1U11A

Pure (n5-carboxyaminoimidazole ribonucleotide mutase) from the acidophile acetobacter aceti
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PurE (N5-carboxyaminoimidazole Ribonucleotide Mutase)
publication title Acidophilic adaptations in the structure of Acetobacter aceti N5-carboxyaminoimidazole ribonucleotide mutase (PurE).
pubmed doi rcsb
source organism Acetobacter aceti
molecule tags Lyase
total genus 52
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 1u11A00
3TRHA 2NSJA 4ZK2A 1QCZA 4AY3A 2H31A 2NSHA 2FWAA 1O4VA 4ZC8A 4AY4A 3LP6A 5CLFA 4GRDA 5CLJA 4B4KA 5BOSB 2ATEA 2FW1A 2FW9A 5CLIA 2FW6A 2FWPA 5CLHA 1D7AA 4YCJA 1XMPA 4YCBA 5BOSA 4ZMBA 2YWXA 4YCDA 3OPQA 3OOWA 3ORSA 2FWIA 4YCCA 5CLGA 3KUUA 1U11A 2NSLA 5CTJA 4JA0A 2FWJA 3RGGA 2FW8A 5BORA 5CVTA 5C5DA 4ZJYA 2FW7A 3RG8A 2FWBA 4Z7JA
chains in the Genus database with same CATH superfamily
1P0IA 5JJ5A 3E05A 3P7MA 2KBFA 1IN5A 1VFPA 5B6JA 3GB9A 4LW8A 4YP0A 5JT1A 4ND7A 2I2CA 3TLJA 4AY4A 4QG3A 4DVGA 4WOJA 1NI4B 4URVR 1ZH6A 4IMJB 4CF3A 4H2DA 2DYKA 1JR3E 3O9MA 3TNJA 3U7EB 3U9TA 1DWQA 5KSOA 4R2XA 3PHCA 5A1JA 1JAYA 1M6YA 1TU0A 2KLBA 4EJMA 3UUFA 2YXLA 1V6AA 2J3JA 4HMQA 1LQ2A 3FNQA 2MSEB 2ONYA 2XCLA 3W6ZA 3C6XA 3PD1A 4QU5A 2GD0A 2BRUC 4WLFA 5EA2A 3G0GA 3RANA 2GQ0A 4KLCA 2CE2X 5C8XA 4E31A 1M5TA 2GFQA 2H7XA 2ZRCA 4IV8A 4RD1A 5H83A 2I3GA 1H22A 3KQSA 5H80A 5EE1A 2H2IA 1O77A 3ETJA 2IUSA 1HC7A 1R66A 7REQA 3WLAA 1C9MA 3PQ7A 4X64B 1SQ0A 3MS4A 4RIFA 1TVKB 1HFEL 3AETB 3FKSA 2VTKA 1NNI1 5FBLB 4KP7A 1FNNA 1CR4A 3JARB 4LY3A 1OXTA 3B5JA 3JAKB 3QPWA 4AY2A 1PT5A 1CUGA 4C05A 3L7YA 2H1FA 2L82A 1PUJA 3NM6B 1LC0A 4FCWA 5AD1A 3T1TA 3N8HA 5AHWA 3RT9A 4NULA 4AI6A 3IEVA 1BXGA 5GY7A 1OI7A 1U04A 2RDMA 1SBTA 4OK5A 2C2WA 1IUOA 2OHXA 8AT1A 4WJLA 1DFHA 3G82C 3KUCA 2Q49A 2WI8A 4KITB 5D3KA 1FFYA 4IIJA 5IULC 4M9CA 1ULAA 4ZDKA 1ZZGA 2ZJBA 3NAMA 4A0HA 1UM9B 2DPMA 3LBHA 4I4TB 4TQ9A 5CLHA 5AI5A 1E2BA 3EC1A 4P35A 3QIVA 1L1EA 4Q4JB 5FTWA 5EXXA 4Q4HA 1R0RE 3GT0A 4EHIA 5E1OA 1DARA 3AKEA 2VDUE 5HSGA 4RFSB 2JNWA 2Q6IA 2CD9A 4PICA 5J5VA 2FPSA 1M8KA 3TRIA 1DQPA 3MUFA 1ML3A 3ZHXA 3CLSC 1P17A 3TUJC 1P33A 3I6IA 4F45A 2YVKA 3L6UA 4G1UC 4JDUA 4K6GA 1EVJA 3WS7A 3COVA 3RRYA 3QGMA 1NL3A 2NSJA 4BJ5A 2O3UA 1R4MB 3FMPB 3OQMA 5JS1A 3I5YA 4I4TF 3IAS1 3RI3A 1JL3A 1G3IA 1NYQA 1X74A 2ATEA 2V7PA 3KSZO 2X0EA 4ZCMA 4G4SP 3R3ZA 1W34A 2DMRA 3T4PA 1MB3A 1NMZA 2XUZA 2XRYA 5KTSA 4QPZA 2B2XA 2PZEA 3TGWA 1TMKA 1D4ZA 4CMIB 2J3HA 2AHRA 821PA 4ZI7B 1UJ6A 3H11B 5CFNA 1XKXA 3A1SA 1L5MA 4PYRA 4QQ8A 5BN4A 3BJRA 1NVKA 4D1YA 2P9HA 1L4UA 1Y1RA 1YS2X 3IJPA 4JBXA 4RD3A 3RSCA 4WKGA 2WAXA 3T7EA 2PZLA 1D2MA 1YMUA 3K30A 3K94A 5F7ZA 3GMSA 1CUUA 3KXIA 2QT0A 3LY7A 5JJKA 1SVWA 4YP6A 5JVDA 1HK7A 2JLSA 2R7LA 3A37A 2XV1A 4ABYA 4CIVA 5LQUA 5I5GA 1Y5MA 5TIIA 3Q12A 4BP1A 3G8DA 3EG9B 3D6FA 3K0HA 2X7JA 4QHYA 4NNPA 4ZI7F 1NASA 5F77A 2R4UA 3DEJA 4CLRB 1P7WA 2J3EA 2OZKA 4KRXA 5EMJA 3TPZA 1LZKA 2PGDA 3PHBE 1E0KA 4X9XA 3MUNA 4D4JA 1E18A 2HYDA 1MJNA 3MJHA 4HQNA 4JWTA 2XUFA 1HYQA 5DLPA 1KQPA 2P62A 3L5KA 4MW1A 3ZLUA 1VLZA 2HT6A 4BYGA 1AUPA 4QATA 5L4NA 2Z30A 3A9TA 3TPFA 4DSTA 2WMDA 1F1JA 1JMYA 1MPXA 1GNTA 2QLLA 3B1ZA 4H1WA 3E81A 3TZCA 3W3AA 5KOHA 1XJ5A 2Y1OA 5EAIA 3LY5A 4JB0A 5EIEA 4A1OA 1N5IA 4RK7A 1T35A 2I7CA 2XA2A 4FGLA 3WKAA 2JLXA 3ZY3A 3KJNA 4GD3Q 1EUYA 3UG7A 2G1AA 1D2HA 2VTEA 5TF4A 4B81A 4LGMA 4XCQA 1D4AA 3QKWA 5JYBA 1ZJ6A 5KQGA 2WIJA 3FJOA 1VXOA 2PDAA 3HNPA 1H23A 1VYVA 1ZVVA 2WYVA 3VKWA 3ZHUA 3O9ZA 4R7ZA 2DEUA 2FZCA 3NHWA 3L6EA 1D4OA 1EFPA 3R6LA 2WHPB 5JHGB 4RHTA 1H9CA 4J4TA 2ZATA 2Z8ZA 4FX5A 3AERA 4Q47A 3GBVA 1Y8QB 1FF9A 3HYRA 4AB1A 4MUIA 4DY4A 3KAKA 5H82A 3GLGE 4JEHA 2G77B 2ZVQX 3LECA 1AZLA 4UM7A 4OJYA 2WB4A 2AZTA 4PFSA 4D9IA 4WBNF 5JTUA 4TSRA 4FFNA 4M0CA 4Y7CA 4ZQCB 4D3ZA 1ZGHA 1UP7A 4Q03A 1CTQA 5L3RA 5BUSA 3I8OA 4MO2A 2ZR7A 4KL8S 4JOBA 2WJZB 5JXIA 1HF3A 2JGJA 4EECA 4DZTA 4W1RA 5L95A 1JJ7A 1TMGE 3RREA 1F38A 1DWOA 4J7AA 1XQVA 1HT0A 4RDIA 3OTIA 4IH9A 3GU3A 2H0AA 4DWWA 3GJ5A 2QTCA 4KXYA 1KRHA 2JAQA 1J5EB 2RARA 4RKFA 1KI7A 3HCNA 3HR4A 3A1EA 3W34A 4E2XA 2Z5FA 4KPEC 3GLFE 3KVRA 3PRHA 1GP2A 1YR8A 2HMVA 4MIKA 3GBSA 3QYFA 5JS7A 1OH8A 4M1ZA 3BWDD 2XXBA 1K5DA 2ZRBA 3L07A 3PPWA 4FYMA 4JD5A 1WPRA 4X8OA 5CLQA 4XOUA 3ZZ0A 5EJMA 3FJYA 2R68A 3HKEB 1QGUA 5SZIA 3ME5A 3N2KB 1OH6A 4G09A 4WZBE 2CL5A 1U1IA 8ABPA 1U8TA 1Y4DE 3CPEA 5JWRA 1R3UA 5FL7D 1K7EB 1ZWKA 1L9KA 3MGBA 5FYDA 1OLUB 4F2DA 5MN5A 3VZPA 4BUZA 3NC4A 4TS3A 1N2CB 2F1JA 5CIWA 3IT3A 1H0HA 3KSUA 2AG1A 2OVFA 3CLUD 1M5UA 1XQ9A 3MCTA 1P62B 2HFKA 3MK31 4JOQA 5AK6A 4ZOAA 3GLHA 1RHRA 1QOZA 3COYA 3F4KA 3OQNA 3HWRA 4NYJR 1A9SA 2GCPA 4IF4A 4PLHA 1XRMA 2RSLA 1AF7A 3IDOA 5DGHA 2C9MA 1ZINA 3H1BA 4KLNA 3F6RA 4UTOA 3PHHA 2E87A 3M2PA 1N34B 2BH2A 1KR5A 1G19A 6PFKA 4K9OA 4L50A 4K81B 2VQFB 3K0KA 4DAOA 3OZRA 1M76A 3OF3A 2H65A 3ESXA 4RS3A 3EXAA 1O94C 3L9XA 1QBKC 4HDOB 1ZH4A 4MICA 4CM1A 2V8OA 1P7YA 2IEDA 5HILA 4CR8A 4QZVA 4MWCA 3CZCA 2DH6A 3LHFA 1YACA 2OC4A 5ALSA 4B9EA 1IN6A 2O3QA 3KJGA 3ZXSA 4DCTA 1AQNA 4J0QA 4YMLA 1YKFA 1ZFNA 4GLLA 1O95D 4LFCB 3ZDCA 4O6VA 5IT4A 2WWWA 3UWOA 5FWDA 3NVKI 2QNIA 1OXSC 3A9CA 4PQRA 4XASA 3SFTA 3QVOA 3DCJA 4ZHQF 1N3BA 3TYXA 1US8A 3LRPA 1JEEA 3DLIA 5CMLA 4E08A 3AKDA 2NW6A 2R85A 2WE7A 3GLQA 5F1PA 5IH7A 2IEBA 1I6WA 2AD1A 4A8JC 3N8IA 1VE5A 3D6TB 3OJ0A 5A7GA 1XZNA 4LF8B 3CNHA 1I3KA 1WCIB 4PX9A 4BKRA 4N40A 3FPEA 3F4BA 4G89A 1DHRA 1U7WA 2AQ8A 4B8WA 2HBYA 3GFBA 1BA3A 4QUDA 1Q3KA 2ZPTX 4ZVSA 4R69A 4BVHA 5KYVA 1R8QA 5F12A 4XZ3A 1UKYA 3JWEA 4B6QA 2JCVA 5JJBA 4GOJA 2Z4RA 4PIPA 1Q0PA 1U9JA 2B8WA 1WXDA 2OCAA 5DLQC 1YB5A 3PNYA 1JLSA 3HU5A 2FEKA 1JQAA 3L0IB 4LE2A 4O08A 4RMHA 3RG8A 3ZTWA 4C87A 4QYXA 1YB2A 2I6FA 2YWFA 2I7DA 3TLEA 1G6Q1 4JYZA 1M33A 2C9DA 1NMXA 5TGZA 3IYLW 2H29A 2J6CA 4XQCA 5BN3B 5EHXA 4NBSA 2H5EA 2ZT7A 4PLFA 3AI1A 4I5EA 2CV2A 5FUVA 1MEEA 5EWMB 1KJ8A 3L8EA 1GFZA 1LRJA 4IJ5A 2J9FB 3ZY5A 4D56A 5DN6D 4JEMA 3G59A 3K8ZA 5F7JA 3KB8A 3SXUA 3QPUA 5BSFA 3PD7A 5JY6A 5AVRA 1OYYA 2DFNA 5AFSA 5IHPA 1MVOA 2AT1A 4YRDA 2O8DA 2HF7A 4BAGA 2OKCA 1SWWA 3E61A 1UCFA 4BOYA 1H3FA 1PK7A 3WKEA 5B5SA 5IFKA 2HQRA 2JGAA 3DMYA 3F8SA 3HA3A 1HRKA 4Y2VA 2BFFA 4BU1A 1AKRA 4FEEA 5FQNA 5JZVA 3UFXA 1XJQA 3JQ8A 2QLFA 3L0YA 3A0RB 1F0KA 4LMRA 4M8KA 4OP3A 3W5IA 1EBBA 3WLEA 1BCRB 2FFRA 3L8GA 3SN6A 4FDUA 5IT9A 2CNBA 1YUMA 1MNAA 4ZU3A 3H8VA 3TNLA 3TRKA 5LQRA 5CK4A 4DWJA 3H5IA 5T8KC 1REQB 4M88A 3VNSA 2DUWA 1V39A 1F4PA 3FHOA 1DOHA 4BNJA 3MTJA 5EE9A 1MU0A 3KL4A 2JH8A 1QV7A 1AA9A 5EZ5A 3ADCA 3LPNA 3E18A 3O90A 3V8NA 2LTAA 1QH9A 1NFFA 1RWWA 2JHAA 1T3GA 2DHRA 3MWDA 1B00A 2GN9A 3QE0A 4U7TB 3SD7A 4ZOLB 3GRRA 5JZBA 2VWPA 4IH1A 4B0OA 4XYLA 5L3QA 4I8XA 1SY7A 1HORA 2GYYA 2YH2A 4NG4A 5JISA 2FUKA 5L3VA 3DAHA 3R44A 4IS2A 1Y7HA 1Y1TA 1R10A 2BZ0A 2ET6A 3HA2A 3N2LA 5FPYA 4CF7A 1Q2UA 4GM1A 1UFOA 2ZYRA 1EFAA 3RR2A 4WTOA 4X5OA 2JPDA 1JWLA 1JW9B 3WZMA 1T9HA 1UZAA 1SUEA 1J42A 1BVHA 4P82A 3EVAA 1EXMA 1ZD5A 3PFCA 4NJOA 5JPCA 1E79A 1HKHA 2CLSA 2C83A 2QN2A 3MIZA 4IO1A 4Q39A 4WN3A 5DV9A 1FPQA 3LQ4A 2FFHA 4A15A 3TIVA 1N1MA 4UFOA 2QVYX 2HSEA 5BW5A 1JQDA 3ED5A 5JPDA 2R1TA 1X1RA 2O2ZA 3O4FA 3NBMA 2JW5A 4M49A 3U61B 4HRVA 3DMPA 1DT3A 2G67A 2OHOA 3UWKA 2E0IA 1M54A 2CMGA 3ER6A 4MEAA 2PJDA 3X0DA 4ARCA 4OVKA 3OPMA 4RWEA 4WXPA 3HCOA 1KBQA 3FETA 2CW5A 1LTHR 5HKKD 4RX1A 4YCMA 5JCZA 1IWOA 3N6VA 4JP2A 1LDGA 4NXNB 2PGIA 3C24A 4Y2XA 2ZIFA 3NXSA 3BRWD 2GHQA 1U0SY 2Q8QA 5T3YA 3KJFA 5K6TA 3J81k 2QMEA 3OZCA 3HVHA 3TI9A 4UOQA 5KAPA 3TWOA 4BMVA 4DG9A 1E5VA 3W4JA 1R4ZA 2E4ZA 5F7OA 4HMOA 1XRQA 4HDQB 3I53A 1XPJA 2FPUA 1DEAA 1OWLA 5JDIC 3A7EA 4L76A 1BQ4A 3L6DA 4Z86A 1HKUA 2Q3MA 4OHZA 3EPKA 3FJ1A 1CDZA 4NLLA 4JUFA 5JCPA 5I4BA 1ID8A 2HRZA 5IBCA 2CKDA 2KBEA 4FOOA 1L8AA 2WA2A 3DAPA 5E6UA 1AKQA 1PLJA 2IEIA 3GVHA 3K3PA 1R9NA 5FLKA 1X1DA 3FNHA 3PDCA 5FBQB 3U44B 4OI0A 5A9TA 1GG5A 1E1QA 1THTA 3QLTA 2RBEA 1JYSA 4DMKA 1WX1A 1G0OA 1S0UA 3RS2A 5JQGA 5EJGA 3DZDA 3NM4A 1PJAA 2COKA 3R4VA 1BQ3A 2HFJA 3D5QA 3UUGA 5JRZA 3NHZA 3SPXA 1SBHA 3RG2A 4X24A 1O5IA 4BMYA 3A04A 1U9ZA 3LXUX 3TOCA 2YC2C 4GGOA 4ZGWA 3O3NB 1Q7TA 2JIBA 2Q5CA 2QTFA 4KOAA 1U7DA 3PDWA 4H9GA 4XH9B 1K4YA 1HTTA 5D3ZA 3F6SA 4BQRA 3REQA 1PZGA 2F8LA 4N12A 1BKDR 1R6UA 4AP9A 4ROSA 4YRFA 2QRZA 1V9CA 2HJRA 2WA1A 1E1CB 3RTEA 4XVCA 2CE7A 1CV2A 3FTQA 1JPVA 3KFXA 4LNAA 3ZYZA 3ETDA 1QHIA 1Z47A 3LCRA 4C4ZA 5K6RA 2PSHA 1YFLA 2I78A 4PG4A 4D3XA 3ORSA 1YQEA 4C5AA 3SP1A 3T3MB 1CEEA 4TX1A 4BJ1A 5E9WA 5JECA 5CXUA 5TQJA 5KZMB 1YQQA 2WM8A 3GHYA 3TB6A 2AZMA 5L51A 1P1FA 1JKXA 3K20A 5CT9A 1OYVA 2HMYB 3HYNA 1VIVA 4B74A 3UXEA 3UPUA 1JU4A 5CNKA 4DIMA 4I8IA 4MPJA 4QDZA 3AB8A 4RGVA 1YIDA 3CX7A 5CNJA 3WLNA 2X3YA 3ND7A 4AJ4A 1UFRA 1LKZA 4J2OA 2MJLA 2BM8A 2JC3A 2PH1A 3MW8A 3OZGA 4JL6A 1JQEA 4K88A 4R2LA 4D99A 3FDZA 2WJPA 4OPMA 4TMYA 4DLNA 2NTVA 5E3IA 3ML1A 6ABPA 3LVRE 2B1GA 1IJEA 4HQ0A 5IDXA 3UWSA 3R7SA 5ALDA 2VCHA 4KQKA 5EQFA 4GSKA 1T6XA 4CHGA 1XYVA 2Q8PA 3CM0A 3IV9A 5GIOE 3SFVA 1JSRA 3DHVA 1H42A 2EGHA 3LW8A 3NHUA 2BOVA 1YS7A 3EGXB 1Q16A 4Q9AA 1CX9B 1ZOLA 2YZ7A 4DLVA 4O1HA 2JG3A 1FP4A 4GS5A 2QX6A 4PWYA 3NWBA 3ADKA 3RB8A 4YO8A 2O6HA 1MZVA 2G9UA 2JRCA 3B3JA 2WJGA 2CHVA 1T4CA 3OIUA 4U7PB 3SE0A 2EWVA 3KLPX 4UNPA 4MYRA 4J3NA 5KHLB 2BL4A 2ZBFA 3UC5A 1RMYA 3DF7A 4CVNA 3AF1A 1RTKA 4Q3EA 3O31A 3Q3HA 3TFQA 1JDTA 5JTTA 4DXDA 1MOPA 4J7CA 4HSGA 1NA5A 4M7OA 1LV7A 4Y6QA 5E6RB 2CNWD 4LVOA 3HNRA 5L4LA 4N48A 2X0DA 5GOTA 5E38A 4D9BA 1RABA 4GX0A 2EW2A 3O2QB 1RBQA 1DUSA 1KZ1A 2AI2A 4Q6BA 3L3BA 2B4RO 4QAJA 4AKIA 1SQ5A 2V6GA 2VJNA 3BF8A 1O1YA 1OIVA 4BEWA 3CUUA 3E0XA 4KXWA 1DQRA 4IGAA 3GZNB 3QMPA 3P2EA 2V98A 4YREA 1SVLA 3C7TA 4FKZA 3OWHA 1QFSA 5CYOA 2GAFA 3RS8A 5JZOA 5LXTA 1CRLA 2Q2QA 3UUEA 4XI9A 3THXB 4RKYA 4IZ6A 3UK0A 2RKWA 4GX2A 3OBIA 3EZXA 3ZTYA 4TOIA 2I0FA 1R4NB 2AOUB 5DW3A 5CFRA 5A4MS 3HM9A 3ANTA 4IOJA 4KQ9A 1WUJS 4PNZA 3RBZA 1B0ZA 1OMOA 4J2TA 5KYYA 4GICA 1IXSB 1OAAA 1FPMA 4JJGA 4PN7A 9MHTA 1C81A 3QUCA 1QRRA 2IH5A 2B7LA 1VLJA 3K9WA 4YJ3A 1QO0A 5JY1A 4RZXA 1Z68A 2ARKA 2XECA 4U4AA 1L5YA 4YRLA 4DW8A 2V7UA 1XLTA 1GRQA 2Q5IA 2RC5A 1BD4A 1XHLA 1VPVA 2QRQA 2XTAA 1D2GA 3L40A 3PGA1 1RHQA 1U3DA 1OILA 2Z9CA 1D07A 1KKLA 3M6AA 1H2WA 4XQEA 3JAWB 5EJFA 1OKKA 5JPIA 3U0BA 3WGZA 1QHFA 3ZQ4A 5BP7A 1GQSA 2C5FA 4GVXA 5FUXA 3BZBA 2JDIA 2HKIA 4B3IA 3QWIA 1C41A 1Z4LA 5LU8A 2VBFA 1LDMA 3FKJA 3MD9A 3DBRA 3VPHA 3AO0B 1OBCA 3F0TA 1GY8A 2VHJA 1M2KA 3QHQA 2A9VA 1YE8A 3OVMA 3OURA 2XHEA 2RG1A 1ECBA 4TM7A 5IDWA 1OIXA 2HQBA 2P4UA 4LDPA 5DP2A 1C7ZA 1FTWA 4BO2A 3EIOA 4Z3KA 3I9FA 2P8SA 3T1NA 1YTLA 4B0PA 1KYYA 4AW9A 3IL2A 2P6UA 4DR2B 2WUVA 1V43A 2XJ9A 4NCAA 3P9CA 2AOVA 2JFWA 4ZEOA 4NFHA 4M4SA 1U90A 1X19A 4K0KB 4DC1A 3ADPA 3QPDA 5DTQA 5JWHA 2NUPB 3VVBA 5F5LA 1NJ5A 4U3JB 4MW7A 4YFYA 2XUGA 1B23P 5D1HA 1YJ5A 4KUGA 1MQ8B 1T0IA 4K9NA 4OBBA 3NHPA 2XZOA 2QAJA 3MTGA 3AMVA 3K5HA 5TMDA 1AZSC 2RJ3A 3VR3A 5GZ6A 4F4FA 2JBWA 3O8DA 1MW8X 4FT4A 4YHHB 1H5QA 4BGUA 4YX9A 1T3LA 1RPAA 3QXGA 3QBJA 4IJ6A 4ND5A 3CW2A 4V2UA 3PUYA 5AYVA 4P5PA 1BD3A 2ZULA 3RRJA 4AMVA 4B6EA 3L46A 2JGLA 3A3NA 3A6KA 3L4BC 3LYLA 5GONF 3TM5A 4C9BA 4CM8A 4RMNA 1YRLA 2ZRFA 3HNOA 1VG8A 4HTFA 4C06A 4PYLA 3WSTA 4AYTA 1AHHA 5C81A 1KFBB 3FIUA 4XR9A 3Q5GA 5L7TA 2GAAA 1JLMA 4L3VA 3RS4A 3PX3A 1ZLXA 1LWOA 4FYWA 5H1YA 1JG2A 1V37A 4TT8A 3TRDA 5EJ5A 1NT4A 1QIIA 1WSWA 1Z4PX 3FBGA 3FNFA 4EYQA 1E5XA 1ECCA 5KWIA 4ZT6A 4MGHA 4CHTA 2JGDA 3ELWA 1IY2A 4BNTA 4BYMA 5IJWA 1XDSA 2I3ZA 3EQ2A 2P9QA 3VUFA 3H9JA 4V02A 4C0KA 4UDOA 3QY9A 1B2RA 5C37A 1YHZA 5AI0A 4DV3B 4Y2HA 4DEXA 2JBHA 2SNIE 4O1MA 3RWOA 3MJEA 1NPTO 4JXJA 2I7TA 2BLNA 2CNDA 1M1XB 1MX5A 2OBFA 2R60A 3H3JA 3ZUGA 5LBIA 3ZWDA 2I99A 3BGIA 3BSSA 3T5PA 4KR2A 5E3HA 3LY9A 1Q11A 2PH3A 4DKJA 1Y8CA 1W87A 1G98A 4QXOA 1YDFA 4G65A 4PSVA 1QU2A 1UMBA 3OEEA 4YBRA 5IUNC 1SBZA 1WF6A 3OC6A 4CMEA 1J21A 1HYBA 3G02A 3OFNA 4YJHA 1GL9B 1JKFA 1Y8RA 5J2TA 3KHSA 1V11A 3G5UA 3QV2A 4YLEA 1H8ED 2X6TA 3CUYA 1SB8A 4HLDA 1P0FA 4RF4A 4V0LA 3R0ZA 1M2OA 3ROEA 2II6A 3ZV5A 5JNRA 3T41A 3ZJ5A 1FP1D 3LDAA 3DCNA 1ZYUA 3QVGB 4O5OA 4TTIA 4U8GA 3JQAA 2IYAA 2W4QA 4KRGA 4PAWA 4UCWA 1LU9A 3II6X 1XDDA 3K6JA 3OTQA 1ADJA 4KFTA 3UT0A 4PZEA 4MQ4A 5LP6F 4M3NA 4ZT7A 2BONA 1DKPA 4BVKA 1J8QA 1XHFA 2I1WA 1GGKA 4QBTA 3VSEA 1SKYE 1T1SA 3RTAA 1EZ4A 3I2IA 2QROA 4ANFA 3SCZA 3ZCQA 2PTGA 4I1YA 4NJEB 3CRNA 1Q7RA 1HTWA 1VKRA 3V3KA 4N47A 1GZ6A 3ER9A 1R15A 1T2UA 3O3CA 2AW5A 4P1ZA 4RSGA 4WXMA 5K3DA 3WYNA 4AQ7A 3CF2A 4R9RA 1O9HA 1IVYA 2VTVA 4CKYA 5FXMA 1QMGA 1JHZA 5DHUA 3RUFA 3VR4A 1NIJA 1Z6GA 2FJPA 3ZS8A 1HEIA 1NVDA 3Q15C 2W4IA 4HPXB 4D3DA 1KZ6A 3C16C 4G1MB 5E4TA 3T7KA 3GYBA 4CKBA 1WTAA 1C0PA 4IKPA 1TUEA 1NUHA 1J7KA 1X7WB 5AOCA 3D8BA 1I01A 5IANA 1MX1A 4DJ5X 4MAMA 4MGZR 5K7SA 4AIRA 3RYHA 4BS9A 2O2SA 4ZRMA 1FXWA 1XU4A 3G8CA 5B30A 1IDOA 4BLSA 3WG9A 1CR0A 1YI8A 4DLLA 3C1UA 5B3KA 3BWYA 2XDWA 3MEQA 5BURA 5DBEX 5CTAA 4BE9A 1U3UA 3JRWA 4EMUA 1IWBB 1QFMA 5AW5A 3ZU5A 4GUAA 4CLEA 4YCSA 1V47A 1D8TA 3PIDA 3ABIA 2HK7A 3OFKA 2IUEA 3LDUA 3KKNA 1RXSA 4MUNA 5DHFA 3Q8KA 1J00A 2E4XA 4PGAA 2FX2A 3HJGA 4GMFA 3MGKA 3DDZX 5IBQA 3T06B 2WSIA 5A4IS 4O0MA 4RHXA 1KFCB 1GZ5A 4TXHA 4HV4A 4LZOA 4I7EA 4NFYA 2EKLA 1OOEA 3RAJA 2IGBA 3FCSB 2B1RA 3U4QB 2JD1A 3I6MA 2ES4A 1CNEA 2BGRA 3D81A 3EWAA 4XUCA 4BFZA 3AEUA 1OW3B 1MA0A 3PEWA 1CIVA 3P96A 1XMVA 3W9YA 5BUZA 5JWOA 1JDUA 3EXEA 4M83A 5LP6C 1ZIPA 2A6PA 4INOA 4TMWA 3UMVA 2PS9A 3FN4A 4CQMA 3X1ZA 1Y4AE 4AQDA 5ARDA 4BC0A 2WM3A 3ROXA 5AI4A 4MUHA 3URKA 2CJFA 2JGNA 3W4IA 1XNQB 3Q2OA 4W8HA 4HNAB 1I3CA 4PCAA 4ZTBA 2A4MA 4GYJA 2I33A 2P7IA 3C7DB 2G9ZA 4R8KA 2PFKA 1ADGA 3QBVA 5DYNA 4ER7A 1ZK1A 3QFSA 4BRWA 4DDMA 3CE9A 1ISIA 2FZ5A 4ZO7A 4MB2A 3IBTA 2WJ3A 3FUVA 1B42A 2LDXA 3WWCA 4AWBA 3JQ7A 1IEWA 4ND3A 2IYSA 4BQIA 1Y34E 1F14A 3OEWA 2ENWA 4KWEA 4DTCA 3TG8A 5JJIA 2KLHA 1C4OA 4CDNA 2FUNB 2VP5A 2POCA 1Q6ZA 2XMPA 3JSAA 4J0JA 4K6FA 5ALRA 4GXTA 5IAEA 4TKUB 1RRPA 4JK3A 4PZYA 2GLXA 4NK4A 4YQFA 5CRIA 1GDDA 2IPXA 4FHGA 3KNZA 3ND6A 4E5DA 2BZSA 3WISA 4BY9E 4OQQA 3ANXA 4ZVOA 2G80A 1IOVA 3SQLA 1C7FA 1SUAA 4MULA 3BMCA 3F1KA 1BHO1 4DM4A 2B3TA 3DAFA 2FWAA 1UJ2A 5LP1A 5A04A 4CXMA 2ZT6A 1TYDE 3PI6A 4EW1A 4KN6A 5KYWB 5DEIA 1D7AA 4AZ3B 2WKSA 4F1KA 1L5SA 1LC3A 1TVKA 5E2IA 3KR1A 1TMOA 3AETA 4PRYA 5T67A 1J8FA 2PKQO 3VHLB 3JARA 4MV7A 3WGMA 1TO2E 2H1HA 1D5WA 3JAKA 3ORQA 4MDYA 3X3HA 2GT1A 3DHWC 1IOWA 5JQWA 3Q87B 3CQ9A 2FAXA 3ETHA 4JLMA 1YZYA 1CVIA 2CXQA 4RKEA 4TRJA 4WINA 2IW3A 4ERNA 3UWPA 1K97A 5F4BA 1YZVA 3SSAA 2IKSA 2VRCD 1W6UA 1ST3A 5G40A 3V4SA 4Z4HA 3AIIA 3HA7A 4PYJA 4F96A 3GCXA 3KR9A 4DM3A 3U37A 1YVDA 2XZDA 4IMPA 3WTBA 3B8EA 3GH3A 3VPSA 4EW3A 2Y6VA 1VB5A 2L18A 3DOOA 3H87A 1JIUA 2GPSA 2RGEA 1EJ0A 1UM9A 4U7JA 3R5KA 4IDQA 3IO3A 1V45E 4F5EA 4CKZA 3RBAA 4L0QA 4QWMA 1JBQA 1I5OA 3EVNA 4Q4JA 2PBLA 3T5AA 2XWSA 3G9ZA 4ML3A 1NVFA 3E9CA 3EASA 3K8YA 2J9ZB 1W85B 4LVNA 4RFSA 2YYAA 2Y93A 1YJAA 4OA5A 4TPKA 1ZUD1 3LHDA 4JI4B 4CV3A 1VPWA 2G9RA 1MLDA 3RFVA 1XP5A 2I22A 1YOBA 4EFNA 2DR0A 2EKBA 3BCUA 1ZM2A 3K05A 3LT1A 2ZUTA 4B4WA 6GPBA 2AMVA 2WBLC 4NCXA 2K6GA 1GPBA 1FDWA 3UAGA 1YBVA 5ALQA 2V9PA 2WPNA 1GA6A 3BD9A 1UDXA 4K40A 1TLFA 3QX8A 1N5OX 1Z28A 1WLSA 4GBJA 1K68A 4ETMA 1ZM7A 1TRHA 3UJDA 2BFBB 5CDFA 1VBMA 2F9FA 4JUAA 2EG5A 3LA8A 3HCAA 3ISTA 3UV7A 3CZ4A 4KGDA 2H17A 2PS1A 2HHCA 4ON9A 1ZN7A 5MN4A 3DZBA 4R3WA 1M6NA 1IHXA 1TPZA 1UWLA 3CXRA 3PHLA 2HHLA 4E5SA 1F06A 3IEKA 3V7NA 3U1BA 4UEKA 4LA4A 3ZWVA 3AU9A 3NOQA 2R66A 1ZGAA 3GNQA 2I6SA 2A7QA 3GLIB 4DSUA 3ZIAA 4IIFA 2A14A 1I2BA 5CH3A 4JDPA 4HAVA 2FCRA 2OORC 4UAGA 1XE3A 3T61A 3EE6A 4CMBA 1G5IA 4X41A 2WAYA 3KKLA 2ZKIA 4KE7A 2QG9A 1E8NA 1XCPA 4LQ4A 3STHA 4A03A 3ZX4A 5KJ1A 4NZMA 1LEHA 1MN6A 5CXSA 1HG0A 2C5EA 2C1ZA 4CFZA 3GNTA 4R8MA 2R5WA 2G7MC 3EG9A 2QQFA 1RBYA 2ACWA 5EUCA 5DWVA 3QXHA 1MJGM 2WJ4A 5IJ9B 4P4NA 5ENZA 5HCNA 1Z88A 1I32A 4PYIA 3X1YA 1AO3A 2XF8A 3BWEA 3NOXA 2QG4A 4YJ2B 1Q0HA 4BZWA 3A6ZA 2J5QA 4KWCA 4XUGB 4ARUA 5AI6A 4Z1OA 2O20A 3VHQA 3M3PA 4TKVB 1L5LA 4X93A 1ND5A 3REFA 3SYKA 1Q84A 4MHTA 3EDQA 1SZCA 4ZV9A 4X8MA 1OI3A 3NWJA 3DEFA 4JJIA 2HIHA 2AJCA 5FOWA 3NZEA 3A6EA 3LBIA 1UT6A 8ATCA 5CEEA 1UOEA 1QG2A 3OPNA 2YHUA 4BLTA 1JLKA 4PG6A 1MA3A 4GRAA 3KTDA 3BZWA 1A9XB 3H1PA 3DO6A 2HR1A 1SK8A 3GT4A 3GBPA 5ICGA 2XT9A 3F5QA 1R6BX 2FRDC 2XZPA 3K35A 5EXPA 1H3NA 2R6AA 1EJBA 4HFJA 5JLJA 3BXFA 4P3KA 1RJ9A 4CDRA 4G0UA 2BFOA 4DNXA 4PX3A 3LQRA 4GYWA 1JHPA 2VHTA 4FYVA 1TI7A 1FQOA 2WHPA 2IXDA 1FFBA 2G5PA 3CWQA 4HJRA 1GL6A 4V0RA 4YAFA 4OYLA 4PSDA 1GDHA 3U4AA 1Y8QA 2GX6A 3I23A 3FOEC 3HKCB 3COPA 4W6ZA 4MW2A 4QT4A 1M34E 1WCV1 4AKHA 2QYOA 4YRJA 2FW9A 3ESRA 1OBHA 2YN4A 4EG4A 1M67A 3VR2D 1T15A 1NVGA 1J0AA 1NZJA 2VDNB 1XNRB 4CKCA 1S02A 3PZBA 3NUGA 4QOGA 1TT5A 3GUHA 3PTAA 3EWNA 2W42A 3ABOB 1EVLA 2WIDA 2LPMA 4CQNA 4YQYA 3LHSA 2G88A 1RQGA 2FE1A 3MCZA 1E63A 1ZN9A 2C57A 2JVIA 3B6EA 5FNVB 1E0JA 1XDUA 5K3AA 4ER6A 1F8FA 1R50A 1VJRA 5B7GA 5G1OA 3UWDA 5F73A 2O7NA 3D02A 2FX3A 2DFKB 1RI2A 4ISCA 4N3GA 4RDXA 3R4CA 3AINA 3LWDA 2P9TA 3PIIA 1VJ5A 3EOAI 3P9XA 5LB4A 1SCKA 3SIRA 1H1DA 1RRFA 2Z1MA 2Z2ZA 1PFUA 3B2QA 3QTTA 4GI1A 4OLAA 3HKEA 1P2UA 3N2KA 4XVRA 3T1VA 1RAEA 1BROA 5JAQA 4BQEA 1J2EA 1I0LA 5FTJA 2O2XA 5FNVF 3LBFA 1NM5A 1WA5A 3R8CA 1QF6A 3H2JA 3KQTA 1N2CA 2VYQA 2J3DA 1ONPA 2XQVA 3P20A 3GO4A 3RF6A 4YUZA 3FOCA 5J3JA 3PUKA 2VNJA 1OI4A 2R1ZA 2WIFA 4DA8A 1BDMA 4OI2A 5K0TA 4GM0A 4NF2A 2UKDA 2QE6A 3IMCA 1MDBA 1RE1A 5H3LA 4MEJA 1NQTA 5DYIA 4AN0A 5DCWA 2R6GA 2AXQA 4D02A 3PFWO 5L7YA 1PT6A 2OOSA 3A10A 4IZOA 5DHSA 2VPYA 4H6WA 2XB9A 2QP4A 1G5QA 1XMPA 2O2GA 3JQPA 5KNDA 2C4UA 4N3AA 2IX3A 1BXZA 1SBIA 1G20E 3FGOA 4LV6A 5IT0A 2HIAA 3AF4A 2OCPA 1RLIA 1QCYA 2M32A 5AR1A 2Y77A 4H1HA 4QO7A 3K8OE 3ISVA 3LBNA 4IOKA 4OLJA 3CG4A 5AHKA 1P3DA 1U11A 3CF0A 3JR3A 2NO9A 5EXTA 5KSPA 3QG1A 1Q74A 1DV2A 3QIAA 4UBOA 5EZYA 3GNLA 4B79A 5L53A 5EOVA 4JN6B 1ECFA 2YWRA 2H4WA 4RLSA 2ZSDA 2XVYA 3LL4A 2QD1A 3PNKA 3GUCA 3UWMA 4DDTA 5JSFA 4JLVA 3V55A 1TJ4A 1U2RA 4WNAB 4D4HA 1XJCA 2R86A 2X8BA 3O03A 4L9SA 1I2AA 5H4GA 1U63A 1GAJA 2ZQ5A 5M04A 1KFJB 4G5HA 5A0FA 2FFAA 4G37A 1PR1A 2V7VA 4Z1MD 1NBIA 4YRKA 1Q21A 3NDRA 3EXFB 4UMFA 5D6OA 2EOAA 4KMMA 1LF0A 1YONA 4UCQA 3OX4A 4R1MA 5DHAA 4KLAA 1M66A 1R0ZA 3B6IA 2FPPA 4PF1A 3PWTA 5TS2A 4EUHA 4MCAA 1GSAA 2HV9A 3SEAA 1M72A 2D74A 4F21A 4OQMA 4XIIA 1IIBA 4BX8A 2Y4OA 4KVZA 2RB4A 4GDMA 3CR7A 1U2GC 2QMQA 1GFIA 3K72B 3UJAA 3GP3A 3IKMB 4DLPA 4Q19A 2Y68A 1JLLB 1W19A 2GZAA 4KODA 5BN3A 1NNUA 3N87A 3PWKA 4QLBA 5BQ5A 5ICMA 3NYIA 2JIRA 4H17A 1NLMA 3P0FA 5LBUA 5A5EA 4WD3A 3LO8A 3D31A 3OMWA 3VC7A 1XVVA 2JANA 2VXYA 3CIFA 4J1TC 5CLGA 4HYYA 2XT6A 1ZRSA 3U60B 3H1TA 3OF2A 5JO9A 4G8JA 4TLEA 1XTSA 2O4CA 4FSDA 2R8EA 3WRYC 3NBFA 1P77A 1E9CA 2NM0A 2OHJA 2PU7A 3LLSA 4I8DA 5C34B 5I9NA 3KOYA 2PYDA 3FWKA 2DQZA 1FVXA 1N8TA 2IPOA 3G1UA 5JMPA 2GPWA 1YQWA 3WDSA 4LHZA 3JQCA 4X6YA 3ZHYA 3WWEA 1FNBA 4JVSB 5TGTA 4EKIA 1PYOA 2EBUA 3KPUA 1REQA 2QZSA 3IEPA 5DE3A 4AXXA 3L8CA 3C3WA 3S5JA 5K3CA 4BMPB 3SGLA 3BJZA 1HL3A 1TZKA 1UDCA 2YS7A 1SVKA 3C8HA 4KXNA 5EQJB 3TO5A 4G0OA 4ZOLA 2QR2A 3HVIA 3M70A 1GRRA 5IXSA 1P9WA 3L0DA 3AF0A 1A9YA 2BGLA 1XMSA 5JCOA 5KWSA 4HADA 4J3FA 4N5NA 2P3OA 3IOEA 2AEMA 1GOTA 2ZYWX 2E89A 2VHXA 2B2NA 4ALKA 5HS6A 2OL4A 3GMDA 1B7GO 2MYPA 2V5AA 2J07A 1QK5A 3QWAA 4PBRA 2NSHA 5CU7A 3ZQKA 3PNPA 3QLVA 4PEVA 2PL3A 3OCJA 4DUYB 1I4DD 4EPTA 5A5FA 2BFDB 3PDUA 2BCGY 3MF4A 3RAEC 3JQ9C 4JVMA 4UHJA 3TQCA 1P5FA 4GPIB 3NKFA 2FWNA 1AB6A 2HTEA 3MRVA 1RYHA 4NFSA 3VPAA 4XIYA 1RRKA 3GPCA 3H6KA 4G25A 4N3CA 3W8EA 2BD0A 2NV0A 3QXSA 3OO0A 1NPDA 1VPTA 2IYPA 2X5NA 5EXDA 4P3YA 2YWDA 3FNIA 4R1LA 3L6RA 1G5FA 1XLWA 2WAMA 1XKTA 3G0OA 3PC6A 4E4TA 4RTMA 3A31A 2C4TA 1YVRA 2M6RA 3AVPA 4AO8A 4BMOB 4XWTA 3ROMA 4E7PA 4ERXA 4BASA 3X1XA 1VLVA 1SCJA 4KFUA 3LUJA 1MVLA 4Q34A 5E1MA 5LN1A 4N82A 2OV4A 4ID3A 1O4VA 1XIVA 1NRJB 2IVFA 1E1YA 1YUBA 1A77A 3FSEA 1K6EA 1LPBB 4P4TA 4CIXA 2NYRA 3W8FA 1IE3A 3TCXB 3MSCA 3DZHA 4L08A 4QL3A 4Y2JA 3TECE 1IY9A 2FSFA 4X62B 1BX0A 2NU6B 4XSHA 1SCDA 4CLHA 4K8OA 4QC2A 3QBEA 3FYSA 1V5GA 5C9ZA 4M54A 2Q4BA 1XAIA 2GM3A 5CX4A 2Q45A 1ML4A 1YZTA 4ZO9A 3ZGNA 3SR0A 2Q5QA 5JCJA 4A5SA 4US2R 4HLCA 5IM4A 2VQ3A 1HSOA 1ADFA 3PCXA 2A0KA 3MJVA 1Z7GA 4TZKA 4RC9A 3WYEA 4NCIA 1V25A 5DX8A 1HPLA 3EVGA 4C3OB 4RIGA 1VKOA 3OX2A 1FFXB 3FPLA 2FOLA 5AUPB 1CEXA 2Q6LA 3WMRA 4UXIA 1O6GA 3TTTA 4O2AF 2LNDA 4RLFA 5CIYA 1E3WB 3RM3A 3U44A 3H8SA 4O0LA 3ZDAA 1HYHA 2X58A 1ZHFA 1QQ7A 3Q6NA 4DBLE 5C8ZA 5J58A 2HSDA 3ZKWB 5CX1B 5E4YA 3UM9A 3ZY2A 4FGWA 4JX9A 1EX6A 1S2DA 3ABZA 3D9QX 2QL6A 3GUYA 3H9GA 4KXLA 3TOZA 4TTAA 1LBHA 3VVLA 1T8SA 3KEQA 2FPLA 2GHRA 2BSXA 4XCVA 3ILSA 4D4LA 4QUHA 1KP3A 4JYAB 4TM8A 4XUDA 3LQ1A 2FMUA 3OKPA 3Q3EA 1JHVA 4FIDA 5EIHA 3SLKA 2X2PA 1P6XA 2AFIA 1AKWA 2XCOA 4YJFB 3V4LA 1EK5A 3DOEA 1W47A 4NX2A 1WB5A 1AN0A 1NYTA 1JA0A 2HCBA 3ICPA 1H65A 3AKYA 3EDYA 4CLDA 1QRSA 1Y6ZA 3R74A 3PITA 1GTVA 2V0NA 3SM9A 1EWQA 2WUWE 3C3KA 9ATCA 4XB1A 2WT8A 3OZSA 3ZHZA 3HCBA 2TMKA 1EFTA 5ELXA 2QX9A 3UJBA 4HB2A 1FS6A 3K4PA 2VJKA 1XC7A 1XU7A 4JLNA 7YASA 3IODA 3P9QA 3AJDA 1IXYA 1N8NA 4JR0A 1GAQA 4EF5A 4YUVA 4IGFA 1ZXLA 2WSSD 4FKMA 2VUHB 1YUNA 2R4QA 1YR9A 4K28A 2O7RA 2QNBA 5T6BA 3UH1A 3ENWA 3W5VA 5ITWA 2O0LA 4QARA 2RGCA 3NVDA 4G67A 5EKXA 1RKQA 2O8VA 3OU6A 1AN9A 1EFRD 1K66A 2YN2A 4KO3S 4X60A 3WL5A 4ENWA 1UJ4A 3MJSA 1WW3A 2ORYA 1BXKA 1IEVA 3HACA 1VIAA 2A0WA 2NNWB 5BQPA 3ZNQA 4ZHSA 1C1DA 1GR0A 1UBCA 1GQOA 1UP4A 2B34A 2H0QA 3K73O 2Z43A 3NBKA 5ENDA 4QKQA 1FBNA 1L4BA 3I5XA 3FTEA 2IOYA 5HNKA 5EGNA 2YBEA 2P9ZA 4HLUA 3F3KA 4INPA 4OI4A 4F4CA 4IDHA 2C4MA 4UXJA 1G60A 2ATCA 4RF2A 4C7MA 3EEBA 3A14A 3NH9A 1Y9EA 3HMQA 4N9QA 2A9PA 3AR5A 2N42A 3KJHA 4LSGA 5JXHA 2RAFA 2ZTMA 2PWBA 3VGJA 4AKTA 1EB8A 1WXHA 4RH1A 2UUOA 2REXB 3PHIA 2Y1KA 1GPLA 1P60A 3BICA 3UHFA 5IKOA 3T0FA 3UV3A 1YVPA 3OOYA 4R68A 1AOXA 1EBFA 4GFDA 3KALA 4BUJA 5BSHA 3F73A 2I6XA 2QG6A 3QE2A 4ALMA 4J0FA 1YFZA 3GLTA 2QX4A 1SVIA 3JWPA 4BXOA 1AQ6A 4X3CA 2IDZA 5CD9A 4QUJA 1I9GA 1KF0A 1CERA 4XFDA 1G7TA 3V97A 2NZYA 1MDFA 1RHJA 1IMJA 2P4QA 1UR5A 4F2GA 1I51A 4WY5A 1TJNA 5TMEA 4TRRA 3G2HA 1NLYA 3PYMA 3QLUA 3CSDA 3ZCRA 3LX4A 2UUPA 3PU6A 2ODQA 4YQZA 3E4CA 1EA5A 5DKFA 2IF0A 3E7WA 1ACJA 2PMBA 5TQVA 1T4BA 3KCNA 3ESDA 1NBHA 2DCUA 4JUBA 2XYVA 3V8QA 2OQVA 2ASVA 5ERGB 2OWEA 1CJTC 3JD0A 2ZT8A 3DEHA 2CXXA 1DMSA 2O9JA 3QYPA 2AOUA 3ZZUA 4XWOA 5JSQA 3I64A 3PFGA 4V3BA 1TEVA 1TM5E 2JEOA 4AKEA 2HZBA 1L7AA 2PWAA 3OLZA 4DLSA 2BGNA 3ZD6A 3KV1A 4I50B 1V5WA 3U49A 4J29A 4HLNA 1J70A 4X1YA 3IBCA 1L7BA 2OQIA 4NMHA 4YJKA 3AIOA 4YASA 1U0LA 2OZVA 1DWPA 1YC2A 2NACA 1AKUA 1ULUA 3Q7QA 5KKAA 1SQFA 4BHTA 4BJHB 2XUHA 5JAPA 1QTRA 3AW8A 4MA0A 2I87A 1CK4A 3I28A 2O5CA 2GERA 1R18A 1KH1A 3N7TA 4R31A 4F5DA 1EFHA 1W94A 2HY7A 4XWKA 4NL4H 1S9DA 1DRVA 4OGWA 4KBFA 4PVDA 3D54D 3HLKA 4QPPA 3ZE6A 4KNYA 1WXQA 2OCKA 4UPDA 5BRAA 3AWDA 3G2IA 3EZ6A 3FPCA 3OM1A 1T0PA 1XEFA 5KYUA 3B3GA 2QLTA 4ZQBA 4C4TA 2IBTA 4ZQIA 1X9HA 1PNOA 5EMHA 1E1DA 3PCRB 1YWGO 4CT0A 4G5QA 2MMCA 1Z5OA 3U48A 3COJA 1ZO8A 1PK9A 2OCLA 3KTAB 2EDAA 4LXTA 4GBED 1FK8A 1TCUA 1U0RA 3EUEA 5ALNA 1XCBA 4BRZA 5KINB 4QFCA 4NRDA 3KPVA 1ZD1A 2EKZA 2OAQ1 3KBOA 3SY8A 3UJ6A 5HJEA 1YOVB 4D4GA 4V0MA 4IFTA 3SHWA 3PRYA 1O96B 2NUPA 3SC4A 5JAHA 2OUKA 5T57A 2QL7A 4U3JA 5FULA 1B3BA 2BFPA 4FILA 2I6TA 2SCUB 1J25A 5K3SA 2Z5LA 3IIEA 5M5BA 5LA6F 1W0CA 1UK6A 1QDLB 3OESA 4NOLA 1WBDA 1LK5A 1NF2A 3ITKA 4HVCA 3L4JA 3RK0A 4DIBA 1Y4UA 1KVTA 5CA0F 1XVTA 1VB3A 3PV0A 4MW4A 5DTIA 4PHFA 4ZVRA 3BDAA 2ZRKA 3LI2A 5CTJA 3OETA 2BTEA 1C7QA 3ZNOA 3UBTA 4DNQA 2FSIA 1Q0RA 3VFDA 3WBFA 3DT9A 4C4OA 2G4CA 4X90A 3KXDA 4EY3A 4BNFA 3BDIA 4KFSA 3TQQA 4EBFA 4WCFB 1SIWA 3BORA 4DV4B 2REQA 4W9NA 3KXPA 1MABB 2CT8A 3WLRA 4YV0A 2VDRB 2YX1A 1YZNA 4OGKA 5TPWB 3DA8A 5JRJA 3KVNA 1T8UA 3NUZA 4OP2A 5HFAA 3T3IA 2X77A 3NHMA 4RDHA 3QJYA 4GPBA 3GJQA 4F2PA 1GGJA 3BGOS 2LDBA 3R3YA 2IXGA 4DE5A 2BEUA 2HIGA 2PKQP 2RBKA 2VSOA 3KQVA 5H9VA 3EGEA 1CQZA 4O2BB 3D0KA 1SURA 3E8XA 2JK1A 2JLQA 1PJCA 2B3DA 3FR7A 1JHRA 4Z7OB 3C3JA 5FADA 4DSOA 1AF4A 2O2HA 5DBFA 3T95A 1YB6A 6LDHA 1VSTA 5CDGA 4MGEA 3TRHA 4CGYA 2Z6UA 4OD0A 3K7EA 1XF1A 1W581 2CHUA 3OU2A 2OXRA 3VNUA 2R1VB 3LOUA 1WULS 1MGPA 4MWSA 2VHZA 4JCCA 4BFXA 3I5UA 4J4HA 2R751 2EX4A 2JGKA 2WD8A 2D0PB 4RGQA 4PINA 4QGHA 5CH5A 1EGAA 3MBKA 4EHNA 4M37A 4R6XA 2X9QA 1CBUA 3TVTA 1PHRA 1LDBA 1SZPA 4LWOA 1O95A 3CCCA 3OM0A 1VLMA 4Q1CA 1P19A 4ZU6X 4DMLA 3H2YA 3NH6A 1RRVA 4KB5A 2V59A 5IUKC 4RHCA 4BRSA 3QFTA 2IHYA 2B20A 2ZR8A 1A82A 1TM4E 2V96A 5FTLA 3E7DA 1JHQA 2HC9A 2QQGA 1E4OA 4FE7A 4J94A 4A92A 5A4FS 2J9GA 4HTAA 3ZWMA 3U13A 1LS6A 1DKMA 1ZC4A 5BRJA 2PX3A 1T1JA 1A04A 1JIVA 2VUUA 4L8FA 3OE1A 3WI7A 1XG5A 3HUUA 3OZBA 4OKIA 1P4AA 4Y7DA 5EP1A 4A6DA 5HEKA 4QU0A 1NATA 1U8EA 2NWQA 4FZ5A 2XUDA 4LG1A 2VATA 4HUQA 5CA1B 5HUJA 1AUVA 4J07A 2OB1A 2VAXA 2W6JD 5CGZA 4CF6A 5BMVB 1A7JA 4FFDA 1UM8A 2PL1A 2PT9A 2VIIA 3E82A 1GQRA 2P9FA 4FLFA 3IILA 4EL0A 2EIXA 1NW9B 4IZHA 4KLZA 5A4JA 5LMUB 1GTL1 1SQ6A 3P2IA 2BFWA 1JHDA 1H2EA 1NW5A 2XNJA 3W8NA 3GR6A 4CR7A 4QT0A 4KYUA 5GM2A 5TSDA 1PT8A 1XMOB 4KN8A 1FUUA 5HJ2A 1MAUA 4FFMA 3DULA 3EJWA 3T1QA 3CNEA 2HPVA 2LKDA 2Y0BA 2Z4SA 5DN6A 1USUA 2LVBA 3OZEA 4ER3A 4CIYA 2HU2A 2F90A 1E2HA 2IHZA 1MPTA 2VNIA 2VYFA 3CNLA 3GG9A 4ZCRA 2GKOA 3SQWA 5BMVF 4I9NA 4DDHA 3D6UA 2UZIR 3EQ9A 2VAPA 1IEXA 3HYTA 4WXEA 1G291 3UK6A 2P77A 4XXHA 5B1HA 3T7RA 3T3HA 2UZAA 1IN1A 1OGIA 2VFAA 2PUCA 5EIOA 3LNTA 2R7AA 3LCVB 1HXHA 1Z29A 3E9NA 2AV6A 5IARA 4CYMA 3HVRA 2CV1A 1IQRA 3A11A 2A1TS 1E1MA 4Y67A 1MBZA 4MUFA 4UHHA 1WBJB 5HW0A 2ZAOA 4EHJA 3INRA 1L9XA 2BELA 2G7ZA 4QXAA 2CL6X 1HG1A 4JI3B 1RTTA 1SC6A 1GAEO 2BFEB 2JJ1D 2VF2A 3I1YA 3RE1A 2VLBA 1WB9A 5ALEA 5DM0A 5G1PA 1EWRA 1Z36A 2WIKA 3HCEA 3BVPA 1J2YA 4QHSA 4CT5A 3AG6A 1L7MA 2IE0A 1I24A 2QORA 2VXBA 4EM6A 3P9YA 2C7QA 1JFTA 1PJLA 4DGQA 1IPEA 1U2QA 2C31A 4FCCA 3IIKA 2FPRA 1WMDA 4YFVA 1P0QA 3WHLA 5C1BA 3L1IA 3OJFA 4HWSA 5AHXA 3HEMA 3LW7A 1MUUA 4FW8A 1NLUA 2IITA 2HSGA 3M33A 4FBLA 2H6EA 3QU4A 4OSPA 3PUHA 5HKLA 1NJ8A 1ZITA 2D7CA 2GYVA 1IVSA 1JU9A 1ZIXA 1AB5A 1ODIA 1JG6A 4PYOA 4R2IA 3KEOA 1R8XA 3GDGA 1G16A 4J1NA 4GKJB 2PKEA 1MX9A 2IOFA 4BQQA 1U8CB 5AK5A 4JJFA 4YMVA 5DYYA 3DR5A 3FMFA 5TPZA 3TKYA 5A7HA 3ZWXA 5CAEA 1NRWA 2FH5B 3KYBA 3IIMA 4MQMA 2FLKA 3DFIA 3M6IA 3GLHE 1U28C 3NASA 5K0JA 3GGPA 3J81A 1TQ8A 4GL4A 1P9NA 2C92A 1QIFA 3HVKA 3OOJA 1GG9A 5BUQA 5HKKA 1ACMA 2DUUA 3CZQA 3SSMA 4ALIA 5LVAA 2FPMA 2ZTUA 3FXAA 4P81A 3S2EA 3SX0A 4JS0A 3GUVA 1KS9A 4M7WA 4WN9B 1EE2A 3TLXA 1M2VB 3B3AA 1KSJA 4Q18A 5KYWA 2PD3A 4NYMR 4AZ3A 1KEEB 1HQYE 1JNXX 2FGKA 3MTQA 4NU0A 3L84A 4N5HX 1Z63A 1GFWA 2UUAB 2GARA 1B6RA 4MV9A 3WYFA 2CVPA 3C3MA 5D84A 2V58A 1DLIA 2YDXA 3AR7A 3DZ8A 3EDOA 3W6PA 5B6IA 3HEAA 4NNOA 3W7AA 4F5YA 2F1OA 1T6ZA 3ENNA 5GWXA 3B38A 4Q5IA 5K4AA 3U5TA 5J23A 1WD5A 4OHUA 4LMBA 3GVCA 3AEXA 3NBYC 4U9HS 4BO0A 4DLBA 3I45A 1V7QA 3U3ZA 1N36B 2BM1A 1V8FA 3SC3A 2FSHA 3GA5A 4JU9A 4EG0A 2QA5A 2AJDA 3IJ5A 3OZAA 1VE1A 4FFPA 4AMZA 5JZ9A 2A59A 1D2RA 2IA5A 5CXQA 1XDWA 4JYPA 3SJAA 2C20A 2EFCB 2WHRA 3AEKB 3B36A 3QUBA 3D4NA 4L0CA 4N0EA 3RBVA 4FDTA 5A5GA 5FA8A 4AMUA 1O58A 3EFOB 1NVAA 1P1IA 2R00C 3CUEF 2WJVA 1DFIA 1V71A 1QP8A 1W85A 3FNBA 4R8RA 3H1AA 1QXSA 2PLFA 3CZ5A 1C80A 4HNQA 3OCUA 5D3QA 2OYCA 1CEYA 2JASA 4C04A 3E0QA 2DQ4A 3H13A 4DXAA 4IHKA 4FB4A 5KYTA 1S89A 1GTMA 2WIGA 3D4OA 4FYJA 5I9TA 1MX3A 5A2QA 2YW9A 4RPJA 2M1ZA 2HNBA 3JRXA 1ZWLA 2ZBVA 1QZUA 2WP8J 2XDQB 4HN9A 1EGHA 1JA1A 1GKUB 1E2FA 1Y48E 2C8VA 4QU8A 3TKLA 2BJVA 3H6HA 3L49A 1EUZA 4CJXA 2DGDA 2Y1CA 2ZJOA 3CRZA 1E2QA 3AR2A 3C6BA 4U6SA 3VOSA 2I4MA 1QF9A 1GZ4A 4OQFA 4Z49A 4IVNA 1TQ4A 4RZUA 5EJIA 2J0QA 2GOYA 3CINA 4KYTA 5C4MA 4IOLA 2BFBA 1W88A 3T4UA 2F59A 5E9JA 5MHTA 1X1TA 4PBSA 2EFJA 2IK8A 3OHPA 3S8MA 1JHUA 4YCDA 2Z8YM 4GMHA 1HL7A 2YINC 2ZE8A 3DNFA 4R7TA 5JOQA 2DBZA 4D4IA 4DR1B 1JI3A 3Q2IA 2RAPA 2HIMA 2IXFA 2WMYA 1NX6A 1SU6A 2E21A 3C6MA 3OIFA 4NVRA 4RLHA 4Y0VA 3VGPA 5B4UA 3WL4A 1N1EA 4BTVA 4U2KA 3W06A 3FGPA 1NUPA 3DO8A 4CI0B 3GLIA 2VDKB 1A69A 4ZD6A 3F7TA 4RXMA 1NJSA 2GAIA 5H81A 1R0BA 1Q7CA 3EZLA 3G9QA 5EIBC 5HZMA 4KVGA 3S27A 4DLZA 3PQ8A 2CBZA 1DDOA 4JLUA 2YC4C 4F9EA 3ZVMA 3SEQA 3GLKA 1FNMA 2PM8A 4LHWA 1SEPA 4IJQA 4V3CA 2DQKA 1O89A 1AKNA 1K7CA 2O50A 2YMLA 2FN4A 3EDCA 4CIAA 1BN7A 1ST2A 1X2BA 3KQHA 2AN4A 1SIOA 4OHXA 2CMHA 2QMOA 4H18A 5AJWA 3NDJA 3NW9A 3RSSA 3WL7A 5IJ9A 3DG9A 5DXJA 2X8AA 1UMCB 3TW4A 1G5TA 2FWMX 2VHEA 3COSA 3ZUPA 4YJ2A 1O5OA 1BH6A 3ICOA 5AMXA 3C1TA 2CC2A 4WZZA 1XXHB 2DG2A 4TKVA 3TLYA 3DWGA 1OV6A 2RIPA 4YVFA 2XYHA 4LUCA 4B17A 1IH8A 4BFCA 3REGA 4RTSA 3RWBA 1SXJD 3PFNA 2FR0A 2C8LA 1H94A 2X2FA 2FFQA 3FMIA 1L5OA 3AC0A 3NHSA 5BMOA 1N57A 3DW3X 3LDHA 2CZCA 2WUGA 1ZK3A 4XM1A 4QFMA 2V3CC 5CB6A 2MYUA 2PGJA 4IIXA 3DEKA 5CYGA 5U4XA 4URYR 4J0DA 4OXIA 2I4OA 1EG2A 1A97A 1J49A 1EK1A 1XFDA 4MVJD 1WAMA 4RHUA 5COQA 3F7MA 4RMJA 3D7NA 1FU7A 5SY6A 3I9V6 1BXRB 1V1RB 3TQSA 4Z4IA 1IJBA 3GGGA 3I39X 4V0QA 1A9QA 3P9RA 5FTKA 5IKPA 2A1UB 2ZB3A 2GGSA 3K0AB 5F64A 5ITZB 3CVUA 2OCXA 2C4NA 2NZJA 3KX2A 1TOAA 1IN8A 5DN9A 3TIXB 2EYUA 2G9NA 1Z4OA 2W37A 4GMDA 4AURA 4B4KA 1HZZC 4ZO6A 5IWAB 5G4KA 4IYRA 3OZXA 4TUYF 5HRUA 2WTUA 2DB3A 2N46A 2FSVA 1GVHA 1LSUA 1NN0A 3U7RA 2AC7A 1AX9A 1VSQA 2CXRA 5LL6P 4FYXA 1W36D 5LMNB 1ANKA 4EJSB 2ZREA 2XKAA 3ASUA 5CVDA 3EWIA 1BKSB 3KUUA 4LMAA 5J1TB 3CLTD 1FA9A 2C88A 5C46F 4JJAA 3H2IA 3M4NA 5LLTA 2O07A 2IKQA 1QVZA 4JSYA 2Q5HA 1IHYA 4KDEA 3BT7A 1VJTA 1IHUA 1W4BA 3KB6A 3TM4A 4L9RA 2ACVA 1SKYB 1JWAB 1Q22A 1FJHA 1XL1A 2VNKA 2GHTA 3G2JA 4I6EA 1LWNA 5DHTA 5DVZA 5JO0A 2D06A 1Y6FA 4ZAVA 3FTCA 3GV0A 1H4QA 2W71A 1KL7A 4GR9A 3TSCA 1KI8A 5P21A 3FOZA 1XZPA 2X4IA 4ACBA 1DXHA 1U99A 3AY0A 4HGYA 5LC1A 3SJZA 2A5DA 1CZLA 1M75A 3EGOA 4RZSA 1ULTA 1YRWA 2Y4NA 1F3OA 1HDZA 4N39A 4BVAA 3NVAA 1AMNA 1I94B 2GK6A 4Y2RA 2IZ6A 4Z99A 1SC4A 1ORRA 2QZ9A 4JHLA 2BMJA 4FR5A 1BJKA 1UWCA 1X42A 1E5DA 1G8JA 3BHIA 3NR2A 3BMNB 4V0SA 5IC6A 4L5BA 5JLAA 5JARA 1V41E 5IMBA 4BPRA 2B82A 2Z6QA 3AWIA 3LH5A 1II0A 3LCUA 5KS2A 1VFNA 2I5PO 4N54A 1GQQA 2VP9A 1VECA 1DTWA 2UAGA 1FLAA 3HFSA 4EY5A 3DBHB 5A0TA 4H3VA 3VDMA 3KO8A 4YIKA 2ZXEA 1GLVA 1EVYA 2X40A 2NVWA 1QB8A 2BH9A 3GC6A 4JGGA 4MKIA 4QYIB 4ZKDA 5JYDA 1N7HA 2BE7A 5BVHA 2A0YA 4Q00A 3RGWS 3QUQA 2YW2A 3GN1A 2PSJA 1L1QA 4YHBA 1WHSB 2AX3A 3WYAA 1L5KA 1QCDA 1SR8A 1RBMA 3K0EA 1MFZA 2MSLA 1QHHA 1M2WA 2YBDA 3CGGA 3DH0A 3KQWA 2ZVJA 3RFTA 5DYWA 4PCUA 4LOLA 2NQTA 3NV9A 4K46A 1X1SA 1E4EB 1Z18A 2R47A 1QX4A 1RAIA 4JBGA 2VPQA 5CP8A 1E62A 3OE5A 1O03A 1CY6A 5B7PA 5F3RA 3FYTA 2ZUCA 5TT0A 1G7RA 2H3HA 2NU9B 3KLMX 2EF0A 3QG5A 5M7EA 3IBYA 1P44A 2ZRGA 3GFSA 4MNTA 2XBUA 4EO9A 3MJRA 4WNAA 4P0QB 1KK3A 2J5BA 1BE1A 3DV0A 3W2HA 3AM1A 3DQZA 1N2GA 4Y1EA 4JJ8A 3FCUB 2DBYA 3GH1A 5EHNA 3P4YA 1UMKA 3WGJA 3ZXIA 2IS6A 1R5OA 1XXLA 4GZ5A 3EXFA 3U62A 2H2WA 3PT9A 1AV6A 1LI5A 5JI3E 4V0KA 1OREA 1P4RA 4L9AA 4LY0A 3Q7EA 3ADBA 4HDRB 3KT6A 3LQKA 2X0FA 3EH1A 4ASUD 3NQ41 3K9BA 4F3YA 4RV5A 4YRBA 2D2XA 1RP7A 5AW1A 3BTVA 4MKZA 1Q50A 1CY1A 4HXEB 5TXGA 5TC4A 4UFPA 4CEIA 2DTEA 1H8EA 1Y7LA 2B4AA 4LOJA 4RANA 2GPJA 3ISJA 1JLLA 4BNKA 3RH0A 1NUQA 3RRNA 1J06A 2CK3A 5AKJA 2AYXA 3EW7A 3W7VA 2M9MA 3LYAA 5MDHA 3H2ZA 3KVOA 2NVBA 5BV2P 5A06A 1JG3A 2ENUA 3EXIA 5K8UA 3ZGYA 4PAOA 4EKEA 2X9NA 3SBEA 3V1MA 4CIDA 4LDAA 1CY8A 1A0OA 1M1ZA 3VU9A 4LISA 1HM5A 1P18A 2GCNA 1P1KA 1N75A 4I1VA 2EZUA 4NEGA 5IN5A 3T15A 2IGTA 5ILOA 1JA9A 3FW1A 1M6HA 1EXVA 1NC1A 3TCNA 1TZBA 2WYWA 3NALA 3I92A 3OQIB 5DWDA 1NQWA 2Q21A 4HX5A 1G21B 2O48X 3QJ5A 4RGYA 1HUQA 1H8HD 2Z2IA 4BNVA 3IRUA 2WWIA 4ESEA 1V5FA 1WE2A 2G8LA 2QAIA 5ESWA 2ZCVA 2C4KA 3RVJA 1GKIA 2AZ4A 3WMEA 4FYPA 3UICA 4PG8A 4N0PA 5TNXA 3QSYA 2Y0DA 2BJWA 3HADA 5LNK6 4EARA 1HETA 4Q9LA 3C5VA 2I1LA 2UZ1B 3AI2A 3D3QA 3AHJA 5TQ2B 2WF8A 1P7PA 1O97D 2I29A 3S2UA 2G0NA 2GA8A 4B83A 1L7NA 1JIJA 4TTPA 1DJLA 1P73A 4WADA 4LJSA 1YA8A 4UU0A 3DV2A 4AJ2A 2OBXA 4DLRA 2QRKA 4IBOA 2C0CA 2FX5A 4LBZA 5A4KA 4D9JA 1RI3A 3TG2A 3FPFA 5IDYA 1U6IA 4LDZA 3DZJA 2C5AA 3WMFA 3AJ9A 4EMTA 3L7CA 3ZJVA 4M0PA 4ED9A 2ZVPX 1KPGA 3ZPXA 2BFDA 1QV6A 3KB2A 1AXGA 4F9FA 3CRVA 1PNQA 2QTLA 2HDHA 4NBKA 1A5SB 4JI5B 3FCEA 2IUTA 4IAOA 2LCIA 4BZPA 2VSYA 4PZLA 1OBOA 4J90A 4RK5A 3B2NA 4TLMB 4AQYB 5J1SB 2CLCX 1OUMA 1HQKA 1PSWA 2WM2A 4XPIA 5BW6B 5AKEA 3RU2A 4QJBA 3HGTA 4QLOA 4M8IA 3CISA 3D8UA 3BXZA 3HXKA 4IIHA 1JR3D 5GJCA 2AC4A 4X6XA 1SM4A 2D00A 4G97A 4FYYA 2B30A 2FEXA 1SQGA 3OHSX 4QOIA 4W5WA 5DNUA 3AIMA 1CUDA 4NOMA 1RKXA 2E5WA 2ZWAA 4QTUB 1TFRA 3GUUA 5AVWA 2XX3A 4WASA 3GJZA 1BHQ1 2IL1A 1T2DA 5TT1A 1XTQA 3WL8A 2VBGA 3VYSB 1TF2A 4F86A 4YCJA 2JI7A 1SN7A 3D3EA 4JWKA 2C97A 2QRGA 4U1RA 4KH1A 3S28A 2IV3A 3WO1A 1I80A 3A32A 3BH6A 3FPGA 5AVOA 4X1IA 4YT8A 1W5SA 1NT2A 1PIWA 3ENKA 2DKFA 4MP8A 2DUNA 4FYKA 3U7HB 2JHFA 1PGPA 3JYNA 5IVIA 3VOBA 2IHTA 3W1WA 2KI5A 1AXEA 4WK0B 2QT1A 4M21A 4IPTA 5AVTA 4QYMA 2FCAA 2QP3A 4U2BA 4JFRA 3IDZA 3MT7A 1EJ2A 3GJYA 3WBJA 3DL7A 4AZVA 4RSMA 1ESMA 2X76A 3AK4A 1ZNZA 3KZVA 3TK1A 5AW8A 4M38A 3WIUA 1VXRA 1ISFA 5AVSA 2F7SA 2HRBA 4NV1A 1EXNA 2AE2A 4C2UA 2R6FA 4YGYA 1KVQA 4LJAA 1F9EA 4G1BA 1NDHA 1O6ZA 1V0JA 1SUBA 3TEMA 4WOBA 3NIDB 5FOXA 1BMDA 3I01A 1I6MA 4WT7A 5IJAA 3TAHA 1WKVA 2PNFA 4L8WB 4FJ2A 1U9IC 2PT7A 4JKIA 1NOKA 3D4PA 3EIHA 4AWXA 4BIIA 5L3SB 1Y5NA 1JPNA 3FVWA 2XQFA 1TJPB 3GCZA 1NQXA 4BGIA 4PONA 5LUAA 1TX4B 1K7XB 2YTZA 3VYWA 4BO3A 4ZMRA 1G64A 3ZR4B 5AESA 3HWWA 4N9WA 2VUIB 2PJUA 3H4MA 4B6GA 2MSWA 4EX7A 2JRLA 3DKIA 3J7TA 4JR1A 2CY0A 3GRAA 3FFXA 3VPDA 4IIEA 2XRFA 2BCJQ 5KIAA 3L77A 3PJRA 1PZNA 4BKPA 1FOEB 2IYUA 5DSTA 3G2LA 4IY1A 2IUUA 5KWJA 3QFHA 3RUDA 4Z8YA 1D1PA 3E2MA 4GWLA 4KLRA 4RVOA 2VRCA 2VJDA 5BNWA 5KJFA 2UXBB 1DELA 3BGWA 3ZDEA 3SHOA 4KU4A 3LOPA 1RWKA 1OZHA 3OTHA 4GQBA 5CT6A 3HJNA 3IQWA 2BEVB 1AD2A 5JIBA 2B61A 1XF9A 1Z2EA 2H51A 3PUIA 5AK4A 4YPOA 4TYNA 1MRZA 1Z4KA 2W6MA 2ZROA 2V65A 2W6NA 1CYDA 4EG8A 1YRYE 2QPTA 4A2PA 1QWSA 1RLJA 4TV8A 3UATA 2EZTA 2C1XA 1IEQA 3CBGA 3JWJA 3IR6A 4AZTA 3W77A 2CSXA 3OEHD 4F4JA 1OJ7A 2J7PD 1VHQA 3ORFA 1B2LA 1TEHA 3JWIA 2ZJ7A 5AXDA 4EY8A 4QU9A 5EHIA 3R0QA 2XZTA 1FYXA 1DVRA 1INLA 4CFYA 1CC1S 2XMRA 3RHZA 2O8EB 1XPUA 2X13A 2R8OA 1T9AA 1KJIA 1BYUA 1XRSB 1F12A 4UQOA 4XWGA 3G17A 3TLGA 4C0JA 1JEYA 2BR5A 2W2TA 2MT9A 1BS9A 2HQOA 2JLVA 2YFKA 3BUSA 4YBZA 3EOBI 2J4FA 5GJWC 5HFNA 3WGGA 1OT5A 4EQ6B 3EQZA 1TXGA 4CIBA 2XNDD 3L7DA 1XZHA 1YQGA 2CZQA 3PNLA 3WK9A 2WRZA 1NR1A 1NSYA 1CDOA 2FP3A 4ZC1A 1KZHA 2XITA 1HX7A 3DOHA 4IGKA 3AUUA 2AEFA 2MIIA 4JBIA 5CR9A 1AMOA 1P3Y1 1P74A 3AFNA 1O0SA 1Z5NA 2K5UA 2WJJA 4IMIB 4J6FA 3VHRA 3GZ4A 4C4XA 4UVHA 1LNZA 5TQ0B 1RHUA 5EKSA 5K8VA 4KPGA 1WB6A 1UT5A 3TTYA 1K08A 5A7FA 8MHTA 4DR7B 2IWRA 1QSGA 3OCZA 3RTDA 2YRWA 3R5JA 4M9XA 4GH5A 2JLYA 1U31A 2A1IA 1YH3A 3LRXA 4AAYA 2W8ZA 3I6YA 4DR6B 2VF8A 3MS2A 3NB0A 9LDBA 2YS6A 4HR7A 4BVJA 4ZFNA 4A23A 4AT1A 4EW6A 1VIDA 3M1IA 5DTEA 2O8FB 1Z45A 4BBZA 1AG9A 2RD2A 4QXPA 5F9FA 1WF3A 1QYRA 3BFPA 3C6ZA 2Z83A 4FIZA 3R9IA 1NQ5A 1Z34A 2ECQA 2NYVA 4AXBA 1L7RA 5EJ9A 3VKUA 3GLSA 3HPQA 4I50A 3KJEA 4QOEA 5C8YF 3GLRA 3PI7A 4AF8A 4YRIA 2OV8A 4DF3A 3UAZA 2R6HA 4EI9A 5EINA 4EYOA 5CVTA 5KQRA 3TFOA 1RDFA 2WSYB 1DOZA 2VYND 4LVCA 1PW5A 3DBLB 3SYRA 5F98A 3LXRA 2W7TA 3GEHA 2Q3HA 4LTMA 3I34X 2FPGB 1TJ3A 3MRSA 2UDPA 3LC2O 2C2ZA 3CUTA 2IT1A 3VJMA 3I2GA 3CEJA 2BMWA 3OFJA 3LWZA 3CZMA 1XYYA 1NR5A 2PCJA 3CB4A 3O0DA 1XTUA 2IIBA 2B83A 3LCCA 1V8DA 4OHKA 2XNHA 2PSEA 3ZW8A 5C52B 2W6ID 3SDZA 4YMIA 2ABWA 4RHFA 1HDEA 3IJRA 4TMTA 4C4SA 1QVWA 3B9QA 2P30A 3NHBA 3O47A 3ON5A 3FOFC 2IS1A 1XD2B 3TR6A 1LF5A 5AKHA 5AXAA 2O3TA 3CH5A 3TTUA 3KTAA 1BMQA 3JQDA 3NFRA 4MDHA 1OE0A 1KO1A 3VR2A 1M2EA 4KMOA 4MPTA 2YWHA 3QW4B 3KWLA 4DNFA 5BSKA 5ICSA 2PMKA 1O96A 1X15A 1H9AA 3L82B 1LVGA 2FW1A 4A6EA 2OTCA 2BF7A 1W36B 2LIPA 2BGUA 2SCUA 1CJVC 3L6CA 1EZ1A 2W8BA 2ZWIA 3NUQA 2Z98A 2PNJA 4YRZA 4BMXA 1HURA 1O3YA 1OGYA 2QNRA 2HD4A 3CX8A 4CCWA 1ECPA 1UZLA 4O29A 4OF4A 1DZ3A 3P1JA 1LJLA 1QYXA 4BWGA 2XTMA 4CG1A 5G2OA 3F97A 3TPCA 1KAHA 3VJLA 2RBGA 3T7SA 3VZCA 5CT8A 4IIBA 4AK9A 5L4SA 2GETA 1RYDA 1KY2A 3LC7O 2R0QC 3HY3A 3VR6D 5LZ7A 4I4CA 4MJLA 5F9MA 3WC4A 3HFJA 1WBBA 4NCBA 1UDWA 3HRIA 4WKOA 2AMJA 1NU6A 2CLKB 3DTVD 3PA6A 3P94A 4I9HA 1RM5A 4P5EA 4WCFA 1CUYA 5K8TA 2DF8A 2OVBA 2YXDA 2JHGA 3VX3A 4ALNA 2HBZA 3OE7D 3GJRA 2FN3A 5AKKA 5JFGA 5KCZA 1XCOA 5L7WA 1M0SA 3ST7A 3DCIA 4URZR 1EAYA 1RIFA 2GEVA 3V4OA 4M9RA 5BV1A 1KWKA 3JATB 1TEXA 1QZZA 3L6OO 1WXWA 3NEYA 1X9IA 2SKDA 2CLEB 1N5LA 2HK8A 3AHGA 3O38A 4O2BA 3RSFA 4E2YA 1ZUWA 1CUCA 3TRJA 1UK7A 2EFYA 3W3ZB 4KREA 2RAVA 5KC9A 1P39A 2AK2A 3U6BA 1YGYA 2R7NA 2ZIXB 1KY3A 4OUDB 5I51A 3MRXA 3Q85A 2IRWA 1R4AA 1SUWA 2W83A 2WTEA 2YICA 4D9EA 4YMSA 5EG5A 3WLHA 4UM8B 1RXEA 2F43B 5CDFE 1J09A 2UVPB 2OQ2A 1GLNA 2HU8A 2ZPUA 4BTEA 2WB2A 2A5LA 2DQYA 2GVNA 1UKCA 3Q4GA 2GN1A 3ASZA 2QWXA 4JX8A 4L7QA 2INGX 2C9YA 2YWJA 3EGIA 4O2LA 3KLOA 2C3OA 4C2AA 3Q9SA 4DARA 5AJVB 1Z56C 2QZZA 3BK1A 3LS2A 2ODNA 4F3CA 3THWB 4IYJA 1KJNA 5FJJA 3AUJB 3F71A 2OOKA 2B4QA 4AP5A 3AVXA 1FFSA 4QRHA 4R05A 3LTEA 2BBWA 3X1JA 2VZLA 3TX6A 3E27A 3JVIA 4OAOA 4RZQA 2FF5A 2J33A 2Z56A 3ECCA 4G2TA 5EN4A 5TGDA 4MRRA 1E3IA 1JJFA 5KREA 3EVBA 4H0NA 4NYIQ 1P8AA 4PYKA 4R6WA 4ZC8A 1OU4A 5KI6A 1TZCA 3RFXA 2ICAA 4BNDB 4Z1MA 5ER9A 2YZGA 4B73A 3HYSA 3UAXA 3EY4A 5CYPA 3ZWKA 4KQFA 2HHJA 5GGYA 5CA1A 3L79A 3C4JA 2ZYIA 3THRA 2PT5A 2YIJA 3FD8A 3T94A 4P0PB 2V5UA 5HF8A 5SY4A 2FK7A 1H6BA 1SC1A 4JUDX 3HCPA 1EXDA 1UZNA 2AF3C 4L2IA 4PO3X 1EP9A 4N65A 4NHOA 4S1VA 4CM5A 4YCLA 1YB4A 1LA2A 3I6BA 5CVVA 1ICIA 5FBKA 1AQIA 2JZCA 4GSYA 3M81A 4WESA 5ALLA 4J1QA 4II2A 4B6PA 2E85A 2R48A 1S96A 2G06A 1Z07A 5LOVB 5DI3B 3EIUA 1FE8A 3ZHVA 1DU4A 3KZNA 3PQDA 5FUQA 4Z4QA 3ZG6A 3MQFA 4FHCA 2MINB 4LHVA 1W1IA 4OP1A 4C89A 4W7HA 3JS5A 3O8RA 1H2FA 3LM8A 4W5RA 4MV5A 3L1HA 3A6HA 3ICEA 1Q0UA 2PL5A 4FCTA 1WOYA 4UULA 1K8QA 3DV9A 5FA5A 5JH7F 5DMHA 4CMHA 1TGYA 3CX3A 2BI4A 3D2CA 3GRPA 3RLFA 3WB1A 2ZIEA 2Z57A 4PQYA 5EUBA 3KQNA 4J16A 3V1LA 3H2SA 2Q3JA 4XGKA 1M7HA 2W98A 1XTVA 3BTUA 4F1JA 5ICCA 1KOJA 4UE3S 3U4GA 4RXUA 3FAZA 1NVXQ 4U2CA 4MS1B 1XEAA 1W73A 2CMFA 4P34A 4ZI5A 4B2IA 5BYAA 3AZQA 1A2OA 5T4FA 4H3HB 4INJA 4EKDA 3U4IA 1N32B 5G41A 4W6QA 3B2EA 1FZTA 2J5KA 1YXMA 5B1DA 3I0NA 3WNCA 2ZB8A 2PQ6A 3UCEA 2P7HA 3NHAA 3NJ4A 2G07A 2C59A 4AY3A 4YV7A 1PTJC 1RLTA 4UPVA 4E33A 5CVJA 1V5IA 3RADC 3QQPA 1DBPA 1A8HA 3HI4A 2ZDHA 3FZQA 5AW7A 5HTKA 5KTMA 1X13A 3DSRA 4U0KA 3TDMA 3HXTA 1RAHA 2E9SA 4LI3X 1P1RA 3EG5A 3G89A 2BEWB 3EZGA 3V00A 4RM2A 4MUJA 2E4UA 4X91A 1N2ZA 1TTTA 4CG0A 4J4BA 2PMFA 3V2HA 1ZM9A 2NLOA 1DNPA 3M0EA 4OB6A 2RGNC 4TKLA 5ERXA 4EOGA 1SELA 2R8BA 4R3NA 4NXMB 1TCCA 3ABSB 3EBOA 3V7FA 3A1VA 1FDUA 1U5BB 4LSWA 4O4IF 1JHMA 4LXHA 1SXIA 2WWGA 3F6PA 3O82A 4LC0A 5DISB 2EP5A 4F4DA 2KE5A 4OKNA 3WRWA 1XDGA 1TYZA 4LC1A 1AKTA 2VKQA 2OM2A 2DH5A 4YI5A 4JKOA 2WR8A 2NN3C 1C50A 3RC9A 4AZWA 3CO0S 1N2CE 2QUKA 2WD7A 3IQZA 3EOZA 3ETCA 2Z6AA 4Y2QA 5LZ5A 2OCBA 1MO6A 4BLVA 1HDRA 1CNFA 4YDQA 1YBAA 3B3FA 5BSGA 3L7JA 3RPEA 3WYDA 1TTPB 2HMSA 5AOAA 3T9BA 2QBYA 1FMCA 4B2PA 1XEWY 5PGMA 1KFKB 2TYSB 3O0TA 4U2GA 5FIUA 3O26A 2O1XA 4WN9A 5G0TA 1UFKA 1DRJA 1W1UA 1M2VA 3PWSA 2O54A 1PR2A 4LS3A 4AJHA 5ED0A 5DP1A 1KEEA 5FB3A 3HCCA 1E92A 3NAZA 3I04A 4L8LA 4G07A 1I2ZA 4J8PA 3N86A 5E9QA 1NUSA 4ZAFA 3W6OA 4DCOA 5LZ4A 4AULA 5CITA 1C9DB 1KVSA 2I55A 3SHTA 2G40A 2PZJA 5BW4A 3QKUA 1U0TA 1HNZB 1ZUNB 4G23A 2VP4A 3S40A 1YR3A 3ZV4A 3ZI7A 3H3FA 3QKRB 3ZWYA 4MGKR 4R40A 3L04A 2IH4A 2FW7A 2ZWMA 3GT3A 4I3GA 3M4JA 4OQ4A 4WDRA 4MQ5A 4X92A 5KPJA 1BDJA 2ZIAA 1A4RA 2A8YA 1H5UA 1SXHA 1RQRA 1U80A 2OCIA 2ZJ1A 3I62A 4GZ6A 3HB4X 5D5QA 1CHNA 5ECWA 4PR3A 1L5GB 3L1JA 3PEEA 3AEKA 4BNNA 2HW8A 1UOOA 5TRTA 4D3SA 4IHJF 1Z0KA 1MJFA 2CLIB 2XUKA 3BQMB 1DFGA 3EFOA 3JALA 2A57A 1V5EA 2IP2A 1KC3A 1ZH0A 4ZAWA 1TD9A 3BMQB 3U7QA 1L4MA 1AMUA 3FPJA 1X8XA 4G4GA 4CTNA 1CJKC 1A9PA 1NR7A 3O94A 3PUJA 5G4LA 2NXWA 2PZGA 2GHIA 4TWJA 3IV6A 1QPBA 4B9AA 3D6JA 3SS7X 3ONFA 1WDWB 2XDQA 5IKEA 5EUQB 4C6SA 1NXXA 2VWQA 3BXOA 4O4JF 3UG6A 5KNCD 4C0XA 4CT4B 3QXJA 2QXUA 2P0EA 1B93A 5FUYA 4A8PA 4AD8A 4XARA 1JDZA 3Q9NA 4MPDA 1BG6A 3QENA 1KKMA 1EE1A 4U5XA 3NU1A 5D51S 2GEUA 2JJMA 2P4EA 3KB1A 3WJ2A 5A2GA 3AM4A 1FSPA 4OYRA 4IIYA 3TLZA 3E5RA 2VH5R 5JMWA 1H1LB 4AICA 2H8GA 2HCJB 3P9KA 3E3OA 5IVDA 2XEXA 3X1WA 2Q3CA 2WSSA 5CURA 4ZJPA 1Z62A 2HRDA 3I1FA 3VNRA 1ZRNA 3ZX5A 2I7XA 1VL2A 2PRYA 5DLEA 2WC1A 4C0QC 4XGQA 3T9FA 3VR0A 4D98A 3FCXA 3ZIUA 1EFRA 2ZI7A 1WKCA 3P32A 3DE2X 3U40A 5AW9A 2VCYA 4H31A 1X2EA 2YIDA 4Q4LA 1SVNA 3WP0A 4DC0A 5BNFA 1OXVA 1GU7A 3DFZA 2ZIUB 3S0JA 1FTGA 3LUDA 3WMXA 4UUNA 1G9TA 4L15A 4MI9A 3AF6A 3IT2A 4HNHA 4S2UA 2CCGA 1JXOA 3PC3A 1NMEA 3L0CA 4RW0A 2DP4E 3T9DA 3L4KA 3BRQA 4TRNA 3WNZA 5L3ZA 3T9EA 2ZDGA 1QQ5A 2OP1A 1Z75A 2WSBA 2YRXA 3WGOA 5FI1B 2O57A 2P69A 3B6ZA 2VDVE 3IEXA 2R9VA 1JHXA 3B8HA 4KWTA 1XXHA 1Z4JA 2CCJA 2OV2A 2WU8A 4B1FA 3ZWQA 1VSUA 6YASA 5L40A 4MPRA 3UCFA 1JZQA 3AYZB 5DCUA 4E5VA 1FTNA 3W78A 5JNLA 4KO2S 3DT6A 4LYYA 3A1FA 2ZJYA 5HP4A 2IY8A 2TSYB 3I5AA 3FGNA 1CWUA 3IT1A 2AR9A 5COAA