1U0JA

Crystal structure of aav2 rep40-adp complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
267
structure length
261
Chain Sequence
GMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of adeno-associated virus type 2 Rep40-ADP complex: Insight into nucleotide recognition and catalysis by superfamily 3 helicases
pubmed doi rcsb
source organism Adeno-associated virus - 2
molecule tags Replication
molecule keywords DNA replication protein
total genus 83
structure length 261
sequence length 267
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.950 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1u0jA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0jA02
2QP9X 4P4SB 2G0NA 2QL6A 3QF4A 5L3SB 3AVYA 2JAQA 1PLLA 4BUJA 1S3GA 5H70A 3VMFA 3FYHA 4WXRA 1N2CE 1EXMA 3ICEA 3PUYA 1GZSA 3HR8A 1OV4A 4D0LB 2QPTA 2P2LA 4R98A 2A3RA 1VYUA 4TMXA 5KNDA 1OH8A 1T8TA 2D74A 5CITA 4BWYA 3MMPA 2Q9BA 3RRMA 3VKWA 1N6LA 5ANRB 3QKRA 2ZJOA 3V00A 2G0TA 4NZYA 2DYKA 4M1YA 3ASYA 3SU8A 2V55B 2V6JA 3BE4A 4BLPA 2RGAA 1F3OA 2GZHA 4UKDA 1ANKA 1UDXA 4B3BA 3I3SR 5AUQA 5J4HA 3MJRA 3AVXA 2JJ8A 2JLWA 3A37A 4QL3A 1VHTA 4HEJA 1KNXA 3FDIA 1R0YA 1JR3E 3L82B 3QXSA 4AG5A 3ZD6A 3A8TA 3IBGA 4A6XA 4IKEA 2H1LA 1NSFA 5C46F 1NN1A 4U00A 5JECA 5J4KA 4KBFA 5GJWC 1KY2A 3C4JA 3DHWC 3O8BA 1HQCA 2A9KA 4M22A 3R9IA 4D0NA 2HCBA 2VF7A 3LX8A 4P3YA 4URWR 3THOA 3UKDA 4B71A 2YC2C 3CH4B 1WBDA 1IHUA 3B1YA 4IEIA 4CF7A 4GL2A 4EDHA 3IGFA 4HUQB 4B35A 1X8JA 2YWFA 4KAXA 4BZQA 3D7MA 3Q9LA 4HLUA 2ZS7A 3TQFA 1KI8A 5L3QB 2QQ0A 4JIMA 2HXYA 2CHQA 2QPOA 3I61A 4KSBA 3B7GA 4JJKA 5CLQA 3Q5DA 1W0KA 3Q8XB 1ZCAA 1SVIA 2CCGA 1OYYA 3MD0A 4OHXA 1DAEA 4M9XA 2A5YB 1UM8A 2XITA 3CONA 2OE2A 4OHVA 3LA6A 4AK9A 1D2NA 4FIDA 1G7CA 5LDDC 4PANA 1QDEA 4KYIB 1XJCA 1G3MA 2F43B 3S1AA 1QVAA 4HB2A 3WP0A 1ZM3A 3RDPA 3EASA 4LBZA 4A4DA 3GJXC 3RS0A 1DBSA 1K8RA 1DVRA 2VSFA 4PC1A 2REXB 4Q9KA 1ZM9A 1W1WA 3T1OA 5AUOB 1J8MF 3ZLJA 2PZFA 2EWVA 4Z1MA 4AKIA 4M2LA 2OO7A 1UKVY 2ZE7A 1CEEA 4JLBA 3IHWA 4FMDB 1UF9A 1YR6A 5AUPB 3DOEA 1E2NA 3HDTA 4OHWA 1DTSA 2HF8A 1NLZA 1MV5A 2O8FB 3EW9A 4TMZA 4HI0E 3ZIAD 4LHYA 2ZE8A 3G82C 4ITRC 4V0NA 3J81k 1KKMA 3A4LA 1TL7C 3GLHA 2VRWA 2ZS9A 4XVRA 4BFZA 2WBLC 1GNQA 4LBWA 3QG5A 3C15C 1XCMA 5AUNB 3FTQA 3KQLA 2D7CA 3DKPA 1RYFA 2QTHA 4NP6A 2PJZA 3K09A 3JVUA 1N0UA 2RKOA 1J90A 1MH1A 4V02A 4TL8A 2ZQ5A 1DG3A 1GG2A 1J70A 3VU9B 3A1SA 1TUIA 1HE1C 2FZLA 2GXSA 2VHUA 3CM0A 5EXPA 3QVUA 4AKEA 4BRUA 1PV4A 1SKYB 2VEDA 5LBIA 3I62A 2GEVA 2DWQA 3SR0A 3P27A 1CRPA 2WWFA 2D62A 5K8UA 5LB2A 4RD1A 4P4SA 1FP6A 3SS8A 1VKJA 5GJBA 2RGNC 1E3MA 4KXFB 4TTQA 4WA7A 1WMSA 3GLIE 2GBLA 1KGDA 2GVZC 2ZJ2A 1F60A 3QEOA 3AP2A 5IT5A 2BEKA 2EFEB 2PCLA 2YWGA 4D2IA 3A1UA 4R7ZA 5EE1A 1NMYA 3NTUA 1T91A 4PPGA 2J5XA 4B43A 3DKVA 1YRBA 3CWQA 1NJFA 1P9WA 2P65A 3BFKA 3D6TB 4HAVA 4MRNA 4W9MC 1EG7A 1S9DA 2J59A 5CYOA 3K70C 2AXPA 2XSZD 2GETA 4LV8B 2PZEA 3TQCA 1YHNA 3QBVA 4BQSA 3ADKA 2R8RA 3QBTA 2C96A 5DISB 2CHVA 3TIFA 1W7AA 5HE8A 3SQXA 1S1CA 1FMLA 1P2TA 1L7VC 1YZTA 2IEZA 3LH5A 2RGCA 1H8ED 1WF3A 1AM4D 2VIIA 5HR5A 1RKBA 2PCJA 3AP3A 2FGKA 3CNLA 5FPTA 5JS7A 2JJ2A 1Z0FA 2ZJ5A 4DT1B 3HR7A 1P75A 4Q00A 1RRPA 4DDVA 1S3SA 2MSEB 1KI2A 2W0SA 3EA5A 3N70A 2ZJYA 1Q44A 3FVQA 2R9VA 4TSFA 2QU8A 1GWNA 1HT2E 1NY5A 2X19A 2YVUA 3CX7A 3TR0A 3UIEA 1W36B 1G8YA 4B34A 4F91B 4NMMA 1XFAA 3OESA 1G9XA 4Y0VA 5JBQA 3R8FA 5FOVA 1ZW6A 4L9WA 2B92A 3ZDQA 4AKGA 1FMJA 2WMOB 3A36A 3CX6A 5L3QA 4Z54A 3JVVA 3IQWA 2JA1A 3RLFA 5EE5B 4G5GA 3PEUA 1E79A 4MUBA 1ZC3A 2QM8A 4B2IA 5DI3B 3GQBA 2ZI9A 1P9RA 4NDZA 1XMSA 1QHGA 2QG6A 1V5WA 3NH6A 3TE6A 2WHXA 1VYVA 4IDNA 4IJMA 4IVRA 5EE9A 1GOTA 1XPOA 3AUXA 1E2PA 3B2EA 1E32A 2VP2A 5KSZA 2SHKA 3SFZA 1CKEA 1WQ1R 2QT0A 3M1IA 4XSHA 4D4KA 2WZQA 5D3QA 1XTSA 4XWAA 3IILA 4DBLC 1GKYA 2ZI5A 2AHOA 3KKNA 4AI6A 4A0FA 2ATVA 1VCOA 3ZVLA 4G5QA 3X1DA 1NG1A 3O8DA 5BN3A 3NEYA 1OFHA 3DOFA 5TDHA 3Q3JB 4ESHA 2AN9A 2Z4SA 2HV8A 4HZUB 4CT5A 4Q7KA 1ZAKA 2CCJA 2JLXA 4CDGA 4P4TA 4BLSA 4Q7MB 2XTNA 1SHZA 3H2YA 4DIDA 1OXVA 4BFXA 1ZNWA 2ZYWX 4I1UA 1H8HA 1Z6XA 4I1OA 3ZVRA 3TSWA 1KTVA 4JL5A 3NBFA 4EJSB 2VBCA 2R6DA 2QGZA 2EWWA 3KQKA 3DO6A 1KMHB 2KSQA 421PA 1OH7A 1FOEB 3U7EB 2ZEJA 2HJVA 4BZPA 1SXJD 4LHZA 4YMWA 1IY2A 4RD2A 2J0VA 2JEOA 2AK2A 3PXGA 1G3UA 4UXIA 1OKKA 4FINA 2IYZA 4CYMA 4YMUA 3IQXA 3RS5A 1YZUA 1CRQA 4MYTA 5FPSA 3T61A 5BQ5A 4D4JA 1N3BA 4G3XA 4PR0A 4OK6A 4A2PA 3VR6A 3LXRA 3TNFA 1N5IA 5EJEA 4LYJA 2FOLA 1D5CA 4JS0A 3Q7QA 3K0AA 1TTTA 5JMTA 3TKLA 3OIVA 2ZIAA 4MQBA 1CJKC 1OHHA 2NO7A 3QI2A 2FN4A 5FBWB 1G8FA 1E9DA 5KHOC 3KQUA 1P6XA 4HUTA 2EYQA 3QF4B 1Y63A 1E9EA 1LY1A 2ZRNA 4QXAA 5J5CA 721PA 1E0JA 2JLQA 5JRZA 4NYIQ 2OESA 1JBKA 5DHAA 5JI2E 3AF4A 3EARA 1MKYA 4M9ZA 1Q1QA 2WSSA 3VR2A 2IS2A 1QG4A 3L0PA 4Q03A 2V7QA 1GRNA 2IYWA 2A2ZA 3E2IA 3H1TA 1T0JB 3K9HA 3I8XA 1M7HA 4GT1A 2ZJAA 2XX3A 5JCZA 1MT0A 3UMSA 1D2EA 4GNKA 2CL7X 4MDFA 4BGDA 1NIJA 3M4YA 1IY1A 4LGMA 4C0AC 4D6PA 3T1TA 2QRZA 3KQHA 1NG9A 2J0SA 2ZRIA 2WPDA 2R6AA 5IF9A 4YMSA 4QG7A 1WBBA 1XRJA 3WBJA 3B1WA 3QVVA 3WMEA 3C8UA 4JT4A 1D6JA 1OH6A 3OEED 1XTJA 3C16C 3HPRA 4A92A 4ZCLA 4RFSA 1E4VA 5CJPA 1RRCA 1OXUA 4EKDA 1KKLA 1LV7A 2GXQA 2D06A 3KJGA 3QPUA 1E0KA 4NTZA 2OEPA 4I4LA 3GLHE 5DI3A 3VHLB 4NBSA 1YR7A 1XX6A 2RH5A 2OBMA 2EFCB 4QGFA 4TMVA 1S4QA 4AYWA 3PEYA 1W36D 4LJ9A 3UXMA 2JLVA 4B2PA 3IBYA 1IAQA 2N1BA 2C99A 4UJ5A 1IN8A 5TVKA 5EE0A 2CHGA 5FOTA 1QHXA 4TYNA 1PLJA 5HZHA 4OHYA 1E2HA 2EFGA 3HYRA 2B8TA 4C3ZA 3THYA 2H5EA 2NO6A 3FMIA 1W2HA 1E99A 2FGJA 4DRZA 2EYUA 2IHYA 1BMFD 3HU2A 3PV0A 3TAHA 4FXPA 3B78A 5DH9A 1A4RA 1G291 4G0NA 2GVDC 2WTUA 1PJRA 1SVKA 4ZKDA 2EFHB 3PEWA 5G53C 1FUUA 3GLGE 2QAJA 4GOXA 4B48A 4LUCA 3U3MA 5FBLB 1YR9A 4D81A 4Q9LA 4KO8A 4CEHB 4LX0A 3MRSA 4TTPA 2ODWA 4Q1AA 2JLUA 3B13B 2F6RA 1QHYA 4I1SA 4MUAA 1JNYA 1KSJA 5C4GB 3SOPA 5AJXA 2ORWA 1BS1A 2XJ4A 4EPXA 1XEWX 4FMBB 1C9KA 1ZD9A 4NYIR 2HCJB 1XXHB 4R2IA 3FHTA 2OG2A 5KNCA 2QBYB 1NMZA 1VYTA 4UXHA 2O8FA 3NHBA 4R9UC 3TBKA 4QRHA 1MABA 4M0LA 2DFTA 2QTFA 3MWKA 4N1AA 1F5NA 2ZRLA 2LCFA 3GJ7A 4URUR 4C0JA 3FMPB 4TYYA 4QBGB 4DLWA 2GJ8A 2GJ9A 3PJRA 3U7FB 2AD5A 4URVR 4B2LA 1RIFA 4GPTA 2ZPTX 1T3SA 3CNOA 3CPJB 3VAAA 3KB1A 3QG1A 1UEJA 2QENA 2ZU6A 4NCNA 4Q19A 3VR4A 3K0EA 5P21A 2NO1A 4W7SA 1DADA 4NE2A 2CLSA 1EX6A 5HE9A 2WJIA 4FI3C 3LBNA 3TH5A 3WP1B 3TRFA 2QBYA 4PAOA 2OBLA 4Q7LA 4XJXA 2GK7A 2ZSFA 5EQTA 2QMEA 3BS4A 4ASUA 5K8LA 1FFHA 2AX4A 4GOKA 4LYFA 2GILA 4CEJA 1W48A 4W5WA 2ZAOA 3U44B 4GMDA 1HV8A 4CZ2A 3C7KA 5CIQA 4EFLA 4AY2A 2C9CA 1W2GA 1XBTA 2WM9B 1E2LA 1KNQA 4XD7D 3SJZA 5C1BA 2FJUA 1I4DD 1DO0A 4M1SA 3GLIA 4L16A 1GP2A 5FL7A 2OILA 5EP3A 1KK1A 2PMDA 3HWSA 1DE0A 4KV9A 2GZDA 1JECA 1LS6A 3N2IA 2QI9C 1U2RA 4BFUA 5HPYB 1VHLA 2Z43A 3OF5A 2E9SA 2IL1A 1C1YA 2K5UA 1KK2A 2J41A 4Q18A 4WXPA 3P4YA 2Q3HA 4PX9A 3SE0A 2QEQA 1Z6GA 2FSIA 4WAUA 1Z6YA 1E1RA 2QN6A 2P6NA 3DDCA 4QBFA 4BPBA 1CXZA 3K09C 4B6EA 3GLIB 1LFDB 4NYMQ 1R2QA 1M2OB 3LX5A 4PPFA 5HZKA 1OFIA 4DT1A 1DARA 3PG5A 1RZ3A 4JSYA 2IYUA 3B6EA 2WIAA 4ESVA 4TLCA 2QROA 4GZLA 3O8CA 4RJLA 2CXXA 3REGA 2OCAA 3KXLA 2OAQ1 5G3YA 4PZLA 1COWA 1LB1B 1KO7A 2OZEA 4MYUA 3AGQA 1BYIA 5AJVB 3K70B 1VIYA 3TMKA 3I5XA 2RHDA 1QVRA 2RGNA 1TQ6A 1Q0UA 3AEZA 1GNRA 1CJTC 1OW3B 1TEXA 2W0MA 5C18A 3ZGXA 3QUSA 3W8NA 3I5YA 1E0AA 3B8HA 4MYCA 4TLBA 1H8HD 2IYTA 1Z0KA 1Z28A 4NCKA 1DELA 1XTIA 3OIYA 1Z0JA 4OQFA 5B57C 3CIOA 1N6KA 2FFBA 4TZ6A 4QHTA 1U98A 2IWHA 4OJKA 3VHXA 2PJRA 3THYB 2HLDD 3X1YA 1CS4C 1VG8A 2P6UA 3KDSE 3OAAD 1G5PA 4PHTA 1FL9A 4I1VA 1XD9A 1NVVR 1N5JA 1G3QA 1WCV1 2GKSA 3NC0C 5SZJA 2IC5A 4QOSA 3UG6A 3L2OB 1U0JA 3LD9A 1FTSA 4S2EA 2VP5A 1P73A 5DIFA 1YJ5A 4ZDIA 2GCNA 2FPLA 2QMHA 1D9XA 3I1FA 2OM2A 3B9PA 3AF2A 1WRBA 3BC1A 4HZIA 5IRCD 5LD2B 3FKSA 4G5RA 1ZD8A 3BIFA 3WYGA 5DE3A 5IK2D 2J3EA 4IFEA 4RD3A 3TW4A 821PA 4OKSA 2RB4A 2BJVA 3ASZA 3L0IB 2XZLA 2Z4RA 5E7MA 4M1OA 4LBVA 1NSTA 1G18A 1O3YA 1R8SA 2FFHA 4HZUA 2VL7A 3B85A 3E1SA 4US1R 5JCPA 2H57A 2ZJ8A 3GJ5A 4N0DA 4QJ3A 3RNLA 3K8YA 5JEDA 4V0ME 4GDFA 3NH9A 5JLJA 2FA9A 2FU5C 2UZIR 4PAQA 5FI0B 4DZZA 3WBKA 4G5SA 4IDPA 4HDCA 2QZ4A 4Q21A 4LZZA 1KDPA 3DMNA 1JXMA 4MKIA 2V4ZA 2JJ1D 1HE8B 4LJ6A 4US0R 2QAGC 1V43A 4DVGA 3CRQA 4XIGS 2CDNA 1FQKA 2D7DA 4X8OA 2R65A 4HUQA 2NMVA 1S96A 3A6PC 1DEKA 2ODEA 4XVQA 1NP6A 4TQUS 1Q22A 4NONA 4KJZA 1ZIOA 3LQQA 4URYR 5B58C 3TGPA 4OJQA 3OEHA 4TZ0A 4XSGA 1KI4A 3GLGA 2VSXA 1U90A 3IKJA 2GJAA 2BKUA 2Q9CA 3ETLA 5FR2A 1TUEA 1FNNA 4WIAA 4XVUA 4DB4A 5DLQC 4OI1A 1B23P 4DCVA 4ZKEA 5CDFE 1N5KA 3ICQB 1WXQA 2IYYA 2ONKA 3OIWA 5FUWA 3TUZC 3IIKA 4BASA 1R5NA 5SZHB 3WHKA 1CJVC 2WWWA 1SKYE 3U7HB 1G4AE 2HEIA 2PBRA 3K0AB 1HYQA 1QBKC 4L5BA 1E79D 3K9GA 2BDTA 1KZGB 3IIMA 3OZXA 4JLJA 4KCGA 1YRAA 2GNOA 1D2MA 4O3MA 4E5UA 1KMHA 4OI2A 1G41A 1EWQA 3QKSA 1NIPA 1VG9B 1CLUA 3CNNA 2AKAB 5CM9C 4QM6A 4JVSB 5EXSA 4IXMA 1G7SA 3BFVA 2ODNA 1E1QA 1LNZA 2XOKD 3CBQA 1U81A 4EPWA 3Q85A 2QAGB 1G7TA 2Y8EA 4JLDA 3WYFA 1KAGA 5EUMA 1CJUC 4JKYA 3GFTA 5G3ZA 1QF9A 3RRNA 3LVRE 4HLCA 1XTKA 3NEJA 3R8CA 1DOAA 5LD2C 3A4NA 1XPRA 1CBUA 2I1QA 1OF1A 3KFVA 4TMTA 4DLZA 1UBFA 1W0KD 1N5LA 1SXJB 1XF9A 4TT3A 1KJYA 2GK6A 4TYQA 3U3KA 1KJWA 3UWKA 2RGDA 2ECKA 1KJZA 3QOFA 2C78A 1Q12A 2Q3FA 4ERNA 3RYTC 2CL6X 2ZRCA 5HCNA 3EA0A 1KDTA 2A5FA 1A7JA 1EGAA 2EW1A 2IUSA 4HYYA 4AG6A 1D9ZA 4H1UA 2J7PD 2NOAA 1N25A 2IA5A 2IYXA 1OFUX 4P31A 1SXJA 5H68A 3QXJA 3CR7A 1P3JA 1ZMXA 4KU4A 1TX4B 3PR1A 5EZ5A 4TL6A 3AF1A 3BBPA 1RPZA 2C04A 1NLYA 2LKCA 1GILA 1W5TA 3GCGA 4E03A 2J0UB 3BOSA 2IYQA 2BIFA 4A0RA 4FN5A 2DFKB 1RRGA 2R6GA 5L3SA 3GEHA 1FTNA 2XZOA 4RZXA 3VKHA 2YWHA 1QHIA 2D2FA 1OB2A 2YC4C 4MH0R 4UQOA 1F48A 1X3SA 2ZSDA 3RHFA 4HATA 4ARZB 3ZVNA 2ZE5A 2D4HA 2IT1A 3PENA 5KU1A 4ZI3A 5CK4A 2GCOA 2W83A 4D0GA 2FEMA 4WZAE 3PUZA 2FPKA 4O2LA 4C4PA 3C41J 4P0TA 4NH0A 4RFVA 2ZE6A 1SXJC 4QGAA 2CCKA 3K9NA 2N42A 1E0SA 2W2TA 4GFDA 4F92B 2H16A 1FPMA 1HURA 4MGKR 2H17A 4KFSA 1XD2A 2ZSBA 4DLUA 5CK5A 1XTRA 3SQWA 4DLVA 2BMEA 4IEEA 3NG1A 2NZJA 4B76A 4BLQA 5JHHB 1E9FA 1WE2A 1AKYA 3X1ZA 4A1FA 1OYWA 4DCTA 1X8KA 2GESA 1KY3A 4PQFA 2XJ9A 1OXTA 4MRSA 1RW4A 1E2DA 1RFLA 2CL0X 2MSCB 1E9AA 1XJ0A 2RGXA 3MLEA 3Q7PA 4UNQA 4EIWA 1I4TD 1IM2A 4M4SA 2OAP1 3K0SA 2WJGA 3KKMA 3LW7A 3FFAA 4JLMA 3CUEF 4B3GA 2D3WA 4LOAA 2ZRMA 1P62B 4U5XA 4CW7A 3T15A 3AH8A 3SBEA 5CJ2A 4PQRA 4Q66C 5DO9A 4HB4A 1SXJE 2WIBA 1P60A 1ZNYA 2ZAMA 4C0SA 1TAGA 1U9IA 2IBMA 2VP6A 3WNBA 2DBYA 1JEEA 4II7A 4DEYA 1II0A 1QZXA 1D8TA 5F9HA 2FV8A 2ZS8A 1RC8A 2J0QA 4X8HA 1GL6A 1VECA 1KDRA 3NKVA 4LJ5A 2Z6VA 1E2KA 2GBLC 3CW2A 1AA9A 3LXXA 2F1JA 2GEDA 2I3BA 1G8PA 1XZPA 4MRRA 4QBHA 1IJEA 2V3CC 4DB2A 5CLLA 4UNPA 4CEIA 3EX7C 1E2EA 4B32A 1XP8A 3QY0A 2BMJA 1G17A 1GDDA 3NHAA 4JVLA 3NXSA 4NHOA 2BBTA 3KXIA 1KSGA 3CX8A 1YQTA 3T06B 4HLDA 1X1RA 1DAHA 3MWJA 2RMKA 2WWGA 3EWAA 3ADDA 1Q57A 4IDOA 3P20A 1F2UA 4CEIB 5FOSA 5DI9A 1AQYA 3SFVA 1OT3A 1YZLA 3ZQ6A 2DB3A 2BBWA 1UADA 2IHBA 5GJCA 1ZNXA 3QPVA 2JJ2D 1WDTA 5A4JA 2AWNA 2GA8A 3IUYA 1GFIA 2QE7D 1JXOA 2KJQA 1MR3F 4UXJA 3V4FA 3DMDA 1M34E 4WVFA 4Q1BA 5J40A 3ECCA 4DXAA 4X8LA 5EP1A 1R4AA 1HTWA 2GCPA 3GLFA 2P67A 1KSHA 4MYHA 5TB5A 3NBXX 2ZI6A 1TPZA 4ACAA 3LDAA 2G3YA 2UKDA 4MGYR 3SJCA 3KKOA 1ZM7A 3K9LA 4B74A 5FBRB 3IEUA 2OFXA 4PXAA 1G4UR 2BC9A 4RZUA 2ERYA 3LLUA 4JLAA 2AKYA 2F3TA 2DR3A 2XGJA 4JL8A 3BH7A 4Q5IA 1KAOA 5D3MA 4AIIA 3VR1A 3U6KA 1P5ZB 4MGIR 2XXAA 2WSSD 1RVDA 1XEXA 4LDJA 2WMNB 2GJSA 3KQNA 3U7GA 3GJ3A 3DZ8A 1ZU5A 2KI5A 2J7PA 4M1MA 3ZZTA 1XEFA 4GBMA 4K81B 4IDHA 4LJAA 1CULC 4IHQA 1KK3A 4UNRA 3QXXA 4E09A 4PHHA 3BXZA 2PMKA 1AN0A 2ZUDA 4G1UC 4US2R 1Q21A 1P4SA 2BHRA 3RANA 1NL3A 3HPQA 2G1JA 3B1XA 2ATXA 4A2WA 2QTVB 1A2KC 3GFPA 5BW8A 3I92A 4V0KA 3KUDA 2OXCA 2JJ1A 2A5JA 3TW8B 2FFAA 5FBVB 2V6IA 5JWHA 3VQTA 5L3RA 2H18A 3QSYA 4DLYA 3KZ1E 2IXEA 5JZVA 3Q72A 4YDSA 1G3IA 3C5HA 5HKKA 3E70C 3LLMA 3SZRA 2FEOA 3W90A 3DVLA 2GWHA 3AVVA 3QKTA 3A1VA 3F3YA 1LS1A 1NBME 1P2UA 1KK0A 2A7QA 4IDQA 3RS4A 3T5DA 4UNSA 4ARZA 2KBEA 3ADBA 4PZZA 1YZNA 2EQBA 1Q1EA 1II8B 2P5SA 4GZMA 3U5ZB 4TL7A 1EFHA 1MRNA 1Z0AA 2C77A 2ZU0C 4G5OA 3HJNA 2XEXA 2FFQA 1R0ZA 4GRAA 1IQPA 4RCYA 1R0XA 1IN6A 3NIBA 3O47A 2QRNA 3LNCA 1CP2A 5BYJA 2CE2X 1AS0A 3KX2A 2GZAA 1H65A 5BYKA 1M7GA 1XD2B 4A6PA 1CTQA 1E2JA 1G8GA 1W0JD 2GXUA 1TNDA 3L0OA 3CF6R 3QKUA 1SVSA 4MA4A 1G19A 2ZR7A 4BE7B 1M1YE 4LJ4A 1G21E 3P1JA 2W2XA 4ZPXA 4F7WA 2B21A 1CF4A 1Z5ZA 2LWIA 5HCIA 2O8CA 3MUFA 3BH0A 3UANA 4DKXA 4DSUA 3VX4A 3A4MA 2IS4A 1OSNA 2JATA 2JLZA 3RABA 1ZM4A 1Z8FA 4NKRA 4DLTA 1GL9B 1GITA 4IOMA 4OBEA 1BOFA 2JASA 3ZQJA 3KFXA 1OHHD 3RC3A 2VHJA 3OEEA 3CZPA 4GP6A 5FUVA 1RJ9A 5FPYA 2ZROA 2C9OA 5DHFA 4AWXA 5M04A 5DGXA 5FOUA 5ELXA 3G0HA 3S1AB 3ZH9B 4ZCIA 2ZJBA 4MKHA 2ZRAA 5CB8A 4AURA 2P0EA 1OIVA 3LBHA 2GAOA 1XPUA 2Q0HA 2BBSA 2VP0A 2W58A 4Q4JB 3FOZA 1UEIA 3WMFA 3R9XA 4K8OA 4C0LA 2WWYA 5AR1A 1Y3AA 2ORVA 4TMKA 4C9BA 5GJVC 1S0UA 4OQLA 3PIRA 2QSYA 1W0JA 1DPFA 1NF3A 1Z83A 1J8YF 2V7QD 1NVXQ 3UMFA 4BEBA 4DLRA 1N0WA 1AZTA 1NN0A 1RJ9B 3UWOA 4B33A 5EXTA 1KIMA 3ZS9A 2CNWA 2PX3A 2NQ2C 4EPVA 5KPJA 1DAKA 1CR2A 3A58B 5SZKB 2ASEA 2F9MA 4Y0AA 4YONB 1RRFA 2OUKA 3MJHA 4ON9A 2W00A 2UVQA 4JYBA 3TR5A 4A2QA 4D26A 1SQ5A 3KTAA 4LPSA 4QNRA 3VX3A 2XSZA 1JPNA 1QHNA 2FSHA 1Q3HA 1E4YA 3NVAA 2BJWA 4GMXA 3K0CC 3GLHB 4XTCS 3RS3A 3QKSB 3PCRB 4BRWA 4FWTA 2IS6A 1W4RA 1AK2A 1U0LA 2OCPA 2ZYUX 4XWOA 4JLVA 2VLIA 2Q6TA 3QEJA 4BECA 3F5FA 4FD2A 5KUTA 3W5JA 1FX0A 1JEDA 2ERXA 5GVRA 1DO2A 2B6HA 2REOA 1OFTA 3N5CA 1ODFA 3FGNA 1EFCA 1E9CA 3MSXA 2GHIA 4EPRA 3SYKA 5EZ6B 2PLFA 3BB4A 3CRMA 1M7BA 5LPNA 2BCJQ 1F6BA 1KI6B 2FZ4A 3W6OA 3EPJA 2F43A 4PTLA 4DEXA 4E22A 4QJ4A 1IN5A 2WOJA 1JQLB 2VYFA 3IO5A 3K1JA 1E6CA 1ZU4A 4KFRA 4WZ6A 4KVGA 5TMPA 5J4YA 1KO8A 1P72A 4HAUA 4F38A 3SYLA 4OK3A 2IEYA 2B8WA 4XOIA 2OHFA 2JLSA 4URZR 2H92A 3CRRA 3T1QA 3ND8A 3DM5A 4QC2A 1J7KA 2VTKA 2L0XA 5DN6A 1OLOA 1HUQA 5FH9A 4M1KA 4EUNA 1TADA 1GNPA 5EE3A 5KDDA 5TY0A 1G8HA 1NKTA 5K8IA 4C30A 3P26A 5G41A 3DM9B 1VIAA 2Q9AA 2YJTD 3DEFA 1Z07A 2YOHA 3MCAA 1P61B 3AKEA 4JYCA 4QGHA 3M0EA 4RFSB 2J0UA 2PZGA 5FOWA 3EZFA 1US8B 2FMXA 3DPUA 4JLKA 2YOGA 4M53A 3TUIC 4DDUA 1ZJ6A 2JGNA 3CWZA 3MFYA 5B64A 3SJBA 2CLDX 4D80A 3TLXA 1BO6A 4KBGA 1HH4A 4W5JA 3X1WA 1AGPA 1PUJA 2AXNA 3ONWA 4PC2A 2ZTSA 4I81A 3QE0A 3L8ZA 4NCIA 1QRAA 1ZBDA 4QM7A 3AQ4A 5F98A 2GCOB 2JDID 3TAUA 1US8A 4JT2A 5KOYA 1C4OA 5DN6D 3U60B 2ZI4A 2PH1A 2G77B 1ETUA 1CJMA 2YKGA 4PFSA 2VA8A 3DL0A 4JKIA 2W6JD 1T5LA 4IVPA 4TLAA 3H84A 5KDLA 4IFBA 4C0QC 4C0BA 2CBZA 1ZP6A 1NRJB 3TVDA 3THWB 3B9QA 4YXWD 5DSZA 4F4CA 2KWIA 1II8A 2LKDA 1AS3A 4DSNA 3VNUA 3BJIC 5JS8A 1JI0A 2GDJA 4J0QA 3W3ZB 3EG5A 4QKQA 3GD7A 2PLRA 2CLCX 2A78A 1TQDA 3ZYCA 5L3VA 3CH5A 1UKZA 3KB2A 3WRXC 4DCSA 4NYMR 3U3OA 2HUPA 2ZRHA 4R2HA 1TU4A 2UZ3A 3F0TA 1MO6A 1XU4A 1OXXK 4PQYA 221PA 1MO5A 1HEIA 2ZVPX 3FMFA 4NCJA 3W6PA 2WKRA 4K46A 3NC1C 3RAPR 3BK7A 4CGZA 4ZDJA 4TSFD 4H1VA 4M1WA 2D2EA 1IXSB 1QG2A 4RD4A 4RY2A 2XOKA 1T4GA 2IF2A 4BFYA 2FNAA 4ACBA 1U9IC 1VTKA 3E5HA 4B3FX 1NLFA 2AK3A 4JBXA 2GTPA 5G40A 1COWD 5HTKA 4PSKA 1JB1A 2H7VA 3KXKA 2CVHA 1HY3A 5EUQB 2IX3A 4PPQA 2GF9A 3LV8A 1TF7A 2QORA 3NWJA 3QNUA 3AP1A 4FCWA 2IW3A 1EX7A 1Z22A 1NY6A 2G1KA 3D8BA 1OB5A 5FOXA 1CR1A 3U3JA 1KMQA 4RVCA 4A15A 3K0FB 121PA 4A36A 4JBYA 2RHMA 4OYHA 4HDOB 4AD8A 3U44A 4TL9A 1DAMA 4IOKA 2JDIA 1NN3A 1CR0A 4RD6A 4RKFA 1NVWQ 5HKKD 1KOFA 5JSZB 5EXXA 2HLDA 2QMUA 3I73A 1ZD1A 2QSZA 2XTMA 5E4FA 4DIEA 4XTRA 1IJFA 4LPKA 1J2JA 2DCUA 1E2FA 2WAXA 3SHFA 2N46A 1G6OA 1T0HB 3LBIA 2YWEA 2ZRFA 1E1QD 3I4LA 3B1ZA 4MGZR 5JI3E 4KVAA 4DSOA 4U02A 1VG1A 1E2QA 2RGGA 3GLFE 4A82A 4CRWB 1L4YA 2O0KA 1GUAA 2HT6A 3D31A 1TMKA 2IYRA 2ZSEA 5FPHA 3W5IA 4C7OB 3TVTA 2DPXA 3QF7A 1N6HA 4XD7A 2XB4A 2WVJA 3GMTA 4KLZA 5GADl 4D25A 4PHGA 1EWRA 2O8DA 2KE5A 2ZETA 3LWNA 4O2RA 3B82A 4QHSA 2RAPA 1P2SA 4EPTA 4N3NA 3FKQA 4KFUA 1G5RA 4GOJA 4NPHA 3RSOA 2ZANA 4UJ3A 4FWIB 4C7OA 1TQ4A 3VKGA 2P5TB 5JHGB 2KB0A 3MGCA 4KODA 2O8DB 3QQ5A 1VCIA 1P2VA 3QPWA 4D4LA 2AR7A 2MMCA 2PT5A 2FH5B 5KSOA 4FMCB 3T5GA 2ZJZA 8OHMA 2CMKA 2IUUA 4M1TA 4B3CA 1SZPA 4TN1A 2YHSA 1FZQA 2MSDB 1UBGA 2ZREA 4MRPA 2W2VA 4OL0A 1JR3A 2G6BA 4LWZA 4QBIA 2O8BA 2EFDB 1GKUB 1OPXA 1UFQA 1XB2A 3EC2A 5FL7D 4IOLA 3GP8A 2GAAA 1A1VA 2WWIA 5FPKA 2NTYC 1XDBA 2ZR9A 3IO3A 4YXWA 3V9PA 2ONJA 3EAQA 1NNEA 1ZM2A 2AWOA 3THWA 4M9SA 4V0LA 5FTKA 2V54A 5H8WA 3JZAA 1WP9A 1IN7A 1E98A 1TU3A 1R8QA 4TTRA 4FCVA 3UMRA 3CKLA 1E2MA 4URXR 3L43A 5KDOA 1N6NA 1KI9A 1YE8A 2X77A 3R9WA 3SJAA 3WNDA 6Q21A 1RE0A 5JFGA 1EFUA 2VSOA 1UKYA 3AKYA 2ZR0A 3MG9A 2BMFA 4MKFA 3SNHA 3LFUA 3BB3A 4L15A 5A0FA 3SBDA 3AKCA 3FKSD 2FSGA 1ZINA 3WRYC 1KI3A 2EVWX 2Q3MA 1E94E 5EP2A 2X8AA 1F2TB 5AJWA 4FMDF 1AIPA 4TQ9A 1GSIA 1A5TA 2C9YA 1GTVA 4Q4JA 4V0OA 1W49A 3EWSA 3ND9A 2FX3A 4CEHA 4Q4HA 4TYWA 4F93B 4RKEA 4Q1FA 1BKDR 2ZSAA 3EZ9A 3VFDA 3A1TA 2I1VB 5UKDA 4PC3A 2ORIA 1SULA 4Q4AB 1E2IA 2J7KA 4BLRA 2JIZD 3BAFA 4JZKA 1M74A 2J87A 5GVSA 1X8LA 5FFMA 4B73A 1EESA 3O8RA 2QPAA 3IHLA 4JJZA 4XWKA 1ZNZA 2O8CB 1NI3A 1U99A 2WWHA 1E69A 3VR3A 3EZ6A 4FCTA 4WW0A 3VTKA 2O5VA 1G7RA 2ZRPA 1DS6A 3EIQA 3K0FA 2XTZA 4PAMA 5F2EA 4Q47A 4DSTA 5BXQC 2P6RA 5BWMA 1PVOA 2WSMA 2VH5R 1W47A 3KJHA 2IF0A 2DFNA 1XEWY 1NVVQ 3HP1A 3B5JA 1GM5A 1M8PA 1XMIA 2WWXA 2AD1A 3CF2A 4NCHA 2HF9A 3T12A 2REBA 3JZMA 3N2EA 5FTJA 2XB2A 2J1LA 5KNBA 1GL7A 1KO1A 1W4CA 1GRQA 1YKSA 2G88A 3AV0B 3BORA 1BYUA 2QGNA 4CEJB 1Z2CA 4Z8YA 3L0SA 3ZJYA 1DAFA 1LW7A 3AB3A 2ZRBA 2QA5A 3FMOB 3PEVA 5DYIA 621PA 1P9NA 3W34A 4PC7A 1KI6A 3SN6A 2BM0A 2J46A 1GAJA 3QXCA 1N6OA 1U0HC 2BOVA 1BMFA 2OXRA 4LV6A 1FNMA 2AFIE 4LJ7A 4V03A 2JCSA 2ZRDA 1L4UA 4LC1A 1AKEA 4Q1CA 4TWZA 2CVFA 1KZ7B 1TEVA 2EU8A 1ELOA 4JLPA 3RC8A 2ZXUA 3KTAB 2C5LA 2VHCA 5C4MA 3WXMA 4TLDA 2IK8A 3NDPA 3T1VA 3LRPA 5EP4A 3QENA 2AFHE 1K6MA 2BCGY 5E3HA 1W4BA 4MKGA 2CE7A 2J9RA 5JSZA 1QHHA 2A5DA 2VF8A 3BERA 4PO8A 1R7RA 2GRJA 4LBYA 2BM1A 1S8FA 1NN5A 3WY9A 1EFRA 4MITA 4RD0A 4B6FA 4ZV4A 1UAAA 1JPJA 4EJSA 1X86B 2HXSA 4AYTA 3UATA 5B30A 4GSYA 3LO5A 3HU1A 5JJLA 3QJYA 4Q7JB 2YNMA 1G16A 2NGRA 3MWLA 1TQ2A 2WKQA 2XNDA 5FUYA 1JAHA 2IUTA 2ZRKA 1JJ7A 2F3RA 1SKQA 3AVOA 4EPYA 1QHSA 4DLXA 1UKEA 3C5CA 2ZITA 1XJQA 1MOZA 2A30A 3KJEA 1AGRA 1R0WA 2O0HA 1GVNB 3BRWD 3QXHA 4A9AA 5DNYB 2RCNA 5D3MB 2F1HA 2XXAB 2F1IA 2G9NA 5J4LA 5TV2A 2HYDA 1Z47A 3EIHA 4LV5B 3C14C 2NO9A 4B47A 5AJYA 3R7WA 4QGGA 3OFND 1FUKA 1IXRC 4DDWA 3BGWA 4PPNA 4FW9A 4LJYA 521PA 2JLRA 3CRW1 4ZI2A 2PX0A 3EZ7A 2B7BA 5FR1A 1WA5A 3EIEA 4HAZA 4L9SA 1TF2A 3KKPA 1K5GA 1X1SA 1KO4A 1XCGB 2DWPA 2OSBA 2IS1A 1G64A 4DWJA 4D82A 3GJ0A 1R6BX 3EZ2A 3KL4A 3R7WB 1G5TA 1R5OA 1L2TA 3CPHA 3FHOA 5J47A 4DC9A 3RWOA 1T5IA 2BKEA 2JLYA 1O87A 2YYZA 3PUVA 1OH5A 2WPDD 4IVQA 3IDQA 4YMTA 3I32A 3DZDA 3BWDD 4ZCMA 4KI0A 5E7IA 1IONA 2VPPA 3IPXA 3REFA 1I2MA 4TYPA 1VG0B 1T9HA 3X2SA 1ZC4A 4FMCF 2FDCA 2BV3A 4LK2A 2WOOA 4S35A 3IEVA 5BN4A 1XWIA 3NBZC 1G3RA 4LJ8A 3OE7A 5JWOA 3NDBB 3M6AA 1ZRHA 2X1VA 4KSCA 1NBMD 4IRUB 5FUXA 3AUYA 3THXA 4JVNA 4MDEA 4WZBE 4B3DA 2VP9A 4JLNA 3KKQA 1N6RA 4EQ6B 2XNDD 3U4QA 2OCYC 4ZDWA 2A5GA 3MWYW 2IWRA 4B44A 4HB0A 5DYGA 3GPLA 4Q02A 1ZYUA 1AZSC 2C03A 2YOFA 4QHYA 1IY0A 5KSYA 1LF5A 1N6PA 2DHRA 4JMPA 3IIJA 4Q4LA 4UNNA 3U3RA 2NO0A 4Q4HB 1W5SA 1W44A 2PT7A 2QQEA 5K8TA 1DAGA 2R6CA 5FTNA 3VNVA 2GF0A 3AVQA 5E95A 3THXB 4PSVA 1SGWA 1R10A 5F9FA 2ZRJA 1XCPA 2O8EA 3K0CA 2YINC 5L8VA 1X6VA 2IYLD 3VR5A 4LC0A 1AJEA 1E9BA 2CEAA 3PVSA 5IDVA 3ZZ0A 2VQSA 1UJ2A 4IOJA 4R71A 2DY1A 1IOZA 2ANCA 5KO2A 2RGBA 3OE7D 1L8QA 1OKKD 1U8AA 1Z0DA 3LQRA 1UPTA 3RVBA 4Z1MD 5JWRA 3RRZA 1ZUIA 1PZNA 3BB1A 1OIWA 5AK0A 3H0KA 3I72A 2BVNA 1IBRA 3CLVA 4RCZA 1U8YA 1OIXA 3GEEA 2O8EB 3SHWA 3SC3A 3OIUA 3SEAA 1DG1G 1QHHB 5LB4A 2CJWB 2GEUA 5SZIA 1HA3A 2QNRA 2GXAA 4IXNA 3U61B 1F2UB 1YVDA 2FPMA 5AWFC 2P3SA 4RZ2A 2J45A 2WV9A 4WOPA 2MMGA 3T35A 2HJGA 5JRJA 1E96A 3AVTA 1XXHE 1M6NA 2ZYVX 2IXGA 3OAAA 4M8NE 3UG7A 3K70D 4YMVA 1Z63A 3NBYC 4ILEA 2FWRA 4ZIRB 1JJVA 1UBEA 4DCUA 2OFWA 3AGPA 4RZ3A 2OLKA 4BEJA 1NMXA 2NPFA 5JJKA 1NKSA 5C2JB 1FX0B 2ZM5A 3T34A 4HDQB 3TJZA 3GLFB 4P4UA 1SVOA 3X1XA 1T8UA 3RSLA 1G20E 2IYVA 3EPKA 1A82A 1XMJA 3G5UA 2ZYTX 3WNCA 2F1RA 4A8JB 3MAAC 4BLTA 2CK3A 1Z0IA 3HU3A 5FBQB 4ZIRA 3EPHA 4POAA 3FPAA 3GEIA 1R5BA 2V8OA 3BFXA 4DHEA 2NG1A 1ZCBA 2ZI3A 4YC7A 4EJSC 1SHKA 4BFWA 3CR8A 1MRSA 3B60A 1IN4A 1YU9A 4BFTA 1P7CA 2C2HA 4KLNA 2VO1A 1Q20A 3KUCA 1Z6TA 2NIPA 3BH6A 4O0MA 4PO1A 5KYKA 1Q1BA 1BIFA 2ZVQX 1JR6A 4L8GA 3AVPA 3SDZA 1I4LD 4A8JA 1U8ZA 3UK6A 2E87A 2QP4A 1K5DA 1AQUA 1ZUHA 1LTQA 4Q48A 3GFOA 1KYIA 3PFIA 4D4MA 2HYIC 2TMKA 1U94A 1S9HA 1PLKA 4LHVA 1SVWA 4EFMA 2B7CA 4OI4A 3WMGA 2QY9A 1KO5A 4XH9B 2BEJA 1W4AA 4NL4H 5H1YA 1WB9A 3PUXA 4N0EA 1HT1E 4M21A 1G1MA 4I99A 1Z06A 5CYPA 1NVUQ 1JAIA 1KHTA 2ANBA 4W5HA 4H9GA 4F4IA 5BN5A 4G01B 3WYAA 1Q1ZA 2E1RA 4JLOA 5FI1B 1FW6A 5TXGA 2RGEA 3P32A 3F8TA 2Z83A 1II9A 3LAWA 2VP4A 4Q4AA 1EK0A 3LW8A 4EFNA 3TK1A 1XMVA 4EQ6A 3U4QB 3TUJC 3CRVA 4A8JC 5KPDA 1VPLA 4M9QA 3PITA 3PQCA 2ZUBA 1RYHA 3ZIAA 4AKHA 4GI7A 1VMAA 2VHTA 1B0UA 4B3XA 3W3AA 2ZRGA 3AF3A 5FL3A 2VHQA 3EXAA 4HSEA 3W6NA 3VU9A 2W6JA 5CIWA 4QJ5A 3ZS8A 2V9PA 5JJIA 2DWOA 2QM7A 2CK3D 3GJ8A 4LYAA 4DDTA 4X8MA 3IPYA 2I4IA 1EFRD 5E7JA 1OXSC 5TARA 1F2TA 4LYHA 1CIPA 4BFSA 1XNJA 2OBNA 4RSGA 4C0HA 4LY6A 3OEHD 2PL3A 5KTYA 2PEYA 4ZO4A 2OV2A 2YZ2A 1ZUNB 5IK2A 1FQJA 1JALA 1EFTA 1HQYE 1LF0A 2X2EA 1UBCA 2F9LA 2XNSA 3EC1A 2NPIA 3U6BA 2XAUA 3TSOA 2Z0MA 4LSGA 1E2GA 4KYUA 3D3QA 2C95A 3RWMB 3LY5A 2F7SA 3AF0A 1TF5A 3V4RA 4DUGA 4C2TA 3CZQA 1J99A 2ODBA 1YR8A 2V1XA 4AC9A 3SI7A 4WBSA 2KBFA 3FB4A 3GJ6A 3FHCB 1GKIA 4ASUD 1N0VC 1KI7A 4DJTA 5F3WB 2BWJA 4CIDA 4E07A 4A0HA 3TSZA 3H4MA 4PO9A 1AS2A 3RS7A 3W9YA 1FP7A 1BH2A 1OJLA 3B1VA 1E9SA 1KI1A 3P4XA 3UPUA 3ZVMA 4TLEA 5CB6A 4GP7A 2V1UA 1IXZA 4PC6A 2GJKA 4LHXA 1PUIA 4KFTA 3QKRB 4HLUC 2C98A 3LVQE 3CF0A 4KHZA 3PUWA 4LRWA 2PEZA 4A0GA 3RS2A 4DLSA 4BZXA 4JSTA 3H86A 2O52A 2ZUCA 3ZZUA 5CM8B 1YZKA 2F55A 2HT1A 4NYJR 4F4JA 1YZGA 1ONBA 4Q9IA 3AKDA 2QT1A 2O0JA 2OT3B 1GIAA 2W6IA 1XXHA 2CJWA 2OLJA 3AVWA 4YLGA 5JEEA 1KSFX 2JIZA 4Q9HA 1Z6AA 4C2UA 3GLGB 1UDWA 1VCMA 2BMDA 2R6FA 3HYTA 4QNMA 5CDFA 4B75A 2WJHA 1MABB 4NU0A 4Z51A 1E1RD 4ABYA 1CR4A 1A2BA 3R20A 1T3LA 4HAXA 3OFNA 3U2QA 5A5GA 2X2FA 3I8SA 4DCNA 2OFOA 2YV5A 3FFBA 2G83A 1H8EA 3GJ4A 4JBWA 1LVGA 2R44A 1NBMA 3OHMA 4CVNA 2WJVA 4CT4B 2ZI7A 4TQAA 5FTMA 1W36C 4PHFA 4Q1DA 1Z29A 1JQJC 4EAQA 1MO3A 1YZQA 1XTQA 2R2AA 2NZ8A 2XZPA 4LCBA 1Z08A 1DAIA 3Q5EA 1T3HA 3K53A 5B2ZA 2WKPA 2WAYA 3CO5A 1ZVQA 3ZD7A 4LHWA 2Z5FA 5IHPA 4OI0A 1SVLA 4O25A 4OK5A 4OQXA 1XD8A 3QIAA 1N6IA 3FE2A 3FWYA 4HLQB 4DUGD 5J4VA 1Q3TA 2FE4A 2DFLA 4BLOA 3RRYA 4IW3B 4MRVA 4NYJQ 2HDNB 4TT3D 4Q9JA 4Z8XA 2QAGA 3SYNA 2Q21A 1ZIPA 4TMWA 2BBOA 4Q1EA 1SVMA 3BD9A 3WHLA 4U7DA 5FTLA 1GRRA 1ESNA 2WICA 4JVMA 3AVUA 4QFMA 4OHZA 2FF7A 4YQFA 4PSAA 5AJZA 2QUZA 2O8BB 1ESMA 1JR3D 4YDHB 3AM1A 2FSFA 1VDZA 4Q01A 2IXFA 2IYSA 2QE7A 4JL6A 2OCBA 4HB3A 1S2MA 2H8KA 1KDOA 4P33A 1Z3IX 4OQMA 1MO4A 2QMOA 3A1WA 4L4UA 2FG5A 2QP3A 4LI0A 2AL7A 3CB4A 4HAYA 1Z2AA 1E9RA 2R62A 2WJJA 2W6ID 4BFVA 4OQNA 4PZYA 4V0MA 1XZQA 1W46A 2WJYA 3W8RA 4ZDKA 2C8VA 3CPEA 4AYXA 4HAWA 4KITB 3ADCA 1OE0A 1S1MA 5KSPA 1VCNA 3KJIA 4C0KA 2CNWD 4P32A 1I2DA 1T6NA 1CU1A 3EPLA 1XEXB 1G6HA 3L8YA 1NJGA
chains in the Genus database with same CATH superfamily
3JAWB 1T2DA 3D6NB 2QP9X 3L1KA 4RA6A 4X1IB 2WTXA 1BW5A 2IRFG 1V6SA 1O94C 2XRNA 1ZVJA 2IELA 3MWEB 3NIWA 5BYAA 2QL6A 2WUVA 2RQQA 1M2GA 4B8XA 3V2IA 3HCPA 3HA5A 1XEAA 1ZOOA 4DCJA 4QDJA 1KQOA 2Q5EA 3TN7A 2J3MA 3BZBA 3BL6A 3E6MA 1KPHA 1S3GA 5ENDA 3I37X 3UGQA 3VMFA 3E81A 3EGWA 4JOSA 1EXMA 3ICEA 2WAFA 1O4WA 2X0JA 1QH8B 1O5TA 3HR8A 3VU3A 1JQBA 3W4KA 5J3JA 2VWPA 3P4UA 4HZGA 1Q0PA 1VYUA 1Y7IA 2XQGA 5KNDA 2K7LA 2RH4A 2OD9A 2MSKA 3MMPA 2C3YA 1YTLA 2Q9BA 1SC3A 2J30A 1U5TC 4LTNA 3VKWA 4N7RA 5JC8A 2GXBA 3QKRA 2OZ6A 3OEWA 5F77A 3DE1X 3COYA 4RO0A 5L3ZA 1BEUB 2FE1A 4GIBA 2M6LA 2W6NA 1MJFA 2H4FA 1LEHA 1E3WB 1CRWG 2V55B 3IDOA 3R3WA 5EZYB 3VPGA 5FEMA 5FJIA 3I2FA 2QQBA 5F2KA 5HTOA 2A7XA 1ZGJA 3TW6A 1F1BA 3MJRA 3CBGA 3CLUC 1A8UA 3S27A 1ZI8A 2MHCA 4PG8A 3EODA 2WK1A 3JD2A 4QL3A 5CLGA 1R6UA 1KNXA 3MUNA 3FDIA 4AG5A 3QXSA 3VOBA 3ZD6A 3E61A 4YLEA 3UWKA 4FFSA 2UUOA 3OOYA 4RBNA 1R7JA 1EJ6A 3DHYA 3GAAA 1KR5A 3QSGA 5AKZA 1VE7A 1OX5A 3PHLA 4O1IA 4L5JA 2OCXA 4L4RA 4QUEA 3M34A 4AUNA 2DT6A 3C4JA 2HOTA 3PYXA 2A9KA 4H3KB 2P5LC 3R9IA 2HMUA 4LC9A 4P3YA 4URWR 1P91A 1F5TA 1QGZA 2ENWA 2YC2C 3KBBA 3THOA 1A6QA 4FFBB 5FO5A 3UKDA 4IEIA 2FUNB 5LMNB 3IGFA 4MWEA 2YWFA 4BX0A 3HL0A 4UHJA 3Q9LA 2ZS7A 1KI8A 4MDHA 1JJFA 1C7RA 2CHQA 2HXYA 2QPOA 3I61A 2JAHA 2GPTA 2HBYA 5CLQA 5BW5A 2AUMA 3Q5DA 4QPPA 5I8PA 4BO8A 1MC1A 3B2NA 1WG8A 2J33A 1D7AA 3Q8XB 3RZDJ 1SVIA 3NHRA 3LCCA 2LY9A 2PGLA 3STXA 3S8PA 4M9XA 3H5LA 2EJVA 3HJBA 1YU6A 5DW0A 5T3YA 2P75A 4CL3A 2XAGA 2XUZA 3TXXA 5ED0A 1MTOA 4OHVA 3QVLA 3DDWA 3GZNB 4P96A 4XRMA 1MEJA 2DPLA 2XECA 2Z3VA 2EL9A 3DDSA 1NLMA 3FNIA 5F2OA 4ZZ1A 2B98A 4KYIB 2NUAA 1LZLA 1XJCA 4NOMA 3RVSA 4CV1A 4RTJA 1U5TB 1VJGA 2J3IA 3MT7A 3WP0A 2QEXI 1Z2DA 3IVCA 4OGFA 2HDOA 4OU4A 3RDPA 1Z16A 1R8XA 3V55A 3ZNQA 4LBZA 3ZMDA 1USGA 3GJXC 4YFKF 1UK8A 3DXXA 1L7NA 2DK8A 1DVRA 4QU8A 2VSFA 4QDXA 5ICCA 1Y89A 4PC1A 4QQ8A 4RWZA 1W4MA 2VSYA 3QEKA 2EFQA 1FXUA 2AQ8A 5FO1A 5JSUA 1KOGA 1XZIA 1I0LA 3GAMA 3O8LA 2BH2A 2OMKA 1OTXA 4LGWA 4RY0A 2PDAA 3SVLA 2EWVA 2X3UA 5FADA 1DI0A 3FNFA 4LIVA 5DTJA 1LPAB 5F7JA 4B3SB 5CDHA 1UF9A 1YR6A 3DD5A 3V8MA 1X3ZB 2VBWA 1B8IA 1Q16A 2XA9A 2Z30A 3DOEA 3HDTA 4HO1X 2CMFA 3ULQB 4M0FA 5J1TB 4LLGF 1NLZA 2ZVJA 2FK7A 4XPIA 1NVFA 4D3SA 1MV5A 4C6TB 5I45A 3SVTA 5C53B 3QLEA 4TMZA 5HILA 3IERA 1LKZA 4BKRA 2W4QA 2V4UA 4YMIA 2ZE8A 3FPSA 1JLLB 3F6OA 1IZ0A 2B36A 3J81k 1KKMA 3RK4A 3FXQA 4LMRA 1KS9A 4CHGA 2DA6A 4RMGA 2EKZA 3DQPA 1ORKA 3SZ3A 1SUCA 3G1WA 3T52A 1QFMA 2B1GA 1KIFA 3FCCA 5SYNA 2D7CA 2Q2EA 1Y1SA 3G8CA 4NP6A 2PJZA 4XWGA 4ZMRA 1F20A 1AKTA 3JVUA 3IXQA 5HQJA 1KL7A 2ZQ5A 1ABFA 4HYTA 4QDTA 1GG2A 1J70A 2FMUA 4G2NA 3VU9B 1HE1C 1HE2A 4UVAA 2VHUA 4GM1A 4B5LA 5CYVA 2Q1UA 3E23A 2HQOA 1V8ZA 2GEVA 2DWQA 4ZV7A 4E5NA 1E0EA 5AVWA 2HQAA 4UOQA 4IIUA 4FJ1A 3VOSA 3MGKA 2D62A 2IE0A 5K8UA 4HVAA 3WFIA 5GY7A 1EFVB 3MWEA 4LZPA 3ZHBA 1QVZA 4F5YA 1CUCA 2EFJA 3MCVA 4WA7A 5EYPA 1OI4A 2ZBRA 3H7IA 3OC0A 2IV2X 1M2JA 2GBLA 4RIGA 4UUQA 2VNHA 5B36A 3WGIA 4P84A 5C81A 2ZJ2A 5JD5A 2DDAA 1DFIA 4RKYA 4R1UA 2BEKA 2EA2A 2PCLA 5KJFA 4D2IA 3U5TA 1RWXA 3I4MJ 3A1UA 3IR6A 4QASA 3ZLUA 3RJTA 3BGDA 2P3QA 1XCVA 3BG9A 1ESZA 1KYTA 2FEXA 1T56A 3PPIA 4BVLA 3CUQC 4CFZA 4RULA 3H3FA 3KSMA 1NJFA 5AKXA 4KQ2A 1YASA 2VCEA 1EG7A 2COEA 2J59A 2FZVA 1TTPB 2AXPA 4GX2A 1Y3DE 4GKVA 3ZCTA 2PZEA 4LXXA 5CVTA 1IBKB 3QBVA 1OMIA 1WF6A 1FDSA 5IUJC 5HE8A 2VPWA 4ZJZA 2OQGA 4ZYGA 1FMLA 1XQYA 2Q1TA 4NQWB 1M1NB 2Y1XA 4F56A 1FBUA 2QUKA 4WACA 2QYHA 2RGCA 2VIIA 1RKBA 1ZR4A 2FGKA 3CNLA 1D8AA 1TUBA 3LLVA 3PGVA 4F6LA 1QJ4A 5JS7A 2KISA 3C0KA 4XGIA 1MZPA 3GUHA 1GPBA 3C3XA 4RAZA 3RSSA 1P18A 3OPYI 1JR4A 5BSVA 1U04A 2QW0X 1KI2A 3EA5A 2O20A 3N70A 2ZJYA 1RI4A 5LLSA 2VDQB 2QU8A 2CQ7A 4M54A 3V8EA 3WGUA 4COKA 1HNXB 1X4OA 1BA5A 2LK2A 2BGIA 5EQFA 1BC8C 1QG6A 1W36B 4HF2A 2IUYA 4ZOBA 5K8CA 2G1PA 1DDIA 1WP4A 4B34A 3A6KA 3WTBA 2VKHA 3DLAA 2Z95A 4H7IA 5EY5B 1TYAE 4Y0VA 3WXBA 4IV0A 4LX8A 4UBLA 5AOAA 3C3BA 3SQDA 5AKEA 1GG9A 2H2GA 1FMJA 2WMOB 4DUPA 4AKGA 5KC9A 4KUMA 3CQZJ 1MAHA 3A4TA 4EJOA 5CLIA 3KKLA 3RLFA 2E4XA 2GNPA 4HDSA 1HZZC 3WA7A 1WXIA 2TECE 4HYQA 3D5SC 1J59A 4G8CA 1ZC3A 4YCMA 1L5FA 4HPXB 4LYYA 3HK2A 4IWXA 3KB8A 3AG5A 2ZI9A 1DKQA 1P9RA 2K9SA 1JFSA 1XMSA 3CY6A 3D0RA 2CL5A 3NTRA 1EZ4A 3O2QB 1V5WA 1QBJA 1VYVA 4IDNA 1PSDA 2HWXA 5CXXA 3AUXA 1E2PA 4RPLA 2C31A 4R1PA 1IK6A 2R92J 2Q45A 4L8WB 5KSZA 1TC1A 2PZAA 3V7UA 2Q5CA 2CQQA 4ZZIA 3TUZC 2EKQA 2GAUA 4YACA 2XGMA 3O2JA 3MELA 3O93A 2AN1A 3TGLA 4G9GA 1XTSA 1UP7A 3COPA 2WSYB 3LK6A 2STWA 5B55A 3D59A 3EVCA 3W9BA 1GKYA 2IPXA 4DBLC 3A3YA 2RJNA 3L4KA 4FHTA 3WSTA 4FBMA 4A0FA 4HNHA 2A5WA 4UV8A 1VCOA 1WMBA 5COQA 5GTDA 4WECA 1A9PA 4G5QA 3X1DA 1N9ZA 1GUDA 3O8DA 4V39A 5IBRA 3OYBA 5TDHA 4YJ2F 1CUHA 2VWGA 5IT9Z 1MH9A 2DCMA 4I2OA 3WG9A 1JG4A 2QL5A 4Q7KA 2YXEA 1AKVA 2QG9A 5AW9A 1K4SA 4CDGA 2FN8A 2I3ZA 4EA7A 1W7PB 1SHZA 3H2YA 4B5KA 1OXVA 1FZTA 1XQ9A 3R3ZA 3ZN1A 2FW6A 3OE1A 4U2EA 3VSEA 3WB2A 2X9NA 1CEYA 4UE6A 1JHRA 2L7FP 1K9VF 3KHSA 4I1OA 2WKWA 3WICA 2CLFB 4CR7A 4E2FA 1E92A 3PGXA 3ER9A 3UMVA 3HS3A 3L79A 3LY8A 3O91A 4X64B 2ZSJA 2B2NA 1S29A 1KMHB 2DQKA 2ZB7A 3JWGA 1ECBA 2BSAA 3FMGA 2IDKA 1H2RS 3IOEA 3K72B 1SD5A 1P0CA 3U7EB 1OH7A 2HJVA 4DR7B 4C4RA 4Y1RA 10MHA 1XRLA 4FSDA 4AL4A 4DJ5X 4RAGA 2TRTA 3E9EA 4NOKA 4N82A 4UU8A 3E18A 5B7PA 4ZXPA 1Z4NA 5K3OA 4DRXA 2JEOA 2QD2A 4R31A 4OIOF 4TWBA 3SIRA 3IT2A 3PXGA 1PAUA 3T7RA 5DCMA 4UXIA 3UK2A 1NUHA 4FINA 4J76A 4CYMA 1D2CA 1GD1O 4UBJA 3V8BA 1RHRA 2X1EA 1ZN7A 3I55I 1JKJB 3T3IA 3FCAA 1CY6A 3UMJA 4AMVA 5HGJA 1N3BA 4PR0A 2P2GA 1P2BA 1UANA 2BTQA 2EHJA 1LVHA 2EKPA 1XZFA 2PBZA 1FS6A 4JAVC 2H9IA 3LXRA 3E6AA 3M2PA 2J07A 5CDUA 1GVHA 1Y80A 4W99A 4CLRB 4GUAA 4AKTA 2OQVA 3R77A 4D9HA 1P4WA 2FPUA 1VSVA 2AZTA 4JIGA 4ZWNA 4FE4A 1Z33A 2RGYA 4BYMA 3MTQA 2Q0QA 3EFEA 3K0AA 3RYHA 1MF7A 3FHJA 1TTTA 2B0LA 3U0VA 2I2AA 1L7MA 1T25A 3GTMJ 2NVQJ 1Y8ZA 4G9BA 4I9GA 1JILA 1T6XA 2DT8A 1CJKC 1OHHA 1BXRA 3DAYA 3JAWA 4QPQA 1G8FA 3D6UA 3KG2A 4ZQIA 5LYJA 4C0HA 4Z6KA 3DOIA 4F46A 5H20A 1DBPA 2NPOA 5TVGA 4EMBA 3WNVA 3BCAA 2JHCA 5K3EA 1Y63A 3B6CA 4AM8A 1X13A 5TEVA 3WHBA 1NDQA 3OIPA 3FKJA 2WD7A 1D6SA 5AM0A 2XCRB 5DHUA 2QRLA 3WG7H 2LY1A 4ZYZA 2OESA 1WB6A 5DHAA 4QLBA 4YHHB 3EARA 4M9ZA 1Q1QA 3L7OA 4O02B 3BGSA 5FI5A 2GN4A 1EDDA 4RXUA 3RHSA 2IS2A 1OC2A 2O7RA 2V58A 2PG3A 3IAEA 3IRVA 4GMHA 3GPIA 4Y6QA 4EW6A 1XZDA 5EGNA 2V7QA 1GRNA 3A05A 4BV3A 5IVHA 1GTRA 4CUGA 4R9NA 2A2ZA 3BE5A 3BD8A 3GF2A 3H1TA 1FK8A 2MCFA 3MKLA 3KYLA 1GLNA 3CJRB 1A2QA 5E1DA 2C8LA 2XX3A 3ZWOA 5L4LA 2WG2A 3MOGA 4LXUA 2RKBA 3MRVA 4ZTFA 2HU2A 2M1BA 3CISA 1D2EA 2WE7A 4JGBA 4LGVA 4GNKA 3R7AA 5DN6D 1T95A 3BCBA 4BGDA 3FDJA 1U4SA 1IY1A 1GTG1 2YDYA 2J0SA 5E17F 4E7JA 1U6KA 4O4HA 2R6AA 3UV7A 5IF9A 1U6JA 5IPFA 1O9BA 1S8AA 4CMBA 4DDUA 1C5KA 3WBJA 2VXYA 4C9YA 3QVVA 3WMEA 3C8UA 1A7UA 1OH6A 4PS0A 5HBRA 4DABA 5G0VA 4G25A 4YPFA 5A6SB 2RGUA 1T15A 3K5PA 3MS7A 1E4VA 2EKDA 4J0CA 1VQ1A 4R7TA 1OXUA 4TROA 4ZCLA 4GQBA 2D06A 3QPUA 4ND2A 4NTZA 2A9JA 1Z18A 5JPCA 1TQPA 1T38A 1ISRA 3KOWA 1SXPA 3GLKA 2FLVA 2C0PA 2DQYA 3HI6A 1TQHA 2P0AA 3I4NJ 2VPQA 1M5UA 1NWHA 4HN2A 2F4NA 1JMKC 2A68F 5L45A 2HN9A 4ZTZB 1I32A 1P5FA 2OBMA 1S2OA 2EQ5A 4AF8A 4AYWA 2F17A 3CUUA 1R5ID 4CM8A 5BSEA 2JLVA 3RJPA 2BVMA 1RHKA 3OCUA 2Z58A 4L27A 2OTLI 4ALIA 1IN8A 4BS9A 3QUCA 3E9ZA 3UEOA 1HRDA 2YRXA 3FBGA 3ZPLA 2V0NA 5ALEA 1FOKA 3W7VA 3MCTA 3PTZA 5CLJA 2V6EA 2EFGA 4P92A 2B8TA 4BP3A 1L0OC 2JIRA 4RQBA 4C3ZA 3DT6A 2NO6A 5JSFA 1BHO1 1JVSA 3B02A 1KVUA 2BMWA 2QB5A 3O83A 4QIHA 4BFCA 1T0BA 5HFJA 5BURA 2WEKA 5BSRA 4EFKA 1PZMA 4X6UA 4RFLA 4FXPA 3OOWA 1T2FA 4EGSA 4LOLA 1Y0BA 3FVWA 4Q6WA 3GA0A 1JEYA 4C4ZA 2Z2IA 2QI9F 1MQ8B 3KALA 1B2RA 2ZUUA 2GVDC 2WTUA 1RNLA 4BIMA 1SVKA 3V42A 5LP1A 2W2OA 5CFRA 1SQGA 5KQRA 1FUUA 4W7HA 4XIFA 4Y2RA 4GOXA 4B48A 1QBGA 2PU5A 3L7BA 3PXAA 4LUCA 5FWYA 1J2XA 5IDQA 4D9JA 3RI3A 5ALFA 5FBLB 1LU9A 3U3MA 1YR9A 1UZNA 5COAA 4D81A 3L8DA 4LX0A 3PGLA 1WCYA 2ODWA 3LBYA 2PL9A 4Q1AA 3B13B 4TTPA 3LMKA 3CEPB 1OCOH 4WXMA 1U3TA 3N8NA 1UPUA 4FFBA 2VJ4A 3FRIA 2ORWA 2V7GA 2PUDA 2XGGA 1XEWX 3OUUA 2R66A 3OQHA 3BP8A 1T9KA 1XXHB 5A5EA 1OFVA 3AFMA 4R1TA 3TB4A 2IX3A 3TIIA 3FHTA 2FRHA 2OG2A 2JCBA 5KNCA 1NMZA 3VPDA 2O8FA 1C9MA 2AJLI 1SUPA 1WL8A 2QRVB 1MABA 1TECE 1P7YA 3DGFC 2QTFA 2HPAA 3KSRA 4I3FA 4LNHA 4N1AA 1KFKB 1PP7U 5K5EA 4HEA6 4OY3A 3MEQA 3PJRA 3J81Z 5AXBA 4ZYAA 2BAGA 2I67A 3ICPA 3HOVJ 3CF4G 3TD9A 3DDNA 1Z4KA 3KB1A 1T4BA 2XUFA 1IUOA 1T08B 2FN3A 2W8BB 4NCNA 4EZIA 4KPGA 1LNQA 1RWWA 2OXEA 1DADA 2CLSA 2WJIA 4FI3C 2FOKA 3TH5A 3CLTD 2QBYA 4PAOA 1ZN9A 5I6DA 3NCTA 1L5QA 2EF1A 3BS4A 4K6FA 5DD4A 4GOKA 4BWGA 4B3IA 6GPBA 4A3FJ 4PRYA 1QGUA 4WADA 3RSQA 1SCUB 4CKZA 4BLVA 4J6FA 5IYZF 3RC1A 4JMLA 3ZLVA 4GS5A 1G2HA 1MENA 3MZ8A 1V5IA 1J5EB 4W5WA 3JQPA 3U44B 3L7JA 1LVAA 5I7EA 2XVXA 4XEUA 3GRVA 3NHWA 3E9MA 2WD7B 4MWTA 3TQSA 3PO3J 1D0VA 1WEHA 3C7KA 3IAAA 2OUIA 3OTHA 1YQ9A 1QP4A 4WWHA 3UTDA 4B3TB 1T8WA 4QAQA 3QE4A 2XOXA 2FJUA 1ULUA 3K4KA 4XJSA 3WSVA 3GLIA 3CZ5A 4FFLA 1PL7A 2F2TA 3VYRB 1I1OA 3T3GA 4F11A 3WGZA 3EDMA 1U0EA 5JJCA 3D6MA 5KYGA 1DFGA 5TMEA 4UM5A 1DE0A 2H59A 5IW8A 1U5AA 1PUXA 1PGJA 1L4HA 4OGLA 2YJNA 4MV5A 2QI9C 1U2RA 2RC6A 4MS3A 1FXSA 2VQ3A 1AF4A 5ALQA 1MHTA 1TD9A 2E9SA 3TNYA 1FW8A 1LNSA 1YOBA 3G23A 4MQLA 2Q6OA 2VKTA 4R01A 1W35A 5AJHA 1KK2A 5J5AA 3DOUA 4PX9A 4QEZA 2CUNA 3QBDA 4OHFA 5C8YA 2GKGA 2HQ5A 1Z6GA 4E1VA 4JI8B 1H2BA 4GLBA 1KU0A 1Z6YA 4HWRA 2OA4A 4P53A 3ZWDA 1VOTA 2WC1A 1TUBB 3EDQA 2BFBA 5M29A 2IGKA 3D5EA 3UGJA 4BPBA 2M2IA 4NYMQ 5AVOA 1DARA 1PR0A 1Q0LA 3PG5A 4ZVTA 4F06A 1HORA 1VA5A 4IF6A 2WIAA 3ITEA 4GZLA 3B70A 3OYEA 4DN6A 1H4QA 3REGA 4MS1B 2OCAA 2OAQ1 1TO2E 3ASOH 1WXEA 3GUYA 3S68A 3SZGA 3W6ZA 3QUQA 1OI2A 3DFGA 4KX5A 4E11A 2RHDA 4RX1A 5CAEB 2MIIA 4OAOA 5FD8A 3AEZA 3L1JA 3R2JA 1NV8A 1JSLA 2JGJA 4MMYB 5B1EA 4HZFA 2W0MA 5B37A 2EV9A 4UHFA 4RKWA 1NVTA 2EP8A 2Z4TA 2IYAA 3I83A 3I5YA 2V0GA 1E0AA 1JFVA 1PEKE 4DYHA 1A9OA 4TLBA 1Y98A 3OIYA 4XSZF 1H22A 1NR7A 4HGPA 4QHTA 3UO8B 1JAXA 1NSYA 3LT1A 3VHXA 3CB2A 1V9LA 1JTFA 1J0RA 4X6AJ 5BSHA 2FMTA 3X1YA 1CIJA 1CS4C 1VG8A 3AWIA 3KDSE 3OZTA 4ND7A 1NBOA 1NPDA 4P36A 1XD9A 3GI1A 4GO1A 4GZ6A 3LHDA 2O57A 2CNNA 1ZG5A 2G36A 1HT3A 3VR5D 1FFGA 1HF0A 4BACA 2IC5A 4QOSA 4G0UA 3L2OB 1E77A 4LLNA 4ISBA 4S2EA 1J07A 1U3VA 3IHTA 1JLHA 1PGQA 1FYMA 1EB8A 1JKXA 1L5GB 1GM5A 2FPLA 1Y3HA 3ETGA 2QZPA 3B9PA 3AF2A 1WRBA 2DBRA 4F2GA 5IRCD 5EG0B 1T9ZA 4UVDA 2P6SA 3D0SA 4G5RA 5AIPA 3BIFA 3K1AA 3GWGA 4I2VA 2IHVA 5DE3A 1A8SA 2ATCA 2Z2SB 2YIDA 1IQ0A 5CLFA 2AG0A 4OKSA 3O8OA 4C3UA 5AVKA 821PA 4AN1A 4LZJA 2ZIWB 3HGQA 4X71A 4YGYA 1QZ3A 4DHWA 1B42A 4MMXB 5A2QA 3ZU2A 4FT4A 3BJ6A 3IA7A 1G18A 4LBVA 1SA0B 1JHHA 2FFHA 4Y9TA 3EDYA 5JVDF 4R8SA 4DR6B 3M8EA 2Y1OA 1MAWA 3OLYA 5A3RA 3B85A 3LA2A 5A3VA 2KM1A 3ZYZA 3GH1A 3GJ5A 5E6SB 3FMRA 1Y6QA 2W11A 1YIJI 5T3UA 3VRHA 3MC1A 4F55A 2UZIR 1HKSA 3FJYA 5IARA 4YUXA 1D0XA 4DZZA 2BT4A 5IZCA 1DO8A 5K03A 1RADA 4WE3A 1KDPA 2OP1A 3FW1A 2VQEB 1JXMA 1IRIA 4QELA 3L2RA 1Q6ZA 3AZQA 5LMCA 3GEDA 2AZXA 1M66A 2OF7A 2EJRA 4RNCA 4Y2UA 3UYKA 4LJ6A 1XPOA 5CT4A 2VPXA 2RKWA 2VRBA 1Y8QB 3AG6A 5EIFA 1JDPA 1Y6JA 4X8OA 4LIUA 4NC9A 4NNPA 4EG8A 3A6PC 2C00A 4TT8A 3DL4A 1TWGJ 2D5IA 3EA4A 2RONA 4DQVA 3KP6A 1G21A 4ENKA 1U6IA 1XTBA 3F3KA 4OB6A 2KHZA 3ETJA 3N9IA 4URYR 3HDVA 4OJQA 2GD6A 2MWMA 2WJAA 4TZ0A 1SMKA 1GEGA 3GLGA 5KB3A 2AOUB 2JSPA 4FYXA 1EV7A 2A67A 4KWEA 1U2QA 4N3AA 2OB2A 4N41A 4YJ3A 1WQ2A 1DDOA 4RHYA 3AR6A 3BR3A 1JDNA 4BJ3A 3H5OA 3AR4A 2Z09A 3O03A 3FFXA 2ZSIA 5HF5A 4C7KA 8ATCA 1FNNA 3LSMA 3KJFA 1UJBA 3WGGA 3BXEA 3AXTA 4DCVA 1FSEA 3B20A 3H0GJ 4LZLA 3ZXYA 2I6UA 4CM9A 3IIKA 3FUXA 5K6TA 2Q5LA 1H8AC 3DMPA 3WHKA 4ENSA 2VPYA 3FY4A 4M1EA 1XLTC 5DGTA 3ZMUA 3HDJA 3HV0A 4AU7A 1X2MA 2DLLA 2HEIA 3HBJA 3K0AB 1QBKC 4FZJA 4LISA 3WAKA 1OCRH 3P2EA 2JQ7A 3K9GA 2BDTA 5C5CA 4KCGA 2YXLA 1F8GA 3Q0EA 1BSVA 1J1ZA 1NJ2A 1YRAA 1UDAA 3DT8A 4Q1EA 4E5UA 1UMBA 3NHKA 3MKWB 2PX8A 2VDPB 3I04M 1BW9B 1NOIA 3L4JA 4Z99A 1VG9B 3CNNA 1QH0A 5CA0F 2O2JA 3OYKA 4F12A 3O7MA 5LEJA 5A04A 1EXDA 3MVPA 2E7XA 4LMAA 5T4HA 3ZE1B 4C03A 4O4LA 3WISA 3OSFA 4DRXB 4IH9A 5DM6F 2OPBA 1ZJ4A 1ZQ9A 4BMZA 1VLHA 2DAOA 3BFVA 2X6RA 2Z2XA 1Z7LA 2AFHB 1OCCH 1LNZA 3E7LA 2KDOA 3CBQA 3HYNA 1OV6A 2XUPA 5GTHC 3IV9A 1OMOA 2F3PA 2Y2UA 4QU5A 3WLKX 1ZELA 1CETA 2GERA 1KF0A 3CJTA 3K5IA 1G8XA 1AX9A 4J0JA 4L78A 3EULA 2WT4A 3GFTA 4CWAA 1QH1A 5AVUA 5KNDD 1N9GB 1ENPA 3TDNA 1T8IA 2WYUA 1XFDA 4HXGA 1XTKA 2J3KA 3NEJA 4CKYA 1Y6FA 1VE6A 3C2GA 1U3FA 2XR1A 3R8CA 1VI0A 2ZYIA 2Q2EB 1CBUA 1X1TA 2C8JA 1RXEA 2I1QA 5F64A 4UMDA 5K3DA 4DLZA 3TBIA 1OYIA 1V11B 4G37A 1GAWA 1GZUA 2GK6A 4WBNF 2G76A 4Z1OA 3CT6A 3ABLH 2RGDA 1BOBA 1YRYE 5E4TA 5FXMA 2C78A 4FEAA 1H69A 4MA0A 3PE6A 3GTQJ 3OS2A 1K0UA 4GL4A 4M86A 2B82A 2IZ6A 3LSJA 1U8TA 2ZRCA 5B3JC 5TIIA 2WM8A 1EXWA 4X7MA 1F8UA 1XK7A 1PFUA 3VHXB 2HMTA 4W1PA 4AJOA 3WI7A 2RJ3A 3IV5A 4QOIA 1XG5A 1QAQA 2IA5A 1GQYA 2IYXA 4G5YA 2J8ZA 3N97A 5DYYA 1CNMA 1J2UA 3B2QA 3CR7A 3L7DA 2AC2A 2Q4EA 3L6BA 4KU4A 5LJLA 1TX4B 3QELB 3PR1A 3CD6I 2A0FA 4HGQA 5EZ5A 4L4XA 2BM9A 3M81A 3AW8A 3OD1A 2WJWA 4EP1A 5BN3B 2LKCA 2I5UA 3H8SA 2QU7A 3HKZN 3SR3A 4UZSA 1QK4A 4JQSA 3CJQA 3TW0A 4ALKA 1REPC 3BOSA 3VU8A 3T94A 3H36A 2NV0A 5HCUA 2BIFA 4CM9D 5EG0A 2LBFB 1DBWA 8ABPA 3L6OO 3N2LA 3W5SA 4P5DA 1H88C 2B34A 1RAAA 2R86A 4GGPA 1TJNA 5J58A 2XF8A 4MWZA 5BOVA 2C4VA 4B4OA 2JCVA 1XRPA 3DOHA 2MC4A 3L1PA 4G85A 4M8SA 3V4SA 3VUEA 4F21A 5D87A 1OB2A 1UXGA 1ULHA 3MUEA 2WJPA 4H7HA 3LQ1A 4OAZA 1QOPB 1A5AB 1X7XB 3G5LA 1LQUA 3H9JA 2SCUA 2ZSDA 4K9DA 4DLXA 4KMFA 3LPCA 2ZE5A 1RP1A 1SVUA 5KU1A 2C3MA 4ZI3A 3B5EA 4IQ0A 5IJZA 2GCOA 2W83A 3ANLA 5AW1A 1UDRA 2FEMA 4FBLA 1WFXA 2FPKA 1V1MA 1L8OA 3DVAA 1F9NA 1R49A 1UC8A 3W2TA 3WQRA 5GAHJ 4CV0A 2Q49A 1VQ7I 1FA9A 1SXJC 2AOXA 2D0PB 2ZE6A 2CCKA 4QGAA 4F5WA 5BNGA 4TXHA 4GFDA 3AV3A 1RCFA 1YHYA 3NHMA 3OVMA 4K03A 2I9KA 2ZC2A 5LYYA 4QO7A 1TDJA 5BQPA 4BE4A 4IQ4A 4MGRA 1W30A 1CQJB 1QHEA 2RSLA 3DPSA 1XD2A 2ZSBA 3G73A 4KFSA 2ZIFA 5GGYA 1U2GC 3CMEI 2DR2A 4B82A 2NZJA 2FPSA 1Y9DA 4UV9A 2PN1A 3IP5A 4CUKA 4YN3A 1E9FA 1VJRA 1RACA 1WE2A 3I6QA 5GTIC 1D03A 4O1HA 4QYWA 4UEJA 1X8KA 1YI1A 4UVHA 5EIBC 4ARZA 3LTNC 1OXTA 4CIXA 1QJCA 5KMGB 2R7KA 1PWYE 1HSJA 1I4WA 4QATA 2CL0X 5CMLA 1IL0A 1BDHA 2JK1A 3LL7A 5ELMA 2FOXA 2RGXA 2B5VA 2WAOA 1LDGA 1LK7A 1RZVA 2J9GA 3CF4A 3HNRA 3Q7PA 4UNQA 4B9EA 2OAP1 3W6VA 2R8EA 3EJWA 2W2KA 1XPXA 3IT3A 4OH7A 4U4AA 5FTWA 4ZC1A 3K0SA 4IDGA 4JLMA 4AU1A 4ZYTA 2WKSA 3CUEF 4JHLA 4YCNA 2C7RA 2D3WA 2AXTC 4BJTA 4PONA 2D0OB 4P4LA 2LF7A 1RI1A 4G84A 3QK7A 4RABA 1A77A 5KAIC 1UJ6A 4U5XA 3SKXA 1NHWA 4ENTA 2FW0A 3DC7A 1FMWA 3SBEA 5CJ2A 1USVA 3MWFA 4IV8A 5KX5B 3CGWA 4IINA 3OYAA 4MICA 3EVNA 2UV1A 4RNDB 2C9DA 4HB4A 4X7RA 5DO9A 1Z7GA 2NOJB 1P60A 1ZNYA 2HQSA 2YUIA 1PYGA 1U9IA 4YELA 2TMGA 4X1YB 5KVSA 4IHVA 5HEKA 4M9UA 3VUFA 4AJNA 3AR3A 1CUYA 3GAFA 4GXTA 4R0NA 3AJAA 5ALLA 3TIVA 4DEYA 3S16J 1P2FA 4CCMA 3S32A 2FEAA 2ZS8A 3W2HA 4BCBA 3BSWA 4KIBA 1RC8A 3DYIA 1PUFA 1KDRA 2D5LA 4COOA 4R2WA 2R5ZA 2AYXA 4GGMX 1RKQA 4LJ5A 1WUKS 3WK8A 3HOWJ 4G1FA 5HHTA 4IHSA 1H6AA 3CW2A 4PLCA 5JATA 5EKUA 5TRTA 2F1JA 2R6ZA 2ZBUA 1R9NA 3T1HB 1O3SA 4EKGA 2OG1A 4XIJA 2WUWE 4QTRA 4UNPA 3IAXA 2QRVA 3MT8A 2ZMEC 3RK1A 4B32A 1LDBA 4G26A 1HLPA 4ZOCA 2X5KO 4BDZA 2P7IA 2BMJA 3MTEA 3NXSA 5ULLA 1B41A 2ZBDA 3AUKA 1KSGA 3FXOA 1QCDA 1GAQA 1RC0A 2IW1A 3WZLA 5IANA 3ZUPA 4ZQCB 3T06B 2YYAA 4AF6A 2VJPA 2WSLA 1X1RA 4WZAA 1DAHA 1PR1A 1Y4UA 2OYSA 1KXZA 1PZGA 1LDYA 3EVEA 2C7VA 2JRCA 5IUKC 1F06A 4Q24A 1KC1A 2DKNA 1KJIA 1YUMA 1V9SA 3RSGA 3SZMA 4RORA 1AQYA 1I9GA 2WC2A 1PYDA 2OGUA 4BP9A 2IHBA 1NUQA 4C20A 4EL5A 3GELA 3QPVA 2JJ2D 2QSGX 5A4JA 1X8XA 3TJMA 1ES9A 3IUYA 3OHSX 3W4JA 5H82A 4HEA2 1G8AA 2QE7D 3KP1A 3PDUA 2Y1LA 2I65A 2XHKA 3DW1X 1MR3F 2GLOA 1FFXB 1U7HA 5D8KB 1M34E 1V37A 2I2DA 4MUNA 4PVCA 5JVDA 1BXGA 1IXCA 2XMZA 3IWZA 1VMEA 5FKLA 5J40A 2D2IA 5AOCA 2HI3A 3MCZA 1SZCA 2QTTA 4MW7A 1XQWA 2OV7A 5A2QK 2ZTMA 1KSHA 3FWEA 5BT8A 3HB1A 3NBXX 2Z2KA 2XCLA 4ACAA 4G8JA 2UKDA 3RI4A 2PSJA 3OQBA 2YIJA 4UZFA 1GA6A 3EIOA 3NRVA 4L3OA 3SJCA 3JALA 1Y0NA 4HWTA 1WJDA 2F5FA 1ML3A 2FPPA 2WAMA 2BMVA 3KTOA 5K6AA 1G3TA 2HADA 4RM2A 4HOYA 3S28A 3LLUA 3ZX5A 5KS2A 3PXBA 4PCVA 3LOUA 3D3WA 3NU1A 2ZT5A 1GKKA 3J80A 4DV2B 4KXWA 3ZTWA 2EGHA 4EG0A 1CK4A 4LFAB 2XXAA 2II6A 4CXFA 4F97A 5JBNA 2WMNB 4YIHA 2CQXA 3U7GA 2VJAA 1FTTA 2KI5A 3NYRA 4D5GA 2CGPA 1Q5PA 5J8FA 1AKUA 1NMEA 2J7PA 3ABIA 3GDOA 3QXGA 4K81B 1GUFA 4LJAA 5HBGA 5HNHA 2QSHX 3H2IA 4J1NA 4MLZA 3QXXA 3CW8X 3K4PA 3FR7A 1ESCA 5JT1A 2PMKA 5TJ9A 1SCJA 3DDUA 3QM1A 3RHTA 4EY3A 2WQ7A 2F90A 1T2KA 2FLWA 4US2R 1U8BA 1ONSA 1WTAA 1Z8HA 3FUUA 2PMEA 5BMOA 3UF0A 1W1WE 1XUOA 1S2DA 5GZ6A 2K9LA 1NL3A 5IT4A 3ZOBA 1W88A 4XB1A 3NZEA 2PPVA 3I39X 3K6GA 2SKEA 1TJPB 4JHXA 4A2WA 4MUHA 3VNAA 4AJ9A 1DQRA 3GFPA 4ZYVA 4V0KA 5BW8A 1S5LC 1DTWA 4MHOA 3DXFA 4RAQA 2JJ1A 5LC1A 3RHZA 2FFAA 3JYHA 4R0MA 2GN1A 1AXGA 3RUHA 4CDMA 1E7WA 2NYXA 3E3VA 1GZVA 2V6IA 3PL5A 4XFJA 4UEWA 3RVMA 1GZ4A 5L3RA 2VC2B 1F8XA 4ZVQA 4ZEVA 5BSUA 3KKKA 4BJ5C 1KVTA 4KBYA 4MRAA 3Q72A 4QXOA 1G3IA 1VJ1A 4RMNA 3W90A 1DIBA 2PUTA 1WSUA 2IU0A 3VKVA 5E6RB 2QLLA 5KJEA 1V95A 3ZGKA 3A1VA 4KXQA 3RQIA 2CFRA 2JBWA 3K4QA 5H5JA 1LS1A 4EMTA 1N78A 3T5DA 2RREA 2A7QA 2H85A 4IDQA 3I6MA 1WPRA 2WUDA 3LRTA 1LZKA 1LSOA 3EW7A 3H4IA 3H05A 3KPYA 2IGTA 3U1DA 1YZNA 2FUG6 3GNQA 3VO8A 4EZEA 1IZ1A 1JG1A 1II8B 1R22A 4GZMA 2GB4A 1EFHA 1L8AA 3KZMA 2C77A 2ZU0C 5GOTA 4BMCA 4EB3A 1JS1X 3LSKA 1NVDA 1U7WA 4G5OA 3PFGA 1L9XA 4KYVA 2O6LA 5AMXA 2YUTA 2IOHA 3PUIA 3ECOA 3M9AA 2C7BA 1EK1A 1R0XA 3HY3A 4NBLA 1NKVA 3I9KA 4RCYA 2QRNA 3C85A 5DHTA 5FYQA 3UA4A 2ET6A 4DYDA 1AS0A 2OJED 1GGMA 2GZAA 1QIIA 3KT0A 3LRXA 4A6PA 2GXUA 1J0AA 4D4HA 1RZRD 1HE5A 5DYNA 4D9EA 2X13A 1G19A 3L7NA 1M1YE 2FG6C 3JQGB 4XRSG 3AETB 4PFQA 3BEOA 3BQYA 4UNOA 5JAOA 2IZZA 4ZRNA 3H3UA 1U3CA 3FYTA 3MUFA 4NEHB 5HCIA 3QHQA 4A5SA 4DKXA 3W5CA 1QFSA 3F7MA 5D1HA 1KFBB 3A4MA 4G4IA 4JI2B 5JQGB