1U11A

Pure (n5-carboxyaminoimidazole ribonucleotide mutase) from the acidophile acetobacter aceti
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
159
Chain Sequence
b'SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSAHRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVESRALKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PurE (N5-carboxyaminoimidazole Ribonucleotide Mutase)
molecule tags Lyase
source organism Acetobacter aceti
publication title Acidophilic adaptations in the structure of Acetobacter aceti N5-carboxyaminoimidazole ribonucleotide mutase (PurE).
pubmed doi rcsb
total genus 52
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 1u11A00
4YCBA 2FWAA 2FW7A 1XMPA 4GRDA 5BOSB 5CLJA 2FWPA 5C5DA 3TRHA 2NSLA 5CTJA 5BOSA 1U11A 4YCCA 2FW8A 1D7AA 5CLGA 2FW6A 4YCJA 3RGGA 2FWIA 3OPQA 4ZJYA 2NSJA 5CLHA 4AY3A 4AY4A 1QCZA 4ZC8A 2NSHA 2FW1A 2YWXA 5CVTA 4ZMBA 5CLIA 2FWJA 2FWBA 4ZK2A 1O4VA 3LP6A 2ATEA 5BORA 5CLFA 3KUUA 3OOWA 3ORSA 4B4KA 2FW9A 2H31A 4Z7JA 4YCDA 3RG8A 4JA0A
chains in the Genus database with same CATH superfamily
5TPWA 2G82A 3LF2A 3VYVA 5HP4A 2GBPA 4NFLA 2Y1DA 1DJPA 4GBED 4A2PA 3N2GA 4YAFA 1NHGA 2ZRAA 2Z8YA 4ZEOA 3G0GA 1V39A 3SX2A 3FH0A 2A3RA 1E4EB 3GW8A 3O3NB 2CXHA 2OGUA 2R84A 2PWYA 3ZWXA 4BFSA 4X1IA 1Z13A 1C0EA 1ZMOA 5G1PA 4E2YA 1E32A 1CZOA 4Z4GA 3T0IA 1YR2A 2E0IA 3WL5A 4G09A 4O4JB 1X0VA 2UDPA 1T2FA 3AWDA 1CEXA 3DF7A 3MTJA 1OU4A 4JUAA 5K9ZA 5LU8A 2I7CA 2ZVQX 5EIXA 2NU6A 1JIJA 5EUCA 4KBYA 5A4FS 1SA0A 1SU6A 2FPGB 2NP6A 1CIVA 1YZQA 5DSTA 2VHTA 3FPKA 5F5LA 4LYEA 1U3CA 1IM8A 1E5VA 2DE0X 1NUUA 2GERA 1K66A 1BWSA 5F12A 4ERNA 4BNTA 1EP1B 5ITZA 3OQMA 4JCOA 3OCVA 2I62A 4Q3BA 1Z5GA 3QKRA 4AU1A 3T3PB 2VOEA 2AG6A 3BRCA 2BUBA 3HRIA 3EASA 4MYCA 4BMSA 1LQTA 3SBOA 5I4BA 1YMUA 4BGEA 4WZBB 1NYLA 1KSJA 2OC4A 4TZ6A 1W6UA 1JDUA 2NXNA 2QYTA 3QFRA 4QPNA 3R3WA 3KR9A 3ZHZA 1GHTA 3HXLA 3UOWA 4KOAA 3U13A 3GFVA 2Q27A 1N6RA 1C7QA 4EMTA 3VJRA 3LLUA 3RWOA 4G0UA 2MSDB 4LJ4A 1YJAA 2NAFA 4YCDA 4EATA 5IN4A 2AQ8A 3QEOA 2WICA 3R44A 4E12A 3I64A 5DV9A 3MSXA 1CQIA 1K97A 3PTLA 3AIKA 1G20E 5D7BA 1GT6A 3PXGA 4NAVA 2XNSA 2ZSHA 5ALVA 3OJOA 1JH8A 1NVVQ 1AOXA 2WUFA 1JAHA 5AW6A 4OGLA 1I1HA 3UT6A 4FYVA 1L3BA 2H00A 1R27A 1B74A 2D74A 1HM5A 4RA9A 1RRFA 3W1VA 1P33A 2G7MC 4DLVA 4A6XA 5HNKA 3L5OA 5CH8A 2Q50A 5HTKA 1KF0A 3ZXYA 2EGUA 2IV3A 5DGDA 3FFTA 1WMAA 1YJBA 4EQ6B 2Q5FA 4QGGA 1WXHA 3C7AA 5KYWB 2NG1A 3H17A 2BKUA 1U2RA 3PL1A 4NMXB 2GRUA 2PRYA 2M6LA 3MWDA 3LUKA 4JJFA 4JY7A 2BF7A 1TUGA 3BSFA 1HL3A 3INYA 1O96A 3IRVA 1KPIA 1VL2A 4KZKA 4OGWA 4U6SA 5C3UA 1KPGA 2XCUA 2VBGA 3I2IA 2CGEA 2II6A 3MCTA 4WXYB 2JGNA 2FMFA 3OZRA 5EL0A 1VI2A 2G1KA 4DBLE 4N5NA 3VUFA 1SG6A 1Z25A 3BXZA 3QXXA 1RJDA 4HWKA 3NJRA 3D0QA 3ZGXA 4WNIA 2V7VA 2AHOA 3CQ9A 5ALGA 2KW5A 3VTFA 1USWA 4LQCA 4F5WA 1AQUA 4Y9DA 2V7BA 1NDUA 3ROGA 4KVAA 2DSTA 2YJ6A 1AG9A 3PUWA 4NY1A 5KX5F 5TQJA 4NZZA 4HB3A 4TWBA 2NQ8A 2XGSA 1SBIA 3PUVA 2XYRA 4X9XA 3REGA 3TOZA 2HMYB 2V9CA 5TT0A 1OWPA 1XCOA 1WLSA 2A5GA 3MCZA 1E79D 5CPFA 2FZEA 1S96A 1SVIA 2JATA 1G6HA 1RBQA 1WXIA 3PENA 2UUAB 4BB9A 2QIPA 3ICQB 4L5AA 4S0ZA 4I4NA 2JIQA 4LV5B 4MIEA 4KPEC 2QPOA 2GDJA 3V00A 2PJUA 4ZTUB 1V8BA 1L1QA 1ZL0A 2WVGA 3X1ZA 1HK7A 3E4CA 1KXZA 2ET6A 4OHFA 1E2LA 2I1VB 2PFKA 5BUZA 1RRPA 1MB3A 2PFGA 1Q7EA 1T9HA 3MGAA 5K3SA 4WJLA 1ESMA 2XXAB 4O4IF 3E2PA 3MAGA 5LNK6 4AO8A 2X8JA 1AB6A 4IJKA 1JPNA 4UNIA 2Y1GA 2QUJA 1GD1O 4L8LA 4XDYA 4CG3A 5JNRA 4X5OA 4JLUA 1CF9A 1ZBDA 1EXNA 2IUTA 4AS3A 4CEIB 5EWMB 4PFKA 4WEQA 1OF1A 3AVQA 1IBLB 4XXHA 2I2CA 1V8OA 5AM3A 4OB8A 1AQLA 3GLIB 2I22A 1QVRA 2A1TR 2RGUA 1TQ8A 5HGXA 3G7UA 7AT1A 2RE8A 2FSPA 1GGMA 2UXCB 3S5UA 1IZ7A 3EXHB 3D8TA 3P20A 3V1KA 5JQWA 3ROFA 1BN6A 3CLVA 3AGPA 3R20A 2Z2IA 3TYXA 3RD5A 4EG4A 1O5IA 1CB0A 1I2DA 4KXLA 3T54A 4D9IA 3HA3A 3MB5A 1UPTA 4OHXA 1YQEA 3EC2A 5EKDA 3UANA 4V39A 4I3FA 4LJ8A 1ST3A 1K7EB 2O7NA 1E94E 2VP6A 1RAAA 2HQBA 1FL9A 3LC2O 3DFFA 4MPJA 3O83A 4PSAA 3V4RA 3TRIA 1RFGE 1U3DA 2DUUA 2EG5A 5ILOA 2CLEB 4NE7A 3R6GA 121PA 3KQTA 2QY9A 3ZHVA 5BV1A 3T7KA 3PXDA 1DOZA 1Z6PA 2PVCA 2OCGA 3A70A 4MK4A 4WD3A 4HNVA 1RI4A 3GLGA 1HTBA 2ZDGA 2QR5A 4PVDA 5CHYA 3RSQA 3SC2A 3UK2A 3SBDA 4YBZA 5NLLA 3P9PA 2AI1A 4RF3A 2FDXA 1V8DA 3B53X 2HLHA 3N0TA 4JUCA 1MJFA 4R5HA 1RPNA 2ODAA 3SZUA 4GL4A 3ERCA 4II2A 3W5BA 1IFXA 3CFYA 2ZWPA 2ZZKA 2BH9A 3PEVA 5CR9A 3ZDBA 5CK5A 1QQ6A 2C7PA 3RYIB 1XIVA 2HDHA 2H5IA 2I4NA 4CKCA 2GFQA 4QXPA 3A10A 5GTDA 2C9DA 3NLLA 3RTGA 2CSXA 3HU2A 1GUAA 3VX3A 2Y76A 1SUAA 3OZEA 3O3OB 4HMQA 3X44A 3WYFA 4KV9A 3LAWA 5GVSA 4HNRA 4B8WA 1UFRA 1RYFA 1LXCA 3VU3A 1YRBA 1AA6A 3EG9A 2A94A 1GY8A 1K7FB 3STUA 1EAYA 2CHQA 4UXJA 8ADHA 3ZIAD 2BEUA 1PX0A 2UVQA 3SIPA 3ZX4A 3ZQJA 2D1TA 2O3TA 1DARA 2Y1CA 1Y6QA 1WKBA 3FCUB 4TKVB 2XUGA 3KJHA 3RS7A 3O7WA 3NU1A 2H2IA 2Q2NA 3LXRA 3LSYA 2P9JA 2XPCA 5EP1A 4EKDA 3LO5A 4RMGA 2FPGA 5CM2Z 4DCSA 4KDRA 1JMKC 1NVXQ 2QRPA 3N5CA 2XODA 4REOA 5FULA 1M0TA 3SQNA 5EJEA 1MUUA 3D4PA 4C4PA 1X38A 2Y27A 5F35A 1I4TD 2HA2A 1XZDA 2RHMA 2YMQA 4K03A 4YXFA 4EIWA 2YX1A 1GVNB 3BH0A 2PFSA 3MTEA 4F2GA 5IBRA 4YQEA 4PFSA 4YMLA 4AMZA 1KK0A 1T5IA 2KBEA 2ZW9A 4FDVA 4CUJA 3WLKX 1QOZA 3HH8A 1O54A 4DNFA 2O9JA 1Y8RA 3CCBA 4TVOA 1QFYA 1LCIA 3OOWA 2EV9A 1BSVA 3ZKWB 3KKLA 1RAGA 2O5VA 1GNQA 1NNI1 3LW7A 4HVTA 1TYZA 2C9BA 3O92A 3L0IB 3G6KA 2QQ0A 3T1YB 2EKZA 2TSYB 1U7XA 2VDRB 4WFJA 1CQIB 2AFVA 3G79A 1QRSA 3FOWA 2F7SA 1VLJA 4BUCA 3SBEA 1ZLXA 2V96A 1KH2A 2JBWA 1OLSA 2IHVA 1LNQA 4MYSA 3W2FA 3EXIB 2NIPA 4IGEA 5LMUB 3IE1A 1C9NA 3ICCA 5E8JA 4CV1A 1VHJA 2GHQA 4F92B 2H07A 1L5WA 3EAQA 2B8TA 3V9PA 3OEED 5EE1A 5DX8A 1CUWA 1U8EA 2XRYA 1XJQA 2ZRJA 3QJGA 5BW4A 1NNUA 1UBKS 2JCVA 3F78A 1ZUIA 4CT5A 4CKEA 1V6CA 4KYVA 4Z1MD 1KSHA 3R3VA 5IJ0B 5JNLA 4WHMA 1AZSC 2QM0A 4KMOA 1XTIA 2ZITA 2C5LA 2CNOA 2HNAA 3QWFA 3HUTA 2ZUEA 4XB6B 4WZ6A 5ALPA 1PHRA 3L8DA 1UC8A 1C9DB 3PNSA 1TNDA 3EY9A 1U1IA 4BTEA 1FFCA 3GJ0A 1P0CA 2RIPA 2B4AA 4U2KA 3ZE0B 2XZDA 5I9NA 5K6RA 1ORTA 1UWLA 1W1WA 3PB3A 2XWPA 2NUPB 2IS6A 1BDMA 4LCJA 4YGXB 5EC8A 3B52X 3BD8A 5HKOA 2B78A 2AJBA 3JVUA 1OPXA 3ELBA 2WSLA 3GVCA 5A5VA 3U4MA 1YZNA 2CMKA 5D3KA 1WJGA 2YUTA 4JBNA 4DCMA 3QE4A 4LF5B 4TSKA 1ZL2A 3BL8A 3TW4A 2OHGA 4F04A 1E2KA 1ZSVA 2UZ1B 3KYDB 3WNQA 4RGQA 5LMCA 5LZ7A 2PZAA 2PY6A 2I6QA 2R96A 3R7DA 2DHRA 3V33A 1YRLA 3G2OA 5LQMA 1L4MA 2GJKA 1L5GB 3LNTA 2B7CA 1FFSA 1J97A 1WP4A 4K6HA 4A8JC 1PG2A 1EK0A 3V2UA 3R5FA 2P6OA 2QI9C 3FDFA 4GF5A 3PEFA 1Z2EA 4KXVA 4C2BA 2QTMA 1XDUA 3CWZA 1L5NA 3GA5A 1PV4A 4RPIA 1VCOA 1WCWA 2OV6A 4X8OA 1T1EA 3ZCUA 2L82A 2ZT5A 5FNVA 3AI1A 1SBQA 3UOAB 1UKZA 2WIKA 3VVCA 4Z8XA 1XBTA 3KSAC 4PQEA 4YASA 5TPZD 4YCAA 2PLWA 2AFRA 3TFQA 5C52B 5FQOA 5JD3A 3RS0A 1DCFA 2EJBA 2B5OA 4EF6A 4Z51A 2EX4A 3RR2A 3ROXA 1S2NA 3BAFA 1HYBA 1RHQA 4ZU6X 3U1TA 1LDEA 4EGSA 3GLFB 3TLKA 2DWQA 3NHUA 3HXOA 1G3MA 5EWMA 3H19A 2W8ZA 2V03A 2X0KA 2E4VA 1Z4LA 3BH7A 3QSYA 1VYUA 2CNWA 1PGOA 2GN9A 2DJ5A 3HL4A 2A67A 2Y4NA 1M6WA 1X1EA 3D7KA 3OU6A 5JSKA 4F1KA 1AUPA 3VPXA 4NYIR 2DOKA 3UFXA 1NT4A 3HDYA 3WLLA 2XXBA 1WY5A 2QG6A 1ZMXA 3VPCA 3T7CA 3OZVA 2JBAB 5F1YA 2VHYA 1BX1A 3F5FA 1AK9A 3H0KA 5ILGA 1M8KA 4EJSA 1WUIS 1J23A 2XJ9A 1QOQB 1RHJA 3JPYA 5KJCA 1YGPA 2CYBA 2P9YA 3GRAA 2Y1OA 3DAYA 5DH9A 3SC3A 1PT9A 3HPRA 3D4NA 3SNHA 3TI7A 3ZIUA 3TX6A 4G0YA 1P62B 2YZ7A 2OFFA 1GARA 3INGA 4P5EA 4JI4B 4MWDA 4JP1A 4OATA 1I9CA 3PUIA 4P92A 1IY8A 2GEBA 2IT1A 3R4VA 5IP5A 1IN6A 1M34B 4RL4A 4LRWA 2QVLA 3ITDA 2WKSA 4BNZA 4FP9A 4O4JF 5F98A 1Z39A 3VX4A 3GDFA 4ZT2A 3VHXA 3KU4A 5JE8A 3RVPA 3KFVA 4LE2A 3T6KA 5I8WA 2PYIA 1GFWA 1MIOA 3CW9A 4P7JA 4AECA 3KUXA 4HRVA 4KUEA 4QPJC 2RMKA 4RMIA 3N8IA 3DWFA 4HDMB 4RV5A 3UV3A 3DTVA 5CFNA 3Q7IA 4MCHA 4X7BA 1EB8A 1ZA1A 2WIJA 5TQ0A 4D9FA 4FFRA 5AHRA 3AB8A 5F2OA 1ULZA 1XTVA 3DOJA 3A6PC 3C85A 5C4MA 4ZT6A 4INPA 2FGJA 2QNRA 3D8SA 4PZLA 4U3JA 3RYIA 5JNVA 4PYQA 1XL1A 1PVVA 1D4FA 1UKCA 2Y0CA 1Z2CA 4R6WA 4G24A 4BPRA 3FD8A 4J6FA 2FE4A 5J4VA 1B8VA 1NAIA 4EY5A 1C3OB 5I7UA 5I4IA 1LJ8A 2X1MA 1AZTA 4EG0A 4IMRA 2AN3A 1P7CA 2IVFA 1EQ2A 4EI7A 4PN3A 2O19A 2E37A 5DW0A 3AGQA 3GD5A 2VQEB 2HUNA 2QB5A 2ZM6B 3M9LA 2G76A 1IEXA 4YT4A 2OESA 4CLHA 3KPYA 1PWYE 5B1EA 3VHQA 5J43A 5BT9A 2VPWA 4G97A 3ROKA 3VYTB 3MN1A 3TMYA 2XITA 5LDDC 3G2JA 4YT2A 4WN3A 5K0LA 2ZRFA 1QH1A 2PZLA 2QMZA 3FNFA 1FUEA 2UYYA 3HUUA 5JD5A 4BYGA 4D0SA 2AC4A 3GLUA 4F4HA 5F23A 4UVEA 5IYZA 3TD6A 4WT7A 4LF6B 3REQB 1JMVA 4OBXA 4N3GA 1NNEA 1MEEA 4UNPA 3TDMA 4FGSA 2O5RA 1ZUHA 3O8CA 5E2AA 2QW8A 1N5RA 4UHJA 5EJ2A 1N2CB 5C3MA 1P7PA 3UHOA 4LXXA 3JQAA 1P3DA 3IFSA 3LU1A 1XZQA 1Y5MA 2BMEA 4I3GA 4OYYA 1XA4A 3KZOA 3K35A 3AR5A 3PYMA 2AMVA 4FYIA 4HFMA 4HTFB 4JSTA 4OH1A 5AK5A 1SPXA 4MSUA 4NZYA 2A92A 3U7GA 3Q8MA 2VJPA 3RF6A 4MJXA 3WL6A 2PRZA 4DC1A 4HWOA 3GDOA 4KIJA 4OGFA 4BX3A 2O1EA 1IN8A 4DDTA 1Z2PX 3K05A 5MN4A 2NXJA 4MW4A 4X62B 3HJUA 4G1BA 1YR1A 5B30A 3KUUA 1V5GA 3OT5A 1JR3D 5CVUA 1JG3A 1ZHOA 1KH1A 2CMFA 4JA0A 1HMYA 2J46A 1GGJA 2JIZD 5DM4A 2IYPA 2XTZA 3KSDO 4MV6A 3D1VA 5AH0A 5DFAA 3FBWA 2REXB 2E87A 1WW8A 1QVWA 3BWBA 3N8GA 3OOEA 4A5SA 1BN7A 1G4AE 1X8LA 2R6JA 2M6KA 4KQGA 4IL5A 3TL3A 1BJTA 1YRQA 4BY9E 4M8IA 1P2VA 2W8BA 4RMHA 5CVCA 1EWKA 5BPHA 2ROQA 3M1LA 1ZSNA 5E0OA 5GM2A 1QO0A 5EG5A 2CZCA 5AM0A 1G5PA 3H2JA 3RJMA 2HCBA 2YHIA 3LQ2A 4A9AA 2Q99A 3GLKA 4LZLA 3KHUA 4GMXA 4ASUD 1GGNA 1K08A 3GCXA 1BA3A 4XUEA 4ENSA 2XT9A 4M7WA 2QYHA 3R0VA 3AWIA 4QGHA 3GGCA 5DI3B 1YQUA 4C20A 3PYXA 4QDUA 4LE1A 2FWAA 3DVSX 1M2VB 2YZKA 2FGKA 3D64A 3KQQA 4RFSB 4W8GA 5BV0A 5A4KA 1UBGA 3K4HA 3HA5A 3ILVA 3BSSA 1FU7A 3V3TA 1EESA 3SSNA 3RBAA 5EXEA 1YA6A 1RWVA 1XTQA 1YDWA 1NPDA 3CW2A 5CCBA 2I2FA 1GPDG 3IT2A 1ISFA 3NHSA 4RGBA 2BLNA 2JKYA 4D0GA 3U19A 3P0JA 1KP2A 1KO1A 4ZYLA 4IILA 4QSMA 3HHPA 3I92A 1I4DD 2F62A 1A8SA 2ONKA 5BP7A 1VBNA 1P5ZB 2ZB3A 4KUHA 5EZ5A 4TYWA 1N8SA 3DC7A 3QHAA 1N6KA 1K1EA 1R15A 3E7DA 1RDFA 4HLUA 3K94A 5G1NA 3H2GA 4E32A 1QBKC 1VHWA 4MUYA 4D9EA 1Q15A 1U9CA 4LQDA 1B23P 2OYCA 3T4PA 1NLUA 4ZEVA 4L07A 1JHZA 3SFTA 3KKNA 4ARUA 1KARA 3GQBA 4B8YA 4GVPA 4F38A 1G6KA 1PR4A 1GAQA 3OSZA 3Q0TA 4IDDA 2PQMA 3WGHA 4CR8A 2PGAA 2ODEA 5A1TA 2KQUA 3TLXA 3A05A 4NG5A 1EFVA 4NDAA 3L7MA 3ILHA 2AMFA 1EFRA 1II9A 3AFOA 4EB6A 2YWDA 1SVUA 1WTCA 1ND6A 3MF4A 4E5MA 3RIXA 1XRNA 2NZJA 3LFUA 1VIYA 3KO8A 2ZRHA 3H42B 4JWTA 3U17A 2ZE7A 4J4BA 1J39A 4U4AA 3W8FA 4M1WA 4UVGA 4EEKA 3FXAA 3PWTA 5TMPA 5KTRA 1XSEA 2XUOA 4NBWA 4UASA 3B6ZA 5SICE 1U3VA 2DH6A 2O8FB 1LDYA 2WLSA 1I94B 1H23A 3WQSB 1TM7E 1OZFA 2JIBA 3GLFA 3KE9A 4P7KA 3FYSA 3NAGA 1U7WA 3KELA 4QUHA 5K99A 3RAEC 1NQ5A 2PX0A 3H1FA 2YIDA 4OHCA 4OHRA 1RRCA 4FZ3A 3PQ7A 4EHAA 5HKKA 3IBCA 4K1XA 1QZ3A 3N53A 1BHO1 1P77A 4LOAA 4G0QA 4U7HA 1A8IA 2W2KA 4YAKA 3CF2A 3AEKA 3E70C 2CFCA 1KFJB 5K0TA 1AGRA 2CVOA 2IYWA 1P5RA 2BP7B 4NEGA 4Y6PA 3R0QA 2PPVA 3GCZA 3AEUB 4WECA 5J2UA 3GLSA 2IYTA 2FEMA 2VDKB 3DQPA 1NXVA 3E81A 3TZKA 2WQ6A 5IAJA 3SD7A 1YNSA 1IIBA 2F8SA 1G5QA 2WPDA 1N0UA 3HVRA 3FGPA 4MUIA 1UUFA 3P0RA 1ECGA 4MS4B 2ACVA 4RZ2A 2ASVA 5BN5B 4YY3B 2FQXA 1OYYA 3UGQA 3GUCA 3ASZA 3OQNA 4EA6A 4PS1A 2GD6A 2DTXA 4D8YA 2YQZA 4PFJA 1YL6A 3UAOA 2O6LA 1Y1RA 2FY8A 2GZHA 2AJ8A 2G8LA 2HOQA 3NKLA 4X6XA 1CRPA 2BE9A 3FKSD 4W1RA 4BMPB 1IQ0A 4Q6WA 4HBGA 4V0NA 1RKUA 4XTCS 2ZZMA 4JOQA 3LHSA 3H1BA 3KAQA 4NVRA 4RPLA 4UBJA 4FGKA 5JXJA 3UAYA 2GPTA 4JBGA 1N2ZA 3BDIA 4KQEA 2VYVD 1J0EA 5LCXA 3TMAA 1YRYE 3AUFA 2XGJA 3KJQA 3BFJA 1BKSB 5EJ5A 3BUSA 3AFMA 4U3JB 1X1RA 3WR5A 1W93A 4M87A 1OR8A 5GVRA 4BAZA 2OQIA 1FFBA 1U1EA 3V2IA 3MTIA 4G5HA 3E53A 1OXUA 3GLQA 3D7SA 1J49A 1UMCA 2QAGA 1JFRA 3EFEA 2O48X 3RFVA 2E6KA 4B82A 1DWOA 5A4MS 4MRSA 4Z0TA 1B14A 1P2TA 2VK8A 1G64A 3CUSA 5LP6B 5A6SB 1EKXA 4BBAA 3NBKA 2ZBQA 3H83A 3MK31 2HRBA 4OSPA 4UHDA 3REFA 5C7IO 3DB2A 4EUEA 4UDXX 2R1VB 1GR0A 2BI8A 1WMDA 4JP3A 4OU5A 5E2BA 1QRTA 5AKXA 3MYYA 4UXHA 4EHLA 2NO9A 2AX3A 3A6ZA 3PL5A 4OI1A 4KPFC 4H31A 5HFAA 1QC5A 5C8DA 1AKTA 5TQVA 1PJBA 2Y6VA 1E7WA 3N75A 3O7MA 2JLXA 3D5TA 4B87A 3GRUA 5K2MA 3IDAA 1NYTA 3AF4A 2EFCB 4L0MA 1USIA 3C97A 3EMDA 4M1OA 3KOOA 4TROA 4X1OA 5AOCA 2PIAA 2PKRA 4DCTA 5IF9A 3ZJVA 4GMHA 1V3TA 4K6MA 1FP2A 4ME6A 3BG5A 1TW2A 3PVZA 1H69A 3I73A 3M81A 2JHPA 2QL6A 4HYYA 4IGIA 4NFSA 3T9FA 3HBLA 4DCNA 1MT3A 1UFVA 2BSQA 3HBJA 1UINA 3AYXB 2WUDA 2YWCA 4HQRA 4RXMA 1OBCA 4WCFC 3DBVO 1ZCFA 1FSFA 1E2DA 2H0AA 4PZCA 2O0JA 2PTHA 1QS0B 1B41A 1JYSA 4BN5A 1T2DA 3IP5A 3AVWA 4DMLA 4WXMA 1M1YE 1XU9A 2E2WA 2IY9A 4MINA 3VZBA 4E2FA 3QVMA 5DRYA 4DA4A 1Z7WA 2C4TA 3IAFA 2I3BA 2SBTA 4EDHA 4CCYA 4FLMA 5C5EA 4LRXA 5LM3A 1TKRA 2XE4A 5DNAA 1HT3A 1DCKA 2PKWA 2CCGA 3GCDA 3HZZA 3BS4A 2CJFA 3BCRA 5F2EA 4DT1B 1NUAA 3QMWA 2HRZA 1LWNA 3X0DA 1IHYA 3IOYA 1F2UB 3HO1A 1E20A 3KLPX 3ETJA 4I1PA 3TRDA 2IHUA 4FFNA 3ABIA 4OMFG 1IYZA 5IAKA 1CXZA 4FR2A 2RJOA 4N65A 4XX1A 2AJDA 4U2FA 1CS4C 3AF2A 1UOPA 5HS4A 1E3LA 1GGVA 3K0EA 3OEYA 4Q1VA 5ECWA 5DCLA 3DF9A 1K9SA 1DQYA 1XQ1A 2YIMA 5DT9A 5U9CA 2I4OA 4L57A 1YQTA 5DWQA 1GGEA 4F4IA 1ACLA 4Z49A 1IE3A 1VGVA 4TVSA 3OP1A 4GP7A 1DEAA 2VXYA 4ZYZA 3G82C 1AQ6A 2CLMB 1H94A 1Z16A 1CRLA 5B6PA 1SC9A 5H70A 1B16A 1NY5A 5BMVB 1M66A 3VNRA 4IS2A 1E3WB 5J1SB 3WLHA 4JEIA 2PL3A 2R2AA 3K1TA 3LP8A 5CT4A 3TBHA 3WBJA 1QNLA 2KE5A 2JZCA 2OYSA 5ALRA 4C43A 5KPDA 4RIFA 1E1RD 4C0XA 4H3VA 1N7GA 1CUCA 3RABA 4PO3X 3LTEA 2F1HA 3MXTA 4OAQA 4Q4JB 1CUGA 4EELA 2XF2A 4PXAA 4J0DA 4RD3A 3I9V6 5JJIA 3VPHA 3E3LA 4OB7A 2C4HA 1I0IA 3GGGA 4JJGA 4R7GA 5LA6F 4LFBB 1L7EA 2P0YA 2FN8A 2VP3A 3INRA 5DLEA 1HEUA 1D2CA 4GC9A 3RGWS 2QAGC 1NATA 1OXVA 3K9LA 5LR6A 2VEOA 5I5EA 1TTPB 2Q5EA 3V32A 3TSWA 2C97A 4C7XA 1U2ZA 4KHPB 3OJEA 1KMHA 1UPBA 1TKBA 3NT2A 5AM4A 5ENDA 8AT1A 5ADHA 5DI9A 1L4HA 1G3RA 2QSYA 2GM5A 5DXFA 2Z30A 1DUVG 5JDIC 1MW9X 4E70A 3M4XA 4X7MA 1PNQA 2P2LA 3DXFA 3ORRA 1U04A 1MABA 4D3SA 3MIZA 1FNCA 3WKBA 4EX6A 1FRVA 4TQAA 3F4LA 4J29A 1FQOA 4R8KA 4RHTA 5JY1A 3NTUA 2IYRA 4L4RA 3ZY2A 3CUWA 2H5LA 1G8FA 4LJ7A 4LDQA 2PANA 5DMXA 3RHFA 3CMCO 4MR8A 4BJ5A 4J1TC 2ZPAA 3NETA 3PHHA 3H9UA 5KJ1A 1WULS 1X19A 5GOTA 4A5OA 1R0LA 2K6GA 3DAPA 1SBTA 3U3XA 5CEFA 2ALJA 2IF0A 4LDNA 1NVVR 2FW1A 2KB0A 3OIFA 4I6EA 5IANA 2PRKA 4KYIB 2VRCA 2CXUA 3MAJA 4RDIA 1RHMA 1Z4PX 3F3MA 5DYWA 2DWUA 2J3EA 4P4SB 2P75A 1UC5B 1CUJA 1Z62A 3QBVA 3QELA 3KLBA 3LDHA 4G8JA 3ONNA 2ZSAA 3DHVA 3VZSA 5C18A 3UGJA 5GIPE 3QE0A 2A88A 1E9VA 4LCEA 1W0CA 1NVUQ 1V16A 4EVIA 3DE3X 5H8WA 5BQPA 1UBSB 2GAJA 4HAXA 1Z4NA 5HIAA 3U3DA 3AR9A 1GT91 3EB9A 1FIUA 1DJLA 4ARZA 2WJIA 1U2TA 1XRRA 5HZMA 1EPUA 1VBKA 4G2NA 3B12A 3BE8A 3LBIA 3R09A 1NI4A 2PQ2A 4GBJA 1Y6JA 4HAYA 3EXEB 4RJJA 3UUEA 4GYJA 3RSFA 1DOAA 1GZUA 1JKJB 1FW8A 3DG9A 4WKCA 3ZCVA 1L7NA 1WF6A 3OZTA 2IL1A 3E9NA 2NSDA 3QVGB 2ATEA 3DUWA 2LNDA 4I1IA 3PNYA 4M0FA 4Y0AA 1HNNA 1N2GA 3TB6A 2GM4A 1G6Q1 2OEPA 4TVBA 3OFJA 5E4FA 2AQHA 3G5LA 4HEA1 4EW6A 3ESQA 4GZLA 4WTOA 4K6CA 3EW7A 5AVTA 2E4XA 5MHTA 3AI3A 4PC2A 4G36A 2BUCA 3A9UA 2D5BA 3ET4A 4LI0A 4R8SA 2F8LA 1W88B 1J70A 3VJMA 3ZY5A 3QP9A 1UKEA 1YZTA 3UKDA 1QOPB 5JFOA 1TQDA 4A2CA 1C7IA 3TJRA 3PR1A 4LWZA 4TLBA 2FOLA 3MINB 3OM8A 4ZTZB 2G6BA 3VYSB 5CXQA 1K4MA 1T4CA 2JI6A 2WKPA 4DHWA 5TVKA 1WXDA 4EGCB 1EP3B 3GZTB 2HLPA 3DLTA 1QX3A 1P0MA 2HF2A 2MT9A 1H4VB 4NPCA 3MBIA 4O0LA 3ZIAA 1VL1A 4AG5A 3BB1A 5JFGA 5A5FA 4FILA 4NU5A 3NKVA 2JJMA 2J3IA 2MMCA 3IP8A 4K81B 1KVSA 1CCWA 1YT5A 5DTQA 4GOXA 4UQOA 5ERGB 3DLBA 2Q46A 2XVAA 2VSOA 3Q9LA 2WP0A 4YRQA 3PNVA 2JG3A 2PUAA 4EPRA 4W6ZA 3ZHBA 1ZVVA 3H6GA 4LF4B 4M0LA 4UVHA 2G9QA 1F2TA 5HZKA 1OUMA 1A76A 1Q2XA 1YS4A 4HGNA 1YFLA 1O1YA 3GEDA 2A57A 2H6EA 3B38A 4GXTA 4IDGA 4WOPA 4BE9A 4UTRA 1SEVA 3BMOA 3P45A 4YJ3A 1LRKA 3OX3A 4HDRA 1H05A 4C04A 2JC3A 5TS3A 1XXHE 3O9ZA 1EUCA 1GCGA 2PX2A 4HB0A 4YRJA 3F7NA 1PT5A 3OTWA 2MTBA 5B1IA 4HRXA 3C3MA 3OLWA 4XWYA 3G0DA 1Z0JA 3X1DA 4JXXA 2FP4A 2ZRKA 2QVXX 3SSAA 2ZB4A 3JTMA 5AKEA 2H9AA 5LJIA 3R5HA 4RPKA 2E5FA 4LDPA 3SR3A 2BHTA 4F7WA 2OHHA 3O4HA 9LDTA 5CDHA 4EFKA 2YC4C 3U48A 5FTKA 1YZFA 1JKIA 3KZMA 5L51A 2PVPA 3OE4A 1Z0SA 1TPZA 1F1BA 1U02A 1FMCA 2PUWA 3PWZA 4QC2A 4TGLA 1UJMA 3QLUA 2C0QA 5GONA 4D42A 2C2XA 5AVSA 2P4SA 2PJZA 2YJNA 2ZROA 4C29A 3K9FC 1PBNA 1Z8NA 3EK2A 3N70A 2CNWD 3P5SA 4JWKA 3ZXIA 1DEXA 3HNPA 4A6EA 3J7AC 3FUUA 4I55F 1II8A 2SKDA 1JH9A 3PE4A 4FE4A 1KEZA 4BO1A 1E1DA 1S01A 1I2MA 3IAS1 3K53A 4MW9A 3WNZA 3C2QA 5JNUA 3LJKA 1R0RE 3Q12A 2WUWE 4B6OA 1H5QA 3H2YA 3Q15C 4G0MA 3ZNOA 3ESBA 4Z86A 3SHFA 1JI3A 2I0FA 3LOPA 3PFIA 1N5JA 1H4TA 3WDLA 2C2KA 4LW8A 2IOQA 1I7DA 5IT4A 1X7YB 2VKQA 4QQNA 3HE3A 2BFMA 3PGVA 4I19A 4RENA 3FYHA 1XKLA 2CK3A 3HXTA 3EGVA 3ILXA 4YHBA 5J63A 5KTMA 3DDHA 2J9XB 3FJ1A 2WF9A 1CEYA 1RADA 3EVEA 4N01A 1U2SA 4DILA 2X15A 2BGMA 4RULA 2HJVA 1S4MA 1D6SA 2W98A 2YYYA 5DLYA 3EIOA 2C54A 5KNDH 4RNCA 2HCRA 1SK9A 2N3ZA 1Y6RA 1M2FA 2W6CX 3WBKA 4RTNA 3WB9A 3VAYA 3RUHA 4F5DA 1E63A 1YE3A 1UM9B 3DL4A 5EXPA 1WMEA 3MWKA 3NP9A 1W5FA 1XCLA 4H59A 5CA1F 4U9UA 2DUMA 3ZQUA 2V54A 1Z0IA 3MS4A 5B37A 4BB6A 3LI2A 1G8PA 1XF9A 5E3IA 2QTVA 4EW3A 1GYPA 2B1GA 3HJHA 3NDBB 3P0IA 3K6KA 4DQVA 4US2R 1JU4A 2PL1A 4ZC1A 4JFAA 2VS1A 3OIDA 1TQ2A 1F0YA 2X1HA 3BRWD 4JR1A 1KDYA 1RWQA 3IR6A 3QI7A 1Y4AE 3A28A 4CCSA 3RC1A 2VTVA 1XPOA 1XLTA 4N5LA 1U1GA 3GROA 4ZKDA 4J7CA 1U0FA 1CS0A 3DE6X 1A5BB 1ONPA 3RADC 5ALJA 1COWD 1K8RA 1OC2A 4M86A 1M1XB 3IGFA 1FX0B 1P9LA 2PX6A 2BZGA 3MWGA 3ON5A 3DGFC 3O9MA 3LIIA 2L42A 4MRPA 4P80A 3EWAA 5GJWC 4R01A 1N8KA 2W6PA 1S7GA 1WUJS 1U3FA 4ZGGA 1R50A 1BMTA 4HT3B 3ESZA 4BJ6A 4L72A 4EFMA 3DPSA 2GXSA 2F3UA 1M1YA 1VMKA 4MR8B 4FW8A 5DF1A 1SMKA 1TCCA 3BSWA 1BWRA 1H2EA 1GZVA 4LY0A 2OV1A 1GU1A 1NWCA 2RGNC 5C31A 1E4OA 3C39A 2M32A 1KORA 3RC9A 1IY9A 2WFZA 2EDAA 2XQGA 1E9EA 1G19A 2VAPA 3SOPA 3B3FA 1PHPA 4IIBA 5JSFA 5C8VA 1XMVA 1FFYA 4LBYA 3I58A 4GFDA 4QDKA 3P96A 1NXSA 2VYVA 2FRDC 2FUEA 4QBGB 2HFJA 3NX4A 4ZHSA 3OQJA 1JDSA 5JARA 3CZQA 4PGMA 3KSBC 1QIHA 1QR2A 1IQPA 1DQSA 1KU0A 2R1TA 3AKCA 5EJGA 4MVJM 3I9V1 1TTHA 4MHOA 2Y66A 4TV8B 1U3UA 3RTAA 2J0UA 2QMYA 1OJ7A 2XRMA 2J5KA 3NT5A 1CZLA 3QOYA 4J1SA 1NUPA 2AA3A 1YUBA 4WWHA 4R2JA 4R31A 3ZD8A 4YLYA 4M54A 1QPBA 1Y4ZA 4I14A 2GKGA 2DTDA 3SEAA 5L3SB 5L95A 1MKYA 2G9UA 3TB4A 4ALNA 3K8YA 3NATA 4YCSA 2WWYA 3F49S 3IJRA 4HG2A 3QF7A 3IQIX 3JASB 4MVJD 4BE7B 5H02A 3SR0A 2ZATA 1RNLA 3NHPA 1BU5A 3FFBA 3HSSA 4CG0A 1YXMA 6REQB 1GILA 1E98A 3ROEA 3TAXA 3OT1B 3QLUC 4MVWA 1PLKA 3IMEA 3R3HA 3WHKA 3AONB 1GZ6A 4AP6A 2V3CC 5B3LA 2XE6A 3UAGA 4L3OA 2F1JA 4UFPA 1K8YB 4O3MA 2A5FA 1MC5A 1O5OA 2OVFA 4D99A 1TVMA 3EC1A 1R6BX 1ZK3A 4Z0HO 4AAYA 4ZT7A 1Q0SA 2AF4C 2XDYA 1D1QA 3I45A 1NW9B 4R2XA 5A71A 3ZE7A 4D0RA 4WOBA 1ODIA 3RTCA 3GZJA 2IU0A 4BC0A 5LZ2A 2NU9B 1ZR4A 2VK4A 3URMA 2RC5A 1Z12A 2FJPA 1IUOA 2ZTLA 3V4FA 4EITA 3GX1A 1GITA 1T4CB 3GAAA 4J91A 3RSHA 2K2QB 3LSTA 4UQLA 1FP7A 4MYDA 4WESB 1AC5A 4E51A 1FTGA 2AKEA 2VAWA 1HE5A 2HMWA 3FYTA 3K9QO 3KHTA 1T1RA 2FE1A 4IIJF 2YICA 1EWRA 1IB6A 2XDQA 1OAOC 3D2AA 1KYWA 2JK0A 4JJKA 3S6JA 4XAQA 4KE8A 4B5LA 1OAAA 2I4TA 3ASYA 3DMTA 4ZYYA 3TXXA 3W6OA 2P3SA 3L7OA 4HKTA 2WNHA 1Z35A 3P9CA 2CY0A 2VN8A 2WHPA 1IB0A 3OWHA 4FINA 1WF3A 4FUTA 4LZZA 4PLCA 5TV2A 3T8YA 2OAQ1 2IXTA 1W4LA 3DCJA 5BSVA 4NX2A 1E5DA 2YWGA 3WG9A 5BR4A 3TUZC 4G41A 1JHXA 1IU9A 1XI2A 3MT7A 1DG9A 3JQGA 4GLOA 1Q12A 2R5NA 5JIBA 2GGSA 3PGLA 1QH0A 1PFGA 2R62A 4HX9A 3F2IA 4P82A 5YASA 2XKKA 2AG0A 2Q6OA 1PQYA 1Z9BA 3QVSA 4MICA 1XDZA 2VH2A 5C5CA 2G07A 3IYLW 1J42A 2I6GA 1ID8A 1EJ6A 2ZWOA 2WE8A 2PZFA 4QG7A 4RIHA 4YRNA 3E6AA 3ND8A 3I9NA 3WFZA 3G8AA 1UXJA 2GZSA 1ODLA 2VK2A 4NS4A 1J06A 1A8HA 2VKTA 1ESNA 3OMWA 3B1VA 1NBOA 4N76A 2PD3A 3T5AA 1ZM2A 2HRCA 3A25A 3BM5A 3RVMA 3WGNA 3HXQA 1DTWA 3D8HA 4RY2A 1TC2A 5CRIA 4BTLA 1CTQA 5A1JA 1PVOA 3CPSA 5DNCA 1JKFA 5GONB 5AHKA 2B61A 4Y2VA 3L4KA 1K8QA 1G63A 2BFPA 5FA6A 5T5QA 1T8TA 3SYMA 4WN9B 3GP3A 5DKFA 1GQOA 1QPZA 4INJA 1ZVJA 2XKBA 3L3BA 4CODB 4YJDA 1W4RA 3B6IA 3GFTA 3DQZA 4RK7A 1QQAA 4NZOA 4DLNA 4JI5B 1B8PA 1Y37A 4EHDA 1SBCA 2EJCA 2C31A 2OV3A 4MWGA 1AXGA 2IK8A 2PL5A 1T3TA 3CO0S 4Q93A 5CBPA 3R9XB 3M6MD 5DHTA 3QZUA 5G41A 4BFUA 1NJFA 1PFVA 4BKUA 3THOA 4PINA 3S2SA 4EEZA 2POQX 3THSA 3B20A 1VE1A 5B1DA 3BCHA 3G5UA 1CUBA 4LK2A 4I99A 3S2UA 2OHOA 2QX9A 2Z2JA 5KVQA 1DCMA 4OF4A 3SHVA 2OCLA 1I5EA 1XCGB 2OKGA 3MMNA 1ADYA 4IHJA 3CRVA 1NN5A 3G9ZA 4P35A 2VUUA 1OOEA 4DV1B 3AM4A 4ZCQA 2OBYA 1DRVA 4QWWA 2AD5A 2V1UA 4J16C 3O9VA 1OAOA 3DLAA 4IOLA 2X0FA 4B9EA 4C0LA 3W1WA 2YHBA 1EFUA 1UK9A 4KSYA 1UBHS 3OA2A 5AJZA 3I2KA 3PPYA 3HP4A 3WFJA 1I3NA 2PEYA 3NYIA 1A7UA 4R2WA 1GRQA 3SFVA 1G3QA 4UUAA 5MF6A 1BVRA 4DRYA 3JAMA 2QRZA 1DLJA 4H7PA 1YC2A 1Z75A 1S1MA 1U9IC 1NAHA 3E61A 4G23A 1V7PC 4X7RA 1BXRA 5H1YA 3VDXA 1P9NA 1ZD8A 5AI6A 4KPUA 4XYEA 3ZWOA 2X1VA 3IQHX 3ZQ6A 4R83A 3TFOA 3ZWKA 1T2AA 3LDFA 4L6CA 4AM8A 1U4NA 2FN4A 1KEPA 3FCOA 4L8WB 4N1AA 3BWEA 4NECA 4B80A 1NW3A 3I9LA 5JO0A 5AR1A 3TIFA 3S2YA 1L5HB 3DTTA 5FO0A 1OVGA 2A8YA 3TPFA 3BZWA 3JAKB 1N2HA 4GPBA 1AUVA 5C8ZA 1GTRA 1UKVY 3I5AA 1ZR2A 5M7EA 2DQKA 1JEJA 1DIGA 1M8FA 1NI5A 4MGHA 1F14A 4KTVE 4G9GA 4N0MA 1O0BA 3C3PA 4XVUA 2I54A 3VZRA 3HMQA 2IUEA 1SKQA 1CEQA 2CF5A 4UEOA 3FDZA 4UW9A 4WKPA 4F3TA 4HGOA 4I2VA 4PAWA 5KX5A 4L4XA 1NUSA 5T4EA 1NF8A 1JT9A 5K3FA 2Z5LA 3CE6A 3NUQA 4PHHA 5EMHA 1L4NA 4FFDA 4JEUA 2DR3A 4BWYA 3ND6A 4MB6A 3B5JA 2XMRA 2R68A 1Z7GA 3G3EA 3H3JA 3VMFA 2RAPA 2WIFA 3L6OO 5EHZA 2HU8A 3GARA 3OLCX 3PC8A 4RKWA 1GTMA 3QW2A 4GUAA 1XLVA 3BK1A 4QVGA 1CUZA 4JB8A 1U9ZA 6AT1A 2HU7A 5DCWA 4N5MA 3FTCA 1OFUA 3TINA 4QTYA 2HSEA 1GZ7A 2HZBA 5FORA 1R3UA 1SCJA 2VZ8A 3WICA 1QRAA 3EUAA 2J3QA 3OEWA 4W7HA 1N7IA 2CDNA 4EI2A 3ZCXA 3T3DA 2A5YB 3NPMA 3E22B 4KV7A 4ZOCA 2Y77A 1OGIA 1WG8A 4YV7A 1RVDA 1V95A 4CEJB 3SMQA 1XELA 1Z73A 3TLMA 3WGQA 4RY9A 2JAPA 3H7AA 2AH5A 4XFJA 4A03A 4GH5A 1E7SA 5AI0A 3KL2A 2W6JA 2ZJ4A 2C88A 3FCAA 3GELA 3KR1A 3L06A 5E2IA 4ZVUA 3D4BA 3K70B 3LNCA 2WP8J 1VXRA 1WPXA 3OC6A 3JASA 3LRTA 2EP8A 1Z26A 2VF7A 2XUPA 3EFOA 3V7WA 5KBYA 2XD9A 3VR4D 3C15C 4DDMA 6REQA 3DE7X 2CVZA 5FOQA 2CLFB 1CK4A 4WFQA 2WYWA 3CWCA 4DM3A 4G8DA 3G5TA 1SR8A 5MFPA 2XCQA 3RU3A 3RAGA 4CF5A 1V96A 4ZI7B 2VDNB 4QECA 1ADGA 1FRNA 3KTFA 1R4AA 3FF1A 5D5QA 4QGAA 3NNSA 4WVLA 4FR0A 4DIDA 5BUQA 4CR6A 2O3RA 4E30A 3HS3A 1BMFA 2CJWA 1MG5A 1PL6A 2GN8A 2WHXA 4KRXA 5DLQC 4C05A 3ANTA 1DB3A 3MWEA 1ZH8A 4DJDC 2PKEA 4AJJA 1P1BA 5HE9A 4Q9NA 5U1PA 1RXCA 2A58A 1J24A 4F6RA 4WXPA 2UU9B 3EVDA 3PPWA 1EUZA 2HADA 1WBBA 3N28A 1CUVA 3O0TA 4C5AA 2ZR8A 3PF9A 4IZOA 5HF5A 3EVTA 1E3TA 1RZ3A 2RJ3A 2IBMA 2QPLA 2C3PA 2DLCX 3Q3IA 6ADHA 3CURA 1Z4QA 3L49A 1WQ3A 4M7OA 3VFDA 4GKJB 1W4BA 4UTOA 2LDBA 4ARAA 1P7ZA 3EQ6A 1LBTA 1PQ4A 1N1EA 1XO1A 3KPUA 4IWNA 4TTAA 2P78A 4U1RA 1E0KA 1KPHA 3RVJA 2I99A 4BO2A 1Y8QB 2CLCX 3KEQA 4UHCA 3TD2A 1O0SA 2DUNA 4ZJZA 4IGKA 1DIAA 1QU2A 1N3YA 3K30A 4R84A 4HWRA 4MJ3A 5FBHA 1VKHA 2J0VA 1O4WA 3FZYA 3FGNA 4J1NA 3TTYA 3FTPA 2D0DA 4MS3B 1X14A 5KOHB 1BXKA 1SO8A 1IPHA 4O4HB 3JARA 2QBYA 2GFIA 1LNSA 2BDUA 2B6NA 2BBWA 2XCLA 4PZYA 2JANA 4DQXA 3H2ZA 5BMVF 4IDBA 2Z3VA 3E58A 2BOVA 1N7HA 4YDRA 5AP9A 4G5RA 3QLTA 5I8ZA 4DUGA 4R7TA 2CL6X 5CJPA 1ONNA 5J59A 1SVKA 3GZ4A 1E0JA 4PCVA 3UG7A 3U7HB 5AJTA 4FMDF 3EGIA 1K5DA 1ZRSA 2QJOA 2REQB 3AF5A 4WFIA 5JCJD 4IQ8A 4O2BB 3JQCA 1E4EA 3I5UA 4L9WA 3KEOA 1JAYA 2P9QA 2GTIA 4UARA 3UKJA 2GVNA 4AF6A 3CVVA 2V0CA 1W44A 2RHRA 3EMBA 3WRYC 4IOMA 2FU5C 2ZLBA 4BQRA 1R4NB 5CB6A 1FJHA 2RHLA 4KO2S 4D45A 1ENZA 2W11A 4EVRA 4J07A 1OROA 1U9JA 1RSZA 3KQUA 3OM9A 1KI1A 2DPXA 3MLBA 4JNKA 4NDNE 4U02A 1OH7A 1FK8A 3TM5A 3EE6A 4H9GA 2WF8A 4C0BA 4RELA 2NZ2A 2JGMA 4DLSA 2QRMA 3CS3A 3CN7A 1C50A 2HSGA 2ZYVX 1EGHA 1UWCA 3IBGA 3IESA 2DSNA 1SA0B 4ZO8A 3UHJA 5CA0F 1JV2B 3JWJA 3CRNA 5IFLA 4Q9HA 4TXLA 1XA0A 1NR7A 1OI4A 1GA6A 1VYHA 1XRSB 2FG7C 5AO9A 3EZGA 1QB8A 3GHHA 4MVJP 1A1VA 1I1QB 5L6LB 4AO6A 5CNJA 3D81A 5CX1A 3ZOKA 1U99A 5EJ4A 4O2LA 2FSVC 4TX1A 4ZAVA 3C6KA 4IHKA 4NEHB 4F86A 3SZ3A 4CXMA 1EVQA 3T7DA 3QVUA 3RIYA 1VMAA 4D6PA 3KOWA 4D9NA 3JQ8B 1LEHA 2VR1A 4PBRA 1SOVA 2QVBA 4G07A 5DNDA 3KQKA 2PRSA 2OR3A 2HQ1A 1P91A 4Q3KA 2X5NA 2Y99A 4AZ3B 4BKQA 1CC1S 4H1WA 5I7EA 5K0GA 3KD2A 4GGPA 1RXSA 1T5DX 2Q07A 3GVHA 2A9OA 5KREA 1VRVA 3FDJA 3IQEA 3OT4A 2B21A 4EMSA 1D2RA 2QRKA 2P2GA 2JJ8A 5CFRA 1ONOA 4PICA 2FLVA 4C21A 1E62A 1KGSA 4RHEA 3E9EA 3UMJA 5TGZA 3HDQA 4NU0A 2YDYA 3E7XA 3WWDA 3IOCA 4FEAA 5E6SA 3VGPA 1QIKA 1V11B 2BJHA 4I5IA 1EWYA 4CDNA 4DLUA 1U11A 2WKWA 1HDRA 1SUBA 5A0FA 4I9NA 2CKMA 3UKOA 5U4XA 1ENOA 2O2JA 3IODA 2Q5QA 4RF5A 1OGYA 2PD6A 3MFYA 1NOKA 3IPXA 2O3JA 4P32A 4XCXA 4AY3A 1KZYC 4ZOQI 1Z8DA 3CPJB 1C14A 5G40A 4PY2A 1RC1A 221PA 2A4MA 2QQ5A 4YH1A 1I7QB 3LQYA 3WXMA 1COWA 3W2HA 4BXOA 1SD2A 4A92A 3H9GA 3D6NB 1QH8B 2FFBA 1PTJC 2OXCA 2WAOA 4L75A 3SDZA 3DKIA 3D6JA 2IIVA 4FHDA 2D7JA 2E89A 5FAKA 4TM8A 1HH4A 2RHWA 3IE0A 4MQBA 2C4WA 1MXHA 5FNZA 4RF4A 2IP1A 2BVNA 5D3ZA 1TUEA 2YMLA 1M2OB 3A32A 4LDRA 4PLWA 4PPYA 5DO9A 5DTJA 1O94D 3D2LA 4TMFA 1T9CA 3OPMA 3NM5A 4B40A 1UKAA 1OT3A 4IH1A 3KYBA 2PV0A 4HX2A 4NZ9A 4G4IA 3V9AA 3IHWA 4ECAA 2HPHA 4DDVA 3MCUA 3FKQA 3TE7A 4WNAB 5KYGA 1PI3A 2AN9A 3E2MA 2QORA 4J76A 2DLNA 4QU0A 5LZ4A 3RPEA 4KR6A 2JEZA 2ZQYA 4TTSA 1ND5A 1A50B 2X4LA 5IW8A 4DSUA 3IUSA 3N59A 3VO1A 1H6AA 4E31A 2QF7A 5DHSA 4BGVA 5IG2A 1Q77A 2C59A 3ITKA 2RCYA 1RLOA 4RA6A 2O8CB 3PUXA 5FOVA 4R2MA 2FV8A 2YFHA 5C32A 4F4JA 1QU3A 2FA9A 2QTRA 3TQOA 1VIVA 2BW0A 2H1CA 2ZRLA 2E3JA 4EG8A 4CM9D 2R8ZA 3LGXA 1O5TA 3PS9A 5C37A 1S9DA 2I66A 2D2VA 1A7JA 4MPDA 1JA0A 1UCFA 1ZK2A 2IQ5A 3QTTA 1J25A 2H51A 3GGOA 2EL9A 3IKMB 2R8BA 4F6LA 1PNRA 4S1WA 2X8JB 1A2QA 4GI3A 1V5FA 4BAUA 1BHJA 2QLBA 5IU6A 5ESXA 5HG0A 1JNYA 1RWNA 4IFBA 4A23A 2PUJA 3LWZA 1N6IA 1ZINA 4IQ0A 4KXYA 3E4DA 2WKQA 4X6YA 4X90A 2Q1XA 4I9UA 1P9WA 2DBRA 5CGZA 3SHOA 4A0QA 4C07A 2H92A 4ZI7A 4LZOA 3CLRC 1EDEA 1LBIA 4Q7MB 3M2PA 3VH2A 3EUFA 2B5VA 2XUQA 3B8HA 1CZUA 1D5WA 1VKOA 4NG4A 4F3RA 3F71A 3JVIA 1SUPA 4EFNA 3RJZA 2MDTA 3QENA 4ZJYA 3CNOA 2VSFA 2JAHA 2R7LA 1Z5WA 4BJHB 1IHUA 2ZBRA 5BWLA 3EPHA 1J7KA 1TK2A 1OLXB 1JQDA 1OYVA 4P84A 3HB0A 2PV7A 2ZYSA 5IPFA 2G72A 2P4EA 2QE7A 4GX5A 1KZ6A 1E61A 5T4BA 4UREA 3TDKA 1DFIA 5EJIA 3SJ7A 4AMBA 1U7UA 4HXEB 3WA7A 5G02A 5BPFA 5HRAA 1U6IA 1FOEB 1P4GA 4IUDS 5CVVA 4M37A 4OM7A 3ZCSA 1LK7A 3KOYA 3E7PA 3NXSA 1L4FA 1H9BA 3DZCA 4CMAA 1Q1QA 3QH4A 3EGXA 3OLVA 1H2AS 3GLRA 1P2UA 4DEYA 1U7HA 2IQIA 1KRHA 3C6XA 4O33A 4UUNA 2X42A 5FFFA 3CUEF 2I7DA 4LFCB 4EYSA 1J5EB 4LIPD 3OZDA 3CUVA 3U4GA 1FMFA 2J9GA 4R51A 4OSEA 4R6XA 5DGHA 2F4VB 4DAOA 1W2HA 5BWBA 3EDRA 4QO7A 5KOHA 1QHXA 4YMSA 2DQZA 3J81k 4MYRA 1D2EA 2FUG6 1DJQA 1MAHA 2GEVA 2FXVA 3AIMA 3JQDA 3OWXA 1UMBA 1XTBA 3MMZA 3QU2A 3KJFA 2V65A 4X91A 4YNBA 3LH5A 4LOJA 1CIJA 2ODPA 3H2BA 1DNPA 1N0HA 1I13A 4NYMQ 4KWIA 1W0KA 1SUDA 4I66A 4FYWA 4JBLA 1EM8B 8OHMA 5JAUA 3EXG1 3G68A 4KHZA 4AKIA 2C1XA 3C1OA 3M3HA 4UNRA 3OURA 5BV7A 4RHFA 2PWPA 3ORYA 4G0OA 1N0IA 1PJ2A 1ZIDA 3LYUA 1K7XB 1XL0A 3GEEA 2E55A 2NSJA 3CX6A 4N5IX 4JYAB 3MGKA 2WG0A 3K1JA 3TEJA 2RH9B 4L2IA 3T9EA 4HN9A 3I30X 2GZMA 5IDWA 1UJBA 3OPYA 3ETDA 3G9XA 3MEQA 5I4KA 1GQ2A 4YJGA 1CJMA 3T7IA 4ZOLF 4S1TA 3RU2A 3KPWA 5KYYB 4L8VA 1V48A 2Z5GA 3WLEA 4KXWA 3JWPA 4IRXA 4LYJA 4ANFA 4ZHQA 5K0EA 4YP5A 4IXTA 5IWAB 5DCUA 1PTKA 3LCCA 1JLLB 3SEFA 3UXHA 1FYXA 2CDAA 2MSNA 3NOVA 4B3TB 1M0SA 1J33A 1VE6A 1B6TA 3AY7A 4B6FA 1WDLA 2W90A 2CD9A 4F1JA 1HT1E 2JCGA 2VCHA 4Z53A 2AC7A 3C3CA 3QG1A 4JLBA 2PMBA 1PJZA 5TARA 1YACA 3DBHA 4MS1B 3G2NA 4KIUA 3JWIA 3JQ8A 4XD7D 3DNMA 4OHWA 1QP4A 5AVJA 3HDGA 2VYNA 3C5WP 3THWA 1YHZA 2OWEA 2AT1A 5JWRA 4DQLA 3I2YX 4JAVC 2C8KA 3NP7A 4I4TA 1I7NA 4XWWA 4RHCA 1R0CA 4JB0A 3DV9A 4U7TB 4GUDA 3WOHA 3EDCA 4ERXA 2HF9A 2X2PA 1C7ZA 4H0FA 2NVOA 2C9CA 3FVWA 3PCTA 1IUKA 1JVNA 2LPMA 3BSYA 4LNHA 1C7RA 2WTMA 3ODGA 4FDAA 5E6SB 4L0CA 1RWKA 3HJRA 5JAOA 5LBUA 4ZDWA 2R48A 3BIXA 1S3GA 3DCYA 4OJNA 3DHNA 3BMQB 1MA3A 1L8LA 3KT8A 3DEZA 4WCFA 5EKXA 3T1VA 3KZNA 4CI9A 5CB4B 5CDYA 1CZKA 1M7HA 2C4MA 4MV9A 4GOKA 3WYDA 2J3DA 1X92A 1XEXA 4YT8A 2H5EA 4RVHA 2EWVA 2OT3B 4M99A 4TPKA 2AE1A 5H0IA 4ZEWA 3S7TA 1JG2A 2X2OA 3NV9A 3LHDA 1I2CA 2ZI4A 1X8JA 5EVJA 3VISA 4AG3A 4BVGA 1Z0ZA 1ARZA 2HNBA 4AK9A 4W6QA 1H2YA 5ALTA 2PIDA 2RH4A 1QXSA 2BJVA 5TRTA 1QCCA 2AR7A 2ZU6A 3DMDA 4HH3C 3EXG2 4YPFA 1YVEI 3ER6A 4PQYA 5EQFA 1I3OA 1JDVA 3C41J 3TLGB 3OMLA 4BO9A 5KJEA 5KYXB 3ZDCA 1M2OA 4BNKA 1BX0A 3RWBA 2RGWA 2XX3A 3TM4A 2YDXA 4GMFA 1UXGA 3K32A 1SULA 1B8UA 1GQFA 1Y9AA 2Z3ZA 2PH5A 2INGX 4BGIA 3ZWDA 2FR8C 2GZAA 2J3KA 2H18A 3FVVA 5EHXA 3AB7A 2Q3BA 1DPFA 1V35A 3D6TB 3PLNA 1XEWX 4WH0A 3VYRB 5AI5A 3OC0A 3BWMA 4YN3A 2G25A 3UN1A 1DJOA 2PTGA 1Z83A 2QMEA 4LBVA 4C4SA 3JWEA 4D4HA 4XTRA 1R0XA 2DWCA 3I05A 4PLPA 1EHIA 1MV8A 1UBTS 4KK3A 4BKPA 4XKJA 3WZLA 3ZWWA 2DFKB 5CVDA 5HDBB 2V7QA 3VYUB 1POXA 3EGOA 2B99A 1PDVA 3AI7A 4A6PA 4DPMA 4C78A 4RA6B 1GUBA 4CV2A 3ORQA 1EFPB 4V1CA 2C5HA 4KC0A 4PYMA 4ZC8A 4EENA 5LOVA 3NIDB 2JFNA 2NXWA 2QRGA 3KYCA 3CNBA 4P98A 5I4CA 1VSUA 1BDIA 4RZUA 2XQJA 3LBFA 5AIAA 1T9ZA 1FPQA 4D9MA 1QCYA 3GK3A 4JITA 1I5RA 4KUGA 5JI3E 1BXZA 3OF3A 4RABA 2V0GA 3IAM1 5EQJB 1AGPA 4YWJA 2EJWA 2QGZA 3HVKA 4Z9XA 4A2QA 3KVVA 1W85A 2FRVA 2W6MA 1GL9B 4ZAYA 2C83A 2WD9A 3D2CA 1XMPA 4MWSA 4NYJR 2C4KA 3N2LA 3ZX5A 4DJEC 1G2PA 2QD4A 4QYXA 1UBLS 3FMPB 1BJKA 4FFMA 1VECA 2VJMA 3C7CB 4QXQA 1E60A 4E88A 4OL0A 2G5GX 4WZAE 1X87A 5G0SA 1W4ZA 4MUGA 5P21A 1BE6A 2A78A 2J9RA 1YE5A 1M2HA 3WGLA 4L5IA 1VGQA 2H06A 4J7XA 2PAAA 5SZHB 4DLLA 1KJQA 1N2BA 3LE8A 1CBUA 1II0A 2FWJA 1MAAA 1G21A 1NXWA 2EKQA 4FJ1A 1YVRA 4H3SA 2X9VA 4JMPA 4XDGA 2HA4A 4RC9A 4FXPA 2C61A 1G42A 2X14A 1X42A 5THXA 4DDWA 4JI0B 3DWGA 4ZMRA 4JP8A 4YMGA 2ACKA 4PCUA 1AV6A 2QMQA 3MQFA 1Q95A 4CN8A 3JV7A 4ZOLA 1GCOA 2JA2A 1L5RA 1J8FA 2W83A 4QYIB 1JQLB 2IWRA 2CDBA 1H3NA 3V6LA 1KKUA 4YO7A 5J47A 4JVMA 4LNUA 2B8EA 4MUNA 4CTKA 4R2LA 4PPGA 4C4ZA 3PSAA 2AW5A 1W87A 3K1ZA 4LE0A 5F3DA 4KN8A 5CFLA 3VKHA 1ACJA 4TS9A 2P6UA 4U5XA 3UJ6A 1MZVA 4KQFA 1YZ3A 3RARA 3AM5A 2V58A 3MHTA 1P45A 2WSBA 4FCTA 5IDXA 1P80A 3RAJA 1HL7A 5HQTA 4ZP1A 3WLAA 5KYTA 3DOOA 3H5RA 3BBLA 4TSFA 3COJA 3GEBA 3KJGA 2XB9A 1H5UA 2ZVDA 4KBFA 1TOAA 3LT4A 5EJ6A 1EK6A 1E9FA 4E1VA 1AY0A 4H7JA 3N0VA 4CM5A 1A04A 3FHTA 1M6VA 3RBVA 3S2IA 4PGHA 3O4RA 1D8TA 2HU5A 2W93A 1L7PA 2IJGX 2RHOA 1F3LA 2Q1YA 5IDQA 5D1HA 2XTMA 1ECBA 2GJAA 4KSCA 2BFBA 4QPZA 5EIWA 3ROMA 2ZCJA 3QBTA 2GD1O 5DZSA 1XC7A 3JQ7B 4TZTA 4O4LA 3K3PA 3ZN2A 2G0NA 3MTAA 4DUPA 1RU3A 2GBIA 1P72A 2Q5IA 3RRMA 3E8MA 1VJ1A 3I1JA 5IDVA 4D0LB 2CCKA 1G59A 3SQXA 4IEIA 4FKZA 1MB4A 2IGTA 3ZZ0A 2DP4E 3R3UA 3TVYA 3X2FA 4KITB 4S04A 1KZGB 5AVOA 3FOCA 1W8IA 3TG2A 5IC5A 1IC6A 4KQHA 4E5NA 1QMPA 5BYAA 3P1JA 1RI3A 6Q21A 5K2OA 4NESA 2LRHA 4HGPA 4OXNA 2P11A 1Z88A 4TMKA 4V0QA 3ZCRA 4LCBA 3FZQA 5DEIA 3OY7A 3PLRA 3DP9A 1B42A 3NC4A 2VUTA 4Q21A 1BNCA 1QIGA 2IU4A 4H1HA 4PN7A 5J2TB 1L5OA 2D3TA 4XWGA 3W3AD 2HPZA 3G02A 3JX9A 4HDQB 4RPHA 3IHTA 2JFQA 3IDOA 2PO7A 2XGGA 4FS3A 2XQFA 1VM6A 5EP3A 5H7XA 3RS3A 1UXIA 1W5EA 5JH7A 5MN6A 3CF4G 4D4GA 4CEIA 3NHLA 2B5WA 5AJUA 1LS1A 1PEAA 1E1CB 4O63O 5CCEA 3D3JA 4K9LA 1MA0A 3R2JA 4M9UA 3AUXA 4WLUA 5F4BA 1O6ZA 2V0NA 3EZ9A 3MUNA 3WK8A 4B3BA 2C7GA 2H7YA 4D46A 2XD4A 2IE8A 3GGDA 4PHTA 3N6RA 1M8GA 4JDPA 3QIAA 5JNSA 1M2EA 2J30A 2QSZA 2VF4X 3EZLA 1VHDA 1SCIA 2DF8A 4NLLA 3DBRB 3H11A 4L16A 3CA8A 4GQBA 1DG3A 2QTCA 3H86A 4ZV7A 3GP5A 4QYTA 4C7OA 3WGGA 3ZGYA 3ZVNA 3T5PA 3L9WA 5CAEB 5F9HA 1Y7TA 1SZDA 1OHHA 4P5DA 4DBLC 2FW7A 3WMEA 1GUDA 1UBFA 1BQEA 1MO2A 2WJVA 4E2WA 1K8ZB 1XWIA 3QFTA 4A91A 3CXUA 4EL0A 1IUNA 2IPXA 3KKZA 4TV9A 4UBKA 4BWVA 3EBOA 4E21A 1UAAA 1NQAO 1OYWA 4OGKA 2BBSA 4AT1A 2XWJI 1Z22A 4Y2TA 3BD6A 5BRNA 4BVAA 1VE7A 3UH1A 4OGGA 3RSLA 3F3YA 3DZGA 3K0CA 9GPBA 1NJ1A 4JI7B 1TF5A 1ZZEA 1J56A 1GO2A 1I80A 1JA9A 2J6BA 4RW0A 5C1OA 3AHCA 1CRQA 1PJSA 4HMOA 3ACDA 3FCSB 1XXHB 1XZEA 1D0SA 1LSJA 5M34A 1E2UA 5J4LA 4CVNA 2Q3FA 1W6RA 1XQXA 3HB7A 4TMWA 2IH5A 4BPBA 2NPIA 2VATA 2VF8A 3WADA 3GMTA 2QM8A 2BF4A 3HJNA 4PZ0A 4MEAA 4B3IA 1DO8A 1U98A 1U7TA 4BFVA 3INNA 4GRIA 2DM6A 2Y05A 4B32A 2X8WA 3K9WA 1HKHA 1Z08A 2HRDA 3KTDA 4HAIA 1MNQA 1Y9EA 5BN4A 1UDBA 3JVVA 4EYKA 3SFZA 2PRIA 3I04M 3R6LA 4Q7QA 4K9PA 4E4TA 5LOVB 4CKBB 8ATCA 2FTKE 3K0AB 2GO7A 4M1MA 4II7A 1Y7LA 3A11A 1E5LA 3FWKA 1OCEA 4TTRA 1T3HA 5JSYA 3OHMA 3GLGE 3RS8A 4GBGA 4U6QA 3K31A 1YDMA 5FWYB 5IT5A 1GPAA 4DRZA 3F90A 2C1EA 2HR1A 2QGNA 3MB8A 3WGUA 1SKMA 1C3JA 2XKAA 2VP4A 3LCVB 4K6FA 3EDYA 2HT6A 1NX9A 1US8B 4YFVA 1G41A 1FDSA 2O3QA 1N2EA 1NJ8A 1NM5C 1WNFA 3OUTA 5D84A 5K8VA 4BZQA 2UYHA 3N6VA 5B58T 3EDMA 4BDSA 2IZ0A 4S35A 3BZUA 3PP8A 4FEEA 1XRPA 4UHBA 4YCJA 4FJ2A 3LLSA 4KAJA 5KJFA 4D97A 5KWIA 1AHIA 1NF3A 1CJCA 4YROA 4AQYB 2B3DA 1E4YA 3AJEA 5LQUA 1DKQA 1OBVA 1SAYA 3ZS8A 4AWXA 3W5AA 1CR0A 2WJZB 4NXNB 3DM5A 3CUUA 4JJIA 2NZXA 1KOLA 1IJFA 2FLWA 1AK1A 3L7IA 2D1FA 4FN5A 4H1TA 4KWHA 3L82B 1APBA 4URUR 2BP7A 2VTBB 4RK0A 4NULA 3T1TA 2QV0A 1T8RA 2ZJ2A 3GPIA 4LTMA 3F6SA 5ICMA 2IKQA 1NU8A 3X1YA 1PGPA 4REQA 4WNCA 1X3SA 3ZHTA 4KVGA 1XFAA 3IPYA 4BQQA 1PJ3A 1UDCA 4PYKA 3FPFA 4QFMA 4UATA 1GPYA 1ZP6A 1X39A 4G8BA 2NUTB 5LYJB 1KYIA 3IIKA 1BFKA 2YWEA 1X1CA 3ZV6A 1CIPA 1NTRA 4MZXA 4QRDA 4LGYA 4F4FA 3EPRA 2CXXA 2Q1WA 2HGZA 3HCPA 4P33A 4RKYA 4ENUA 3THYB 3G0BA 4RF2A 5JJLA 2VJLA 2YHSA 3KJZA 3OMXA 2WTBA 3L0OA 4N18A 4BDTA 4DM7A 2XVZA 4FWTA 5AYVA 4OQFA 3EUWA 1L7BA 3IMFA 5EXXA 4RJLA 1EJ0A 2Q4EA 3DTVD 5BNFA 1J8YF 4EY8A 1MU0A 4UCQA 3G8YA 5LD2B 2HF7A 2HK7A 4YDHB 4B48A 3GN1A 3A6KA 3ZV7A 4CPDA 1XCBA 4KG7A 4PRZA 2I7VA 3AUUA 5AI4A 4PLTA 4EPXA 5EE9A 2OBNA 3Q8KA 4GPTA 1QK4A 3U56A 4U7GA 2VWPA 2DB3A 4OLFA 2CV1A 4ZVRA 3DT6A 1NI3A 3DMFA 1D4ZA 1BA2A 3U40A 1QF9A 3CN9A 1TLLA 3LL7A 4OAPA 1E9SA 4WRRA 4NZNA 3RFCA 2GLUA 1JR2A 4RZHA 3TTUA 4C4YA 1FSSA 4X1IB 5FKJA 4H7FA 2BSXA 1XEAA 4LYHA 3UCEA 3WL8A 1AGXA 2E1PA 4CMGA 3LUHA 1GCIA 1HLGA 1YA8A 3DGEC 5LDGA 3CX4A 2A9FA 2R00A 5IWCA 4OHPA 1A88A 1JB1A 3ZW8A 4UVDA 3NAMA 5LB4A 3KSZO 1TMKA 1X77A 1JA1A 1JJIA 1U0GA 3BMNA 3FNQA 1L8QA 3CJTA 1W35A 1HA3A 1NIJA 2PMDA 3CLTD 3HEBA 2NVWA 4AZWA 2QU8A 4MZDA 1DIHA 1XQVA 1T43A 1AKUA 3KKKA 2OCPA 4HN2A 1IXKA 1GSHA 3A1EA 1CDZA 2Z1DA 4I4IA 3EA0A 1A9PA 1ODSA 2NTNA 2ZAOA 1U65A 1FTSA 1TJYA 2VT7A 1K0UA 1AUXA 3AX6A 4X3OA 3LHKA 3NALA 3RVLA 1YFJA 1HYHA 3P2KA 1ZH4A 4V24A 1UP7A 3G0OA 3IA2A 2YINC 2IIBA 1Z6GA 2YBDA 2GNAA 3H2IA 3AHDA 3JYQA 3KB2A 3OQ6A 3B1ZA 1PV1A 3DW3X 4CUZA 3FYUC 4JV5B 1H3FA 2F6RA 2XT6A 1SC4A 1M2GA 1OLOA 2O54A 3O8LA 4QAJA 3HR8A 2GEDA 3WKCA 1ODJA 3U7FB 1TK9A 4KIFA 1U8FO 2OCAA 1OPRA 3OJFA 3SLKA 3NHRA 4QGSA 2ZETA 3HY6A 3IHLA 1E1CA 4YXWD 4Y7CA 3LX4A 1BRTA 3HN7A 3LKBA 1C7JA 3PPIA 4TUYF 4BNGA 4DARA 1ZONA 2CFRA 3R5SA 1DKLA 4HMPA 3TZCA 2JLWA 3FWPA 3UJAA 2WJGA 2QOEA 3GEIA 1X80A 3AKZA 4H08A 1RQ7A 2HMUA 1Z0FA 4HATA 1UBEA 2W4MA 5DN6A 4QU8A 5JJKA 2VHCA 2XGMA 3ZY6A 1TMOA 3OZFA 2IOFK 4WMLA 4EW1A 4Z7QB 5JBIA 4B2PA 1U3WA 4AJEA 2OAEA 5F1OA 3GJ6A 4BQFA 1GRNA 1D03A 2PYZA 4U7PB 5K09A 1E3EA 3U44B 1NRJB 3D4IA 3PUYA 1BOFA 3GH1A 1CQXA 1K63A 1RTTA 3DE2X 1C9KA 2BEVB 4G1MB 2V3VA 3IV7A 1MOPA 4LWQA 2PSFA 2VNJA 1GNTA 1NURA 2NZUG 4IV8A 1A5TA 4GM4A 4OLJA 3ONDA 1ACMA 2Y2VA 5HRUA 4DKXA 1Q3TA 3E18A 4L85A 1D8AA 3H5TA 1D6MA 1EIWA 3DE5X 1E58A 3MCWA 4CCWA 1A5SB 1LPOA 1S7CA 1UBCA 4Q00A 3FF4A 3USCS 1QQ7A 1ZIOA 2Q21A 4P9NA 1XVAA 1Y7PA 2HA5A 3T0FA 4GKKB 2H31A 3IAM6 3RASA 4XLLA 2BFNA 3WSVA 4EJ0A 1SQ5A 1UJ5A 4F46A 2XMSA 2Q9BA 2ZRMA 3AG5A 1L4LA 1ETUA 1W30A 3ETHA 4G0XA 4WKBA 5D00A 1ENPA 1UMDB 1R8YA 4UEKA 1O2DA 3VDQA 1NKTA 1EVZA 4PLFA 3L2OB 3O4JA 4QJ3A 5BY2A 1G8HA 2H16A 3IMGA 3KKQA 1N92A 3OWOA 3PJFA 3UAVA 4YX9A 1A8QA 1GU7A 4TRMA 1YOBA 2PBLA 1DBSA 1MVLA 3I12A 4NNJA 1QIFA 2PX5A 3ONVA 3WLNA 2I9PA 1XZIA 2ZRGA 1YIOA 3ADDA 4G4SP 2CZGA 1V7CA 5JWHA 1PZHA 4CF7A 1W0JA 1Z29A 4LY3A 4HPXB 2FFHA 2FNAA 2H1HA 1JIVA 4XGNA 1OILA 5TC4A 3UXMA 1ZVKA 3HP7A 2XTJA 3A27A 4MQMA 3AKYA 1TM1E 3K0SA 3L0DA 3C6YA 1SZPA 1Z0AA 4AIIA 5FI3A 2CFIA 5IBQA 5E38A 1PP4A 3NV7A 3TAHA 1PFWA 1EHCA 2GEKA 4XA8A 3GLIA 3RIHA 4N7MA 4K86A 6ABPA 1KQOA 1DJMA 4POOA 2XSZD 2FMXA 2EVWX 3WNDA 3FWYA 3WMRA 3AL0C 3IR7A 4K6GA 2VTDA 3QVLA 1JTVA 3IQDB 2C4UA 4AZ0A 2CXSA 2UZ0A 3HKDA 3Q0IA 4XDHA 4WOKA 4ZHQF 4ZICA 2PM8A 1D4AA 5J2TF 2XEDA 4Y1FA 4ZEXA 4YRPA 1IULA 2ANBA 1K6IA 1MFZA 5DHAA 3AK4A 4IIJB 2YZGA 1IWOA 3FZNA 1JHQA 1Z2OX 3N0XA 1A4RA 2YW9A 4GYYA 4JFRA 4P54A 5DYIA 2C9ZA 3KCNA 4K9QA 2ZB2A 2AOUB 2CLDX 3HBNA 2NT4A 4QEDA 5ES3A 4MQFA 2FX5A 2OUIA 3JWHA 3PEWA 3ZH9B 5AK6A 3D1JA 4NCXA 3JYNA 3CZRA 2NUTA 3I1YA 4R40A 1JHMA 1JIXA 3V1NA 5KQGA 4ZCMA 2IBSA 2GZ1A 3NTXA 3DT8A 1LPNA 3AB3A 4DV2B 5KVAA 3VDMA 3GF4A 4LC9A 1CE8B 2Y71A 4DGQA 2E4YA 1F1JA 4V3BA 4MPTA 5SZIA 3R4CA 4RV9A 4WIAA 2ZUWA 4EKIA 4ZMBA 4RTQA 2R3SA 2HJSA 4RCZA 2NPFA 1ZLYA 1XRLA 4MHSA 2XLCA 4AUMA 4BCDA 4NMHA 3UMBA 3PC2A 4K8RB 1XMSA 1SU4A 4PSVA 3M4JA 4RGYA 3ZV5A 1T0UA 3LPCA 3CCCA 4YMVA 4JKIA 5K8CA 3IP1A 1TIPA 2EJVA 4J16A 4C1NA 3WTBA 1IAVA 2JGLA 1BE0A 1JSRA 2B1IA 2FW8A 2QROA 4E5PA 3WAJA 3TBKA 3PNLA 1C4XA 4TSRA 1SBNE 1PX2A 1OH6A 3I52A 2BEWB 3AL2A 1FTYA 3HFJA 3QIVA 4EHFA 4ND6A 3DMHA 5FLYA 2I6XA 3DEIA 4LISA 3HV2A 4FN4A 3JYHA 3F0TA 3FAKA 1JX6A 3KVYA 3L4BC 1RWPA 1EP2B 2BEUB 4BO3A 1L4UA 3H84A 3CLUC 1NVEA 3UPDA 5C1BA 4ZZ0A 4EM6A 2AYYA 3LPNA 3KIPA 1Q6ZA 1NR5A 1PEDA 2A1UB 1QAMA 3M6UA 4EB3A 3W0LB 2FSGA 3IVAA 4R98A 4DIEA 2YFQA 2QP9X 1RC0A 4AWAA 5L3VA 3BMNB 1N5MA 2AOTB 4F3YA 1WXQA 1LTKA 3IEKA 5CH3A 5BN1A 5TEWA 2O7SA 2WV7A 2XIQA 4E1AA 2ANCA 3IPAA 3UUFA 3O74A 3ZVRA 2CUNA 1WB6A 2GPAA 3GWZA 4B4UA 2E48A 3NJ4A 3A3YA 3UUGA 1RZRD 5DN6D 3ZV3A 4JD5A 5ITWA 3CO5A 2AFIA 5CW1A 1DUSA 4H27A 4RANA 1N8TA 1YH3A 2ZAMA 3RS2A 3VAAA 5ABPA 2VO1A 4EGAA 1SB8A 2X41A 2PR2A 3E8SA 4AVYA 2WWIA 3KJIA 4KQ9A 3RSZA 1ZGHA 4EY7A 4X0EA 3CC8A 1JDPA 1QO0D 2JH3A 3BICA 3DPIA 5ESDA 3WMWA 4FHFA 1XNQB 2P9FA 2QTWB 2HDOA 3N8NA 3DBLA 5HGJA 4JHLA 1WVGA 3LPAA 4LVUA 3U4AA 2WTAA 2OZLA 2V7XA 2UAGA 1M54A 4H1UA 3RG2A 1OTXA 3QUQA 2P91A 4FGLA 1P60A 4JT9A 1IY2A 4MXDA 4EHIA 2R6GA 3AP2A 3ZNNA 1C1HA 4ENRA 2ZFUA 3H5WA 1Q0PA 4R1QA 4B3CA 1Z2DA 5LL6P 2Q1SA 5ALSA 1VG1A 2I4RA 2J4CA 4HS4A 1C0KA 1M7BA 4I5FA 2J5XA 5EZYB 4B0OA 5LFAA 3C5VA 2QYOA 3H4IA 1TQHA 3FM9A 4DHEA 5IT0A 1GPBA 1URPA 1DO0A 1WB5A 5A05A 3TL6A 5CNKA 4L76A 4ND8A 5FXMA 2C82A 2YYSA 3W5DA 3GVPA 4R3UC 3QPCA 1DUIA 2WT9A 5JAZA 3RSGA 2XTNA 2FOXA 2PGOA 3TGLA 3EQZA 5HMLA 4DSZA 2ZCUA 3B89A 4H35A 1ZYUA 4ID9A 4KGZA 5BOSA 5DGTA 5BSFA 3LBYA 5D8DA 3L7KA 4JXKA 4BECA 2FW6A 4MS4A 2BEVA 5J5VA 2GM3A 4N7RA 2GCGA 4LRTB 2FFAA 5AVVA 2W71A 4EPTA 4D82A 1HURA 3C43A 3MCAA 3MJHA 2HIHA 4R8LA 4X64B 4MO9A 4YJ2A 5EE0A 3L8HA 1FU4A 2NUPA 3IOEA 4AY6A 1V37A 3HKEB 2CLKB 4TLCA 3V48A 3WS7A 1WAMA 4H6XA 4RHYA 3VSAA 1J2RA 3EIXA 4GE0A 3RJTA 4EFLA 2IHKA 4B4DA 3T5MA 1GUFA 2HMVA 4BEBA 1WDKA 3LY9A 1WUHS 3NO4A 5DBIA 4YI5A 2HSDA 5EMNA 4GWGA 2DXIA 1VC2A 4YVFA 3HEMA 4GG1A 4ITVA 2PT5A 5FR2A 2HUPA 2XUIA 3Q1LA 2H1SA 2QLMA 1UMDA 4LZNA 3KOMA 2XMCA 3SE0A 4ARBA 1G5RA 1RBYA 2WVHA 1Q11A 2BFEA 1W73A 1ZIPA 2JGKA 3CGWA 2OG2A 3L8FA 3VMMA 5C8XA 3D8NA 3PGJA 2B4KA 3PQ5A 5JG7A 5ESRA 2ZSJA 2QAGB 1Z28A 3C98A 5C0OE 3TNDA 3V42A 3WB1A 4QXMA 4C6TB 4AICA 5IMSA 1IBKB 1HRKA 1TLFA 1TA4A 3OJCA 3V4SA 1TMYA 3I6QA 4QU5A 3U9LA 1VYVA 1USKA 2W2TA 2ZRPA 2LTAA 1ZA2A 1G2OA 2VHVA 3GQVA 2DR0A 3MSCA 2EC5A 3VOAA 2YYZA 3K4PA 3MRVA 4ZZIA 2VSYA 4UEWA 2F4NA 3U39A 2FFRA 2XGOA 2ZAYA 2O7VA 1Z82A 3KBBA 3GPLA 1RFLA 2AV6A 5K0NA 3FTEA 1MH1A 2C2BA 1I32A 1KEKA 2O2IA 3INTA 4K26A 5CITA 2ZBVA 3FOBA 1N5IA 4FQ5A 3S55A 3OLYA 1J0BA 3LM8A 2XNHA 3ZVMA 3U3JA 3X1XA 4KKVA 3OLQA 3DUFB 3HBAA 2XB2A 1PJ4A 2HC9A 4QOFA 3WL4A 2ZUDA 1D6JA 2LDXA 4RD6A 7YASA 5DBEX 5KNBH 1TIBA 2QP4A 3C16C 3L05A 1CVIA 1N5KA 4KQ1A 2O3UA 1E0DA 1REQA 2RGGA 4QUAA 1G8MA 3H4MA 2R5FA 2A84A 1QAQA 2VK1A 5C7LO 1DADA 3NEJA 3AEXA 2BONA 5HEKA 2WFLA 4HHEA 3MGCA 1SN7A 4BATA 4QAQA 2FZLA 3BTSA 5JI2E 1TU0A 2HNKA 2YJ3A 2Q2OA 1ZUNB 1SKBA 5B1YA 5DSXA 3ETNA 1AO0A 1YDHA 1XLTC 3DH0A 4TV8A 3UC9A 2OC9A 3K1AB 5ICCA 2FUNB 5CU7A 3K70D 4IH9A 1E7MA 1Z0KA 5INTA 4BBJA 4UTVA 1XZJA 2RKWA 3GLVA 1DMSA 1U7PA 1WUKS 1F8GA 3ZTTA 3GJ7A 2RAVA 1GRCA 4EJMA 2A35A 2P4QA 3D8BA 4N6NA 4DLKA 1XA3A 3M4ZA 1DWUA 1Z47A 3U61B 3I28A 4CL0A 3UM9A 3BXPA 2Z04A 3I01A 2J09A 2I6TA 2KJQA 3L46A 4NYJQ 4ROTA 3ECSA 3ZTWA 4CLXA 3B6JA 1IUPA 1TGYA 1DKUA 2IZZA 3IH5A 3QNWA 2DT5A 2IELA 3LRXA 4PZZA 1DHTA 4L5JA 5KNBD 4ZZ1A 1FXSA 4ZTBA 4FFOA 4NR0A 4WUTA 5ULLA 3BXXA 2JIPA 3QYAA 5ECDA 4FEGA 4BP3A 2PH3A 4DA0A 4NEQA 1VB5A 3B9QA 3PIIA 4BQEA 3ZEAA 3DVRX 3R9IA 2XNDA 4LRQA 2W6ID 2IDMA 1P2GA 1QTRA 1OV6A 2O2SA 4GI5A 4WDRA 2WINI 3VU9B 1E92A 4BWGA 3UWSA 2QT9A 3OG9A 2XMPA 3U80A 5EMJA 4AIRA 1U0JA 4XFDA 1OAKA 1YSCA 3UT5B 4OCZA 2B2XA 1Y98A 1W52X 2ODWA 3UNXA 4TZ0A 2JFXA 3OH8A 3BQ9A 3AVVA 4PANA 2HKIA 1DC3A 1TAGA 2IIQA 4KWEA 4QXOA 621PA 4DMUB 2V59A 3KAPA 3RODA 2QKYA 2O8BA 4S05A 2PMWB 421PA 3NVAA 4GR5A 3JD0A 4Z9YA 1VKRA 1PGJA 3DOIA 2A59A 1AK2A 1O77A 1PO7A 4LSMA 1NP7A 4QQ8A 2BKEA 2PZBA 2QTLA 2ZE5A 3D8UA 1JVSA 3IALA 3KG2A 4G4SO 4ZODA 3QF4A 2ECKA 5ECGC 4C9BA 1M6HA 3R3ZA 3H8SA 3FCYA 3LL4A 4D5EA 3E5MA 3L7JA 1Y9DA 1K75A 4B1FA 4HWGA 1YB6A 1YI1A 2P4HX 5DX0A 2D5LA 5KNDD 3TRFA 3IP3A 2J9FB 5HUQA 2YCBA 2JAQA 4DTIA 1EGVB 1GKIA 1ISIA 3BH6A 1PV2A 4MDFA 4PNEA 1I01A 2QG4A 3HHEA 3H3XA 3RCBA 3TFWA 4BNUA 3DE1X 2QX8A 3G2KA 4DJ5X 3FBGA 4GZ6A 3RUEA 4GICA 2B37A 1ZWKA 1N75A 2ZIXA 4H0CA 1CUAA 3I04A 3WK6A 1XV5A 3I23A 4BGUA 2IOFA 3HCOA 4JJ4A 4NU6A 4EJ6A 1DTWB 1FFGA 1MGOA