1U18A

1.96 a crystal structure of h60c mutant of nitrophorin complexed with histamine
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
184
structure length
184
Chain Sequence
b'KCTKNALAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYCYDPKTQDTFYDVSELQEESPGKYTANFKKVEKNGNVKVDVTSGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDTNAGDKVKGAVTAASLKFSDFISTKDNKCEYDNVSLKSLLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrophorin 1
publication title 1.96 A Crystal structure of H60C mutant of nitrophorin complexed with histamine
rcsb
source organism Rhodnius prolixus
molecule tags Signaling protein
total genus 46
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1u18A00
1E00A 1HBQA 5HTDA 3WBGA 2FWVA 2HMBA 4I9RA 3APWA 5LKFA 1HMRA 5LJEA 4UU3A 2XSTA 4HPDA 4YBUA 3NPOA 4YCHA 1ZNGA 5KHPA 1DV9A 4IMNA 4IMOA 2WEWA 2HYSA 4XMEA 4ORSA 4ORUA 4TQ2A 1AB0A 4AW8A 1SXXA 2L68A 1MDCA 3MVFA 1IFCA 4YGZA 1FENA 4I3DA 2AL0X 5BVSA 1GT4A 4ES7A 1X8QA 3DSZA 5DG4A 3TGAA 4A8ZA 1DZPA 2CBRA 2MM3A 4YFQA 4ODDA 1A18A 4QZUA 3WJDA 4OS0A 1O8VA 2EU7X 1DC9A 3B2IA 4QGXA 3EBWA 2A13A 2AT0X 1LIFA 1FEMA 2IFBA 4HPCA 3NX1A 3TF6A 3CQRA 5HCDC 1EUOA 3I17A 1CBQA 1O1UA 5L8IA 1GT3A 3ZQ3A 4NP1A 4AYHA 4DQ3A 2G7BA 1ZNDA 2JOZA 1QY0A 3NADA 4Y0SA 1BSYA 1NGLA 3G7XA 2AT5X 2XKLA 3FIQA 4LZUA 4YBPA 4ZHDA 3BS2A 4CK4A 1VPRA 4IBAA 1ICMA 1GX8A 1OEEA 1FDQA 1GKAB 2OVEA 2JN3A 2QOSC 3KFGA 4TKJA 4ZHHA 1ACDA 2KT4B 4YKOA 4LZVA 5C0NA 4NYQA 4ZR2A 4YFRA 4IB8A 1DF3A 1ALBA 1BJ7A 2JU8A 3I0AA 1X8PA 3U03A 1YWAA 1TXLA 3C76X 1ZNHA 1FE3A 1NP1A 3AKNA 2WUTA 2GC9A 3JS1A 5HZ8A 1DZJA 2RCQA 1R0UA 4RUUA 4ALOA 3D96A 3O22A 2ACOA 5EZ2A 3TZSA 2FT9A 1JJXA 1QWDA 2OVAA 3GAQA 4O9SA 5JR8A 4I3BA 5BVTA 3CWKA 5EDBA 1GT5A 2CZTA 3PEDA 1QFTA 4IB9A 3UEXA 1ADLA 1OEJA 2LB6A 2F73A 4MVLA 5HAEA 1IIUA 1S7DA 2LKKA 3VG2A 2FS6A 4YCEA 3FA8A 3FA9A 5BVQA 3TGBA 3HWEA 1EXSA 2WR6A 1TOWA 2BLGA 2WQAE 1YUPA 4RUNA 1KGLA 3FR4A 2Q2PA 2GJ5A 5LJCA 4GKCA 5HZ9A 2QO5A 3STKA 2GTFX 1DZKA 2FLJA 2ANSA 2WQ9A 5H9KA 4R0BA 4M6SA 1P6PA 3TGCA 1D3SA 1CJ5A 1VYGA 3AKMA 1SXWA 1JBHA 2ASNX 3B2KA 3P6GA 5L8OA 3ZUOA 2LBAA 4BVMA 1U18A 1A2DA 3KFHA 3HWGA 4HFOA 3UEVA 2CM4A 4XMDA 1U17A 3L4RA 1NP4A 1U0XA 3D95A 5D8JA 4QYPA 5EPQA 2KTDA 1GX9A 3BU9A 5H8TA 4YFPA 3FA6A 1KT3A 1BEBA 2R56A 3PP6A 4EXZA 4GH7A 1S2PA 3U0DA 1LIDA 3IA8A 1OBPA 1KT4A 2RQ0A 5F6BA 1IKEA 1QY2A 3EBKA 2QM9A 3P6EA 4ORXA 4ORYA 1BBPA 5LKEA 2CZUA 3C77X 3FW4A 5IO6A 3NR3A 3ZUIA 2OVDA 1EIOA 1G74A 4AZMA 4AZRA 3UEUA 2O62A 4QZTA 5AQ6A 3BX8A 2RA6A 2Q39A 4EFGA 1BM5A 2NNQA 2X45A 1EW3A 3FENA 4AZPA 2HZRA 3FR5A 3VG6A 2OFMX 1G85A 1A57A 3VG3A 1QABE 3T1DA 4BQUA 3PECA 5EEEA 1KT7A 2LFOA 3KQ0A 2ACPX 1D2UA 3K3LA 1KZWA 4GETA 1MVGA 2AH7X 2FRSA 1UREA 1OPAA 3APUA 3WJGA 2Q4NA 3STNA 1Z24A 1HQPA 3OJYC 2FR3A 2MJIA 4IAWA 5H9LA 1EPBA 3PH5A 4WBKA 4ZGUA 1B0OA 1LIBA 2N93A 3NQ9A 3WJCA 4K19A 1GT1A 2NNDA 3VG5A 4AZQA 5LJDA 2AMMX 5HBSA 5HTEA 1AVGI 1OBUA 4TJZA 1TVQA 4ORRA 5F7GA 1KXOA 1B4MA 3KZAA 1T68X 2QO4A 4IB6A 1KZXA 2HNXA 1E5PA 3STMX 3C78X 4ZH9A 3WJEA 4GNYA 2QO6A 3SAOA 5IO7A 4ZCBA 4A1HA 1GXAA 1ICNA 1OPBA 3Q6LA 1LFOA 1LKEA 1HBPA 2AKQA 4TLJA 3FA7A 2A2UA 4Y0QA 1X8NA 4NLIA 2X46A 3FLLA 3P6CA 3BLGA 1YWDA 1SXYA 2JU3A 2FTBA 4GE1A 1KQWA 4ZFXA 1JJJA 2L9CA 4MVIA 5HWZA 1PEEA 3HWFA 1CBSA 3EYCA 5FENA 1N0SA 2NP1A 5EEDA 1O1VA 2NNEA 3CR6A 1YIVA 1OBQA 1T0VA 5F1EA 3F9DA 1X71A 4N7CA 1IW2A 4OS8A 3B2HA 4TNNA 5HZQA 2Q2MA 4YMYA 2R74A 3APXA 3P6HA 5FAZA 5K06A 2Q9SA 5DPQA 1TW4A 2POAA 4Y0RA 3O2YA 5LJHA 5LJGA 3O19A 4IB7A 4ZHFA 1XKIA 1ZNKA 3CBSA 1JYJA 1LPJA 1ZNLA 2W2FA 1PM1X 4MVKA 1QFVA 3F8AA 1I05A 5H9AA 1ERBA 3FMZA 3FEPA 2G79A 3EM0A 3U9PC 3FEKA 1BRPA 4ZH6A 1ZRYA 2OZQA 4A60A 4IAXA 4UU2A 1MUPA 3IFBA 3P6FA 1QG5A 2DM5A 1SA8A 1OEKA 1LICA 1ML7A 4HPAA 4EEJA 5HA0A 3JSQA 4ZHCA 4YGGA 2OFRX 2YG2A 4ORWA 1EALA 2PY1A 4M7MA 1SY0A 1RLBE 1I4UA 2CBSA 5LJBA 5D45A 5B27A 5KIDA 4YGHA 3MBTA 1GKAA 1EPAA 4OMXA 4XMCA 2W2BA 3WVMA 1BLRA 1X89A 4WFVA 1S44A 3S26A 5D47A 1A3YA 1MX7A 1X8UA 2AT8X 4YDAA 3BDRA 3FW5A 4D6BA 5B29A 2RD7C 4AZNA 5KICA 4N7DA 1YP7A 3BU1A 1G7NA 4TKHA 4NLJA 1JYDA 4QGWA 1FELA 3B2LA 5LJKA 4OS3A 4GNWA 4TKBA 1JV4A 3WJFA 3UEWA 2R73A 3WXQA 1QY1A 4BOEA 4QAEA 4XMFA 2ALLX 4I3CA 4OMWA 3QKGA 3HK1A 3NQ3A 3P6DA 3BRNA 4YKMA 3HWDA 4QYNA 2FS7A 1E06A 3RSWA 1I04A 4XMHA 2K62A 2WWPA 1SY3A 4ALBA 1L6MA 1SY1A 1GGLA 1GM6A 3B2JA 3NX2A 2LBVA 1KT5A 1LNMA 4YDBA 1IFBA 1LIEA 4I9SA 5F6ZA 3CBCA 2WSJA 4AZOA 4LKPA 3ELXA 3EMMA 4XMGA 3APVA 2AT6X 4NYRA 1CBIA 1BSQA 3KFFA 1HN2A 3VG7A 4D6AA 1KQXA 1QQSA 5D48A 1G5WA 2K23A 5FFHA 1SXUA 1EQDA 2G78A 4ZJ0A 3CQNA 1YP6A 3VG4A 5HZ6A 1DFVA 3PPTA 1TOUA 1BRQA 3CMPA 1ERXA 3D97A 1KOIA 2A0AA 5H9NA 3NP1A 1AQBA 1IKJA 5F58A 3FELA 5HA1A 1XCAA 1FTPA 3BX7A 2A2GA 1EIIA 2FR2A 1YWBA 1T8VA 1AELA 1VYFA 2CM9A 1MX8A 1RBPA 2RCTA 1X8OA 4NNSA 3BY0A 2L5PA 4Y0PA 4LKTA 1YWCA 3DTQA 1BSOA 5D4AA 5CE4A 1JZUA 2A3FX 4KIIA 4NNTA 3FR2A 1B56A 4DQ4A 1BWYA 2JU7A 1SY2A 1ZNEA 5L8NA 1H91A 4WFUA 4YH0A 1B8EA 5HCEC 2P8GA 2W2AA 3RZYA 3WJBA 5HCCC 1UZ2X 2L67A 4ZHGA 1PBOA 1E02A 4EDEA 4HPBA 4QGVA 1PMPA 5IO5A 3ELZA 2WEXA 1KT6A 3KFIA 2HZQA 2MO5A 1DZMA 1CBRA 4ARHA 5HZ5A 3PH6A 1LF7A 1CRBA 2E4JA 3BSZE 1I06A 1HMSA 5EDCA 1HMTA 4GRJA 4PSQA 2HLVA 2AT3X 4A1YA
chains in the Genus database with same CATH superfamily
4GGRA 2PI3O 1E00A 1HBQA 5HTDA 1LELA 1VWMB 3HPEA 3WBGA 4CDCA 2FWVA 2HMBA 1LDQA 4I9RA 3APWA 4KC7A 5LKFA 5IO5A 1HMRA 5LJEA 4UU3A 2VFBA 3HOEA 2XSTA 4HPDA 1SWPA 4YBUA 1NQMA 3NPOA 1MM9A 4YCHA 1ZNGA 5KHPA 1DV9A 4IMNA 2OY8A 2X8TA 4IMOA 4BX6A 3RKGA 2WEWA 2HYSA 1VWFB 2AF5A 5B5GA 4U3QA 1LUQA 4XMEA 4ORSA 4ORUA 4TQ2A 4COTA 1RSUB 1VWPB 1AB0A 1EI5A 4AW8A 1SXXA 4I95A 1MK5A 2L68A 4QRLA 3RY2A 1RXKA 1MDCA 3MVFA 1IFCA 4YGZA 1FENA 1VWJB 4I3DA 1K24A 2AL0X 5BVSA 1GT4A 1SWFA 1SWUA 3HOLA 4ES7A 4Y59A 1X8QA 3DSZA 4PJ2A 5DG4A 4EQAC 3TGAA 4A8ZA 2RTMA 2Y3EA 1DZPA 4CDDA 1SWKA 2CBRA 2MM3A 4YFQA 4ODDA 1A18A 4QZUA 3WJDA 4L1NA 4OS0A 1O8VA 4Y5DA 2EU7X 3ZI8A 4BCSA 2RTAA 1DC9A 2IZCB 3B2IA 5IRUA 4QGXA 3EBWA 1W5RA 2A13A 2AT0X 4OELA 1IJ8A 3CKGA 4INNA 1LIFA 1FEMA 3V8UA 2IFBA 2FGSA 1LCZA 1FJ1E 3WZOA 2I5ZO 4HPCA 1SWLA 2Y3FA 3NX1A 3CQRA 2C1SA 3TF6A 4CPHA 1EUOA 4BX7A 3AEHA 3I17A 1CBQA 5HCDC 1N9MA 1O1UA 5L8IA 2IZBA 1RXJA 4MEEA 1GT3A 4BJ8A 1SLFB 3ZQ3A 5IXGA 4NP1A 4AYHA 4DQ3A 2G7BA 1ZNDA 4U9CA 4B55A 2JOZA 2A5BA 1QY0A 2RTNB 3NADA 4Y0SA 1BSYA 2BS6A 1NGLA 2OF9A 3G7XA 2AT5X 4GGTA 2XKLA 3FIQA 4LZUA 4YBPA 2KW1A 4ZHDA 1Y52X 3BS2A 1VPRA 2OFBA 1ICMA 4IBAA 1GX8A 1OEEA 1VWKB 3NQKA 4NV8A 2X34A 5L3YA 1FDQA 1GKAB 1NQNA 2OVEA 2JN3A 2QOSC 3KFGA 2RTRB 3E3CA 1ACDA 1HQQA 2KT4B 4IABA 4TKJA 4Z2OA 4YKOA 4ZHHA 4LZVA 3MM0A 1SWOA 4BGFA 5C0NA 5CHKA 1JMXA 4NYQA 4ZR2A 4YFRA 3ZW2A 4IB8A 1DF3A 1ALBA 1BJ7A 2JU8A 1SRIA 1X8PA 3I0AA 3U03A 1YWAA 4KH8A 4O3YA 1VWRB 1TXLA 2X32A 3CKFA 3P02A 3C76X 1SWSA 1ZNHA 1FE3A 3SLOA 1NP1A 2G8CO 1SRFA 3AKNA 4FBVA 2WUTA 2GC9A 3JS1A 5AJCA 5B5FA 5HZ8A 1DZJA 2RCQA 1R0UA 2QMIA 4RUUA 4ALOA 3D96A 3O22A 2ACOA 5EZ2A 1HXZA 3TZSA 4CPFA 2FT9A 1JJXA 3EC5A 1QWDA 2OVAA 1JQPA 3GAQA 2MF6A 1DF8A 4GD9A 4I3BA 4O4XA 4O9SA 5BVTA 3CWKA 5EDBA 2BS5A 2AVIA 2WPUA 1GT5A 2CZTA 2DJGA 1QFTA 3PEDA 1Y53X 4IB9A 3PQSA 4GJSA 1ADLA 3UEXA 1OEJA 4CV7A 2LB6A 2F73A 2FHLA 4MVLA 5CSEA 5HAEA 1IIUA 2OY1O 3AUMO 1S7DA 2LKKA 2ZAGA 4ON1A 2MHDA 2FS6A 3VG2A 4YCEA 3FA8A 1JMZA 3FA9A 5BVQA 3TGBA 3HWEA 2IZFB 3ZW0B 1EXSA 2WR6A 1TOWA 2BLGA 3SOTA 2WQAE 1YUPA 4RUNA 1KGLA 3RDSA 3SLJA 4I6SA 3FR4A 2Q2PA 2GJ5A 3FYFA 5LJCA 4GKCA 5HZ9A 1STPA 2QO5A 3STKA 2GTFX 2BHVA 1DZKA 1SWJA 2FLJA 2IZLB 2ANSA 2OF8A 2WQ9A 4R0BA 5H9KA 4M6SA 1P6PA 1I9HA 3TGCA 1NC9A 2GTLM 1D3SA 3H3IA 1CJ5A 1VYGA 3AKMA 5FQ7E 4BX5B 1SXWA 1JBHA 1LCVA 2ASNX 3B2KA 3P6GA 5L8OA 1MEPA 3ZUOA 4Z6JA 2LBAA 4BVMA 2OY7A 1U18A 2RTPB 1A2DA 2VFCA 3KFHA 3HWGA 2HKDA 1VWAB 4HFOA 1PTSA 3UEVA 2CM4A 1SWBA 4XMDA 1U17A 1VWCB 4U8UO 3T6FA 3L4RA 1VWNB 1SWRA 1NP4A 4CDFA 1U0XA 1SLEB 2GTLO 1KFFA 3D95A 5D8JA 4QYPA 4GU8A 5EPQA 2KTDA 1GX9A 2X8FA 3BU9A 5H8TA 4YFPA 3FA6A 4O4UA 1KT3A 1BEBA 2R56A 3PP6A 4EXZA 3PDFA 1STRB 4GH7A 3SZHA 1S2PA 3U0DA 3RDQA 1AVDA 1LIDA 4NV7A 3IA8A 3T2XA 1LCWA 1OBPA 1KT4A 2RQ0A 2JMBA 2M4LA 5F6BA 3SZJA 4O3ZA 1IKEA 1QY2A 3EBKA 2QM9A 1SWCA 3P6EA 4JHQA 3RE5A 1VWIB 4ORXA 4ORYA 1BBPA 5LKEA 1SWNA 3RBYA 2A8GA 5BYPA 2CZUA 3C77X 3FW4A 5IO6A 3NR3A 3ZUIA 2OVDA 1EIOA 1G74A 1E2TA 2Y32A 2F01A 3WZNA 4AZMA 4AZRA 3RY1A 1SWDA 3UEUA 1SRGA 2O62A 4QZTA 5AQ6A 3BX8A 2RA6A 2FKGA 2Q39A 3ZZVA 4EFGA 1W6FA 1SWEA 2NNQA 2X45A 4I60A 1EW3A 3ZW1A 3FENA 2DJFA 4AZPA 4O4OA 5FQ8E 4FBOA 2HZRA 3FR5A 3VG6A 2OFMX 4O4SA 1G85A 4CSBA 2RTKA 1MOYA 3VG3A 1QABE 3T1DA 1A57A 4BQUA 2X56A 3PECA 5EEEA 3OD9A 1KT7A 2LFOA 3KQ0A 2ACPX 1D2UA 3K3LA 1KZWA 4GETA 1MVGA 1W4TA 2FRSA 1UREA 1OPAA 3APUA 2AH7X 2Q4NA 5IRAA 3STNA 4KCAA 3WJGA 3RE6A 1Z24A 1HQPA 3RDXA 3X00A 3VGWA 3OJYC 1JJUA 2OY5O 2FR3A 2MJIA 1SLGB 4IAWA 5H9LA 1EPBA 3PH5A 1NDJA 4WBKA 4ZGUA 1B0OA 1LIBA 2N93A 2IZJA 3NQ9A 2RTLA 3VPJE 3WJCA 4K19A 1GT1A 2NNDA 3VG5A 3VE1A 1RSTB 4DNEA 4AZQA 3GE2A 5LJDA 4MIRA 2AMMX 4QQ1A 2QCBA 2QOMA 3D9WA 2RTOB 5AJBA 4GDZA 5HBSA 5HTEA 1STSB 1AVGI 1OBUA 4TJZA 4BX6B 1TVQA 4ORRA 5F7GA 1KXOA 2IZHB 1B4MA 2RTIB 3KZAA 1T68X 2QO4A 4IB6A 1KZXA 4O3WA 3RWXA 2HNXA 1E5PA 3STMX 3C78X 4ZH9A 3WJEA 3EW2A 4GNYA 2JGSA 2C4IA 2QO6A 4ID2A 3SAOA 5IO7A 3KVNA 4ZCBA 4A1HA 1GXAA 1ICNA 1OPBA 2UZ2A 2IZIA 3Q6LA 4IRWA 1LFOA 4LQZA 1LKEA 1RAVA 1HBPA 2AKQA 4TLJA 3FA7A 2A2UA 1HY2A 4Y0QA 3EW1A 1X8NA 4NLIA 2X46A 1WUBA 3FLLA 3P6CA 3BLGA 1YWDA 1SXYA 2JU3A 1WBIA 2A5CA 2FTBA 4GE1A 1KQWA 4Z2VA 1PBYA 4ZFXA 2L9CA 1JJJA 4MVIA 3VHIA 5HWZA 1Y0GA 1PEEA 2FHNX 2I5VO 1CBSA 3HWFA 2OFAA 3EYCA 4FGIB 1N0SA 2NP1A 5FENA 5EEDA 1O1VA 2NNEA 3CR6A 1YIVA 1VWQB 1OBQA 1SMPI 1T0VA 5F1EA 3F9DA 1X71A 4N7CA 4HWMA 1IW2A 1VWEB 4ZGFA 4OS8A 1BM5A 1SWAA 3B2HA 1AVEA 4TNNA 3WYQA 5HZQA 2Q2MA 3ZW1B 5B3MO 2R74A 3APXA 3HTYA 3P6HA 4YMYA 1VWDB 5FAZA 2C1QA 1I78A 5K06A 2Q9SA 3OBLA 5DPQA 4FBRA 2G5LA 1KL3A 1TW4A 2POAA 4Y0RA 3O2YA 4BX7B 4CPHB 2X8SA 5LJGA 5LJHA 3O19A 4IB7A 4ZHFA 1XKIA 2MWHA 1ZNKA 1RXHA 1JYJA 2RTGB 3CBSA 5B10O 1LPJA 1ZNLA 2W2FA 1PM1X 4MVKA 3RDUA 1QFVA 3F8AA 1I05A 5H9AA 2RTFB 1OSPO 4GUZA 1VWLB 1ERBA 2RTEB 3FEPA 1UYNX 3FMZA 4QNIA 2FKJA 2G79A 4GK9A 3EM0A 2LA7A 3FIDA 3FEKA 1BRPA 3U9PC 5IRWA 4ZH6A 4WHIA 4EKVA 1ZRYA 2OZQA 1SLDB 4IAXA 4A60A 5JR8A 4UU2A 5AEOA 1MUPA 4MISA 3IFBA 3P6FA 2OL6O 2BSZA 4GDAA 2OYBO 1QG5A 2DM5A 1SA8A 1OEKA 1LICA 1ML7A 4HPAA 3WZQA 4EEJA 5HA0A 3S60A 3JSQA 4ZHCA 4YGGA 2OFRX 2YG2A 4ORWA 1EALA 2PY1A 1VWGB 1KL5A 2RN4A 4M7MA 1SY0A 1RLBE 4GGZA 1I4UA 2CBSA 5LJBA 1K3BA 3F6ZB 2X4MA 5D45A 5B27A 3S5VA 5KIDA 4YGHA 3MBTA 1GKAA 1N43A 4GJVA 1EPAA 4OMXA 4XMCA 2W2BA 3WVMA 1Y9TA 2IZEB 1X89A 1BLRA 4WFVA 1S44A 3S26A 1SREA 5D47A 1A3YA 1MX7A 1X8UA 2AT8X 2UYWA 4YDAA 3S5XA 3BDRA 3FW5A 4D6BA 5K68A 5B29A 5B11O 2RD7C 1Y55X 4AZNA 5KICA 4N7DA 4MVEA 1YP7A 4Z28A 3BU1A 1SWGA 1G7NA 4TKHA 4NLJA 2Z4IA 1JYDA 1SRJA 1SWTA 3OE3A 4O49A 1FELA 4QGWA 4Z27A 3B2LA 5LJKA 4OS3A 4GNWA 3D4RA 1JV4A 3SLTA 3WJFA 4TKBA 3UEWA 4U8UN 2R73A 3WXQA 1QY1A 4JNJA 4QAEA 2IZAA 1VWOB 4BOEA 2GTLN 4L3RA 4XMFA 2BC3A 2ALLX 4I3CA 4CPIA 2RTJA 4OMWA 3QKGA 5FQ6E 3FDCA 3HK1A 1LDOA 3NQ3A 3P6DA 3BRNA 4YKMA 3T2WA 3HWDA 4QYNA 2FS7A 3VHMA 1E06A 2X55A 4KC8A 3RSWA 3WYPA 1I04A 4XMHA 2K62A 2WWPA 1SY3A 4ALBA 1L6MA 1SY1A 1GGLA 1GM6A 1VWHB 3B2JA 3NX2A 4JO6A 2LBVA 1KT5A 3ZW0A 1LNMA 4YDBA 1IFBA 1LIEA 1SWHA 4I9SA 5F6ZA 3CBCA 2WSJA 4AZOA 3PQUA 4LKPA 3ELXA 3RDMA 1SWQA 3EMMA 1SRHA 3APVA 4XMGA 5F2BA 2AT6X 4NYRA 4YVBA 1CBIA 1BSQA 3KFFA 1HN2A 3VG7A 4D6AA 1KQXA 1QQSA 3RDOA 5D48A 1G5WA 4Z2PA 3VHHA 3LHNA 4BX5A 2K23A 1VWBB 5FFHA 1JIWI 1SXUA 1EQDA 3T6LA 2G78A 2F09A 4ZJ0A 2YMSA 3CQNA 1YP6A 3VG4A 4C5PA 5HZ6A 1KL4A 5CYBA 2IZGB 1DFVA 3PPTA 2RTCB 2VDFA 1TOUA 1BRQA 3CMPA 1ERXA 3D97A 1KOIA 2A0AA 1VYOA 5H9NA 3NP1A 1AQBA 1IKJA 4FQBB 5JD2A 5F58A 3FELA 4GZVA 5HA1A 3QQ2A 4JGLA 4OEMA 1XCAA 1FTPA 2OVSA 3BX7A 2A2GA 3LV4A 1EIIA 4OKAA 2FR2A 1N7YA 1T8VA 1YWBA 1VYFA 2KD2A 2RTHB 2CM9A 2Z4HA 1AELA 1MX8A 1RBPA 2RCTA 1X8OA 2OL8O 4NNSA 2ZSCA 4O3XB 3BY0A 3ZWEA 2L5PA 2JW1A 3NBXX 4BBOA 1UYOX 4LKTA 1YWCA 2IZKA 1Y9LA 4Y0PA 3LTWA 3P24A 3DTQA 3Q34A 1BSOA 2BT9A 5D4AA 5CE4A 1JZUA 2A3FX 4KIIA 4NNTA 4CK4A 3FR2A 1B56A 2KTSA 5B2AO 4DQ4A 1BWYA 2JU7A 2RTBB 3JQOA 1SY2A 1ZNEA 3MX7A 1H91A 4WFUA 3WZPA 2ZAIA 5L8NA 4YH0A 1B8EA 2RTQB 5HCEC 4CDEA 2P8GA 2W2AA 3RZYA 3WJBA 5HCCC 3UAQA 1UZ2X 2L67A 4ZHGA 1PBOA 1E02A 4EDEA 1NBXA 4HPBA 1PMPA 2GH7A 3ELZA 3MG5A 3SZIA 2WEXA 4QGVA 1KT6A 5K67A 3KFIA 2HZQA 2MO5A 2RTDB 4NW4A 1DZMA 1CBRA 4CPEA 4KT5A 4ARHA 5HZ5A 3PH6A 4ML7B 3WOVA 2IZDB 1N9YA 1LF7A 1CRBA 2E4JA 1GX3A 3BSZE 4DCBA 1I06A 1HMSA 5EDCA 3VU1A 2CAMA 3VE2A 1N4JA 2OL7A 3N91A 1HMTA 4GRJA 4PSQA 1HXLA 2AT3X 2HLVA 4U46A 3PK2A 4A1YA 4U8UM
chains in the Genus database with same CATH topology
1E00A 1HBQA 5HTDA 3WBGA 2FWVA 2HMBA 4I9RA 3APWA 4KC7A 5LKFA 1HMRA 5LJEA 4UU3A 3HOEA 2XSTA 4HPDA 4YBUA 3NPOA 4YCHA 1ZNGA 5KHPA 1DV9A 4IMNA 4IMOA 2X8TA 3RKGA 2WEWA 2HYSA 4U3QA 4XMEA 4ORSA 4ORUA 4TQ2A 4COTA 1AB0A 1EI5A 4AW8A 1SXXA 4I95A 2L68A 4QRLA 1MDCA 3MVFA 1IFCA 4YGZA 1FENA 4I3DA 2AL0X 5BVSA 1GT4A 3HOLA 4ES7A 1X8QA 3DSZA 4PJ2A 5DG4A 4EQAC 3TGAA 4A8ZA 1DZPA 2CBRA 2MM3A 4YFQA 4ODDA 1A18A 4QZUA 3WJDA 4L1NA 4OS0A 1O8VA 2EU7X 3ZI8A 1DC9A 3B2IA 4QGXA 3EBWA 2A13A 2AT0X 4INNA 1LIFA 1FEMA 3V8UA 2IFBA 4HPCA 3NX1A 3TF6A 3CQRA 5HCDC 1EUOA 3I17A 1CBQA 1O1UA 5L8IA 1GT3A 3ZQ3A 4NP1A 4AYHA 4DQ3A 2G7BA 1ZNDA 4U9CA 2JOZA 1QY0A 3NADA 4Y0SA 1BSYA 2BS6A 1NGLA 3G7XA 2AT5X 2XKLA 3FIQA 4LZUA 4YBPA 2KW1A 4ZHDA 3BS2A 4CK4A 1VPRA 4IBAA 1ICMA 1GX8A 1OEEA 3NQKA 1FDQA 1GKAB 2OVEA 2JN3A 2QOSC 3KFGA 3E3CA 4TKJA 1ACDA 2KT4B 4IABA 4ZHHA 4YKOA 4LZVA 5C0NA 4NYQA 4ZR2A 4YFRA 3ZW2A 4IB8A 1DF3A 1ALBA 1BJ7A 2JU8A 3I0AA 1X8PA 3U03A 1YWAA 4KH8A 4O3YA 1TXLA 3P02A 3C76X 1ZNHA 1FE3A 1NP1A 3AKNA 4FBVA 2WUTA 2GC9A 3JS1A 5AJCA 5HZ8A 1DZJA 2RCQA 1R0UA 2QMIA 4RUUA 4ALOA 3D96A 3O22A 2ACOA 5EZ2A 3TZSA 2FT9A 1JJXA 1QWDA 2OVAA 3GAQA 4O4XA 4O9SA 5JR8A 4I3BA 5BVTA 3CWKA 5EDBA 2BS5A 1GT5A 2CZTA 3PEDA 1QFTA 4IB9A 3PQSA 3UEXA 1ADLA 1OEJA 4CV7A 2LB6A 2F73A 4MVLA 5HAEA 1IIUA 1S7DA 2LKKA 2ZAGA 4ON1A 2MHDA 2FS6A 3VG2A 4YCEA 3FA8A 3FA9A 5BVQA 3TGBA 3HWEA 3ZW0B 1EXSA 2WR6A 1TOWA 2BLGA 3SOTA 2WQAE 1YUPA 4RUNA 1KGLA 4I6SA 3FR4A 2Q2PA 2GJ5A 3FYFA 5LJCA 4GKCA 5HZ9A 2QO5A 3STKA 2GTFX 2BHVA 1DZKA 2FLJA 2ANSA 2WQ9A 5H9KA 4R0BA 4M6SA 1P6PA 3TGCA 2GTLM 1D3SA 3H3IA 1CJ5A 1VYGA 3AKMA 5FQ7E 1SXWA 1JBHA 2ASNX 3B2KA 3P6GA 5L8OA 3ZUOA 2LBAA 4BVMA 1U18A 1A2DA 3KFHA 3HWGA 4HFOA 3UEVA 2CM4A 4XMDA 1U17A 4U8UO 3L4RA 1NP4A 1U0XA 2GTLO 3D95A 5D8JA 4QYPA 4GU8A 5EPQA 2KTDA 1GX9A 2X8FA 3BU9A 5H8TA 4YFPA 3FA6A 4O4UA 1KT3A 1BEBA 2R56A 3PP6A 4EXZA 4GH7A 1S2PA 3U0DA 1LIDA 3IA8A 1OBPA 1KT4A 2RQ0A 2M4LA 2JMBA 5F6BA 4O3ZA 1IKEA 1QY2A 3EBKA 2QM9A 3P6EA 4ORXA 4ORYA 1BBPA 5LKEA 3RBYA 5BYPA 2CZUA 3C77X 3FW4A 5IO6A 3NR3A 3ZUIA 2OVDA 1EIOA 1G74A 4AZMA 4AZRA 3UEUA 2O62A 4QZTA 5AQ6A 3BX8A 2RA6A 2Q39A 3ZZVA 4EFGA 1BM5A 2NNQA 2X45A 1EW3A 3ZW1A 3FENA 4AZPA 4O4OA 5FQ8E 4FBOA 2HZRA 3FR5A 3VG6A 2OFMX 4O4SA 1G85A 4CSBA 1A57A 3VG3A 1QABE 3T1DA 4BQUA 3PECA 5EEEA 3OD9A 1KT7A 2LFOA 3KQ0A 2ACPX 1D2UA 3K3LA 1KZWA 4GETA 1MVGA 2AH7X 2FRSA 1UREA 1OPAA 3APUA 3WJGA 2Q4NA 3STNA 4KCAA 1Z24A 1HQPA 3OJYC 2FR3A 2MJIA 4IAWA 5H9LA 1EPBA 3PH5A 4WBKA 4ZGUA 1B0OA 1LIBA 2N93A 3NQ9A 3VPJE 3WJCA 4K19A 1GT1A 2NNDA 3VG5A 3VE1A 4AZQA 3GE2A 5LJDA 4MIRA 2AMMX 4QQ1A 5AJBA 5HBSA 5HTEA 4GDZA 1AVGI 1OBUA 4TJZA 1TVQA 4ORRA 5F7GA 1KXOA 1B4MA 3KZAA 1T68X 2QO4A 4IB6A 1KZXA 4O3WA 3RWXA 2HNXA 1E5PA 3STMX 3C78X 4ZH9A 3WJEA 4GNYA 4ID2A 2QO6A 3SAOA 5IO7A 4ZCBA 4A1HA 1GXAA 1ICNA 1OPBA 3Q6LA 1LFOA 4LQZA 1LKEA 1HBPA 2AKQA 4TLJA 3FA7A 2A2UA 4Y0QA 1X8NA 4NLIA 2X46A 3FLLA 3P6CA 3BLGA 1YWDA 1SXYA 2JU3A 2FTBA 4GE1A 1KQWA 4ZFXA 1JJJA 2L9CA 4MVIA 5HWZA 1PEEA 3HWFA 1CBSA 4FGIB 3EYCA 5FENA 1N0SA 2NP1A 5EEDA 1O1VA 2NNEA 3CR6A 1YIVA 1OBQA 1SMPI 1T0VA 5F1EA 3F9DA 1X71A 4N7CA 4HWMA 1IW2A 4ZGFA 4OS8A 3B2HA 4TNNA 3ZW1B 5HZQA 2Q2MA 4YMYA 2R74A 3APXA 3HTYA 3P6HA 5FAZA 5K06A 2Q9SA 3OBLA 5DPQA 4FBRA 1TW4A 2POAA 4Y0RA 3O2YA 5LJHA 2X8SA 5LJGA 3O19A 4IB7A 4ZHFA 1XKIA 2MWHA 1ZNKA 3CBSA 1JYJA 1LPJA 1ZNLA 2W2FA 1PM1X 4MVKA 1QFVA 3F8AA 1I05A 5H9AA 1ERBA 3FMZA 3FEPA 4QNIA 2G79A 4GK9A 3EM0A 2LA7A 3U9PC 3FEKA 1BRPA 4ZH6A 4WHIA 1ZRYA 2OZQA 4A60A 4IAXA 4UU2A 5AEOA 1MUPA 4MISA 3IFBA 3P6FA 1QG5A 2DM5A 1SA8A 1OEKA 1LICA 1ML7A 4HPAA 4EEJA 5HA0A 3S60A 3JSQA 4ZHCA 4YGGA 2OFRX 2YG2A 4ORWA 1EALA 2PY1A 4M7MA 2RN4A 1SY0A 1RLBE 1I4UA 2CBSA 5LJBA 3F6ZB 5D45A 5B27A 3S5VA 5KIDA 4YGHA 3MBTA 1GKAA 1EPAA 4OMXA 4XMCA 2W2BA 3WVMA 1Y9TA 1BLRA 1X89A 4WFVA 1S44A 3S26A 5D47A 1A3YA 1MX7A 1X8UA 2AT8X 4YDAA 3S5XA 3BDRA 3FW5A 4D6BA 5B29A 2RD7C 4AZNA 5KICA 4N7DA 4MVEA 1YP7A 3BU1A 1G7NA 4TKHA 4NLJA 2Z4IA 1JYDA 4O49A 3OE3A 4QGWA 1FELA 3B2LA 5LJKA 4OS3A 4GNWA 3D4RA 1JV4A 3WJFA 4TKBA 3UEWA 4U8UN 2R73A 3WXQA 1QY1A 4BOEA 4QAEA 2GTLN 4L3RA 4XMFA 2ALLX 4I3CA 4OMWA 3QKGA 5FQ6E 3HK1A 3NQ3A 3P6DA 3BRNA 4YKMA 3HWDA 4QYNA 2FS7A 1E06A 4KC8A 3RSWA 1I04A 4XMHA 2K62A 2WWPA 1SY3A 4ALBA 1L6MA 1SY1A 1GGLA 1GM6A 3B2JA 3NX2A 2LBVA 3ZW0A 1KT5A 1LNMA 4YDBA 1IFBA 1LIEA 4I9SA 5F6ZA 3CBCA 2WSJA 4AZOA 3PQUA 4LKPA 3ELXA 3EMMA 4XMGA 3APVA 2AT6X 4NYRA 1CBIA 1BSQA 3KFFA 1HN2A 3VG7A 4D6AA 1KQXA 1QQSA 5D48A 1G5WA 3LHNA 2K23A 5FFHA 1JIWI 1SXUA 1EQDA 2G78A 2F09A 4ZJ0A 2YMSA 3CQNA 1YP6A 3VG4A 5HZ6A 5CYBA 1DFVA 3PPTA 1TOUA 1BRQA 3CMPA 1ERXA 3D97A 1KOIA 2A0AA 5H9NA 3NP1A 1AQBA 1IKJA 4FQBB 5F58A 3FELA 4GZVA 5HA1A 4JGLA 1XCAA 1FTPA 2OVSA 3BX7A 2A2GA 3LV4A 1EIIA 2FR2A 1YWBA 1T8VA 2KD2A 1VYFA 1AELA 2CM9A 2Z4HA 1MX8A 1RBPA 2RCTA 1X8OA 4NNSA 4O3XB 3BY0A 3ZWEA 2L5PA 2JW1A 3NBXX 4Y0PA 4LKTA 1YWCA 1Y9LA 3P24A 3DTQA 1BSOA 2BT9A 5D4AA 5CE4A 1JZUA 2A3FX 4KIIA 4NNTA 3FR2A 1B56A 2KTSA 4DQ4A 1BWYA 2JU7A 3JQOA 1SY2A 1ZNEA 3MX7A 1H91A 4WFUA 5L8NA 2ZAIA 4YH0A 1B8EA 5HCEC 2P8GA 2W2AA 3RZYA 3WJBA 5HCCC 3UAQA 2L67A 1UZ2X 4ZHGA 1PBOA 1E02A 4EDEA 4HPBA 4QGVA 1PMPA 5IO5A 3ELZA 2WEXA 1KT6A 3KFIA 2HZQA 2MO5A 4NW4A 1DZMA 1CBRA 4KT5A 4ARHA 5HZ5A 3PH6A 4ML7B 3WOVA 1LF7A 1CRBA 2E4JA 3BSZE 1I06A 1HMSA 5EDCA 3VU1A 3VE2A 3N91A 1HMTA 4GRJA 4PSQA 2HLVA 2AT3X 4A1YA 4U8UM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E00 A;  1HBQ A;  5HTD A;  3WBG A;  2FWV A;  2HMB A;  4I9R A;  3APW A;  5LKF A;  1HMR A;  5LJE A;  4UU3 A;  2XST A;  4HPD A;  4YBU A;  3NPO A;  4YCH A;  1ZNG A;  5KHP A;  1DV9 A;  4IMN A;  4IMO A;  2WEW A;  2HYS A;  4XME A;  4ORS A;  4ORU A;  4TQ2 A;  1AB0 A;  4AW8 A;  1SXX A;  2L68 A;  1MDC A;  3MVF A;  1IFC A;  4YGZ A;  1FEN A;  4I3D A;  2AL0 X;  5BVS A;  1GT4 A;  4ES7 A;  1X8Q A;  3DSZ A;  5DG4 A;  3TGA A;  4A8Z A;  1DZP A;  2CBR A;  2MM3 A;  4YFQ A;  4ODD A;  1A18 A;  4QZU A;  3WJD A;  4OS0 A;  1O8V A;  2EU7 X;  1DC9 A;  3B2I A;  4QGX A;  3EBW A;  2A13 A;  2AT0 X;  1LIF A;  1FEM A;  2IFB A;  4HPC A;  3NX1 A;  3TF6 A;  3CQR A;  5HCD C;  1EUO A;  3I17 A;  1CBQ A;  1O1U A;  5L8I A;  1GT3 A;  3ZQ3 A;  4NP1 A;  4AYH A;  4DQ3 A;  2G7B A;  1ZND A;  2JOZ A;  1QY0 A;  3NAD A;  4Y0S A;  1BSY A;  1NGL A;  3G7X A;  2AT5 X;  2XKL A;  3FIQ A;  4LZU A;  4YBP A;  4ZHD A;  3BS2 A;  4CK4 A;  1VPR A;  4IBA A;  1ICM A;  1GX8 A;  1OEE A;  1FDQ A;  1GKA B;  2OVE A;  2JN3 A;  2QOS C;  3KFG A;  4TKJ A;  4ZHH A;  1ACD A;  2KT4 B;  4YKO A;  4LZV A;  5C0N A;  4NYQ A;  4ZR2 A;  4YFR A;  4IB8 A;  1DF3 A;  1ALB A;  1BJ7 A;  2JU8 A;  3I0A A;  1X8P A;  3U03 A;  1YWA A;  1TXL A;  3C76 X;  1ZNH A;  1FE3 A;  1NP1 A;  3AKN A;  2WUT A;  2GC9 A;  3JS1 A;  5HZ8 A;  1DZJ A;  2RCQ A;  1R0U A;  4RUU A;  4ALO A;  3D96 A;  3O22 A;  2ACO A;  5EZ2 A;  3TZS A;  2FT9 A;  1JJX A;  1QWD A;  2OVA A;  3GAQ A;  4O9S A;  5JR8 A;  4I3B A;  5BVT A;  3CWK A;  5EDB A;  1GT5 A;  2CZT A;  3PED A;  1QFT A;  4IB9 A;  3UEX A;  1ADL A;  1OEJ A;  2LB6 A;  2F73 A;  4MVL A;  5HAE A;  1IIU A;  1S7D A;  2LKK A;  3VG2 A;  2FS6 A;  4YCE A;  3FA8 A;  3FA9 A;  5BVQ A;  3TGB A;  3HWE A;  1EXS A;  2WR6 A;  1TOW A;  2BLG A;  2WQA E;  1YUP A;  4RUN A;  1KGL A;  3FR4 A;  2Q2P A;  2GJ5 A;  5LJC A;  4GKC A;  5HZ9 A;  2QO5 A;  3STK A;  2GTF X;  1DZK A;  2FLJ A;  2ANS A;  2WQ9 A;  5H9K A;  4R0B A;  4M6S A;  1P6P A;  3TGC A;  1D3S A;  1CJ5 A;  1VYG A;  3AKM A;  1SXW A;  1JBH A;  2ASN X;  3B2K A;  3P6G A;  5L8O A;  3ZUO A;  2LBA A;  4BVM A;  1U18 A;  1A2D A;  3KFH A;  3HWG A;  4HFO A;  3UEV A;  2CM4 A;  4XMD A;  1U17 A;  3L4R A;  1NP4 A;  1U0X A;  3D95 A;  5D8J A;  4QYP A;  5EPQ A;  2KTD A;  1GX9 A;  3BU9 A;  5H8T A;  4YFP A;  3FA6 A;  1KT3 A;  1BEB A;  2R56 A;  3PP6 A;  4EXZ A;  4GH7 A;  1S2P A;  3U0D A;  1LID A;  3IA8 A;  1OBP A;  1KT4 A;  2RQ0 A;  5F6B A;  1IKE A;  1QY2 A;  3EBK A;  2QM9 A;  3P6E A;  4ORX A;  4ORY A;  1BBP A;  5LKE A;  2CZU A;  3C77 X;  3FW4 A;  5IO6 A;  3NR3 A;  3ZUI A;  2OVD A;  1EIO A;  1G74 A;  4AZM A;  4AZR A;  3UEU A;  2O62 A;  4QZT A;  5AQ6 A;  3BX8 A;  2RA6 A;  2Q39 A;  4EFG A;  1BM5 A;  2NNQ A;  2X45 A;  1EW3 A;  3FEN A;  4AZP A;  2HZR A;  3FR5 A;  3VG6 A;  2OFM X;  1G85 A;  1A57 A;  3VG3 A;  1QAB E;  3T1D A;  4BQU A;  3PEC A;  5EEE A;  1KT7 A;  2LFO A;  3KQ0 A;  2ACP X;  1D2U A;  3K3L A;  1KZW A;  4GET A;  1MVG A;  2AH7 X;  2FRS A;  1URE A;  1OPA A;  3APU A;  3WJG A;  2Q4N A;  3STN A;  1Z24 A;  1HQP A;  3OJY C;  2FR3 A;  2MJI A;  4IAW A;  5H9L A;  1EPB A;  3PH5 A;  4WBK A;  4ZGU A;  1B0O A;  1LIB A;  2N93 A;  3NQ9 A;  3WJC A;  4K19 A;  1GT1 A;  2NND A;  3VG5 A;  4AZQ A;  5LJD A;  2AMM X;  5HBS A;  5HTE A;  1AVG I;  1OBU A;  4TJZ A;  1TVQ A;  4ORR A;  5F7G A;  1KXO A;  1B4M A;  3KZA A;  1T68 X;  2QO4 A;  4IB6 A;  1KZX A;  2HNX A;  1E5P A;  3STM X;  3C78 X;  4ZH9 A;  3WJE A;  4GNY A;  2QO6 A;  3SAO A;  5IO7 A;  4ZCB A;  4A1H A;  1GXA A;  1ICN A;  1OPB A;  3Q6L A;  1LFO A;  1LKE A;  1HBP A;  2AKQ A;  4TLJ A;  3FA7 A;  2A2U A;  4Y0Q A;  1X8N A;  4NLI A;  2X46 A;  3FLL A;  3P6C A;  3BLG A;  1YWD A;  1SXY A;  2JU3 A;  2FTB A;  4GE1 A;  1KQW A;  4ZFX A;  1JJJ A;  2L9C A;  4MVI A;  5HWZ A;  1PEE A;  3HWF A;  1CBS A;  3EYC A;  5FEN A;  1N0S A;  2NP1 A;  5EED A;  1O1V A;  2NNE A;  3CR6 A;  1YIV A;  1OBQ A;  1T0V A;  5F1E A;  3F9D A;  1X71 A;  4N7C A;  1IW2 A;  4OS8 A;  3B2H A;  4TNN A;  5HZQ A;  2Q2M A;  4YMY A;  2R74 A;  3APX A;  3P6H A;  5FAZ A;  5K06 A;  2Q9S A;  5DPQ A;  1TW4 A;  2POA A;  4Y0R A;  3O2Y A;  5LJH A;  5LJG A;  3O19 A;  4IB7 A;  4ZHF A;  1XKI A;  1ZNK A;  3CBS A;  1JYJ A;  1LPJ A;  1ZNL A;  2W2F A;  1PM1 X;  4MVK A;  1QFV A;  3F8A A;  1I05 A;  5H9A A;  1ERB A;  3FMZ A;  3FEP A;  2G79 A;  3EM0 A;  3U9P C;  3FEK A;  1BRP A;  4ZH6 A;  1ZRY A;  2OZQ A;  4A60 A;  4IAX A;  4UU2 A;  1MUP A;  3IFB A;  3P6F A;  1QG5 A;  2DM5 A;  1SA8 A;  1OEK A;  1LIC A;  1ML7 A;  4HPA A;  4EEJ A;  5HA0 A;  3JSQ A;  4ZHC A;  4YGG A;  2OFR X;  2YG2 A;  4ORW A;  1EAL A;  2PY1 A;  4M7M A;  1SY0 A;  1RLB E;  1I4U A;  2CBS A;  5LJB A;  5D45 A;  5B27 A;  5KID A;  4YGH A;  3MBT A;  1GKA A;  1EPA A;  4OMX A;  4XMC A;  2W2B A;  3WVM A;  1BLR A;  1X89 A;  4WFV A;  1S44 A;  3S26 A;  5D47 A;  1A3Y A;  1MX7 A;  1X8U A;  2AT8 X;  4YDA A;  3BDR A;  3FW5 A;  4D6B A;  5B29 A;  2RD7 C;  4AZN A;  5KIC A;  4N7D A;  1YP7 A;  3BU1 A;  1G7N A;  4TKH A;  4NLJ A;  1JYD A;  4QGW A;  1FEL A;  3B2L A;  5LJK A;  4OS3 A;  4GNW A;  4TKB A;  1JV4 A;  3WJF A;  3UEW A;  2R73 A;  3WXQ A;  1QY1 A;  4BOE A;  4QAE A;  4XMF A;  2ALL X;  4I3C A;  4OMW A;  3QKG A;  3HK1 A;  3NQ3 A;  3P6D A;  3BRN A;  4YKM A;  3HWD A;  4QYN A;  2FS7 A;  1E06 A;  3RSW A;  1I04 A;  4XMH A;  2K62 A;  2WWP A;  1SY3 A;  4ALB A;  1L6M A;  1SY1 A;  1GGL A;  1GM6 A;  3B2J A;  3NX2 A;  2LBV A;  1KT5 A;  1LNM A;  4YDB A;  1IFB A;  1LIE A;  4I9S A;  5F6Z A;  3CBC A;  2WSJ A;  4AZO A;  4LKP A;  3ELX A;  3EMM A;  4XMG A;  3APV A;  2AT6 X;  4NYR A;  1CBI A;  1BSQ A;  3KFF A;  1HN2 A;  3VG7 A;  4D6A A;  1KQX A;  1QQS A;  5D48 A;  1G5W A;  2K23 A;  5FFH A;  1SXU A;  1EQD A;  2G78 A;  4ZJ0 A;  3CQN A;  1YP6 A;  3VG4 A;  5HZ6 A;  1DFV A;  3PPT A;  1TOU A;  1BRQ A;  3CMP A;  1ERX A;  3D97 A;  1KOI A;  2A0A A;  5H9N A;  3NP1 A;  1AQB A;  1IKJ A;  5F58 A;  3FEL A;  5HA1 A;  1XCA A;  1FTP A;  3BX7 A;  2A2G A;  1EII A;  2FR2 A;  1YWB A;  1T8V A;  1AEL A;  1VYF A;  2CM9 A;  1MX8 A;  1RBP A;  2RCT A;  1X8O A;  4NNS A;  3BY0 A;  2L5P A;  4Y0P A;  4LKT A;  1YWC A;  3DTQ A;  1BSO A;  5D4A A;  5CE4 A;  1JZU A;  2A3F X;  4KII A;  4NNT A;  3FR2 A;  1B56 A;  4DQ4 A;  1BWY A;  2JU7 A;  1SY2 A;  1ZNE A;  5L8N A;  1H91 A;  4WFU A;  4YH0 A;  1B8E A;  5HCE C;  2P8G A;  2W2A A;  3RZY A;  3WJB A;  5HCC C;  1UZ2 X;  2L67 A;  4ZHG A;  1PBO A;  1E02 A;  4EDE A;  4HPB A;  4QGV A;  1PMP A;  5IO5 A;  3ELZ A;  2WEX A;  1KT6 A;  3KFI A;  2HZQ A;  2MO5 A;  1DZM A;  1CBR A;  4ARH A;  5HZ5 A;  3PH6 A;  1LF7 A;  1CRB A;  2E4J A;  3BSZ E;  1I06 A;  1HMS A;  5EDC A;  1HMT A;  4GRJ A;  4PSQ A;  2HLV A;  2AT3 X;  4A1Y A; 
#chains in the Genus database with same CATH topology
 4GGR A;  2PI3 O;  1E00 A;  1HBQ A;  5HTD A;  1LEL A;  1VWM B;  3HPE A;  3WBG A;  4CDC A;  2FWV A;  2HMB A;  1LDQ A;  4I9R A;  3APW A;  4KC7 A;  5LKF A;  5IO5 A;  1HMR A;  5LJE A;  4UU3 A;  2VFB A;  3HOE A;  2XST A;  4HPD A;  1SWP A;  4YBU A;  1NQM A;  3NPO A;  1MM9 A;  4YCH A;  1ZNG A;  5KHP A;  1DV9 A;  4IMN A;  2OY8 A;  2X8T A;  4IMO A;  4BX6 A;  3RKG A;  2WEW A;  2HYS A;  1VWF B;  2AF5 A;  5B5G A;  4U3Q A;  1LUQ A;  4XME A;  4ORS A;  4ORU A;  4TQ2 A;  4COT A;  1RSU B;  1VWP B;  1AB0 A;  1EI5 A;  4AW8 A;  1SXX A;  4I95 A;  1MK5 A;  2L68 A;  4QRL A;  3RY2 A;  1RXK A;  1MDC A;  3MVF A;  1IFC A;  4YGZ A;  1FEN A;  1VWJ B;  4I3D A;  1K24 A;  2AL0 X;  5BVS A;  1GT4 A;  1SWF A;  1SWU A;  3HOL A;  4ES7 A;  4Y59 A;  1X8Q A;  3DSZ A;  4PJ2 A;  5DG4 A;  4EQA C;  3TGA A;  4A8Z A;  2RTM A;  2Y3E A;  1DZP A;  4CDD A;  1SWK A;  2CBR A;  2MM3 A;  4YFQ A;  4ODD A;  1A18 A;  4QZU A;  3WJD A;  4L1N A;  4OS0 A;  1O8V A;  4Y5D A;  2EU7 X;  3ZI8 A;  4BCS A;  2RTA A;  1DC9 A;  2IZC B;  3B2I A;  5IRU A;  4QGX A;  3EBW A;  1W5R A;  2A13 A;  2AT0 X;  4OEL A;  1IJ8 A;  3CKG A;  4INN A;  1LIF A;  1FEM A;  3V8U A;  2IFB A;  2FGS A;  1LCZ A;  1FJ1 E;  3WZO A;  2I5Z O;  4HPC A;  1SWL A;  2Y3F A;  3NX1 A;  3CQR A;  2C1S A;  3TF6 A;  4CPH A;  1EUO A;  4BX7 A;  3AEH A;  3I17 A;  1CBQ A;  5HCD C;  1N9M A;  1O1U A;  5L8I A;  2IZB A;  1RXJ A;  4MEE A;  1GT3 A;  4BJ8 A;  1SLF B;  3ZQ3 A;  5IXG A;  4NP1 A;  4AYH A;  4DQ3 A;  2G7B A;  1ZND A;  4U9C A;  4B55 A;  2JOZ A;  2A5B A;  1QY0 A;  2RTN B;  3NAD A;  4Y0S A;  1BSY A;  2BS6 A;  1NGL A;  2OF9 A;  3G7X A;  2AT5 X;  4GGT A;  2XKL A;  3FIQ A;  4LZU A;  4YBP A;  2KW1 A;  4ZHD A;  1Y52 X;  3BS2 A;  1VPR A;  2OFB A;  1ICM A;  4IBA A;  1GX8 A;  1OEE A;  1VWK B;  3NQK A;  4NV8 A;  2X34 A;  5L3Y A;  1FDQ A;  1GKA B;  1NQN A;  2OVE A;  2JN3 A;  2QOS C;  3KFG A;  2RTR B;  3E3C A;  1ACD A;  1HQQ A;  2KT4 B;  4IAB A;  4TKJ A;  4Z2O A;  4YKO A;  4ZHH A;  4LZV A;  3MM0 A;  1SWO A;  4BGF A;  5C0N A;  5CHK A;  1JMX A;  4NYQ A;  4ZR2 A;  4YFR A;  3ZW2 A;  4IB8 A;  1DF3 A;  1ALB A;  1BJ7 A;  2JU8 A;  1SRI A;  1X8P A;  3I0A A;  3U03 A;  1YWA A;  4KH8 A;  4O3Y A;  1VWR B;  1TXL A;  2X32 A;  3CKF A;  3P02 A;  3C76 X;  1SWS A;  1ZNH A;  1FE3 A;  3SLO A;  1NP1 A;  2G8C O;  1SRF A;  3AKN A;  4FBV A;  2WUT A;  2GC9 A;  3JS1 A;  5AJC A;  5B5F A;  5HZ8 A;  1DZJ A;  2RCQ A;  1R0U A;  2QMI A;  4RUU A;  4ALO A;  3D96 A;  3O22 A;  2ACO A;  5EZ2 A;  1HXZ A;  3TZS A;  4CPF A;  2FT9 A;  1JJX A;  3EC5 A;  1QWD A;  2OVA A;  1JQP A;  3GAQ A;  2MF6 A;  1DF8 A;  4GD9 A;  4I3B A;  4O4X A;  4O9S A;  5BVT A;  3CWK A;  5EDB A;  2BS5 A;  2AVI A;  2WPU A;  1GT5 A;  2CZT A;  2DJG A;  1QFT A;  3PED A;  1Y53 X;  4IB9 A;  3PQS A;  4GJS A;  1ADL A;  3UEX A;  1OEJ A;  4CV7 A;  2LB6 A;  2F73 A;  2FHL A;  4MVL A;  5CSE A;  5HAE A;  1IIU A;  2OY1 O;  3AUM O;  1S7D A;  2LKK A;  2ZAG A;  4ON1 A;  2MHD A;  2FS6 A;  3VG2 A;  4YCE A;  3FA8 A;  1JMZ A;  3FA9 A;  5BVQ A;  3TGB A;  3HWE A;  2IZF B;  3ZW0 B;  1EXS A;  2WR6 A;  1TOW A;  2BLG A;  3SOT A;  2WQA E;  1YUP A;  4RUN A;  1KGL A;  3RDS A;  3SLJ A;  4I6S A;  3FR4 A;  2Q2P A;  2GJ5 A;  3FYF A;  5LJC A;  4GKC A;  5HZ9 A;  1STP A;  2QO5 A;  3STK A;  2GTF X;  2BHV A;  1DZK A;  1SWJ A;  2FLJ A;  2IZL B;  2ANS A;  2OF8 A;  2WQ9 A;  4R0B A;  5H9K A;  4M6S A;  1P6P A;  1I9H A;  3TGC A;  1NC9 A;  2GTL M;  1D3S A;  3H3I A;  1CJ5 A;  1VYG A;  3AKM A;  5FQ7 E;  4BX5 B;  1SXW A;  1JBH A;  1LCV A;  2ASN X;  3B2K A;  3P6G A;  5L8O A;  1MEP A;  3ZUO A;  4Z6J A;  2LBA A;  4BVM A;  2OY7 A;  1U18 A;  2RTP B;  1A2D A;  2VFC A;  3KFH A;  3HWG A;  2HKD A;  1VWA B;  4HFO A;  1PTS A;  3UEV A;  2CM4 A;  1SWB A;  4XMD A;  1U17 A;  1VWC B;  4U8U O;  3T6F A;  3L4R A;  1VWN B;  1SWR A;  1NP4 A;  4CDF A;  1U0X A;  1SLE B;  2GTL O;  1KFF A;  3D95 A;  5D8J A;  4QYP A;  4GU8 A;  5EPQ A;  2KTD A;  1GX9 A;  2X8F A;  3BU9 A;  5H8T A;  4YFP A;  3FA6 A;  4O4U A;  1KT3 A;  1BEB A;  2R56 A;  3PP6 A;  4EXZ A;  3PDF A;  1STR B;  4GH7 A;  3SZH A;  1S2P A;  3U0D A;  3RDQ A;  1AVD A;  1LID A;  4NV7 A;  3IA8 A;  3T2X A;  1LCW A;  1OBP A;  1KT4 A;  2RQ0 A;  2JMB A;  2M4L A;  5F6B A;  3SZJ A;  4O3Z A;  1IKE A;  1QY2 A;  3EBK A;  2QM9 A;  1SWC A;  3P6E A;  4JHQ A;  3RE5 A;  1VWI B;  4ORX A;  4ORY A;  1BBP A;  5LKE A;  1SWN A;  3RBY A;  2A8G A;  5BYP A;  2CZU A;  3C77 X;  3FW4 A;  5IO6 A;  3NR3 A;  3ZUI A;  2OVD A;  1EIO A;  1G74 A;  1E2T A;  2Y32 A;  2F01 A;  3WZN A;  4AZM A;  4AZR A;  3RY1 A;  1SWD A;  3UEU A;  1SRG A;  2O62 A;  4QZT A;  5AQ6 A;  3BX8 A;  2RA6 A;  2FKG A;  2Q39 A;  3ZZV A;  4EFG A;  1W6F A;  1SWE A;  2NNQ A;  2X45 A;  4I60 A;  1EW3 A;  3ZW1 A;  3FEN A;  2DJF A;  4AZP A;  4O4O A;  5FQ8 E;  4FBO A;  2HZR A;  3FR5 A;  3VG6 A;  2OFM X;  4O4S A;  1G85 A;  4CSB A;  2RTK A;  1MOY A;  3VG3 A;  1QAB E;  3T1D A;  1A57 A;  4BQU A;  2X56 A;  3PEC A;  5EEE A;  3OD9 A;  1KT7 A;  2LFO A;  3KQ0 A;  2ACP X;  1D2U A;  3K3L A;  1KZW A;  4GET A;  1MVG A;  1W4T A;  2FRS A;  1URE A;  1OPA A;  3APU A;  2AH7 X;  2Q4N A;  5IRA A;  3STN A;  4KCA A;  3WJG A;  3RE6 A;  1Z24 A;  1HQP A;  3RDX A;  3X00 A;  3VGW A;  3OJY C;  1JJU A;  2OY5 O;  2FR3 A;  2MJI A;  1SLG B;  4IAW A;  5H9L A;  1EPB A;  3PH5 A;  1NDJ A;  4WBK A;  4ZGU A;  1B0O A;  1LIB A;  2N93 A;  2IZJ A;  3NQ9 A;  2RTL A;  3VPJ E;  3WJC A;  4K19 A;  1GT1 A;  2NND A;  3VG5 A;  3VE1 A;  1RST B;  4DNE A;  4AZQ A;  3GE2 A;  5LJD A;  4MIR A;  2AMM X;  4QQ1 A;  2QCB A;  2QOM A;  3D9W A;  2RTO B;  5AJB A;  4GDZ A;  5HBS A;  5HTE A;  1STS B;  1AVG I;  1OBU A;  4TJZ A;  4BX6 B;  1TVQ A;  4ORR A;  5F7G A;  1KXO A;  2IZH B;  1B4M A;  2RTI B;  3KZA A;  1T68 X;  2QO4 A;  4IB6 A;  1KZX A;  4O3W A;  3RWX A;  2HNX A;  1E5P A;  3STM X;  3C78 X;  4ZH9 A;  3WJE A;  3EW2 A;  4GNY A;  2JGS A;  2C4I A;  2QO6 A;  4ID2 A;  3SAO A;  5IO7 A;  3KVN A;  4ZCB A;  4A1H A;  1GXA A;  1ICN A;  1OPB A;  2UZ2 A;  2IZI A;  3Q6L A;  4IRW A;  1LFO A;  4LQZ A;  1LKE A;  1RAV A;  1HBP A;  2AKQ A;  4TLJ A;  3FA7 A;  2A2U A;  1HY2 A;  4Y0Q A;  3EW1 A;  1X8N A;  4NLI A;  2X46 A;  1WUB A;  3FLL A;  3P6C A;  3BLG A;  1YWD A;  1SXY A;  2JU3 A;  1WBI A;  2A5C A;  2FTB A;  4GE1 A;  1KQW A;  4Z2V A;  1PBY A;  4ZFX A;  2L9C A;  1JJJ A;  4MVI A;  3VHI A;  5HWZ A;  1Y0G A;  1PEE A;  2FHN X;  2I5V O;  1CBS A;  3HWF A;  2OFA A;  3EYC A;  4FGI B;  1N0S A;  2NP1 A;  5FEN A;  5EED A;  1O1V A;  2NNE A;  3CR6 A;  1YIV A;  1VWQ B;  1OBQ A;  1SMP I;  1T0V A;  5F1E A;  3F9D A;  1X71 A;  4N7C A;  4HWM A;  1IW2 A;  1VWE B;  4ZGF A;  4OS8 A;  1BM5 A;  1SWA A;  3B2H A;  1AVE A;  4TNN A;  3WYQ A;  5HZQ A;  2Q2M A;  3ZW1 B;  5B3M O;  2R74 A;  3APX A;  3HTY A;  3P6H A;  4YMY A;  1VWD B;  5FAZ A;  2C1Q A;  1I78 A;  5K06 A;  2Q9S A;  3OBL A;  5DPQ A;  4FBR A;  2G5L A;  1KL3 A;  1TW4 A;  2POA A;  4Y0R A;  3O2Y A;  4BX7 B;  4CPH B;  2X8S A;  5LJG A;  5LJH A;  3O19 A;  4IB7 A;  4ZHF A;  1XKI A;  2MWH A;  1ZNK A;  1RXH A;  1JYJ A;  2RTG B;  3CBS A;  5B10 O;  1LPJ A;  1ZNL A;  2W2F A;  1PM1 X;  4MVK A;  3RDU A;  1QFV A;  3F8A A;  1I05 A;  5H9A A;  2RTF B;  1OSP O;  4GUZ A;  1VWL B;  1ERB A;  2RTE B;  3FEP A;  1UYN X;  3FMZ A;  4QNI A;  2FKJ A;  2G79 A;  4GK9 A;  3EM0 A;  2LA7 A;  3FID A;  3FEK A;  1BRP A;  3U9P C;  5IRW A;  4ZH6 A;  4WHI A;  4EKV A;  1ZRY A;  2OZQ A;  1SLD B;  4IAX A;  4A60 A;  5JR8 A;  4UU2 A;  5AEO A;  1MUP A;  4MIS A;  3IFB A;  3P6F A;  2OL6 O;  2BSZ A;  4GDA A;  2OYB O;  1QG5 A;  2DM5 A;  1SA8 A;  1OEK A;  1LIC A;  1ML7 A;  4HPA A;  3WZQ A;  4EEJ A;  5HA0 A;  3S60 A;  3JSQ A;  4ZHC A;  4YGG A;  2OFR X;  2YG2 A;  4ORW A;  1EAL A;  2PY1 A;  1VWG B;  1KL5 A;  2RN4 A;  4M7M A;  1SY0 A;  1RLB E;  4GGZ A;  1I4U A;  2CBS A;  5LJB A;  1K3B A;  3F6Z B;  2X4M A;  5D45 A;  5B27 A;  3S5V A;  5KID A;  4YGH A;  3MBT A;  1GKA A;  1N43 A;  4GJV A;  1EPA A;  4OMX A;  4XMC A;  2W2B A;  3WVM A;  1Y9T A;  2IZE B;  1X89 A;  1BLR A;  4WFV A;  1S44 A;  3S26 A;  1SRE A;  5D47 A;  1A3Y A;  1MX7 A;  1X8U A;  2AT8 X;  2UYW A;  4YDA A;  3S5X A;  3BDR A;  3FW5 A;  4D6B A;  5K68 A;  5B29 A;  5B11 O;  2RD7 C;  1Y55 X;  4AZN A;  5KIC A;  4N7D A;  4MVE A;  1YP7 A;  4Z28 A;  3BU1 A;  1SWG A;  1G7N A;  4TKH A;  4NLJ A;  2Z4I A;  1JYD A;  1SRJ A;  1SWT A;  3OE3 A;  4O49 A;  1FEL A;  4QGW A;  4Z27 A;  3B2L A;  5LJK A;  4OS3 A;  4GNW A;  3D4R A;  1JV4 A;  3SLT A;  3WJF A;  4TKB A;  3UEW A;  4U8U N;  2R73 A;  3WXQ A;  1QY1 A;  4JNJ A;  4QAE A;  2IZA A;  1VWO B;  4BOE A;  2GTL N;  4L3R A;  4XMF A;  2BC3 A;  2ALL X;  4I3C A;  4CPI A;  2RTJ A;  4OMW A;  3QKG A;  5FQ6 E;  3FDC A;  3HK1 A;  1LDO A;  3NQ3 A;  3P6D A;  3BRN A;  4YKM A;  3T2W A;  3HWD A;  4QYN A;  2FS7 A;  3VHM A;  1E06 A;  2X55 A;  4KC8 A;  3RSW A;  3WYP A;  1I04 A;  4XMH A;  2K62 A;  2WWP A;  1SY3 A;  4ALB A;  1L6M A;  1SY1 A;  1GGL A;  1GM6 A;  1VWH B;  3B2J A;  3NX2 A;  4JO6 A;  2LBV A;  1KT5 A;  3ZW0 A;  1LNM A;  4YDB A;  1IFB A;  1LIE A;  1SWH A;  4I9S A;  5F6Z A;  3CBC A;  2WSJ A;  4AZO A;  3PQU A;  4LKP A;  3ELX A;  3RDM A;  1SWQ A;  3EMM A;  1SRH A;  3APV A;  4XMG A;  5F2B A;  2AT6 X;  4NYR A;  4YVB A;  1CBI A;  1BSQ A;  3KFF A;  1HN2 A;  3VG7 A;  4D6A A;  1KQX A;  1QQS A;  3RDO A;  5D48 A;  1G5W A;  4Z2P A;  3VHH A;  3LHN A;  4BX5 A;  2K23 A;  1VWB B;  5FFH A;  1JIW I;  1SXU A;  1EQD A;  3T6L A;  2G78 A;  2F09 A;  4ZJ0 A;  2YMS A;  3CQN A;  1YP6 A;  3VG4 A;  4C5P A;  5HZ6 A;  1KL4 A;  5CYB A;  2IZG B;  1DFV A;  3PPT A;  2RTC B;  2VDF A;  1TOU A;  1BRQ A;  3CMP A;  1ERX A;  3D97 A;  1KOI A;  2A0A A;  1VYO A;  5H9N A;  3NP1 A;  1AQB A;  1IKJ A;  4FQB B;  5JD2 A;  5F58 A;  3FEL A;  4GZV A;  5HA1 A;  3QQ2 A;  4JGL A;  4OEM A;  1XCA A;  1FTP A;  2OVS A;  3BX7 A;  2A2G A;  3LV4 A;  1EII A;  4OKA A;  2FR2 A;  1N7Y A;  1T8V A;  1YWB A;  1VYF A;  2KD2 A;  2RTH B;  2CM9 A;  2Z4H A;  1AEL A;  1MX8 A;  1RBP A;  2RCT A;  1X8O A;  2OL8 O;  4NNS A;  2ZSC A;  4O3X B;  3BY0 A;  3ZWE A;  2L5P A;  2JW1 A;  3NBX X;  4BBO A;  1UYO X;  4LKT A;  1YWC A;  2IZK A;  1Y9L A;  4Y0P A;  3LTW A;  3P24 A;  3DTQ A;  3Q34 A;  1BSO A;  2BT9 A;  5D4A A;  5CE4 A;  1JZU A;  2A3F X;  4KII A;  4NNT A;  4CK4 A;  3FR2 A;  1B56 A;  2KTS A;  5B2A O;  4DQ4 A;  1BWY A;  2JU7 A;  2RTB B;  3JQO A;  1SY2 A;  1ZNE A;  3MX7 A;  1H91 A;  4WFU A;  3WZP A;  2ZAI A;  5L8N A;  4YH0 A;  1B8E A;  2RTQ B;  5HCE C;  4CDE A;  2P8G A;  2W2A A;  3RZY A;  3WJB A;  5HCC C;  3UAQ A;  1UZ2 X;  2L67 A;  4ZHG A;  1PBO A;  1E02 A;  4EDE A;  1NBX A;  4HPB A;  1PMP A;  2GH7 A;  3ELZ A;  3MG5 A;  3SZI A;  2WEX A;  4QGV A;  1KT6 A;  5K67 A;  3KFI A;  2HZQ A;  2MO5 A;  2RTD B;  4NW4 A;  1DZM A;  1CBR A;  4CPE A;  4KT5 A;  4ARH A;  5HZ5 A;  3PH6 A;  4ML7 B;  3WOV A;  2IZD B;  1N9Y A;  1LF7 A;  1CRB A;  2E4J A;  1GX3 A;  3BSZ E;  4DCB A;  1I06 A;  1HMS A;  5EDC A;  3VU1 A;  2CAM A;  3VE2 A;  1N4J A;  2OL7 A;  3N91 A;  1HMT A;  4GRJ A;  4PSQ A;  1HXL A;  2AT3 X;  2HLV A;  4U46 A;  3PK2 A;  4A1Y A;  4U8U M; 
#chains in the Genus database with same CATH homology
 1E00 A;  1HBQ A;  5HTD A;  3WBG A;  2FWV A;  2HMB A;  4I9R A;  3APW A;  4KC7 A;  5LKF A;  1HMR A;  5LJE A;  4UU3 A;  3HOE A;  2XST A;  4HPD A;  4YBU A;  3NPO A;  4YCH A;  1ZNG A;  5KHP A;  1DV9 A;  4IMN A;  4IMO A;  2X8T A;  3RKG A;  2WEW A;  2HYS A;  4U3Q A;  4XME A;  4ORS A;  4ORU A;  4TQ2 A;  4COT A;  1AB0 A;  1EI5 A;  4AW8 A;  1SXX A;  4I95 A;  2L68 A;  4QRL A;  1MDC A;  3MVF A;  1IFC A;  4YGZ A;  1FEN A;  4I3D A;  2AL0 X;  5BVS A;  1GT4 A;  3HOL A;  4ES7 A;  1X8Q A;  3DSZ A;  4PJ2 A;  5DG4 A;  4EQA C;  3TGA A;  4A8Z A;  1DZP A;  2CBR A;  2MM3 A;  4YFQ A;  4ODD A;  1A18 A;  4QZU A;  3WJD A;  4L1N A;  4OS0 A;  1O8V A;  2EU7 X;  3ZI8 A;  1DC9 A;  3B2I A;  4QGX A;  3EBW A;  2A13 A;  2AT0 X;  4INN A;  1LIF A;  1FEM A;  3V8U A;  2IFB A;  4HPC A;  3NX1 A;  3TF6 A;  3CQR A;  5HCD C;  1EUO A;  3I17 A;  1CBQ A;  1O1U A;  5L8I A;  1GT3 A;  3ZQ3 A;  4NP1 A;  4AYH A;  4DQ3 A;  2G7B A;  1ZND A;  4U9C A;  2JOZ A;  1QY0 A;  3NAD A;  4Y0S A;  1BSY A;  2BS6 A;  1NGL A;  3G7X A;  2AT5 X;  2XKL A;  3FIQ A;  4LZU A;  4YBP A;  2KW1 A;  4ZHD A;  3BS2 A;  4CK4 A;  1VPR A;  4IBA A;  1ICM A;  1GX8 A;  1OEE A;  3NQK A;  1FDQ A;  1GKA B;  2OVE A;  2JN3 A;  2QOS C;  3KFG A;  3E3C A;  4TKJ A;  1ACD A;  2KT4 B;  4IAB A;  4ZHH A;  4YKO A;  4LZV A;  5C0N A;  4NYQ A;  4ZR2 A;  4YFR A;  3ZW2 A;  4IB8 A;  1DF3 A;  1ALB A;  1BJ7 A;  2JU8 A;  3I0A A;  1X8P A;  3U03 A;  1YWA A;  4KH8 A;  4O3Y A;  1TXL A;  3P02 A;  3C76 X;  1ZNH A;  1FE3 A;  1NP1 A;  3AKN A;  4FBV A;  2WUT A;  2GC9 A;  3JS1 A;  5AJC A;  5HZ8 A;  1DZJ A;  2RCQ A;  1R0U A;  2QMI A;  4RUU A;  4ALO A;  3D96 A;  3O22 A;  2ACO A;  5EZ2 A;  3TZS A;  2FT9 A;  1JJX A;  1QWD A;  2OVA A;  3GAQ A;  4O4X A;  4O9S A;  5JR8 A;  4I3B A;  5BVT A;  3CWK A;  5EDB A;  2BS5 A;  1GT5 A;  2CZT A;  3PED A;  1QFT A;  4IB9 A;  3PQS A;  3UEX A;  1ADL A;  1OEJ A;  4CV7 A;  2LB6 A;  2F73 A;  4MVL A;  5HAE A;  1IIU A;  1S7D A;  2LKK A;  2ZAG A;  4ON1 A;  2MHD A;  2FS6 A;  3VG2 A;  4YCE A;  3FA8 A;  3FA9 A;  5BVQ A;  3TGB A;  3HWE A;  3ZW0 B;  1EXS A;  2WR6 A;  1TOW A;  2BLG A;  3SOT A;  2WQA E;  1YUP A;  4RUN A;  1KGL A;  4I6S A;  3FR4 A;  2Q2P A;  2GJ5 A;  3FYF A;  5LJC A;  4GKC A;  5HZ9 A;  2QO5 A;  3STK A;  2GTF X;  2BHV A;  1DZK A;  2FLJ A;  2ANS A;  2WQ9 A;  5H9K A;  4R0B A;  4M6S A;  1P6P A;  3TGC A;  2GTL M;  1D3S A;  3H3I A;  1CJ5 A;  1VYG A;  3AKM A;  5FQ7 E;  1SXW A;  1JBH A;  2ASN X;  3B2K A;  3P6G A;  5L8O A;  3ZUO A;  2LBA A;  4BVM A;  1U18 A;  1A2D A;  3KFH A;  3HWG A;  4HFO A;  3UEV A;  2CM4 A;  4XMD A;  1U17 A;  4U8U O;  3L4R A;  1NP4 A;  1U0X A;  2GTL O;  3D95 A;  5D8J A;  4QYP A;  4GU8 A;  5EPQ A;  2KTD A;  1GX9 A;  2X8F A;  3BU9 A;  5H8T A;  4YFP A;  3FA6 A;  4O4U A;  1KT3 A;  1BEB A;  2R56 A;  3PP6 A;  4EXZ A;  4GH7 A;  1S2P A;  3U0D A;  1LID A;  3IA8 A;  1OBP A;  1KT4 A;  2RQ0 A;  2M4L A;  2JMB A;  5F6B A;  4O3Z A;  1IKE A;  1QY2 A;  3EBK A;  2QM9 A;  3P6E A;  4ORX A;  4ORY A;  1BBP A;  5LKE A;  3RBY A;  5BYP A;  2CZU A;  3C77 X;  3FW4 A;  5IO6 A;  3NR3 A;  3ZUI A;  2OVD A;  1EIO A;  1G74 A;  4AZM A;  4AZR A;  3UEU A;  2O62 A;  4QZT A;  5AQ6 A;  3BX8 A;  2RA6 A;  2Q39 A;  3ZZV A;  4EFG A;  1BM5 A;  2NNQ A;  2X45 A;  1EW3 A;  3ZW1 A;  3FEN A;  4AZP A;  4O4O A;  5FQ8 E;  4FBO A;  2HZR A;  3FR5 A;  3VG6 A;  2OFM X;  4O4S A;  1G85 A;  4CSB A;  1A57 A;  3VG3 A;  1QAB E;  3T1D A;  4BQU A;  3PEC A;  5EEE A;  3OD9 A;  1KT7 A;  2LFO A;  3KQ0 A;  2ACP X;  1D2U A;  3K3L A;  1KZW A;  4GET A;  1MVG A;  2AH7 X;  2FRS A;  1URE A;  1OPA A;  3APU A;  3WJG A;  2Q4N A;  3STN A;  4KCA A;  1Z24 A;  1HQP A;  3OJY C;  2FR3 A;  2MJI A;  4IAW A;  5H9L A;  1EPB A;  3PH5 A;  4WBK A;  4ZGU A;  1B0O A;  1LIB A;  2N93 A;  3NQ9 A;  3VPJ E;  3WJC A;  4K19 A;  1GT1 A;  2NND A;  3VG5 A;  3VE1 A;  4AZQ A;  3GE2 A;  5LJD A;  4MIR A;  2AMM X;  4QQ1 A;  5AJB A;  5HBS A;  5HTE A;  4GDZ A;  1AVG I;  1OBU A;  4TJZ A;  1TVQ A;  4ORR A;  5F7G A;  1KXO A;  1B4M A;  3KZA A;  1T68 X;  2QO4 A;  4IB6 A;  1KZX A;  4O3W A;  3RWX A;  2HNX A;  1E5P A;  3STM X;  3C78 X;  4ZH9 A;  3WJE A;  4GNY A;  4ID2 A;  2QO6 A;  3SAO A;  5IO7 A;  4ZCB A;  4A1H A;  1GXA A;  1ICN A;  1OPB A;  3Q6L A;  1LFO A;  4LQZ A;  1LKE A;  1HBP A;  2AKQ A;  4TLJ A;  3FA7 A;  2A2U A;  4Y0Q A;  1X8N A;  4NLI A;  2X46 A;  3FLL A;  3P6C A;  3BLG A;  1YWD A;  1SXY A;  2JU3 A;  2FTB A;  4GE1 A;  1KQW A;  4ZFX A;  1JJJ A;  2L9C A;  4MVI A;  5HWZ A;  1PEE A;  3HWF A;  1CBS A;  4FGI B;  3EYC A;  5FEN A;  1N0S A;  2NP1 A;  5EED A;  1O1V A;  2NNE A;  3CR6 A;  1YIV A;  1OBQ A;  1SMP I;  1T0V A;  5F1E A;  3F9D A;  1X71 A;  4N7C A;  4HWM A;  1IW2 A;  4ZGF A;  4OS8 A;  3B2H A;  4TNN A;  3ZW1 B;  5HZQ A;  2Q2M A;  4YMY A;  2R74 A;  3APX A;  3HTY A;  3P6H A;  5FAZ A;  5K06 A;  2Q9S A;  3OBL A;  5DPQ A;  4FBR A;  1TW4 A;  2POA A;  4Y0R A;  3O2Y A;  5LJH A;  2X8S A;  5LJG A;  3O19 A;  4IB7 A;  4ZHF A;  1XKI A;  2MWH A;  1ZNK A;  3CBS A;  1JYJ A;  1LPJ A;  1ZNL A;  2W2F A;  1PM1 X;  4MVK A;  1QFV A;  3F8A A;  1I05 A;  5H9A A;  1ERB A;  3FMZ A;  3FEP A;  4QNI A;  2G79 A;  4GK9 A;  3EM0 A;  2LA7 A;  3U9P C;  3FEK A;  1BRP A;  4ZH6 A;  4WHI A;  1ZRY A;  2OZQ A;  4A60 A;  4IAX A;  4UU2 A;  5AEO A;  1MUP A;  4MIS A;  3IFB A;  3P6F A;  1QG5 A;  2DM5 A;  1SA8 A;  1OEK A;  1LIC A;  1ML7 A;  4HPA A;  4EEJ A;  5HA0 A;  3S60 A;  3JSQ A;  4ZHC A;  4YGG A;  2OFR X;  2YG2 A;  4ORW A;  1EAL A;  2PY1 A;  4M7M A;  2RN4 A;  1SY0 A;  1RLB E;  1I4U A;  2CBS A;  5LJB A;  3F6Z B;  5D45 A;  5B27 A;  3S5V A;  5KID A;  4YGH A;  3MBT A;  1GKA A;  1EPA A;  4OMX A;  4XMC A;  2W2B A;  3WVM A;  1Y9T A;  1BLR A;  1X89 A;  4WFV A;  1S44 A;  3S26 A;  5D47 A;  1A3Y A;  1MX7 A;  1X8U A;  2AT8 X;  4YDA A;  3S5X A;  3BDR A;  3FW5 A;  4D6B A;  5B29 A;  2RD7 C;  4AZN A;  5KIC A;  4N7D A;  4MVE A;  1YP7 A;  3BU1 A;  1G7N A;  4TKH A;  4NLJ A;  2Z4I A;  1JYD A;  4O49 A;  3OE3 A;  4QGW A;  1FEL A;  3B2L A;  5LJK A;  4OS3 A;  4GNW A;  3D4R A;  1JV4 A;  3WJF A;  4TKB A;  3UEW A;  4U8U N;  2R73 A;  3WXQ A;  1QY1 A;  4BOE A;  4QAE A;  2GTL N;  4L3R A;  4XMF A;  2ALL X;  4I3C A;  4OMW A;  3QKG A;  5FQ6 E;  3HK1 A;  3NQ3 A;  3P6D A;  3BRN A;  4YKM A;  3HWD A;  4QYN A;  2FS7 A;  1E06 A;  4KC8 A;  3RSW A;  1I04 A;  4XMH A;  2K62 A;  2WWP A;  1SY3 A;  4ALB A;  1L6M A;  1SY1 A;  1GGL A;  1GM6 A;  3B2J A;  3NX2 A;  2LBV A;  3ZW0 A;  1KT5 A;  1LNM A;  4YDB A;  1IFB A;  1LIE A;  4I9S A;  5F6Z A;  3CBC A;  2WSJ A;  4AZO A;  3PQU A;  4LKP A;  3ELX A;  3EMM A;  4XMG A;  3APV A;  2AT6 X;  4NYR A;  1CBI A;  1BSQ A;  3KFF A;  1HN2 A;  3VG7 A;  4D6A A;  1KQX A;  1QQS A;  5D48 A;  1G5W A;  3LHN A;  2K23 A;  5FFH A;  1JIW I;  1SXU A;  1EQD A;  2G78 A;  2F09 A;  4ZJ0 A;  2YMS A;  3CQN A;  1YP6 A;  3VG4 A;  5HZ6 A;  5CYB A;  1DFV A;  3PPT A;  1TOU A;  1BRQ A;  3CMP A;  1ERX A;  3D97 A;  1KOI A;  2A0A A;  5H9N A;  3NP1 A;  1AQB A;  1IKJ A;  4FQB B;  5F58 A;  3FEL A;  4GZV A;  5HA1 A;  4JGL A;  1XCA A;  1FTP A;  2OVS A;  3BX7 A;  2A2G A;  3LV4 A;  1EII A;  2FR2 A;  1YWB A;  1T8V A;  2KD2 A;  1VYF A;  1AEL A;  2CM9 A;  2Z4H A;  1MX8 A;  1RBP A;  2RCT A;  1X8O A;  4NNS A;  4O3X B;  3BY0 A;  3ZWE A;  2L5P A;  2JW1 A;  3NBX X;  4Y0P A;  4LKT A;  1YWC A;  1Y9L A;  3P24 A;  3DTQ A;  1BSO A;  2BT9 A;  5D4A A;  5CE4 A;  1JZU A;  2A3F X;  4KII A;  4NNT A;  3FR2 A;  1B56 A;  2KTS A;  4DQ4 A;  1BWY A;  2JU7 A;  3JQO A;  1SY2 A;  1ZNE A;  3MX7 A;  1H91 A;  4WFU A;  5L8N A;  2ZAI A;  4YH0 A;  1B8E A;  5HCE C;  2P8G A;  2W2A A;  3RZY A;  3WJB A;  5HCC C;  3UAQ A;  2L67 A;  1UZ2 X;  4ZHG A;  1PBO A;  1E02 A;  4EDE A;  4HPB A;  4QGV A;  1PMP A;  5IO5 A;  3ELZ A;  2WEX A;  1KT6 A;  3KFI A;  2HZQ A;  2MO5 A;  4NW4 A;  1DZM A;  1CBR A;  4KT5 A;  4ARH A;  5HZ5 A;  3PH6 A;  4ML7 B;  3WOV A;  1LF7 A;  1CRB A;  2E4J A;  3BSZ E;  1I06 A;  1HMS A;  5EDC A;  3VU1 A;  3VE2 A;  3N91 A;  1HMT A;  4GRJ A;  4PSQ A;  2HLV A;  2AT3 X;  4A1Y A;  4U8U M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...