1U0XA

Crystal structure of nitrophorin 4 under pressure of xenon (200 psi)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
184
structure length
184
Chain Sequence
b'ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrophorin 4
publication title Structural dynamics controls nitric oxide affinity in nitrophorin 4
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Transport protein
total genus 49
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2004-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1u0xA00
3DTQA 1ML7A 1YWCA 1KT6A 1BRPA 4Y0PA 4I3BA 1JJJA 1PEEA 3CBSA 4YFPA 3ELXA 5B29A 2W2BA 2ANSA 1SXYA 2XSTA 3NP1A 3WJCA 1B8EA 2FR2A 4TNNA 1FEMA 2AL0X 1HBQA 2A2UA 3JS1A 4QAEA 1TW4A 3RSWA 1BSYA 2ALLX 4DQ4A 1SY0A 2X46A 2R74A 2MM3A 2RCQA 2NP1A 5KHPA 4YKOA 1A57A 1A3YA 1EW3A 1ERXA 1KQXA 2WEXA 3FENA 4I3DA 4A1YA 1OBQA 1DC9A 2CM4A 1XKIA 5BVQA 1MX7A 5C0NA 1QY2A 4WFVA 4ZFXA 1B0OA 1QWDA 3STNA 2CM9A 5FENA 2FR3A 1GT4A 2CZTA 3ZUIA 4ES7A 3B2HA 1MX8A 2WQAE 2LKKA 3FMZA 3KFFA 1HMTA 3FR2A 2OFRX 5KICA 1DF3A 4ZH6A 3P6FA 3HWFA 5L8IA 1KGLA 1GGLA 3BSZE 3CR6A 4AZMA 1LNMA 2ACOA 3BX8A 3P6CA 2QO4A 5LJKA 5HCDC 1U0XA 2HMBA 1X8QA 3D96A 1N0SA 3TGAA 1TOUA 3TZSA 4AZPA 2E4JA 4QZUA 4OMXA 2FWVA 3APWA 2BLGA 1JV4A 5EEDA 4AYHA 4D6BA 1CBIA 2GTFX 3BU1A 4YGGA 4OS0A 1TXLA 5LKFA 1Z24A 1ZNHA 1BBPA 4Y0QA 1JBHA 1HMSA 1GM6A 2NNQA 2GC9A 1PBOA 4GNWA 4M6SA 3VG4A 1SY2A 1KT3A 1O8VA 2W2FA 4YCHA 5F6ZA 1RBPA 4A60A 1FELA 5DPQA 2LBVA 1GX8A 1UZ2X 4XMEA 1E02A 4XMHA 5LJGA 1BM5A 3UEUA 1T68X 4GNYA 5LJCA 1JZUA 1YIVA 1FE3A 4IMOA 4QGVA 4GH7A 2R56A 1IW2A 1A2DA 2AT6X 3KFIA 4LZUA 3B2KA 3GAQA 1DZJA 2K23A 2HLVA 3AKNA 4XMCA 1VPRA 1LKEA 3O19A 4HPCA 5D47A 5DG4A 2Q39A 3ELZA 4TKBA 2MJIA 2LB6A 2Q4NA 5HCEC 3MBTA 4TKJA 2RQ0A 4HPAA 1G7NA 1BRQA 2JU3A 1EXSA 5D45A 1S2PA 3BDRA 1DV9A 1MUPA 1GXAA 1OEJA 1SA8A 3WJBA 5BVSA 4XMDA 2A3FX 4AZQA 3APUA 1OPBA 2P8GA 4AW8A 5IO6A 4EXZA 1LIBA 1G5WA 5LJDA 5F58A 1NP4A 1ZNDA 3DSZA 2HZRA 2AT5X 1KT5A 1KXOA 2EU7X 3CMPA 4N7DA 1LPJA 2A0AA 3FW5A 4GKCA 3UEVA 2HYSA 1JYDA 5CE4A 1YUPA 3UEWA 2X45A 3IA8A 3NX2A 4O9SA 3VG2A 4MVLA 5HTEA 1S7DA 3FA8A 3HWEA 2RCTA 4GRJA 4NNTA 2WSJA 2Q2MA 3FR4A 3STMX 3P6HA 2ASNX 4YH0A 2GJ5A 3HWDA 3F9DA 1KT4A 2N93A 5L8NA 1G74A 3AKMA 1ALBA 3PP6A 4K19A 4YBUA 5KIDA 3FELA 1IKJA 2WQ9A 3FA9A 4NYQA 1O1VA 4QGWA 3EYCA 3WBGA 1A18A 5HA0A 3C77X 1LIEA 3NX1A 2RD7C 4YFRA 3FR5A 1HQPA 5FAZA 2A2GA 3I0AA 5HBSA 4I3CA 4EDEA 1DZPA 2K62A 4ORWA 1ZNEA 4ALBA 3U03A 1IKEA 3KQ0A 5D48A 1S44A 3VG5A 2R73A 4R0BA 3CWKA 2MO5A 5EZ2A 3ZUOA 2L5PA 2OZQA 4D6AA 4ZJ0A 4IB9A 3EBWA 3VG7A 3C78X 3EMMA 4AZOA 4TJZA 4YCEA 1EPBA 4NYRA 4ORXA 3TF6A 5LKEA 1LF7A 1AELA 1L6MA 2RA6A 4OS8A 4BVMA 3FEPA 3FA7A 3KFGA 2NNDA 1QY1A 1NGLA 2G7BA 1QG5A 4A1HA 5HZ9A 1B56A 1BWYA 4RUUA 1MDCA 2QO6A 1VYGA 5BVTA 3B2JA 4ORRA 1R0UA 1MVGA 1X8NA 3HK1A 1PM1X 3NPOA 1X8PA 2FS7A 1KZXA 1LIDA 3PPTA 1G85A 4HFOA 4OMWA 2AH7X 1JYJA 1TOWA 5IO7A 3NADA 4YFQA 3CQNA 1GKAB 4ALOA 1T8VA 2O62A 3VG6A 1X8UA 1DZKA 1LIFA 3HWGA 1GX9A 3NQ3A 4UU3A 3BY0A 4IB8A 4ZCBA 3APXA 5HZ5A 3WJFA 5K06A 1BLRA 4TKHA 4I9RA 4ZH9A 4ZHCA 1DZMA 1QFTA 1X89A 3EM0A 1OEEA 4QGXA 3CQRA 5EEEA 3WJGA 3O2YA 4ORYA 2QM9A 1YWDA 2L9CA 1BSQA 3P6GA 5F6BA 3VG3A 1FDQA 5HZ6A 5F7GA 1KOIA 3TGBA 1GT3A 4ZHDA 1NP1A 1QQSA 4ARHA 3D97A 2F73A 1SXUA 2AT0X 4YGHA 1B4MA 3QKGA 2JU7A 1AB0A 4MVKA 1XCAA 3B2IA 2HNXA 3IFBA 4HPBA 2FT9A 3FIQA 4TLJA 4GETA 2Q9SA 4DQ3A 3L4RA 2IFBA 2PY1A 3WJEA 1YP6A 3P6DA 4BQUA 3P6EA 1HN2A 2OVEA 4QYNA 5LJEA 1SY1A 2FTBA 2W2AA 4WBKA 4N7CA 2AMMX 1TVQA 2WEWA 4QZTA 4NLJA 3WXQA 2QO5A 3F8AA 2WR6A 1T0VA 5FFHA 2POAA 3KFHA 3PEDA 1IFCA 3FEKA 4IAWA 1E00A 1GT1A 1O1UA 1I4UA 3BLGA 2JN3A 1DFVA 2FLJA 1KT7A 5HZQA 1KQWA 5LJBA 2OFMX 1YWBA 2WWPA 2XKLA 4AZNA 3NR3A 4KIIA 1AVGI 3STKA 4EFGA 1X8OA 2G78A 3BX7A 4NNSA 4PSQA 5H9NA 1HBPA 5EPQA 3Q6LA 5HCCC 5H8TA 1OBUA 1EPAA 1GT5A 1H91A 1IFBA 2LBAA 1I06A 5HTDA 3OJYC 3FA6A 4CK4A 3PH5A 2CBRA 3SAOA 3RZYA 1QY0A 3APVA 1ZNLA 1QFVA 4XMFA 1PMPA 1P6PA 3FW4A 2NNEA 4IBAA 1SXWA 3O22A 5B27A 1OEKA 4IMNA 4ORSA 3WVMA 3BRNA 4LKTA 1IIUA 3JSQA 4Y0RA 3TGCA 4QYPA 3KZAA 1FTPA 4NP1A 4HPDA 4IB6A 2DM5A 3FLLA 5EDCA 3UEXA 5LJHA 4YKMA 2AKQA 2LFOA 2AT8X 4TQ2A 5F1EA 1OPAA 4IAXA 4MVIA 2A13A 5D8JA 4ZGUA 1EALA 3S26A 1D2UA 2FS6A 2KT4B 1BJ7A 2AT3X 3MVFA 1RLBE 4YDAA 5IO5A 1FENA 1SXXA 2G79A 3BS2A 1JJXA 3C76X 5D4AA 1E06A 1CBQA 4IB7A 5JR8A 1E5PA 1ADLA 3I17A 1YP7A 1AQBA 4EEJA 1X71A 1OBPA 4ZHFA 3D95A 5HWZA 1HMRA 1U17A 2CZUA 1ICNA 3U0DA 1ERBA 3PECA 4YDBA 2CBSA 3WJDA 5L8OA 4LZVA 5HZ8A 1CJ5A 1U18A 2L68A 1LICA 5H9KA 1EIOA 1I05A 1EIIA 3K3LA 1QABE 4RUNA 4ORUA 4YBPA 5HA1A 3CBCA 1ICMA 2JOZA 2L67A 2YG2A 1I04A 1SY3A 4LKPA 1YWAA 1ZNGA 2KTDA 1LFOA 4GE1A 5H9AA 1KZWA 1ZRYA 5HAEA 2OVAA 2ACPX 4ZHHA 3NQ9A 1UREA 2OVDA 1GKAA 5H9LA 1BSOA 2QOSC 4AZRA 3T1DA 4YMYA 1EQDA 1D3SA 2Q2PA 1VYFA 4ZHGA 1ACDA 1CRBA 4NLIA 1CBSA 4Y0SA 4A8ZA 4YGZA 5AQ6A 4ZR2A 4XMGA 1ZNKA 3PH6A 2WUTA 1BEBA 3G7XA 1CBRA 4BOEA 5EDBA 4UU2A 2FRSA 2HZQA 3ZQ3A 4ODDA 3B2LA 2JU8A 1EUOA 4M7MA 4I9SA 4WFUA 4OS3A 3BU9A 3U9PC 3EBKA
chains in the Genus database with same CATH superfamily
3DTQA 1ML7A 1YWCA 1KT6A 1BRPA 2CAMA 4Y0PA 4JO6A 4CDDA 4I3BA 1JJJA 1PEEA 3CKGA 3CBSA 4YFPA 3ELXA 5B29A 2W2BA 2ANSA 1SXYA 2XSTA 3NP1A 3WJCA 4CSBA 1FJ1E 1B8EA 2FR2A 1VWGB 1SWNA 1VWQB 1FEMA 4FQBB 2AL0X 4TNNA 2RTCB 1HBQA 1DF8A 2A2UA 3JS1A 1TW4A 4QAEA 1BSYA 3RSWA 2ALLX 4MIRA 1SY0A 1KFFA 1PBYA 2X46A 4DQ4A 5IRAA 2R74A 2MM3A 2RCQA 1JIWI 2NP1A 5KHPA 2IZAA 2RTAA 4YKOA 3RKGA 1A3YA 1A57A 1EW3A 1ERXA 1KQXA 2WEXA 3FENA 4I3DA 3VU1A 1OBQA 4A1YA 1DC9A 3FYFA 2CM4A 1XKIA 2I5ZO 1MX7A 5AJBA 5BVQA 2OY7A 1QY2A 4WFVA 5C0NA 2FGSA 2KD2A 4ON1A 4ZFXA 1B0OA 3ZW0A 1QWDA 3STNA 2CM9A 3SZJA 1PTSA 5FENA 2FR3A 3HTYA 1GT4A 3VHHA 2CZTA 3ZUIA 1SWRA 1LELA 5CSEA 3SLOA 4KH8A 3B2HA 1MX8A 4ES7A 4B55A 4CDFA 2WQAE 2LKKA 3FMZA 4OKAA 1HY2A 3KFFA 1HMTA 3FR2A 2OFRX 5KICA 4GJVA 4ZH6A 3P6FA 1DF3A 3HWFA 3RWXA 5L8IA 3D9WA 1KGLA 1GGLA 3BSZE 3CR6A 4GGRA 4U8UO 4AZMA 1LNMA 3SZIA 4CDCA 2ACOA 4EQAC 3BX8A 3HOLA 1SWDA 3OE3A 3P6CA 2QO4A 5LJKA 5HCDC 1U0XA 2HMBA 4INNA 2OL8O 1X8QA 3D96A 1N0SA 2MHDA 1TOUA 3TGAA 3TZSA 4AZPA 2E4JA 4QZUA 5IRWA 4OMXA 4BJ8A 2FWVA 1OSPO 2BLGA 1JV4A 1MEPA 1NQMA 3APWA 3PQUA 4MVEA 4O3YA 5EEDA 4AYHA 4D6BA 1CBIA 2GTFX 3BU1A 5F2BA 1VWIB 4OS0A 4YGGA 4GD9A 1TXLA 5LKFA 2ZSCA 1Z24A 1ZNHA 1BBPA 4Y0QA 2OL6O 1JBHA 1HMSA 2OY1O 1GM6A 2NNQA 3ZWEA 2GC9A 1PBOA 4GNWA 4M6SA 3VG4A 4BX7B 1N43A 1SY2A 1WUBA 1KT3A 1O8VA 2W2FA 4YCHA 5F6ZA 1RBPA 4A60A 1FELA 5DPQA 1K3BA 2LBVA 1GX8A 1UZ2X 3OBLA 4XMEA 3T2XA 1E02A 2IZKA 4XMHA 5LJGA 2RTNB 1BM5A 3UEUA 4OELA 1T68X 2A5BA 4JGLA 1WBIA 2IZHB 1HXZA 2BS6A 4GNYA 4KC7A 4O3WA 5LJCA 1YIVA 1JZUA 3LTWA 1FE3A 3EC5A 4IMOA 1IJ8A 4QGVA 4GH7A 2R56A 1IW2A 3H3IA 3P24A 1A2DA 3Q34A 1N9YA 2RTKA 4GUZA 2AT6X 5HZ6A 2BS5A 1JQPA 3KFIA 3RE6A 4LZUA 3B2KA 3GAQA 1DZJA 2K23A 2HLVA 2HKDA 1SWQA 3AKNA 1I78A 1VPRA 4XMCA 1LKEA 3O19A 1JJUA 4HPCA 5D47A 5DG4A 2Q39A 3ELZA 4O3XB 4TKBA 2MJIA 2BSZA 2LB6A 2QOMA 4BX7A 2Q4NA 3ZZVA 3GE2A 5HCEC 3SLTA 3MBTA 2RN4A 4TKJA 1SRFA 2X4MA 1I9HA 2RQ0A 4HPAA 1G7NA 1BRQA 4CV7A 2JU3A 1EXSA 4IABA 2IZEB 5D45A 1S2PA 3BDRA 1DV9A 1MUPA 1GXAA 1OEJA 1SA8A 1SRHA 3WJBA 3ZI8A 5BVSA 2IZFB 4XMDA 1LCZA 1Y9LA 2A3FX 2AVIA 2DJFA 3APUA 4AZQA 1OPBA 2P8GA 4AW8A 5IO6A 4EXZA 1LIBA 1Y55X 1G5WA 4O4OA 4Z6JA 5LJDA 5F58A 2BC3A 1NP4A 1ZNDA 3DSZA 2HZRA 2AT5X 1KT5A 1KXOA 2EU7X 1N7YA 3CMPA 4N7DA 1LPJA 2A0AA 3FW5A 4O4XA 4GKCA 3UEVA 2HYSA 2RTLA 5AJCA 1JYDA 2F01A 5CE4A 1MM9A 1YUPA 3UEWA 4BX6B 2X45A 3IA8A 4LQZA 3NX2A 4O9SA 2QMIA 3VG2A 1VWHB 4MVLA 3WYPA 5HTEA 2UYWA 1S7DA 3FA8A 3HWEA 2RCTA 4GRJA 4NNTA 2WSJA 2Q2MA 2RTGB 3FR4A 3STMX 3P6HA 2ASNX 4YH0A 2GJ5A 3HWDA 3F9DA 1KT4A 1N9MA 2N93A 5L8NA 1G74A 2RTPB 1ALBA 1LDQA 3AKMA 3PP6A 3V8UA 2G8CO 3CKFA 4K19A 4YBUA 5KIDA 3FELA 2OF9A 1IKJA 2WQ9A 3FA9A 4NYQA 1LCWA 2VFCA 1O1VA 4QGWA 3EYCA 1VWFB 4I60A 3WBGA 1A18A 1E2TA 5HA0A 4DNEA 3C77X 1LIEA 3NX1A 2RD7C 4YFRA 2FKJA 3FR5A 1HQPA 5FAZA 1LUQA 2A2GA 4U46A 3I0AA 1VWCB 1VWEB 4U9CA 5HBSA 4I3CA 3P02A 2GTLM 4EDEA 1VWKB 1UYOX 1DZPA 2K62A 3RY1A 3S60A 4ORWA 1ZNEA 4GGTA 4ALBA 3U03A 1IKEA 1VWRB 2Y3EA 3ZW1B 3KQ0A 4GJSA 5D48A 1S44A 3VG5A 2R73A 4R0BA 4JNJA 3CWKA 2MO5A 5EZ2A 3ZUOA 4U3QA 2L5PA 2OZQA 4D6AA 1SWUA 1VYOA 4IB9A 4ZJ0A 1SREA 3EBWA 3VG7A 3C78X 3EMMA 4AZOA 1RSUB 2RTRB 3VE2A 4TJZA 4YCEA 3WZQA 1SWKA 2JW1A 1EPBA 4NYRA 1UYNX 4ORXA 3RDSA 3TF6A 1LF7A 4BX5B 5LKEA 1VWLB 1AELA 1L6MA 2RA6A 4OS8A 4BVMA 3JQOA 4CPFA 3FEPA 1SWGA 3FA7A 3KFGA 2NNDA 1QY1A 1BLRA 1NGLA 2MWHA 1SMPI 2G7BA 1QG5A 5FQ7E 3WZNA 4A1HA 1B56A 5HZ9A 1BWYA 4RUUA 1MDCA 2QO6A 3PDFA 1VYGA 2I5VO 5K68A 5BVTA 3B2JA 4ORRA 1R0UA 2VFBA 1MVGA 1X8NA 4O4SA 4COTA 2RTOB 3HK1A 1PM1X 3NPOA 2RTFB 2G5LA 1K24A 1X8PA 2FS7A 2JMBA 2F09A 1LIDA 3PPTA 1G85A 4HFOA 2Z4IA 4GDZA 4OMWA 1RXJA 2AH7X 1SLFB 2RTMA 1JYJA 2RTQB 1TOWA 3D4RA 3NADA 5IO7A 4YFQA 3CQNA 1GKAB 5BYPA 2IZJA 2PI3O 5B2AO 3WYQA 1T8VA 4ALOA 2O62A 2Y32A 3OD9A 3VG6A 1X8UA 1SWEA 2BT9A 1DZKA 1LIFA 1SLGB 1GX9A 2AF5A 3AEHA 3BY0A 3HWGA 3LV4A 3APXA 3NQ3A 4IB8A 2IZBA 4UU3A 4ZCBA 1SWPA 3WJFA 4TKHA 4I9RA 4ZH9A 4OEMA 4PJ2A 4CPIA 4BX5A 4Z2VA 4BCSA 4ZHCA 1DZMA 1QFTA 1X89A 3EM0A 1OEEA 2C4IA 4QGXA 3CQRA 5EEEA 2X32A 2ZAGA 4Z28A 3WJGA 3O2YA 4ID2A 2QM9A 4ORYA 1YWDA 2L9CA 4U8UM 5FQ6E 1BSQA 3P6GA 1SWCA 5F6BA 2A8GA 2OY8A 3VG3A 1FDQA 2YMSA 3F6ZB 1SWFA 3N91A 5F7GA 1KOIA 2WPUA 3T6LA 3VHIA 1GT3A 2Z4HA 3TGBA 2IZDB 4ZHDA 4JHQA 2JGSA 3HOEA 4L3RA 1NP1A 1QQSA 1VWMB 3WZPA 1Y0GA 1SWAA 2OFAA 4ARHA 4GZVA 1MOYA 2FHLA 2RTHB 2F73A 3D97A 3PQSA 1SXUA 2AT0X 3VE1A 4YGHA 1B4MA 3QKGA 2JU7A 1AB0A 4MVKA 5JD2A 1XCAA 1W6FA 3B2IA 1LCVA 3SOTA 2HNXA 2X55A 1EI5A 1W5RA 3IFBA 4HPBA 1VWJB 2FT9A 3FIQA 4TLJA 3VHMA 3MX7A 2Q9SA 4GETA 4DQ3A 1KZXA 4U8UN 4O4UA 3PK2A 1KL5A 3L4RA 2OY5O 2IFBA 2PY1A 4KCAA 3WJEA 1YP6A 4IRWA 3P6DA 5CHKA 5FQ8E 4BQUA 4I95A 4GU8A 5B11O 3P6EA 1HN2A 2OVEA 2OFBA 4QYNA 3RDUA 5LJEA 1SY1A 2FTBA 2W2AA 4WBKA 2BHVA 1VWNB 2OL7A 4N7CA 2AMMX 2RTJA 1TVQA 3NBXX 2IZCB 2WEWA 4QZTA 4NLJA 3WXQA 1STRB 1JMXA 2QO5A 3F8AA 2WR6A 1T0VA 5FFHA 2POAA 4CPHB 3KFHA 2X8TA 3PEDA 3RDMA 1IFCA 3FEKA 4O49A 1AVEA 3MG5A 4FGIB 4IAWA 5L3YA 1E00A 2GH7A 1GT1A 2OVSA 1KL3A 5B3MO 1O1UA 2C1SA 1I4UA 4NW4A 3BLGA 1RAVA 2JN3A 1DFVA 3FIDA 4ML7B 2KW1A 5K67A 2FLJA 1KT7A 5HZQA 1SWTA 1KQWA 3RDOA 5LJBA 2OFMX 1SLEB 1YWBA 2WWPA 4I6SA 2XKLA 4Y5DA 4AZNA 3NR3A 3RDXA 4KIIA 1AVGI 3STKA 4C5PA 3WZOA 1SRIA 2OF8A 1X8OA 2G78A 3BX7A 5B5GA 3X00A 4NNSA 4PSQA 5IRUA 3T6FA 5H9NA 1HBPA 4O3ZA 5EPQA 5HZ5A 1VWAB 3AUMO 3Q6LA 2FHNX 2RTDB 5HCCC 1VWBB 5H8TA 1MK5A 2RTEB 1NC9A 1OBUA 2KTSA 4BX6A 1EPAA 1GT5A 1H91A 1IFBA 1HQQA 1STSB 2LBAA 4CDEA 1I06A 4Z2PA 5HTDA 1LDOA 1STPA 3OJYC 2Y3FA 3FA6A 4CK4A 3PH5A 2CBRA 4CPHA 3SAOA 3RZYA 3TGCA 3UAQA 1QY0A 3APVA 4KT5A 1ZNLA 1QFVA 4XMFA 1PMPA 1P6PA 1AVDA 3FW4A 2NNEA 4IBAA 4NV7A 1HXLA 1SXWA 1SWBA 2IZGB 3O22A 1OEKA 4IMNA 4FBVA 4ORSA 5B27A 5IXGA 3WVMA 3LHNA 3BRNA 4LKTA 1IIUA 2GTLN 2ZAIA 3JSQA 4QQ1A 4QYPA 3KZAA 4Y0RA 4YVBA 5AEOA 1FTPA 1SWLA 4NP1A 4HPDA 4IB6A 2DM5A 3FLLA 5CYBA 5EDCA 3RY2A 3UEXA 5LJHA 4YKMA 3E3CA 2AKQA 2LFOA 2AT8X 3QQ2A 4FBRA 4TQ2A 5F1EA 1OPAA 4IAXA 5B10O 4MVIA 2A13A 3KVNA 2X56A 5D8JA 4EFGA 4ZGUA 1EALA 3S26A 2LA7A 1D2UA 2FS6A 2KT4B 3HPEA 1BJ7A 2AT3X 3MVFA 1RLBE 4YDAA 2VDFA 1SWSA 5IO5A 1FENA 1SXXA 2G79A 2MF6A 2X8FA 3BS2A 1JJXA 3C76X 1Y52X 1RSTB 1SLDB 3ZW1A 3EW2A 5D4AA 1E06A 1CBQA 4IB7A 5JR8A 1E5PA 3T2WA 1ADLA 3I17A 1SWJA 3ZW2A 4HWMA 1YP7A 1AQBA 3SLJA 4EEJA 1X71A 1OBPA 2RTBB 4ZHFA 3D95A 4DCBA 4CPEA 2X8SA 1SRJA 1N4JA 3WOVA 1Y53X 1HMRA 1U17A 2CZUA 1ICNA 5HWZA 3U0DA 1ERBA 4GDAA 3PECA 4KC8A 4QNIA 2CBSA 1SRGA 4YDBA 3RDQA 3WJDA 1W4TA 5L8OA 2DJGA 4LZVA 5HZ8A 5B5FA 3EW1A 4Y59A 1CJ5A 4Z27A 1U18A 2L68A 1LICA 5H9KA 1EIOA 1I05A 1KL4A 4MEEA 1NDJA 2FKGA 3S5XA 1EIIA 3K3LA 4ZGFA 1NBXA 2RTIB 1QABE 4RUNA 4ORUA 4YBPA 1NQNA 5HA1A 1RXHA 3CBCA 1ICMA 2JOZA 2L67A 2YG2A 3VGWA 1I04A 1Y9TA 1SY3A 4LKPA 1YWAA 1ZNGA 2KTDA 1LFOA 4GE1A 5H9AA 3RBYA 1KZWA 1ZRYA 4EKVA 3VPJE 5HAEA 1GX3A 2OVAA 2ACPX 1JMZA 2QCBA 4GK9A 4ZHHA 3NQ9A 1UREA 2OVDA 1GKAA 5H9LA 1BSOA 2QOSC 4AZRA 3T1DA 4YMYA 5K06A 1EQDA 3S5VA 3FDCA 1D3SA 2Q2PA 4FBOA 1VYFA 4Z2OA 2OYBO 4BGFA 4ZHGA 1ACDA 1CRBA 4BBOA 4NLIA 1CBSA 1SWHA 2IZLB 4Y0SA 4A8ZA 2M4LA 2C1QA 4YGZA 5AQ6A 4ZR2A 4XMGA 1ZNKA 3PH6A 2GTLO 2WUTA 1BEBA 1VWPB 1VWDB 3G7XA 1CBRA 3NQKA 2IZIA 4MISA 4BOEA 1VWOB 4NV8A 1SWOA 5EDBA 4GGZA 4QRLA 4UU2A 2FRSA 2HZQA 2A5CA 3ZQ3A 2UZ2A 4ODDA 3RE5A 3B2LA 2JU8A 3SZHA 1RXKA 1EUOA 3MM0A 4L1NA 4M7MA 4I9SA 4WHIA 2X34A 3ZW0B 4WFUA 4OS3A 3BU9A 3U9PC 3EBKA
chains in the Genus database with same CATH topology
3DTQA 1ML7A 1YWCA 1KT6A 1BRPA 4Y0PA 4I3BA 1JJJA 1PEEA 3CBSA 4YFPA 3ELXA 5B29A 2W2BA 2ANSA 1SXYA 2XSTA 3NP1A 3WJCA 4CSBA 1B8EA 2FR2A 4FQBB 1FEMA 4TNNA 2AL0X 1HBQA 2A2UA 3JS1A 4QAEA 1TW4A 3RSWA 1BSYA 2ALLX 4MIRA 1SY0A 2X46A 4DQ4A 2R74A 2MM3A 2RCQA 1JIWI 2NP1A 5KHPA 4YKOA 1A57A 3RKGA 1A3YA 1EW3A 1ERXA 1KQXA 2WEXA 3FENA 4I3DA 3VU1A 1OBQA 4A1YA 1DC9A 3FYFA 2CM4A 1XKIA 5AJBA 1MX7A 5BVQA 5C0NA 1QY2A 4WFVA 2KD2A 4ON1A 4ZFXA 1B0OA 3ZW0A 1QWDA 3STNA 2CM9A 5FENA 2FR3A 3HTYA 1GT4A 2CZTA 3ZUIA 4KH8A 3B2HA 1MX8A 4ES7A 2WQAE 2LKKA 3FMZA 3KFFA 1HMTA 3FR2A 2OFRX 5KICA 1DF3A 4ZH6A 3P6FA 3HWFA 5L8IA 1KGLA 1GGLA 3BSZE 3CR6A 4U8UO 4AZMA 1LNMA 2ACOA 4EQAC 3BX8A 3HOLA 3OE3A 3P6CA 2QO4A 5LJKA 5HCDC 1U0XA 2HMBA 4INNA 1X8QA 3D96A 1N0SA 2MHDA 1TOUA 3TGAA 3TZSA 4AZPA 2E4JA 4QZUA 4OMXA 2FWVA 3APWA 2BLGA 1JV4A 4MVEA 5EEDA 3PQUA 4AYHA 4O3YA 4D6BA 1CBIA 2GTFX 3BU1A 4YGGA 4OS0A 1TXLA 5LKFA 1Z24A 1ZNHA 1BBPA 4Y0QA 1JBHA 1HMSA 3ZWEA 1GM6A 2NNQA 2GC9A 1PBOA 4GNWA 4M6SA 3VG4A 1SY2A 1KT3A 1O8VA 2W2FA 4YCHA 5F6ZA 1RBPA 4A60A 1FELA 5DPQA 2LBVA 1GX8A 1UZ2X 3OBLA 4XMEA 1E02A 4XMHA 5LJGA 1BM5A 3UEUA 1T68X 4JGLA 4KC7A 2BS6A 4GNYA 5LJCA 4O3WA 1JZUA 1YIVA 1FE3A 4IMOA 4QGVA 4GH7A 2R56A 1IW2A 3H3IA 3P24A 1A2DA 2AT6X 2BS5A 3KFIA 4LZUA 3B2KA 3GAQA 1DZJA 2K23A 2HLVA 3AKNA 4XMCA 1VPRA 1LKEA 3O19A 4HPCA 5D47A 5DG4A 2Q39A 3ELZA 4O3XB 4TKBA 2MJIA 2LB6A 2Q4NA 3ZZVA 3GE2A 5HCEC 3MBTA 2RN4A 4TKJA 2RQ0A 4HPAA 1G7NA 1BRQA 4CV7A 2JU3A 1EXSA 4IABA 5D45A 1S2PA 3BDRA 1DV9A 1MUPA 1GXAA 1OEJA 1SA8A 3WJBA 3ZI8A 5BVSA 4XMDA 1Y9LA 2A3FX 4AZQA 3APUA 1OPBA 2P8GA 4AW8A 5IO6A 4EXZA 1LIBA 1G5WA 4O4OA 5LJDA 5F58A 1NP4A 1ZNDA 3DSZA 2HZRA 2AT5X 1KT5A 1KXOA 2EU7X 3CMPA 4N7DA 1LPJA 2A0AA 3FW5A 4O4XA 4GKCA 3UEVA 2HYSA 5AJCA 1JYDA 5CE4A 1YUPA 3UEWA 2X45A 3IA8A 4LQZA 3NX2A 4O9SA 2QMIA 3VG2A 4MVLA 5HTEA 1S7DA 3FA8A 3HWEA 2RCTA 4GRJA 4NNTA 2WSJA 2Q2MA 3FR4A 3STMX 3P6HA 2ASNX 4YH0A 2GJ5A 3HWDA 3F9DA 1KT4A 2N93A 5L8NA 1G74A 3AKMA 1ALBA 3PP6A 3V8UA 4K19A 4YBUA 5KIDA 3FELA 1IKJA 2WQ9A 3FA9A 4NYQA 1O1VA 4QGWA 3EYCA 3WBGA 1A18A 5HA0A 3C77X 1LIEA 3NX1A 2RD7C 4YFRA 3FR5A 1HQPA 5FAZA 2A2GA 3I0AA 4U9CA 5HBSA 4I3CA 3P02A 2GTLM 4EDEA 1DZPA 2K62A 3S60A 4ORWA 1ZNEA 4ALBA 3U03A 1IKEA 3ZW1B 3KQ0A 5D48A 1S44A 3VG5A 2R73A 4R0BA 3CWKA 2MO5A 5EZ2A 3ZUOA 4U3QA 2L5PA 2OZQA 4D6AA 4ZJ0A 4IB9A 3EBWA 3VG7A 3C78X 3EMMA 4AZOA 3VE2A 4TJZA 4YCEA 2JW1A 1EPBA 4NYRA 4ORXA 3TF6A 5LKEA 1LF7A 1AELA 1L6MA 2RA6A 4OS8A 4BVMA 3JQOA 3FEPA 3FA7A 3KFGA 2NNDA 1QY1A 1NGLA 2MWHA 1SMPI 2G7BA 1QG5A 5FQ7E 4A1HA 5HZ9A 1B56A 1BWYA 4RUUA 1MDCA 2QO6A 1VYGA 5BVTA 3B2JA 4ORRA 1R0UA 1MVGA 1X8NA 4O4SA 4COTA 3HK1A 1PM1X 3NPOA 1X8PA 2FS7A 2JMBA 2F09A 1LIDA 3PPTA 1G85A 4HFOA 2Z4IA 4GDZA 4OMWA 2AH7X 1KZXA 1JYJA 1TOWA 3D4RA 3NADA 5IO7A 4YFQA 3CQNA 1GKAB 5BYPA 4ALOA 1T8VA 2O62A 3OD9A 3VG6A 1X8UA 2BT9A 3RWXA 1DZKA 1LIFA 3HWGA 1GX9A 3LV4A 3NQ3A 3BY0A 4IB8A 4UU3A 3APXA 4ZCBA 3WJFA 5HZ5A 5K06A 1BLRA 4TKHA 4I9RA 4ZH9A 4PJ2A 4ZHCA 1DZMA 1QFTA 1X89A 3EM0A 1OEEA 4QGXA 3CQRA 5EEEA 2ZAGA 3WJGA 3O2YA 4ID2A 2QM9A 4ORYA 1YWDA 2L9CA 4U8UM 5FQ6E 1BSQA 3P6GA 5F6BA 3VG3A 1FDQA 2YMSA 3F6ZB 3N91A 5HZ6A 5F7GA 1KOIA 3TGBA 1GT3A 2Z4HA 4ZHDA 3HOEA 4L3RA 1NP1A 1QQSA 4ARHA 4GZVA 3D97A 3PQSA 2F73A 3VE1A 1SXUA 2AT0X 4YGHA 1B4MA 3QKGA 2JU7A 1AB0A 4MVKA 1XCAA 3B2IA 3SOTA 2HNXA 3IFBA 1EI5A 4HPBA 2FT9A 3FIQA 4TLJA 3MX7A 2Q9SA 4GETA 4DQ3A 4U8UN 4O4UA 3L4RA 2IFBA 2PY1A 4KCAA 3WJEA 1YP6A 5FQ8E 3P6DA 4BQUA 4I95A 4GU8A 3P6EA 1HN2A 2OVEA 4QYNA 5LJEA 1SY1A 2FTBA 2W2AA 4WBKA 2BHVA 4N7CA 2AMMX 1TVQA 3NBXX 2WEWA 4QZTA 4NLJA 3WXQA 2QO5A 3F8AA 2WR6A 1T0VA 5FFHA 2POAA 3KFHA 2X8TA 3PEDA 1IFCA 3FEKA 4O49A 4FGIB 4IAWA 1E00A 1GT1A 2OVSA 1O1UA 1I4UA 4NW4A 3BLGA 2JN3A 1DFVA 4ML7B 2KW1A 2FLJA 1KT7A 5HZQA 1KQWA 5LJBA 2OFMX 1YWBA 2WWPA 4I6SA 2XKLA 4AZNA 3NR3A 4KIIA 1AVGI 3STKA 4EFGA 1X8OA 2G78A 3BX7A 4NNSA 4PSQA 5H9NA 1HBPA 4O3ZA 5EPQA 3Q6LA 5HCCC 5H8TA 1OBUA 2KTSA 1EPAA 1GT5A 1H91A 1IFBA 2LBAA 1I06A 5HTDA 3OJYC 3FA6A 4CK4A 3PH5A 2CBRA 3SAOA 3RZYA 3UAQA 1QY0A 3APVA 4KT5A 1ZNLA 1QFVA 4XMFA 1PMPA 1P6PA 3FW4A 2NNEA 4IBAA 1SXWA 3O22A 5B27A 1OEKA 4IMNA 4FBVA 4ORSA 3WVMA 3LHNA 3BRNA 4LKTA 1IIUA 2GTLN 2ZAIA 3JSQA 4QQ1A 4QYPA 3KZAA 4Y0RA 5AEOA 3TGCA 1FTPA 4NP1A 5CYBA 4HPDA 4IB6A 2DM5A 3FLLA 5EDCA 3UEXA 5LJHA 4YKMA 3E3CA 2AKQA 2LFOA 2AT8X 4FBRA 4TQ2A 5F1EA 1OPAA 4IAXA 4MVIA 2A13A 5D8JA 4ZGUA 1EALA 3S26A 2LA7A 1D2UA 2FS6A 2KT4B 1BJ7A 2AT3X 3MVFA 1RLBE 4YDAA 5IO5A 1FENA 1SXXA 2G79A 3BS2A 2X8FA 1JJXA 3C76X 3ZW1A 5D4AA 1E06A 1CBQA 4IB7A 5JR8A 1E5PA 1ADLA 3I17A 3ZW2A 4HWMA 1YP7A 1AQBA 4EEJA 1X71A 1OBPA 4ZHFA 3D95A 2X8SA 3WOVA 5HWZA 1HMRA 1U17A 2CZUA 1ICNA 3U0DA 1ERBA 3PECA 4KC8A 4QNIA 2CBSA 4YDBA 3WJDA 5L8OA 4LZVA 5HZ8A 1CJ5A 1U18A 2L68A 1LICA 5H9KA 1EIOA 1I05A 3S5XA 1EIIA 3K3LA 4ZGFA 1QABE 4RUNA 4ORUA 4YBPA 5HA1A 3CBCA 1ICMA 2JOZA 2L67A 2YG2A 1I04A 1Y9TA 1SY3A 4LKPA 1YWAA 1ZNGA 2KTDA 1LFOA 4GE1A 5H9AA 3RBYA 1KZWA 1ZRYA 3VPJE 5HAEA 2OVAA 2ACPX 4GK9A 4ZHHA 3NQ9A 1UREA 2OVDA 1GKAA 5H9LA 1BSOA 2QOSC 4AZRA 3T1DA 4YMYA 1EQDA 3S5VA 1D3SA 2Q2PA 4FBOA 1VYFA 4ZHGA 1ACDA 1CRBA 4NLIA 1CBSA 4Y0SA 4A8ZA 2M4LA 4YGZA 5AQ6A 4ZR2A 4XMGA 1ZNKA 3PH6A 2GTLO 2WUTA 1BEBA 4MISA 3NQKA 3G7XA 1CBRA 4BOEA 5EDBA 4QRLA 4UU2A 2FRSA 2HZQA 3ZQ3A 4ODDA 3B2LA 2JU8A 1EUOA 4L1NA 4M7MA 4I9SA 4WHIA 3ZW0B 4WFUA 4OS3A 3BU9A 3U9PC 3EBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTQ A;  1ML7 A;  1YWC A;  1KT6 A;  1BRP A;  4Y0P A;  4I3B A;  1JJJ A;  1PEE A;  3CBS A;  4YFP A;  3ELX A;  5B29 A;  2W2B A;  2ANS A;  1SXY A;  2XST A;  3NP1 A;  3WJC A;  1B8E A;  2FR2 A;  4TNN A;  1FEM A;  2AL0 X;  1HBQ A;  2A2U A;  3JS1 A;  4QAE A;  1TW4 A;  3RSW A;  1BSY A;  2ALL X;  4DQ4 A;  1SY0 A;  2X46 A;  2R74 A;  2MM3 A;  2RCQ A;  2NP1 A;  5KHP A;  4YKO A;  1A57 A;  1A3Y A;  1EW3 A;  1ERX A;  1KQX A;  2WEX A;  3FEN A;  4I3D A;  4A1Y A;  1OBQ A;  1DC9 A;  2CM4 A;  1XKI A;  5BVQ A;  1MX7 A;  5C0N A;  1QY2 A;  4WFV A;  4ZFX A;  1B0O A;  1QWD A;  3STN A;  2CM9 A;  5FEN A;  2FR3 A;  1GT4 A;  2CZT A;  3ZUI A;  4ES7 A;  3B2H A;  1MX8 A;  2WQA E;  2LKK A;  3FMZ A;  3KFF A;  1HMT A;  3FR2 A;  2OFR X;  5KIC A;  1DF3 A;  4ZH6 A;  3P6F A;  3HWF A;  5L8I A;  1KGL A;  1GGL A;  3BSZ E;  3CR6 A;  4AZM A;  1LNM A;  2ACO A;  3BX8 A;  3P6C A;  2QO4 A;  5LJK A;  5HCD C;  1U0X A;  2HMB A;  1X8Q A;  3D96 A;  1N0S A;  3TGA A;  1TOU A;  3TZS A;  4AZP A;  2E4J A;  4QZU A;  4OMX A;  2FWV A;  3APW A;  2BLG A;  1JV4 A;  5EED A;  4AYH A;  4D6B A;  1CBI A;  2GTF X;  3BU1 A;  4YGG A;  4OS0 A;  1TXL A;  5LKF A;  1Z24 A;  1ZNH A;  1BBP A;  4Y0Q A;  1JBH A;  1HMS A;  1GM6 A;  2NNQ A;  2GC9 A;  1PBO A;  4GNW A;  4M6S A;  3VG4 A;  1SY2 A;  1KT3 A;  1O8V A;  2W2F A;  4YCH A;  5F6Z A;  1RBP A;  4A60 A;  1FEL A;  5DPQ A;  2LBV A;  1GX8 A;  1UZ2 X;  4XME A;  1E02 A;  4XMH A;  5LJG A;  1BM5 A;  3UEU A;  1T68 X;  4GNY A;  5LJC A;  1JZU A;  1YIV A;  1FE3 A;  4IMO A;  4QGV A;  4GH7 A;  2R56 A;  1IW2 A;  1A2D A;  2AT6 X;  3KFI A;  4LZU A;  3B2K A;  3GAQ A;  1DZJ A;  2K23 A;  2HLV A;  3AKN A;  4XMC A;  1VPR A;  1LKE A;  3O19 A;  4HPC A;  5D47 A;  5DG4 A;  2Q39 A;  3ELZ A;  4TKB A;  2MJI A;  2LB6 A;  2Q4N A;  5HCE C;  3MBT A;  4TKJ A;  2RQ0 A;  4HPA A;  1G7N A;  1BRQ A;  2JU3 A;  1EXS A;  5D45 A;  1S2P A;  3BDR A;  1DV9 A;  1MUP A;  1GXA A;  1OEJ A;  1SA8 A;  3WJB A;  5BVS A;  4XMD A;  2A3F X;  4AZQ A;  3APU A;  1OPB A;  2P8G A;  4AW8 A;  5IO6 A;  4EXZ A;  1LIB A;  1G5W A;  5LJD A;  5F58 A;  1NP4 A;  1ZND A;  3DSZ A;  2HZR A;  2AT5 X;  1KT5 A;  1KXO A;  2EU7 X;  3CMP A;  4N7D A;  1LPJ A;  2A0A A;  3FW5 A;  4GKC A;  3UEV A;  2HYS A;  1JYD A;  5CE4 A;  1YUP A;  3UEW A;  2X45 A;  3IA8 A;  3NX2 A;  4O9S A;  3VG2 A;  4MVL A;  5HTE A;  1S7D A;  3FA8 A;  3HWE A;  2RCT A;  4GRJ A;  4NNT A;  2WSJ A;  2Q2M A;  3FR4 A;  3STM X;  3P6H A;  2ASN X;  4YH0 A;  2GJ5 A;  3HWD A;  3F9D A;  1KT4 A;  2N93 A;  5L8N A;  1G74 A;  3AKM A;  1ALB A;  3PP6 A;  4K19 A;  4YBU A;  5KID A;  3FEL A;  1IKJ A;  2WQ9 A;  3FA9 A;  4NYQ A;  1O1V A;  4QGW A;  3EYC A;  3WBG A;  1A18 A;  5HA0 A;  3C77 X;  1LIE A;  3NX1 A;  2RD7 C;  4YFR A;  3FR5 A;  1HQP A;  5FAZ A;  2A2G A;  3I0A A;  5HBS A;  4I3C A;  4EDE A;  1DZP A;  2K62 A;  4ORW A;  1ZNE A;  4ALB A;  3U03 A;  1IKE A;  3KQ0 A;  5D48 A;  1S44 A;  3VG5 A;  2R73 A;  4R0B A;  3CWK A;  2MO5 A;  5EZ2 A;  3ZUO A;  2L5P A;  2OZQ A;  4D6A A;  4ZJ0 A;  4IB9 A;  3EBW A;  3VG7 A;  3C78 X;  3EMM A;  4AZO A;  4TJZ A;  4YCE A;  1EPB A;  4NYR A;  4ORX A;  3TF6 A;  5LKE A;  1LF7 A;  1AEL A;  1L6M A;  2RA6 A;  4OS8 A;  4BVM A;  3FEP A;  3FA7 A;  3KFG A;  2NND A;  1QY1 A;  1NGL A;  2G7B A;  1QG5 A;  4A1H A;  5HZ9 A;  1B56 A;  1BWY A;  4RUU A;  1MDC A;  2QO6 A;  1VYG A;  5BVT A;  3B2J A;  4ORR A;  1R0U A;  1MVG A;  1X8N A;  3HK1 A;  1PM1 X;  3NPO A;  1X8P A;  2FS7 A;  1KZX A;  1LID A;  3PPT A;  1G85 A;  4HFO A;  4OMW A;  2AH7 X;  1JYJ A;  1TOW A;  5IO7 A;  3NAD A;  4YFQ A;  3CQN A;  1GKA B;  4ALO A;  1T8V A;  2O62 A;  3VG6 A;  1X8U A;  1DZK A;  1LIF A;  3HWG A;  1GX9 A;  3NQ3 A;  4UU3 A;  3BY0 A;  4IB8 A;  4ZCB A;  3APX A;  5HZ5 A;  3WJF A;  5K06 A;  1BLR A;  4TKH A;  4I9R A;  4ZH9 A;  4ZHC A;  1DZM A;  1QFT A;  1X89 A;  3EM0 A;  1OEE A;  4QGX A;  3CQR A;  5EEE A;  3WJG A;  3O2Y A;  4ORY A;  2QM9 A;  1YWD A;  2L9C A;  1BSQ A;  3P6G A;  5F6B A;  3VG3 A;  1FDQ A;  5HZ6 A;  5F7G A;  1KOI A;  3TGB A;  1GT3 A;  4ZHD A;  1NP1 A;  1QQS A;  4ARH A;  3D97 A;  2F73 A;  1SXU A;  2AT0 X;  4YGH A;  1B4M A;  3QKG A;  2JU7 A;  1AB0 A;  4MVK A;  1XCA A;  3B2I A;  2HNX A;  3IFB A;  4HPB A;  2FT9 A;  3FIQ A;  4TLJ A;  4GET A;  2Q9S A;  4DQ3 A;  3L4R A;  2IFB A;  2PY1 A;  3WJE A;  1YP6 A;  3P6D A;  4BQU A;  3P6E A;  1HN2 A;  2OVE A;  4QYN A;  5LJE A;  1SY1 A;  2FTB A;  2W2A A;  4WBK A;  4N7C A;  2AMM X;  1TVQ A;  2WEW A;  4QZT A;  4NLJ A;  3WXQ A;  2QO5 A;  3F8A A;  2WR6 A;  1T0V A;  5FFH A;  2POA A;  3KFH A;  3PED A;  1IFC A;  3FEK A;  4IAW A;  1E00 A;  1GT1 A;  1O1U A;  1I4U A;  3BLG A;  2JN3 A;  1DFV A;  2FLJ A;  1KT7 A;  5HZQ A;  1KQW A;  5LJB A;  2OFM X;  1YWB A;  2WWP A;  2XKL A;  4AZN A;  3NR3 A;  4KII A;  1AVG I;  3STK A;  4EFG A;  1X8O A;  2G78 A;  3BX7 A;  4NNS A;  4PSQ A;  5H9N A;  1HBP A;  5EPQ A;  3Q6L A;  5HCC C;  5H8T A;  1OBU A;  1EPA A;  1GT5 A;  1H91 A;  1IFB A;  2LBA A;  1I06 A;  5HTD A;  3OJY C;  3FA6 A;  4CK4 A;  3PH5 A;  2CBR A;  3SAO A;  3RZY A;  1QY0 A;  3APV A;  1ZNL A;  1QFV A;  4XMF A;  1PMP A;  1P6P A;  3FW4 A;  2NNE A;  4IBA A;  1SXW A;  3O22 A;  5B27 A;  1OEK A;  4IMN A;  4ORS A;  3WVM A;  3BRN A;  4LKT A;  1IIU A;  3JSQ A;  4Y0R A;  3TGC A;  4QYP A;  3KZA A;  1FTP A;  4NP1 A;  4HPD A;  4IB6 A;  2DM5 A;  3FLL A;  5EDC A;  3UEX A;  5LJH A;  4YKM A;  2AKQ A;  2LFO A;  2AT8 X;  4TQ2 A;  5F1E A;  1OPA A;  4IAX A;  4MVI A;  2A13 A;  5D8J A;  4ZGU A;  1EAL A;  3S26 A;  1D2U A;  2FS6 A;  2KT4 B;  1BJ7 A;  2AT3 X;  3MVF A;  1RLB E;  4YDA A;  5IO5 A;  1FEN A;  1SXX A;  2G79 A;  3BS2 A;  1JJX A;  3C76 X;  5D4A A;  1E06 A;  1CBQ A;  4IB7 A;  5JR8 A;  1E5P A;  1ADL A;  3I17 A;  1YP7 A;  1AQB A;  4EEJ A;  1X71 A;  1OBP A;  4ZHF A;  3D95 A;  5HWZ A;  1HMR A;  1U17 A;  2CZU A;  1ICN A;  3U0D A;  1ERB A;  3PEC A;  4YDB A;  2CBS A;  3WJD A;  5L8O A;  4LZV A;  5HZ8 A;  1CJ5 A;  1U18 A;  2L68 A;  1LIC A;  5H9K A;  1EIO A;  1I05 A;  1EII A;  3K3L A;  1QAB E;  4RUN A;  4ORU A;  4YBP A;  5HA1 A;  3CBC A;  1ICM A;  2JOZ A;  2L67 A;  2YG2 A;  1I04 A;  1SY3 A;  4LKP A;  1YWA A;  1ZNG A;  2KTD A;  1LFO A;  4GE1 A;  5H9A A;  1KZW A;  1ZRY A;  5HAE A;  2OVA A;  2ACP X;  4ZHH A;  3NQ9 A;  1URE A;  2OVD A;  1GKA A;  5H9L A;  1BSO A;  2QOS C;  4AZR A;  3T1D A;  4YMY A;  1EQD A;  1D3S A;  2Q2P A;  1VYF A;  4ZHG A;  1ACD A;  1CRB A;  4NLI A;  1CBS A;  4Y0S A;  4A8Z A;  4YGZ A;  5AQ6 A;  4ZR2 A;  4XMG A;  1ZNK A;  3PH6 A;  2WUT A;  1BEB A;  3G7X A;  1CBR A;  4BOE A;  5EDB A;  4UU2 A;  2FRS A;  2HZQ A;  3ZQ3 A;  4ODD A;  3B2L A;  2JU8 A;  1EUO A;  4M7M A;  4I9S A;  4WFU A;  4OS3 A;  3BU9 A;  3U9P C;  3EBK A; 
#chains in the Genus database with same CATH topology
 3DTQ A;  1ML7 A;  1YWC A;  1KT6 A;  1BRP A;  2CAM A;  4Y0P A;  4JO6 A;  4CDD A;  4I3B A;  1JJJ A;  1PEE A;  3CKG A;  3CBS A;  4YFP A;  3ELX A;  5B29 A;  2W2B A;  2ANS A;  1SXY A;  2XST A;  3NP1 A;  3WJC A;  4CSB A;  1FJ1 E;  1B8E A;  2FR2 A;  1VWG B;  1SWN A;  1VWQ B;  1FEM A;  4FQB B;  2AL0 X;  4TNN A;  2RTC B;  1HBQ A;  1DF8 A;  2A2U A;  3JS1 A;  1TW4 A;  4QAE A;  1BSY A;  3RSW A;  2ALL X;  4MIR A;  1SY0 A;  1KFF A;  1PBY A;  2X46 A;  4DQ4 A;  5IRA A;  2R74 A;  2MM3 A;  2RCQ A;  1JIW I;  2NP1 A;  5KHP A;  2IZA A;  2RTA A;  4YKO A;  3RKG A;  1A3Y A;  1A57 A;  1EW3 A;  1ERX A;  1KQX A;  2WEX A;  3FEN A;  4I3D A;  3VU1 A;  1OBQ A;  4A1Y A;  1DC9 A;  3FYF A;  2CM4 A;  1XKI A;  2I5Z O;  1MX7 A;  5AJB A;  5BVQ A;  2OY7 A;  1QY2 A;  4WFV A;  5C0N A;  2FGS A;  2KD2 A;  4ON1 A;  4ZFX A;  1B0O A;  3ZW0 A;  1QWD A;  3STN A;  2CM9 A;  3SZJ A;  1PTS A;  5FEN A;  2FR3 A;  3HTY A;  1GT4 A;  3VHH A;  2CZT A;  3ZUI A;  1SWR A;  1LEL A;  5CSE A;  3SLO A;  4KH8 A;  3B2H A;  1MX8 A;  4ES7 A;  4B55 A;  4CDF A;  2WQA E;  2LKK A;  3FMZ A;  4OKA A;  1HY2 A;  3KFF A;  1HMT A;  3FR2 A;  2OFR X;  5KIC A;  4GJV A;  4ZH6 A;  3P6F A;  1DF3 A;  3HWF A;  3RWX A;  5L8I A;  3D9W A;  1KGL A;  1GGL A;  3BSZ E;  3CR6 A;  4GGR A;  4U8U O;  4AZM A;  1LNM A;  3SZI A;  4CDC A;  2ACO A;  4EQA C;  3BX8 A;  3HOL A;  1SWD A;  3OE3 A;  3P6C A;  2QO4 A;  5LJK A;  5HCD C;  1U0X A;  2HMB A;  4INN A;  2OL8 O;  1X8Q A;  3D96 A;  1N0S A;  2MHD A;  1TOU A;  3TGA A;  3TZS A;  4AZP A;  2E4J A;  4QZU A;  5IRW A;  4OMX A;  4BJ8 A;  2FWV A;  1OSP O;  2BLG A;  1JV4 A;  1MEP A;  1NQM A;  3APW A;  3PQU A;  4MVE A;  4O3Y A;  5EED A;  4AYH A;  4D6B A;  1CBI A;  2GTF X;  3BU1 A;  5F2B A;  1VWI B;  4OS0 A;  4YGG A;  4GD9 A;  1TXL A;  5LKF A;  2ZSC A;  1Z24 A;  1ZNH A;  1BBP A;  4Y0Q A;  2OL6 O;  1JBH A;  1HMS A;  2OY1 O;  1GM6 A;  2NNQ A;  3ZWE A;  2GC9 A;  1PBO A;  4GNW A;  4M6S A;  3VG4 A;  4BX7 B;  1N43 A;  1SY2 A;  1WUB A;  1KT3 A;  1O8V A;  2W2F A;  4YCH A;  5F6Z A;  1RBP A;  4A60 A;  1FEL A;  5DPQ A;  1K3B A;  2LBV A;  1GX8 A;  1UZ2 X;  3OBL A;  4XME A;  3T2X A;  1E02 A;  2IZK A;  4XMH A;  5LJG A;  2RTN B;  1BM5 A;  3UEU A;  4OEL A;  1T68 X;  2A5B A;  4JGL A;  1WBI A;  2IZH B;  1HXZ A;  2BS6 A;  4GNY A;  4KC7 A;  4O3W A;  5LJC A;  1YIV A;  1JZU A;  3LTW A;  1FE3 A;  3EC5 A;  4IMO A;  1IJ8 A;  4QGV A;  4GH7 A;  2R56 A;  1IW2 A;  3H3I A;  3P24 A;  1A2D A;  3Q34 A;  1N9Y A;  2RTK A;  4GUZ A;  2AT6 X;  5HZ6 A;  2BS5 A;  1JQP A;  3KFI A;  3RE6 A;  4LZU A;  3B2K A;  3GAQ A;  1DZJ A;  2K23 A;  2HLV A;  2HKD A;  1SWQ A;  3AKN A;  1I78 A;  1VPR A;  4XMC A;  1LKE A;  3O19 A;  1JJU A;  4HPC A;  5D47 A;  5DG4 A;  2Q39 A;  3ELZ A;  4O3X B;  4TKB A;  2MJI A;  2BSZ A;  2LB6 A;  2QOM A;  4BX7 A;  2Q4N A;  3ZZV A;  3GE2 A;  5HCE C;  3SLT A;  3MBT A;  2RN4 A;  4TKJ A;  1SRF A;  2X4M A;  1I9H A;  2RQ0 A;  4HPA A;  1G7N A;  1BRQ A;  4CV7 A;  2JU3 A;  1EXS A;  4IAB A;  2IZE B;  5D45 A;  1S2P A;  3BDR A;  1DV9 A;  1MUP A;  1GXA A;  1OEJ A;  1SA8 A;  1SRH A;  3WJB A;  3ZI8 A;  5BVS A;  2IZF B;  4XMD A;  1LCZ A;  1Y9L A;  2A3F X;  2AVI A;  2DJF A;  3APU A;  4AZQ A;  1OPB A;  2P8G A;  4AW8 A;  5IO6 A;  4EXZ A;  1LIB A;  1Y55 X;  1G5W A;  4O4O A;  4Z6J A;  5LJD A;  5F58 A;  2BC3 A;  1NP4 A;  1ZND A;  3DSZ A;  2HZR A;  2AT5 X;  1KT5 A;  1KXO A;  2EU7 X;  1N7Y A;  3CMP A;  4N7D A;  1LPJ A;  2A0A A;  3FW5 A;  4O4X A;  4GKC A;  3UEV A;  2HYS A;  2RTL A;  5AJC A;  1JYD A;  2F01 A;  5CE4 A;  1MM9 A;  1YUP A;  3UEW A;  4BX6 B;  2X45 A;  3IA8 A;  4LQZ A;  3NX2 A;  4O9S A;  2QMI A;  3VG2 A;  1VWH B;  4MVL A;  3WYP A;  5HTE A;  2UYW A;  1S7D A;  3FA8 A;  3HWE A;  2RCT A;  4GRJ A;  4NNT A;  2WSJ A;  2Q2M A;  2RTG B;  3FR4 A;  3STM X;  3P6H A;  2ASN X;  4YH0 A;  2GJ5 A;  3HWD A;  3F9D A;  1KT4 A;  1N9M A;  2N93 A;  5L8N A;  1G74 A;  2RTP B;  1ALB A;  1LDQ A;  3AKM A;  3PP6 A;  3V8U A;  2G8C O;  3CKF A;  4K19 A;  4YBU A;  5KID A;  3FEL A;  2OF9 A;  1IKJ A;  2WQ9 A;  3FA9 A;  4NYQ A;  1LCW A;  2VFC A;  1O1V A;  4QGW A;  3EYC A;  1VWF B;  4I60 A;  3WBG A;  1A18 A;  1E2T A;  5HA0 A;  4DNE A;  3C77 X;  1LIE A;  3NX1 A;  2RD7 C;  4YFR A;  2FKJ A;  3FR5 A;  1HQP A;  5FAZ A;  1LUQ A;  2A2G A;  4U46 A;  3I0A A;  1VWC B;  1VWE B;  4U9C A;  5HBS A;  4I3C A;  3P02 A;  2GTL M;  4EDE A;  1VWK B;  1UYO X;  1DZP A;  2K62 A;  3RY1 A;  3S60 A;  4ORW A;  1ZNE A;  4GGT A;  4ALB A;  3U03 A;  1IKE A;  1VWR B;  2Y3E A;  3ZW1 B;  3KQ0 A;  4GJS A;  5D48 A;  1S44 A;  3VG5 A;  2R73 A;  4R0B A;  4JNJ A;  3CWK A;  2MO5 A;  5EZ2 A;  3ZUO A;  4U3Q A;  2L5P A;  2OZQ A;  4D6A A;  1SWU A;  1VYO A;  4IB9 A;  4ZJ0 A;  1SRE A;  3EBW A;  3VG7 A;  3C78 X;  3EMM A;  4AZO A;  1RSU B;  2RTR B;  3VE2 A;  4TJZ A;  4YCE A;  3WZQ A;  1SWK A;  2JW1 A;  1EPB A;  4NYR A;  1UYN X;  4ORX A;  3RDS A;  3TF6 A;  1LF7 A;  4BX5 B;  5LKE A;  1VWL B;  1AEL A;  1L6M A;  2RA6 A;  4OS8 A;  4BVM A;  3JQO A;  4CPF A;  3FEP A;  1SWG A;  3FA7 A;  3KFG A;  2NND A;  1QY1 A;  1BLR A;  1NGL A;  2MWH A;  1SMP I;  2G7B A;  1QG5 A;  5FQ7 E;  3WZN A;  4A1H A;  1B56 A;  5HZ9 A;  1BWY A;  4RUU A;  1MDC A;  2QO6 A;  3PDF A;  1VYG A;  2I5V O;  5K68 A;  5BVT A;  3B2J A;  4ORR A;  1R0U A;  2VFB A;  1MVG A;  1X8N A;  4O4S A;  4COT A;  2RTO B;  3HK1 A;  1PM1 X;  3NPO A;  2RTF B;  2G5L A;  1K24 A;  1X8P A;  2FS7 A;  2JMB A;  2F09 A;  1LID A;  3PPT A;  1G85 A;  4HFO A;  2Z4I A;  4GDZ A;  4OMW A;  1RXJ A;  2AH7 X;  1SLF B;  2RTM A;  1JYJ A;  2RTQ B;  1TOW A;  3D4R A;  3NAD A;  5IO7 A;  4YFQ A;  3CQN A;  1GKA B;  5BYP A;  2IZJ A;  2PI3 O;  5B2A O;  3WYQ A;  1T8V A;  4ALO A;  2O62 A;  2Y32 A;  3OD9 A;  3VG6 A;  1X8U A;  1SWE A;  2BT9 A;  1DZK A;  1LIF A;  1SLG B;  1GX9 A;  2AF5 A;  3AEH A;  3BY0 A;  3HWG A;  3LV4 A;  3APX A;  3NQ3 A;  4IB8 A;  2IZB A;  4UU3 A;  4ZCB A;  1SWP A;  3WJF A;  4TKH A;  4I9R A;  4ZH9 A;  4OEM A;  4PJ2 A;  4CPI A;  4BX5 A;  4Z2V A;  4BCS A;  4ZHC A;  1DZM A;  1QFT A;  1X89 A;  3EM0 A;  1OEE A;  2C4I A;  4QGX A;  3CQR A;  5EEE A;  2X32 A;  2ZAG A;  4Z28 A;  3WJG A;  3O2Y A;  4ID2 A;  2QM9 A;  4ORY A;  1YWD A;  2L9C A;  4U8U M;  5FQ6 E;  1BSQ A;  3P6G A;  1SWC A;  5F6B A;  2A8G A;  2OY8 A;  3VG3 A;  1FDQ A;  2YMS A;  3F6Z B;  1SWF A;  3N91 A;  5F7G A;  1KOI A;  2WPU A;  3T6L A;  3VHI A;  1GT3 A;  2Z4H A;  3TGB A;  2IZD B;  4ZHD A;  4JHQ A;  2JGS A;  3HOE A;  4L3R A;  1NP1 A;  1QQS A;  1VWM B;  3WZP A;  1Y0G A;  1SWA A;  2OFA A;  4ARH A;  4GZV A;  1MOY A;  2FHL A;  2RTH B;  2F73 A;  3D97 A;  3PQS A;  1SXU A;  2AT0 X;  3VE1 A;  4YGH A;  1B4M A;  3QKG A;  2JU7 A;  1AB0 A;  4MVK A;  5JD2 A;  1XCA A;  1W6F A;  3B2I A;  1LCV A;  3SOT A;  2HNX A;  2X55 A;  1EI5 A;  1W5R A;  3IFB A;  4HPB A;  1VWJ B;  2FT9 A;  3FIQ A;  4TLJ A;  3VHM A;  3MX7 A;  2Q9S A;  4GET A;  4DQ3 A;  1KZX A;  4U8U N;  4O4U A;  3PK2 A;  1KL5 A;  3L4R A;  2OY5 O;  2IFB A;  2PY1 A;  4KCA A;  3WJE A;  1YP6 A;  4IRW A;  3P6D A;  5CHK A;  5FQ8 E;  4BQU A;  4I95 A;  4GU8 A;  5B11 O;  3P6E A;  1HN2 A;  2OVE A;  2OFB A;  4QYN A;  3RDU A;  5LJE A;  1SY1 A;  2FTB A;  2W2A A;  4WBK A;  2BHV A;  1VWN B;  2OL7 A;  4N7C A;  2AMM X;  2RTJ A;  1TVQ A;  3NBX X;  2IZC B;  2WEW A;  4QZT A;  4NLJ A;  3WXQ A;  1STR B;  1JMX A;  2QO5 A;  3F8A A;  2WR6 A;  1T0V A;  5FFH A;  2POA A;  4CPH B;  3KFH A;  2X8T A;  3PED A;  3RDM A;  1IFC A;  3FEK A;  4O49 A;  1AVE A;  3MG5 A;  4FGI B;  4IAW A;  5L3Y A;  1E00 A;  2GH7 A;  1GT1 A;  2OVS A;  1KL3 A;  5B3M O;  1O1U A;  2C1S A;  1I4U A;  4NW4 A;  3BLG A;  1RAV A;  2JN3 A;  1DFV A;  3FID A;  4ML7 B;  2KW1 A;  5K67 A;  2FLJ A;  1KT7 A;  5HZQ A;  1SWT A;  1KQW A;  3RDO A;  5LJB A;  2OFM X;  1SLE B;  1YWB A;  2WWP A;  4I6S A;  2XKL A;  4Y5D A;  4AZN A;  3NR3 A;  3RDX A;  4KII A;  1AVG I;  3STK A;  4C5P A;  3WZO A;  1SRI A;  2OF8 A;  1X8O A;  2G78 A;  3BX7 A;  5B5G A;  3X00 A;  4NNS A;  4PSQ A;  5IRU A;  3T6F A;  5H9N A;  1HBP A;  4O3Z A;  5EPQ A;  5HZ5 A;  1VWA B;  3AUM O;  3Q6L A;  2FHN X;  2RTD B;  5HCC C;  1VWB B;  5H8T A;  1MK5 A;  2RTE B;  1NC9 A;  1OBU A;  2KTS A;  4BX6 A;  1EPA A;  1GT5 A;  1H91 A;  1IFB A;  1HQQ A;  1STS B;  2LBA A;  4CDE A;  1I06 A;  4Z2P A;  5HTD A;  1LDO A;  1STP A;  3OJY C;  2Y3F A;  3FA6 A;  4CK4 A;  3PH5 A;  2CBR A;  4CPH A;  3SAO A;  3RZY A;  3TGC A;  3UAQ A;  1QY0 A;  3APV A;  4KT5 A;  1ZNL A;  1QFV A;  4XMF A;  1PMP A;  1P6P A;  1AVD A;  3FW4 A;  2NNE A;  4IBA A;  4NV7 A;  1HXL A;  1SXW A;  1SWB A;  2IZG B;  3O22 A;  1OEK A;  4IMN A;  4FBV A;  4ORS A;  5B27 A;  5IXG A;  3WVM A;  3LHN A;  3BRN A;  4LKT A;  1IIU A;  2GTL N;  2ZAI A;  3JSQ A;  4QQ1 A;  4QYP A;  3KZA A;  4Y0R A;  4YVB A;  5AEO A;  1FTP A;  1SWL A;  4NP1 A;  4HPD A;  4IB6 A;  2DM5 A;  3FLL A;  5CYB A;  5EDC A;  3RY2 A;  3UEX A;  5LJH A;  4YKM A;  3E3C A;  2AKQ A;  2LFO A;  2AT8 X;  3QQ2 A;  4FBR A;  4TQ2 A;  5F1E A;  1OPA A;  4IAX A;  5B10 O;  4MVI A;  2A13 A;  3KVN A;  2X56 A;  5D8J A;  4EFG A;  4ZGU A;  1EAL A;  3S26 A;  2LA7 A;  1D2U A;  2FS6 A;  2KT4 B;  3HPE A;  1BJ7 A;  2AT3 X;  3MVF A;  1RLB E;  4YDA A;  2VDF A;  1SWS A;  5IO5 A;  1FEN A;  1SXX A;  2G79 A;  2MF6 A;  2X8F A;  3BS2 A;  1JJX A;  3C76 X;  1Y52 X;  1RST B;  1SLD B;  3ZW1 A;  3EW2 A;  5D4A A;  1E06 A;  1CBQ A;  4IB7 A;  5JR8 A;  1E5P A;  3T2W A;  1ADL A;  3I17 A;  1SWJ A;  3ZW2 A;  4HWM A;  1YP7 A;  1AQB A;  3SLJ A;  4EEJ A;  1X71 A;  1OBP A;  2RTB B;  4ZHF A;  3D95 A;  4DCB A;  4CPE A;  2X8S A;  1SRJ A;  1N4J A;  3WOV A;  1Y53 X;  1HMR A;  1U17 A;  2CZU A;  1ICN A;  5HWZ A;  3U0D A;  1ERB A;  4GDA A;  3PEC A;  4KC8 A;  4QNI A;  2CBS A;  1SRG A;  4YDB A;  3RDQ A;  3WJD A;  1W4T A;  5L8O A;  2DJG A;  4LZV A;  5HZ8 A;  5B5F A;  3EW1 A;  4Y59 A;  1CJ5 A;  4Z27 A;  1U18 A;  2L68 A;  1LIC A;  5H9K A;  1EIO A;  1I05 A;  1KL4 A;  4MEE A;  1NDJ A;  2FKG A;  3S5X A;  1EII A;  3K3L A;  4ZGF A;  1NBX A;  2RTI B;  1QAB E;  4RUN A;  4ORU A;  4YBP A;  1NQN A;  5HA1 A;  1RXH A;  3CBC A;  1ICM A;  2JOZ A;  2L67 A;  2YG2 A;  3VGW A;  1I04 A;  1Y9T A;  1SY3 A;  4LKP A;  1YWA A;  1ZNG A;  2KTD A;  1LFO A;  4GE1 A;  5H9A A;  3RBY A;  1KZW A;  1ZRY A;  4EKV A;  3VPJ E;  5HAE A;  1GX3 A;  2OVA A;  2ACP X;  1JMZ A;  2QCB A;  4GK9 A;  4ZHH A;  3NQ9 A;  1URE A;  2OVD A;  1GKA A;  5H9L A;  1BSO A;  2QOS C;  4AZR A;  3T1D A;  4YMY A;  5K06 A;  1EQD A;  3S5V A;  3FDC A;  1D3S A;  2Q2P A;  4FBO A;  1VYF A;  4Z2O A;  2OYB O;  4BGF A;  4ZHG A;  1ACD A;  1CRB A;  4BBO A;  4NLI A;  1CBS A;  1SWH A;  2IZL B;  4Y0S A;  4A8Z A;  2M4L A;  2C1Q A;  4YGZ A;  5AQ6 A;  4ZR2 A;  4XMG A;  1ZNK A;  3PH6 A;  2GTL O;  2WUT A;  1BEB A;  1VWP B;  1VWD B;  3G7X A;  1CBR A;  3NQK A;  2IZI A;  4MIS A;  4BOE A;  1VWO B;  4NV8 A;  1SWO A;  5EDB A;  4GGZ A;  4QRL A;  4UU2 A;  2FRS A;  2HZQ A;  2A5C A;  3ZQ3 A;  2UZ2 A;  4ODD A;  3RE5 A;  3B2L A;  2JU8 A;  3SZH A;  1RXK A;  1EUO A;  3MM0 A;  4L1N A;  4M7M A;  4I9S A;  4WHI A;  2X34 A;  3ZW0 B;  4WFU A;  4OS3 A;  3BU9 A;  3U9P C;  3EBK A; 
#chains in the Genus database with same CATH homology
 3DTQ A;  1ML7 A;  1YWC A;  1KT6 A;  1BRP A;  4Y0P A;  4I3B A;  1JJJ A;  1PEE A;  3CBS A;  4YFP A;  3ELX A;  5B29 A;  2W2B A;  2ANS A;  1SXY A;  2XST A;  3NP1 A;  3WJC A;  4CSB A;  1B8E A;  2FR2 A;  4FQB B;  1FEM A;  4TNN A;  2AL0 X;  1HBQ A;  2A2U A;  3JS1 A;  4QAE A;  1TW4 A;  3RSW A;  1BSY A;  2ALL X;  4MIR A;  1SY0 A;  2X46 A;  4DQ4 A;  2R74 A;  2MM3 A;  2RCQ A;  1JIW I;  2NP1 A;  5KHP A;  4YKO A;  1A57 A;  3RKG A;  1A3Y A;  1EW3 A;  1ERX A;  1KQX A;  2WEX A;  3FEN A;  4I3D A;  3VU1 A;  1OBQ A;  4A1Y A;  1DC9 A;  3FYF A;  2CM4 A;  1XKI A;  5AJB A;  1MX7 A;  5BVQ A;  5C0N A;  1QY2 A;  4WFV A;  2KD2 A;  4ON1 A;  4ZFX A;  1B0O A;  3ZW0 A;  1QWD A;  3STN A;  2CM9 A;  5FEN A;  2FR3 A;  3HTY A;  1GT4 A;  2CZT A;  3ZUI A;  4KH8 A;  3B2H A;  1MX8 A;  4ES7 A;  2WQA E;  2LKK A;  3FMZ A;  3KFF A;  1HMT A;  3FR2 A;  2OFR X;  5KIC A;  1DF3 A;  4ZH6 A;  3P6F A;  3HWF A;  5L8I A;  1KGL A;  1GGL A;  3BSZ E;  3CR6 A;  4U8U O;  4AZM A;  1LNM A;  2ACO A;  4EQA C;  3BX8 A;  3HOL A;  3OE3 A;  3P6C A;  2QO4 A;  5LJK A;  5HCD C;  1U0X A;  2HMB A;  4INN A;  1X8Q A;  3D96 A;  1N0S A;  2MHD A;  1TOU A;  3TGA A;  3TZS A;  4AZP A;  2E4J A;  4QZU A;  4OMX A;  2FWV A;  3APW A;  2BLG A;  1JV4 A;  4MVE A;  5EED A;  3PQU A;  4AYH A;  4O3Y A;  4D6B A;  1CBI A;  2GTF X;  3BU1 A;  4YGG A;  4OS0 A;  1TXL A;  5LKF A;  1Z24 A;  1ZNH A;  1BBP A;  4Y0Q A;  1JBH A;  1HMS A;  3ZWE A;  1GM6 A;  2NNQ A;  2GC9 A;  1PBO A;  4GNW A;  4M6S A;  3VG4 A;  1SY2 A;  1KT3 A;  1O8V A;  2W2F A;  4YCH A;  5F6Z A;  1RBP A;  4A60 A;  1FEL A;  5DPQ A;  2LBV A;  1GX8 A;  1UZ2 X;  3OBL A;  4XME A;  1E02 A;  4XMH A;  5LJG A;  1BM5 A;  3UEU A;  1T68 X;  4JGL A;  4KC7 A;  2BS6 A;  4GNY A;  5LJC A;  4O3W A;  1JZU A;  1YIV A;  1FE3 A;  4IMO A;  4QGV A;  4GH7 A;  2R56 A;  1IW2 A;  3H3I A;  3P24 A;  1A2D A;  2AT6 X;  2BS5 A;  3KFI A;  4LZU A;  3B2K A;  3GAQ A;  1DZJ A;  2K23 A;  2HLV A;  3AKN A;  4XMC A;  1VPR A;  1LKE A;  3O19 A;  4HPC A;  5D47 A;  5DG4 A;  2Q39 A;  3ELZ A;  4O3X B;  4TKB A;  2MJI A;  2LB6 A;  2Q4N A;  3ZZV A;  3GE2 A;  5HCE C;  3MBT A;  2RN4 A;  4TKJ A;  2RQ0 A;  4HPA A;  1G7N A;  1BRQ A;  4CV7 A;  2JU3 A;  1EXS A;  4IAB A;  5D45 A;  1S2P A;  3BDR A;  1DV9 A;  1MUP A;  1GXA A;  1OEJ A;  1SA8 A;  3WJB A;  3ZI8 A;  5BVS A;  4XMD A;  1Y9L A;  2A3F X;  4AZQ A;  3APU A;  1OPB A;  2P8G A;  4AW8 A;  5IO6 A;  4EXZ A;  1LIB A;  1G5W A;  4O4O A;  5LJD A;  5F58 A;  1NP4 A;  1ZND A;  3DSZ A;  2HZR A;  2AT5 X;  1KT5 A;  1KXO A;  2EU7 X;  3CMP A;  4N7D A;  1LPJ A;  2A0A A;  3FW5 A;  4O4X A;  4GKC A;  3UEV A;  2HYS A;  5AJC A;  1JYD A;  5CE4 A;  1YUP A;  3UEW A;  2X45 A;  3IA8 A;  4LQZ A;  3NX2 A;  4O9S A;  2QMI A;  3VG2 A;  4MVL A;  5HTE A;  1S7D A;  3FA8 A;  3HWE A;  2RCT A;  4GRJ A;  4NNT A;  2WSJ A;  2Q2M A;  3FR4 A;  3STM X;  3P6H A;  2ASN X;  4YH0 A;  2GJ5 A;  3HWD A;  3F9D A;  1KT4 A;  2N93 A;  5L8N A;  1G74 A;  3AKM A;  1ALB A;  3PP6 A;  3V8U A;  4K19 A;  4YBU A;  5KID A;  3FEL A;  1IKJ A;  2WQ9 A;  3FA9 A;  4NYQ A;  1O1V A;  4QGW A;  3EYC A;  3WBG A;  1A18 A;  5HA0 A;  3C77 X;  1LIE A;  3NX1 A;  2RD7 C;  4YFR A;  3FR5 A;  1HQP A;  5FAZ A;  2A2G A;  3I0A A;  4U9C A;  5HBS A;  4I3C A;  3P02 A;  2GTL M;  4EDE A;  1DZP A;  2K62 A;  3S60 A;  4ORW A;  1ZNE A;  4ALB A;  3U03 A;  1IKE A;  3ZW1 B;  3KQ0 A;  5D48 A;  1S44 A;  3VG5 A;  2R73 A;  4R0B A;  3CWK A;  2MO5 A;  5EZ2 A;  3ZUO A;  4U3Q A;  2L5P A;  2OZQ A;  4D6A A;  4ZJ0 A;  4IB9 A;  3EBW A;  3VG7 A;  3C78 X;  3EMM A;  4AZO A;  3VE2 A;  4TJZ A;  4YCE A;  2JW1 A;  1EPB A;  4NYR A;  4ORX A;  3TF6 A;  5LKE A;  1LF7 A;  1AEL A;  1L6M A;  2RA6 A;  4OS8 A;  4BVM A;  3JQO A;  3FEP A;  3FA7 A;  3KFG A;  2NND A;  1QY1 A;  1NGL A;  2MWH A;  1SMP I;  2G7B A;  1QG5 A;  5FQ7 E;  4A1H A;  5HZ9 A;  1B56 A;  1BWY A;  4RUU A;  1MDC A;  2QO6 A;  1VYG A;  5BVT A;  3B2J A;  4ORR A;  1R0U A;  1MVG A;  1X8N A;  4O4S A;  4COT A;  3HK1 A;  1PM1 X;  3NPO A;  1X8P A;  2FS7 A;  2JMB A;  2F09 A;  1LID A;  3PPT A;  1G85 A;  4HFO A;  2Z4I A;  4GDZ A;  4OMW A;  2AH7 X;  1KZX A;  1JYJ A;  1TOW A;  3D4R A;  3NAD A;  5IO7 A;  4YFQ A;  3CQN A;  1GKA B;  5BYP A;  4ALO A;  1T8V A;  2O62 A;  3OD9 A;  3VG6 A;  1X8U A;  2BT9 A;  3RWX A;  1DZK A;  1LIF A;  3HWG A;  1GX9 A;  3LV4 A;  3NQ3 A;  3BY0 A;  4IB8 A;  4UU3 A;  3APX A;  4ZCB A;  3WJF A;  5HZ5 A;  5K06 A;  1BLR A;  4TKH A;  4I9R A;  4ZH9 A;  4PJ2 A;  4ZHC A;  1DZM A;  1QFT A;  1X89 A;  3EM0 A;  1OEE A;  4QGX A;  3CQR A;  5EEE A;  2ZAG A;  3WJG A;  3O2Y A;  4ID2 A;  2QM9 A;  4ORY A;  1YWD A;  2L9C A;  4U8U M;  5FQ6 E;  1BSQ A;  3P6G A;  5F6B A;  3VG3 A;  1FDQ A;  2YMS A;  3F6Z B;  3N91 A;  5HZ6 A;  5F7G A;  1KOI A;  3TGB A;  1GT3 A;  2Z4H A;  4ZHD A;  3HOE A;  4L3R A;  1NP1 A;  1QQS A;  4ARH A;  4GZV A;  3D97 A;  3PQS A;  2F73 A;  3VE1 A;  1SXU A;  2AT0 X;  4YGH A;  1B4M A;  3QKG A;  2JU7 A;  1AB0 A;  4MVK A;  1XCA A;  3B2I A;  3SOT A;  2HNX A;  3IFB A;  1EI5 A;  4HPB A;  2FT9 A;  3FIQ A;  4TLJ A;  3MX7 A;  2Q9S A;  4GET A;  4DQ3 A;  4U8U N;  4O4U A;  3L4R A;  2IFB A;  2PY1 A;  4KCA A;  3WJE A;  1YP6 A;  5FQ8 E;  3P6D A;  4BQU A;  4I95 A;  4GU8 A;  3P6E A;  1HN2 A;  2OVE A;  4QYN A;  5LJE A;  1SY1 A;  2FTB A;  2W2A A;  4WBK A;  2BHV A;  4N7C A;  2AMM X;  1TVQ A;  3NBX X;  2WEW A;  4QZT A;  4NLJ A;  3WXQ A;  2QO5 A;  3F8A A;  2WR6 A;  1T0V A;  5FFH A;  2POA A;  3KFH A;  2X8T A;  3PED A;  1IFC A;  3FEK A;  4O49 A;  4FGI B;  4IAW A;  1E00 A;  1GT1 A;  2OVS A;  1O1U A;  1I4U A;  4NW4 A;  3BLG A;  2JN3 A;  1DFV A;  4ML7 B;  2KW1 A;  2FLJ A;  1KT7 A;  5HZQ A;  1KQW A;  5LJB A;  2OFM X;  1YWB A;  2WWP A;  4I6S A;  2XKL A;  4AZN A;  3NR3 A;  4KII A;  1AVG I;  3STK A;  4EFG A;  1X8O A;  2G78 A;  3BX7 A;  4NNS A;  4PSQ A;  5H9N A;  1HBP A;  4O3Z A;  5EPQ A;  3Q6L A;  5HCC C;  5H8T A;  1OBU A;  2KTS A;  1EPA A;  1GT5 A;  1H91 A;  1IFB A;  2LBA A;  1I06 A;  5HTD A;  3OJY C;  3FA6 A;  4CK4 A;  3PH5 A;  2CBR A;  3SAO A;  3RZY A;  3UAQ A;  1QY0 A;  3APV A;  4KT5 A;  1ZNL A;  1QFV A;  4XMF A;  1PMP A;  1P6P A;  3FW4 A;  2NNE A;  4IBA A;  1SXW A;  3O22 A;  5B27 A;  1OEK A;  4IMN A;  4FBV A;  4ORS A;  3WVM A;  3LHN A;  3BRN A;  4LKT A;  1IIU A;  2GTL N;  2ZAI A;  3JSQ A;  4QQ1 A;  4QYP A;  3KZA A;  4Y0R A;  5AEO A;  3TGC A;  1FTP A;  4NP1 A;  5CYB A;  4HPD A;  4IB6 A;  2DM5 A;  3FLL A;  5EDC A;  3UEX A;  5LJH A;  4YKM A;  3E3C A;  2AKQ A;  2LFO A;  2AT8 X;  4FBR A;  4TQ2 A;  5F1E A;  1OPA A;  4IAX A;  4MVI A;  2A13 A;  5D8J A;  4ZGU A;  1EAL A;  3S26 A;  2LA7 A;  1D2U A;  2FS6 A;  2KT4 B;  1BJ7 A;  2AT3 X;  3MVF A;  1RLB E;  4YDA A;  5IO5 A;  1FEN A;  1SXX A;  2G79 A;  3BS2 A;  2X8F A;  1JJX A;  3C76 X;  3ZW1 A;  5D4A A;  1E06 A;  1CBQ A;  4IB7 A;  5JR8 A;  1E5P A;  1ADL A;  3I17 A;  3ZW2 A;  4HWM A;  1YP7 A;  1AQB A;  4EEJ A;  1X71 A;  1OBP A;  4ZHF A;  3D95 A;  2X8S A;  3WOV A;  5HWZ A;  1HMR A;  1U17 A;  2CZU A;  1ICN A;  3U0D A;  1ERB A;  3PEC A;  4KC8 A;  4QNI A;  2CBS A;  4YDB A;  3WJD A;  5L8O A;  4LZV A;  5HZ8 A;  1CJ5 A;  1U18 A;  2L68 A;  1LIC A;  5H9K A;  1EIO A;  1I05 A;  3S5X A;  1EII A;  3K3L A;  4ZGF A;  1QAB E;  4RUN A;  4ORU A;  4YBP A;  5HA1 A;  3CBC A;  1ICM A;  2JOZ A;  2L67 A;  2YG2 A;  1I04 A;  1Y9T A;  1SY3 A;  4LKP A;  1YWA A;  1ZNG A;  2KTD A;  1LFO A;  4GE1 A;  5H9A A;  3RBY A;  1KZW A;  1ZRY A;  3VPJ E;  5HAE A;  2OVA A;  2ACP X;  4GK9 A;  4ZHH A;  3NQ9 A;  1URE A;  2OVD A;  1GKA A;  5H9L A;  1BSO A;  2QOS C;  4AZR A;  3T1D A;  4YMY A;  1EQD A;  3S5V A;  1D3S A;  2Q2P A;  4FBO A;  1VYF A;  4ZHG A;  1ACD A;  1CRB A;  4NLI A;  1CBS A;  4Y0S A;  4A8Z A;  2M4L A;  4YGZ A;  5AQ6 A;  4ZR2 A;  4XMG A;  1ZNK A;  3PH6 A;  2GTL O;  2WUT A;  1BEB A;  4MIS A;  3NQK A;  3G7X A;  1CBR A;  4BOE A;  5EDB A;  4QRL A;  4UU2 A;  2FRS A;  2HZQ A;  3ZQ3 A;  4ODD A;  3B2L A;  2JU8 A;  1EUO A;  4L1N A;  4M7M A;  4I9S A;  4WHI A;  3ZW0 B;  4WFU A;  4OS3 A;  3BU9 A;  3U9P C;  3EBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...