1U1MA

Crystal structure of up1 complexed with d(ttagggtta 7gu gg); a human telomeric repeat containing 7-deaza-guanine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
183
structure length
183
Chain Sequence
b'KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*GP*GP*GP*TP*TP*AP*(7GU)P*GP*G)-3'
publication title Human UP1 as a Model for Understanding Purine Recognition in the Family of Proteins Containing the RNA Recognition Motif (RRM).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/dna
total genus 49
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1mA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1mA02
2YKAA 3VAIA 2KRBA 2E5JA 3EGZA 1X4EA 2MZJA 2K3KA 3G96A 3CCRS 1WG1A 2RVJA 2U2FA 2MB0B 2M2BA 2EVZA 2CQPA 2CPHA 2KG1A 3VAHA 2NZ4A 4UQTA 1WF2A 2A3JA 4RU2A 3NS6A 3G9CA 1SJQA 2CPEA 2HZCA 2DGQA 4OZ1A 4ZKAA 2OTJS 2ADCA 2M9KA 3CCMS 1OIAA 1R8HA 2MZQA 3THTA 3ZZYA 4PKDB 1OPIA 3UCZP 4CIOA 1WI8A 3VAFA 2DNQA 2FY1A 1H6KX 5IFMA 1AUDA 1U1MA 2DH9A 4Z2XA 2LEAA 4U67Q 2LECA 4TLQA 5HL7Q 1HL6A 2D9PA 2HGMA 5HO4A 2LKZA 4FXVA 3HHNB 3K0JA 1X5SA 1FXLA 3B4DA 1WEXA 2CPZA 4CH1A 2QFJA 2FPHX 3Q2SC 2MSTA 1SJFA 4IOCQ 2DGXA 2DNKA 3VF0B 1UFWA 1SJRA 3UCGA 3R1HA 3S7RA 2PE8A 1HD0A 1WG4A 1U1PA 2CPJA 1WG5A 1IQTA 1VQLS 4F25A 2F9DA 1VBXA 3SDEA 1H2UX 1ZH5A 1FO1A 1U1LA 2DGVA 3MD1A 3MD3A 2XB2D 1U1OA 3VAGA 2I38A 3CMES 2YTCA 2JRSA 1P27B 1SJ4P 2X1AA 1X5PA 2LQ5A 3SXLA 3THPA 4WFBQ 2MY8A 2Q79A 2LA4A 4PRFA 1DBDA 4C7QA 2J0QD 3NS5A 1X4BA 2O3DA 2V94A 4IO9Q 2KI2A 4F26A 1VC0A 2JWNA 3RW6A 2U1AA 2KH9A 3TO8A 2D3OR 2DGUA 1BY9A 1U6FA 3MUMP 1UP1A 2MQLA 2KM8B 3CC7S 1X4HA 2DNZA 5D78A 3J7YU 2M52A 4PR6A 1Q82T 4QPTA 1X4DA 1WHVA 2HYIB 1FJ7A 2GO9A 2AYBA 1URNA 3S8SA 2CQDA 2BZ2A 3V4MA 1DHMA 1QVGR 4EGLA 1WHWA 1PGZA 2J8AA 2ERRA 1VQ9S 2DB1A 2MKCA 1VQ7S 1VQMS 2G0CA 1XN9A 2KN4A 2DNNA 3CCVS 3P5TL 2OIHA 2RQCA 1SJ3P 4M5DB 2NLWA 2MKSA 2KYXA 2KHCA 1YJ9S 2CPXA 3H2VE 3L3CA 3MOJB 3NMRA 5DDOC 2QEXS 2MJUA 2MQQA 1W2BR 1B7FA 3N9UC 1WTBA 3CCLS 3S01A 2ZJRQ 1X0FA 1N8RT 1M5OC 2MSSA 4WCEQ 3G8SA 2DGWA 1ZZNA 5LSOA 2J0SD 2L41A 2RRAA 3PIOQ 3MI7X 1NJIT 1QM9A 1X4AA 2DHXA 1R8PA 2HVZA 2CQIA 2YWKA 1G2EA 2L08A 3UWTA 1YITS 3CC4S 1OO0B 3LPYA 3CC2S 3VAMA 3UD4P 4QQBA 3MURP 2UP1A 3NNHA 2LXIA 3IRWP 2CQGA 1CVJA 2DITA 2MXYA 1KOHA 1N88A 1A7GE 2M0GB 2I2YA 2CQ0A 2MQPA 4V19X 2XS2A 2AYEA 3ZZZA 2DHSA 3UCUP 4QU7A 1YJWS 5IM0A 2XSFA 2OSRA 2DISA 3S6EA 2DH7A 2LCWA 3Q2TC 2M7SA 5CXTA 5H1SV 3R27A 1JMTA 5JVGQ 2PEHA 2GHPA 2MGZB 1Q7YT 4OZ0A 2F9JA 5IQQA 3G8TA 1HA1A 1YJNS 2CPFA 2RRBA 1YWXA 1VC6A 2DH8A 1OWXA 2EK6A 1M90T 3P6YC 1VQ5S 2M88A 3NNCA 1FHTA 1U1QA 1FJEB 2CJKA 1PO6A 1WHYA 3LQVA 2JX2A 3G4SS 1X4FA 2OSQA 2MYFA 1U6BA 2FHOB 2KM8C 2D9OA 1YTYA 3D2WA 1H2TZ 2N3OA 1WF0A 5LSLA 2XS5A 1VQ4S 2G1DA 4TU9A 1U1NA 5GMKa 4ERDA 2MKIA 1FT8A 3CXCR 5FJ4A 1D8ZA 4YOEA 2CPDA 2DGOA 2CQHA 1U1KA 2LXUA 1KD1T 2L9WA 2DNHA 5DETA 5DM6Q 2N3LA 2MQMA 4TU7A 1VBZA 5CA5A 3CUNA 5LXYA 2DNGA 5DDQC 3HI9A 3US5A 1D9AA 1QVFR 2KRRA 2LYVA 2YH0A 2MZTA 2FC8A 1WWHA 2KVIA 3IWNC 4YB1P 3TYTA 1WHXA 3BO4A 2LA6A 1M5PC 3B4MA 1A9NB 3CCJS 2DHGA 1FJCA 1VQPS 2KU7A 4P6QA 3BEGB 4LIRA 3DLLQ 2WBRA 3CCSS 1VBYA 1P1TA 3MUVP 5JVHQ 2E5GA 2M8HA 5LJ3Y 1O0PA 2K8GA 2CQCA 3EGNA 1VQKS 2MY7A 1FNXH 1VQOS 2AD9A 5GAHU 2M8DB 2BOPA 2M70A 2DNYA 4IUFA 3FEYB 5MLCV 1YIJS 3DXBA 2EK1A 2MQOA 1VQNS 2XNQA 5LJ5Y 1N52B 1K8AT 1YHQS 2KG0A 2E5HA 4CH0S 2CQ4A 3P49B 5DDRC 3JB9k 3G71S 1S79A 3VAKA 2HGLA 2J76E 5D77A 2AYMA 1HD1A 3PIPQ 4YUDA 3CMAS 1VC5A 1K73T 2N7CA 1VQ8S 2LEBA 1U1RA 2HGNA 1X4GA 4WFAQ 3BS9A 2RS2A 1S72S 1K9MT 2RT3A 4LJMA 2KFYA 3MXHP 3SDEB 2B0GA 4C4WA 2MKKA 2KXNB 5DM7Q 3MUTP 1M1KT 4QU6A 2RUGA 1N54B 3CCES 4TU8A 2RNEA 1VQ6S 1SXLA 1WELA 3BO2A 2OJ3A 2CQ3A 2X1BA 2DO4A 5EN1A 1NU4A 3CTRA 3J7ZT 2XNRA 2MZSA 2QA4S 2CQ2A 2JVRA 2VOPA 4WKRA 1JJ4A 2G4BA 4A8XA 1WF1A 1KOOA 5LXRA 2XS7A 1JJ2R 4W92B 1X5TA 2DNRA 2RS8A 3CCUS 2RQ4A 1RKJA 2M4MA 2CQ1A 3P3DA 2F3JA 1F9FA 2MQNA 2E44A 4BS2A 3G6ES 2LMIA 3RW7A 1X4CA 3U1LA 5GAEU 3I56S 2ZJQQ 2FC9A 1Q81T 1H2VZ 2DNLA 2E5IA 2MPUA 2SXLA 3FEXB 1KC8T 4Y0FA 1M5VC 1M5KC 1UW4A 2DGTA 2DO0A 4Y00A 2MZ1A 2X1FA 4W90B 2KXHA 2N82B 5CYJA 2RU3A 2MHNA 3BO3A 4IOAQ 3VALA 4WF9Q 3R1LA 1L3KA 3CPWR 5DDPC 5GAGU 4C0OC 5GVQA 2CPYA 2DK2A 1DRZA 2ZJPQ 4J5OA 2X1GA 2DNOA 4F02A 1X5OA 1U2FA 2CQBA 2DNPA 2VONA 2MKHA 3ULHA 4UY8T 3VAJA 2DIVA 2VODA 1UAWA 2ADBA 3CULA 2MJNA 1WEYA 5GADU 1WI6A 2VOOA 3NNAA 2KXFA 2MMYA 1Q86T 2DIUA 3CD6S 2MZRA 5ITHA 4ED5A 1JJHA 4CQ1A 4WFNQ 3EX7B 1DZ5A 2MKJA 1KQSR 2AYGA 2JVOA 2MGZA 3TP2A 1RK8A 2CPIA 3UE2A 1ZZFA 3H2UB 1NO8A 5BJRA 1YI2S 2OTLS 4WIIA 2KT5A 3CCQS 4LMZA 3OW2R 2DGSA 3CF5Q 1WEZA 2YH1A 3I55S 3U1MA 3SMZA 2DHAA 4FXWA 5IM0B 3UD3P 2DNMA 3MDFA
chains in the Genus database with same CATH superfamily
2O67A 2PSZA 2LQ9A 1MWZA 1NUEA 2W9BA 4MYTA 3QWPA 2FVRA 5RUBA 4I68A 3TX8A 1N33F 3TAMA 1P6TA 1REVB 4JI5F 3I96A 3VR1A 2AEMA 2RF2B 4LSLB 2VG5B 1S77D 4X65J 3Q22A 3DI6A 3K5NA 3DOMA 1FX2A 1KONA 3Q23A 1U1MA 2XCAA 4AXIA 4Z2XA 5U47A 4OZ2A 2Y1LB 3FBCA 2P8IA 2ZH4A 2JEJA 1C1CA 3K0JA 2HNYA 2VA2A 4N8NA 2HRUA 3R1HA 3AD9C 2PE8A 2OI2A 4LSNB 2OPPB 2F9DA 3T1AA 1SC4B 2AWZA 2CUYA 2XB2D 4G1QA 4R8UB 1DLOB 2V5HG 2AJ1A 4QW8A 4J37A 3OQ2A 3C8YA 1AZSA 3PNIA 1PAUB 5H9EK 3O6QA 3CCWA 4USVA 4Z7YA 2GO9A 4C8ZA 3OR2B 4USMA 4LRFA 4X4QA 1VQ9S 1IKXB 1VQ7S 3MMCB 1KVKA 5DZ7A 3MCMA 1FVQA 2WZ1A 1JQGA 3H2VE 3I0RB 1LWEB 1ZAWA 3E3XA 4BC9A 3PV8A 1WDDA 3RR8A 2FHKA 4WCEQ 2QSWA 3PIOQ 2YWKA 1CJKB 1C4AA 3R5CA 1IN0A 2BBEA 1LW2B 3VCDA 3QRRA 3MM8B 1UA0A 2IYIA 2R8JA 4Y28C 2H4WB 4TQSA 5GAHI 4O3SA 3S6EA 5KFZA 3OVAA 2DH7A 3H90A 4O3RA 1ZM9A 3T1HF 2KO1A 2HFUA 4RNHA 1VC6A 1JLGB 4LFCJ 3HVWA 3H2LA 5KG0A 4JYAF 1DAXA 1YVFA 2CZ4A 2N3OA 3BGFA 1VQ4S 2GIRA 2QGFB 2J9CA 4ERDA 2LDYA 1JJCB 1RT5B 4O3QA 5EUHA 2AJFE 3SCJE 4O44A 4DR5F 2N3LA 2HQCA 3BGRB 4P7VA 5HROA 4Q45A 2B6AA 4DUYF 4P7TA 3FKBA 4NLTA 4DR7F 2YH0A 2MZTA 4TVAB 2VQFF 2W1BA 1PC5A 1VQPS 1SKUB 2A2DA 3VGSA 1P1TA 3TWZA 2BACA 3W8GA 5LJ3Y 2CQCA 5HVHA 1FE0A 2C2OB 1JIHA 4IUFA 4OMFG 2Z2ZA 1VRUB 3LP1A 1VRTA 3P49B 3G71S 5CCLA 3AOCA 2E29A 4ED0A 2ZUGA 3CMAS 2N7CA 2IM2A 5LMUJ 4QIGA 4LJMA 3FNNA 4UUWA 3SDEB 3OFHA 1SL1A 2DEIA 4ZPCA 3NGUA 3BF4A 1S1VB 3BSOA 5F9NA 2Y1RI 3C6TA 2MQ8A 3KLHB 1KNZA 4U8VA 1S1WB 1EQ0A 3OUYA 3H40A 3HSZA 5SUHA 3DXSX 5F8NA 4NLXA 3KK2A 3V81A 4C8LA 4M5DA 3KLGB 2HHHF 4JUZA 5CZVA 2ZJQQ 2BJ7A 2QJ3A 3GYNA 3LANA 5L8RC 4YB7A 2W4PA 2NCKL 4LF4J 5FD1A 4ED4A 3FJ2A 4HKQA 4PXDA 3BKFA 4JI2J 2ZJPQ 4LF1A 2X1GA 2GAGC 1K44A 3HT0A 4KV8A 4OYMA 3W9IA 3NEKA 1N32F 2ZWOA 4ZJOA 2B8PA 1I1GA 3IGVA 4RUAA 4F4YA 5D6GA 2XI2A 3CO0P 4I2QA 4A8YA 3OHBA 4HHUA 1NK6A 3G87A 5F41A 4F67A 4DR2F 5T14A 3MAHA 4WYWA 2EXUA 3GIKA 3I55S 3C3LA 3NRBA 4Y2IA 2JJ4D 2XGPA 2UXDJ 2W01A 4F3QA 3HHLB 4ZLNA 4TLRA 3V6DB 1K1QA 4OQJA 3O3LA 2RVJA 2HBYB 3HM9A 4XDDA 1RT1B 1C1BA 1X60A 2ZHOA 2KG1A 4F4XA 1RSCA 1RTIA 4NRUA 4U96A 4FNHA 5G4DA 4ID8A 3QJPA 4B3SJ 3ELHA 1HR0J 1FRIA 1Q79A 3UCZP 4NLUA 4ZP6A 2ZHBA 4ECWA 3MEDB 2B4OA 4DUTA 1SPBP 4RWXA 1HL6A 2D9PA 2BABA 3QT5A 1NBEB 4AL5A 2GHWA 2IAJB 1IBKF 4IRDA 1HBUA 2COLA 3A8IA 2GVDB 4FF1A 1TUVA 2AV5A 2C2MB 4IRKA 1UA1A 2YX1A 4ZVPB 4R5PA 1LV5A 1PJ5A 5ETSA 3OL7A 3MD3A 4X64J 1F6TA 3MHYA 1I94J 3CMES 3C2PA 1X5PA 3PKYA 1SQFA 2MY8A 3FSYA 2LA4A 1RAEB 1GMVA 3OXFA 3GYXB 2V4QA 3CJSA 4C7QA 3FFIA 2RHSB 1LWFB 1U0HB 3PXGa 2DGUA 3HHLC 3PJ9A 4DS5A 3MUMP 5D78A 3J7YU 4PR6A 3HKWA 2G2OA 3NWGA 1FJ7A 2RAQA 2XMJA 3WX8A 4B3OB 4DQRA 4Y2AA 5ETRA 2GZOA 3TAPA 4F3OA 2Z8QA 2ASLA 3UDLA 5T7LB 3UN2A 4J9NA 4DV0J 2CAJA 4WK3A 1S9EB 2KHCA 2G0JA 1S7HA 3BR8A 2XCPA 1YBTA 3N6LA 3W61A 2OEKA 5BYSA 3LF0A 4J91A 3SFGA 4BLGA 2L41A 1NJIT 3T6JA 3AT1B 3CC4S 3T5KA 4IR1A 1T11A 3MURP 2CQGA 2DCLA 2M0GB 4YHHF 1HQUB 2E1MC 4URSA 1MWQA 4M5NA 3R3TA 3R5JB 3QGIA 4RU9A 4G65A 5H1SV 2BJ1A 4NOHA 2EK6A 2G13A 5KFSA 1CC7A 3G4SS 1YTYA 4PG4A 3D2WA 1WF0A 4X62J 3WZ0A 4LVOP 3K8VA 4ED3A 3TX0A 4B9TA 1AROP 4Y2CA 2QL7B 4B3TJ 1NH8A 4Q5VA 2A2CA 3TJ8A 2DNGA 1D9AA 3GIJA 4GKKF 1C4CA 3IWLA 5H9FK 2LU2A 4ID5B 4P6QA 2FJBB 4MFBB 1O0PA 2MY7A 3EM1A 3IP0A 4ZVGA 3DXBA 1JLCA 1RTHA 4KT0C 4QCLA 1IR0A 4JV0A 1S79A 2VG6A 3T5LA 1TL7B 1HD1A 2XYHB 1MROB 4DHVA 1U1RA 4NXNJ 5BXIA 3OVSA 2UVRA 2OPQA 4K0KJ 2B0GA 2B9WA 4NMXA 3QPIA 5D4NA 5KFIA 2A18A 2BXJA 2BJ9A 1GMWD 3GJRB 1YQHA 1NDPA 4IG3A 2DO4A 1NKEA 1AXQA 2JVRA 2W2QP 5KOXA 2B4PA 3LUYA 3CCUS 2F3JA 4OI2A 1VFJA 1CJVB 2MPUA 5KFPA 4U8YA 1RCOB 4B9NA 4RJVA 1Q0NA 2KXHA 2HHVA 2XMVA 1FKPA 5IT9U 2HS0A 2XULA 4X84A 1ZYQA 5CH7B 3MMAB 5J2MA 4K4ZA 3LAMA 2BJEA 3J7AN 3UVJA 3ADAC 3CVKA 2XBPA 3GYGA 1BD6A 5ETLA 2HAFA 1VIXA 3V6KA 1LFWA 1S10A 4ZITA 3C15B 4IDKA 4USJC 2CPIA 5BJRA 3FRYA 2XY5A 2FYXA 2IA0A 2AGQA 5B0EA 2P9CA 5M2RA 1M5HA 2OEMA 2NS1B 1SV5A 2AX1A 5HLFA 3M30B 5J2NA 2D74B 5KFVA 2EVZA 1S6PA 1TL5A 2CPHA 4ZK7M 3TZYA 4RLEA 3PW0A 2JEIA 2CPEA 3GG1A 5K9FA 4CLKA 2V50A 2UV8A 2QN6B 5DLGA 2F4VF 4ECVA 1LWCA 4J90A 4DR3F 2ZM6F 2PGCA 3KUGA 4C48A 4TNOA 4LF8F 2LECA 4ED2A 4MIAA 1T03A 2WHOA 3HHNB 1NDLA 4ICLA 1CG2A 3MPUB 3E2EA 4Q0BA 3MCSA 1UFWA 4G1IA 4EUVA 1VR6A 1T3NA 1TV6A 3IAS9 3OSNA 4N41A 3DLEA 1C0UB 4F2RA 2LP4A 2WVFA 1RWKB 1BWVA 1HNIB 2X1AA 1NPKA 2HMIB 1EARA 3MCOA 1RTDA 1R8CA 4ECYA 4J9LA 1HW8A 2DPJA 4QZVB 4GKJF 4LRCA 4BBYA 4RPFA 1FRHA 1WKLA 1P9YA 2J9EA 3I31A 2ASDA 3CJ4A 3WHIA 4QWDA 4ED8A 3RZAA 1KLNA 4PPZA 2LDIA 5SZTA 2HYIB 3NAIA 2V9WA 3ILJA 2NR0A 3S8SA 1RJJA 2V63A 2BM0A 2G2ZA 1B0TA 2VG7A 4WFYA 1P9QC 3N6NA 4LBHA 3FQLA 1VQMS 2G0CA 1OYDA 4ZVQB 4DU7A 4WZQA 2ACYA 5ETOA 5I3UA 5FIIA 2O01C 2IDLA 4M5JA 1S9GB 2CJ9A 2C2DA 4CP5A 4NX9A 4OI3A 1RAOA 4DEZA 1Q95G 1JXEA 4DI6A 5KFRA 3KK3B 1LK7A 3OV7A 3SSSA 2YNHB 4V19X 4F0HA 4KH1B 4RBTA 4CCHA 3NBPB 2OSRA 2MHEA 4ZP7A 1F1BB 5IC4B 1DY3A 2R2UA 2RB7A 3OVBA 5C25B 3GCWP 5ETKA 3K57A 4Q2MA 3RB3A 1X4FA 1J5EJ 1Y7PA 2R7QA 3NS7B 1U1NA 3NAHA 5FJ4A 4NLOA 2W9BB 3O44A 2ZBIA 3US5A 1WACA 3TAMB 4Y34A 3DI6B 2UXBJ 3DOMB 3VVUA 2V2VA 4HTJA 2C3UA 1S12A 3N0VA 2AD9A 2ZOMA 3QMQA 5T41A 1YJRA 4L3NA 3AODA 1YHQS 3MEGA 2B43A 1C1CB 1G4CA 3UR3C 5CD4H 2W25A 1KLMB 1I5OB 1RADB 2LEBA 2HGNA 5KT7A 4WFAQ 4WWSA 3MXHP 1IQZA 4LF7F 3CCES 1LK5A 1RYSA 3QLHA 4G1QB 5E3RA 1Q5VA 3W2VA 3M6VA 2XNRA 3PYGA 2EPIA 2XS7A 3L09A 1PKUA 1MMLA 3MEKA 1AZSB 1UWBA 1X4CA 1XK8A 4DX7A 1IBMJ 2LEPA 2AJ4A 1GTHA 4HH0A 2ATLA 1CQNA 1RXOB 3KDNA 1FFWB 2MZ1A 2X1FA 2BE7D 4HYKA 3GJQB 3T9ZA 4CT8A 2AGOA 1N5VA 1XC9A 3M6UA 4A48A 3GQCA 3NOCA 4IFYA 1N5QA 2IIHA 1CC8A 4N56A 1SIWB 3GILA 5A2QY 1TELA 4WE1A 4OYZA 3X1LB 2DIVA 1V5VA 1WEYA 2LFVA 3NNAA 2CRLA 3J7Z5 1JJHA 3DOLA 1VOMA 4K4UA 3SSQA 2MGZA 4OJGA 5KT5A 1BMQB 4KRWA 2VBWA 3DOKA 5C42A 1JLEA 1Z4UA 3HZEA 3ZZRA 1J27A 5KFXA 1HHQA 1TUGB 3GR1A 3ZXWA 4LQ9A 1WF2A 5KT3A 3G9CA 2OTJS 4OZ1A 1H73A 1PYTA 3PEHA 3ZTRA 2KYZA 4RBUA 1TUWA 5I42B 4PKDB 1REGX 3BGOP 2POKA 1H6KX 4O44B 1R3NA 3QO9B 4DR1J 5KFDA 5HROB 2B6AB 1YLXA 4HHHA 3ZZPA 2B9EA 2P5VA 2Y0BB 2MSTA 2GS8A 3NGSA 4RR5A 4KIAA 3VHQA 3QAEA 1GEHA 1YRXA 2GGPA 3U27A 3PRDA 3PRBA 3QWUA 1N33J 1FO1A 4JI5J 1FCAA 3LP1B 4X4UA 3M05A 2ZDOA 2LQ5A 6AT1B 2O5DA 2VPYB 5EWEA 2IBKA 2HVDA 3FSIA 1YDLA 1ZAVA 1RHMB 2XYGB 4ALZA 3V6JA 4FYXB 4Y2KA 2B5JA 3CC7S 2DNZA 5I3QA 1IVZA 1X4DA 3C6TB 4BC7A 4HI1A 1S9FA 4RKUC 1NSQA 3BR9A 2AYBA 4QR1A 3OXLA 2WW8A 3OUYB 2LVWA 5AJ3F 4NLVA 3RRGA 4EGLA 1PGZA 3KK2B 3V81B 1IWGA 4J9QA 4UOHA 1NK9A 2V8GA 1SJ3P 4M5DB 4DV5J 3D3BJ 4A8FA 2ZC3A 2CJQA 3EPGA 3N9UC 2ZJRQ 2DGWA 1XNQF 5FLXY 2HVZA 4I2PA 1YITS 2B8QA 5LT5A 1NAQA 1S1XA 2HK2A 2VFUA 2HSEB 4I56A 2DISA 3JSRA 4P9SA 3Q2TC 2KZMA 4BDPA 1SC3B 3D6MB 4CLTA 5IQQA 4X4RA 3A3OB 5KFEA 1U6BA 2WOMA 4DV1J 1XTZA 2QC3A 4OJ3A 4CO2A 5DM6Q 1U2CA 3MTJA 3KJVA 1C1BB 1RTIB 3J80U 2VDHA 2QTWA 5ETNA 1LKZA 3FRZA 3TYTA 1WHXA 4ILRA 1FJCA 1Y4ZB 2G9OA 1VBYA 4X65F 2RHQB 4KYZA 5IXUA 2K8GA 1XNRJ 5KT6A 2M8DB 3T1YF 3T1HJ 1S57A 1Z2LA 3GE9A 3CJQA 1DQAA 5B0GA 2OPSA 4DL0C 5IT0A 5LJ5Y 4JYAJ 3V5RA 2HNDA 4NA1A 1NHVA 3HK2A 4JI3F 4DL7A 1U45A 1K73T 2HIYA 1VK8A 2K7JA 4DR5J 1PG5B 1M1HA 5AE2A 1K9MT 1RBLA 5K14A 3BSCA 3IGNA 4DR7J 5KFFA 2VQFJ 4Q8FA 3QAUA 3BREA 2PFFB 3HP6A 2A6OA 1PBUA 4A8QA 3CTRA 2BQ3A 1F5CA 2VOPA 4TY9A 1WF1A 3EICA 2CNKB 1KOOA 1RKIA 3FFIB 2XQCA 4DSIA 2JSXA 2JLFA 3M6XA 5HMWA 2CQ1A 3P3DA 1F9FA 1WC1A 5HN0A 3KLFA 2EI5A 3ENQA 3IG1A 3ZTPA 3MR3A 1H2VZ 2SXLA 1M5KC 1ZBTA 5K8PA 4M5HA 1FTCA 4KB7A 5LL6d 1VJWA 4I67A 1UZDA 2FTRA 3D0GE 2RMLA 1RGVA 1T02A 3TVKA 1WOOA 4EO6A 4DV3F 3DLBA 2FHMA 3PG9A 1CEZA 5J1NA 3PDNA 3LP0A 2H9ZA 3M8SA 4C0BA 4WJBA 2VH7A 3W1YC 2DNPA 3DYAB 3DLGA 2VODA 1CS4A 3LA0A 5GADU 1D1UA 1SH2A 3MEEB 3NWRA 2MZRA 5ITHA 5J2PA 2HQ3A 2FJWA 2YBVA 4C11A 2HHHJ 5E0OA 1LW0A 2VKRA 1KQSR 2IVMA 3LWLA 1FESA 1FERA 3JQJA 1NO8A 5JUMA 2WB4A 4LMZA 3IM8A 3MR7A 4J9KA 1UPMB 3U1MA 4LUBA 4NE9C 3GZ7A 4DV2F 2YWEA 2NZCA 7AT1B 3MZIA 4JI6F 4MIBA 1N32J 5EWGA 3PYEA 4X4OA 2AZ1A 2P9GA 1WC6A 3GFXA 1NHKL 4OI1A 2A6MA 4H4KA 1E6YA 4RW4A 4DR2J 4GRSA 2UVWA 2DNQA 3N5FA 3J7YI 1FTRA 5AXMA 3TEGA 4DQPA 1NHUA 4ZOSA 2BVZA 2R7VA 1HD0A 1SUQB 1FRJA 2UXCJ 2G1HA 1TK5A 3H20A 2Q66A 4I6WA 2R8HA 1JLCB 4N77A 1RTHB 4N7TA 1U1LA 1B64A 4K8RA 3WIUA 1NK7A 4K4VA 1XR5A 3Q89A 4R0EA 2YTCA 3PX6A 5GMEA 2VG6B 1RQ0A 5EX3A 3GV8B 2EC0A 1FNMA 4MYUA 1FA0A 6FDRA 3TAQA 1Y3KA 4C3MA 2LLZA 2HVIA 1GNKA 1DURA 3D66A 2M52A 4IG3B 2VA3A 1SC1B 5MAOA 5J1PA 1WC4A 2W4DA 3ZO7A 3LO3A 2MKCA 1TFWA 1YJ7A 3N4WA 2V34A 3RJMB 2NLWA 3BSNA 4XPEA 2HAIA 4HDHA 3HD2A 4YY3F 5DG8A 1OSDA 2AP6A 1FKPB 1RA6A 3M8YA 1NB2A 1WSRA 3PW2A 2DXDA 5J2MB 5DRKA 3D0HE 3AAWB 4ELTA 4RW8A 3UVJB 3CC2S 3VAMA 5LM7E 3CJ3A 2UP1A 1KOHA 5KG3A 4FKYA 2J9DE 3EXCX 3AJDA 4MT1A 6FD1A 4FBUA 2LCWA 2D3O1 2QE5A 1I51B 4RW9A 1S48A 1CBKA 4PG5A 2XI3A 3BQ1A 4LF2A 4ANDA 1RLCL 1LWEA 3UN5A 2VFRA 2AEJA 2F7VA 2OEJA 2PD1A 4RW6B 2UXDF 1GTEA 5HLFB 4YOEA 5J2NB 3R7BB 1S6PB 4TU7A 3T6BA 2ASYA 1L5UA 1QVFR 2Q1LA 3TANA 1HI1A 4QWBA 2L48A 3GFYA 2KU7A 3SYZA 2PT0A 5JVHQ 4B9VA 4C3LA 1QAIA 1QAJA 3R9LA 3T5HA 1T03B 1JLGA 1Q5YA 3JXOA 1LEOA 4KPYA 5L1IA 4ICLB 4Q0BB 4E8UA 1VQ8S 1RT5A 1JLQA 4DMZA 5E3CA 1TV6B 3BGRA 1EETA 4GKKJ 4ELUA 2BRKA 3D3CJ 3DLEB 3BKUA 1SXLA 2JEGA 5M2UA 2YKOA 5HVFA 4XK8C 5HAOA 4ECXA 3A13A 1KP6A 1RKJA 4QOTA 4ZIVA 3U1LA 4B9LA 3FZBA 2UUTA 4QYZJ 1PSDA 2XMTA 1R0BG 2Y1JA 4W90B 3BO3A 4PCQA 4TKTA 5KFLA 2M3DA 3MCNA 5L1KA 2OHDA 4HR2A 3FMBA 2NXEA 2ACMA 4JI0F 2QLXA 1R89A 2OMLA 4DV0F 3PJXA 2F4FA 3ZZUA 4UY8T 1UAWA 3JTPA 2CXEA 4YEAA 1C2PA 2R8KA 4ED5A 3AD7C 1TMJA 3M32A 3L4BC 3NMAA 1U0SA 1RT7A 5KG5A 1BGXT 3QGHA 3TP2A 3MM7A 4RNOA 2V2ZA 2OTLS 2ZFHA 1HHSA 4WPAA 1KTQA 3B78A 2YKNA 3C16B 2YH1A 4FXWA 2CDRB 4IKAA 4WXWA 1UL3A 3KHLA 4QWEA 5E41A 2WSFC 2V4JA 1SI9A 1Q53A 2CQPA 5HJXA 4UZBA 3M8PA 1LNQA 1X31C 4KR0B 3CCMS 1OPIA 2DVIA 2ZHAA 1IBLF 1HW9A 1R8BA 2IC3A 4XAKA 2W8KA 1N36F 1AUDA 3FDSA 2DH9A 1KFSA 2LQ8A 2YNFA 4NZ0A 2RU9A 3L95X 5KFOA 4X4TA 1WEXA 4CH1A 4CI0B 5CQGA 2VKZG 2R9LA 4WFZA 4IOCQ 2DGXA 4CT9A 3VF0B 1U7LA 3UCGA 3KJNB 3V6DA 2VQEF 5HP1B 3GB0A 2FD2A 3PR4A 1Y5NB 1SKSA 3MEGB 2I38A 4PUOA 4ATNA 4PYDA 2FJVA 2F4VJ 3AA9A 3IBCB 4DR3J 2ZZNA 1D9DA 2J0QD 1VIOA 4ZMMA 2ZM6J 4QW9A 4CO0A 4IO9Q 3J81Y 2JWNA 4ZVHA 3TO8A 3T41A 3AA8A 3BV8A 5DQHA 1UP1A 2MQLA 3QLHB 4GO7X 2KM8B 3IA0A 2ZDPA 3W2VB 4ENOA 2YPYA 2IAJA 1FFGB 3DRSA 1O6XA 3CIMA 2BZ2A 1V5IB 4DV6F 1YZ7A 4DR4J 3MM9A 4NMLA 1DHMA 5ETQA 5A8KA 3B54A 2UVVA 2FJEB 1KVIA 2J8AA 3KYLA 2KN4A 4JP8A 3RB0A 3P5TL 1UWBB 1TK8A 3ZZTA 4M95A 4HT7A 5LMNF 2VBXA 4GKJJ 2VZ9A 3DN9A 5DO2A 5I4MA 1ZZNA 3R5GA 3ZNUA 3PFOA 3MTKA 4P2SA 4IFYB 3DRXA 3U02A 1B99A 4O0IA 4WE1B 2UZAA 1OY6A 5A76A 2MQPA 3D1HA 1N5SA 4EMDA 3L7UA 4RUHA 5IM0A 2YKQA 3V4IA 2D41A 3W5YA 3DOLB 3WC2A 4NWBA 5T7LA 2KJVA 2MGZB 5H9EJ 3M2VB 1S9EA 4C97A 3KJQB 4DG1B 4CLSA 4YDDB 3DNCA 3DOKB 2FIUA 5C42B 1JLEB 1LXNA 2KM8C 4C8YA 2XS5A 2G1DA 4TU9A 5F3TA 1RB0A 3R6GB 5CAAA 3HZGA 2OP5A 2DNHA 4DFKA 1KQFB 2FLPA 2XC9A 1C0TA 1VBZA 3JSMA 2DJWA 2KVIA 1M5PC 4DN0A 1G7CB 1FK9A 2RDJA 4D3HA 2QFIA 4W98A 4KGVB 5THWA 3RBDA 1FNXH 1HNZF 2J6UA 4ECZA 9RUBA 2IM1A 1T9TA 4ZVTB 4FYYB 1AA1B 2HPUA 1PYOB 3GIRA 3VAKA 2GGPB 1EZZB 1S59A 4X4NA 3LGMA 3UFCX 5DM7Q 3BGUA 4K4XA 3PY8A 3EGWB 4CLPA 4NXMF 4NZ6A 4DX5A 2VF3A 4WKRA 4KQZA 4ZS6A 1XMOJ 2O1PA 2RS8A 4OLPA 4ZVFA 2E1RA 3A3PB 2IJNA 2B5JB 2ABYA 5BR8F 4RNMA 4NL5A 1M5VC 1TKXA 2YPZA 1LOUA 3FVYA 1MROA 3R2CJ 2PDAA 2WVCA 4WF9Q 4LF7J 5DG7A 5GAGU 4KJIA 2PN6A 3OTCA 4NLSA 3R5DA 3TA2A 1L3TA 3BB5A 2ADBA 3C19A 2KXFA 2IRUA 2PFDA 3QGPA 3CD6S 1FDAA 4I2PB 3TUJC 2HWHA 4K59A 1UKUA 1MN9A 4KY3A 1S1XB 1U8SA 4I6YA 4M63A 2FGCA 4PABA 5CABA 2FY8A 3MMAA 2KL8A 3IFEA 4C2MA 2E9TA 1WG1A 1IM4A 3TW0A 4FZVA 3U7JA 2GMHA 1YJTA 2WOMB 4DPXA 4TY8A 5LSRA 1R8HA 3THTA 4CIOA 2J7WA 5F0UA 1SKRA 1QSYA 2YKPA 3KJVB 4NRTA 5HMZA 1HNWF 3HT3A 4HHJA 4CM2A 2HRYA 1VBKA 4ED6A 2Z30B 4B08A 1S0OA 2PI5A 3M30A 4C8MA 1NEEA 2YWFA 3CDBA 4F25A 4USIA 2OPSB 1Y5IB 1HYSB 3V2UC 2BE2A 3CMQA 4Q7AA 1U1OA 3VAGA 3PW7A 1SJ4P 4CNZA 2JC0A 1D9FA 1XERA 4PRFA 5D0EA 3T3FA 4USUA 2R8IA 4CLLA 5HJYA 5K14B 3RW6A 2FJXA 3SCLE 3OTDA 1NM2A 3GJTB 3VZHA 3HO1A 5A8RA 2DEJA 5IT4A 1CSJA 3UI3A 3UNGC 1NZ8A 1XJWB 1RE1B 2R7OA 4MH8A 2CJYB 2GCFA 4M5IA 2C2EA 2F40A 4DCJB 3KLFB 2RQCA 2G0IA 3IG1B 1XBWA 4JBCA 4DPWA 5KFUA 1HNIA 3K5LA 3BH6B 3MM5A 3NMRA 2MQQA 1SQGA 3HD1A 3G8SA 2IMOA 4FF3A 2R7RA 2KT3A 1XMBA 3LP2A 2BANA 5DG9A 4P75A 4DS4A 3LP0B 2PIIA 4UQGA 3UD4P 2QV6A 4QQBA 4OHXA 1R6VA 1VQYA 1N88A 1XR6A 2JDJA 2VFVA 3G8QA 4UOCA 5J2PB 2XSFA 1YRTA 4C11B 1LW0B 2PEHA 2QA1A 1VYAA 1UVNA 3LTOA 2W9CA 2M88A 2ZVSA 1PO6A 5A2QU 2B9XA 3DFEA 4OV6A 1QTMA 1XNQJ 2BEFA 5GMKa 1FT8A 4ED7A 1JXLA 3T9NA 4JV1A 1KD1T 2W2NP 5LXYA 3ITHA 5D0HA 2CVIA 2CG8A 3RGIA 1RAAB 3IWNC 2LA6A 3GONA 1BQNA 3BEGB 2C1EB 1E6YB 4RW4B 1VQKS 4PXEA 2Y8YA 1R7IA 4B9SA 5F8LA 1YGYA 3FCWA 1ZOTA 1VQNS 4GMKA 1OMSA 2DKOB 4DR1F 1N52B 4OZ3A 3GLJA 5B0CA 3CD7A 1XMQF 1AFJA 4LQ3A 4JI1F 3BQ0A 4YUDA 1WOPA 4KHMA 2XZDB 2XEXA 4AFFA 2UUAF 4P2MA 4C4WA 2ALYB 4X4VA 2D3ZA 1FD8A 1DQ9A 1FNOA 2VBZA 4YN3B 5GADI 2CQ2A 1NPRA 3T1YJ 3VGTA 1IBCB 2VJUA 1RT2A 4CH7A 1JJ2R 4W92B 1S4FA 2DNRA 4KH0B 3HCXA 5EGYA 5KFMA 2I1RA 5B09A 3P45B 3OR1A 4RUBA 2DBBA 1HI0P 5J1EB 3GIMA 4ZN3A 2FC9A 3DRPA 4JI3J 1HWLA 1RAGB 4Y0FA 4Y00A 1HARA 3Q8SB 1KLMA 2N82B 4J9UE 3PTWA 1UETA 2IJRA 2R7UA 4DL2A 4H4KC 5AXKA 2VDIA 3QT6A 3Q8YA 2DK2A 1JX4A 3LW5C 4F02A 2DNOA 1KEKA 4DV5F 4QIFA 2W2OP 2PEBA 4ZJLA 4FYVB 4F2SA 1LQ9A 3K5MA 4OI4A 2JVOA 4RW8B 4AYBD 5GAEI 5ETMA 3CO9A 2DCUB 4RO0A 4FS2A 2KZZA 2YNGA 2Z2YB 4DV3J 4NLWA 2YKAA 1GQEA 1VHFA 4RW9B 5FLXU 3MMBA 3N6MA 2M2BA 5DQGA 5AE1A 1Z2ZA 1RAIB 1LFPA 4ZVUB 4NLRA 4ZLPA 1X9MA 1Y00A 2HZCA 1JLFB 3DRYA 3W65A 4DV1F 1X8DA 4YFUA 2BW2A 1R27B 3RAXA 1NCLA 3A8KA 4RWWA 3P96A 4MKVA 2H5EA 3ZNJ1 1EP4A 4ZDNA 4EWTA 3KLEA 5M2PA 1X0PA 4B3RJ 3B4DA 4ZIWA 2QFJA 2WCXA 4WK1A 4DFMA 4DV2J 2CNNB 2VL1A 4N5SA 4O3NA 2QLJB 3PVXA 1VQLS 4JI6J 1NK0A 1XNRF 3PHEA 3RAMA 1QAYA 1ZH5A 2ILYA 5AXLA 2RILA 2JHEA 2DGVA 4WYLA 3MD1A 4CLYA 2H65B 5IC6B 1MLAA 4FF4A 2GQQA 4DCPB 1L3VA 4DV7F 2YQ1A 5I42A 2F8EX 1Q8LA 2O3DA 1JLQB 1R6YA 3VGVA 3QO9A 1EETB 1EAYC 4ETXA 3R7SB 3CJTA 5KT4A 1U6FA 2BW7A 1X4HA 3JS9A 1S1UA 2E5LF 1DFDA 4WTOB 3FC9A 1S97A 1URNA 5J2QA 2H51B 1GXUA 3W9JA 2XWYA 1WDTA 4DPTA 4NZ7A 3MECB 1T0TV 1CLFA 1YJ9S 3HLUA 3AFGA 3S1TA 1RWOB 1URRA 1X0FA 2DRDA 2EFPA 1NZAA 2RRAA 1RWUA 3NL0A 3M2RA 2CQIA 3UDVA 1VLOA 2Q6BA 1ZPWX 4WXOA 2DRBA 3AB2B 5KFNA 3CB4A 4B9UA 2CQ0A 3I9V9 1YK9A 2BKNA 3SCKE 2LQJA 1RISA 3M32B 1RT7B 2BYCA 2GHPA 1Q7YT 5CZXA 3MM7B 3OL6A 3I5AA 4YY3J 4J9PA 1YJNS 2CPFA 2OD4A 5DGAA 4FDFA 1RT4A 4ZHRA 1FJEB 2CJKA 2YKNB 1QSSA 1F5AA 3BYPA 4MK7A 1S0VA 4DU8A 1UTAA 1M0SA 3HFZB 3H42A 5C5JA 1F9EB 1VISA 4KE5A 2V4JB 1AB8A 3NKYA 3D67A 4ZCKA 1OYEA 3M8PB 3LGNA 5EDWA 4B17A 3MPYA 2FC8A 3KTQA 1ACMB 4EYHB 2F65A 4DQSA 2VPWB 4A8SA 2IBOA 3QZ8A 2IC3B 2PO4A 1QTNB 1ZM4A 3SBMA 2YNFB 4ZCLA 3K5PA 5B0BA 4JOUA 3DDNA 4CTAA 2EFNA 4KO0A 3IBFB 1U6ZA 1X4GA 2PMHA 1MU2A 2UXCF 3CWJA 4CDIA 2JZ5A 4RNNA 1WTFA 4PUOB 1JKHA 2X1BA 2RJZA 3ENVA 3CJ8A 2QA4S 2HHUA 5LXRA 1SVDA 2ZD1B 1SL0A 1MN7A 3N79A 4OIXA 4YR0A 3B82A 4BS2A 2QT7A 3I56S 1FKAF 3VQTA 2E5IA 4YDXA 2F8HA 3PO5A 3DRSB 3AOAA 4Y6IA 4K4TA 3OPKA 1XEZA 3LH2S 1DTTA 1S99A 3Q24A 3I5CA 3MM9B 5A8KB 4IOAQ 3VALA 1B0VA 2HQFA 3R6LB 3CPWR 1ZA2B 4C0OC 1SC6A 3D1OA 4OFZA 4ECUA 2EG2A 4J5OA 3KXDA 3EUNA 2VONA 2MKHA 4GVLA 1R0CB 1CJUA 4TYAA 4KHRA 4KAIA 2M5YA 2QRRA 3BJYA 2MMYA 1NJWA 2NPFA 1D8YA 5I3PA 1GFWB 1MMNA 4Q44A 4AD6A 3TI0A 2LXFA 2GAHC 3A8JA 5DS7A 2KJWA 3QT8A 3F41A 3EZUA 1W25A 2XHCA 1PIEA 2QG9B 1K47A 4EU0A 5IM0B 3DGVA 3V4IB 3MDFA 3HF5A 3QIPA 1FE4A 4JI0J 4IRCA 1FEEA 1ZTTA 3J81j 1S1TA 4EYIB 3Q8UA 3IS9A 4V19J 3DKDA 3DYAA 4RU2A 4ZVRB 4AT1B 4FYDA 2C3OA 4DL6A 1CJTA 2IVFB 3MEEA 2V8VA 3OTBA 3WQPA 3QGGA 2HFOA 3SQGA 2YQ0A 4H4OA 2A0FB 1Y3JA 1FX4A 2FB0A 3QIDA 3DLHA 1IR1A 1C0TB 1PJ7A 2IDEA 2HLTA 4USWA 3JSMB 5G0RA 4ZP8A 1X7VA 4FXVA 2N4DA 5KFGA 2ZUAA 1FK9B 3I0SA 1EX8A 3UDEA 1YSJA 2X7IA 1WG4A 4IG0A 1VQSA 2CPJA 1MW7A 2V8DA 4F4WA 4KBIA 1Y0HA 3D6TB 1TAUA 5KOWA 2HS4A 3M2UB 3H0PA 1BE4A 1S7IA 4N47A 3K59A 2PA3A 2JRSA 1XIQA 4UW2A 3D1QA 2J0WA 1HBOA 1IBLJ 1UCNA 1N36J 3GU0A 2HQIA 1JK9B 2OLWA 2ZBQA 1X4BA 4M5GA 2GVZA 1VC0A 1RUSA 3RR7A 3W3SA 3DU5A 4F04B 4G3IA 2VB6A 4FYWB 2R7SA 3GR0A 3KHHA 1KBRA 2PA8D 4XTTA 2F63A 2VQEJ 2XLJA 1SUQA 1WHWA 2UV8G 4EBEA 1YX2A 2DNNA 3N5BA 2OIHA 2HURA 3C46A 1AW0A 1PCAA 8AT1B 5A6PA 1UFKA 3RBZA 2BDPA 1TKXB 1NSPA 3MOJB 3T5JA 1WKJA 5KFBA 5HBMB 4A8MP 3NCPA 3TJAA 2MSSA 2J0SD 3DCAA 3IO1A 2HZAA 1FKOA 2HBRB 2YX7A 3UWTA 3EDRB 4OYXA 3NNHA 1KQGB 2AEFA 2OPRA 1NDCA 3O8WA 4DV6J 1TKDA 1W2IA 4NA3A 3ZZZA 1SJ1A 9ATCB 4QU7A 3KOAA 1TL3B 5KG2A 4IFVA 1P8GA 2M7SA 4LFAJ 2AJQA 4I69A 1QSLA 2NSCA 3M9MB 4F4KA 1CULA 5LMNJ 3KMQA 4AQYF 1OWXA 2CWXA 5E5NA 1FHTA 1WHYA 1CQMA 1IKWA 4LIWA 2GX8A 2MKIA 2PC6A 1Q8KA 3MPVA 5KFYA 1RP5A 2AHOB 4OX7A 5HVGA 3H4DA 1SL2A 3NGRA 2DRAA 2Z2MA 2ROPA 3CGIA 4HDGA 1QUPA 1FDBA 2MKYA 4V1Ak 3TUPA 2Z58B 3BO4A 4URQU 2DT9A 1HIYA 3D6HB 4LIRA 4TY8B 4OHWA 3AQPA 2WBRA 5A6WA 4XPCA 2JC1A 2E5GA 4OYPA 2M8HA 4QWAA 2VJVA 2BOPA 4URGA 2E7WA 5MLCV 3SSRA 3CEDA 3HVRA 3DRRA 1K8AT 2OKQA 4WP8A 4NLDA 1OSCA 1TVRA 4LF5F 3O1LA 4CH0S 4K4YA 1K1SA 1DTQA 1RABB 4I7FB 2HEKA 1J5OA 4Y65A 4RW6A 1ELOA 4DBQA 1RYRA 2B7BB 5GAGI 1S72S 2WONA 4TXSA 3HSJA 4DQIA 2MKKA 1BHNA 1NRKA 3CD5A 3CW2C 2V0NA 2G2YA 2BE2B 4L73A 4L3KA 4U6PA 2CQ3A 5EN1A 2HNZA 3GCXP 1KR4A 2B51A 1HNZJ 1UMJA 3R2DJ 1I3OB 4PQUA 4O4GA 2H1YA 2GO8A 3R7NB 3MM6A 1H38A 2M4MA 4J7CA 4DWIA 1OQ6A 2LMIA 2XMAA 2NUUG 5A8RB 2AX0A 2FDNA 1QJHA 1FRLA 1KTVA 1GX5A 2DGTA 3BDEA 3ENAA 2HW3A 1LXJA 4DR4F 2YWGA 4NCBA 5F8JA 4XO0A 3H98A 2BRLA 5GVQA 2CPYA 2XSJB 4NXMJ 3R5BA 3J81U 1S6UA 4GVBA 3WDOA 4F4ZA 2W7PA 3MM5B 2XY6A 3CULA 4F4AA 1UZHA 5K20B 2VOOA 3HSGA 1OY8A 3EGVA 1YBAA 1L3UA 3LP2B 1Q7LB 2BANB 3W8PA 2I8EA 2AYGA 3ILOA 5BR8J 3IAM9 2K1RB 1YI2S 5E33A 3VVTA 4UT4A 2JFKA 2WBMA 2BUNA 2WSCC 3DDIA 4OYAA 4G1PA 3SFUA 4CYUA 2E5JA 1X4EA 4J9OA 3HJFA 3GSIA 4NLYA 1WKKA 3BKTA 2W9CB 2F5GA 3F44A 2GW8A 3DLKA 1U2RA 2DGQA 3R8YA 2M9KA 4Y2MA 4CLUA 2XLIA 4U7UD 1TAQA 1VJQA 2DY9A 3KJFB 1F3VA 1ZA1B 3ITHB 5D0GA 1TL1A 1Z1ZA 1GH8A 3C16A 2LKZA 3KHGA 2CJAA 1U09A 1X5SA 1ZTWA 3QBCA 2CADA 1T94A 1BQNB 2GQCA 1SH0A 2ROEA 2CKWA 3ET6A 5B0DA 3OTOF 2YXLA 3OFEA 2KHDA 5KFHA 5IWAF 1N0VC 4FVMA 5K8OA 1KS2A 1X9WA 2GMLA 4PWWA 1MSWD 1DBDA 2CZVC 1HNWJ 2C28A 2WVDA 2KH9A 2J6SA 1O51A 4CO1A 4K2JA 4NI2A 2V4RA 2V2KA 4QPTA 2I5JA 3PW5A 2W8LA 3BN4A 4LR9A 3OT9A 1EB0A 2BJDA 1QVGR 5HP1A 1RT2B 3RRHA 3G82A 1XQIA 1XMOF 2HHSA 1PILA 4JI7F 4LBPA 3CCVS 2LQBA 3OR1B 3G6YA 2V67A 2JL9A 3HHLD 3DRPB 3KK1A 2ZBPA 3L3CA 4F7VA 1F2GA 1YBUA 3G6XA 2MJUA 1W2BR 4FBTA 1FWKA 3OXGA 5IV4A 2DHXA 4NCGA 3I6PA 4PG8A 3P8BB 4OJ1A 2OD6A 1N56A 3GWCA 1GXLA 1RHUB 2XS2A 5KFKA 3OTEA 1U47A 4U7CA 4PEOA 2C3MA 2FZCB 2ZH9A 4NEYA 2ZVIA 5BYRA 4JI4J 3OL8A 5IV3A 3DDKA 2APOA 3KLVA 4DUZF 2FHOB 2YNGB 2D9OA 2MLXA 2NXCA 4IH7A 4M94A 3MMBB 2BQRA 2GJFA 3CUNA 4FVCA 1RWMB 3E01A 2KRRA 2LYVA 3LOUA 3PW4A 1UWAA 5B0AA 2V8HA 3M4XA 2VPXB 1Q4RA 2UUWA 5IS2A 4JV5J 3F73A 3CCSS 3MUVP 3IC1A 4ECSA 1TL4A 4JV2A 4QWCA 1VQOS 1QE1A 4EZ6A 3TZXA 3EPIA 4PQAA 3M2VA 1UVKA 3D54A 5L9NA 3FSXA 1EP4B 2KFNA 2DTJA 1IKYB 4DG1A 4EZ9A 3KLEB 3HPOA 2AGPA 4C0HA 3QATA 5DDRC 1BXNA 3PRVA 2ZH8A 2J76E 2QMWA 1VC5A 1R43A 1GXTA 4E98A 3W2WA 1V3SA 3QNWB 3EDQB 2R8GA 1WORA 3CJ2A 1VQ6S 3M8ZA 1RTJA 1UEKA 3Q86A 4A8XA 1Y5LB 3Q8VA 4TYBA 4P2XA 2RDIA 1V6HA 2X3GA 1XMQJ 2PI4A 3OSPA 4JI1J 1S1UB 1JWWA 4P2FA 5KAKA 3EXYA 3NXZA 2W7OA 5JJBA 5J2QB 2UUAJ 1EKSA 1UVLA 4L76A 3R1LA 5ETTA 3POTA 4C3KA 3PX0A 3ONQA 3RU0A 3EZ5A 1X5OA 4WFXA 2CQBA 4YS2A 1TFYA 1TR0A 2B7CB 2KB2A 1GAOA 3W63A 1WNEA 3LPEA 2VPZB 4QJVA 3PX4A 1RWPB 4IO1A 4KGZB 3E51A 1MNEA 3M2RB 4CQ1A 1OPZA 5D0RA 3CJKA 1H98A 2CDQA 4AE5A 2GQ2A 3I32A 2DHHA 4LRAA 2W9AA 3UW1A 1WEZA 2IYGA 3OFFA 3H5UA 3UD3P 2FVQA 1F0XA 2MLZA 2ZC4A 4WP9A 3W64A 2EFGA 2K3KA 3RUBL 1RT3A 2W4CA 3H5XA 1RHKB 3OJSA 3LAKA 2NZ4A 1RT4B 4ZHRB 4KTQA 1B4SA 1SJQA 2ADCA 2ZH2A 5D4PA 3RTVA 1B3TA 1S6OA 1OIAA 4I0WA 3C14B 3T19A 2ZH3A 1AYEA 1SH3A 2OELA 2WB1D 2RQMA 1HFEL 2X3DA 3KFWX 3ZC4A 1NK4A 3WX4A 4A8OA 1VRQC 3DM2A 2EBEA 1QDUB 3Q2SC 3QZ7A 1SJFA 1KHVA 2DNKA 3SQOP 3A4TA 4ZPVR 3IXQA 3W7BA 4EBDA 1IQTA 1RWVB 4K2XA 2QLBB 5F0WA 5CD4A 1NSKL 3MR6A 4A8WA 3EMTA 3Q8RB 2ZH6A 3G2XA 4CTAB 4KO0B 4ZLJA 1TP7A 1O5JA 1FJGF 2C22A 7FD1A 3PYFA 1MU2B 2KI2A 1RAHB 1NKBA 5C2GA 4RL1A 5LOQA 4FXDA 4ZN1A 1Q82T 1JKHB 3DGPA 1WHVA 1HQEA 4ANCA 2PMZD 2UU9F 2ERRA 2CWKA 3E8OA 4DN9A 4Q43A 4G6VB 4BWMA 1HYSA 2WTFA 3H5SA 1UEVA 4P71A 4DV7J 4K5RA 1N5YA 1FVSA 3BBBA 2BKPA 1DTTB 5DDOC 1VDHA 4E2FB 4B3MF 4H54A 1TKZA 1HMVA 3P4UB 2FHJD 3FQKA 1NSAA 2QZ8A 2Y3YA 1UJ4A 3DLJA 2E5LJ 1AT1B 3GP9A 3H25A 4R25A 1IR2A 1CJUB 2ZWPA 4ELVA 2JEFA 2BM1A 3UCUP 1HBNB 2CZ9A 3RBEA 4JI8J 3LWMA 2IM0A 4UTGA 1TTHB 2F9JA 1HA1A 2VUGA 4UOGA 3P6YC 2DH8A 1Q8IA 3AJ1A 2FLLA 1SCJB 1SKWA 1WC0A 5KFTA 3QIPB 4I1TA 2YWHA 2LXUA 2ZH1A 3GFHA 4QYRA 2E9ZA 1S1TB 2MQMA 1GT8A 1H0HB 2JH3A 1HHTP 5DGBA 3IS9B 4ZPBA 5L9XA 2XWXA 5KFCA 1CJTB 1A9NB 1S76D 2HQGA 3DLLQ 1UVIA 3SQGB 3FBEA 4H4OB 3BH7B 1T8EA 2NXNA 4USTA 4WU3A 2C3PA 2XNQA 3FMWA 5G0RB 2OFHX 1T9WA 1U26A 3OLAA 5DLFA 3N01A 3JB9k 1U49A 2QIFA 3I0SB 5D77A 4B3RF 4LVNP 2Q3PA 5ADZA 3K2YA 4F50A 4CO3A 1NDKA 2XZTB 1QUVA 4IG0B 2FUG9 2KT2A 2KFYA 1BQXA 3ILLA 3B6BA 1BQMA 2RNEA 3BBCA 3UD5A 1U25A 3J7ZT 4FF2A 1HBOB 4LR8A 3PM9A 4ES2A 2GVZB 1KSPA 5CYMB 2K06A 4DR6F 2E44A 3RW7A 5GAEU 4NLPA 4X66F 2DNLA 4O0NA 3KKFA 5AE3A 1KC8T 3HHDA 4RW7A 2A1BA 1RWNB 2DO0A 5CYJA 2RU3A 1HPZA 1YRUA 2BJ3A 1L3KA 4IOBA 3KNGA 1U2FA 3IWXA 3PKMA 2H5IB 4KKOA 3TARA 1ZM2A 2HBQB 5IZHA 1T7PA 1YJUA 3VAJA 1KWMA 2GIFA 1O8BA 2YWWA 1FWLA 2VU5A 3NLCA 3HVTA 2DIUA 4F0MA 4DV4F 2ZOFA 1HBMB 5EX0A 4I4BA 1FKOB 3K5OA 3VTIA 5F8IA 1HNXF 5J1EA 4YR3A 3UE2A 3TRGA 2OPRB 3BGLA 4DL4A 3SMZA 1S49A 2AZ3A 3OL9A 2QSFA 1HLWA 4IFVB 4RBVA 2KRBA 3EGZA 1T9XA 2QMUB 3K17A 1CULB 2BOAA 2HS3A 4UQTA 3EVMA 5CYQA 3NS6A 3V6HA 5KT2A 1IKWB 3VGUA 3L9ZA 2A10A 4OYIA 2YKMB 3MF5A 3G6VA 2R7XA 1GMUA 2YNIA 3W62A 2BA9A 4TLQA 4M1KA 4U95A 4MIWA 1S0MA 3ZTSA 2CPZA 3TQ1A 1IUJA 2Q43A 3B8HA 3K58A 1U1PA 3HSDA 1VCTA 4ZPWR 4DFPA 1YG0A 3DRRB 3JAMY 1TVRB 1NJYA 2Z2LA 1JLFA 1L3SA 4LF9F 3KLIA 2ATCB 1DTQB 4NYOA 1IJFB 3GFZA 4ILLA 1J5OB 3KDOA 3THPA 2Q79A 1V3ZA 2HK3A 3NS5A 2WONB 2DXFA 1D0EA 2H48B 4K5SA 3HHKA 2U1AA 4EBCA 1BY9A 2IHR1 4ILMA 1U24A 2E1AA 4IYQA 2HNZB 4L6V3 2IVYA 2ZH5A 2C2NA 2R2SA 3GMGA 4PZVA 2CQDA 4PQUB 3K8WA 4O4GB 2MLYA 2XTJP 2AJ0A 4KFBA 3M8WA 3R97A 3MM6B 5HI7A 1XN9A 2NXJA 2Q6CA 3PHTA 4D3GA 2CYYA 1V9OA 1T05A 1KN6A 1VK3A 2QEXS 4MKBA 2KTQA 3SEOA 3S01A 1T95A 3PCOB 3NGTA 2NREA 1SQEA 1HNVB 1UJ5A 2DXEA 3MI7X 4ZCMA 4YR2A 1X4AA 7FDRA 3IR5B 4OX9F 1OO0B 4ZCIA 4HEA9 3H4BA 4GVBB 5L1LA 4EFAC 1N34J 5E3QA 1CVJA 2DITA 1I6JA 3W5XA 4I64A 4DOZA 2VBYA 1ZS6A 5ETPA 5ETVA 2HHQA 1IM6A 1Q78A 3HJVA 1P1LA 3MECA 3R27A 2XO7A 5JVGQ 4USKA 3CSKA 2ZNYA 4WIQA 2AT1B 4FKXA 1M5SA 4ITSA 3CT9A 1VQ5S 4HACA 2B3TB 1KVJA 5F8MA 4DLEA 4ES1A 4DSFA 2OSQA 2MYFA 4P73A 1E6VA 3AH6A 3GSDA 1F3FA 3PACA 3WBZA 3EE3A 2RKIB 4CYUB 2DGOA 4IR9A 3UR0A 2BKOA 4C98A 5CA5A 3HI9A 2CIMA 1FDDA 5C7PA 3HKZD 3DLKB 3NCQA 2B4UA 2H54B 3B4MA 2UUCF 2DHGA 4FPRA 1NMEB 1RT6A 3Q8PB 4HL9A 3M8QB 1TKTB 3CE8A 3MOZA 3A12A 1MWYA 1RAFB 2ZE2A 1RA7A 2M70A 4QR2A 4AQYJ 1H7XA 2HHTA 5BYQA 4A47A 4AUKA 3HFVA 2EK1A 2MQOA 5F3ZA 1TL1B 1T9VA 4L72B 4WKYA 1T3OA 2P6TA 5HK4A 1N48A 2K7KA 3ET6B 2XYPB 2EFQA 4ZVEA 1DQ8A 4WZMA 4O3PA 5KG6A 2V8PA 1H7WA 2NYHA 1RWWB 3QFHA 1M1KT 1RHJB 2D1CA 3BO2A 4OYOA 2GJIA 5HMYA 5HATA 4N76A 4P52A 3FZ2A 3JSYA 5HMXA 4MJKA 1X5TA 2GNKA 4QIWD 3HVAA 2XY7A 3BYRA 1D3WA 1YKWA 2J0XA 5HANA 5L38A 4CWBA 1JLAA 4LF5J 3AXMA 3M1VA 1JLBA 2BV3A 3AD8C 4NI2B 2I5JB 4YB5A 2YX4A 1UW4A 3X3UA 4LR7A 1Q8BA 4YB6A 2L3MA 5DJBA 5F8GA 2R42A 2VASA 4JB8B 2R7WA 3G82B 1A6LA 2C2RA 3ISNC 4MKYA 3C6UA 4NASA 1B70B 3KK1B 3ULHA 3OD2A 4KC5A 4H4MA 4CNYA 3TOQA 2VV5A 2ZD1A 2EEYA 3IRXA 3EX7B 3SIPB 4NCGB 3QJLA 3SCIE 2J8SA 3CCQS 5C24A 2DGSA 2R3VA 2OFGX 2FLNA 2HNYB 4OV1A 4HTIA 4PXCA 3P5BP 1IKVA 3EYZA 3DMJA 2IRXA 4AXJA 4QPXA 2QO3A 4LFAF 2CJXB 5D8HB 2FZKB 3BN7A 5GMDA 2FJDB 4DSEA 2V6AA 4M8LA 4O3OA 3VAFA 3EVOA 1APSA 3HXMA 4AL7A 4DFJA 3BM7A 3E01B 3NGKA 4J9MA 3PEJA 5HL7Q 3D7SB 3QYYA 1RU1A 2HGMA 2ZKTA 2E7XA 4FP9A 1FF2A 3S7RA 1R0AA 4DX6A 3UPFA 1QE1B 1RTZA 3KWMA 1H2UX 2WRMA 2QL9B 3SI8A 2EWHA 2DY1A 2CG4A 1RU2A 1KQKA 4OJHA 1P27B 3SXLA 1HKAA 3W2WB 3OBIA 5HSPA 4O23A 2AJ2A 3CDUA 1B7YB 1RTJB 2CFXA 3D4JA 1AUSL 2YY3A 3D68A 1ICEB 3D0IE 1RHQB 3GG0A 4DPUA 3OTOJ 1S6QA 2WAQD 4MK8A 5IWAJ 3RG6A 3M2UA 3PJWA 5L1JA 4DJBA 2WVEA 1YZ6A 1G6BA 1HQ2A 2LU1A 3J7A1 3PR5B 3I9ZA 1B7FA 1WTBA 2EFOA 2FLOA 1ROFA 4EK2A 1M5OC 3BPSP 3U1NA 3POTB 3GJSB 1NLKL 3RRKA 2R4FA 2L08A 4EI2A 3AHPA 1QLNA 3M8RA 4W4MA 2BQUA 4A46A 2MXYA 1A7GE 2I2YA 2AYEA 1YJWS 4JI7J 4J9SA 5A8WA 1R31A 5CXTA 4MTPA 2GHVC 3CJKB 2W2MP 4P74A 4KGKA 1IWAA 2Z0GA 1ULRA 4QIVA 3DC2A 4OZ0A 1JXVA 3G8TA 2HWTA 2RRBA 3WC0A 1VRTB 5A0YA 2ILZA 2Z4PA 4C8KA 2JX2A 4HT5A 5HBMA 5EHHA 1H2TZ 1FXDA 4ED1A 2UUBF 2V2QA 3H8YA 3NY0A 3CXCR 2ZOGA 1N0UA 2AIRB 1H72C 3D6FB 1RT3B 3GPAA 3TUZC 2W2PP 5DDQC 4DF4A 3D9BA 2OH2A 1WWHA 2QX0A 4ECQA 1D09B 2B4VA 3JQMA 2P6SA 1TL3A 2RE1A 2BX6A 1RZMA 5FDLA 2AQ4A 1EHWA 1KRPA 4DSJA 2DNYA 3FEYB 1KHWA 4IQXA 4ETZA 5B7WA 1HI8A 3ISZA 3DM2B 5D3GA 4DUZJ 2KG0A 4MMOA 2CQ4A 3VV2B 4DPYA 4KHPF 1EKRA 2HGLA 3PIPQ 1BUXA 1ZAXA 4CO4A 2HG4A 2H5JB 1H74A 1RWXB 1N54B 1U48A 2J5AA 1WELA 5AXNA 1NKCA 4KV8B 4LF6F 2ZITA 4LFBF 4PWDA 1NNDA 1OY9A 2C3YA 2G4BA 5B0FA 3QQCD 2IA6A 4I2QB 2Y1IA 2RQKA 4ZPTR 4KPCA 4BHQA 2MQNA 4AL6A 4OHVA 4C6AA 1YJVA 4NYZA 2FZGB 3I4PA 3DGPB 1HWJA 4I7FA 2L9NA 2N4CA 1HQEB 2MDAA 2HVHA 3MAAA 3FBFA 4OI6A 4IQMA 3ICLA 3KNAA 2JLEA 4Y3CA 3MFHA 4OI0A 4DL3A 4Q2LA 2CJBA 1ZM3A 1N5YB 1ZPVA 2EFVA 2QLWA 2XM3A 1PBAA 1TKZB 4ZJQA 1HMVB 3I5BA 2H3EB 2MKJA 5F9LA 2VC0A 1NB7A 2AKWB 4BCAA 3UO0A 3OW2R 4J9VA 3HMJG 1JNRB 1HBUB 5KFQA 2I0XA 5JXSA 5KFWA 2HFNA 1QY7A 3G96A 2XSJA 4DUYJ 2P2CB 4R5PB 3VAHA 3BZQA 2X51A 3AXKA 4JI4F 3QRQA 1QD1A 3HDSA 3RB4A 3CJRA 4PWUA 5KFAA 2AU0A 1FRMA 2IFXA 4UY85 3W5ZA 3M9OB 2K1RA 4ZVOB 3MMJA 3QT7A 2E1CA 4B9MA 5HQMA 2FVSA 1RBOB 2EKYA 3JYTA 2FPHX 4JV5F 2XLKA 1SJRA 2HKEA 2E66A 4OX8A 1IXKA 1RAJA 1NK5A 4DXLA 4A4JA 1OS5A 1KFDA 4KGMA 5E2QA 5KG4A 2QYCA 4TQRA 4K4WA 3N28A 3JTOA 3ZTQA 4WFBQ 4FPIA 1OJ4A 2NXUA 2J7KA 3ISND 1GK8A 1BQMB 3O5TB 1CPZA 4O4RA 1MG7A 3I87A 5DZ6A 3F56A 2HBZB 4C8OA 3FCHA 3EZOA 2RD5C 3JQKA 2NQPA 2QYGA 4R0JA 2MKSA 1Y11A 1ZETA 1FFSB 3MWBA 4DSLA 4RZRA 1S4EA 4UUXA 4M5KA 4RW7B 4LREA 2QLFB 4LFCF 1RACB 1FJGJ 3CCLS 3QRPA 1HPZB 1EIYB 3CD0A 4CZCA 4MK9A 1N6QA 5LSOA 2F8MA 1FRKA 1QM9A 2OO4A 4K50A 2IRYA 4KKOB 5IOLA 2NUHA 1WC5A 1KDNA 5D4OA 2UU9J 3IM9A 3IBWA 1VS3A 2DHSA 1R8AA 3HVTB 4OLOA 4ZA1A 4OHZA 2HWIA 2OAUA 3ENWA 4Z7CA 4PXBA 3NP5A 4FN5A 5H9FJ 3AOBA 4GO5X 3QSYB 1QAXA 1U1QA 3KG4A 1REVA 3LQVA 2ZH7A 2H4YB 2HRTA 3W60A 4NLQA 2RF2A 4LSLA 1DJ0A 2VG5A 4B3MJ 4NLGA 1U4BA 1GMWA 1X9SA 1F9HA 4B02A 2CQHA 4USHA 2HHXA 3I4HX 2OPQB 4DDFA 5LMUF 3F0NA 4MAKA 2E7VA 2ZKUA 5CYQB 2P9EA 3TR5A 2V69A 1IBKJ 3THVA 3CCJS 2NSBA 1FRXA 2FQQB 3QJJA 4NYPA 4GC7A 5GAHU 2YQ3A 3SV3A 2HIQA 4LSNA 2OPPA 2J9DA 3SZ2A 2YNIB 3FGVA 3L7PA 4OYBA 4ZLLA 1B0PA 4NEZA 2E5HA 1NPPA 2ZBCA 4RUCA 3C66A 4R8UA 1TK0A 4HVZA 1DLOA 4LF4F 2O66A 2HVEA 4K4SA 2GV1A 1HWKA 2GIQA 2RT3A 2WK4A 2XO6A 1PJ6A 3CIZA 4Q8EA 3MUTP 3FCVA 4JI2F 4P72A 3KLIB 2KVQE 1W7WA 2XGQA 2IM3A 3OR2A 2ZZMA 3TUIC 1JJ4A 3BQ2A 2OGUA 1UVMA 1T9UA 3GV5B 1IKXA 3Q8QB 3AY0A 3MMCA 4FS1A 1IKYA 2VD3A 3Q83A 4KSEB 2UVUA 4IDKB 2BJ8A 3FBBA 3CDEA 3I0RA 1UEUA 2JNJA 3A8EA 3UQSA 1EJ7L 4KFBB 1SV5B 5KG1A 2F1FA 1CJKA 1SB6A 1LWXA 2WW4A 1LW2A 4YHHJ 1T05B 4HH1A 3HX9A 3MM8A 4M5LA 2HZVA 1WI6A 3GTYX 1WUUA 4Z37A 4DR6J 4B3SF 4HI2A 1HR0F 1M1GA 1LWCB 1RK8A 1VHIA 4X66J 1ZZFA 2R2TA 4WIIA 4DLGA 3UNYA 3D5MA 2XMWA 5HQ8A 2GA7A 2D7SA 4X2BA 2DHAA 2MTLA 2I9SA 2CNOB 3VAIA 1UJ6A 3W66A 4JI8F 3CCRS 2ZZTA 4LSZB 2XMMA 5DQIA 2IMWP 1NJZA 1UVJA 4WU2A 4HACB 3RYLA 4K7QA 1PC4A 5KG7A 2ASJA 1E6VB 4X64F 1FDNA 1I94F 1RTDB 4DV4J 3ZZYA 3ETOA 2R7TA 4CLWA 1HNXJ 2ROGA 4F8RA 2J7UA 5IFMA 3Q0AA 2HHPA 2FGOA 4IH5A 4U67Q 4DZ6A 1VRUA 2CVEA 4WTYA 1FXLA 2DYAA 2HFZA 1W26A 1BC6A 1RT6B 2DR9A 2VG7B 1EQMA 2ZE2B 3IMQJ 3KUEA 3SDEA 4XIUA 1WSVA 1RLDA 3MR5A 1S1VA 4S0MA 2K3IA 1JNZB 4PAAA 3R5AA 3KLHA 5I3UB 5IT9Y 1S1WA 4YMEA 3KUHA 3C14A 4KGXB 4NPOA 3OLBA 4ER8A 1PAEX 2IPOB 1WOSA 2D3OR 2FJAB 3CDWA 3KLGA 3JTNA 4ECRA 4EO8A 2VICA 4OHYA 3KG1A 3AB4B 2DD8S 2WVBA 3CCZA 1AFIA 3L7OA 5D4LA 1JLAB 4LF9J 3M1VB 1JLBB 2JOQA 2E1PA 1N8RT 3MFIA 2HQDA 3IR7B 3MAQA 4X62F 1R8PA 2V9KA 3C6UB 4PPDA 3TZZA 2VFSA 4B3TF 1TZ0A 3D28A 4C8NA 3A1YG 3TQEA 2EC2A 4H4MB 2IY5B 1FWPA 8ATCB 5L46A 3IRXB 4QIEA 2J6TA 2DR6A 3HHLA 2HHWA 1RCXB 2YVSA 1RT1A 4I6AA 1YWXA 3ZFVA 3NNCA 2XMKA 5C24B 3CJ0A 2Y8WA 1VGYA 1IKVB 3W9HA 3PFEA 5JMNA 1N5TA 3DMJB 3DU6A 2ZNZA 4YP3A 4OX9J 4WBFA 3G86A 1U1KA 3KHRA 5DETA 4U9RA 1NJXA 4NXNF 3K89A 3MEDA 4LF8J 5IQ6A 2Z56B 4K0KF 2QA4G 4YB1P 1T9YA 1HBNA 3RBXA 3MPWA 1K0VA 2GVDA 3EGNA 1VI7A 4E0DA 3H5YA 2HFSA 1NH7A 4N8OA 3EWGA 4L74A 2K2PA 3VQSA 2AYMA 2DR5A 4C9DA 3CNQP 4DPOA 1NXIA 5K8NA 5B08A 5K8MA 3MR2A 1R0AB 1KKHA 3KG0A 1G3OA 5CCMA 4CLFA 1LWFA 2KXNB 1U0HA 4QU6A 3HULA 4U7UK 3FUYA 4F3MA 2UUCJ 2OUGA 1IJEB 2CA9A 3WIVA 3VWSA 3TNVA 2VIHA 3TA0A 3PO4A 5EWFA 4HLBA 4B3OA 1WJ9A 4ZVSB 2EW9A 1A0OB 1MMDA 2RQ4A 2CNLB 3NCRA 2QA2A 3G6ES 2NYIA 3GIIA 4OZJA 3H59A 1FI4A 1UW9A 1Q81T 3JAMU 3FEXB 3OJUA 4NA2A 3MPDA 4WP3A 1Q1KA 1DARA 4ZPDA 2RRNA 1S6QB 1TQLA 2GMJA 3RAQA 5DDPC 2L9DA 4UOFA 1DRZA 1HWUA 2AF6A 4LBIA 1BWEA 1HQUA 3ILIA 2DR7A 5E7OB 2BMBA 1Q86T 4WFNQ 2Y0SD 5CYMA 3H2UB 4EEYA 2KT5A 1N34F 4DL5A 2OMOA 3CF5Q 3QFWA 3K7RA 4DCOB 5A8WB 4F36A 4OZNA 2W7AA 2MZJA 3M9NB 4CM0A 2U2FA 2MB0B 1J2VA 3OHAA 2A3JA 5A0YB 4ZKAA 2I6WA 4A8KA 3TEHB 1VLYA 5KFJA 1RDRA 4PG7A 4ID5A 3CDAA 2MZQA 4MFBA 1WI8A 2KDOA 1HBMA 1WC3A 1XWLA 5L39A 2FY1A 2EG1A 4OZ5A 4RX6A 2LEAA 4OYWA 5HO4A 3DHXA 1G1XA 2GC8A 1FD2A 1U02A 1TL7A 3TVYA 5FDLB 4DQQA 2E9RX 4X4PA 3A3NB 3ZZ0A 5HQLA 1WG5A 4CRJA 5CHCB 1VBXA 1JB0C 3LALA 5D3GB 4BWJA 4DZDA 2RUSA 3IN5A 1PYSB 1U8WA 2FVPA 1XR7A 3PYDA 5E3AA 2YKMA 2V94A 3CCTA 3TZWA 4F26A 3SV4A 1TU0B 5AT1B 4X4SA 1F5BA 2N7YA 1CJVA 2QMXA 3H7HB 4PWDB 1RHRB 3GV7B 1UPPA 4PG6A 3V4MA 2ZEJA 4QBUA 4GC6A 2W24A 2PMWA 1UFLA 2DB1A 1ITPA 2BE9B 4UF4A 1WD6A 2MEWA 4ZP9A 2KYXA 2RIJA 2CPXA 2RH3A 2HFVA 1F2HA 2XZWA 5KTQA 3MAAB 4P10A 1S0NA 1SIZA 1J5EF 3NGDA 3C15A 2C42A 1Q16B 2D3UA 1G2EA 4DF8A 4MKAA 2FVCA 3LPYA 4CO5A 1H3DA 3FK4A 2GFFA 2LXIA 3IRWP 3HFKA 3TVZA 4L75A 3ETMA 2AMCB 1S5ZA 3BDPA 4DX8H 2B56A 2EBGA 1RI7A 3NOGA 2UXBF 8RUCA 2Z57B 2V68A 1JMTA 2WSEC 1M90T 4QR0A 3AJ2A 2HNDB 2XMUA 1Y9OA 2FHJA 5LSLA 2B9YA 1HNVA 2ZBRA 1D8ZA 2CPDA 3OFGA 2L9WA 4OX6A 2BR0A 2D69A 2VHGA 2KFZA 3HHEA 5D15A 5C2CA 3PZPA 3EJMA 3KMSA 4QYZK 2AW0A 5K5MA 5F8HA 3I82A 2RSQA 2JFDA 2C2ZB 2IJFA 1YIJS 1C0UA 3MGJA 3ZZOA 2UUBJ 3DHWC 1IBMF 3JYTB 4NCAA 4IH6A 2HMIA 2R2RA 2RKIA 3BS9A 2RS2A 3TJ9A 1BLUA 1TMMA 4FNIA 2RUGA 3CJ5A 4CLZA 4RNFA 4XDCA 4TU8A 1GX6A 3FEZA 3RB6A 4LT6A 4M5MA 4J9RA 1VMBA 4TN2A 2OJ3A 1K0TA 1NU4A 3DLGB 4ECTA 2MZSA 3M6WA 2HLUA 4YQWA 5AJ3J 3M8QA 1CS4B 1TKTA 2VFTA 3BPDA 4DSKA 2JLGA 3M7VA 1RBAA 2C2KB 4F0KA 4KHPJ 3BSAA 3IR6B 1FEHA 1Y10A 4PYAA 2VC1A 3VZIA 4LRBA 1N4LA 2MHNA 1FXRA 1S9GA 2DPIA 2Y9HA 3BBFA 4LF6J 4LFBJ 3UDCA 1V3RA 3O2IA 3KK3A 2EKNA 2QL5B 2DR8A 4OZLA 3UN3A 2YNHA 4LRDA 4ES3A 2MJNA 2XG8A 3QSIA 4UZCA 3NBPA 1OQ3A 1N6QB 2GJ2A 2ALZA 5E3PA 1DZ5A 3JSBA 2KKHA 1NK8A 1F60B 3J80Y 4OL8A 3TA1A 1HWIA 5C25A 2NPIA 3LGHA 4ZPAA 3ZTOA 4ANEA 2XHWA 2RDDA 3AQOA 2DNMA 3EVWA 3NG8A 1SBRA
chains in the Genus database with same CATH topology
2IRXA 2O67A 2PSZA 2LQ9A 4AXJA 4DV2F 2YWEA 4QPXA 1MWZA 1FE4A 4IRCA 1FEEA 2QO3A 1ZTTA 2W9BA 4LFAF 4MYTA 3MZIA 1S1TA 3QWPA 2FVRA 4JI6F 4EYIB 4I68A 4MIBA 3TX8A 3IS9A 5D8HB 4V19J 1N33F 5EWGA 3DYAA 4X4OA 3BN7A 4RU2A 4FYDA 3TAMA 1P6TA 1REVB 2C3OA 2P9GA 4JI5F 3GFXA 4DL6A 3I96A 3VR1A 2FJDB 4OI1A 4DSEA 2IVFB 2RF2B 4LSLB 2VG5B 1S77D 4M8LA 3MEEA 2V8VA 3OTBA 3Q22A 3DI6A 3QGGA 4H4KA 2HFOA 3K5NA 3DOMA 3SQGA 4O3OA 1E6YA 1KONA 3VAFA 4RW4A 4H4OA 1Y3JA 2UVWA 2DNQA 3Q23A 1APSA 3N5FA 2FB0A 3HXMA 2XCAA 1U1MA 3QIDA 4AXIA 4AL7A 3DLHA 1C0TB 3J7YI 1FTRA 4Z2XA 4DFJA 5U47A 2HLTA 3BM7A 5AXMA 3E01B 3NGKA 3JSMB 4J9MA 3PEJA 5HL7Q 5G0RA 4ZP8A 1X7VA 3QYYA 2HGMA 2ZKTA 2ZH4A 2JEJA 4FXVA 1C1CA 3K0JA 2HNYA 2E7XA 2N4DA 5KFGA 2VA2A 4DQPA 4N8NA 1FK9B 3I0SA 2HRUA 4FP9A 1NHUA 3R1HA 1FF2A 4ZOSA 2BVZA 3S7RA 1YSJA 2PE8A 2R7VA 1HD0A 1WG4A 1SUQB 4IG0A 1VQSA 1R0AA 2CPJA 3UPFA 1FRJA 1QE1B 1MW7A 4LSNB 2OPPB 2V8DA 4F4WA 2F9DA 3H20A 1Y0HA 4KBIA 3T1AA 1TK5A 2Q66A 4I6WA 1TAUA 3KWMA 2R8HA 5KOWA 1JLCB 1H2UX 4N77A 2AWZA 1RTHB 2HS4A 2WRMA 3M2UB 1U1LA 1B64A 3SI8A 2EWHA 2CG4A 2XB2D 1NK7A 1KQKA 4G1QA 4K4VA 4N47A 1XR5A 4OJHA 4R0EA 3K59A 2PA3A 2YTCA 2JRSA 1P27B 3PX6A 4UW2A 2VG6B 3SXLA 3D1QA 2J0WA 1RQ0A 5EX3A 4R8UB 1HBOA 3GV8B 2EC0A 1DLOB 2V5HG 2HQIA 1JK9B 2AJ1A 2OLWA 4QW8A 1X4BA 1FNMA 4MYUA 4J37A 3W2WB 1FA0A 6FDRA 3OQ2A 3TAQA 3C8YA 1VC0A 3OBIA 1Y3KA 3RR7A 3W3SA 3DU5A 4C3MA 4G3IA 2VB6A 4O23A 3PNIA 2LLZA 3CDUA 2HVIA 3O6QA 2R7SA 1RTJB 1GNKA 1DURA 2CFXA 3CCWA 2M52A 4IG3B 2YY3A 3GR0A 3KHHA 2GO9A 4C8ZA 3OR2B 2PA8D 3D0IE 2VA3A 3GG0A 5MAOA 5J1PA 2W4DA 2XLJA 1SUQA 1WHWA 3LO3A 2UV8G 4X4QA 1VQ9S 1S6QA 1IKXB 2MKCA 2WAQD 1VQ7S 4MK8A 1TFWA 4EBEA 2DNNA 3MMCB 3N5BA 3M2UA 3N4WA 3PJWA 2OIHA 2NLWA 3C46A 3BSNA 5L1JA 1AW0A 4DJBA 1FVQA 4XPEA 2HAIA 5A6PA 4HDHA 1G6BA 2BDPA 4YY3F 3H2VE 3I0RB 5DG8A 1LWEB 1TKXB 1ZAWA 2LU1A 3J7A1 3MOJB 3T5JA 3PR5B 3E3XA 5KFBA 3I9ZA 1OSDA 5HBMB 4BC9A 4A8MP 3PV8A 1WTBA 1B7FA 2EFOA 3NCPA 2FLOA 1ROFA 2MSSA 1M5OC 3RR8A 2AP6A 1FKPB 1RA6A 2FHKA 4WCEQ 3U1NA 3POTB 2J0SD 3DCAA 3IO1A 3PW2A 2QSWA 3PIOQ 5J2MB 5DRKA 3RRKA 2YWKA 3D0HE 2R4FA 3AAWB 1FKOA 2L08A 2YX7A 3AHPA 1C4AA 3R5CA 4ELTA 4RW8A 3UWTA 3CC2S 3VAMA 1QLNA 3M8RA 1IN0A 3CJ3A 3NNHA 2UP1A 2BBEA 2BQUA 1LW2B 4A46A 3VCDA 2MXYA 1KOHA 1A7GE 1KQGB 2OPRA 2I2YA 3O8WA 3MM8B 1TKDA 1W2IA 5KG3A 4NA3A 1UA0A 2IYIA 2AYEA 2R8JA 3ZZZA 1SJ1A 2J9DE 4Y28C 3EXCX 4QU7A 6FD1A 1YJWS 3KOAA 1TL3B 5KG2A 4FBUA 4TQSA 5GAHI 4IFVA 4O3SA 3S6EA 5KFZA 5A8WA 3OVAA 2DH7A 4J9SA 1R31A 2LCWA 1P8GA 2M7SA 2QE5A 4MTPA 5CXTA 2GHVC 4O3RA 2AJQA 4I69A 4RW9A 3CJKB 1S48A 1QSLA 4KGKA 2NSCA 3M9MB 1ZM9A 2Z0GA 1ULRA 4QIVA 3DC2A 4OZ0A 4F4KA 4PG5A 2XI3A 3G8TA 3BQ1A 2HWTA 2KO1A 3T1HF 3KMQA 4RNHA 2RRBA 4AQYF 3WC0A 1VC6A 1OWXA 1JLGB 5E5NA 1FHTA 1VRTB 1LWEA 5A0YA 2ILZA 2Z4PA 3HVWA 4C8KA 3H2LA 5KG0A 1WHYA 4JYAF 2JX2A 4HT5A 5HBMA 2VFRA 1DAXA 5EHHA 1YVFA 2CZ4A 1H2TZ 1CQMA 1FXDA 2N3OA 4ED1A 2UUBF 3BGFA 1IKWA 2GIRA 1VQ4S 4LIWA 3H8YA 2J9CA 2F7VA 2GX8A 2MKIA 4ERDA 2LDYA 2PC6A 2PD1A 4RW6B 3CXCR 2UXDF 1GTEA 5HLFB 1RT5B 3MPVA 4O3QA 4YOEA 5J2NB 5KFYA 5EUHA 2AJFE 1RP5A 2ZOGA 1N0UA 3SCJE 4O44A 4DR5F 1RT3B 2N3LA 3BGRB 1S6PB 4TU7A 3T6BA 4OX7A 2ASYA 4P7VA 3H4DA 3TUZC 5HROA 4Q45A 2B6AA 1L5UA 5DDQC 4DUYF 1SL2A 2Q1LA 1QVFR 4P7TA 3TANA 1HI1A 4NLTA 4DF4A 2DRAA 4DR7F 2YH0A 2MZTA 2Z2MA 2OH2A 2ROPA 4QWBA 3CGIA 1WWHA 2VQFF 4HDGA 1QUPA 1FDBA 2L48A 4ECQA 2B4VA 3BO4A 3GFYA 1PC5A 4URQU 2P6SA 1VQPS 2KU7A 2DT9A 4OHWA 4TY8B 1TL3A 2RE1A 4LIRA 3AQPA 2A2DA 2WBRA 5A6WA 3SYZA 2PT0A 1P1TA 4XPCA 5JVHQ 2JC1A 2E5GA 4B9VA 2AQ4A 5FDLA 2BACA 2M8HA 5LJ3Y 2CQCA 4C3LA 4QWAA 1QAIA 1QAJA 1FE0A 1KRPA 2BOPA 4DSJA 1JIHA 4URGA 2DNYA 2E7WA 3FEYB 1KHWA 5MLCV 4IUFA 4IQXA 3T5HA 3SSRA 3CEDA 4ETZA 5B7WA 3HVRA 1HI8A 4OMFG 1T03B 1JLGA 3DRRA 1VRUB 3ISZA 3LP1A 1VRTA 3DM2B 2OKQA 1K8AT 5D3GA 4NLDA 1OSCA 1TVRA 2KG0A 3O1LA 4MMOA 4LF5F 4CH0S 4KPYA 2CQ4A 4K4YA 1K1SA 5L1IA 3P49B 1DTQA 4KHPF 4I7FB 4ICLB 3G71S 5CCLA 2HGLA 1J5OA 2E29A 4Q0BB 4ED0A 3PIPQ 2ZUGA 4Y65A 4E8UA 3CMAS 1ZAXA 4CO4A 4RW6A 2N7CA 1ELOA 4DBQA 1VQ8S 1RYRA 1RT5A 2IM2A 2B7BB 2HG4A 5GAGI 2WONA 4TXSA 1JLQA 4DMZA 1S72S 4DQIA 4QIGA 5E3CA 4LJMA 3FNNA 1TV6B 3BGRA 4UUWA 3SDEB 1EETA 2MKKA 4ELUA 2BRKA 3OFHA 1N54B 1SL1A 3DLEB 1NRKA 3CD5A 1U48A 4ZPCA 3BF4A 2V0NA 2J5AA 1S1VB 1SXLA 1WELA 5AXNA 2JEGA 2BE2B 5M2UA 3BSOA 1NKCA 4KV8B 5F9NA 4LF6F 2ZITA 2Y1RI 4LFBF 4PWDA 4U6PA 2CQ3A 3C6TA 1NNDA 5EN1A 2HNZA 2C3YA 3KLHB 1KNZA 1KR4A 1S1WB 2B51A 2YKOA 2G4BA 1UMJA 3OUYA 3H40A 4PQUA 4O4GA 5SUHA 4XK8C 2GO8A 3DXSX 5B0FA 5F8NA 4ECXA 2IA6A 4NLXA 3KK2A 3MM6A 4I2QB 3V81A 1RKJA 1H38A 2M4MA 2Y1IA 4DWIA 2RQKA 4ZPTR 4QOTA 4BHQA 4C8LA 2MQNA 4M5DA 3KLGB 4AL6A