1U0ZA

N-domain of grp94 lacking the charged domain in complex with radicicol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
211
Chain Sequence
b'EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTETSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTVWDWELMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-Domain Of Grp94 Lacking The Charged Domain In Complex With Radicicol
rcsb
molecule keywords Endoplasmin
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 63
structure length 211
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1u0zA00
2YEAA 2PNRA 1I58A 2XK2A 2YE6A 4R3MA 3B24A 4KSGA 3SL2A 1UYGA 3RLQA 4B6CA 2IOPA 2YEHA 2YI6A 4PRVA 4L90A 3O2FA 4KQVA 3CWVA 4AWPA 4KFGA 4URLA 4JAUA 4BXIA 2XABA 2UWDA 3ZXQA 3B27A 5C93A 2ZDYA 3D0BA 1YT1A 4L93A 1U2OA 2K5BA 2WEQA 4L94A 5F5RA 2CG9A 2YI7A 4BQGA 2YI0A 1I5DA 2XCMA 4GEEA 3O6OA 2O1WA 4MP2A 4CWTA 1Z5CA 2FWYA 2ZBKB 1YETA 1NHIA 3RLPA 5IDJA 3A0RA 2XX2A 4LP0A 1UYEA 2BREA 5M4MA 3DGEA 1THNA 1YESA 2YK9A 1UY8A 2YEBA 4HY6A 3ZKBA 2XDXA 4XCLA 1ZWHA 4MBCA 5CPHA 1NHHA 2YEGA 5BODA 1AH8A 1BKNA 3R4OA 2WI1A 3TZ5A 3R4NA 2WERA 1JM6A 5CTXA 3VADA 4GCZA 4KTNA 2YEEA 5IN9A 4HXZA 3GIGA 1S14A 4KP4A 1I5BA 4UROA 4O04A 2QF6A 3D2RA 4BIUA 2BYHA 4O07A 3D36A 2WI4A 4EEHA 1MX0A 3G7EA 5D6PA 4DZYA 3C0EA 5D7RA 1GJVA 1YC3A 5GGZA 2CCSA 3FT5A 4JQLA 2O1UA 2YECA 4XKOA 4FMTA 1TBWA 4Q20A 1ZXNA 4LWHA 3A0WA 4CE3A 3A0TA 5M4EA 4CWSA 2WI5A 4YKYA 5FNDA 2VCIA 5L3JA 1TH8A 2CH4A 3RKZA 4BIZA 1UY6A 1YT2A 4LWGA 4URNA 4EFTA 2YE3A 4FCPA 4L91A 1Z59A 2H8MA 2Q8GA 3VHCA 3GIGB 4YKXA 1Y4UA 2CGFA 2XDSA 3IEDA 4CE2A 4ZKIA 3B25A 3KE6A 2QG2A 4V26A 3T2SA 2XHRA 3G75A 5J71A 3FV5A 3JZ3A 2XJXA 2YE5A 1TIDA 2YE4A 2FWZA 2BZ5A 3R4PA 2YE8A 4AS9A 2YE9A 2ZKJA 1OSFA 1UYDA 5M4PA 2HCHA 4LPBA 3OWDA 2YEDA 1QZRA 4K4OA 2IWXA 4XCJA 3OPDA 3T1KA 3Q5KA 4U7NA 2IWUA 3H80A 4CE1A 1YS3A 3Q5JA 1UYMA 4PU9A 4AWQA 2YK2A 3EHJA 1BXDA 4E02A 3NMQA 2XDLA 3OMUA 3PEHA 2BU5A 3EHHA 4NH7A 4L8ZA 4KSHA 1Z5AA 3TUHA 4ASFA 4QPJA 4LWIA 3U2KA 2IWSA 2WI7A 5F3KA 3U67A 1TILA 3TZ4A 3Q5LA 3HZ5A 1ZW9A 3FT8A 2XX4A 2YJWA 3QTFA 2WI6A 2WI3A 1UY9A 4FPPA 1GKZA 4P8OA 2HG1A 4B7PA 4ASBA 1KZNA 3HYYA 2FXSA 2Q8IA 4U7OA 4O09A 1YSRA 3T0HA 5CTWA 4XIRA 3HYZA 4CWFA 2VWCA 4GT8A 4AWOA 3QDDA 4ZVIA 5CTUA 1YT0A 2BYIA 3R92A 4DUHA 3HHUA 2YGFA 1I5AA 5M4KA 3B26A 4URMA 2BSMA 1Y8NA 2XX5A 3R91A 4WUCA 1Y8PA 1R62A 4I5SA 3O0IA 1UYHA 2YE7A 3MNRP 2Q8FA 3K98A 4YKWA 4NH8A 4E00A 4WUBA 4YKZA 1BYQA 3OWBA 2XJGA 2XHXA 1L0OA 1I5CA 2VW5A 5CF0A 4HY1A 2YKJA 1TC0A 2YKCA 2XDUA 5FNFA 3CGZA 4O0BA 1TC6A 2EXLA 3H4LA 3ZKDA 5IDMA 3HZ1A 3WQ9A 3T10A 1GKXA 4HXWA 1QYEA 1NHJA 2YI5A 4CWQA 1YSZA 2Q2EB 4P7AA 1I59A 1UYIA 2H55A 2YKIA 4FCQA 2FYPA 1S16A 4XDMA 4I3HA 3VHAA 4V25A 3BMYA 4XKAA 2YJXA 1QY8A 3EKOA 4NH9A 2AKPA 4JAVA 3HEKA 3C11A 4YKQA 2CCUA 2BRCA 1YC1A 4MPCA 4BQJA 2YE2A 3K97A 4XIQA 4CWPA 2WEPA 1AMWA 3INWA 1UYCA 3RLRA 4XD8A 3K99A 1ZXMA 2ESAA 3ZXOA 4H7QA 2ZDXA 4O05A 4MB9A 2HKJA 4EGIA 4EM7A 1PVGA 2BT0A 2VCJA 5M4HA 4HZ0A 3ZM7A 1YC4A 5M4NA 4CWNA 2YGEA 1EA6A 4HZ5A 2GFDA 4R3AA 5D7CA 4XE2A 1UYKA 1U0ZA 4X9LA 4MPNA 3R4MA 2O1VA 2IOQA 1MU5A 5D7DA 1B62A 3A0XA 4ASGA 2JJCA 3EKRA 3CRLA 3EHGA 2BU7A 4U93A 4CWOA 2YKBA 3LNUA 1A4HA 3GIFA 1AH6A 1US7A 1UY7A 4EGKA 1B63A 4MPEA 4ASAA 4BAEA 4EFUA 1UYFA 2C2AA 3GIEA 4HYMA 1Y8OA 2XJJA 1AJ6A 2E0AA 4FCRA 4YKUA 3CGYA 4H81A 4LWEA 2BU2A 1H7SA 4XTJA 4XITA 2BTZA 4H85A 3U2DA 4GGLA 3TZ2A 2XHTA 4PRXA 1Z5BA 3EHFA 4CWRA 4XIPA 4GFNA 2YKEA 2YEIA 5J6AA 4PL9A 2IORA 1ID0A 5BOCA 3G7BA 4E01A 5FWKA 4YKTA 3BM9A 3T0ZA 4EGHA 2QG0A 4GQTA 1KIJA 2WI2A 2YEJA 2XDKA 4XKKA 2YEFA 1B3QA 4R1FA 3VHDA 4QPKA 3A0ZA 2Q8HA 1YERA 5D6QA 2JKIA 3A0YA 4W7TA 1AM1A 3B28A 3OW6A 3TTZA 3K60A 2YGAA 1BGQA 3INXA 1Y4SA 2BU8A 2GQPA 1H7UA 2CCTA 4LWFA 4WUDA 4XC0A 1EI1A 4MP7A 4JASA 4HYPA 3WHAA 1UYLA 3LPSA 3CRKA 4YKRA 4EMVA 4MOTA 2BU6A 5CTYA 3TZ0A 2XD6A 3PEJA 2QFOA 5FNCA
chains in the Genus database with same CATH superfamily
2YEAA 2PNRA 1I58A 5JENA 2XK2A 2YE6A 4R3MA 3B24A 4KSGA 3SL2A 1UYGA 3RLQA 4B6CA 2IOPA 2YEHA 2YI6A 4PRVA 4L90A 3O2FA 4KQVA 3CWVA 4AWPA 4KFGA 4URLA 4JAUA 4BXIA 2XABA 2UWDA 3ZXQA 3B27A 5C93A 2ZDYA 3D0BA 1YT1A 4L93A 1U2OA 2K5BA 2WEQA 4L94A 5F5RA 2CG9A 2YI7A 4BQGA 2YI0A 1I5DA 2XCMA 4GEEA 3O6OA 2O1WA 4MP2A 4CWTA 1Z5CA 2FWYA 2ZBKB 1YETA 1NHIA 3RLPA 5IDJA 3A0RA 2XX2A 4LP0A 1UYEA 2BREA 5M4MA 3DGEA 1THNA 1YESA 2YK9A 1UY8A 2YEBA 4HY6A 3ZKBA 2XDXA 4XCLA 1ZWHA 4MBCA 5CPHA 1NHHA 2YEGA 5BODA 1AH8A 1BKNA 3R4OA 2WI1A 3TZ5A 3R4NA 2WERA 1JM6A 5CTXA 3VADA 4GCZA 4KTNA 2YEEA 5IN9A 4HXZA 3GIGA 1S14A 4KP4A 1I5BA 4UROA 4O04A 2QF6A 3D2RA 4BIUA 2BYHA 4O07A 3D36A 2WI4A 4EEHA 1MX0A 3G7EA 5D6PA 2C1GA 4DZYA 3C0EA 5D7RA 1GJVA 1YC3A 5GGZA 2CCSA 3FT5A 4JQLA 2O1UA 2YECA 4XKOA 4FMTA 1TBWA 4Q20A 1ZXNA 4LWHA 3A0WA 4CE3A 3A0TA 5M4EA 4E72A 4CWSA 2WI5A 4YKYA 5FNDA 2VCIA 5L3JA 1TH8A 2CH4A 3RKZA 4BIZA 1UY6A 1YT2A 4LWGA 4URNA 4EFTA 2YE3A 4FCPA 4L91A 1Z59A 2H8MA 2Q8GA 3VHCA 3GIGB 4YKXA 1Y4UA 2CGFA 2XDSA 3IEDA 4CE2A 4ZKIA 3B25A 3KE6A 2QG2A 4V26A 3T2SA 2XHRA 3G75A 5J71A 3FV5A 3JZ3A 2XJXA 2YE5A 1TIDA 2YE4A 2FWZA 2BZ5A 3R4PA 2YE8A 4AS9A 2YE9A 2ZKJA 1OSFA 1UYDA 5M4PA 2HCHA 4LPBA 3OWDA 2YEDA 1QZRA 4K4OA 2IWXA 4XCJA 3OPDA 3T1KA 3Q5KA 4U7NA 2IWUA 3H80A 4CE1A 1YS3A 3Q5JA 1UYMA 4PU9A 4AWQA 2YK2A 3EHJA 1BXDA 4E02A 3NMQA 2XDLA 3OMUA 3PEHA 2BU5A 3EHHA 4NH7A 4L8ZA 4KSHA 1Z5AA 3TUHA 4ASFA 4QPJA 4LWIA 3U2KA 2IWSA 2WI7A 5F3KA 3U67A 1TILA 3TZ4A 3Q5LA 3HZ5A 1ZW9A 3FT8A 2XX4A 2YJWA 3QTFA 2WI6A 2WI3A 1UY9A 4FPPA 1GKZA 4P8OA 2HG1A 4B7PA 4ASBA 1KZNA 3HYYA 2FXSA 2Q8IA 4U7OA 4O09A 1YSRA 3T0HA 5CTWA 4XIRA 3HYZA 4CWFA 2VWCA 4GT8A 3LMMA 4AWOA 3QDDA 4ZVIA 5CTUA 1YT0A 2BYIA 3R92A 4DUHA 3HHUA 2YGFA 1I5AA 5M4KA 3B26A 4URMA 2BSMA 1Y8NA 2XX5A 3R91A 4WUCA 1Y8PA 1R62A 4I5SA 3O0IA 1UYHA 2YE7A 3MNRP 2Q8FA 3K98A 4YKWA 4NH8A 4E00A 4WUBA 4YKZA 1BYQA 3OWBA 2XJGA 2XHXA 1L0OA 1I5CA 2VW5A 5CF0A 4HY1A 2YKJA 1TC0A 2YKCA 2XDUA 5FNFA 3CGZA 4O0BA 1TC6A 2EXLA 3H4LA 3ZKDA 5IDMA 3HZ1A 3WQ9A 3T10A 1GKXA 4HXWA 1QYEA 1NHJA 2YI5A 4CWQA 1YSZA 2Q2EB 4P7AA 1I59A 1UYIA 2H55A 2YKIA 4FCQA 2FYPA 1S16A 4XDMA 4I3HA 3VHAA 4V25A 3BMYA 4XKAA 2YJXA 1QY8A 3EKOA 4NH9A 2AKPA 4JAVA 3HEKA 3C11A 4YKQA 2CCUA 2BRCA 1YC1A 4MPCA 4BQJA 2YE2A 3K97A 4XIQA 4CWPA 2WEPA 1AMWA 3INWA 1UYCA 2FTKA 3RLRA 4XD8A 3K99A 1ZXMA 2ESAA 3ZXOA 4H7QA 2ZDXA 4O05A 4MB9A 2HKJA 4EGIA 4EM7A 1PVGA 2BT0A 2VCJA 5M4HA 4HZ0A 3ZM7A 1YC4A 5M4NA 4CWNA 2YGEA 1EA6A 4HZ5A 2GFDA 4R3AA 5D7CA 4XE2A 1UYKA 1U0ZA 4X9LA 4MPNA 3R4MA 2O1VA 3CYGA 2IOQA 1MU5A 5D7DA 1B62A 3A0XA 4ASGA 2JJCA 3EKRA 3CRLA 3EHGA 1F51A 2BU7A 4U93A 4CWOA 2YKBA 3LNUA 1A4HA 3GIFA 1AH6A 1US7A 1UY7A 4EGKA 1B63A 4MPEA 4ASAA 4BAEA 3S5TA 4EFUA 1UYFA 2C2AA 3GIEA 4HYMA 1Y8OA 2XJJA 1AJ6A 2E0AA 4FCRA 4YKUA 3CGYA 4H81A 4LWEA 2BU2A 1H7SA 4XTJA 4XITA 2BTZA 4H85A 3U2DA 4GGLA 3TZ2A 2XHTA 4PRXA 1Z5BA 3EHFA 4CWRA 4XIPA 4GFNA 2YKEA 2YEIA 5J6AA 4PL9A 2IORA 1ID0A 5BOCA 3G7BA 4E01A 5FWKA 4YKTA 3BM9A 3T0ZA 4EGHA 2QG0A 4GQTA 1KIJA 2WI2A 2YEJA 2XDKA 4XKKA 2YEFA 1IXMA 1B3QA 4R1FA 3VHDA 4QPKA 3A0ZA 2Q8HA 1YERA 5D6QA 2JKIA 3A0YA 4W7TA 1AM1A 3B28A 3OW6A 3TTZA 3K60A 2YGAA 2C1IA 1BGQA 3INXA 1Y4SA 2BU8A 2HHIA 2GQPA 1H7UA 2CCTA 4LWFA 4WUDA 4XC0A 1EI1A 4MP7A 4JASA 4HYPA 3WHAA 1UYLA 3LPSA 3CRKA 4YKRA 4EMVA 4MOTA 2BU6A 5CTYA 3TZ0A 2XD6A 3PEJA 2QFOA 5FNCA
chains in the Genus database with same CATH topology
2YEAA 2PNRA 1I58A 2XK2A 2YE6A 4R3MA 3B24A 4KSGA 3SL2A 1UYGA 3RLQA 4B6CA 2IOPA 2YEHA 2YI6A 4PRVA 4L90A 3O2FA 4KQVA 3CWVA 4AWPA 4KFGA 4URLA 4JAUA 4BXIA 2XABA 2UWDA 3ZXQA 3B27A 5C93A 2ZDYA 3D0BA 1YT1A 4L93A 1U2OA 2K5BA 2WEQA 4L94A 5F5RA 2CG9A 2YI7A 4BQGA 2YI0A 1I5DA 2XCMA 4GEEA 3O6OA 2O1WA 4MP2A 4CWTA 1Z5CA 2FWYA 2ZBKB 1YETA 1NHIA 3RLPA 5IDJA 3A0RA 2XX2A 4LP0A 1UYEA 2BREA 5M4MA 3DGEA 1THNA 1YESA 2YK9A 1UY8A 2YEBA 4HY6A 3ZKBA 2XDXA 4XCLA 1ZWHA 4MBCA 5CPHA 1NHHA 2YEGA 5BODA 1AH8A 1BKNA 3R4OA 2WI1A 3TZ5A 3R4NA 2WERA 1JM6A 5CTXA 3VADA 4GCZA 4KTNA 2YEEA 5IN9A 4HXZA 3GIGA 1S14A 4KP4A 1I5BA 4UROA 4O04A 2QF6A 3D2RA 4BIUA 2BYHA 4O07A 3D36A 2WI4A 4EEHA 1MX0A 3G7EA 5D6PA 4DZYA 3C0EA 5D7RA 1GJVA 1YC3A 5GGZA 2CCSA 3FT5A 4JQLA 2O1UA 2YECA 4XKOA 4FMTA 1TBWA 4Q20A 1ZXNA 4LWHA 3A0WA 4CE3A 3A0TA 5M4EA 4CWSA 2WI5A 4YKYA 5FNDA 2VCIA 5L3JA 1TH8A 2CH4A 3RKZA 4BIZA 1UY6A 1YT2A 4LWGA 4URNA 4EFTA 2YE3A 4FCPA 4L91A 1Z59A 2H8MA 2Q8GA 3VHCA 3GIGB 4YKXA 1Y4UA 2CGFA 2XDSA 3IEDA 4CE2A 4ZKIA 3B25A 3KE6A 2QG2A 4V26A 3T2SA 2XHRA 3G75A 5J71A 3FV5A 3JZ3A 2XJXA 2YE5A 1TIDA 2YE4A 2FWZA 2BZ5A 3R4PA 2YE8A 4AS9A 2YE9A 2ZKJA 1OSFA 1UYDA 5M4PA 2HCHA 4LPBA 3OWDA 2YEDA 1QZRA 4K4OA 2IWXA 4XCJA 3OPDA 3T1KA 3Q5KA 4U7NA 2IWUA 3H80A 4CE1A 1YS3A 3Q5JA 1UYMA 4PU9A 4AWQA 2YK2A 3EHJA 1BXDA 4E02A 3NMQA 2XDLA 3OMUA 3PEHA 2BU5A 3EHHA 4NH7A 4L8ZA 4KSHA 1Z5AA 3TUHA 4ASFA 4QPJA 4LWIA 3U2KA 2IWSA 2WI7A 5F3KA 3U67A 1TILA 3TZ4A 3Q5LA 3HZ5A 1ZW9A 3FT8A 2XX4A 2YJWA 3QTFA 2WI6A 2WI3A 1UY9A 4FPPA 1GKZA 4P8OA 2HG1A 4B7PA 4ASBA 1KZNA 3HYYA 2FXSA 2Q8IA 4U7OA 4O09A 1YSRA 3T0HA 5CTWA 4XIRA 3HYZA 4CWFA 2VWCA 4GT8A 4AWOA 3QDDA 4ZVIA 5CTUA 1YT0A 2BYIA 3R92A 4DUHA 3HHUA 2YGFA 1I5AA 5M4KA 3B26A 4URMA 2BSMA 1Y8NA 2XX5A 3R91A 4WUCA 1Y8PA 1R62A 4I5SA 3O0IA 1UYHA 2YE7A 3MNRP 2Q8FA 3K98A 4YKWA 4NH8A 4E00A 4WUBA 4YKZA 1BYQA 3OWBA 2XJGA 2XHXA 1L0OA 1I5CA 2VW5A 5CF0A 4HY1A 2YKJA 1TC0A 2YKCA 2XDUA 5FNFA 3CGZA 4O0BA 1TC6A 2EXLA 3H4LA 3ZKDA 5IDMA 3HZ1A 3WQ9A 3T10A 1GKXA 4HXWA 1QYEA 1NHJA 2YI5A 4CWQA 1YSZA 2Q2EB 4P7AA 1I59A 1UYIA 2H55A 2YKIA 4FCQA 2FYPA 1S16A 4XDMA 4I3HA 3VHAA 4V25A 3BMYA 4XKAA 2YJXA 1QY8A 3EKOA 4NH9A 2AKPA 4JAVA 3HEKA 3C11A 4YKQA 2CCUA 2BRCA 1YC1A 4MPCA 4BQJA 2YE2A 3K97A 4XIQA 4CWPA 2WEPA 1AMWA 3INWA 1UYCA 3RLRA 4XD8A 3K99A 1ZXMA 2ESAA 3ZXOA 4H7QA 2ZDXA 4O05A 4MB9A 2HKJA 4EGIA 4EM7A 1PVGA 2BT0A 2VCJA 5M4HA 4HZ0A 3ZM7A 1YC4A 5M4NA 4CWNA 2YGEA 1EA6A 4HZ5A 2GFDA 4R3AA 5D7CA 4XE2A 1UYKA 1U0ZA 4X9LA 4MPNA 3R4MA 2O1VA 2IOQA 1MU5A 5D7DA 1B62A 3A0XA 4ASGA 2JJCA 3EKRA 3CRLA 3EHGA 2BU7A 4U93A 4CWOA 2YKBA 3LNUA 1A4HA 3GIFA 1AH6A 1US7A 1UY7A 4EGKA 1B63A 4MPEA 4ASAA 4BAEA 4EFUA 1UYFA 2C2AA 3GIEA 4HYMA 1Y8OA 2XJJA 1AJ6A 2E0AA 4FCRA 4YKUA 3CGYA 4H81A 4LWEA 2BU2A 1H7SA 4XTJA 4XITA 2BTZA 4H85A 3U2DA 4GGLA 3TZ2A 2XHTA 4PRXA 1Z5BA 3EHFA 4CWRA 4XIPA 4GFNA 2YKEA 2YEIA 5J6AA 4PL9A 2IORA 1ID0A 5BOCA 3G7BA 4E01A 5FWKA 4YKTA 3BM9A 3T0ZA 4EGHA 2QG0A 4GQTA 1KIJA 2WI2A 2YEJA 2XDKA 4XKKA 2YEFA 1B3QA 4R1FA 3VHDA 4QPKA 3A0ZA 2Q8HA 1YERA 5D6QA 2JKIA 3A0YA 4W7TA 1AM1A 3B28A 3OW6A 3TTZA 3K60A 2YGAA 1BGQA 3INXA 1Y4SA 2BU8A 2GQPA 1H7UA 2CCTA 4LWFA 4WUDA 4XC0A 1EI1A 4MP7A 4JASA 4HYPA 3WHAA 1UYLA 3LPSA 3CRKA 4YKRA 4EMVA 4MOTA 2BU6A 5CTYA 3TZ0A 2XD6A 3PEJA 2QFOA 5FNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEA A;  2PNR A;  1I58 A;  2XK2 A;  2YE6 A;  4R3M A;  3B24 A;  4KSG A;  3SL2 A;  1UYG A;  3RLQ A;  4B6C A;  2IOP A;  2YEH A;  2YI6 A;  4PRV A;  4L90 A;  3O2F A;  4KQV A;  3CWV A;  4AWP A;  4KFG A;  4URL A;  4JAU A;  4BXI A;  2XAB A;  2UWD A;  3ZXQ A;  3B27 A;  5C93 A;  2ZDY A;  3D0B A;  1YT1 A;  4L93 A;  1U2O A;  2K5B A;  2WEQ A;  4L94 A;  5F5R A;  2CG9 A;  2YI7 A;  4BQG A;  2YI0 A;  1I5D A;  2XCM A;  4GEE A;  3O6O A;  2O1W A;  4MP2 A;  4CWT A;  1Z5C A;  2FWY A;  2ZBK B;  1YET A;  1NHI A;  3RLP A;  5IDJ A;  3A0R A;  2XX2 A;  4LP0 A;  1UYE A;  2BRE A;  5M4M A;  3DGE A;  1THN A;  1YES A;  2YK9 A;  1UY8 A;  2YEB A;  4HY6 A;  3ZKB A;  2XDX A;  4XCL A;  1ZWH A;  4MBC A;  5CPH A;  1NHH A;  2YEG A;  5BOD A;  1AH8 A;  1BKN A;  3R4O A;  2WI1 A;  3TZ5 A;  3R4N A;  2WER A;  1JM6 A;  5CTX A;  3VAD A;  4GCZ A;  4KTN A;  2YEE A;  5IN9 A;  4HXZ A;  3GIG A;  1S14 A;  4KP4 A;  1I5B A;  4URO A;  4O04 A;  2QF6 A;  3D2R A;  4BIU A;  2BYH A;  4O07 A;  3D36 A;  2WI4 A;  4EEH A;  1MX0 A;  3G7E A;  5D6P A;  4DZY A;  3C0E A;  5D7R A;  1GJV A;  1YC3 A;  5GGZ A;  2CCS A;  3FT5 A;  4JQL A;  2O1U A;  2YEC A;  4XKO A;  4FMT A;  1TBW A;  4Q20 A;  1ZXN A;  4LWH A;  3A0W A;  4CE3 A;  3A0T A;  5M4E A;  4CWS A;  2WI5 A;  4YKY A;  5FND A;  2VCI A;  5L3J A;  1TH8 A;  2CH4 A;  3RKZ A;  4BIZ A;  1UY6 A;  1YT2 A;  4LWG A;  4URN A;  4EFT A;  2YE3 A;  4FCP A;  4L91 A;  1Z59 A;  2H8M A;  2Q8G A;  3VHC A;  3GIG B;  4YKX A;  1Y4U A;  2CGF A;  2XDS A;  3IED A;  4CE2 A;  4ZKI A;  3B25 A;  3KE6 A;  2QG2 A;  4V26 A;  3T2S A;  2XHR A;  3G75 A;  5J71 A;  3FV5 A;  3JZ3 A;  2XJX A;  2YE5 A;  1TID A;  2YE4 A;  2FWZ A;  2BZ5 A;  3R4P A;  2YE8 A;  4AS9 A;  2YE9 A;  2ZKJ A;  1OSF A;  1UYD A;  5M4P A;  2HCH A;  4LPB A;  3OWD A;  2YED A;  1QZR A;  4K4O A;  2IWX A;  4XCJ A;  3OPD A;  3T1K A;  3Q5K A;  4U7N A;  2IWU A;  3H80 A;  4CE1 A;  1YS3 A;  3Q5J A;  1UYM A;  4PU9 A;  4AWQ A;  2YK2 A;  3EHJ A;  1BXD A;  4E02 A;  3NMQ A;  2XDL A;  3OMU A;  3PEH A;  2BU5 A;  3EHH A;  4NH7 A;  4L8Z A;  4KSH A;  1Z5A A;  3TUH A;  4ASF A;  4QPJ A;  4LWI A;  3U2K A;  2IWS A;  2WI7 A;  5F3K A;  3U67 A;  1TIL A;  3TZ4 A;  3Q5L A;  3HZ5 A;  1ZW9 A;  3FT8 A;  2XX4 A;  2YJW A;  3QTF A;  2WI6 A;  2WI3 A;  1UY9 A;  4FPP A;  1GKZ A;  4P8O A;  2HG1 A;  4B7P A;  4ASB A;  1KZN A;  3HYY A;  2FXS A;  2Q8I A;  4U7O A;  4O09 A;  1YSR A;  3T0H A;  5CTW A;  4XIR A;  3HYZ A;  4CWF A;  2VWC A;  4GT8 A;  4AWO A;  3QDD A;  4ZVI A;  5CTU A;  1YT0 A;  2BYI A;  3R92 A;  4DUH A;  3HHU A;  2YGF A;  1I5A A;  5M4K A;  3B26 A;  4URM A;  2BSM A;  1Y8N A;  2XX5 A;  3R91 A;  4WUC A;  1Y8P A;  1R62 A;  4I5S A;  3O0I A;  1UYH A;  2YE7 A;  3MNR P;  2Q8F A;  3K98 A;  4YKW A;  4NH8 A;  4E00 A;  4WUB A;  4YKZ A;  1BYQ A;  3OWB A;  2XJG A;  2XHX A;  1L0O A;  1I5C A;  2VW5 A;  5CF0 A;  4HY1 A;  2YKJ A;  1TC0 A;  2YKC A;  2XDU A;  5FNF A;  3CGZ A;  4O0B A;  1TC6 A;  2EXL A;  3H4L A;  3ZKD A;  5IDM A;  3HZ1 A;  3WQ9 A;  3T10 A;  1GKX A;  4HXW A;  1QYE A;  1NHJ A;  2YI5 A;  4CWQ A;  1YSZ A;  2Q2E B;  4P7A A;  1I59 A;  1UYI A;  2H55 A;  2YKI A;  4FCQ A;  2FYP A;  1S16 A;  4XDM A;  4I3H A;  3VHA A;  4V25 A;  3BMY A;  4XKA A;  2YJX A;  1QY8 A;  3EKO A;  4NH9 A;  2AKP A;  4JAV A;  3HEK A;  3C11 A;  4YKQ A;  2CCU A;  2BRC A;  1YC1 A;  4MPC A;  4BQJ A;  2YE2 A;  3K97 A;  4XIQ A;  4CWP A;  2WEP A;  1AMW A;  3INW A;  1UYC A;  3RLR A;  4XD8 A;  3K99 A;  1ZXM A;  2ESA A;  3ZXO A;  4H7Q A;  2ZDX A;  4O05 A;  4MB9 A;  2HKJ A;  4EGI A;  4EM7 A;  1PVG A;  2BT0 A;  2VCJ A;  5M4H A;  4HZ0 A;  3ZM7 A;  1YC4 A;  5M4N A;  4CWN A;  2YGE A;  1EA6 A;  4HZ5 A;  2GFD A;  4R3A A;  5D7C A;  4XE2 A;  1UYK A;  1U0Z A;  4X9L A;  4MPN A;  3R4M A;  2O1V A;  2IOQ A;  1MU5 A;  5D7D A;  1B62 A;  3A0X A;  4ASG A;  2JJC A;  3EKR A;  3CRL A;  3EHG A;  2BU7 A;  4U93 A;  4CWO A;  2YKB A;  3LNU A;  1A4H A;  3GIF A;  1AH6 A;  1US7 A;  1UY7 A;  4EGK A;  1B63 A;  4MPE A;  4ASA A;  4BAE A;  4EFU A;  1UYF A;  2C2A A;  3GIE A;  4HYM A;  1Y8O A;  2XJJ A;  1AJ6 A;  2E0A A;  4FCR A;  4YKU A;  3CGY A;  4H81 A;  4LWE A;  2BU2 A;  1H7S A;  4XTJ A;  4XIT A;  2BTZ A;  4H85 A;  3U2D A;  4GGL A;  3TZ2 A;  2XHT A;  4PRX A;  1Z5B A;  3EHF A;  4CWR A;  4XIP A;  4GFN A;  2YKE A;  2YEI A;  5J6A A;  4PL9 A;  2IOR A;  1ID0 A;  5BOC A;  3G7B A;  4E01 A;  5FWK A;  4YKT A;  3BM9 A;  3T0Z A;  4EGH A;  2QG0 A;  4GQT A;  1KIJ A;  2WI2 A;  2YEJ A;  2XDK A;  4XKK A;  2YEF A;  1B3Q A;  4R1F A;  3VHD A;  4QPK A;  3A0Z A;  2Q8H A;  1YER A;  5D6Q A;  2JKI A;  3A0Y A;  4W7T A;  1AM1 A;  3B28 A;  3OW6 A;  3TTZ A;  3K60 A;  2YGA A;  1BGQ A;  3INX A;  1Y4S A;  2BU8 A;  2GQP A;  1H7U A;  2CCT A;  4LWF A;  4WUD A;  4XC0 A;  1EI1 A;  4MP7 A;  4JAS A;  4HYP A;  3WHA A;  1UYL A;  3LPS A;  3CRK A;  4YKR A;  4EMV A;  4MOT A;  2BU6 A;  5CTY A;  3TZ0 A;  2XD6 A;  3PEJ A;  2QFO A;  5FNC A; 
#chains in the Genus database with same CATH topology
 2YEA A;  2PNR A;  1I58 A;  5JEN A;  2XK2 A;  2YE6 A;  4R3M A;  3B24 A;  4KSG A;  3SL2 A;  1UYG A;  3RLQ A;  4B6C A;  2IOP A;  2YEH A;  2YI6 A;  4PRV A;  4L90 A;  3O2F A;  4KQV A;  3CWV A;  4AWP A;  4KFG A;  4URL A;  4JAU A;  4BXI A;  2XAB A;  2UWD A;  3ZXQ A;  3B27 A;  5C93 A;  2ZDY A;  3D0B A;  1YT1 A;  4L93 A;  1U2O A;  2K5B A;  2WEQ A;  4L94 A;  5F5R A;  2CG9 A;  2YI7 A;  4BQG A;  2YI0 A;  1I5D A;  2XCM A;  4GEE A;  3O6O A;  2O1W A;  4MP2 A;  4CWT A;  1Z5C A;  2FWY A;  2ZBK B;  1YET A;  1NHI A;  3RLP A;  5IDJ A;  3A0R A;  2XX2 A;  4LP0 A;  1UYE A;  2BRE A;  5M4M A;  3DGE A;  1THN A;  1YES A;  2YK9 A;  1UY8 A;  2YEB A;  4HY6 A;  3ZKB A;  2XDX A;  4XCL A;  1ZWH A;  4MBC A;  5CPH A;  1NHH A;  2YEG A;  5BOD A;  1AH8 A;  1BKN A;  3R4O A;  2WI1 A;  3TZ5 A;  3R4N A;  2WER A;  1JM6 A;  5CTX A;  3VAD A;  4GCZ A;  4KTN A;  2YEE A;  5IN9 A;  4HXZ A;  3GIG A;  1S14 A;  4KP4 A;  1I5B A;  4URO A;  4O04 A;  2QF6 A;  3D2R A;  4BIU A;  2BYH A;  4O07 A;  3D36 A;  2WI4 A;  4EEH A;  1MX0 A;  3G7E A;  5D6P A;  2C1G A;  4DZY A;  3C0E A;  5D7R A;  1GJV A;  1YC3 A;  5GGZ A;  2CCS A;  3FT5 A;  4JQL A;  2O1U A;  2YEC A;  4XKO A;  4FMT A;  1TBW A;  4Q20 A;  1ZXN A;  4LWH A;  3A0W A;  4CE3 A;  3A0T A;  5M4E A;  4E72 A;  4CWS A;  2WI5 A;  4YKY A;  5FND A;  2VCI A;  5L3J A;  1TH8 A;  2CH4 A;  3RKZ A;  4BIZ A;  1UY6 A;  1YT2 A;  4LWG A;  4URN A;  4EFT A;  2YE3 A;  4FCP A;  4L91 A;  1Z59 A;  2H8M A;  2Q8G A;  3VHC A;  3GIG B;  4YKX A;  1Y4U A;  2CGF A;  2XDS A;  3IED A;  4CE2 A;  4ZKI A;  3B25 A;  3KE6 A;  2QG2 A;  4V26 A;  3T2S A;  2XHR A;  3G75 A;  5J71 A;  3FV5 A;  3JZ3 A;  2XJX A;  2YE5 A;  1TID A;  2YE4 A;  2FWZ A;  2BZ5 A;  3R4P A;  2YE8 A;  4AS9 A;  2YE9 A;  2ZKJ A;  1OSF A;  1UYD A;  5M4P A;  2HCH A;  4LPB A;  3OWD A;  2YED A;  1QZR A;  4K4O A;  2IWX A;  4XCJ A;  3OPD A;  3T1K A;  3Q5K A;  4U7N A;  2IWU A;  3H80 A;  4CE1 A;  1YS3 A;  3Q5J A;  1UYM A;  4PU9 A;  4AWQ A;  2YK2 A;  3EHJ A;  1BXD A;  4E02 A;  3NMQ A;  2XDL A;  3OMU A;  3PEH A;  2BU5 A;  3EHH A;  4NH7 A;  4L8Z A;  4KSH A;  1Z5A A;  3TUH A;  4ASF A;  4QPJ A;  4LWI A;  3U2K A;  2IWS A;  2WI7 A;  5F3K A;  3U67 A;  1TIL A;  3TZ4 A;  3Q5L A;  3HZ5 A;  1ZW9 A;  3FT8 A;  2XX4 A;  2YJW A;  3QTF A;  2WI6 A;  2WI3 A;  1UY9 A;  4FPP A;  1GKZ A;  4P8O A;  2HG1 A;  4B7P A;  4ASB A;  1KZN A;  3HYY A;  2FXS A;  2Q8I A;  4U7O A;  4O09 A;  1YSR A;  3T0H A;  5CTW A;  4XIR A;  3HYZ A;  4CWF A;  2VWC A;  4GT8 A;  3LMM A;  4AWO A;  3QDD A;  4ZVI A;  5CTU A;  1YT0 A;  2BYI A;  3R92 A;  4DUH A;  3HHU A;  2YGF A;  1I5A A;  5M4K A;  3B26 A;  4URM A;  2BSM A;  1Y8N A;  2XX5 A;  3R91 A;  4WUC A;  1Y8P A;  1R62 A;  4I5S A;  3O0I A;  1UYH A;  2YE7 A;  3MNR P;  2Q8F A;  3K98 A;  4YKW A;  4NH8 A;  4E00 A;  4WUB A;  4YKZ A;  1BYQ A;  3OWB A;  2XJG A;  2XHX A;  1L0O A;  1I5C A;  2VW5 A;  5CF0 A;  4HY1 A;  2YKJ A;  1TC0 A;  2YKC A;  2XDU A;  5FNF A;  3CGZ A;  4O0B A;  1TC6 A;  2EXL A;  3H4L A;  3ZKD A;  5IDM A;  3HZ1 A;  3WQ9 A;  3T10 A;  1GKX A;  4HXW A;  1QYE A;  1NHJ A;  2YI5 A;  4CWQ A;  1YSZ A;  2Q2E B;  4P7A A;  1I59 A;  1UYI A;  2H55 A;  2YKI A;  4FCQ A;  2FYP A;  1S16 A;  4XDM A;  4I3H A;  3VHA A;  4V25 A;  3BMY A;  4XKA A;  2YJX A;  1QY8 A;  3EKO A;  4NH9 A;  2AKP A;  4JAV A;  3HEK A;  3C11 A;  4YKQ A;  2CCU A;  2BRC A;  1YC1 A;  4MPC A;  4BQJ A;  2YE2 A;  3K97 A;  4XIQ A;  4CWP A;  2WEP A;  1AMW A;  3INW A;  1UYC A;  2FTK A;  3RLR A;  4XD8 A;  3K99 A;  1ZXM A;  2ESA A;  3ZXO A;  4H7Q A;  2ZDX A;  4O05 A;  4MB9 A;  2HKJ A;  4EGI A;  4EM7 A;  1PVG A;  2BT0 A;  2VCJ A;  5M4H A;  4HZ0 A;  3ZM7 A;  1YC4 A;  5M4N A;  4CWN A;  2YGE A;  1EA6 A;  4HZ5 A;  2GFD A;  4R3A A;  5D7C A;  4XE2 A;  1UYK A;  1U0Z A;  4X9L A;  4MPN A;  3R4M A;  2O1V A;  3CYG A;  2IOQ A;  1MU5 A;  5D7D A;  1B62 A;  3A0X A;  4ASG A;  2JJC A;  3EKR A;  3CRL A;  3EHG A;  1F51 A;  2BU7 A;  4U93 A;  4CWO A;  2YKB A;  3LNU A;  1A4H A;  3GIF A;  1AH6 A;  1US7 A;  1UY7 A;  4EGK A;  1B63 A;  4MPE A;  4ASA A;  4BAE A;  3S5T A;  4EFU A;  1UYF A;  2C2A A;  3GIE A;  4HYM A;  1Y8O A;  2XJJ A;  1AJ6 A;  2E0A A;  4FCR A;  4YKU A;  3CGY A;  4H81 A;  4LWE A;  2BU2 A;  1H7S A;  4XTJ A;  4XIT A;  2BTZ A;  4H85 A;  3U2D A;  4GGL A;  3TZ2 A;  2XHT A;  4PRX A;  1Z5B A;  3EHF A;  4CWR A;  4XIP A;  4GFN A;  2YKE A;  2YEI A;  5J6A A;  4PL9 A;  2IOR A;  1ID0 A;  5BOC A;  3G7B A;  4E01 A;  5FWK A;  4YKT A;  3BM9 A;  3T0Z A;  4EGH A;  2QG0 A;  4GQT A;  1KIJ A;  2WI2 A;  2YEJ A;  2XDK A;  4XKK A;  2YEF A;  1IXM A;  1B3Q A;  4R1F A;  3VHD A;  4QPK A;  3A0Z A;  2Q8H A;  1YER A;  5D6Q A;  2JKI A;  3A0Y A;  4W7T A;  1AM1 A;  3B28 A;  3OW6 A;  3TTZ A;  3K60 A;  2YGA A;  2C1I A;  1BGQ A;  3INX A;  1Y4S A;  2BU8 A;  2HHI A;  2GQP A;  1H7U A;  2CCT A;  4LWF A;  4WUD A;  4XC0 A;  1EI1 A;  4MP7 A;  4JAS A;  4HYP A;  3WHA A;  1UYL A;  3LPS A;  3CRK A;  4YKR A;  4EMV A;  4MOT A;  2BU6 A;  5CTY A;  3TZ0 A;  2XD6 A;  3PEJ A;  2QFO A;  5FNC A; 
#chains in the Genus database with same CATH homology
 2YEA A;  2PNR A;  1I58 A;  2XK2 A;  2YE6 A;  4R3M A;  3B24 A;  4KSG A;  3SL2 A;  1UYG A;  3RLQ A;  4B6C A;  2IOP A;  2YEH A;  2YI6 A;  4PRV A;  4L90 A;  3O2F A;  4KQV A;  3CWV A;  4AWP A;  4KFG A;  4URL A;  4JAU A;  4BXI A;  2XAB A;  2UWD A;  3ZXQ A;  3B27 A;  5C93 A;  2ZDY A;  3D0B A;  1YT1 A;  4L93 A;  1U2O A;  2K5B A;  2WEQ A;  4L94 A;  5F5R A;  2CG9 A;  2YI7 A;  4BQG A;  2YI0 A;  1I5D A;  2XCM A;  4GEE A;  3O6O A;  2O1W A;  4MP2 A;  4CWT A;  1Z5C A;  2FWY A;  2ZBK B;  1YET A;  1NHI A;  3RLP A;  5IDJ A;  3A0R A;  2XX2 A;  4LP0 A;  1UYE A;  2BRE A;  5M4M A;  3DGE A;  1THN A;  1YES A;  2YK9 A;  1UY8 A;  2YEB A;  4HY6 A;  3ZKB A;  2XDX A;  4XCL A;  1ZWH A;  4MBC A;  5CPH A;  1NHH A;  2YEG A;  5BOD A;  1AH8 A;  1BKN A;  3R4O A;  2WI1 A;  3TZ5 A;  3R4N A;  2WER A;  1JM6 A;  5CTX A;  3VAD A;  4GCZ A;  4KTN A;  2YEE A;  5IN9 A;  4HXZ A;  3GIG A;  1S14 A;  4KP4 A;  1I5B A;  4URO A;  4O04 A;  2QF6 A;  3D2R A;  4BIU A;  2BYH A;  4O07 A;  3D36 A;  2WI4 A;  4EEH A;  1MX0 A;  3G7E A;  5D6P A;  4DZY A;  3C0E A;  5D7R A;  1GJV A;  1YC3 A;  5GGZ A;  2CCS A;  3FT5 A;  4JQL A;  2O1U A;  2YEC A;  4XKO A;  4FMT A;  1TBW A;  4Q20 A;  1ZXN A;  4LWH A;  3A0W A;  4CE3 A;  3A0T A;  5M4E A;  4CWS A;  2WI5 A;  4YKY A;  5FND A;  2VCI A;  5L3J A;  1TH8 A;  2CH4 A;  3RKZ A;  4BIZ A;  1UY6 A;  1YT2 A;  4LWG A;  4URN A;  4EFT A;  2YE3 A;  4FCP A;  4L91 A;  1Z59 A;  2H8M A;  2Q8G A;  3VHC A;  3GIG B;  4YKX A;  1Y4U A;  2CGF A;  2XDS A;  3IED A;  4CE2 A;  4ZKI A;  3B25 A;  3KE6 A;  2QG2 A;  4V26 A;  3T2S A;  2XHR A;  3G75 A;  5J71 A;  3FV5 A;  3JZ3 A;  2XJX A;  2YE5 A;  1TID A;  2YE4 A;  2FWZ A;  2BZ5 A;  3R4P A;  2YE8 A;  4AS9 A;  2YE9 A;  2ZKJ A;  1OSF A;  1UYD A;  5M4P A;  2HCH A;  4LPB A;  3OWD A;  2YED A;  1QZR A;  4K4O A;  2IWX A;  4XCJ A;  3OPD A;  3T1K A;  3Q5K A;  4U7N A;  2IWU A;  3H80 A;  4CE1 A;  1YS3 A;  3Q5J A;  1UYM A;  4PU9 A;  4AWQ A;  2YK2 A;  3EHJ A;  1BXD A;  4E02 A;  3NMQ A;  2XDL A;  3OMU A;  3PEH A;  2BU5 A;  3EHH A;  4NH7 A;  4L8Z A;  4KSH A;  1Z5A A;  3TUH A;  4ASF A;  4QPJ A;  4LWI A;  3U2K A;  2IWS A;  2WI7 A;  5F3K A;  3U67 A;  1TIL A;  3TZ4 A;  3Q5L A;  3HZ5 A;  1ZW9 A;  3FT8 A;  2XX4 A;  2YJW A;  3QTF A;  2WI6 A;  2WI3 A;  1UY9 A;  4FPP A;  1GKZ A;  4P8O A;  2HG1 A;  4B7P A;  4ASB A;  1KZN A;  3HYY A;  2FXS A;  2Q8I A;  4U7O A;  4O09 A;  1YSR A;  3T0H A;  5CTW A;  4XIR A;  3HYZ A;  4CWF A;  2VWC A;  4GT8 A;  4AWO A;  3QDD A;  4ZVI A;  5CTU A;  1YT0 A;  2BYI A;  3R92 A;  4DUH A;  3HHU A;  2YGF A;  1I5A A;  5M4K A;  3B26 A;  4URM A;  2BSM A;  1Y8N A;  2XX5 A;  3R91 A;  4WUC A;  1Y8P A;  1R62 A;  4I5S A;  3O0I A;  1UYH A;  2YE7 A;  3MNR P;  2Q8F A;  3K98 A;  4YKW A;  4NH8 A;  4E00 A;  4WUB A;  4YKZ A;  1BYQ A;  3OWB A;  2XJG A;  2XHX A;  1L0O A;  1I5C A;  2VW5 A;  5CF0 A;  4HY1 A;  2YKJ A;  1TC0 A;  2YKC A;  2XDU A;  5FNF A;  3CGZ A;  4O0B A;  1TC6 A;  2EXL A;  3H4L A;  3ZKD A;  5IDM A;  3HZ1 A;  3WQ9 A;  3T10 A;  1GKX A;  4HXW A;  1QYE A;  1NHJ A;  2YI5 A;  4CWQ A;  1YSZ A;  2Q2E B;  4P7A A;  1I59 A;  1UYI A;  2H55 A;  2YKI A;  4FCQ A;  2FYP A;  1S16 A;  4XDM A;  4I3H A;  3VHA A;  4V25 A;  3BMY A;  4XKA A;  2YJX A;  1QY8 A;  3EKO A;  4NH9 A;  2AKP A;  4JAV A;  3HEK A;  3C11 A;  4YKQ A;  2CCU A;  2BRC A;  1YC1 A;  4MPC A;  4BQJ A;  2YE2 A;  3K97 A;  4XIQ A;  4CWP A;  2WEP A;  1AMW A;  3INW A;  1UYC A;  3RLR A;  4XD8 A;  3K99 A;  1ZXM A;  2ESA A;  3ZXO A;  4H7Q A;  2ZDX A;  4O05 A;  4MB9 A;  2HKJ A;  4EGI A;  4EM7 A;  1PVG A;  2BT0 A;  2VCJ A;  5M4H A;  4HZ0 A;  3ZM7 A;  1YC4 A;  5M4N A;  4CWN A;  2YGE A;  1EA6 A;  4HZ5 A;  2GFD A;  4R3A A;  5D7C A;  4XE2 A;  1UYK A;  1U0Z A;  4X9L A;  4MPN A;  3R4M A;  2O1V A;  2IOQ A;  1MU5 A;  5D7D A;  1B62 A;  3A0X A;  4ASG A;  2JJC A;  3EKR A;  3CRL A;  3EHG A;  2BU7 A;  4U93 A;  4CWO A;  2YKB A;  3LNU A;  1A4H A;  3GIF A;  1AH6 A;  1US7 A;  1UY7 A;  4EGK A;  1B63 A;  4MPE A;  4ASA A;  4BAE A;  4EFU A;  1UYF A;  2C2A A;  3GIE A;  4HYM A;  1Y8O A;  2XJJ A;  1AJ6 A;  2E0A A;  4FCR A;  4YKU A;  3CGY A;  4H81 A;  4LWE A;  2BU2 A;  1H7S A;  4XTJ A;  4XIT A;  2BTZ A;  4H85 A;  3U2D A;  4GGL A;  3TZ2 A;  2XHT A;  4PRX A;  1Z5B A;  3EHF A;  4CWR A;  4XIP A;  4GFN A;  2YKE A;  2YEI A;  5J6A A;  4PL9 A;  2IOR A;  1ID0 A;  5BOC A;  3G7B A;  4E01 A;  5FWK A;  4YKT A;  3BM9 A;  3T0Z A;  4EGH A;  2QG0 A;  4GQT A;  1KIJ A;  2WI2 A;  2YEJ A;  2XDK A;  4XKK A;  2YEF A;  1B3Q A;  4R1F A;  3VHD A;  4QPK A;  3A0Z A;  2Q8H A;  1YER A;  5D6Q A;  2JKI A;  3A0Y A;  4W7T A;  1AM1 A;  3B28 A;  3OW6 A;  3TTZ A;  3K60 A;  2YGA A;  1BGQ A;  3INX A;  1Y4S A;  2BU8 A;  2GQP A;  1H7U A;  2CCT A;  4LWF A;  4WUD A;  4XC0 A;  1EI1 A;  4MP7 A;  4JAS A;  4HYP A;  3WHA A;  1UYL A;  3LPS A;  3CRK A;  4YKR A;  4EMV A;  4MOT A;  2BU6 A;  5CTY A;  3TZ0 A;  2XD6 A;  3PEJ A;  2QFO A;  5FNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...