1U0JA

Crystal structure of aav2 rep40-adp complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
267
structure length
261
Chain Sequence
GMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication protein
publication title Structure of adeno-associated virus type 2 Rep40-ADP complex: Insight into nucleotide recognition and catalysis by superfamily 3 helicases
pubmed doi rcsb
source organism Adeno-associated virus - 2
molecule tags Replication
total genus 83
structure length 261
sequence length 267
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.950 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1u0jA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u0jA02
1Z6TA 1I2DA 4MRNA 2RHDA 1U0JA 1B23P 2LCFA 4R2HA 4B47A 4EUNA 2BVNA 2WJVA 3OE7D 3C5CA 4HB0A 3GLGA 2H92A 1NF3A 2BMJA 2JDID 3CPJB 1D9ZA 3UATA 3NTUA 2ZYUX 2YC2C 3M0EA 2P6RA 1GRQA 2VHCA 2XNDA 2A5FA 4BZPA 1XPOA 3VR2A 2VF7A 3U3OA 3KKOA 1JXMA 3VR4A 4PXAA 3QF4B 1NVWQ 1CJTC 3ZH9B 2JLSA 1OJLA 1G5RA 2IYZA 1E1RA 1Q44A 4XIGS 3ZD6A 3WYFA 1AS3A 3VKGA 4B2IA 2IS1A 1E4YA 3HDTA 2O8FA 1ZM7A 5FTJA 2O8DA 2V7QD 2W6JD 2CDNA 1F2UA 2OO7A 3CW2A 1XXHA 3NHBA 5KPJA 3SQXA 1EXMA 5EE5B 4ERNA 1TEXA 1YR8A 3B6EA 4LHXA 3FKQA 4BEBA 2IWHA 3BS4A 4G5GA 5AUOB 1KMQA 1QBKC 5FR1A 3R8FA 1GSIA 4OI0A 2CEAA 1CJKC 4AYXA 4BZXA 3CF6R 4QHTA 2IS2A 2ZE5A 3DHWC 4D26A 4TYPA 3TMKA 2FSIA 4JVSB 3ICQB 1OPXA 1AA9A 4JBWA 5KSYA 1HH4A 3CF0A 5CK5A 3SYNA 2NMVA 3HPRA 4PSAA 3GFTA 4WZ6A 1GL7A 1X86B 4Q4JB 4C3ZA 2Z0MA 4WOPA 2FMXA 1DBSA 1QRAA 3P4XA 3QXSA 4HSEA 1WQ1R 1IN6A 3DOEA 3T34A 3H2YA 3SOPA 4PAQA 3OE7A 2W2XA 5DE3A 2VP0A 2WPDD 2DBYA 3B1VA 1EFRD 4FINA 3AF0A 5H1YA 1ESMA 3TW8B 3WYGA 3S1AA 1QDEA 2VP6A 5KOYA 1ZU5A 2Z4SA 1RKBA 2JDIA 4F93B 2NZ8A 3TSWA 1Z5ZA 3FVQA 5AUQA 4C30A 4MRPA 4BPBA 1Z0KA 4OQFA 5DHAA 3HU1A 4HEJA 4IFBA 2VHQA 3QG1A 1CR0A 4GFDA 4ITRC 2ODWA 2AR7A 4BUJA 5HCNA 1RZ3A 1E2IA 2QP9X 5AJWA 4BECA 5KU1A 2O5VA 2JAQA 1Q1QA 3UMSA 1BMFD 1CU1A 2PZGA 1E9AA 1KSHA 2C8VA 1ZNZA 3CF2A 3WNDA 1ZM9A 2ODBA 3MJRA 2RGEA 2ZJYA 4ZPXA 2QP3A 4XWOA 2V7QA 3NC0C 2W6JA 4Q1CA 2GJAA 4QGGA 1W4BA 1GILA 2BEJA 1I4DD 3DPUA 5FL3A 3K70B 4NYIR 1JEDA 4UXHA 3VFDA 3RC3A 1OH6A 3AVOA 5G40A 4WVFA 2UVQA 3CIOA 1JQJC 4JKIA 2WBLC 4EIWA 4AY2A 2OCYC 5FUVA 3X1XA 2ZU6A 3DDCA 4TMWA 1SVIA 3CX7A 1JR3E 5EE0A 3GLFB 1S9DA 3KKPA 2HT6A 4UNPA 4HUQB 4IXNA 1DG3A 3IQWA 5P21A 1W36D 1K8RA 2GA8A 4DDWA 1VG8A 2RKOA 4HDOB 4M1WA 4M1SA 5KO2A 5C1BA 4NYIQ 3ICEA 4Q1DA 2ZIAA 4HB2A 4MKIA 5DYIA 2B8TA 2WPDA 3K8YA 5BXQC 3GJ6A 2VSOA 1GKYA 1BIFA 3MSXA 5L3VA 4DCSA 4PO9A 4ZKDA 1M2OB 4JVNA 3NG1A 3BORA 3QEOA 4B43A 4EQ6B 3QXJA 1NVVR 3R20A 2ZSDA 2ZI3A 1VCMA 4PANA 3H0KA 1RVDA 2IUTA 3P32A 3W3AA 4CEIA 5DI9A 1KI8A 4PAMA 1T0HB 2WTUA 4TMZA 4WA7A 4QNRA 2IBMA 4UNRA 4QHYA 3QKSB 1P72A 3HR7A 4TSFD 4OJKA 3K0FB 3L0OA 1JAHA 2PBRA 3AKYA 1F5NA 1P2TA 1TADA 3A1TA 3T1QA 3U44A 4Q66C 5F9FA 1LY1A 1NLYA 2WWIA 3Q5EA 5BYJA 3BH6A 3PUWA 1TL7C 4JSTA 4M8NE 4MGKR 5GJWC 3RAPR 5K8IA 2J0UA 4LYJA 4W5WA 4XWKA 2R9VA 1KDPA 3AUYA 4CEJB 2PL3A 2N1BA 1KK1A 4LPSA 2IYTA 4KLZA 2AXPA 1SVKA 2ZRJA 3GLIB 3U60B 1RC8A 2C9CA 2DFTA 3RWMB 2WIAA 4Q9KA 1MH1A 1NKSA 3U61B 2DHRA 4NCJA 1YR6A 3U7FB 1XEXA 2EWWA 3GEHA 5KDLA 3OESA 4PAOA 1GNQA 2ZTSA 2OG2A 2V8OA 3MRSA 2B7CA 3ECCA 4DC9A 4AYWA 3ND9A 5ANRB 1TF7A 3E2IA 1XMJA 4PX9A 3B78A 3REGA 1LNZA 2QA5A 4NTZA 2X2EA 1XTSA 3LVRE 5CDFE 4LYFA 4OKSA 3B13B 4ZIRA 2WOJA 4OI2A 2UZIR 1FX0B 3A37A 4BFSA 5H70A 4R98A 4XOIA 1OHHD 1XRJA 3KQKA 3IILA 2R65A 3GEIA 4OQLA 5TB5A 2F1HA 1GNRA 3AGPA 1E2JA 2PEYA 3W9YA 1Z29A 2GJSA 4IHQA 2C9YA 3TAHA 4ARZB 3WHKA 3ZQ6A 1FL9A 4TLEA 3C4JA 2GK6A 2I4IA 3U6KA 1N3BA 3DZDA 1Q12A 5K8UA 4TSFA 2F9LA 3EAQA 4IOKA 3RWOA 1PVOA 2ZJOA 3F5FA 4B2LA 4Q4LA 1NLFA 4KAXA 1WDTA 3MAAC 4EPXA 1E9BA 3KXLA 1OH8A 4L5BA 2FEOA 4Y0VA 3SFZA 3FHCB 1XB2A 1ZIPA 2RGNA 4D4JA 3R9WA 2JJ1D 221PA 3EZFA 2GJ8A 5KNDA 1CKEA 421PA 2EFDB 1WMSA 4H1UA 1IY0A 4CT5A 3L2OB 3ETLA 4QJ3A 5FL7D 4QFMA 2G0TA 5J4VA 2CMKA 3OEHD 3V9PA 5JCZA 1G6OA 3R7WB 1KK0A 2ZANA 4UJ5A 1OF1A 3I8SA 2P5SA 3IPXA 5FPHA 1PLLA 1NY6A 5CB6A 2HXSA 3SU8A 3GLGB 1YKSA 1S2MA 2E9SA 2VP5A 1NMYA 5L8VA 3K0CA 2KSQA 1IN5A 3CRW1 4A9AA 4ASUD 4Q03A 1OW3B 4B74A 3FMIA 1KDOA 2LWIA 2YVUA 3FHOA 2BJWA 4JL8A 2E1RA 1T3LA 1GFIA 4LJ5A 1AM4D 5EZ5A 2J87A 4IEEA 2ATVA 5GJBA 4JT4A 3G0HA 1CLUA 1KSJA 1TQDA 1OXTA 4Q9HA 1LB1B 1ZUNB 2QN6A 4KVAA 3IO3A 4E03A 1VYUA 5JI3E 2O8FB 1SVWA 2IYUA 1OHHA 2IHBA 2J0QA 2AX4A 1QG2A 2Q3HA 4NYMR 1XXHB 2FOLA 3LRPA 4JLPA 3BFXA 4OQNA 2WSSD 4KHZA 2PZEA 5FBRB 3WNBA 4MA4A 5DHFA 5HZHA 5FOUA 1E9CA 2B6HA 4RZXA 3LLMA 2IWRA 1E9DA 1N6IA 1AQUA 1ZD9A 3AF3A 5KTYA 1A4RA 4PZLA 4BFYA 1N6HA 1G19A 4F7WA 1XWIA 2VEDA 1R4AA 2WV9A 4M0LA 4JSYA 4TQ9A 1ZNWA 2GTPA 3UMRA 1LF5A 2C77A 3BH0A 4KVGA 1F2TA 3CWQA 1ZJ6A 5JHGB 2LKCA 3LBIA 4M2LA 1Q3HA 1EFCA 4LX0A 4V03A 5FL7A 1Z0DA 1ZRHA 1Z0FA 3OEHA 3T35A 4LHYA 3SNHA 3AVXA 1SKYB 3ZGXA 1U81A 2H16A 3A1UA 3TUJC 1KY2A 3PUYA 4DSOA 5KSOA 2CJWB 4M53A 2IYQA 2BCGY 3SDZA 5JCPA 2P3SA 5TDHA 2ANCA 3GLHE 4DLTA 4RZ3A 2WM9B 4Q9JA 1UKVY 2B8WA 4FW9A 4ASUA 1HQCA 2JLRA 4YDSA 1M34E 1P6XA 4ZDIA 2J45A 3X1YA 4L16A 1TQ4A 1YZNA 2ZRBA 5E7JA 3NDBB 4JLJA 3AP2A 3ZDQA 1VCNA 2PX3A 4A0RA 1OLOA 3A58B 5JEEA 1ZM4A 3VHXA 3NBXX 2J0VA 2P0EA 4HZIA 1CF4A 5CM9C 2A9KA 4TT3A 4B3CA 3PEUA 1Z6AA 4OYHA 2ZRPA 1E2HA 2O52A 2VYFA 1FMJA 1D8TA 2R62A 4D4KA 2ATXA 2NGRA 3ZZ0A 1UDWA 3QKRB 3ZIAD 1MRSA 1W1WA 2FEMA 4NP6A 3Q3JB 3CWZA 4G1UC 1E9SA 4KXFB 4N3NA 3W6OA 1Y63A 2QT0A 2XZLA 3V4RA 2FX3A 2H18A 4B33A 5GVRA 4LUCA 1G8PA 1RFLA 3EZ6A 1Q57A 4PO1A 1JPNA 2A3RA 1UF9A 2OV2A 1R8QA 1P61B 1U8ZA 2IYWA 1U98A 2VBCA 3CM0A 2G3YA 1AK2A 2VP2A 2H5EA 1SGWA 5DISB 2GVZC 2GVDC 5FOTA 1Q0UA 3C8UA 4P32A 3OHMA 4KITB 4G5QA 3CKLA 2RGXA 1NBMD 4YQFA 1XPRA 2X2FA 1KO7A 2JA1A 3REFA 2BC9A 3LQQA 3R8CA 4AC9A 3NXSA 1P73A 4BFVA 3NH6A 1AN0A 2YNMA 2WSMA 2DY1A 1XMSA 4PPQA 5K8TA 3BBPA 2JEOA 4PPNA 4NCIA 1KYIA 2F1JA 4KU4A 4DIDA 5H8WA 2IK8A 2BMEA 1EFHA 5E3HA 1G3RA 4PFSA 4MYUA 5C4GB 4CEIB 2GJ9A 4JJKA 2A7QA 3IO5A 4ZDJA 2OSBA 3FB4A 3FKSD 4Q1BA 4ZI3A 1RRGA 1MOZA 4IVPA 3UPUA 2PEZA 1IXRC 1CXZA 1LTQA 3VX3A 1W5SA 1XTQA 2JIZD 2O0JA 5UKDA 3EIEA 4GP7A 4K46A 5HKKD 1I2MA 2W6IA 1AS0A 2ZRAA 3U44B 3CH4B 1IOZA 1E9FA 4Q7KA 3ZD7A 5IT5A 2G77B 3SJAA 3WMGA 2HEIA 3KDSE 2VHTA 4NZYA 1WF3A 1QHSA 4C0JA 4X8OA 3I61A 3BK7A 1Q1BA 2F1IA 1OV4A 1I4TD 2VTKA 2GZHA 4QBHA 2ZS7A 5FI1B 5KPDA 3EG5A 2AHOA 1OH7A 4X8HA 3W6PA 2GWHA 2CVHA 3IIMA 3BE4A 5FPTA 5JI2E 3CPEA 4MKGA 2RGNC 4L9WA 4DCTA 1A1VA 5KNBA 1M7BA 2QMEA 2C95A 2QQ0A 2WMNB 3DM5A 5EXSA 4L9SA 3TSZA 1P5ZB 2FU5C 4IEIA 4TLCA 3GP8A 2D62A 1R6BX 4OHVA 2GKSA 2J41A 3DEFA 1KAOA 1GITA 4FCVA 1OB2A 4C4PA 5GVSA 3AP3A 4US2R 1NBMA 3ASZA 4P4SB 121PA 1W36B 1FQJA 2BCJQ 2IHYA 2WWWA 4XH9B 3K0CC 4B73A 2PH1A 1DE0A 2IA5A 1IBRA 4RCYA 3TVTA 3GJ3A 1KI4A 2J59A 5FH9A 4KLNA 3K9NA 3KUCA 3X1ZA 4MRVA 1GUAA 1NN0A 3X1WA 1OSNA 2PT5A 2P67A 2QEQA 3QOFA 1M74A 3OIYA 3C14C 4GOKA 2ZRKA 3TUIC 2I1VB 1KNQA 3PCRB 2FDCA 2VA8A 5DGXA 1IONA 1TU3A 2JLQA 4LJ8A 4F92B 2AWOA 2FGKA 1QVAA 5FBQB 4ZCMA 2MSEB 2XB4A 3D3QA 1J90A 5LPNA 3C5HA 2JIZA 2ASEA 1VYVA 2Z43A 5HKKA 5CJ2A 2Q9CA 3CUEF 4RFSA 1BO6A 3KJHA 1YU9A 3NBYC 3RS4A 2VHUA 3PG5A 1TF5A 4LSGA 3EX7C 3U4QA 3T1OA 5LDDC 1CS4C 4BZQA 3UIEA 5GJVC 1E2MA 5JBQA 2WKPA 4TTRA 1HQYE 1MABA 2ZR9A 4TLBA 4JLVA 2YC4C 1E9EA 4LBWA 4YLGA 3ZVNA 3CRVA 3PV0A 2IW3A 4A0HA 2OESA 5IRCD 2WIBA 2O8EA 4BLOA 3AF4A 2IEYA 1L2TA 2REXB 1GL9B 4MKHA 1G9XA 4RD4A 2J9RA 1ZU4A 3P4YA 3KTAA 2XSZA 1ESNA 4FWIB 1E6CA 2FPKA 2YINC 1Z3IX 5J47A 2XNDD 3W90A 2C78A 2HF9A 2OM2A 2JATA 2O0HA 1V5WA 4IDQA 1E2KA 5L3QB 4R71A 3K9GA 1KDTA 4IDNA 1A2BA 3NBFA 3AKEA 1II8B 1CR4A 1P60A 3QE0A 1E1RD 4QC2A 1OIXA 1T91A 4RD0A 1C1YA 4O0MA 4FI3C 2KB0A 5BQ5A 4ILEA 2OBMA 5AJXA 4OK6A 1AQYA 3KXKA 1FP6A 4B6EA 2ZAOA 1MR3F 1H65A 4W7SA 5EXTA 4F4IA 1ZVQA 4RSGA 2JASA 2XX3A 4PSVA 2GF9A 2N42A 3NIBA 1OT3A 1YZQA 4A2PA 4OBEA 4NH0A 2DB3A 4B44A 3X1DA 2P6UA 2ZUDA 1U2RA 4C7OA 4HLUA 1W4AA 1OXUA 1CR2A 4URVR 2BWJA 1LV7A 1P4SA 3U3JA 4E5UA 4AYTA 3A4LA 3W5JA 4DVGA 3MMPA 4JYBA 3AP1A 4MITA 2D74A 3W8RA 4LCBA 1F2TB 2X19A 3VR6A 3NHAA 3I5XA 2GCPA 2BKUA 3Q72A 3AQ4A 4QNMA 1C9KA 2BIFA 2P2LA 2VPPA 3LX8A 3WHLA 4W9MC 1XZPA 1XEWX 4PC3A 4JMPA 1QF9A 4EFMA 1QHHA 3L0IB 3B9QA 4MQBA 1KI1A 3WRYC 1BS1A 3O8BA 4Q9LA 4HZUA 3CBQA 2CCKA 4KYUA 1P2UA 1QHIA 1YZUA 3UG6A 1W0KA 3B1ZA 3QVVA 2F1RA 1SXJD 2VQSA 1XBTA 2QPOA 2W2VA 4PPGA 3ZS8A 3BAFA 1Q21A 3M6AA 2AKAB 3LV8A 4Q4AA 4M1MA 3EPLA 4GT1A 1TU4A 2HXYA 4MH0R 1HT1E 3DL0A 1VPLA 4D82A 2DFNA 1XCPA 1XD2A 4RZ2A 3X2SA 1RRCA 4BLPA 1E0KA 2CL0X 2X8AA 1QHYA 4DCVA 3GJ7A 1IN7A 4JKYA 3WNCA 4DDTA 3A1WA 5CLQA 2REOA 4HDQB 5C2JB 5J4KA 3THYA 3RS5A 3TGPA 3M1IA 1JR3D 1X6VA 4GZLA 2D7CA 2ZR0A 1GKIA 1IXZA 2ZROA 3BFVA 1DARA 1SZPA 4K81B 2XITA 1IY2A 1KMHA 3QY0A 5AWFC 3ADBA 2QM7A 2HCBA 4JLDA 2NPIA 4YXWD 4LBZA 1M7GA 1W47A 1DVRA 5EE3A 2GAOA 1EWRA 5FPSA 3SBEA 2Q9BA 4BLQA 3GFPA 2IX3A 2ZE6A 4U02A 5HTKA 4Q1AA 1KO4A 2G1KA 4HAWA 1CR1A 1OFIA 4LC1A 2DFLA 1KO8A 4CF7A 4N0DA 1XNJA 1XTRA 3QKUA 2C5LA 4B3FX 2N46A 1NG9A 2XXAA 2PMDA 2AKYA 1EFUA 2W83A 3FPAA 4KSBA 3K9LA 2GZAA 4TL8A 2P6NA 4A8JA 5CIQA 4MGYR 5FPKA 1UADA 4HI0E 3FGNA 4AK9A 3MLEA 2CLSA 1PUIA 4GL2A 4KO8A 1XPUA 2YYZA 4Q48A 1COWD 2H17A 3A1VA 4POAA 4PR0A 1UKEA 1EX6A 2JJ8A 5EE9A 3D7MA 3VR1A 2Q6TA 2OILA 4W5JA 4QJ5A 1SXJA 2XNSA 3K0AA 1XFAA 2G9NA 5F9HA 3FMOB 4YC7A 3CONA 1J70A 2EYUA 2QBYB 2O8CA 1G5TA 1NVXQ 2IYVA 1N2CE 1U99A 4HAXA 3HYRA 1OYYA 3AUXA 4KBFA 1ZC3A 3PFIA 2OXCA 3QEJA 5FTLA 5E4FA 1X1SA 2RAPA 1XTKA 2F43A 3VAAA 1G21E 3IQXA 2XEXA 2C98A 1SXJE 5JHHB 4RKEA 5DLQC 5FFMA 1UFQA 3RYTC 1JR3A 3SFVA 4BRWA 5EJEA 2JLVA 3PQCA 1ELOA 1E2GA 1MO6A 3UMFA 1HURA 1RYHA 4DDUA 1CP2A 3U3MA 4DSNA 2QENA 1NSTA 4O25A 4QBGB 2AXNA 5KUTA 4Q19A 1TF2A 4YXWA 2QP4A 4BFUA 1UBGA 1VDZA 2D4HA 3K9HA 3KKNA 3L8ZA 1AIPA 3PVSA 4B2PA 1W44A 3KKQA 2Z83A 5KSPA 1IJFA 2Q3MA 1A2KC 3GFOA 4LJ7A 4KBGA 4E22A 1EFTA 4NYJR 5DI3B 3SEAA 4IJMA 5JMTA 2EU8A 2HYDA 1WXQA 4XSHA 4JLBA 3BC1A 4DLRA 1KOFA 4R9UC 2O8BA 2HJGA 4I81A 3SZRA 3ZS9A 4NU0A 4N0EA 2VP4A 4GSYA 4B34A 4NCHA 5FUWA 3OIUA 4GMXA 2UZ3A 1COWA 2E87A 3MFYA 2NQ2C 3CH5A 1Z28A 1JJVA 4M1OA 2CHGA 2HCJB 2IYYA 5D3MA 1VG0B 3W8NA 4JZKA 1G18A 1E3MA 4FMDB 3CR7A 3W6NA 5LB2A 4B3XA 3PJRA 2ZRIA 4NL4H 3A1SA 1OFHA 3RABA 1N5KA 2IXFA 2G88A 3MWKA 2ODNA 2IF0A 5G41A 1NMXA 1DAKA 4V0MA 1SHKA 2I3BA 2RGDA 4JLNA 1QG4A 3AF2A 2FG5A 1Z6GA 4WXRA 4EPVA 4M9ZA 4NMMA 2REBA 2HYIC 1U8AA 4OQMA 3U4QB 4GZMA 2V9PA 4OHYA 3PIRA 1HE1C 1X1RA 1L4YA 3JZAA 4CT4B 4M9SA 1T0JB 4HLUC 1E9RA 1NIPA 6Q21A 5AJVB 2FSHA 4I1OA 1OKKA 3CRMA 1XZQA 1NVVQ 1R0ZA 1Z8FA 1U0HC 4DLWA 4LGMA 3WP0A 4XVRA 4V0ME 5E95A 2OCPA 2XJ4A 4B75A 4DLYA 1N6RA 1Z2CA 5D3QA 1E2PA 5B58C 4HAYA 3U7GA 1XJQA 5CDFA 3KQNA 1W4CA 3G5UA 4UQOA 1JECA 3BB3A 4LHWA 1DOAA 1US8A 5KHOC 1E99A 1NN3A 2GJKA 2XTZA 3UWOA 3THWA 1ZCAA 4R2IA 3QPUA 1HTWA 1GNPA 2PCJA 521PA 4U5XA 2EYQA 3PUXA 4M4SA 4QGAA 1N6PA 3CZQA 1NN1A 4DXAA 1UBFA 4MGZR 2GESA 2G6BA 3BH7A 3QNUA 3JVUA 2CCGA 2F55A 1AGPA 2D06A 4A15A 4HB3A 4FMBB 2BOVA 2ZI9A 4CEHA 2PJRA 2GXQA 1VTKA 1W0JA 5TARA 1JQLB 2H1LA 2VHJA 4Q1EA 3E1SA 4P4TA 2FFHA 5F2EA 4A92A 1NNEA 4TN1A 2QPTA 1NL3A 3Q9LA 5LD2C 3DM9B 4JIMA 3KJGA 1TTTA 3T1TA 1NRJB 3B1YA 5CIWA 1R0WA 3LFUA 4FMCB 4HAUA 4BLSA 4AG5A 1YJ5A 1Z47A 1YR7A 4ACAA 1XU4A 1OXVA 4LJ6A 5HR5A 4LWZA 3AVVA 1QHGA 2QG6A 3F3YA 2OAQ1 4UNQA 1TEVA 2AD1A 1HUQA 2YWHA 2ZSEA 1VIAA 1ETUA 4PHFA 1FFHA 4URUR 1GDDA 2HV8A 2C04A 5AUNB 4Q00A 2G1JA 4QRHA 4TYNA 3VNUA 2QGZA 1E4VA 5HPYB 4TLAA 3EZ2A 3LO5A 1G3QA 4DB2A 2YOHA 4M1TA 3C41J 3BOSA 2DWQA 1JNYA 4CW7A 1KJWA 2WHXA 1XTIA 3Q7QA 4C0BA 2GCOA 1NKTA 3NEJA 5B30A 4EJSC 2D2FA 4OL0A 1KZGB 3QSYA 1J8MF 2ZRGA 4A8JC 4D25A 3IGFA 621PA 1XJCA 2FJUA 3P1JA 4XTCS 2ZYVX 2G83A 3U7EB 3WBKA 3UG7A 5FTKA 5CYPA 3HYTA 5BN4A 2AK3A 4TWZA 2BBTA 4MYTA 5JRZA 2GCNA 4A2WA 5H68A 4TT3D 4IKEA 2XTMA 1SXJC 4Z51A 2VRWA 5J4HA 1W49A 3THXA 1LS1A 2OLKA 2GDJA 4MUBA 4XWAA 4ZKEA 1DADA 3N2EA 4M9XA 5AR1A 2O8DB 4DRZA 1KK3A 4PC6A 4TTQA 1KJZA 5A5GA 1F2UB 2VP9A 1WCV1 1O87A 4HAVA 1JI0A 1EK0A 1KSFX 3PXGA 4NE2A 2AN9A 1N6NA 2RH5A 3FOZA 4LK2A 2FV8A 1YZKA 3ADKA 3EC2A 1CJUC 3PUVA 4N1AA 3VKWA 1XMIA 3BIFA 2CLDX 2ZI4A 4WAUA 5C46F 4O2RA 3ADCA 3LVQE 5JRJA 4TYQA 2ZEJA 5J5CA 2R6FA 3WRXC 2LKDA 1PLKA 4I99A 2IXEA 4LDJA 1ZC4A 3GLHA 2CVFA 2WVJA 3FWYA 3J81k 2QAJA 2DR3A 4YMVA 2FZ4A 3L8YA 3KJEA 2ZJ2A 3UWKA 2XXAB 4TQUS 4RKFA 4NYMQ 4RD6A 3PUZA 1TX4B 3FE2A 4LRWA 4L15A 4RZUA 1FNMA 3W3ZB 4DT1A 1MO3A 1P9WA 3QQ5A 1QHNA 1NP6A 2Q21A 4NCNA 3TQFA 1VECA 1J8YF 3S1AB 1XD8A 1GKUB 1WA5A 2WJYA 3DKPA 4LBYA 3HJNA 3TVDA 3ZVLA 2CL6X 3GJ0A 4F4CA 3B8HA 3OIVA 2R6DA 5TV2A 3QF7A 4Q1FA 1P2SA 1XF9A 3NWJA 5EE1A 4BFXA 1BH2A 2WAXA 4BFZA 1GVNB 5IHPA 1ZP6A 4LC0A 4DCUA 2WWYA 1UAAA 2CLCX 2QQEA 1Z0AA 3VHLB 1IJEA 2WZQA 2W58A 3U3RA 3T12A 2GILA 3B85A 4WW0A 4BWYA 1IQPA 1KAGA 4WIAA 1AGRA 1AZSC 2F43B 2W6ID 2YOFA 1DAGA 1H8HD 2R6AA 5J4LA 3LBNA 3NH9A 1NJFA 4ZV4A 5C18A 1EESA 4URZR 1G1MA 4QXAA 4UJ3A 4KFRA 5JZVA 3F8TA 4PQYA 5FTMA 4ESVA 2YV5A 2KWIA 1H8EA 1E2QA 4TL9A 4TZ6A 3T5GA 3CRQA 5BN5A 4TTPA 1Q22A 2TMKA 3NEYA 1G6HA 4LPKA 3QF4A 8OHMA 3KX2A 3B82A 1N5LA 2DCUA 3D6TB 1A5TA 2XAUA 4IFEA 2CE7A 3H1TA 1N25A 4BQSA 3FMFA 2WAYA 4MRRA 4OQXA 1V43A 4BEJA 2ZSBA 4OHXA 1G3IA 3B7GA 5FOXA 1F6BA 2D7DA 3H4MA 3ZLJA 3Q7PA 4XD7D 1N6LA 1SVOA 1DG1G 5JLJA 4Q9IA 4KFUA 4PSKA 5E7IA 3KJIA 1AKYA 1KK2A 3BWDD 4GOJA 2JLZA 4E07A 2A2ZA 1JAIA 2GBLC 1U9IA 4TLDA 1E1QD 2ORVA 1NJGA 2VSFA 1E0SA 2QTFA 5JSZA 1XP8A 2EFEB 1KO5A 5FTNA 4DSUA 3KQLA 3OEED 1OB5A 2ZRLA 3OZXA 4KSCA 3IBGA 1Q20A 2OXRA 2ZRMA 3OF5A 4GDFA 1LF0A 2ZVPX 3MCAA 1FTNA 1T4GA 3GJXC 4HAZA 3LH5A 3LXRA 4GMDA 2XZPA 1R0XA 5TXGA 4HATA 1E0JA 4QHSA 4Q4JA 1HT2E 4B48A 1U8YA 4LYHA 3TBKA 4OJQA 1FP7A 4B3DA 4C9BA 1KY3A 1QVRA 2FSFA 1H8HA 1GG2A 2A5GA 1S1MA 1IY1A 2ANBA 3PENA 2EFGA 3QI2A 2WJIA 4EPYA 1GM5A 1Q1EA 3ZYCA 3TK1A 2IUSA 1WP9A 4KODA 4Q4HA 5DO9A 3TLXA 1DAMA 3E5HA 2H57A 2J0UB 3MGCA 2ZXUA 1UJ2A 4EKDA 4JLAA 2MMGA 4LJAA 2QMUA 2YWEA 4DUGD 4DWJA 3TAUA 4QL3A 4TL7A 4D0GA 3RVBA 5FBVB 5J40A 1CIPA 4EFNA 4LZZA 1KI7A 3CO5A 3ADDA 3DMDA 3I8XA 4QJ4A 4YDHB 3KQHA 3W34A 3FHTA 1XEXB 1T3SA 4GRAA 4A82A 3THWB 3B5JA 4JL5A 2Q3FA 4EPWA 2NO6A 2XSZD 3QIAA 1IM2A 4XJXA 4DLXA 3LY5A 4XD7A 3RRYA 2QY9A 4LOAA 1WBDA 4FD2A 1Y3AA 1VIYA 2PX0A 3IUYA 2RGGA 2ZE8A 4ZIRB 1G7SA 4W5HA 2BBWA 1E1QA 1W4RA 3DVLA 4CEHB 3THOA 2K5UA 1UKYA 2Z4RA 3OEEA 3M4YA 4Q7JB 2QNRA 5CLLA 4LV5B 1KNXA 4V0NA 1NMZA 1WB9A 2R44A 3GLFA 1L8QA 2D3WA 2IEZA 3EA5A 1W7AA 2VLIA 3BXZA 5EZ6B 3CX6A 3FFBA 3LW8A 1UEIA 2Z6VA 4Z8XA 4LYAA 4PO8A 2DYKA 4DEXA 1XJ0A 2V6IA 1ZBDA 3KQUA 4AG6A 4HB4A 1IXSB 4LHZA 2EW1A 2OBLA 2A78A 3UANA 4U7DA 2FPLA 4Q01A 1GZSA 5SZHB 1PV4A 3IIKA 1ZM2A 3GLFE 4IVQA 3GPLA 2L0XA 1E96A 1LFDB 2QRNA 3H84A 2F3TA 3IKJA 4TMVA 4US1R 2WWHA 4V0LA 3TQCA 4LJ4A 4F38A 4DUGA 2IF2A 2PLFA 3SHFA 1G41A 1G4UR 1D5CA 2QMOA 5JWOA 2ECKA 3QKSA 1E2EA 2H8KA 4UXJA 1G20E 3QUSA 1OYWA 3K0FA 4CGZA 2ORWA 2W2TA 2A5JA 4B3BA 1G3UA 3NDPA 4Q18A 5M04A 1AZTA 2QAGC 1S3GA 3RHFA 3GJ5A 3QPVA 1KI6A 5HCIA 2ZRNA 1W0KD 4DEYA 3WBJA 4PHHA 3AKCA 1E98A 3K1JA 2F3RA 3KB2A 3A4MA 3SJCA 3DZ8A 1CJMA 2W0SA 2XTNA 1PLJA 4CEJA 1O3YA 2ZYWX 4LHVA 3ZVRA 1JR6A 1OH5A 3L82B 3EASA 2GXAA 2IUUA 2FA9A 1M1YE 1YE8A 4O2LA 1PZNA 1P9NA 3AV0B 1P7CA 1ZIOA 2ERXA 2ZREA 4MDEA 2QSZA 1LS6A 4G3XA 3CR8A 1T8UA 2GEVA 5BW8A 1OXXK 5TVKA 2FFBA 2NO1A 1MO4A 4JBXA 4RVCA 1KI9A 1XCMA 4GOXA 3RS0A 4JVLA 4IRUB 3TNFA 1OFTA 2OFWA 3SJZA 2XB2A 1RRPA 3EIQA 4P4UA 4B35A 1K5GA 3QPWA 3GLIE 1C4OA 3AKDA 2P5TB 2QSYA 4C0KA 2B21A 4XVUA 4I1VA 4Q47A 1FX0A 3GLHB 3A36A 3MWYW 1EX7A 5TY0A 3P20A 2V54A 1Z06A 3LX5A 3TJZA 2QT1A 5A4JA 3RNLA 4EPTA 4ZI2A 1G5PA 3CNNA 4AURA 3K0SA 3AGQA 3AM1A 4ARZA 1S96A 1YZTA 1Z63A 1W5TA 4BASA 2RHMA 3T06B 4CIDA 2OUKA 2IC5A 2NOAA 2OCBA 4GPTA 4IOLA 5FOVA 4OHWA 2QUZA 3QXCA 4C2TA 4UXIA 1WRBA 1KI2A 3VX4A 4MGIR 2D2EA 2ZETA 1N5JA 2RGCA 5JWHA 3KKMA 3MD0A 3T61A 4Z54A 2J3EA 4OK5A 4C0LA 2NO7A 2AFIE 1U9IC 3EPHA 2HLDD 2HUPA 4LY6A 5FR2A 4Y0AA 1KDRA 3EXAA 1KI3A 1N0UA 1ZUHA 2IS4A 4US0R 1II0A 3R7WA 2GAAA 2NO9A 2RMKA 1NIJA 1R5NA 1DO0A 2VO1A 4D6PA 4CDGA 2OEPA 1YR9A 3I4LA 4D2IA 2JLWA 2JLXA 5DN6D 2WICA 1GAJA 3HU3A 1YQTA 2I1QA 2KE5A 1FW6A 1P75A 1ZM3A 2FFQA 4A2QA 3LW7A 2JGNA 1MRNA 1Q3TA 2QZ4A 1EWQA 1N6OA 2QGNA 3EWSA 1YRBA 1RYFA 2MSDB 3SC3A 4YMSA 2FF7A 2OCAA 4D0LB 3ZVMA 1MV5A 4AKGA 1PJRA 2ZI6A 4A6PA 2IS6A 5EQTA 4B71A 1G8GA 3GLGE 3CNOA 4EFLA 1R8SA 721PA 3KZ1E 4I4LA 3VU9A 3Q85A 3Q8XB 1U0LA 4PZZA 2FE4A 3ZQJA 3L0SA 4P0TA 3ASYA 2YHSA 2GNOA 1RIFA 2GETA 5FOSA 5DSZA 3KFXA 4ZDKA 3SJBA 4EJSA 4URXR 4IW3B 3V4FA 1D2EA 1XTJA 2ZS9A 3HP1A 5B2ZA 2YOGA 1KJYA 3RS3A 2X77A 2CL7X 1P62B 5JSZB 4IXMA 1Z6XA 1E79D 1J2JA 1TUEA 3K70C 2F6RA 4TYWA 1E94E 1XXHE 2XJ9A 2J46A 4ZCLA 4JLKA 3CNLA 1VCIA 5CM8B 3GQBA 2Y8EA 4P31A 2GXUA 2HLDA 4EDHA 2W0MA 3RRMA 4UNNA 2ZJ5A 1WE2A 1W2GA 4RD1A 2ZRFA 4Z8YA 3TIFA 1SVMA 5G3ZA 2CJWA 3EA0A 1TAGA 1UM8A 3DKVA 5KDDA 2OBNA 2X1VA 3A6PC 1P3JA 4Q4HB 5EP1A 5DN6A 4ABYA 2H7VA 1FPMA 2ZJAA 2ZVQX 2C99A 3RRZA 3IBYA 3BERA 3WMFA 4QM6A 2QL6A 4RCZA 1OKKD 3QENA 1SKYE 3I3SR 1CBUA 1E2LA 3GEEA 3O8DA 1J99A 1R10A 1W48A 1NY5A 2BJVA 1VCOA 1Z07A 5EP4A 1HEIA 3GJ4A 5GADl 4C0SA 1YVDA 2ZYTX 1T6NA 4Q7LA 5JFGA 4KV9A 1GWNA 2FNAA 3QKRA 3UKDA 5F98A 1AS2A 3KB1A 3N5CA 3CB4A 2CBZA 2ZI5A 2ZJZA 4R7ZA 5LBIA 2GF0A 3QXHA 3VR3A 1DO2A 1UKZA 1GRRA 5LB4A 5HZKA 3U7HB 4FMDF 2KBFA 3A4NA 3QKTA 3TUZC 4G5OA 2QRZA 2J7PD 1XMVA 3KL4A 4EPRA 1KIMA 4TYYA 1RJ9A 3GJ8A 3VNVA 2BDTA 1ZW6A 4QGHA 1JXOA 1E79A 4PTLA 1W0JD 4KFSA 1NLZA 4Z1MD 2OLJA 1OFUX 3QBVA 1G16A 3RDPA 2CHQA 1TNDA 1T5LA 1XX6A 1ZMXA 5EXXA 1Z6YA 1QHXA 2BM1A 2EVWX 2GXSA 4A4DA 4AI6A 4NYJQ 5JS8A 1BYUA 3MJHA 5CK4A 2B7BA 4MYHA 2WWGA 4BRUA 3LQRA 2WJGA 1CULC 3TSOA 1CTQA 4RFSB 3GCGA 3K09A 4WZBE 4C0QC 1EFRA 2ZS8A 4CVNA 2YJTD 1FQKA 1L7VC 3AB3A 1ONBA 1IHUA 3F0TA 2VIIA 2EFCB 1EGAA 2ONJA 3NVAA 1NVUQ 4IDHA 4FCWA 4BFTA 2YWFA 3SE0A 2CHVA 2ZRHA 2WJJA 2C03A 4I1UA 4MRSA 4URYR 4DLSA 5DNYB 3L0PA 5JS7A 1E32A 1MABB 1VHLA 2ERYA 2WWXA 4RD3A 3TE6A 3RS2A 4DDVA 2XZOA 3AF1A 3AVQA 4V0KA 1GP2A 1S4QA 2QI9C 2O8EB 3I73A 2FH5B 2R6CA 3IEUA 1BMFA 3OFND 1F48A 4S35A 3B1WA 3PEVA 1YZGA 2IL1A 1KI6B 3UK6A 3ZZTA 1G8FA 3KTAB 1NG1A 5FOWA 3MWJA 4TZ0A 2QTHA 2ZQ5A 1FTSA 1TUIA 2GBLA 3CZPA 4D4LA 4PQFA 5FPYA 1F3OA 1G291 2BEKA 3TH5A 2IT1A 2J7PA 5C4MA 4BLRA 4HLDA 3CLVA 2ZM5A 3AVTA 1LVGA 3NC1C 4DKXA 4F4JA 2AD5A 1EG7A 1KZ7B 2ZE7A 4ZDWA 4FMCF 4BLTA 2FPMA 1F60A 4AKHA 2ZUBA 5FBWB 5G53C 1UEJA 2R6GA 2IYSA 4B3GA 1XEWY 3FTQA 3TR0A 4Z1MA 3LLUA 1KHTA 2BHRA 2ZSFA 1T5IA 1FUUA 4L4UA 5AK0A 1E2NA 4QOSA 3PITA 3O8RA 3AVPA 1E2FA 1D2MA 4P4SA 1FUKA 2GEUA 2Q0HA 2GZDA 4NKRA 3SHWA 3V00A 2RGBA 1N0VC 4NHOA 1GL6A 1HY3A 1FMLA 2QU8A 2ZI7A 3LNCA 4C7OB 2J7KA 2IYRA 2P65A 1DAEA 4I1SA 4O3MA 2C2HA 3UXMA 4H9GA 3BFKA 2BBSA 2YKGA 3JZMA 1VG1A 1XCGB 2PMKA 1GOTA 1P2VA 1G17A 2KI5A 3EPJA 4FIDA 3KFVA 1R5OA 2PLRA 4QG7A 1A82A 5BWMA 3VKHA 4U00A 1XEFA 1NI3A 2QMHA 3JVVA 4LJYA 1D6JA 2C96A 2JCSA 2RCNA 3BB4A 3OIWA 4A6XA 3D31A 1ZCBA 2DFKB 4MUAA 2BBOA 1R0YA 1ZAKA 5KDOA 5K8LA 3EWAA 1QHHB 4RJLA 2ZUCA 2EQBA 3FDIA 2QORA 1E69A 1KO1A 3B60A 3LA6A 3OFNA 3HWSA 4HLQB 1TQ2A 2VL7A 4HZUB 1S3SA 5CYOA 5HE9A 2XGJA 5JJKA 3KXIA 1T3HA 2Q9AA 1DS6A 1J7KA 2JJ2D 3ND8A 1X8JA 1ZD1A 2FZLA 4E09A 4M1KA 3RLFA 4JL6A 3W5IA 3IHWA 4IOMA 4Q4AB 2G0NA 1G8YA 3WY9A 4X8LA 4NCKA 5LD2B 5HE8A 1GIAA 1M7HA 1XD2B 2OE2A 1M6NA 4GP6A 4JVMA 1DELA 4M22A 2OAP1 3U2QA 821PA 1AKEA 1M8PA 4GI7A 1KGDA 3KUDA 4YMUA 2ZJBA 3C7KA 4P3YA 3TKLA 3THYB 1CRPA 1FNNA 1N0WA 3SS8A 3EIHA 2FGJA 3L43A 3WMEA 3I62A 1S0UA 1TPZA 3TW4A 2YZ2A 1XD9A 3VQTA 3AEZA 2GRJA 4WBSA 5IF9A 1H8ED 1KMHB 1RW4A 2NTYC 1U94A 1VHTA 4HYYA 5L3QA 1G64A 4F91B 4AKIA 2FSGA 1DEKA 2KJQA 2CCJA 4G5RA 4B6FA 3I72A 4IVRA 1II8A 2FWRA 2DWPA 1TQ6A 1YRAA 3TRFA 2BMFA 3NKVA 1IAQA 4UKDA 2WOOA 2NZJA 3VU9B 4AIIA 4M1YA 5EP2A 2CK3D 5FI0B 1RPZA 3B1XA 4NONA 4Q7MB 2VF8A 3RRNA 3TR5A 2CE2X 3LDAA 4EJSB 4FXPA 4V02A 3T1VA 2QAGA 4A8JB 3Q5DA 1FOEB 1Z0IA 5DIFA 2VSXA 3LD9A 1JB1A 3O47A 5KNCA 2WKRA 3N70A 2HJVA 2IYLD 2ZU0C 5B57C 1R2QA 4M21A 3SYKA 4QBFA 2JJ2A 3PEWA 1VMAA 2F7SA 1SXJB 2JJ1A 3LBHA 4TQAA 3G82C 3K0AB 4AKEA 4OHZA 4XVQA 5L3SA 4IOJA 3A8TA 1X8KA 2AL7A 3BGWA 4LV8B 3SN6A 3NBZC 4WXPA 1R7RA 2O8CB 1JJ7A 4OI1A 1G8HA 4A36A 4Q21A 4CRWB 3R9XA 4ON9A 4RFVA 5FBLB 5G3YA 4CZ2A 1SKQA 2V4ZA 3GMTA 1Z0JA 1D2NA 1JEEA 4LJ9A 1E0AA 4FWTA 2Z5FA 4BGDA 2QPAA 3SQWA 1CEEA 3H86A 3SYLA 3BD9A 1T8TA 3K09C 4P33A 1Q1ZA 4J0QA 4ZCIA 2A30A 4Q02A 5IDVA 4PHGA 3HR8A 1TMKA 5FUYA 3EW9A 1IN4A 1MT0A 3DOFA 3WP1B 2RGAA 2AK2A 2MMCA 2PZFA 5IK2D 1SVSA 5EUQB 3P26A 4D4MA 4A0FA 2WWFA 2HF8A 4QGFA 5SZJA 1UBEA 4JS0A 2AFHE 1UDXA 2V1XA 2JLUA 1MO5A 3EZ7A 2CK3A 5DYGA 4DJTA 4DIEA 2ORIA 4KJZA 2WSSA 1G3MA 2O8BB 4MYCA 2GK7A 3C16C 3LWNA 4MKFA 3K70D 4AWXA 4OI4A 2J0SA 1KKMA 1RJ9B 4C2UA 1QZXA 4KCGA 4B32A 1VG9B 3ZJYA 2OFXA 1S9HA 3HPQA 2B92A 1UBCA 2DPXA 4LI0A 4AD8A 4JLOA 1Z22A 3I92A 1ANKA 5D3MB 2F9MA 4BFWA 1GTVA 4PPFA 2CXXA 5E7MA 3AVUA 3I1FA 3QBTA 4II7A 4Q5IA 2NG1A 2ODEA 2QROA 3OAAD 2W00A 1WBBA 2PT7A 2V1UA 1A7JA 1P9RA 3T15A 1DPFA 3MG9A 4FCTA 1K5DA 4NPHA 3O8CA 2QM8A 3CX8A 4BE7B 1ZNXA 3IHLA 1I4LD 2NIPA 3ONWA 2YWGA 1XDBA 1OE0A 2ONKA 4NBSA 4PHTA 5DH9A 3RS7A 3ZZUA 3EC1A 2AWNA 4HLCA 2NPFA 1W36C 1OIWA 3CRRA 3LXXA 3P27A 4KFTA 5ELXA 3D8BA 4X8MA 4IDOA 5EP3A 2BKEA 2GHIA 3VR5A 2SHKA 1ZD8A 5EXPA 3I32A 4YONB 4D81A 5KYKA 4TMTA 2BMDA 3GD7A 3IDQA 1X3SA 5JJIA 3AH8A 2QBYA 3QG5A 1B0UA 1BYIA 4G01B 3C15C 4DBLC 5CB8A 4H1VA 5F3WB 4FN5A 3IPYA 5IK2A 1DAFA 1DAHA 3RSLA 5AUPB 3VMFA 3ZIAA 2OFOA 1US8B 2A5DA 5JEDA 1CJVC 2XOKD 4DLUA 4C0HA 1ZYUA 3WYAA 3LAWA 1CRQA 5AJYA 2OZEA 4ZO4A 3VTKA 3RC8A 4QBIA 3U5ZB 4JBYA 2PJZA 1ZUIA 1UPTA 2KBEA 2V55B 4GBMA 5JWRA 2DWOA 4B76A 5BYKA 1R5BA 2FFAA 5TMPA 1NN5A 2IXGA 1T9HA 2QTVB 2CNWD 4KYIB 4C0AC 5SZKB 4KI0A 4URWR 2HT1A 1G7TA 1DTSA 5L3RA 4WZAE 1IN8A 3K0EA 3N2IA 4HUTA 4CYMA 5DI3A 1KTVA 5JJLA 5JECA 1W46A 1DAIA 2QE7D 3OAAA 1HV8A 4HUQA 5AJZA 4DLVA 1Z83A 3AVYA 1G7RA 5EUMA 1N6KA 1W2HA 3FMPB 1G7CA 4HDCA 4QM7A 2IYXA 2A5YB 3FFAA 1JBKA 5SZIA 4RD2A 3B9PA 3BB1A 1U90A 3DO6A 2PCLA 3CPHA 1D9XA 1NBME 3R9IA 4ESHA 1SULA 4EQ6A 2ZPTX 3FKSA 1RRFA 4DSTA 4UNSA 4TMXA 2EWVA 4M9QA 1KSGA 2ZJ8A 3QVUA 1VYTA 1L4UA 3IIJA 3I5YA 2JLYA 1LW7A 3DMNA 1NSFA 1BOFA 1VKJA 4YMTA 3MUFA 4PQRA 1X8LA 2WMOB 3HU2A 5A0FA 2GCOB 3EPKA 2FN4A 5CITA 4MDFA 1PUJA 2XOKA 4D0NA 2R2AA 1OIVA 4JT2A 3EZ9A 1YHNA 4PC2A 1G4AE 1N5IA 4ACBA 3PR1A 1HA3A 1E2DA 2ZRDA 4OK3A 3PEYA 1GRNA 4G0NA 4S2EA 3GLIA 4JJZA 4LV6A 1OXSC 3THXB 2ZR7A 2CNWA 3B2EA 5FUXA 3MWLA 2R8RA 4DLZA 4EAQA 2OT3B 4L8GA 2WKQA 1JALA 5J4YA 4XSGA 4DB4A 4A1FA 4A0GA 4TMKA 5GJCA 2C9OA 2HDNB 4DZZA 1MKYA 2MSCB 2QE7A 4YMWA 4DCNA 1SQ5A 2BV3A 1ZNYA 4GNKA 2V3CC 2RB4A 4D80A 2OHFA 1HE8B 1SVLA 3IEVA 4PZYA 3FYHA 2ZAMA 4JYCA 1ODFA 2UKDA 1K6MA 2VH5R 1FZQA 5KSZA 3RANA 1KKLA 1HYQA 1Z08A 1Z2AA 4XTRA 1JPJA 4RY2A 3EARA 5BN3A 3T5DA 2ZSAA 3WXMA 3SR0A 2NO0A 3SBDA 3QXXA 3BJIC 1SHZA 4DHEA 2O0KA 2QAGB 1YZLA 4PC1A 3SI7A 3U3KA 3QJYA 1AJEA 4DT1B 4V0OA 3U6BA 2BM0A 4JLMA 2V6JA 4LBVA 1S8FA 2J1LA 4IDPA 5B64A 4TL6A 5L3SB 3K53A 2GEDA 4QKQA 4K8OA 1II9A 3E70C 4G5SA 2ZITA 1BKDR 5CJPA 1S1CA 3BRWD 3RSOA 3AVWA 2ZRCA 1RE0A 4NDZA 4PC7A 2J5XA 2WJHA 1ZINA 2EFHB
chains in the Genus database with same CATH superfamily
2J6BA 1ICIA 3WAKA 2WJVA 1XDGA 3C5CA 1X15A 2NSLA 3EDPA 4AP5A 1FOKA 2VHCA 3JRXA 3M2TA 1WHTB 3VEPA 3ZH9B 1JG7A 3TEFA 1E1RA 4GEGA 2QLMA 1JUPA 3KVRA 3CW2A 2CDNA 3NHBA 3SQXA 1TEXA 1H94A 3EXFB 4MPPA 1IZYA 2Q5QA 4EEZA 3G9ZA 1AH2A 5J3LA 3TDUC 4L3VA 3SHOA 2WLSA 2HPHA 1NXPA 1FP4A 3TMKA 3SX4A 3I0MA 3DKYA 2VHVA 2IKQA 1DBSA 2D45A 2XDWA 3D1LA 3DOEA 5IZCA 1ESMA 3SM9A 4DA6A 2E1MB 2Z4SA 3VPAA 3I2HA 3WK4A 3L7MA 2IY9A 2VHQA 4KMFA 4CQMB 3ZJ5A 1S3FA 4XR4A 1XB4A 3HJBA 3GLUA 3TZHA 5AJWA 3UMSA 1TQ8A 1BMFD 1E9AA 5TRTA 4GSLA 3P5SA 1E3WB 1S72I 2ODBA 4HFNA 2E1PA 4IJVA 2IPXA 2Z2KA 2WYWA 4EW6A 3UT5A 1JEDA 3O26A 3S29A 3AVOA 5IEJA 2ZR8A 3HCEA 4WBNF 1RQPA 2ZYRA 2BGNA 4DPLA 1ZGCA 3H7AA 4L9AA 1V7QA 2GN9A 3JTEA 5DUKA 4M1SA 3HACA 2ZIAA 2MTBA 4H3KB 2EFYA 1BIFA 1KQ9A 4AF7A 3CUSA 3QXJA 1SD5A 4PANA 4MDHA 2GUGA 2WTUA 5LZ5A 1SZDA 2EFPA 1FLVA 3JQ6A 1GT6A 2JVGA 3NHLA 4KR6A 1Q7TA 3BH6A 1MH9A 3RCBA 5JBIA 2CHEA 4CCLA 5JXGA 2LNBA 2AMFA 5E6UB 1BG6A 4H18A 2XF7A 5JW6A 2QZSA 1P77A 2YXDA 3OZ7A 2HR1A 3HFJA 3S2HJ 2DFDA 2BRUA 4E12A 1NBOA 4N9IA 1IV8A 3HJTA 2ETXA 3UBTA 1P5HA 5H70A 4MK4A 1GPDG 2F1HA 4MHTA 1C9DB 3TZEA 4FE7A 2F9LA 1FE8A 1PK7A 4B5LA 3AR7A 4JI6B 4FFWA 2R25B 2I2WA 4FCCA 3WYDA 3SZLA 5J4VA 1EGMB 2ARKA 2WM2A 4L5AA 4V19K 4HAMA 4JBNA 3SYMA 1ZUD1 3L7OA 2GPAA 2L9VA 4G1FA 4Q03A 2LWIA 1SHLA 2PX8A 3S17J 5TEVA 4LQCA 1GFIA 3UB2A 3YASA 2DHDA 1VXRA 4UREA 4FKMA 3UICA 3V1MA 1DIGA 3ZWYA 4AQDA 1NUQA 3HWX1 5LU8A 4U7HA 2FOXA 5DWDA 1UZCA 1HKSA 2B6HA 4Y7DA 2IVFA 2DBRA 4JSRA 1AZWA 1XWIA 2BE7A 2Q0XA 3IMKA 4XQGA 2VOEA 3L0YA 1LDGA 2PIAA 3I9KA 3DTVD 3BH0A 3RH0A 1EFCA 4ZU1X 2P4UA 5DHTA 4KXYA 5JMOA 1KH3A 4M53A 3QVWA 3FJ1A 2Y68A 4D41A 4CM8B 4FW9A 4ASUA 3JAWA 4L16A 3AP2A 3ZDQA 3NBXX 2R8BA 2PWZA 5H3HA 4AMBA 2MU1A 1DRKA 2QZ9A 4UATA 1SG6A 5ALHA 2R5WA 4UZEA 3TP0A 1JDVA 3EZ6A 1MBJA 1UF9A 5E0OA 1NWCA 3CM0A 3KVNA 2MR6A 2A9VA 3IJ5A 4FGUA 3OHMA 3BR5A 2FRVA 2V98A 2O50A 3AJEA 3D2CA 3GN2A 1OLUB 2WSMA 1QYCA 3FNRA 3T5BA 3BBPA 3KAKA 2F1JA 4A0XA 3KV3O 5HILA 3O3NB 1NE7A 1JG6A 3P96A 1FXWA 4Q1BA 2CLMB 2PA3A 1W5SA 4RPCA 4DEVA 1LNQA 3IVAA 3U44B 4MTEA 1GA1A 1YJNI 2VHTA 1MAAA 1XGNA 1AOXA 4QBHA 1BS2A 4PWZA 4R1PA 4JGBA 1X7ZB 4EHBA 3ORFA 4TLCA 1U5CA 1KMNA 1R6BX 1CDDA 2B5WA 1NBMA 3UEOA 2JHAA 3K0CC 3TX2A 5JALA 1GZ4A 2P67A 3WB1A 2VAMA 3TAXA 4TXHA 3IWZA 1MIJA 4F92B 4P5EA 3PDIA 3JQEA 4HXYA 4HFRA 3JD1A 3EX7C 2OZKA 5IASA 3ZEIA 5GINE 1PJAA 3DBRA 4I99C 3H9QA 1E9EA 3ZV6A 4FVTA 3E9DA 4UU1A 4PCVA 1G9XA 3P4YA 4JK1X 2JATA 1XROA 3TNDA 4LYGA 1E2KA 3P4UA 3TDMA 1CR4A 5CTJA 1JYSA 2NU8A 4FI3C 1CUIA 4WLVA 1IAVA 1A27A 3LBYA 4BVKA 1KRWA 1N2SA 2Y1WA 1CF9A 4NSNA 4N49A 5DM1A 1TLLA 3R7DA 2LY1A 4URVR 4PZCA 1P4SA 5FULA 1K4SA 3U3JA 4IXDA 4LOIA 3ROTA 3AP1A 3WL8A 3O2NA 3WHLA 4TZTA 5CX1A 1CY1A 2DQ4A 1ZH5A 3U49A 4HN4B 4HZUA 3P0FA 3GD5A 1WU7A 4XRGA 3W9SA 2NSHA 3LV8A 4J75A 2OO3A 1JDUA 1I0LA 3DL0A 3QLEA 1XN4A 1T6YA 4MQ6A 3PM1A 2RVCA 1FFXB 1X2BA 4M6WA 3I52A 1QHYA 3DYVA 3WNCA 2VYND 5C2JB 4EKEA 1J0XO 4ZYEA 3BFVA 1W52X 3QY0A 2EB7A 1HSOA 2XHEA 4RGUA 3BTCA 4F4DA 1BVRA 4M0UA 2RCYA 5KNLA 2ID7A 1ZELA 4F9FA 2R7DA 2J5PA 3SD7A 1AF4A 2AKYA 3OWOA 1FRVA 5TS2A 2FEWB 3MLEA 4AJPA 4NPCA 2PX4A 3ILYA 3CLRC 4WOCA 2HHLA 1I3NA 3H0EA 2EYUA 3K0KA 2O8CA 1G5TA 4KT6A 3LSRA 1LDMA 5AVXA 2JFQA 4JXXA 4YALA 3RARA 3QEJA 2CJPA 2E4AA 4D3SA 3IQXA 4PNPA 1RPAA 1C7JA 4CF3A 4TV9F 3A05A 1Q83A 3I56I 4DLBA 1MO6A 3KO8A 2AXNA 1V3VA 3V2IA 1BVUA 1ADJA 2GZMA 4V1CI 2Q3EA 2Q3MA 2ZAYA 4QDTA 4DVJA 3CZCA 2XKPA 3LUBA 2NT3A 5F23A 2VP4A 4GSYA 4BKQA 2ZGVA 4B34A 3OIUA 2WHPA 1M2HA 3CH5A 2QLTA 2HCJB 4Q15A 4YT8A 3G2PA 3V8EA 2ADMA 3FRHA 4F5EA 1DBQA 4WBNB 2QNIA 4EPVA 3OZBA 5EJMA 3ECHA 1BI2A 1NLUA 1G0OA 4HGPA 4HLUC 3PVZA 1KJJA 4H4EA 4W5NA 1Z8FA 4B75A 2I7DA 3CU5A 2B9VA 3HN6A 3F2IA 4G8CA 1IHPA 4RY8A 2QM3A 1RPNA 4G4IA 5I7AA 1C80A 1ZVJA 1Z2DA 4R2IA 4ZO7A 5BQOA 1N3LA 4U5XA 4LMPA 3TDZC 3FMSA 2C4MA 1RESA 1JEAA 3S8YA 3DBIA 2J4DA 1EVQA 4Y6GB 4CETA 1GT91 3K1ZA 1VTKA 5TARA 3WADA 3ZY5A 2OGUA 2B2NA 1NNEA 2E34A 1HORA 4OF4A 2HZTA 3BAZA 1Q7GA 1YTLA 2RHTA 1SC6A 1I1SA 5CIWA 3ZJTA 5GM1A 4BBSJ 1C1XB 1LBHA 2RHGB 1ZMRA 4I50F 3JQQA 1R9TJ 1ZOLA 4FKBA 2BSAA 3ASOH 5CA1F 3WJ2A 4PG6A 1NMSA 3JQFA 2WQ7A 4TLAA 3EZ2A 2FPIA 4L8FA 3E22A 1DRUA 3SSNA 4Y2UA 5DHPA 4ID9A 4WY5A 4OP1A 1WKCA 1RRMA 2PVSA 4A2WA 1YVUA 5J4HA 4D8TA 3N2EA 2O8DB 4LI3X 3QWBA 2D1RA 3LA2A 2C2ZA 2C3PA 4IRHA 1VM6A 2OENG 1G98A 2WWRA 3WRXC 3SF8B 4UEOA 2ZJ2A 3N2GA 1JUSA 1H23A 3BL8A 5I3CA 2QV0A 1LBIA 1MZBA 3H9CA 4E08A 5KB3A 5BYAA 2Q4EA 4GGGA 1QIMA 2HA7A 2XUIA 2HEOA 2VDQB 2DQKA 1XV5A 1QV9A 1XF9A 3ZWBA 4UVDA 3MB5A 3H0GJ 2CLIB 1ZPDA 3EF0A 4UEJA 3PRJA 7REQA 1NJFA 4BDSA 1U0OC 4UJ3A 3F8TA 4L50A 4DLNA 2CZGA 4C05A 2XA1A 2TMKA 4PZUA 2BH9A 3C2BA 3CE9A 4Q3NA 2ZZMA 2F00A 2CFSA 2EG9A 4BQSA 3CXRA 1NPTO 1LPPA 2ZSBA 5DXAA 2NS0A 1NFFA 1N6LA 2QTCA 3ITNA 1YMUA 2A2ZA 2GBLC 4M86A 3LYHA 1KO5A 1M1EB 1R0XA 4R8SA 3WK8A 1NQ5A 4ZYYA 2C5AA 2DETA 1WH5A 2V7VA 1F12A 5ILQA 3F2VA 1KQ3A 4TT8A 3OFKA 5J1SB 3PEEA 3FKJA 1BIBA 3L9FA 3DMDA 2QRGA 4TWJA 5LA6A 3T1HB 3GO5A 2OQIA 3DTIA 3DQZA 1NHWA 4FNGA 5BQPA 4GU5A 1P7PA 1YBMA 1E1QA 1OT5A 4I55A 4GLLA 1KEKA 3K8OE 5K0JA 1WCYA 4A3JJ 2YY5A 1KPIA 1DT5A 2ZZNA 1WUJS 3KQUA 3GEMA 2ZUFA 3ILVA 1FFDA 1E1CB 1L5RA 5KVCA 3WISA 4N5LA 3GLFE 3GPLA 4TS4A 1W9MA 2PLFA 1D5CA 3RIHA 4ZQIA 2A5JA 5EHZA 3QPVA 4PHHA 4DRXB 5IFKA 5J1RA 5ENVA 2IRFG 1RQ7A 3DZ8A 4CEJA 4LHVA 1D04A 3SXJA 1EDDA 3DE1X 3AI3A 1GLGA 3L7JA 2AYZA 3LVBA 4G37A 4IYRA 4O2LA 3AV0B 1RXYA 1XRNA 4EY6A 4JBXA 2PVCA 5KWVA 1E1DA 3RS0A 2PA0A 4DCPA 1SB8A 4AMVA 3O1LA 3EIQA 1JA1A 1FX0A 3S5UA 3RNLA 5JNSA 4JYZA 4OHPA 2NPOA 1Z4MA 4EJ2A 2IY7A 3MINB 3RKQA 4UFNA 3HJCA 5D85A 4P1ZA 3UMMA 1M33A 3DC2A 5DT2A 2X15A 4Z9XA 1PNTA 4TV8A 1PQYA 1UWLA 2DLCX 1VE6A 5K7FA 3OYHA 3QYAA 1F7VA 2FFQA 1P74A 4A2QA 2JGNA 1N6OA 1LX7A 5GV8A 2QGNA 5FWDA 4DLAA 2MSDB 3SC3A 3CVYA 2ZBFA 1ZMOA 5CPFA 5F4ZA 4U0WA 4FHCA 4MCJA 3FSGA 2XUQA 3QFCA 1R8SA 4AP9A 8GPBA 2AX3A 1RIFA 1VPEA 4YRGA 4F0JA 4AS3A 4F04A 4R8KA 4IX9A 1UJNA 1ZG5A 2RBKA 3FUUA 4DNQA 2DSNA 1RKXA 4EJVA 5CM8B 3TEMA 2Q28A 4NBWA 4DZRA 3UHFA 5I5GA 3B89A 1SVMA 1OOEA 1K4TA 1TAGA 1MDMB 1D2GA 5NULA 1TIBA 1QK5A 5FWXB 5AI5A 2TRSB 4O02B 2IVMA 3UKDA 2GSWA 1ESEA 5JVGF 1GRRA 3L9XA 4D9IA 2OBBA 1KIMA 4YO8A 3Q2OA 1JLLB 3VNVA 1ACIA 4BYMA 4QFDA 4WZBA 4PTLA 4Z1MD 2Q1WA 1BQEA 1HETA 4ND6A 2XAHA 2BONA 4NYJQ 2IHJA 1CULC 2VC0A 5JASA 2YVLA 2EWMA 3RBXA 2DUWA 3IP6A 1EGAA 4NS1A 4JY7A 2YWFA 5KQSA 2Y0MA 3RVDA 4DDVA 5K6RA 2X8WA 2OQGA 3I73A 3ZOKA 1S7EA 4ANJA 2A68F 4FT8A 3LQYA 4N0BA 4X1KB 4J7UA 3QLVA 2AH5A 2D0IA 2YQ4A 1SOWA 4LEIA 1MBZA 4NARA 3Q12A 3KZYA 1QG6A 1FUEA 2Q6KA 5JPIA 4FMCF 4RE5A 2FPMA 3SZMA 5G1NA 2WILA 2OZLB 1TL8A 1E2NA 1GL6A 1HDXA 2WF9A 3R7BA 3M3DA 4C7OB 2IYRA 2VE9A 4O3MA 4IXWA 1R5OA 1YGPA 3V97A 5HDNA 3ML6A 2DFKB 5EYRA 4IUDS 4IQJA 4RJLA 5F0CA 4PJ0C 1B1CA 4XVCA 1TKAA 5HP4A 3DP9A 1I6LA 3L2UA 2JKZA 4OBXA 3IHWA 6NULA 1SUEA 1GIAA 4HWSA 1HKTA 1Z4NA 4I50B 4W63A 4D98A 3C7KA 4J0CA 2HJ9A 4X0EA 1MAUA 1CW2B 3ZDZB 1KVUA 1PUFA 4Y3OA 5L3QA 3CLSD 4QU8A 3NKVA 4CCAA 1PWXA 3PL8A 2Z1DA 2WOOA 3CH7A 4R1LA 4E5YA 4CCYA 3T1YB 4F9GA 3VJMA 3TR5A 1SCQA 4FXPA 4XUDA 3NONA 2IYLD 1F2DA 3WBBA 4QBFA 1XVUA 2SECE 3OP4A 1WL8A 4WXPA 1TJ4A 1JJ7A 1U7WA 5FLEX 4IL5A 1T6ZA 4E2FA 4CZ2A 2WP8J 4NFHA 4BJ5A 1KP2A 3TPZA 1X3LA 1LTKA 3FA2A 4UUSB 3PXBA 3L7YA 4MS3A 1KEWA 1JZTA 1XA0A 4WI1A 4DIEA 4KJZA 1IHDA 4XYGA 1RJ9B 4K2EA 4J7CA 3H6HA 4OHUA 1PJ8A 3TTSA 2WTEA 1FY7A 2EWNA 4PPFA 2NG1A 2W00A 2BW3A 1JYEA 1OLTA 2PFSA 1I4LD 3G3ZA 3EC1A 4MVWA 4HEA1 3WWOA 2IGMA 3H42B 5EP3A 3ZMVA 3FPFA 4F72A 3UCXA 4RIFA 2ZVDA 2L69A 4G01B 3DMHA 1DAFA 3V4SA 3RSLA 4AO6A 1TA0A 2NUPA 3TO5A 1KOLA 4NOKA 5D3ZA 1UC8A 5DHRA 2I5UA 2PRJA 1GUFA 1VQ1A 3JXEA 3NTRA 1T9HA 4WLFA 3DXZA 4XWWA 4QWQA 5DI3A 4AAYA 3AVYA 2J3JA 1DLJA 3EQ7A 4RFLA 3ZQCA 3NNNA 1V8OA 3BB1A 4EY3A 4INZA 3R9IA 3QUBA 2H1FA 3A2MA 4IR7A 3IKLA 1K08A 2R8PA 2JLYA 3JREA 1SZCA 2V9KA 3I2GA 3M8JA 4BNFA 4PQRA 4LRSB 3HL2A 1QQIA 1W59A 3ZWCA 1XMAA 4I6EA 1X94A 3LJKA 4LIVA 2QQGA 4ARVA 1S7AA 3N6RA 2C2GA 1E2UA 1E8DA 3B2EA 3OJWA 3VZSA 1BVYF 3UAZA 2OV4A 2XOXA 2O3FA 3GT7A 2C61A 4R54A 4DMGA 4A1FA 2XCRB 2XY4A 2QN9A 3IKVA 3M5DA 4I2OA 1I01A 3MYRA 3AMVA 5DBIA 3VUEA 1UB9A 3HDGA 3Q88A 3O8NA 4HYEA 3H5WA 4RY2A 2J9FA 2PT6A 1DUSA 3A1NA 4XM1A 2Y92A 4IUBS 3STXA 4BO1A 3U6BA 1LSOA 1JDPA 5CAEA 3R6TA 2AQFA 1T2EA 5BSEA 4X5OA 4C5CA 3JRFA 3FROA 1U4OA 3E70C 4XJVA 1DNPA 3N28A 3DBHB 1P5RA 4NDZA 1Z6TA 4MRNA 4OWRB 5FYQA 2FSVC 2XPUA 1OV6A 5JAOA 2A1TS 4MV3A 1SBZA 3G6EI 3UATA 3BJAA 1XOIA 5IN4A 3G88A 4KQXA 1EXVA 3RCOA 4NMXB 2JLSA 1EVEA 4TXMA 1AS3A 3UWDA 4LJKA 3TW6A 1C30A 3TMAA 3HDYA 4M38A 3WL7A 4HN2A 3U7JA 4ZANA 3EG9A 4G5GA 3NT4A 4BPRA 4QHTA 1U7ZA 4QTUB 4TYPA 4LTNA 1Z5VA 3HPRA 1YQGA 1RYYA 3LL7A 3PXUA 3DKXA 4TWBA 2E36A 3TW0A 4A12A 5CUQA 4O5AA 2EBWA 3CF4G 3ETCA 5HCNA 2F4NA 1LDBA 2O5VA 4HEA6 2CKDA 1FFCA 3D0RA 4U9UA 1KSHA 5FNVA 4O4JB 2E71A 2REQB 2FPSA 5B4UA 5F9MA 4N39A 1XTUA 3E48A 4CT0A 3FTFA 2IHTA 1DXOA 4DNCA 1UHWA 1RLTA 3BGOS 1L5NA 4UVCA 3STHA 1Q6YA 4J8PA 1JIXA 2DWUA 3OLYA 3FCAA 2GFIA 4F56A 2UYYA 2WPDA 1GV5A 1W4LA 4Q7EA 1EDBA 3ZHXA 5IH3A 3W3AA 4MMXB 4WA7A 5MGNA 3EYYA 4QARA 4DAOA 3RUAA 3IERA 4LE1A 5E1XA 1WB4A 3MRTA 3WMWA 4D9NA 4NJMA 2H29A 2H54A 4EZIA 2PE5A 3D3WA 4LYJA 2R60A 3RTEA 3MJTA 4KI7A 1CNFA 3KOZA 3GLIB 1QOQB 1FQWA 1OFCX 3JQRA 2ZFWA 3AEUA 2C82A 4URHA 1XZLA 2BEWB 2B7CA 2FW6A 2L17A 4BJ6C 1MQ9A 5FCDA 4F9TA 1ZTRA 3GA7A 4MQFB 4CM9D 1UQTA 4M6VA 4RXTA 4EA6A 1LPQA 1Z8DA 4CIBA 4IWXA 5U4QA 2CKMA 4IIXA 4XOIA 2ISYA 3OS0A 2BGKA 2P5KA 3C1TA 4I46A 4O4LB 1HM5A 4N40A 1YOVA 4I98B 3C4JA 2DJNA 4X6LA 5IDYA 3RDIA 2XWJI 4S0HB 2FKNA 4KAXA 2VDKB 2R87A 2XGEA 3ZDDA 1M8JA 3L2OB 2WG1A 4JX6A 4B2YA 4XQ9A 2B99A 4EUKA 5CFMA 4JC8A 1ETWA 2P5SA 1Q0RA 3HG9A 1ORKA 2RKWA 4U2GA 5C31A 1FMWA 2V5VA 1QJ4A 2PWYA 2UZKA 4IDAA 4QE3A 2E1RA 4NUBA 3ECSA 1MBFA 2I8DA 3RYCA 1LB1B 1S5PA 4TSRA 4D6XA 2J0QA 1GD1O 1YJWI 2NXWA 1NJ6A 5FBRB 3I0TA 1JMKC 1YS2X 1NYQA 2IWRA 5B1YA 4BQAA 2X8LA 4OIOF 5IWCA 3QELB 3IOCA 3FWPA 4A73A 3HVUA 3IT2A 3LBIA 3BJOA 3AEKB 2HDOA 3D59A 3RUFA 5LEJA 2X3FA 1G2PA 4FGLA 1TCVA 3SDZA 3L7CA 3I6BA 3UKGA 1DI0A 1QH0A 1F5SA 4YRLA 2FK8A 1MHPA 3NDBB 2O23A 4RIGA 3L1VA 2PX3A 3GUDA 2ZBUA 3L1JA 2KZGA 1T9GS 1UDWA 1RKWA 3TMYA 1W1WA 4JITA 2QW8A 4G1UC 4M3NA 4N3NA 4LHEA 2K2QB 4OM8A 4PO1A 3Q8WA 3WGKA 1ZVMA 3IUJA 3KQSA 1HE3A 4ITUA 2X6TA 2JGIA 4LYDA 5F3DA 1XZKA 3B2QA 3CKLA 4A6DA 5LHGA 1IE3A 4ERXA 3TZCA 4XX0A 1Q19A 3FMGA 3ZDRA 4CICA 4NH4A 2HPVA 3ED1A 3KOXA 2OD2A 4W8OA 4ZAXA 1A2QA 5F21A 2CH0A 2MSLA 4BVAA 1CPYA 2YJ4A 5EG0A 2NNYA 2RHJA 3CH4B 1IOZA 3C3EA 4UHTA 3JRDA 1T2NA 2NUBA 2XQFA 3FRJA 1OV4A 2Q7OE 2BTQA 1BOBA 2FPOA 1PJSA 1KJQA 1PG2A 3H18A 2C95A 1QLWA 3DM5A 3BVPA 3GP8A 2IYFA 2IYPA 2V97A 3HOTA 2C3UA 3DEFA 3SJMA 2HHAA 1KZ1A 3ORYA 1Y7LA 2IW1A 1DE0A 2XNJA 2HC9A 4CQLA 1JGGA 2GFHA 2Z8YM 4EG6A 2EX0A 2AOTA 3UY4A 1PZFA 2FDCA 2FGKA 3MMSA 1HZZC 5HCUA 1GGNA 2EFJA 1U0SY 4QBTA 3ND6A 4EGSA 5IYZA 4NBQA 3RS4A 1ZH0A 2XSJC 4Q34A 1Y89A 3T1OA 4N48A 5DM70 2V3VA 1IG7A 4JLVA 3TJRA 3VO1A 1EP1B 4RGYA 4FE4A 2DKNA 2CDBA 3Q6MA 3KTAA 1ZLYA 4W5OA 3IEXA 1YMQA 5CDYA 4XKWA 4UAJA 1XEAA 3K9GA 4RVFA 3OUUA 1II8B 2BY1A 2CSXA 3JS5A 1ZKDA 1CZKA 4TGLA 2CY0A 3ORSA 3K8QA 5EXTA 4RSGA 2ENUA 1CY0A 5ALSA 3L9WA 4HS9A 1D4FA 3TN7A 2YTZA 2XNKA 4UU0A 3A9WA 3PF9A 1ZJJA 1WPRA 4YS6A 3D5SC 1EHIA 1I0ZA 3L2VA 2HVSA 3AFMA 3OJCA 4AT1A 2G71A 5EMKA 2Z4TA 3MT9A 1T5HX 2I7TA 5K3AA 2BR3A 1CQJB 1QQ7A 1SXJD 2YMLA 5G1OA 1WPKA 2R7WA 2FEXA 3X1MA 1HT1E 2DW4A 4BBZA 4AO8A 1I51A 5CX4A 4GZLA 2IOFA 1DARA 1SZPA 4XWYA 2FXAA 3MW8A 1AUVA 3ADBA 1NOKA 1YE3A 3WV4A 2O03A 3LZCA 3UGKA 2BH2A 3O8LA 4FYYA 2OF7A 3D5LA 3M9AA 4NDLA 5AW0A 5CIQA 1I6HJ 3KEGA 1P0FA 4RVSA 3P9ZA 2CUNA 2SKDA 4Q48A 3GJTA 2R8YA 1P92A 3T5MA 1V6CA 4BQQA 1A1SA 4P7KA 1P7IA 2FOKA 5THXA 3HRKA 3FMOB 1R6AA 3CONA 1VQOI 2IYVA 4JCCA 4OBWA 1N2CE 5DZSA 1OYYA 3IV6A 4KBFA 4TUYF 3H83A 5FTLA 3O90A 3UR3C 5DLQC 1UFQA 1UK6A 2AG6A 4MVJE 1ONSA 1RWVA 3FYCA 3S81A 1O9GA 3V4LA 1Y6IA 1PV1A 2WYVA 4I81A 5M5BA 1MMDA 3VRHA 4W4TA 3KR2A 2CHGA 4CHTA 2H2GA 1E3MA 3H1GA 4FTHA 2ZJPF 2ZT8A 5A4IS 3WJAA 4G56A 1SHKA 1LX6A 3EGDB 4JX8A 2DLNA 4M8IA 3G17A 4GZMA 4EHHA 1X1RA 1L4YA 4FHGA 4CT4B 5KX5A 5EHGA 1KYVA 4I1OA 1XZQA 2NSYA 3C5WP 2HXOA 4MEBA 3ZHOA 5BNIA 1IO2A 1W4CA 2I4OA 3FOEC 4REQA 1JECA 2JA5J 4EI2A 3IT1A 4EMTA 4BNCA 3ZHSA 4M36A 4GZ5A 4FMBB 2NYXA 3FXRA 3E1SA 2FFHA 4A92A 1P4RA 2HN9A 2QDKA 3HTUA 4JP1A 3CYFA 4PCQA 4ZC3A 3QHAA 3FYUB 4ACAA 1Q2UA 4LWZA 3IUQA 4JOQA 2AD1A 1AXRA 4R1NA 5DNAA 1FFHA 2Z3WA 3MOSA 3R3JA 1BE0A 1QKJA 2AOVA 1BOOA 3E6AA 1G3QA 3TIXB 1T29A 3TGWA 1E3LA 5A6VA 3OTQA 3JRBA 1J39A 3SQNA 3GRZA 3NAMA 4CTKA 4C5AA 4TT3D 4DWWA 1W0CA 4DRZA 2Q5JA 3EULA 1ZH2A 1WDMA 3VKWA 3A4YA 5MN4A 4WAUA 5ETJA 4YRSA 4CMJA 2MYPA 5EWLA 2FB9A 3N86A 3JAMZ 2ZT5A 3FWYA 1USUA 5KOHB 4Q3EA 1WR8A 4HFMA 4LGYA 2F4MB 3ZCQA 5L4SA 1VECA 4OQQA 3D1JA 5BOSA 2XCQA 2R6DA 1QIHA 3QF7A 4Q1FA 1BA5A 1BH2A 4IV0A 1R12A 4JX4A 1QFYA 3Q3EA 2F43B 2R6AA 1FPQA 3R09A 1ITZA 4Y7CA 3DE6X 1TC1A 2VUHB 1N5RA 2H1WA 4ZDPA 1X70A 1A5TA 3H11B 2CE7A 1MNQA 1RWXA 1K75A 1TWAJ 4DUPA 4B40A 1LBEA 5KU7A 2ZJ0A 1GCOA 1N7JA 2YH2A 3QPAA 4HVLA 2H1HA 2BVLA 3GTQJ 5EFZA 3TKAA 3UJ9A 3KJIA 2JLZA 3ZMDA 1Z4LA 1V6SA 1QCYA 3FNHA 3C3BA 2QTFA 5HZMA 1FTNA 3KG2A 4P58A 2KRCA 4HATA 2GZSA 3WHPA 4IEJA 4LGWA 5KYVA 4XFJA 1H8HA 2A5GA 3VTAA 1O4VA 2IE0A 3BTUA 4UPDA 2WW8A 3A31A 1NC1A 5EXEA 3M6MD 4EKDA 5C37A 3DVQX 5IT3A 1YKGA 3KP3A 3FHTA 1NAHA 4R7GA 5K4HA 4J4BA 2VYQA 3JQFC 2HQRA 3THWB 3B5JA 1CZLA 3EXHB 3IJPA 3E8MA 2HA5A 3DDNA 4FZRA 1Y3AA 3L84A 2LYCA 3V7CA 4BP1A 1H9AA 4ZO8A 4HGRA 1PVVA 2PFKA 4IO1A 3K72B 1VP9A 4OMYA 2F17A 1ZRNA 1LVHA 4S0XA 4F4HA 3R61A 1WZNA 3CG4A 3PNYA 2O6HA 4EA9A 4LQ4A 1U3CA 2L0XA 4S0ZA 2AEJA 4WKPA 2XCSB 3ND7A 5JWOA 4PVDA 4Q82A 2PGJA 2W2TA 1M1YA 3IOYA 3CJRA 1PL8A 4F5YA 1YNOA 4CL3A 1ORVA 4X1IA 1PDVA 4M3BA 1E4EA 3KB2A 4FLEA 4PYRA 3BRQA 1YDWA 5AW2A 2FE1A 4FFBA 1K7XB 4RS8A 3TLYA 1PZNA 4OP2A 1ZIOA 3CR8A 3ZZNA 1YA6A 1CRLA 1OFTA 3UMJA 3OTWA 5IJ0B 2WB1A 3QPWA 3QH4A 5DGCA 3RVQA 4UD2A 1RR7A 4G0QA 4KEAA 3R4CA 2BZGA 3A36A 1J9IA 5AIPA 3FAZA 1OXKB 4QREA 3OY9A 1QH8B 2WFAA 1S96A 1TA4A 2EIKH 4HV4A 4CIDA 2OCBA 4GL4A 4GPTA 3I12A 1QNTA 2CVPA 4NENA 2WKWA 4D0PA 4MGIR 5T64A 2GM5A 2RGCA 4C0LA 2FSPA 4ZWNA 3H9UA 4FNOA 3GX4X 2JL1A 4DNFA 2IS4A 3CFYA 2CUFA 2BR5A 2Q5FA 2WVAA 3KDPA 3EIUA 4LF8B 1Z5PA 4L57A 3ZHVA 1SMKA 1PT9A 3ONNA 2H8WA 2Y0SA 1RYFA 3ZVMA 2OCAA 4BTEA 2VUUA 3DTVB 4MWEA 4I4LA 4KW7A 4PZZA 1T8WA 5HIAA 3BWXA 1SCKA 2F4IA 1YDFA 1XHFA 1WUHS 5A4KA 1TWCJ 3DV9A 4MVJA 4BEHB 4XPIB 2GSDA 4E15A 2ZJ5A 2L0KA 4DV4B 4BNYA 4MARA 5TMEA 4EEKA 3GGDA 3E3VA 2GD6A 2N8GA 4C7XA 2RV8A 2ADFA 3NHUA 2EBHX 3C1UA 2QRUA 3AONB 4JOBA 2XE6A 2PJUA 4QTRA 4BRZA 2JZYA 1ULBA 4PJNA 3QKRA 2PL5A 3ONQA 4HGQA 2GN2A 4R7ZA 5FLXZ 1IMJA 1M72A 5LN1A 4E4TA 4RSHA 3QZUA 4TUYB 2KIMA 4MQUA 2CQKA 4QUIA 4XA8A 3TX6A 4MUXA 2HKIA 3ICVA 3LUCA 4CIXA 3KM0A 3SLGA 5CDSA 2A8YA 1RBMA 1KS2A 1IL0A 4YIHA 2LLKA 1CY6A 4CVNA 1QDUA 1IHUA 2Q5IA 4ATNA 2C03A 2WU0A 2BI7A 3AR4A 2ERYA 4YAEA 4W6ZA 3AVQA 3GVCA 2QZ8A 4Q3OA 3GDFA 2FH5B 2YQ5A 4GSKA 1O08A 5KQPA 3ESCA 4H1HA 5A0VA 5KOJA 5K3FA 1NXXA 2YWCA 2HQAA 4QTXA 5DVZA 4F86A 2ZM5A 1Y8QB 2RKHA 1DKRA 4J0FA 4XLTA 4UM5A 2W6QA 4HH3C 3D6VA 4C20A 1P1HA 4F1JA 1N1MA 4QLAA 4OHFA 4PF1A 1DTWA 4O6VA 1HY3A 1QAMA 3M6LA 2J0EA 1DAEA 5EEHA 9GPBA 5CLHA 1WW3A 2VNKA 2PX2A 2BBSA 4ZEMA 5BYBA 2JN6A 2GBIA 3ER6A 3KFVA 5EOVA 2HOEA 5ICGA 4WESB 1T4DA 3D4NA 1TZCA 1ZAKA 4MP8A 5LLQA 4S1PA 1ULSA 4ABZA 2V0GA 1WVRA 2IV7A 1N7IA 2LY2A 2BFBB 2PZLA 4KQIA 1V11B 4IG4A 2G0NA 3D8SA 2R6JA 1WSDA 3PI7A 3SQOA 3AL0B 3WQHA 1A76A 4ZRDA 1OC4A 2AGVA 4JBGA 2QQFA 1XQWA 3VQTA 4J29A 5IVKA 4RZSA 4WBSA 1Z5OA 1FJLA 2AHQA 3QYPA 3WOVA 1QO9A 1DEKA 4IIJA 3OTIA 3ABTA 1T5TA 2DA7A 1IWBB 3C2HA 4FX5A 3HUGB 4HDRA 1DFGA 4BKRA 2FP4B 2GUWA 1FSHA 3PQKA 3AIKA 3Q5DA 1XKQA 3F8MA 5FLKA 5LDGA 5KNCA 5DEQA 4JELA 1E64A 4CM4B 2YZKA 3E3MA 1ML4A 5BOXA 2X0DA 3PC7A 2F7SA 3NBKA 4JOMA 3BX1A 4OQZA 5LQNA 4CRWB 3GMTA 1IVYA 3SEFA 3BGDA 4COKA 3ZEAA 1MHTA 1VI0A 4LJ9A 1H3NA 4X7PA 4UTPA 4LJZF 4BGDA 5D84A 2YFHA 3VR5D 2ME6A 1N5OX 1WHTA 3PDUA 4G4SP 3DTNA 2KFDA 1NW9B 2RB5A 1OCTC 2AK2A 1AUQA 4RENA 3RU7A 1XJ5A 2QTGA 4ED9A 4I36A 5A9SA 3LQ1A 1NQTA 1KKMA 5K0GA 4RDXA 1P0PA 3QLVC 4TMYA 2G70A 2X5KO 7ADHA 4R1UA 1EGHA 1GTVA 4X00A 4K9LA 1S3JA 4EJOA 1AU7A 1R5JA 2Q1TA 2PT7A 3T15A 3B20A 4OX9Y 4PIVA 3IHLA 1YTUA 2NIPA 3GELA 2PZAA 4QLOA 3LXXA 5ELXA 3UA4A 1YULA 1I2AA 2Y1KA 4D6YA 1UMDB 4M73A 3RQIA 2BMDA 4Q6BA 1DU0A 2GZ2A 1L5QA 2RNGA 4BMPB 1X19A 1HL3A 3HN7A 5F3WB 5ABPA 1IPEA 1FZPB 4DLUA 5TMBA 5AJYA 2OZEA 4QYIB 4DMFA 4IINA 3ZI4A 5KYUB 2QZPA 2TYSB 1H9TA 4DZPA 1H5NA 3BZ6A 1L4EA 5JV5A 2A9FA 3N2IA 4XDGA 3BZKA 1WKMA 4L0ZB 2P1RA 5AJZA 1GQRA 3OQNA 1QB8A 1IB6A 1G7RA 3I28A 4P55A 1IB0A 2B4AA 3R3WA 4LTMA 3G8DA 3I59B 4LFUA 1JBKA 4NC6A 2FW1A 3NWOA 1FNDA 4M9QA 4F3KA 1KSGA 2C4HA 1VYTA 2XR1A 3Q9UA 1Z77A 1VI2A 4CLOA 1SFRA 3H5IA 3KWLA 4M3DA 3T9BA 1A8SA 4BY9E 3D8RA 3ET5A 1TI7A 1FX7A 3EC7A 1XTZA 2KISA 3H1CA 5ERYA 1SQ5A 1KFBB 3KOMA 3UUWA 4BJ5C 2G9VA 3K05A 1YITI 3CC7I 4Y9SA 3EARA 3G89A 1IJBA 4YAKA 1SHZA 1B42A 5DCWA 4DHEA 2VCEA 4X41A 1TK2A 1DIBA 1AHDP 1TJ3A 2D5CA 3LSJA 1XSXA 4TL6A 2I55A 1A77A 4A3MJ 2QUHA 5C3UA 2OORA 2ZITA 3RV3A 5A03A 5CJPA 3MD2A 2RHDA 5HIIA 1B23P 4B3MB 5THQA 4D7AA 3R75A 4ND4A 4H4KC 3VR2A 5FWYA 4P22A 5K6TA 1XGOA 4FDLA 3E7DA 1LZLA 5KVRA 5ED4A 3R3SA 4XRFA 1VBKA 3VI4B 2IVZA 3HKEA 4MB6A 4N5MA 2Q5EA 3A3YA 4RY0A 1ZOIA 3HV2A 3KTDA 1PSDA 3CUQB 1N9GA 5T3YA 4BZXA 1R1TA 3WE7A 2FU4A 2G06A 2PS1A 2NMVA 2VQCA 5CCDA 3TW8B 3PR2B 1J59A 3EEYA 2WFZA 5LQKA 1QQ6A 5AUQA 2JWTA 3BMNA 4EGJA 2FG7C 4ITRC 2P3LA 4BUJA 4XN0A 1Y9ZA 2ZJ3A 5AVUA 1DINA 5KZMB 5DWVA 4L22A 5AVSA 2RGEA 3JQAD 4L5CA 5D87A 5ALEA 1ODTC 2IA1A 1GILA 3K70B 2KMLA 3VPDA 3RC3A 3PWKA 3PNKA 1BFUA 3CIOA 2EIHA 4JKIA 3S2GA 1PFVA 1I33A 3EDQA 1B59A 3SDGA 4TMWA 3GHHA 1JR3E 4DE5A 1JU9A 4DDWA 1E17A 5EF6A