1U0ND

The ternary von willebrand factor a1-glycoprotein ibalpha-botrocetin complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
265
structure length
265
Chain Sequence
HPICEVSKVASHLEVNCDKRQLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNQLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Willebrand factor
publication title The snake venom protein botrocetin acts as a biological brace to promote dysfunctional platelet aggregation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 59
structure length 265
sequence length 265
ec nomenclature
pdb deposition date 2004-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01462 LRRNT Leucine rich repeat N-terminal domain
D PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1u0nD00
2Z63A 1KOHA 2BEXA 3G3AA 2OMYA 1XCDA 3E3ZA 4EZGA 1O6SA 3G39A 3VQ1A 1YRGA 2O6QA 4HQ1A 2Q4GW 1PGVA 4U7LA 5FTTB 2FT3A 1FQVA 2A0ZA 3SB4A 4Q3GA 3RW6A 1W8AA 4R0AA 2OMTA 4R5CA 3OJAA 5HZLB 1G9UA 2WQWA 5CMNA 2UZYA 4V2EA 2WQUA 2ELLA 1O6VA 1GWBA 2O6RA 1OZNA 3RJ0A 4RCWA 4U08A 3O53A 3ULUA 4L3FA 4R07A 2CA6A 2IFGA 1H6UA 4G8AA 4I6JB 3O6NA 4LSXA 3WPIA 4C2BB 2P1OB 3C6NB 3G3BA 3RFSA 5GS2B 4U09A 5AWDA 3ZYJA 1O6TA 5IJBA 5A5CA 2OMVA 3E4GA 1P8TA 2Z7XA 1A9NA 3DZEA 4Y61B 3RGZA 2ASSB 4Q3IA 4ECNA 2OMZA 2UZXA 1WWLA 4M7EA 2ID5A 3E6JA 4TZHA 3RGXA 1M9SA 3CVRA 4RCAB 3RFEA 3ZYIA 2Z65A 1DCEA 4XOSA 4MN8B 4R6AA 1U0ND 2P1PB 2P1NB 2XWTC 4V2CA 2OMXA 1Z7XW 4LXSA 3W3LA 3G06A 1FT8A 2WFHA 3M18A 3WN4A 3FXIA 3PMHG 4FD0A 5GMGA 2Y5QA 4R6GA 4ECOA 3E2JA 5B0NA 4Z94G 5IJDA 3OGKB 4U06A 4J0MA 3UL9A 4RWTC 4QC0A 2ASTB 4LI2A 4R58A 3RIZA 4KXFB 4P8SA 4BSSA 2P1MB 3UL7A 4P91A 3TSRE 4Q62A 4Z8GA 5B0TA 4LSXC 1XWDC 4WP6A 4ARNA 3ZYNA 5D3IA 3WPHA 3W3MA 4CILA 3GOZA 4MQWX 5B4PA 1QYYA 3RW7A 2JE0A 2Z64A 4R5DA 3VQ2A 5AWCA 1M0ZA 4PQ8A 2Z7XB 5GS0A 4R09A 3W3JA 3WPBA 1IO0A 3W3KA 2P1QB 3W3NA 4CNCA 4B8CD 4M7EC 4GLPA 4Z79A 1M10B 4KT1A 3WPEA 3UL8A 5GMFA 2OMUA 2Z81A 2V9TB 1A4YA 2V70A 3WPCA 4KNGA 4UFRA 1XEUA 2O6SA 3W3GA 2JQDA 4WYKA 3JB9j 3WPGA 2Z82A 4PSJA 1LTXA 5HDHA 4NKGA 4PKIG 3KJ4A 1OTOA 3M19A 1SQ0B 4Z64C 2XOTA 3OJAB 4BSRA 1K5GC 1D0BA 4LSCA 4PERA 3RFJA 2Z62A 4ARRA 4YEBB 4C2AB 1DFJI 5AWBA 2OMWA 4LXRA 3WPDA 4CP6A 1DS9A 1P8VA 1XKUA 4BV4R 1P9AG 3REZA 4QBZA 4LSAA 4NKHA 2JE1A 3WPFA 5IJCA 4BSUA 1OOKG 1OTNA 4FCGA 4R08A 3ULVA 1K5DC 2BNHA 1JL5A 3OGMB 4XGOA 4GT6A 4XSQA 4H09A 5CMPA 2RR6A 3BZ5A 3CIGA 4R6FA 4AW4A 4L3AA 4AY9X 4FS7A 1KOOA 2WQVA 5AWAA 1XECA 4FDWA 4CC4C 4CC4A 4K17A 5IYXC 2R9UA 2RA8A 4IM6A 1FO1A 4FMZA 4J4LA 4LI1A 3ZYOA 1M9LA 3A79B 2Z66A 3ULAA 5LFNA 3C6OB 5AZ5A 1FS2A 4FHOA 4PEQB 4CNMA 3P72A 3G04C 1OTMA 3OGLB 1H6TA 5GQRK 4OQTA 2WQXA 4R6JA 3CIYA 2V9SA 3C6PB 1ZIWA 4QXEA 4V2DA 4Z61C 5GMHA 1OGQA 3UN9A
chains in the Genus database with same CATH superfamily
2Z63A 1KOHA 2BEXA 3G3AA 2OMYA 1XCDA 3E3ZA 4EZGA 1O6SA 3G39A 3VQ1A 1YRGA 2O6QA 4HQ1A 2Q4GW 1PGVA 4U7LA 5FTTB 2FT3A 1FQVA 2A0ZA 3SB4A 4Q3GA 3RW6A 1W8AA 4R0AA 2OMTA 4R5CA 3OJAA 5HZLB 1G9UA 2WQWA 5CMNA 2UZYA 4V2EA 2WQUA 2ELLA 1O6VA 1GWBA 2O6RA 1OZNA 3RJ0A 4RCWA 4U08A 3O53A 3ULUA 4L3FA 4R07A 2CA6A 2IFGA 1H6UA 4G8AA 4I6JB 3O6NA 4LSXA 3WPIA 4C2BB 2P1OB 3C6NB 3G3BA 3RFSA 5GS2B 4NZRM 4U09A 4NZTM 5AWDA 3ZYJA 1O6TA 5IJBA 5A5CA 2OMVA 3E4GA 1P8TA 2Z7XA 1A9NA 3DZEA 4Y61B 3RGZA 2ASSB 4Q3IA 4ECNA 2OMZA 2UZXA 1WWLA 4M7EA 2ID5A 3E6JA 4TZHA 3RGXA 1M9SA 3CVRA 4RCAB 3RFEA 3ZYIA 2Z65A 1DCEA 4XOSA 4MN8B 4R6AA 1U0ND 2P1PB 2P1NB 2XWTC 4V2CA 2OMXA 1Z7XW 4LXSA 3W3LA 3G06A 1FT8A 2WFHA 3M18A 3WN4A 3FXIA 3PMHG 4FD0A 5GMGA 2Y5QA 4R6GA 4ECOA 3E2JA 5B0NA 4Z94G 5IJDA 3OGKB 4U06A 4J0MA 3UL9A 4RWTC 4QC0A 2ASTB 4LI2A 4R58A 3RIZA 4KXFB 4P8SA 4BSSA 2P1MB 3UL7A 4P91A 3TSRE 4Q62A 4Z8GA 5B0TA 4LSXC 1XWDC 4WP6A 4ARNA 3ZYNA 5D3IA 3WPHA 3W3MA 4CILA 3GOZA 4MQWX 5B4PA 1QYYA 3RW7A 2JE0A 2Z64A 4R5DA 3VQ2A 5AWCA 1M0ZA 4PQ8A 2Z7XB 5GS0A 4R09A 3W3JA 3WPBA 1IO0A 3W3KA 2P1QB 3W3NA 4CNCA 4B8CD 4M7EC 4GLPA 4Z79A 1M10B 4KT1A 3WPEA 3UL8A 5GMFA 2OMUA 2Z81A 2V9TB 1A4YA 2V70A 3WPCA 4KNGA 4UFRA 1XEUA 2O6SA 3W3GA 2JQDA 4WYKA 3JB9j 3WPGA 2Z82A 4PSJA 1LTXA 5HDHA 4NKGA 4PKIG 3KJ4A 1OTOA 3M19A 1SQ0B 4Z64C 2XOTA 3OJAB 4BSRA 1K5GC 1D0BA 4LSCA 4PERA 3RFJA 2Z62A 4ARRA 4YEBB 4C2AB 1DFJI 5AWBA 2OMWA 4LXRA 3WPDA 4CP6A 1DS9A 1P8VA 1XKUA 4BV4R 1P9AG 3REZA 4QBZA 4LSAA 4NKHA 2JE1A 3WPFA 5IJCA 4BSUA 1OOKG 1OTNA 4FCGA 4R08A 3ULVA 1K5DC 2BNHA 1JL5A 3OGMB 4XGOA 4GT6A 4XSQA 4H09A 5CMPA 2RR6A 3BZ5A 3CIGA 4R6FA 4AW4A 4L3AA 4AY9X 4FS7A 1KOOA 2WQVA 5AWAA 1XECA 4FDWA 4CC4C 4CC4A 4K17A 5IYXC 2R9UA 2RA8A 4IM6A 1FO1A 4FMZA 4J4LA 4LI1A 3ZYOA 1M9LA 3A79B 2Z66A 3ULAA 5LFNA 3C6OB 5AZ5A 1FS2A 4FHOA 4PEQB 4CNMA 3P72A 3G04C 1OTMA 3OGLB 1H6TA 5GQRK 4OQTA 2WQXA 4R6JA 3CIYA 2V9SA 3C6PB 1ZIWA 4QXEA 4V2DA 4Z61C 5GMHA 1OGQA 3UN9A
chains in the Genus database with same CATH topology
2Z63A 1KOHA 2BEXA 3G3AA 2OMYA 1XCDA 3E3ZA 4EZGA 1O6SA 3G39A 3VQ1A 1YRGA 2O6QA 4HQ1A 2Q4GW 1PGVA 4U7LA 5FTTB 2FT3A 1FQVA 2A0ZA 3SB4A 4Q3GA 3RW6A 1W8AA 4R0AA 2OMTA 4R5CA 3OJAA 5HZLB 1G9UA 2WQWA 5CMNA 2UZYA 4V2EA 2WQUA 2ELLA 1O6VA 1GWBA 2O6RA 1OZNA 3RJ0A 4RCWA 4U08A 3O53A 3ULUA 4L3FA 4R07A 2CA6A 2IFGA 1H6UA 4G8AA 4I6JB 3O6NA 4LSXA 3WPIA 4C2BB 2P1OB 3C6NB 3G3BA 3RFSA 5GS2B 4U09A 5AWDA 3ZYJA 1O6TA 5IJBA 5A5CA 2OMVA 3E4GA 1P8TA 2Z7XA 1A9NA 3DZEA 4Y61B 3RGZA 2ASSB 4Q3IA 4ECNA 2OMZA 2UZXA 1WWLA 4M7EA 2ID5A 3E6JA 4TZHA 3RGXA 1M9SA 3CVRA 4RCAB 3RFEA 3ZYIA 2Z65A 1DCEA 4XOSA 4MN8B 4R6AA 1U0ND 2P1PB 2P1NB 2XWTC 4V2CA 2OMXA 1Z7XW 4LXSA 3W3LA 3G06A 1FT8A 2WFHA 3M18A 3WN4A 3FXIA 3PMHG 4FD0A 5GMGA 2Y5QA 4R6GA 4ECOA 3E2JA 5B0NA 4Z94G 5IJDA 3OGKB 4U06A 4J0MA 3UL9A 4RWTC 4QC0A 2ASTB 4LI2A 4R58A 3RIZA 4KXFB 4P8SA 4BSSA 2P1MB 3UL7A 4P91A 3TSRE 4Q62A 4Z8GA 5B0TA 4LSXC 1XWDC 4WP6A 4ARNA 3ZYNA 5D3IA 3WPHA 3W3MA 4CILA 3GOZA 4MQWX 5B4PA 1QYYA 3RW7A 2JE0A 2Z64A 4R5DA 3VQ2A 5AWCA 1M0ZA 4PQ8A 2Z7XB 5GS0A 4R09A 3W3JA 3WPBA 1IO0A 3W3KA 2P1QB 3W3NA 4CNCA 4B8CD 4M7EC 4GLPA 4Z79A 1M10B 4KT1A 3WPEA 3UL8A 5GMFA 2OMUA 2Z81A 2V9TB 1A4YA 2V70A 3WPCA 4KNGA 4UFRA 1XEUA 2O6SA 3W3GA 2JQDA 4WYKA 3JB9j 3WPGA 2Z82A 4PSJA 1LTXA 5HDHA 4NKGA 4PKIG 3KJ4A 1OTOA 3M19A 1SQ0B 4Z64C 2XOTA 3OJAB 4BSRA 1K5GC 1D0BA 4LSCA 4PERA 3RFJA 2Z62A 4ARRA 4YEBB 4C2AB 1DFJI 5AWBA 2OMWA 4LXRA 3WPDA 4CP6A 1DS9A 1P8VA 1XKUA 4BV4R 1P9AG 3REZA 4QBZA 4LSAA 4NKHA 2JE1A 3WPFA 5IJCA 4BSUA 1OOKG 1OTNA 4FCGA 4R08A 3ULVA 1K5DC 2BNHA 1JL5A 3OGMB 4XGOA 4GT6A 4XSQA 4H09A 5CMPA 2RR6A 3BZ5A 3CIGA 4R6FA 4AW4A 4L3AA 4AY9X 4FS7A 1KOOA 2WQVA 5AWAA 1XECA 4FDWA 4CC4C 4CC4A 4K17A 5IYXC 2R9UA 2RA8A 4IM6A 1FO1A 4FMZA 4J4LA 4LI1A 3ZYOA 1M9LA 3A79B 2Z66A 3ULAA 5LFNA 3C6OB 5AZ5A 1FS2A 4FHOA 4PEQB 4CNMA 3P72A 3G04C 1OTMA 3OGLB 1H6TA 5GQRK 4OQTA 2WQXA 4R6JA 3CIYA 2V9SA 3C6PB 1ZIWA 4QXEA 4V2DA 4Z61C 5GMHA 1OGQA 3UN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z63 A;  1KOH A;  2BEX A;  3G3A A;  2OMY A;  1XCD A;  3E3Z A;  4EZG A;  1O6S A;  3G39 A;  3VQ1 A;  1YRG A;  2O6Q A;  4HQ1 A;  2Q4G W;  1PGV A;  4U7L A;  5FTT B;  2FT3 A;  1FQV A;  2A0Z A;  3SB4 A;  4Q3G A;  3RW6 A;  1W8A A;  4R0A A;  2OMT A;  4R5C A;  3OJA A;  5HZL B;  1G9U A;  2WQW A;  5CMN A;  2UZY A;  4V2E A;  2WQU A;  2ELL A;  1O6V A;  1GWB A;  2O6R A;  1OZN A;  3RJ0 A;  4RCW A;  4U08 A;  3O53 A;  3ULU A;  4L3F A;  4R07 A;  2CA6 A;  2IFG A;  1H6U A;  4G8A A;  4I6J B;  3O6N A;  4LSX A;  3WPI A;  4C2B B;  2P1O B;  3C6N B;  3G3B A;  3RFS A;  5GS2 B;  4U09 A;  5AWD A;  3ZYJ A;  1O6T A;  5IJB A;  5A5C A;  2OMV A;  3E4G A;  1P8T A;  2Z7X A;  1A9N A;  3DZE A;  4Y61 B;  3RGZ A;  2ASS B;  4Q3I A;  4ECN A;  2OMZ A;  2UZX A;  1WWL A;  4M7E A;  2ID5 A;  3E6J A;  4TZH A;  3RGX A;  1M9S A;  3CVR A;  4RCA B;  3RFE A;  3ZYI A;  2Z65 A;  1DCE A;  4XOS A;  4MN8 B;  4R6A A;  1U0N D;  2P1P B;  2P1N B;  2XWT C;  4V2C A;  2OMX A;  1Z7X W;  4LXS A;  3W3L A;  3G06 A;  1FT8 A;  2WFH A;  3M18 A;  3WN4 A;  3FXI A;  3PMH G;  4FD0 A;  5GMG A;  2Y5Q A;  4R6G A;  4ECO A;  3E2J A;  5B0N A;  4Z94 G;  5IJD A;  3OGK B;  4U06 A;  4J0M A;  3UL9 A;  4RWT C;  4QC0 A;  2AST B;  4LI2 A;  4R58 A;  3RIZ A;  4KXF B;  4P8S A;  4BSS A;  2P1M B;  3UL7 A;  4P91 A;  3TSR E;  4Q62 A;  4Z8G A;  5B0T A;  4LSX C;  1XWD C;  4WP6 A;  4ARN A;  3ZYN A;  5D3I A;  3WPH A;  3W3M A;  4CIL A;  3GOZ A;  4MQW X;  5B4P A;  1QYY A;  3RW7 A;  2JE0 A;  2Z64 A;  4R5D A;  3VQ2 A;  5AWC A;  1M0Z A;  4PQ8 A;  2Z7X B;  5GS0 A;  4R09 A;  3W3J A;  3WPB A;  1IO0 A;  3W3K A;  2P1Q B;  3W3N A;  4CNC A;  4B8C D;  4M7E C;  4GLP A;  4Z79 A;  1M10 B;  4KT1 A;  3WPE A;  3UL8 A;  5GMF A;  2OMU A;  2Z81 A;  2V9T B;  1A4Y A;  2V70 A;  3WPC A;  4KNG A;  4UFR A;  1XEU A;  2O6S A;  3W3G A;  2JQD A;  4WYK A;  3JB9 j;  3WPG A;  2Z82 A;  4PSJ A;  1LTX A;  5HDH A;  4NKG A;  4PKI G;  3KJ4 A;  1OTO A;  3M19 A;  1SQ0 B;  4Z64 C;  2XOT A;  3OJA B;  4BSR A;  1K5G C;  1D0B A;  4LSC A;  4PER A;  3RFJ A;  2Z62 A;  4ARR A;  4YEB B;  4C2A B;  1DFJ I;  5AWB A;  2OMW A;  4LXR A;  3WPD A;  4CP6 A;  1DS9 A;  1P8V A;  1XKU A;  4BV4 R;  1P9A G;  3REZ A;  4QBZ A;  4LSA A;  4NKH A;  2JE1 A;  3WPF A;  5IJC A;  4BSU A;  1OOK G;  1OTN A;  4FCG A;  4R08 A;  3ULV A;  1K5D C;  2BNH A;  1JL5 A;  3OGM B;  4XGO A;  4GT6 A;  4XSQ A;  4H09 A;  5CMP A;  2RR6 A;  3BZ5 A;  3CIG A;  4R6F A;  4AW4 A;  4L3A A;  4AY9 X;  4FS7 A;  1KOO A;  2WQV A;  5AWA A;  1XEC A;  4FDW A;  4CC4 C;  4CC4 A;  4K17 A;  5IYX C;  2R9U A;  2RA8 A;  4IM6 A;  1FO1 A;  4FMZ A;  4J4L A;  4LI1 A;  3ZYO A;  1M9L A;  3A79 B;  2Z66 A;  3ULA A;  5LFN A;  3C6O B;  5AZ5 A;  1FS2 A;  4FHO A;  4PEQ B;  4CNM A;  3P72 A;  3G04 C;  1OTM A;  3OGL B;  1H6T A;  5GQR K;  4OQT A;  2WQX A;  4R6J A;  3CIY A;  2V9S A;  3C6P B;  1ZIW A;  4QXE A;  4V2D A;  4Z61 C;  5GMH A;  1OGQ A;  3UN9 A; 
#chains in the Genus database with same CATH topology
 2Z63 A;  1KOH A;  2BEX A;  3G3A A;  2OMY A;  1XCD A;  3E3Z A;  4EZG A;  1O6S A;  3G39 A;  3VQ1 A;  1YRG A;  2O6Q A;  4HQ1 A;  2Q4G W;  1PGV A;  4U7L A;  5FTT B;  2FT3 A;  1FQV A;  2A0Z A;  3SB4 A;  4Q3G A;  3RW6 A;  1W8A A;  4R0A A;  2OMT A;  4R5C A;  3OJA A;  5HZL B;  1G9U A;  2WQW A;  5CMN A;  2UZY A;  4V2E A;  2WQU A;  2ELL A;  1O6V A;  1GWB A;  2O6R A;  1OZN A;  3RJ0 A;  4RCW A;  4U08 A;  3O53 A;  3ULU A;  4L3F A;  4R07 A;  2CA6 A;  2IFG A;  1H6U A;  4G8A A;  4I6J B;  3O6N A;  4LSX A;  3WPI A;  4C2B B;  2P1O B;  3C6N B;  3G3B A;  3RFS A;  5GS2 B;  4NZR M;  4U09 A;  4NZT M;  5AWD A;  3ZYJ A;  1O6T A;  5IJB A;  5A5C A;  2OMV A;  3E4G A;  1P8T A;  2Z7X A;  1A9N A;  3DZE A;  4Y61 B;  3RGZ A;  2ASS B;  4Q3I A;  4ECN A;  2OMZ A;  2UZX A;  1WWL A;  4M7E A;  2ID5 A;  3E6J A;  4TZH A;  3RGX A;  1M9S A;  3CVR A;  4RCA B;  3RFE A;  3ZYI A;  2Z65 A;  1DCE A;  4XOS A;  4MN8 B;  4R6A A;  1U0N D;  2P1P B;  2P1N B;  2XWT C;  4V2C A;  2OMX A;  1Z7X W;  4LXS A;  3W3L A;  3G06 A;  1FT8 A;  2WFH A;  3M18 A;  3WN4 A;  3FXI A;  3PMH G;  4FD0 A;  5GMG A;  2Y5Q A;  4R6G A;  4ECO A;  3E2J A;  5B0N A;  4Z94 G;  5IJD A;  3OGK B;  4U06 A;  4J0M A;  3UL9 A;  4RWT C;  4QC0 A;  2AST B;  4LI2 A;  4R58 A;  3RIZ A;  4KXF B;  4P8S A;  4BSS A;  2P1M B;  3UL7 A;  4P91 A;  3TSR E;  4Q62 A;  4Z8G A;  5B0T A;  4LSX C;  1XWD C;  4WP6 A;  4ARN A;  3ZYN A;  5D3I A;  3WPH A;  3W3M A;  4CIL A;  3GOZ A;  4MQW X;  5B4P A;  1QYY A;  3RW7 A;  2JE0 A;  2Z64 A;  4R5D A;  3VQ2 A;  5AWC A;  1M0Z A;  4PQ8 A;  2Z7X B;  5GS0 A;  4R09 A;  3W3J A;  3WPB A;  1IO0 A;  3W3K A;  2P1Q B;  3W3N A;  4CNC A;  4B8C D;  4M7E C;  4GLP A;  4Z79 A;  1M10 B;  4KT1 A;  3WPE A;  3UL8 A;  5GMF A;  2OMU A;  2Z81 A;  2V9T B;  1A4Y A;  2V70 A;  3WPC A;  4KNG A;  4UFR A;  1XEU A;  2O6S A;  3W3G A;  2JQD A;  4WYK A;  3JB9 j;  3WPG A;  2Z82 A;  4PSJ A;  1LTX A;  5HDH A;  4NKG A;  4PKI G;  3KJ4 A;  1OTO A;  3M19 A;  1SQ0 B;  4Z64 C;  2XOT A;  3OJA B;  4BSR A;  1K5G C;  1D0B A;  4LSC A;  4PER A;  3RFJ A;  2Z62 A;  4ARR A;  4YEB B;  4C2A B;  1DFJ I;  5AWB A;  2OMW A;  4LXR A;  3WPD A;  4CP6 A;  1DS9 A;  1P8V A;  1XKU A;  4BV4 R;  1P9A G;  3REZ A;  4QBZ A;  4LSA A;  4NKH A;  2JE1 A;  3WPF A;  5IJC A;  4BSU A;  1OOK G;  1OTN A;  4FCG A;  4R08 A;  3ULV A;  1K5D C;  2BNH A;  1JL5 A;  3OGM B;  4XGO A;  4GT6 A;  4XSQ A;  4H09 A;  5CMP A;  2RR6 A;  3BZ5 A;  3CIG A;  4R6F A;  4AW4 A;  4L3A A;  4AY9 X;  4FS7 A;  1KOO A;  2WQV A;  5AWA A;  1XEC A;  4FDW A;  4CC4 C;  4CC4 A;  4K17 A;  5IYX C;  2R9U A;  2RA8 A;  4IM6 A;  1FO1 A;  4FMZ A;  4J4L A;  4LI1 A;  3ZYO A;  1M9L A;  3A79 B;  2Z66 A;  3ULA A;  5LFN A;  3C6O B;  5AZ5 A;  1FS2 A;  4FHO A;  4PEQ B;  4CNM A;  3P72 A;  3G04 C;  1OTM A;  3OGL B;  1H6T A;  5GQR K;  4OQT A;  2WQX A;  4R6J A;  3CIY A;  2V9S A;  3C6P B;  1ZIW A;  4QXE A;  4V2D A;  4Z61 C;  5GMH A;  1OGQ A;  3UN9 A; 
#chains in the Genus database with same CATH homology
 2Z63 A;  1KOH A;  2BEX A;  3G3A A;  2OMY A;  1XCD A;  3E3Z A;  4EZG A;  1O6S A;  3G39 A;  3VQ1 A;  1YRG A;  2O6Q A;  4HQ1 A;  2Q4G W;  1PGV A;  4U7L A;  5FTT B;  2FT3 A;  1FQV A;  2A0Z A;  3SB4 A;  4Q3G A;  3RW6 A;  1W8A A;  4R0A A;  2OMT A;  4R5C A;  3OJA A;  5HZL B;  1G9U A;  2WQW A;  5CMN A;  2UZY A;  4V2E A;  2WQU A;  2ELL A;  1O6V A;  1GWB A;  2O6R A;  1OZN A;  3RJ0 A;  4RCW A;  4U08 A;  3O53 A;  3ULU A;  4L3F A;  4R07 A;  2CA6 A;  2IFG A;  1H6U A;  4G8A A;  4I6J B;  3O6N A;  4LSX A;  3WPI A;  4C2B B;  2P1O B;  3C6N B;  3G3B A;  3RFS A;  5GS2 B;  4U09 A;  5AWD A;  3ZYJ A;  1O6T A;  5IJB A;  5A5C A;  2OMV A;  3E4G A;  1P8T A;  2Z7X A;  1A9N A;  3DZE A;  4Y61 B;  3RGZ A;  2ASS B;  4Q3I A;  4ECN A;  2OMZ A;  2UZX A;  1WWL A;  4M7E A;  2ID5 A;  3E6J A;  4TZH A;  3RGX A;  1M9S A;  3CVR A;  4RCA B;  3RFE A;  3ZYI A;  2Z65 A;  1DCE A;  4XOS A;  4MN8 B;  4R6A A;  1U0N D;  2P1P B;  2P1N B;  2XWT C;  4V2C A;  2OMX A;  1Z7X W;  4LXS A;  3W3L A;  3G06 A;  1FT8 A;  2WFH A;  3M18 A;  3WN4 A;  3FXI A;  3PMH G;  4FD0 A;  5GMG A;  2Y5Q A;  4R6G A;  4ECO A;  3E2J A;  5B0N A;  4Z94 G;  5IJD A;  3OGK B;  4U06 A;  4J0M A;  3UL9 A;  4RWT C;  4QC0 A;  2AST B;  4LI2 A;  4R58 A;  3RIZ A;  4KXF B;  4P8S A;  4BSS A;  2P1M B;  3UL7 A;  4P91 A;  3TSR E;  4Q62 A;  4Z8G A;  5B0T A;  4LSX C;  1XWD C;  4WP6 A;  4ARN A;  3ZYN A;  5D3I A;  3WPH A;  3W3M A;  4CIL A;  3GOZ A;  4MQW X;  5B4P A;  1QYY A;  3RW7 A;  2JE0 A;  2Z64 A;  4R5D A;  3VQ2 A;  5AWC A;  1M0Z A;  4PQ8 A;  2Z7X B;  5GS0 A;  4R09 A;  3W3J A;  3WPB A;  1IO0 A;  3W3K A;  2P1Q B;  3W3N A;  4CNC A;  4B8C D;  4M7E C;  4GLP A;  4Z79 A;  1M10 B;  4KT1 A;  3WPE A;  3UL8 A;  5GMF A;  2OMU A;  2Z81 A;  2V9T B;  1A4Y A;  2V70 A;  3WPC A;  4KNG A;  4UFR A;  1XEU A;  2O6S A;  3W3G A;  2JQD A;  4WYK A;  3JB9 j;  3WPG A;  2Z82 A;  4PSJ A;  1LTX A;  5HDH A;  4NKG A;  4PKI G;  3KJ4 A;  1OTO A;  3M19 A;  1SQ0 B;  4Z64 C;  2XOT A;  3OJA B;  4BSR A;  1K5G C;  1D0B A;  4LSC A;  4PER A;  3RFJ A;  2Z62 A;  4ARR A;  4YEB B;  4C2A B;  1DFJ I;  5AWB A;  2OMW A;  4LXR A;  3WPD A;  4CP6 A;  1DS9 A;  1P8V A;  1XKU A;  4BV4 R;  1P9A G;  3REZ A;  4QBZ A;  4LSA A;  4NKH A;  2JE1 A;  3WPF A;  5IJC A;  4BSU A;  1OOK G;  1OTN A;  4FCG A;  4R08 A;  3ULV A;  1K5D C;  2BNH A;  1JL5 A;  3OGM B;  4XGO A;  4GT6 A;  4XSQ A;  4H09 A;  5CMP A;  2RR6 A;  3BZ5 A;  3CIG A;  4R6F A;  4AW4 A;  4L3A A;  4AY9 X;  4FS7 A;  1KOO A;  2WQV A;  5AWA A;  1XEC A;  4FDW A;  4CC4 C;  4CC4 A;  4K17 A;  5IYX C;  2R9U A;  2RA8 A;  4IM6 A;  1FO1 A;  4FMZ A;  4J4L A;  4LI1 A;  3ZYO A;  1M9L A;  3A79 B;  2Z66 A;  3ULA A;  5LFN A;  3C6O B;  5AZ5 A;  1FS2 A;  4FHO A;  4PEQ B;  4CNM A;  3P72 A;  3G04 C;  1OTM A;  3OGL B;  1H6T A;  5GQR K;  4OQT A;  2WQX A;  4R6J A;  3CIY A;  2V9S A;  3C6P B;  1ZIW A;  4QXE A;  4V2D A;  4Z61 C;  5GMH A;  1OGQ A;  3UN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...