ6A 5LC1A 3S5JA 1BX0A 2HZBA 1Z3YA 3AIIA 2JFBA 5K4GA 1BEZA 4WZBA 3FK7A 1BE8A 3O8QA 2Y0DA 3W2FA 1RQLA 2P9EA 1P0IA 1U8BA 1Y1QA 3EQ6A 4FX5A 4JL8A 2OSBA 3GP5A 3KZNA 4R0VA 5DHFA 1U90A 2I7VA 3O2QB 3UA4A 4AK9A 5BMOA 1VYVA 3VISA 2B94A 2O2EA 4YAOA 5CT9A 3T1NA 2XNKA 5C2JB 1AMUA 2BI7A 1Y3IA 1AHNA 2ZYTX 1MW9X 1UK7A 1W29A 1JP7A 3PNLA 3WMRA 2D13A 4D97A 4ZJZA 3GFIA 2X40A 4YGXB 2XGGA 1QGYA 3RYPA 2QG9A 3HUGB 2JFYA 3DFMA 4PLHA 4HMOA 5B6IA 2E1NA 1ODKA 3CN9A 3C70A 4X97A 3FHJA 4ABYA 4BHCA 4I99C 1CNFA 2Z2IA 2UUOA 4RV9A 2JI9A 4ND6A 3DOCA 2H2DA 2AA3A 4KVGA 3RC1A 1RRCA 2I1VB 1MQAA 2QLFA 5F5LA 2C99A 3V7FA 1EDEA 4BJ6A 3EZYA 4S3MA 2OOSA 1SOVA 1OFVA 3TBIA 3MMZA 1G3SA 5D84A 4CCYA 3ZDBA 1YB7A 3C1OA 4KN9S 1E9VA 5KU7A 1V3VA 3HCRA 4BNVA 1I7SB 2Q7DA 3AVVA 3E9DA 2PL1A 2IX9A 3I9V2 4LE2A 5F6FA 3ZCXA 1OCEA 1CW2B 3CDIA 1T10A 3KD3A 5H8WA 1U80A 2ZUWA 2F9FA 3EULA 2GZWA 2BEJA 3OECA 3PA6A 4OMUA 4UHDA 2TSYB 3OL3A 1T3GA 3F8BA 1IAVA 1ZA2A 2FN9A 2YHAA 2HLHA 4RQUA 3HCWA 4UCQA 2I71A 2REQB 2DFDA 3DPTA 2E2JJ 3GTOJ 2Y6VA 1NVWQ 2PMUA 2L2QA 1QPZA 3O74A 2QTAA 3PI7A 1QX3A 4TQGA 4H6WA 1PUFB 1QVTA 5T6BA 2E89A 5BSTA 3A3NA 4QBTA 5I7VA 1U6JA 2B8TA 5F5XA 1PZHA 2Q9AA 5IARA 3K6RA 4B3HA 1NW3A 3B9QA 1QPGA 3SIRA 1UC4B 4WZAA 4TWRA 3CSUA 3IPAA 2Q8PA 2PMWB 3B6KA 1L4LA 2EFWA 4NBTA 1MMSA 1FZQA 5KOYA 4PF1A 1BCSB 1OQAA 3OHMA 3PQDA 4AKGA 2CXRA 3PKIA 4G2NA 1G1AA 5P8WA 4LIPD 1WOMA 5H68A 4N03A 2IDJA 5CEEA 4WL0A 2DYSH 2BOVA 2PYDA 4IGKA 1M1EB 3U4GA 4BV9A 3H5LA 1IM2A 2IZ7A 2GEBA 1CB0A 1MOSA 4NHJA 1HDPA 3VSKA 1DFIA 2NPIA 3BXXA 3OPNA 2EWVA 3K10A 4B4OA 4DIKA 1UDRA 1KO7A 1JXOA 1K7CA 4NCHA 1U9IC 3IJRA 1FB5A 5EE9A 2H94A 1I4OA 3VPAA 4YUXA 5BW5A 3VSCA 2NVYJ 2GAAA 3RRJA 2EBFX 1R6VA 3NDIA 4DR2B 3CZRA 2YMMA 2BY4A 2OFFA 1E98A 4ENJA 1DCKA 1WDKA 2E6UX 3CO0S 5K8TA 2L3DA 4A0RA 3C97A 5IAAA 3TRJA 1OH8A 3KVOA 4OSOA 4QYIA 4F0JA 1KEVA 1U8FO 2Y75A 3OY7A 3SDSA 4L9TA 3H2GA 1JBQA 1IJEA 2JD1A 2YYYA 3AHGA 3GJXC 3WMXA 3ND6A 1FTZA 1NE2A 1RRJA 2PLAA 3X2SA 1H9CA 3BSFA 4F5ZA 1WZIA 1LNQA 2ZITA 2YPRA 3KLPX 4Y98A 1JBEA 1LS1A 1XHFA 3GUUA 2YVAA 4KSBA 3RV4A 1TT5B 3OU2A 4CQJA 4HV4A 1COWD 5KYVA 3V55A 5MFZA 1LBEA 3F9IA 2FAXA 2JCGA 2LXNA 3ETGA 2ZMEB 4KUHA 4V0ME 4YV7A 3WHCA 1JA9A 4PV7A 3SM3A 1T1GA 4IS3A 5FI3A 3CJTB 2KFDA 2LVSA 3FZYA 3GFQA 4JIMA 1QRTA 2Y31A 2YXLA 1W9MA 4U02A 2EFQA 4IDPA 4QHYA 5C53B 2E60A 2YZ2A 4GL4A 2P75A 2JLXA 3GEZA 4EUFA 4OEHA 4FU0A 5JQGB 2XXAB 2C0QA 2PUAA 2YIJA 4G37A 2YUIA 3H84A 1SWVA 2FA5A 1J2TA 1I30A 1CJVC 1XD2A 1D2AA 2GZDA 1XIVA 1QQ7A 2ZROA 2D6FA 3I54A 1PR6A 2B1QA 4HTFB 4DA0A 2FPWA 1DBPA 4PIVA 3IC7A 2IYLD 4UUBA 1J0RA 1JWAB 3GPCA 4QNNA 3TTWA 4ALIA 3ZHVA 3J81Z 4L0DA 1EHYA 1SOAA 1ULBA 2FJUA 3C24A 3D3WA 4OHXA 4Q5IA 3R7SA 3DHEA 1UKCA 3I1FA 3AC0A 4BFTA 3OX3A 1ETYA 1KYQA 1X7WB 4JU9A 4X1OA 4OIPF 4OSEA 3AB8A 4OMCA 1D09A 1FDIA 2ILTA 1XDBA 4J7AA 5JAPA 4US1R 3B1JA 4OK6A 4RDHA 3BCBA 2AXNA 2EARA 4DYQA 5BOXA 1Z0JA 1WAMA 3ITKA 4V1CA 4UM7A 5BWOA 4RF2A 5DNUA 2IX3A 1ADFA 4EO7A 4I4IA 4EZEA 1TO6A 1KAMA 3LDAA 1HSJA 4C87A 4C3HJ 1XPUA 5TJHA 2K40A 3TL3A 3PA8A 3MN1A 1L7PA 2R7KA 2P9TA 3IA2A 4L57A 4AUMA 1PJRA 4KFTA 1PT6A 2ORYA 2Q5LA 4N18A 3VHXB 1Z9CA 3OG9A 3I30X 4ABTA 5TQ2A 2HKIA 3PYXA 2IHTA 2JFXA 3DJYA 3FG9A 1GZDA 2ZJ2A 2DPXA 3OD1A 4WUVA 5IVPA 2O2JA 4I9FA 2IEYA 2XB8A 1JKRC 1DHRA 2PAAA 3G2PA 4U8GA 2Z9DA 4AZ0B 4HW0A 2VBGA 4ZCMA 2P7HA 2Z04A 3N74A 2DFFA 1J06A 2L7MP 4HX4A 1DTWB 1R0ZA 1ZD4A 2GARA 1UZNA 2X6TA 2X5NA 3DE3X 3JZFA 3MT7A 1M2GA 2FMUA 3OETA 2PMEA 1P5RA 3FHNA 2IT0A 5IJWA 4ZMBA 3KQLA 3F6SA 2PZKA 5IK2D 1SVMA 4QDTA 3CLQA 4QXRA 3T5DA 4CR8A 3I4FA 1G4AE 4LK2A 2A5GA 4UARA 3K9FC 1Z74A 4CCOA 3GMTA 1D0IA 1QPBA 3U2RA 1FVXA 1Q0UA 5CDFA 3MBIA 2ZUUA 1X9IA 3R3UA 3IMCA 2ZW9A 3EVDA 4HH4A 3DE1X 4W7IA 2FA9A 2DQYA 3FOWA 3IPYA 4IHWA 1KMCA 2OO7A 3DG9A 4G4IA 4OP1A 3RVBA 3SC2B 2X0NA 3KZKA 5FD8A 2A88A 2YYSA 4NJEB 4ZVPA 2WA0A 3EGWA 2FNAA 4HDSA 1EK1A 4JMPA 3BIJA 4KUEA 4WXMA 4XLLA 2XCQA 3NV7A 1ZGJA 1JA1A 3O1IC 6ADHA 3EN0A 5ALHA 4KAJA 5KYNA 3AXTA 4K9KA 1AGXA 4TLBA 1GEGA 1ZI6A 4OBBA 4LECA 5DNCA 5E20A 1L5OA 1PD1A 1XTVA 1FC3A 1IJBA 2OZ6A 3AHJA