1U1MA

Crystal structure of up1 complexed with d(ttagggtta 7gu gg); a human telomeric repeat containing 7-deaza-guanine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
183
structure length
183
Chain Sequence
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human UP1 as a Model for Understanding Purine Recognition in the Family of Proteins Containing the RNA Recognition Motif (RRM).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/dna
molecule keywords 5'-D(*TP*AP*GP*GP*GP*TP*TP*AP*(7GU)P*GP*G)-3'
total genus 49
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1mA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1mA02
2CPXA 4TU8A 1KOOA 4LJMA 3BS9A 4QU7A 2CQ4A 1Q82T 1P27B 1F9FA 2E5GA 2EVZA 4V19X 3SXLA 1WG1A 2AYGA 2RRAA 5HL7Q 3I56S 2KFYA 2LKZA 1YI2S 3HI9A 2KVIA 1YTYA 1M5PC 3S01A 2KM8C 2LECA 1VQPS 1YIJS 5GMKa 1ZZFA 3ZZYA 3NNCA 3L3CA 4WIIA 1WTBA 2E5IA 2DH8A 1YWXA 3UCZP 4F25A 1N54B 1DBDA 1OIAA 3MUVP 1QVFR 2CPYA 1VQNS 1X4GA 2EK6A 3G8TA 2LXUA 3MURP 1WG5A 1M5KC 2YH0A 3R1LA 3DLLQ 1VBXA 2DIUA 3CD6S 1VBZA 2MQNA 3JB9k 3VF0B 1FJCA 2KYXA 1FNXH 2MKIA 3G9CA 2KRBA 1VQ7S 5LSOA 2FC8A 5LJ5Y 1JJ2R 2MKSA 2DIVA 2KRRA 2MSSA 2MMYA 1VQMS 4M5DB 3R27A 1U1OA 2CQDA 1WWHA 2MYFA 3CUNA 3VAJA 4QU6A 3RW7A 2DNRA 3H2VE 2DNPA 3G8SA 4Y00A 2LA6A 4FXVA 1VQ6S 2RNEA 2N3LA 1UW4A 4C7QA 4WFNQ 1QM9A 1WEXA 3J7YU 1SJ3P 5LXRA 4CIOA 2KG1A 5BJRA 2I38A 2M8DB 2V94A 4QQBA 2KT5A 5GAEU 4PRFA 2YTCA 2AYMA 3NMRA 1WELA 3ULHA 1WI6A 1HD1A 3CC2S 2XNQA 4BS2A 1D9AA 2GO9A 2VOOA 2MHNA 2MZQA 1KC8T 2F9DA 2N7CA 1UAWA 1XN9A 2MY7A 3BO3A 1ZH5A 4PR6A 3TP2A 1VQKS 1N8RT 2ZJPQ 1WG4A 1UP1A 2F3JA 5EN1A 2CPJA 5GVQA 4ERDA 2CPIA 3CCLS 3SDEB 5LSLA 1HD0A 3VAGA 1WHWA 2L41A 1WI8A 2OTLS 3I55S 1NO8A 2J8AA 3VALA 1VQ4S 1KD1T 2J0SD 1W2BR 2O3DA 3UCUP 4OZ1A 1X4EA 4IO9Q 1DRZA 3IWNC 2DHSA 3CMES 3UD3P 1WHXA 4YUDA 2CPDA 4UY8T 2DNMA 2JVOA 2D9PA 1X4HA 3R1HA 1WEYA 2LEAA 4WCEQ 2BZ2A 1X5PA 2DGOA 2MZJA 2MKKA 2DGXA 1X5SA 3S7RA 2AYEA 5CA5A 5GAHU 5DDPC 1KQSR 3NNAA 3P5TL 2DNLA 4U67Q 2KU7A 3VAIA 5D78A 4IUFA 2ZJQQ 4C4WA 3SDEA 5IQQA 2HGNA 4CH0S 3THTA 2PE8A 2DHAA 3RW6A 2XSFA 2HGLA 2M2BA 1G2EA 1YJNS 2CPHA 3P6YC 3VAHA 3VAFA 2L08A 2RQ4A 2K3KA 2DHGA 2KH9A 3CTRA 1M5OC 2M0GB 1H6KX 2LA4A 5H1SV 3NNHA 2XB2D 3D2WA 3CCUS 2KXFA 4ED5A 2KM8B 3CXCR 1WEZA 2MZRA 1NJIT 1U2FA 5DM6Q 2E5HA 2DO0A 2DNKA 2FY1A 2LQ5A 3MUMP 2FHOB 3S6EA 2RT3A 1S72S 4PKDB 2M7SA 4C0OC 3IRWP 3THPA 3B4DA 2K8GA 2CQBA 1U1NA 4FXWA 2E5JA 1B7FA 4EGLA 2OJ3A 2CQHA 1KOHA 2RS8A 3Q2TC 2ERRA 2YH1A 1U6FA 1CVJA 2HZCA 3ZZZA 1X4FA 2J76E 1ZZNA 2XS5A 3CMAS 3LQVA 2NZ4A 3VAKA 3MDFA 4ZKAA 2GHPA 2JX2A 3P49B 3TO8A 2DO4A 2MSTA 4IOAQ 2LCWA 2E44A 2YKAA 2M52A 2DNYA 2X1GA 2M70A 2Q79A 1X4CA 2MZ1A 1VQ9S 1RKJA 3G96A 2MQPA 1P1TA 2M88A 2M4MA 1BY9A 2DGTA 1Q81T 1R8HA 3CCES 3H2UB 5DDOC 2DH7A 5IM0B 1UFWA 2MZSA 2MKJA 2CQ0A 1FJEB 3CULA 1M5VC 1WHVA 3MD1A 5DETA 2X1BA 2LEBA 1H2TZ 1X5TA 2CPFA 4WKRA 3UD4P 2MB0B 3N9UC 2DGWA 3CCVS 1DZ5A 5LXYA 3MOJB 3NS6A 1WF2A 1SJQA 1R8PA 3CCQS 5D77A 2MGZB 2M8HA 5CYJA 2MQOA 2KI2A 1OO0B 1FT8A 1RK8A 1VQ8S 3TYTA 2QA4S 1HL6A 2FPHX 2LYVA 2CQPA 2KHCA 5CXTA 2X1FA 2LXIA 2DGSA 2MY8A 2OTJS 2F9JA 2JWNA 2MJNA 2MKHA 2QEXS 1L3KA 2DNGA 3CCJS 1D8ZA 3FEYB 3UWTA 1VQLS 3G6ES 1FXLA 2AYBA 3U1MA 4W92B 2MZTA 2RS2A 2ADCA 2EK1A 1U1QA 4P6QA 2CQ2A 2B0GA 3OW2R 1M1KT 1IQTA 3CCMS 3EGNA 1OWXA 3FEXB 1VC0A 1X4AA 2OSRA 3CF5Q 1AUDA 1K73T 2VONA 2VOPA 2SXLA 2RU3A 3EGZA 1U6BA 4WFBQ 1A9NB 3CPWR 2JRSA 2ZJRQ 1FJ7A 4OZ0A 1QVGR 2D3OR 2DGQA 4IOCQ 1WF0A 2AD9A 3CC4S 5IM0A 1U1LA 3DXBA 2UP1A 2MQLA 3PIOQ 3BO2A 2D9OA 2HYIB 1URNA 2CQ3A 5DM7Q 2XNRA 3HHNB 1VQOS 1WHYA 2DHXA 1X5OA 2OSQA 4Z2XA 2NLWA 2DGVA 2FC9A 3B4MA 2MJUA 4WFAQ 2CQCA 4UQTA 2MQQA 2KG0A 4YOEA 2ADBA 1X4BA 2LMIA 2KXNB 3CC7S 5FJ4A 3PIPQ 3US5A 4F02A 3S8SA 1SJ4P 4LMZA 2DK2A 2N3OA 3MUTP 2MKCA 3V4MA 1HA1A 4F26A 2N82B 4RU2A 2PEHA 2YWKA 1U1MA 1PO6A 2CPEA 1WF1A 4CQ1A 2DH9A 4CH1A 2RQCA 3G4SS 2VODA 1X0FA 2XS2A 2DB1A 3CCRS 2QFJA 2DISA 2DITA 2KXHA 2DNHA 1SXLA 1JJ4A 2G0CA 4J5OA 1SJFA 2DNOA 5JVGQ 1SJRA 1YITS 4A8XA 5GAGU 2CPZA 2DNQA 5LJ3Y 1YJWS 2HGMA 2MGZA 3EX7B 1O0PA 1K9MT 2DNZA 2J0QD 5MLCV 1YJ9S 3BEGB 1Q86T 3J7ZT 5HO4A 2MPUA 5ITHA 2L9WA 4W90B 5DDQC 2RRBA 2CJKA 3K0JA 2G1DA 3BO4A 1DHMA 1VC5A 2CQ1A 2A3JA 2MQMA 1M90T 2CQIA 5DDRC 3U1LA 2WBRA 5JVHQ 4Y0FA 4TU7A 3CCSS 3MI7X 4YB1P 4TU9A 2XS7A 1X4DA 1VC6A 1A7GE 3Q2SC 1Q7YT 3P3DA 1YHQS 1JMTA 1FO1A 2RVJA 5IFMA 1JJHA 2OIHA 1H2VZ 2HVZA 1VQ5S 2MXYA 1K8AT 2G4BA 4QPTA 5GADU 2M9KA 3VAMA 3UCGA 1U1RA 1FHTA 1U1PA 1PGZA 3SMZA 1NU4A 1S79A 3UE2A 3LPYA 3MD3A 3MXHP 2X1AA 4WF9Q 4LIRA 2U2FA 2I2YA 1VBYA 1U1KA 1N88A 2JVRA 1N52B 2DNNA 2BOPA 2KN4A 2DGUA 2U1AA 1OPIA 2RUGA 1H2UX 2CQGA 4TLQA 3NS5A 3G71S
chains in the Genus database with same CATH superfamily
3JSRA 1IKXA 4F3MA 3PEHA 2OO4A 4OYPA 3DOKB 3FKBA 3CC7S 5T7LB 4O3OA 2K06A 2V8VA 3BS9A 5IC4B 3GIMA 4NLSA 3CB4A 2ALZA 4YEAA 4X84A 5E3QA 1RWOB 2XMWA 2XY5A 3AOCA 2E5GA 3BSNA 2HBZB 3SXLA 5KFHA 5C42B 2AYGA 3KLHA 4DV2F 3UPFA 3IGVA 2HK2A 1PC4A 1O51A 3JXOA 3NBPA 5AXMA 3HHNB 1HW8A 3PX0A 4GKJF 1S0VA 4URQU 3JYTA 3QFWA 4QYZK 3W9IA 2IJRA 2LKZA 2P9EA 5D3GB 2ZZMA 1HHQA 3NAHA 1YI2S 2OPSB 1BWVA 4CT8A 2XMJA 2ZOMA 3DGPB 1OPZA 3DRPB 4OX7A 2KM8C 3HVWA 4MIBA 4P9SA 2HAIA 1YRTA 2CJBA 1JX4A 1KRPA 2RU9A 3GV8B 4GKKJ 1NB2A 3QT6A 4WIIA 4GMKA 5HLFB 2F8MA 3HVTB 3THVA 2E5IA 2LU2A 3IC1A 2B9YA 1Y3JA 1HQEB 4K2JA 1NSAA 3UCZP 1OIAA 1JQGA 1UVKA 1QVFR 2C2EA 1RA6A 4MIWA 1YSJA 3TVKA 1N6QA 1T05A 2BJ7A 2V4JB 2EBEA 3TAMA 2B5JA 2IC3A 4ECXA 2LXUA 1DFDA 2OUGA 2PMZD 2YH0A 3GU0A 3JTOA 3N5FA 4CM0A 8ATCB 2VIHA 2DIUA 5IS2A 3KK2A 1UVJA 2MQNA 1S48A 1KR4A 2CRLA 2XSJB 3PHTA 3JB9k 2UUAF 5B08A 4JI3F 2KYXA 4ZVOB 4TY8B 3C19A 1QTNB 3G9CA 3HHEA 2JOQA 4GRSA 3ZTPA 3TEGA 4X62F 2CDRB 3CCTA 2IBKA 3QGIA 4ZIWA 4O3PA 3J7A1 1YX2A 5CABA 4WTOB 3KJVB 4C8LA 2BE2A 1JXLA 2EFNA 3R27A 4RNFA 3ZZ0A 2R7VA 4DU7A 4OYMA 2OAUA 2CQDA 1LWCA 1WWHA 2MYFA 3HCXA 3MMAB 1EQMA 1SIZA 5B0CA 3CUNA 2UUCF 4NLWA 2HHVA 4NLYA 3MAQA 1TK5A 1CJUB 2DNRA 2CJQA 3H2VE 4CLYA 3MEGB 2VPYB 5JMNA 4J9NA 7FD1A 4AQYF 2DD8S 5JXSA 3CJTA 4FXVA 1K0VA 2FHMA 2N3LA 3O1LA 3MPDA 4C7QA 1T03A 1NKBA 2PIIA 2ZBPA 5LXRA 2CA9A 2B8QA 2HAFA 4IFVB 5A8KB 5KG2A 4CIOA 5BJRA 1S57A 1DQAA 1S6QB 3DU5A 3TARA 3HLUA 1NCLA 4G1QA 4DR1F 2V2KA 5HN0A 3RB3A 1J5EJ 2WOMB 4O0IA 4DS4A 2M8DB 2KT5A 5GAEU 4PRFA 2QJ3A 2V8DA 4Y34A 3ULHA 1UJ4A 2OPQA 2RF2A 2IVYA 4DSLA 1HQUA 1TUWA 4LFBJ 2QLJB 3WIVA 3ZO7A 1K47A 2GC8A 4PQAA 2GO9A 3OTOF 4L76A 2FHJA 4EYHB 4MMOA 2MHNA 2QMWA 2VOOA 5D4OA 2CVIA 3DLJA 1DTTB 1OS5A 3C16A 5KFXA 4J9SA 1VBZA 4JV2A 1RCXB 2N7CA 5SZTA 3JTPA 4DQQA 2R2RA 1SQFA 4LF8J 1RT5B 2MY7A 4O4RA 4CLWA 3JSBA 2EKNA 1NAQA 1S12A 3H90A 3SIPB 2F3JA 3DGVA 2VDHA 1S6OA 3MPUB 2CPJA 3DRSA 3L7OA 3ILJA 4WK1A 5GVQA 4JI7J 3I5CA 3CCLS 2MLZA 4ERDA 2VF3A 2KO1A 5IC6B 3G6VA 4LF7F 3VAGA 2L41A 3ENVA 2OTLS 3I55S 4O3SA 2XYPB 3VALA 2C1EB 3JQKA 4ZVHA 1G3OA 5C7PA 1KD1T 5KFYA 3RBZA 3M6VA 2J0SD 2HNZA 4HACA 4ZITA 2VQEF 2O3DA 2HLTA 2ILZA 1NSQA 1R8CA 1FI4A 3T1HJ 2FJEB 3PCOB 2EBGA 3QATA 4K4VA 1N33F 3UD3P 3KLFA 4DMZA 2V8HA 1WOOA 2CPDA 4MT1A 1PSDA 4F0MA 2K2PA 3I0SA 4M1KA 5SUHA 5E0OA 1U48A 5EDWA 4UY8T 5EUHA 3VCDA 4NCGA 1NSPA 4OHXA 4K4TA 4IRKA 1JLQA 2LEAA 1T9YA 5D0GA 1NDPA 4WCEQ 4DQPA 1MROA 2A2DA 2MKKA 4NXNF 4WBFA 3SFGA 4RKUC 3OLAA 2ZWOA 3A8IA 5E5NA 2P5VA 1LXNA 1TAQA 2HNZB 2HQGA 4C97A 2PA8D 2Q6CA 5CA5A 2R8KA 3RRGA 1V9OA 3NNAA 3P5TL 2IHR1 2IVMA 2J0XA 3D54A 3VAIA 2IFXA 4IUFA 1RDRA 4ED2A 2GVZB 2HBYB 1I3OB 4C11A 1RHMB 5KG7A 1PJ7A 2JEJA 5IQQA 1GXUA 4PXEA 1K0TA 3TOQA 3KJNB 1WOPA 2IMWP 2NCKL 1WSRA 1UCNA 2N4DA 1HBMA 1GTHA 3T5KA 3FSIA 4KPYA 4OZJA 4BHQA 5CH7B 4CLUA 5KT6A 2XM3A 4DPUA 2JC1A 1F2GA 2LDIA 1R8AA 1Y4ZB 3T5JA 3HVAA 4NPOA 3RRKA 1L3VA 3DNCA 4ZIVA 1N5VA 2KTQA 4CNZA 1RT2A 3Q8QB 3R5AA 3QPIA 3GSIA 1GAOA 3CTRA 3CIMA 4XPCA 3BN7A 1H6KX 1TKZA 2VUGA 5D0RA 2YX4A 4EZ9A 2XB2D 3KLEA 3J81Y 1UEKA 2KXFA 3LH2S 3TA2A 1NK5A 4ANEA 3ISZA 4ED4A 4QWBA 2VICA 1MSWD 2OPQB 1HMVB 1KDNA 1WEZA 1WDTA 5CZXA 4J9MA 4NCBA 4X4UA 5F41A 2HS4A 4QBUA 5J2PA 2DO0A 1RAHB 2C3MA 3JAMU 2F1FA 1XWLA 3CJRA 3EVMA 4FP9A 4P2MA 3M2VA 2YNGB 2KFNA 2RT3A 4A8QA 4IOBA 5DLGA 4PKDB 4ED7A 4LSLB 2M7SA 2OPRA 4C0OC 3KJFB 5H9EJ 4XTTA 1UKUA 4KPCA 2G2YA 4WP9A 5ETOA 3B4DA 3U02A 4FKXA 2K8GA 1RAFB 1NJZA 3I5BA 4FXWA 2ATCB 3K7RA 4M5MA 1B7FA 2RDDA 4KT0C 4A8WA 3FBFA 1S97A 2V2ZA 1JNRB 2K3IA 1U2CA 2ASYA 4DR6J 1RBAA 4HTJA 4OYWA 1JLBB 4OX9F 4AQYJ 3M32B 4FPRA 1LW2A 1PCAA 1B7YB 3UVJB 3DOMA 4CO1A 1B3TA 1CVJA 4DR7F 5KG3A 3V6KA 3PKYA 1XJWB 4DI6A 4OJHA 1T9WA 2ZVIA 2ZWPA 1X4FA 3CSKA 4CLSA 1Y5NB 2VJVA 3FGVA 3CMAS 2XS5A 5KFGA 4DLGA 4QCLA 2JEIA 3MDFA 4F50A 2DR7A 2BR0A 4HDHA 4ECYA 4DQRA 2DXDA 2LCWA 2E44A 5KOXA 1RLDA 4H4KC 1IBKJ 4IOAQ 3CT9A 2G9OA 2ZH2A 1OQ3A 4IRDA 2ACMA 2M52A 2A18A 2C28A 1VBYA 1KNZA 1OY8A 4PG8A 1SQEA 3IO1A 3MAAB 2IJFA 4LFCJ 2EG2A 1UZDA 2UU9J 3DRRA 1C1BA 2MZ1A 3SZ2A 3QFHA 3I5AA 2W24A 4KGMA 2MQPA 1U02A 3WX8A 2BVZA 2M88A 3G96A 4DV7J 1RKJA 4I67A 4NLTA 1BY9A 2DGTA 2Z0GA 3OD2A 3M6WA 5F9NA 1Q81T 4KIAA 4ZA1A 2X7IA 1XNRJ 1LK5A 3CDUA 1QE1B 1Y0HA 4QR0A 3H2UB 5DDOC 5HANA 4O4GA 2WW4A 2XZDB 5IM0B 3OUYB 1ZYQA 2UXBF 1MU2A 4X2BA 3HULA 1PAEX 2VB6A 4MKAA 2MKJA 2CQ0A 2IPOB 3CJ0A 2DPJA 4ZP6A 4RUAA 1RT6A 3CJKA 3H5UA 2DRBA 1B64A 3BN4A 3DRYA 1ZETA 3MD1A 2RF2B 4MTPA 2CXEA 1D8YA 3BQ1A 2CPFA 1J2VA 1R6YA 1S5ZA 3TUJC 5EWGA 2UU9F 5LMNF 1NH8A 1EB0A 3M6XA 4UQGA 3OVSA 1NPPA 4G65A 3M8YA 1R8BA 1T0TV 3SSQA 2DGWA 4IFVA 4ILLA 1FDBA 2P9GA 2RKIB 4ES3A 2IA6A 3MOJB 1WF2A 3NLCA 4RNOA 1AUSL 1QSSA 1T03B 1IR1A 1YQHA 2G13A 2W01A 3HFZB 3CGIA 2V67A 1W2IA 5DZ6A 5K20B 2MGZB 2DPIA 3IR7B 1KEKA 2MQOA 3KK3A 4J91A 2DRAA 1OO0B 5DG9A 4J9QA 1VQ8S 4LQ3A 1AZSA 2Z30B 2QA4S 2Q3PA 2XMKA 2Z2MA 3KDOA 1CG2A 1F3VA 1TZ0A 4OHZA 3ZC4A 4RW9A 1KKHA 2KHCA 1PAUB 3UO0A 1SH2A 3GONA 4QOTA 4CO5A 4FZVA 1TTHB 2ZZTA 1HPZB 1M1GA 4M5DA 3UD5A 5HVHA 3W3SA 5CYQA 3L7UA 1S1VB 4FYYB 2F7VA 3C3LA 3RAMA 4FF4A 4Z7YA 3CVKA 5IZHA 4NE9C 3MM8B 3D66A 1Q8IA 3LAKA 2W9BA 3IBCB 2J9EA 4DG1A 1RT4B 2EKYA 4WP3A 3Q2TC 1B99A 3GTYX 3BJYA 5H9EK 2AQ4A 2QGFB 2I5JB 1A6LA 4HL9A 5F8IA 3MEKA 1WC1A 3OL7A 3GILA 2CKWA 2B0GA 2BDPA 5I42B 3GJTB 3UI3A 1IQTA 1GTEA 2APOA 4DFPA 2HFNA 1T05B 1V5IB 5F3ZA 1FRHA 3FEXB 2J7UA 2W7AA 2I8EA 2XLJA 2GAGC 1NH7A 2OH2A 3T1YJ 2KL8A 3TAQA 4F4AA 3POTB 1AROP 3B82A 3F56A 4ZLJA 2JEFA 3TR5A 2N4CA 4USWA 4FNIA 2KFZA 5H9FK 2V2QA 4H54A 3IM8A 1VS3A 3D6MB 3HT0A 2HQ3A 2YX1A 4JYAJ 3FSYA 4J90A 2CJXB 2A2CA 4EO6A 4L74A 3CPWR 2WHOA 3DGPA 1RTIB 3NKYA 3RB6A 2ZNYA 2QL5B 3PACA 2B9XA 4RW8B 2OPSA 5DQHA 2RUSA 3BSOA 1WD6A 3V6JA 2J6SA 1AFIA 3EMTA 1T94A 2D3OR 4B3RJ 1B4SA 2RRNA 1WF0A 2LXFA 2RDIA 3DMJB 3PNIA 2ROGA 3HZGA 3R6LB 4EI2A 2HMIB 4KH0B 5IM0A 3RTVA 4ZPVR 3RBXA 1QE1A 2UP1A 2MQLA 4KY3A 4OFZA 3EPIA 2D9OA 4JBCA 4ETZA 2BEFA 2GW8A 2HEKA 4BDPA 1NJYA 2DHXA 2JLFA 3GG1A 2NXNA 3M05A 2IBOA 2DGVA 1YGYA 2JH3A 3DOKA 5E3RA 3LWMA 2UUCJ 1TQLA 2FC9A 2MJUA 3B4MA 5E41A 3VGVA 4J9OA 3ZZUA 2NR0A 3FRZA 3NP5A 3KKFA 2MLYA 4NLGA 1UEUA 3LANA 2CQCA 4Q43A 4DL0C 4J9RA 4OX9J 1Y11A 3VVUA 4X64J 1FRLA 1TP7A 2YWGA 4PYAA 1LFWA 1X4BA 2V8GA 4NL5A 4X62J 2Q6BA 2XULA 1U8SA 3VR1A 1HBNA 2KXNB 4DR3J 2Y0SD 3GMGA 4DX5A 1DJ0A 1VRTA 3DM2A 3PIPQ 3BYPA 4F02A 2Y3YA 3S8SA 1PJ5A 1RT1A 4A48A 1SJ4P 1GH8A 1CS4A 3OR2B 2OFHX 1R0CB 3M1VB 1PC5A 2JNJA 5I3UB 1HA1A 4F26A 4DV6J 3PW2A 4RU2A 4RUHA 2PEHA 4DL3A 3H59A 5KFDA 2Z4PA 2K7KA 1JLFB 3M8ZA 4MFBA 4MJKA 4TN2A 3UN2A 5KFMA 1WF1A 3K5OA 2HNDB 3HKWA 1R6VA 4CQ1A 3J7AN 3OR2A 5I3UA 2QLWA 1DQ8A 2FZKB 2ZD1A 2ZKTA 4OIXA 4CO2A 5BR8J 4ECWA 2DRDA 4WK3A 2RQCA 4NLDA 2DCLA 4DR2F 1TV6A 1FDNA 2VODA 2GVDB 2OD4A 3GP9A 4J9VA 3MFIA 3ZZRA 3CCRS 2QFJA 3TUZC 1FFWB 2KXHA 2V63A 3M2RB 5KT3A 2G0CA 3K8WA 2WAQD 2YX7A 4W98A 1EAYC 3CWJA 4QJVA 1RE1B 5L9XA 3GFXA 3MM5B 4UOFA 1NHVA 1LWXA 4A8XA 1FDAA 1ZPWX 4MK7A 2FVPA 1S10A 1C0UA 2VKZG 3GR0A 1V3ZA 1CQNA 1YJWS 2UUTA 1PYOB 4ZCKA 4RR5A 4ALZA 2GS8A 2IRXA 2FZGB 3VGSA 5F8NA 1O0PA 2K7JA 5AT1B 2UVVA 1VJWA 1YZ7A 3P8BB 1UMJA 2Z56B 3ZTRA 4Z37A 5IOLA 5AE2A 4K7QA 5MAOA 5BR8F 3V4IA 1WC6A 5K8NA 3BEGB 1CJKB 5F0WA 3R5JB 1Q86T 2D3O1 1N36J 1FTRA 1IBMJ 1Q8LA 5KAKA 2L9WA 3D0IE 3PJWA 1IBCB 2YKNA 4USUA 2Z57B 3A1YG 1TUGB 2G1DA 1GXTA 2WONB 2CQ1A 4NA2A 2BA9A 1VHIA 1TL5A 2AHOB 3TNVA 2F8HA 4DUZJ 4QWDA 3DHWC 1IKXB 1R43A 4OLPA 2CQIA 3AD7C 3GSDA 3U1LA 1SC3B 3MMJA 2PI4A 3M2UB 3DDNA 2IRUA 1H98A 3I32A 3T19A 3KHRA 1GMVA 1JKHA 2QSFA 3AQOA 5F8MA 5HP1B 4OYZA 2AX1A 2DHHA 4YB1P 2BANA 1X4DA 3MPWA 3H0PA 2B51A 2LQ8A 4ZPCA 4OI1A 1Q7YT 1JIHA 4M8LA 1NPRA 1Q0NA 3T1HF 1JMTA 1KONA 2D41A 3DYAB 4I64A 4TVAB 4USKA 4L6V3 5K14B 1VMBA 3SCIE 1PYSB 3GIIA 3W60A 2R7XA 1IXKA 1IBLJ 1VJQA 1U47A 4K2XA 3U7JA 2GIRA 4C8YA 1P1LA 2M9KA 4NCGB 1U1RA 1H73A 2W4DA 3GFHA 2AV5A 1GT8A 1S79A 3I0SB 3IG1A 3UE2A 3LPYA 3MD3A 1IKVB 1BQNA 2IM2A 5CYMB 4USJC 2ZM6J 3NAIA 3W5YA 3MXHP 4RNNA 4X4VA 2ZH8A 4ENOA 1S1VA 1Q5YA 1N5YA 4LRFA 1N48A 2I2YA 4HACB 3KWMA 1U1KA 3OQ2A 1N52B 2DNNA 2RE1A 3LWLA 1WJ9A 1RISA 1IWAA 2FGOA 2KN4A 3NCPA 1DY3A 4M5NA 4EWTA 2XMAA 1N5QA 3EGVA 1FVSA 1QDUB 3FBBA 3QT8A 4MKBA 3K2YA 1Y9OA 2XG8A 3FZ2A 4F0HA 3HD2A 2GMLA 1FF2A 5E3CA 4DSIA 1U1MA 1X7VA 4MKYA 1Q95G 3G71S 1TMMA 2LP4A 4PYDA 2VD3A 2W7OA 5DGAA 2C2MB 4B3TJ 5J2MB 5AE3A 4LFBF 4JI0J 2NSCA 3C6TB 2JEGA 4LRAA 7AT1B 5G4DA 3RB0A 1LNQA 1CJVB 3FFIA 4UOHA 2W9CB 1RTDA 1S1TB 1F9FA 4KO0B 3C14B 3MTJA 4IFYB 1NHUA 5D6GA 2W4CA 2IVFB 3IWLA 1JLCA 2ROEA 2KFYA 5KFVA 1PIEA 3SSRA 3GPAA 1TL3B 1KTVA 3DCAA 2XLIA 2GMHA 1E6YB 3N4WA 5M2UA 4YHHJ 1Q78A 3HI9A 3I9V9 3MEDA 9ATCB 3K5MA 4A8YA 3EYZA 2KVIA 3EXCX 1M5PC 3S01A 1XBWA 4L3NA 3H8YA 2FLPA 4CYUB 4C8ZA 3H2LA 3R1LA 3KJQB 3F44A 4TYBA 3CD5A 2B3TB 3PHEA 3CDEA 3R5CA 5KFEA 2B4UA 3BR8A 1D1UA 3L3CA 1N34F 3LP0B 5KFRA 2VDIA 4G3IA 4ZJOA 4OI6A 1WTBA 1JLGB 3TZZA 1RBOB 2IY5B 3K5NA 1N54B 2YQ1A 3C8YA 3AB2B 3MUVP 3AJ1A 1VISA 4ED3A 1VQNS 4ED5A 4GVBA 3MCNA 4CDIA 4PUOA 4K4SA 5F3TA 5A8RB 4JUZA 5BYSA 2VHGA 1HR0J 3G8TA 2HQIA 4ANCA 3D0GE 1JXVA 1UTAA 2J7KA 1KVKA 4OX6A 4F7VA 4FS2A 1S0NA 5CCMA 1EX8A 2UUAJ 2IMOA 2QG9B 2WCXA 3CD6S 2V0NA 1FJCA 1CULB 4YB7A 4ILMA 1N5TA 4NZ6A 4OZ2A 3FUYA 4O44A 3RR7A 2HWHA 1VQ7S 2VBZA 4AE5A 1FCAA 1AYEA 4CT9A 2FC8A 4WYWA 4ZLPA 1FESA 4OYBA 1RA7A 2K1RA 4DEZA 2XY7A 1JJ2R 5AXNA 1XR5A 2KRRA 4DV2J 3MMBB 4B9NA 1VQMS 3M32A 2FVCA 4DR5F 3QJLA 2JZ5A 1SC1B 5L39A 3W7BA 3UDCA 3Q8YA 3A13A 3M1VA 2NPFA 3UNYA 4QU6A 2FHKA 3RW7A 2N7YA 2B5JB 4FYXB 4LSNB 5CD4A 1HYSA 4Y00A 2LA6A 3G6YA 5THWA 3LP2A 4B3MJ 2XMMA 5HMWA 4ZVEA 4U7UK 1UW4A 2HKEA 4KYZA 4DV5F 1UVIA 4O0NA 1XERA 2HBRB 2E1RA 3EZ5A 4DJBA 5HLFA 2KG1A 3NY0A 2ZITA 3CJ3A 1R0BG 2W2PP 3M4XA 1RKIA 3C66A 4ED1A 1VLOA 4Y6IA 5IT9Y 2AYMA 4UY85 3NMRA 1WELA 4JI1J 2H5IB 2EC2A 4TXSA 1FD2A 1HD1A 3W9JA 2ROPA 1NDKA 4IH5A 2XNQA 1H0HB 5DGBA 2B7BB 5CHCB 5D3GA 1D9AA 1JLAB 1W7WA 2C2OB 3LGHA 5J2NA 2FB0A 2MZQA 3LUYA 3HSJA 3IR6B 2RH3A 1FK9A 2WB4A 1RABB 4NLOA 3BBFA 4DL5A 4FPIA 4KQZA 1UAWA 1YRXA 3FVYA 2H5JB 5ADZA 1IR2A 5F8GA 3JQJA 4ELUA 1JK9B 2WTFA 4IDKB 1FFSB 1UP1A 2AJ4A 3R5GA 1R0AB 2GHVC 2HRTA 3PX6A 3QBCA 9RUBA 3ENAA 1RGVA 3DLHA 4LF7J 1FX4A 5DRKA 2BJ1A 1UW9A 4HEA9 2F4FA 4X4RA 4F3OA 1IJEB 3OXLA 3EICA 4R8UA 2MTLA 4DUTA 4C0BA 4ECTA 3H98A 4WPAA 1VQ4S 3PM9A 2QC3A 1RACB 1TKTA 2V5HG 3R9LA 1T8EA 3X1LB 2KVQE 1F60B 2PGCA 4OI4A 3BBCA 4RBUA 4ZVPB 4BWJA 5C24B 3GQCA 2V68A 3UCUP 2J5AA 4OHVA 4C8NA 3AXMA 3DLEB 3CE8A 4RPFA 2YKPA 1WHXA 4I2PB 2BUNA 4ES1A 1FA0A 1HNZJ 1I94F 1RT4A 4C8KA 2ZBCA 3RAXA 1RHUB 2JVOA 3E3XA 3FQKA 3KK1B 3IBFB 2W9BB 3DC2A 3B6BA 4M5IA 4A8KA 3R1HA 3PO4A 3FQLA 2QA2A 2DJWA 1UFKA 1WEYA 2IDEA 3F0NA 2BZ2A 1HLWA 2AGPA 2MZJA 3F41A 1T7PA 4ATNA 5A8RA 1U0SA 2FVQA 2HQDA 3P96A 3C6UA 2WVEA 3FRYA 1X5SA 1PJ6A 2HG4A 2QYGA 5ETNA 5GAHU 3KK3B 4DV7F 1RYSA 2A0FB 5DDPC 2BKNA 1QUVA 4QYRA 1IBLF 2DNLA 1ZAVA 4U67Q 1SBRA 1JLGA 2FZCB 4ZVGA 3ZNUA 3D3CJ 4DV1J 4I1TA 3PZPA 1SJ1A 4BC7A 4YB5A 3LPEA 4N8NA 4ZVUB 4RW9B 3IAS9 2XHCA 2YQ0A 4LF9F 4KHPF 2GFFA 4CH0S 4DV4F 5HP1A 3THTA 2BYCA 2UXCF 1RTHB 2IJNA 2PE8A 3K5LA 2G2OA 3J80Y 2YKMA 4DPYA 1RT3A 5L1LA 2XSFA 3JS9A 2PT0A 1VDHA 2H9ZA 5KFQA 1DTQB 1OYEA 2HGLA 2Y8YA 2HS3A 1IM6A 3BH7B 4WIQA 3HSDA 1QD1A 4V1Ak 2ZZNA 1SH0A 5AXKA 2KH9A 4C8MA 4RZRA 3J81j 1KP6A 1NZ8A 2LA4A 3WC0A 4DL7A 3H4BA 3MPYA 3MMCA 2QSWA 4X4PA 3CXCR 2JL9A 1TL4A 2P8IA 2NUHA 2YPZA 2MZRA 2D69A 1NJIT 1U2FA 2E7XA 3SQOP 5DM6Q 2F8EX 2E5HA 3DRRB 3BGLA 2PC6A 3NL0A 2MLXA 4KV8A 5J2QB 4NMXA 2WVBA 4XAKA 2O5DA 3MM5A 3S6EA 4JV5F 3A12A 5B7WA 3M30B 3FNNA 4CO3A 3ADAC 2EI5A 2HRYA 2UV8A 3NGSA 3QIPB 2X3DA 2CZ4A 3VTIA 4UOGA 2FJXA 2V4RA 3GCXP 4XK8C 1Q8BA 2AJ0A 2CJ9A 3T6JA 2BM1A 5GAGI 3OBIA 2YWEA 4QIGA 2ZD1B 3TUIC 3N6LA 3IFEA 4WYLA 2AKWB 3DOMB 3ONQA 1TUVA 3ETOA 1VRUB 4KB7A 2X3GA 1SL1A 1BQMB 2RS8A 5B0BA 4MFBB 4DFMA 1YBAA 3QT5A 2ALYB 2V4QA 1WC3A 3BKUA 3IBWA 5KG4A 3ZZZA 1R3NA 3MEEA 3I9ZA 1KQKA 2J76E 2OPPB 1Q53A 1FVQA 3LQVA 1KHVA 1HBNB 1C2PA 2IYIA 3BKFA 4J7CA 4ZKAA 1D09B 2DO4A 4RX6A 1KVJA 1N4LA 2AW0A 5B09A 5C5JA 2E1AA 1QAYA 4IRCA 5B0GA 1S6PA 4HYKA 2AMCB 3LALA 2VFVA 2X1GA 1RU2A 4CLZA 2OHDA 1N6QB 2EFQA 2NXJA 4M5HA 2QN6B 4DPOA 1VQ9S 4OL8A 1IJFB 3CEDA 3AHPA 4ZCIA 1VGYA 2V6AA 3W2WB 2GGPA 2GIQA 4UF4A 1YBTA 1X9MA 1SL0A 1ZOTA 1KLMB 1NNDA 3M30A 4ID8A 2XEXA 2RILA 3OL6A 2ZE2A 4DQIA 4HT7A 1V6HA 5E3PA 1D9FA 4ZVFA 1UFWA 1UWAA 2WVDA 5CQGA 1GEHA 1RAOA 3FMWA 2I6WA 5J2PB 2E5LF 3QSIA 3SBMA 3H4DA 1Q8KA 1FJEB 1FWKA 4NA3A 3BSCA 2VU5A 2DEIA 4K4WA 4EU0A 1WHVA 5F8JA 2X1BA 4WKYA 1H2TZ 4DL6A 1JLEB 4JI6F 4F67A 3GIKA 4ILRA 2NYHA 2Y8WA 4WKRA 1EZZB 1PKUA 4HHHA 4K5SA 3N9UC 3W62A 1M5SA 2R7QA 5HSPA 4A8OA 4RU9A 1KLMA 3MPVA 3OFFA 3N5BA 3D1QA 4ID5B 5CZVA 1IKYB 3LA0A 2GGPB 1FE0A 4DV1F 1HWUA 2QYCA 3NS6A 3HJFA 3MR2A 4EEYA 5D77A 1OY9A 3H7HB 4PWUA 5J1NA 3RBDA 2M8HA 2XLKA 4NLPA 2KI2A 5HMZA 2BW7A 1XQIA 1RTHA 2PN6A 5K8OA 1X9WA 1ZM4A 2LYVA 1VFJA 1RAJA 3P5BP 3OSNA 1F1BB 5KFKA 1NSKL 1U6ZA 4TQSA 3OR1B 4LQ9A 2OTJS 2JWNA 4EYIB 1HWLA 2IAJB 2MJNA 2ZHOA 3I82A 3UDEA 4P73A 4KJIA 2QE5A 3EVWA 3QJPA 4RBTA 3CCJS 1TL7A 3I0RB 4CWBA 2CNNB 1YK9A 2Z8QA 3L4BC 4PPDA 4YHHF 1S9FA 3T3FA 1FXLA 1I6JA 1AB8A 1R89A 1FFGB 2MZTA 3BV8A 2VBXA 4ZPTR 2R7RA 2EK1A 1EETB 2D3ZA 3LAMA 4I2PA 4P6QA 4EMDA 2JSXA 3DLGA 2G1HA 5AJ3F 3EGNA 4KE5A 3CMQA 3MM6B 2W9AA 2J9CA 3M8WA 2VFSA 3GJQB 3F73A 4DV3J 1OY6A 2H3EB 1PYTA 2FGCA 4ZHRB 2F65A 4GC6A 1X4AA 2JHEA 2NZCA 4IG0B 3RG6A 1B0TA 2VBYA 3RU0A 2XGPA 2UZAA 3SI8A 3C15A 1Y10A 4B3SJ 1Q79A 1K1SA 2VONA 3GCWP 2JFKA 3OTEA 2GMJA 4GC7A 2RU3A 1BWEA 1RB0A 3BBBA 4K0KF 3UFCX 3M8PB 1A9NB 1GXLA 3LP1A 3TVZA 4Q5VA 1N5SA 1NUEA 4CTAB 4YQWA 1HQUB 2V9WA 1RZMA 1HQ2A 4OZ0A 5HBMB 1T02A 3PVXA 2HQFA 4IOCQ 4C48A 2XO6A 5HMXA 3N01A 3R7NB 3OUYA 2F5GA 3C15B 3PYFA 1TR0A 2WSEC 3PIOQ 3BO2A 2R7OA 2DXFA 3NCRA 1T9XA 1URNA 2XNRA 1YBUA 3Q22A 3KMQA 5D0HA 1U0HA 1X5OA 3LP1B 2CAJA 1RAGB 4ED0A 4U7UD 3NGRA 4HLBA 3MEGA 4WFAQ 4FVCA 1Y5LB 3PYGA 5IXUA 4G1QB 4P10A 1U4BA 1VI7A 1WOSA 3LOUA 3PRVA 4ICLA 4QZVB 4UQTA 1GMUA 4AYBD 1FNMA 4DG1B 3QSYB 4FNHA 4YOEA 2W25A 1C4CA 2CYYA 3FDSA 2J8SA 2YNIB 2UXDF 3QRPA 3HT3A 1U45A 4LF1A 5FJ4A 3FMBA 2ZKUA 3MM6A 3N79A 1IKWA 4LBPA 4J9LA 1GX5A 4KRWA 3R8YA 2QLBB 3CW2C 2BW2A 2MKCA 1VK8A 3OT9A 2XWYA 3HD1A 3QO9A 2N3OA 3MUTP 2NREA 4OQJA 4LF2A 3UVJA 3GV7B 3CJ4A 5IWAJ 3R7BB 2GIFA 4DS5A 2CPEA 2IM1A 4A46A 3IMQJ 3PJ9A 2NYIA 4M5GA 4CH1A 2ASLA 3TWZA 1UWBB 2XZWA 3CJ8A 1E6VA 3A8JA 3K17A 1FE4A 3OR1A 1SC6A 4UUWA 4X66F 2BJ8A 1WORA 1X0FA 2XS2A 3OVBA 2LQ9A 2VG5B 2RSQA 2GO8A 4G6VB 3QMQA 1PBUA 2DNHA 3KLIA 3V5RA 2R9LA 4ID5A 3HJVA 1Z1ZA 3MHYA 5K8PA 1AFJA 1YITS 1Z2LA 4M94A 3M2VB 4B3OA 4FVMA 4JP8A 2V4JA 2DYAA 3TQEA 4OZ5A 2H65B 2P2CB 2D3UA 2JJ4D 4P2SA 4Y65A 5LSRA 5LJ3Y 4DR2J 4DV3F 2C42A 3ITHB 1HBOA 1B0VA 3AXKA 4M5KA 4LBHA 1N0UA 2J9DE 2OEKA 4AXIA 4B17A 2BMBA 2FY8A 4K4UA 4TY9A 3A8KA 4KHRA 2CADA 3LP0A 1S49A 3HF5A 4RW7B 1NK4A 2H54B 1X0PA 4E2FB 4OV1A 5MLCV 1NK6A 2Q66A 5LMNJ 3PTWA 2HWTA 1HI8A 4KFBA 3J7ZT 4NXMF 4JB8B 3OL8A 1JLAA 4DCPB 2ACYA 1S4EA 5ITHA 1S1UA 2RRBA 4XPEA 4NEYA 3BGRA 4Y2MA 1J5OA 1Q1KA 4MYUA 4ETXA 3WBZA 2Q1LA 4LRCA 5T7LA 1RLCL 2MQMA 4NMLA 5L9NA 1DQ9A 3PFEA 2FJBB 3DOLA 1HWIA 1C4AA 3KUGA 3MM9A 2WBRA 4ZPBA 1F0XA 1JLCB 2XYHB 3HSZA 4R5PB 3EDRB 1LWEB 4A8SA 4V19J 5C42A 4TU7A 4FN5A 4X64F 3MI7X 2XS7A 3D0HE 2BACA 3HHKA 3KLIB 2VPXB 1VC6A 1SI9A 4AXJA 4DPTA 2VG6A 2ZBRA 2B43A 3P3DA 3OFGA 4ZLLA 3AA9A 1E6VB 1FEHA 1XMBA 2W2NP 1FO1A 4KGXB 3FBEA 5T41A 5C2CA 2W8LA 2UXCJ 4S0MA 2PI5A 1YJRA 2L48A 3MECA 4NCAA 1VQ5S 2FVRA 4RUBA 2ABYA 1FXDA 2HFSA 1REVB 2B9WA 3AJ2A 3BH6B 4Q2LA 1U1PA 4ZJLA 1B70B 1BQMA 5F9LA 3SMZA 4JI3J 1X8DA 2HZAA 3Q8SB 1N5YB 3ENQA 3M9OB 1REGX 1SKWA 4RJVA 3AOBA 5KG0A 4NI2A 2DXEA 4NLXA 2MHEA 2HFZA 2ZDOA 4WFXA 4IR1A 5KG6A 3ZFVA 3RJMB 3HK2A 1EQ0A 3TW0A 1W26A 2BOPA 3NGKA 3W8GA 3QIPA 4ED8A 1MWQA 2GCFA 2OPRB 3DI6A 4NLUA 3SCKE 4C98A 1QY7A 4EUVA 2KT3A 1OPIA 3CJ2A 2UVUA 1H2UX 2CQGA 4NEZA 4TLQA 3NS5A 4KV8B 3ZXWA 4EK2A 3KFWX 4U7CA 5J2QA 2CPXA 3FZBA 1KOOA 1QSLA 5HROA 4LJMA 1U2RA 1U0HB 2AZ3A 3EVOA 3NCQA 3UR3C 4K8RA 4C8OA 4QU7A 4I2QB 4WU3A 2H51B 3RRHA 3KLEB 1FRJA 4HR2A 5E2QA 3H5XA 1YG0A 3T41A 4KKOB 1TKZB 4JI4J 4V19X 5LMUJ 1WG1A 3CDBA 3ILOA 2RRAA 1N36F 3M2UA 4LFAJ 5J1EB 3I56S 1HNIB 5A2QU 1C0TB 3GJSB 2ZC3A 4NA1A 4FF2A 4GKJJ 2HHUA 3PG9A 2Y1RI 1M5HA 3ETMA 3IM9A 2WW8A 4ZDNA 2ZH5A 1DTQA 4BLGA 1LW0A 3AOAA 3I6PA 5KTQA 2YWHA 1MWYA 3JQMA 3MMCB 3TEHB 2YY3A 1S77D 2HVIA 5ETKA 1YTYA 1RT3B 1ZTWA 4F8RA 1JXEA 4P72A 1MN7A 1VQPS 5KFUA 3C2PA 3BQ2A 4K4ZA 2EPIA 1YIJS 1G1XA 1G7CB 2C2DA 2AIRB 3PW0A 2HBQB 3NNCA 4H4KA 4F4WA 4WZMA 4I2QA 1U49A 2RAQA 2CUYA 3EE3A 2FJVA 4ZP7A 1YWXA 1UEVA 3BQ0A 4RBVA 4F25A 4ELVA 3G6XA 1RADB 4Z7CA 1CJTB 3ILIA 2OKQA 2V8PA 2EK6A 2VG7A 1CJUA 2BE7D 3EJMA 1JLQB 4ZP9A 4NLVA 1ELOA 1QAXA 2W2OP 4R25A 2GJ2A 3BGOP 3MMAA 3TJ9A 1VBXA 2YVSA 2FIUA 3ISNC 4AT1B 4DN0A 2YNHA 2W4PA 4RO0A 1MMLA 2WB1D 1CQMA 2XYGB 4RW6B 4WE1B 5ETSA 3RUBL 3ZTQA 5C2GA 4RNMA 2EEYA 2MKIA 2GVDA 4ECVA 3IA0A 5LJ5Y 4ECUA 2ZBIA 4F2RA 4O3QA 5D8HB 2A6OA 1YVFA 2MSSA 2ATLA 2MMYA 3IR5B 4EO8A 4R8UB 1JLFA 2QL7B 3A4TA 4A4JA 2XSJA 1REVA 5B0FA 4X4TA 3TAPA 1V5VA 3O6QA 4JI0F 1U1OA 4B9LA 2BV3A 2W2MP 3HZEA 5K9FA 1S7HA 2BKOA 4DBQA 2VA3A 4H4OA 2DNPA 2QO3A 3DRSB 3G87A 1RWUA 3ZZPA 2AWZA 5A8WB 1KWMA 1FWPA 4CO0A 2E1MC 2ZH6A 1TAUA 5LM7E 1D3WA 1NMEB 1QM9A 1WEXA 1RT5A 3V6DB 3J7YU 2HSEB 1SJ3P 5HMYA 2C22A 2OELA 2PMWA 1LWEA 4C0HA 5KT7A 1CLFA 5LMUF 2I38A 1TFWA 2AT1B 3DOLB 5J2NB 2YTCA 3FK4A 2RDJA 2ZEJA 4IDKA 4I6AA 4BC9A 4CP5A 2QTWA 3M9NB 5FIIA 2FLLA 5KT4A 3MM7A 1FJGF 3D6FB 4BS2A 3R2CJ 2NUUG 2LEPA 3DHXA 1JWWA 5B0EA 1FK9B 4PXCA 2HMIA 2F9DA 2B4OA 2BM0A 4PXBA 5E7OB 2UUBJ 1S59A 3KLHB 1RAAB 3V4IB 3PW7A 1J27A 2VFTA 1RP5A 2CWXA 2PEBA 1XN9A 1U26A 2AJ2A 4PR6A 4F3QA 3DFEA 3TP2A 1VQKS 1N8RT 1QUPA 4YN3B 1WG4A 2E66A 1XR7A 3M9MB 4F4YA 2J9DA 1NB7A 2VOPA 2GHWA 5ETVA 2XGQA 4PG4A 4AD6A 2XBPA 3QGPA 4WFZA 4Y2KA 4Y2AA 2MEWA 1HD0A 3SDEB 4DSKA 4B3OB 2QFIA 5C25A 1C1CA 2J8AA 4YY3F 3CNQP 4CLFA 3POTA 3KG1A 2IYGA 3DU6A 4WP8A 1OJ4A 4LRDA 3M8QB 3MMBA 1WKLA 3ISND 3IRXB 2DVIA 1EKRA 1FKOB 1IM4A 2C3UA 4E8UA 1W2BR 2DBBA 2OPPA 3MR7A 4OZ1A 1FTCA 5HAOA 4H4OB 1RJJA 4NZ0A 2W8KA 4IO9Q 1DRZA 2DHSA 3IWNC 4FYVB 4Q0BA 2QMXA 1SB6A 2IDLA 4DV0J 1FX2A 1X4HA 2D9PA 4OI3A 4TYAA 1RAIB 2HHHF 2WSCC 3BPSP 2XC9A 1TK8A 4EZ6A 3OJSA 2XWXA 1MMDA 2B4VA 1LFPA 4BCAA 4N8OA 3TAMB 2ZVSA 4IH6A 4P75A 2FLNA 3S7RA 2AYEA 3X3UA 3SYZA 3SFUA 3NGTA 3MZIA 2QL9B 1HPZA 1RT7B 4ZVTB 1OSDA 5KFTA 3KXDA 5D78A 2WVCA 3BPDA 2VH7A 4C4WA 1RAEB 5FLXU 3CCZA 3SDEA 1JB0C 3PR4A 1URRA 5IQ6A 1CJTA 2OFGX 3GE9A 2DHAA 2ZUGA 3RW6A 2HHWA 1AT1B 2HHTA 1H72C 4F2SA 2C3OA 1MMNA 2NS1B 2FJDB 1VOMA 1S0MA 3NMAA 1TL3A 1YJNS 2R42A 1MN9A 3A3PB 4U9RA 4I4BA 3VAHA 2EC0A 2L08A 1VR6A 2RQ4A 3NBPB 4A47A 2ZH9A 1U25A 3OV7A 4C9DA 1M5OC 3GFYA 1KQGB 2CNKB 1U8WA 1DURA 1HNZF 5H1SV 2ASDA 3W2VB 3OJUA 1KLNA 1VIXA 2BJDA 2GQQA 2KM8B 1WKKA 4L72B 1R7IA 4YDDB 3RR8A 4F04B 1HNWF 4DXLA 1E6YA 1NPKA 2OLWA 3M8PA 4R0EA 4DUYJ 5IV4A 1MW7A 3DKDA 4USIA 3QLHA 2DNKA 4N5SA 2FY1A 2HFUA 2FDNA 1Q16B 3L9ZA 1MU2B 3NS7B 4W92B 1BE4A 2FHOB 3D6HB 3D68A 4ZVQB 4X65J 4R0JA 4O4GB 1DARA 2C3YA 2AEFA 1O5JA 1S72S 1IBMF 3KG0A 3N0VA 3V6HA 3IRWP 3PX4A 1WSVA 2BRLA 3BKTA 3KHHA 4MK9A 2J6TA 4PWDB 1OSCA 5L1JA 3CJ5A 4X4NA 2WRMA 2H4YB 3CIZA 5IT0A 2FUG9 1ROFA 3UDLA 5KOWA 2IRYA 3MTKA 3OFHA 4EBCA 2B56A 4GVLA 2XMTA 4K0KJ 1BQNB 4EGLA 2BJ9A 4DN9A 4USMA 4ELTA 1EETA 5DJBA 2CJYB 4WTYA 3W9HA 2BRKA 3B78A 3IG1B 4UZCA 1X9SA 2OJ3A 1UVLA 1KOHA 3G82B 5ETPA 4MIAA 1SQGA 2YH1A 2HZCA 4F36A 1XMOJ 4HKQA 4ECRA 1TL7B 4QWEA 1VRQC 1ZZNA 3EGWB 4F4XA 3D6TB 2JLGA 2NZ4A 4LFAF 4JI2J 3UR0A 1LWFA 2GHPA 4DL2A 1TKTB 2JX2A 4HI1A 2MSTA 4LR9A 1FRXA 1S1XB 3AFGA 3I31A 4IH7A 4KC5A 2BANB 1JLBA 3WHIA 4KH1B 2KDOA 2QX0A 3J80U 1JKHB 1J5EF 3QYYA 2DNYA 4U8VA 4DUYF 2HHXA 4BWMA 3KNAA 2Q79A 1MWZA 2CG8A 1HW9A 1TMJA 4B3MF 4I56A 2H1YA 3I96A 3HP6A 3U27A 2M4MA 4DPXA 3Q86A 2OD6A 1H74A 2BABA 1RWKB 1R8HA 4DR3F 3RBEA 1U1QA 1BLUA 3CCES 1TFYA 2CWKA 4ZP8A 3H5SA 2FVSA 3OPKA 4HI2A 4EFAC 2UXBJ 2X51A 2CZVC 1CJKA 3HM9A 2HW3A 1AW0A 2MZSA 3NOCA 4KGVB 1S1WA 3PXGa 2DR9A 2R7SA 4ECSA 3MM7B 4DX8H 5KFLA 4QIVA 1U24A 1W25A 4ZMMA 5DQGA 4DSJA 4O3RA 2E9RX 1FXRA 1X5TA 1S1UB 4YR0A 1BGXT 3FEZA 1ICEB 3Q24A 3UD4P 4KGKA 4KFBB 3ZZOA 2MB0B 3GB0A 5HQLA 4DR6F 2A10A 3PDNA 1GMWD 3RGIA 3W2WA 1T9UA 2OMLA 3CJSA 2B6AA 2DY1A 1R8PA 2RQMA 3VZHA 1NM2A 3CCQS 2CVEA 5DG7A 1HBOB 3M8RA 4N77A 5GAEI 2J6UA 2IM3A 5A8WA 2WBMA 5CYJA 5L38A 1UVNA 2CNLB 1XMQJ 1FT8A 1RK8A 1NDCA 1Z4UA 2HQCA 3DLKA 3HDSA 3TYTA 1A0OB 2O1PA 2B7CB 3U1NA 1SKSA 4B9MA 1HL6A 1I94J 4LUBA 1Q5VA 5KFWA 2CQPA 5CXTA 1XNQF 2XI2A 1ZA1B 3ET6B 1XNQJ 2DGSA 3E01A 4Q8FA 1Q7LB 2MY8A 3TQ1A 3VGTA 3JSMB 3IAM9 3VHQA 2LQBA 3CCWA 1TV6B 1NJWA 4TKTA 2DNGA 1FKOA 3G8QA 1S6UA 3FEYB 3UWTA 1FKPA 3M8QA 3ZNJ1 1VQLS 1SIWB 4OYOA 4DFJA 2DKOB 2AYBA 1FRMA 3U1MA 2XMVA 1VRUA 3ILLA 1XTZA 3L7PA 4WXWA 2RS2A 2ADCA 4NLRA 2HLUA 3CCUS 1CC7A 4PAAA 2HPUA 2CQ2A 5KFNA 1RCOB 1U09A 2R2UA 4Q7AA 4D3GA 3CCMS 4I68A 4JI5F 1VRTB 3DM2B 4P71A 3EM1A 3IXQA 1ZM3A 3DLBA 3PY8A 1GK8A 5D4LA 1S9EB 8RUCA 1GNKA 3OFEA 4OHWA 1IUJA 3TZXA 4HDGA 2HHQA 1UA0A 4DLEA 4X4SA 3IP0A 2SXLA 1SL2A 3EGZA 4HHJA 4WFBQ 4CCHA 4WFYA 4CZCA 4I0WA 2JRSA 3VGUA 2AJFE 4LR8A 2VC1A 3RB4A 4NYZA 3D7SB 1FJ7A 2HS0A 5HQ8A 3QWUA 5M2RA 3QAUA 1P9YA 2RD5C 3D4JA 1KN6A 1L3SA 2DGQA 3ZTOA 4YR3A 1QAIA 1HNIA 3D5MA 2WZ1A 1RT2B 4PCQA 1KFDA 1TELA 4DV5J 3QGGA 3DXBA 3JSYA 4KKOA 1U1LA 4DV6F 1EIYB 1RTDB 1O8BA 3TUPA 2YNFB 1RWXB 1WHYA 1Y3KA 3O8WA 3KNGA 3Q0AA 1HNWJ 2OSQA 4Z2XA 3BGFA 2NLWA 1F5BA 2R8JA 5HROB 4I6YA 4NXNJ 1ZPVA 3IWXA 5KG1A 4J37A 3BM7A 1VLYA 2I5JA 2R8GA 3HSGA 3G2XA 3R5BA 3DDKA 3HFVA 2GVZA 2QIFA 4HVZA 4C11B 1KVIA 5H9FJ 3OL9A 5ETQA 3E8OA 3MM8A 4Q44A 2VG5A 4OV6A 2POKA 2ZFHA 2LMIA 4KGZB 2EW9A 1TU0B 3PYDA 2VPWB 5JUMA 2VQEJ 1T11A 2R2SA 2ZC4A 4RLEA 5KFIA 4LBIA 5I42A 1TL1A 2DK2A 2ZUAA 8AT1B 3MR5A 4DQSA 3AY0A 2DT9A 3TANA 4LF4F 2YWKA 1IBKF 3AB4B 1UL3A 2FJAB 1F3FA 1RQ0A 2QA4G 3CD0A 3GG0A 3BSAA 4QR1A 3KJVA 3QO9B 4B3RF 3BR9A 5KFAA 4CM2A 4DSFA 4URSA 1BUXA 1CSJA 5F0UA 5U47A 2Q43A 3G4SS 1V3SA 3ELHA 2CG4A 2ZBQA 4LF8F 3FCVA 2HZVA 2DB1A 2VFUA 1KFSA 3MCSA 3S1TA 2YPYA 2GJFA 4NWBA 1SXLA 2KJWA 4LVOP 4ZLNA 1S4FA 3T5LA 2HFVA 2NXUA 2DNOA 3GR1A 3VWSA 1L3TA 4IKAA 1FD8A 1XC9A 3PRDA 4OHYA 3W64A 3UNGC 1L3UA 3MM9B 3BF4A 6FD1A 2CPZA 2MQ8A 3VQTA 3W1YC 5AJ3J 4JI5J 2RQKA 4U96A 4YP3A 4YMEA 3Q8UA 3EX7B 2VL1A 3MOZA 4P2FA 4L75A 7FDRA 3BGRB 1J5OB 2VBWA 4ZVRB 3W2VA 4JI4F 1O6XA 4RW4A 1XEZA 4O23A 4LF9J 4ZPAA 1AXQA 1ZM2A 1K44A 3W66A 4USVA 3VV2B 2XMUA 5HO4A 2MPUA 4Y3CA 4PABA 1JLEA 4NASA 3DRPA 4ER8A 3K0JA 2Y1LB 3H42A 3WDOA 4W90B 2F40A 1TKXA 4CRJA 1DHMA 1VC5A 1WDDA 3GIRA 4CTAA 2PFFB 4JV0A 3ZZTA 1RT6B 3NWRA 1VK3A 4RWWA 4NLQA 1M90T 1S76D 4ZS6A 3KLGA 1HR0F 5I3PA 2KZMA 3A3NB 2Z2YB 1U7LA 2BKPA 1Y7PA 3MAAA 3QNWB 5BYRA 2ZH3A 2E9TA 2UUBF 3GZ7A 2R4FA 3LF0A 2BXJA 4C3LA 4DFKA 2B4PA 4FF1A 5ETTA 4TU9A 3ENWA 4OZ3A 3M2RA 2E7WA 3Q2SC 4OLOA 1DLOB 1GQEA 1VYAA 5F8LA 5KT2A 1D0EA 3D9BA 3KOAA 3GWCA 4IO1A 2VJUA 1YHQS 2BX6A 1HI1A 2RVJA 1I5OB 3NGUA 1C1BB 3B54A 1JJHA 4LSNA 4ZJQA 4DV4J 1OQ6A 2HVZA 3EDQB 2G4BA 4AL7A 4QPTA 5GADU 3VAMA 3R97A 2MDAA 4MYTA 3UCGA 4YY3J 2EWHA 1MNEA 3KUHA 2AEJA 3OXFA 4P74A 4DPWA 5A2QY 3O44A 4HT5A 4JI6J 2OMOA 4N47A 4QPXA 1LKZA 1VHFA 3CDWA 4RNHA 2X1AA 4N76A 2IAJA 1QJHA 2V34A 1FNOA 4TY8A 3MF5A 2AEMA 3QQCD 4OYAA 1BMQB 4ZK7M 4F4KA 3GYNA 3O3LA 5J1PA 2DGUA 4ED6A 1T9VA 1RTJB 4LSLA 3PW5A 2U1AA 2GNKA 3PEJA 4NYOA 2A6MA 2R7WA 2HNYB 1C1CB 1FRKA 2IC3B 3NG8A 3UN3A 1SVDA 3T5HA 3FBCA 5ETMA 4TU8A 3KLGB 3PYEA 1NRKA 1RWMB 3MAHA 5KFSA 4AFFA 4DHVA 1CPZA 2HURA 2LLZA 2QZ8A 1APSA 2B6AB 5A76A 1SH3A 1TKXB 3HVTA 2CQ4A 3P45B 2ZH7A 1Q82T 1CC8A 5G0RA 1P27B 2CFXA 3K59A 2EVZA 4H4MA 3GFZA 5D4NA 1F9HA 1UPMB 2HHPA 5D15A 5HL7Q 4YB6A 3JTNA 5DS7A 4RW7A 4MAKA 5HQMA 3TRGA 1PG5B 2CNOB 4K59A 5HBMA 3RZAA 2ZHAA 3GYGA 3AD9C 1RTIA 1YKWA 2NXEA 2YBVA 1OMSA 5EGYA 1V3RA 2WSFC 1QAJA 3EWGA 3A8EA 2LECA 2AGQA 2EXUA 5GMKa 4NZ7A 3BREA 4RW4B 5HVFA 3R7SB 1ZZFA 2XQCA 4DZDA 3ZZYA 4Q8EA 2DY9A 1RYRA 4X66J 3FJ2A 4LR7A 4HHUA 4OJGA 1NZAA 2DH8A 4M5LA 1NBEB 1WUUA 3PO5A 1N32J 1DBDA 1YJTA 1UVMA 4Y2CA 2CPYA 3OVAA 4DZ6A 1XMQF 3P4UB 2CZ9A 4W4MA 1X4GA 1X60A 1R27B 4DR1J 2DR5A 3K8VA 4X65F 3SSSA 3MURP 1WG5A 3PFOA 4CH7A 3LGMA 4OZLA 3DLLQ 4DSEA 4A8FA 1SV5B 4OI0A 3VF0B 4F4ZA 2HVEA 3GLJA 1KBRA 2EFVA 1FNXH 1YJ7A 4DX6A 3Q83A 3V81B 2KRBA 2VC0A 3I0RA 4M63A 4NRUA 3KTQA 5LSOA 1IKWB 3C6UB 1RWWB 2DCUB 3FCHA 4YFUA 3T9NA 2MKSA 3AA8A 2DIVA 4ZCLA 5KFJA 3PJXA 4CLLA 4M5DB 2VASA 5IT4A 3SV4A 3SV3A 1SUQA 5CCLA 2YNHB 4WE1A 3WZ0A 4DV0F 2HHHJ 4LT6A 1GMWA 3E51A 1S9GB 1ZA2B 2I9SA 3D28A 3N28A 4WXOA 4Q45A 3HPOA 4ZCMA 3KLFB 3GIJA 1LEOA 1MG7A 1HNVB 2M5YA 2OEMA 5AE1A 3VAJA 3QWPA 1WC5A 5CD4H 3G8SA 1RWNB 2HK3A 3M8SA 1TKDA 2RNEA 5FLXY 1VQ6S 5KFFA 3W63A 2YNFA 3NOGA 3T1YF 4WFNQ 3BZQA 3FC9A 3DDIA 1LXJA 4AUKA 2JFDA 5LT5A 1IKYA 1HBUA 2AX0A 5GADI 2ZOFA 3M6UA 2D7SA 5L1KA 4PQUA 1NK9A 1DTTA 3C16B 2H48B 2IIHA 3HHLD 1IQZA 2I0XA 5ETLA 2V94A 4QQBA 4O3NA 1YLXA 3BB5A 1G4CA 2E29A 3L95X 3R5DA 4KAIA 4UW2A 1R0AA 4DCJB 4JYAF 4LSZB 1WI6A 4NOHA 1H7XA 2Z58B 3CC2S 4C3KA 2Y1IA 1KQFB 4I6WA 2FYXA 1RTZA 2JLEA 4HTIA 1NKCA 2EFPA 1C0TA 1KC8T 2UV8G 4AL6A 3TI0A 4KSEB 5K5MA 1QTMA 3FCWA 5A8KA 1HBUB 4KR0B 4H4MB 1F5AA 4DX7A 4DCOB 2XCPA 1RI7A 4QR2A 2V69A 3BO3A 5A6PA 3Q8RB 4QIFA 1ZH5A 3LGNA 2RIJA 4PWWA 2GQCA 4LIWA 2ZJPQ 4FBUA 1C0UB 1ZAWA 2IM0A 2QMUB 4OMFG 4DU8A 5EN1A 2CPIA 2BJEA 2V50A 3QAEA 5LSLA 2P9CA 4NYPA 1BHNA 1QSYA 4JI1F 1WHWA 4LREA 2HNYA 1WI8A 3CO0P 1S9GA 3HHLC 1LWCB 1NK0A 1NO8A 2GQ2A 4IG3A 4DL4A 1S9EA 3BGUA 3T1AA 5HK4A 1DAXA 4FXDA 1BQXA 3VQSA 2XI3A 1ZS6A 1G6BA 3LP2B 3D67A 4KBIA 4C6AA 1X4EA 4C3MA 3KHGA 1HYSB 3D1HA 3PKMA 3MEEB 3CMES 2UUWA 3CO9A 4YUDA 1RSCA 2E5LJ 1NHKL 2Y0BB 2DEJA 3E01B 2DNMA 1SV5A 3KK2B 4URGA 1HKAA 3OTBA 4L73A 4FS1A 2BE2B 2QV6A 1FKPB 4FF3A 3KDNA 2L9NA 2XTJP 1X5PA 2DGOA 3OTOJ 4PUOB 4QW8A 3R3TA 2ZM6F 2AJ1A 2DGXA 4CNYA 4DDFA 4B9VA 2PFDA 6AT1B 3IRXA 3JSMA 1EARA 1RHQB 4O44B 4N56A 4ITSA 1KQSR 3D2WA 2JDJA 1PILA 2GAHC 2KU7A 5HJXA 1CULA 1YJVA 1EKSA 4JI8F 2PA3A 4DR4F 1B0PA 2H4WB 1FRIA 4ANDA 5IWAF 4USHA 2ZJQQ 4DR4J 1JNZB 5KG5A 2HFOA 4UZBA 4EBDA 3WC2A 2HGNA 3MWBA 3OLBA 3KG4A 4LRBA 1RWPB 4XDDA 4GVBB 4RWXA 1VCTA 4K5RA 2FQQB 4M5JA 2BQRA 4GO5X 1HMVA 4P7VA 4U6PA 4RUCA 2EG1A 2VFRA 3AAWB 4EBEA 3G86A 2VKRA 2GZOA 2M2BA 4HH1A 2ASJA 2FD2A 3BDEA 4CLPA 4OJ1A 1G2EA 1BC6A 2CPHA 3P6YC 4DF4A 3VAFA 3BYRA 1ZBTA 2DHGA 2K3KA 3DMJA 3HKZD 4WWSA 2PMHA 3FSXA 2M0GB 3KUEA 4E0DA 1N34J 1N33J 5K8MA 5D0EA 3NNHA 1LK7A 1WTFA 2HWIA 2VV5A 3T6BA 4UT4A 1H7WA 1IN0A 1UJ6A 2Z2ZA 1UFLA 4RW8A 4ZPWR 3K5PA 1EJ7L 3H25A 3K57A 5DG8A 3OHBA 1HBMB 3OHAA 1LQ9A 3JYTB 3LO3A 2FJWA 2LQ5A 1JJCB 3WQPA 2GA7A 2QLXA 3MUMP 5LOQA 2CDQA 2FTRA 2LFVA 2R3VA 3UQSA 2C2KB 2XZTB 3AD8C 4KO0A 3IS9B 2D1CA 3M7VA 5KT5A 3IN5A 4Y28C 3I87A 1P8GA 3THPA 3UN5A 5KFBA 4LF5J 1NKEA 3MGJA 4RL1A 2AJQA 2JC0A 2CQBA 3W5XA 4QIWD 1U1NA 2E5JA 1Y5IB 3JAMY 3N6MA 4AL5A 3EZUA 1N56A 5GMDA 4D3HA 4CLTA 2KT2A 2CQHA 2IA0A 5E33A 2AP6A 5FDLB 2RMLA 2QLFB 2ERRA 1NLKL 1U6FA 2BOAA 4OI2A 3J81U 4N41A 4QYZJ 3HX9A 4FKYA 4NX9A 3D3BJ 5KFCA 3DRXA 4FDFA 4YDXA 2OGUA 3DLEA 3MCMA 4F0KA 1FEEA 1RXOB 1TL1B 2VZ9A 4L3KA 3QRRA 2HVDA 3AQPA 4DOZA 2ZNZA 5C24A 1IKVA 5CYMA 2C2NA 3ZTSA 3K58A 3VAKA 2UVRA 3P49B 1LV5A 1DLOA 3TO8A 4LF5F 2J7WA 1T3OA 2YNIA 2RB7A 2R2TA 1KHWA 2YKAA 1Y00A 5EHHA 3G82A 2G0JA 5A6WA 1UZHA 2G0IA 3TX0A 2C2RA 4ICLB 1AZSB 2M70A 2A1BA 2YWFA 4JOUA 2VG7B 5KFPA 1X4CA 5EWFA 1NJXA 3QLHB 1TVRA 3RYLA 1WKJA 4B3TF 1H3DA 2L3MA 1P1TA 2Z2LA 3TJAA 1F9EB 4CI0B 3MFHA 2E7VA 2YWWA 3R6GB 3SQGA 4ZN1A 2RKIA 3W8PA 1CEZA 2B8PA 4PXDA 1EP4A 3D1OA 4TQRA 5L1IA 1WACA 2DH7A 3VVTA 5FD1A 3TX8A 2GV1A 1PBAA 2P6SA 2BQUA 3Q8VA 3EZOA 2O67A 5CAAA 2DR8A 3CULA 3NRBA 1M5VC 4P2XA 1LW0B 2C3PA 3KMSA 5BYQA 2HIQA 5DETA 3WX4A 4FBTA 2LEBA 2YKMB 2BJ3A 4IR9A 4K4XA 2ZH1A 5HI7A 4J9KA 3LTOA 5DZ7A 1EP4B 3NEKA 4G1IA 3CCVS 1CJVA 4C2MA 1F6TA 1DZ5A 4JI8J 1VQSA 2W2QP 5LXYA 1GX6A 1SJQA 3C6TA 4PPZA 5M2PA 4IG0A 3H40A 5J2MA 2UVWA 4KTQA 2H5EA 2NQPA 2F63A 2O66A 1FERA 2PDAA 3HO1A 3R2DJ 3VZIA 2AGOA 3KHLA 4KHPJ 2YKOA 2CIMA 3DLGB 2R7UA 2Y1JA 2EFGA 2FPHX 1ZM9A 5L46A 3GYXB 3NXZA 1T9TA 1YRUA 4JV1A 3C46A 1PO6A 3KYLA 3HVRA 2LXIA 5ETRA 1XMOF 2F4VJ 2X1FA 1RT7A 4I7FB 2HVHA 4MH8A 3N6NA 4QWCA 1AA1B 1XK8A 3QRQA 4Q0BB 2F9JA 1HWKA 5GMEA 5BXIA 2MKHA 4XO0A 2QEXS 1UPPA 2GJIA 1L3KA 2K1RB 2ZDPA 3T9ZA 4MKVA 2KJVA 4OX8A 1CBKA 1D8ZA 5DO2A 5T14A 4USTA 1HNXJ 4NXMJ 2G2ZA 2HNDA 2FHJD 4YR2A 1LW2B 3G6ES 3H20A 3EUNA 3HHLB 2LVWA 2OEJA 5FDLA 1P6TA 3ET6A 3W61A 2KB2A 2LU1A 2RJZA 2MKYA 1RU1A 3Q8PB 4A8MP 2M3DA 1Q4RA 3QT7A 3MECB 5EWEA 3DLKB 3OW2R 1M1KT 4JI7F 1RT1B 4PWDA 3DYAA 1KS2A 3IGNA 3UW1A 1OWXA 1RHJB 4PEOA 1F2HA 1H38A 1SKUB 3HXMA 1VC0A 1NK7A 2F4VF 1FWLA 2OSRA 1HQEA 3CF5Q 4PG7A 1AUDA 1X31C 1K73T 2UXDJ 2PO4A 3O2IA 2EFOA 3PV8A 3EPGA 4LF6F 2QA1A 3CDAA 2YNGA 2ZOGA 3ICLA 3OTDA 4IYQA 4TNOA 5E3AA 1M1HA 1ZAXA 2AF6A 4DF8A 5KFZA 4R5PA 4I69A 2ZHBA 1FKAF 1U6BA 2FLOA 4CYUA 3TZWA 1KTQA 1OYDA 2QRRA 2ZJRQ 3SCLE 3OTCA 2WONA 1L5UA 4PZVA 5KFOA 4UTGA 1RHKB 4WJBA 1HHSA 4DWIA 1QVGR 4IQXA 1SKRA 4N7TA 2XY6A 3MR6A 4LFCF 2XO7A 3W65A 2W7PA 2AD9A 4G1PA 3CC4S 1QLNA 4JV5J 2ZE2B 5HVGA 1N0VC 1SC4B 4XDCA 3C14A 4IFYA 1WNEA 4NRTA 5I3QA 2HYIB 3A3OB 2CQ3A 3FFIB 2W9CA 4P7TA 4WU2A 5DM7Q 1VQOS 1HARA 3UDVA 4YS2A 2PD1A 2V9KA 3ITHA 4K4YA 4OZNA 4ZOSA 2O01C 2OI2A 5DLFA 1NK8A 1YJUA 2W1BA 4J9PA 3QZ8A 1VIOA 4IQMA 1TK0A 1S6PB 3Q89A 2MQQA 4QWAA 2KG0A 4OYXA 1FDDA 3HHLA 3TZYA 3Q23A 2B9EA 3V6DA 1S1XA 2ADBA 4Y2IA 4U8YA 5HJYA 1HHTP 3J7YI 4OJ3A 2KKHA 6FDRA 1M5KC 2HHSA 5AXLA 1RHRB 1LWFB 1UWBA 2GX8A 4B3SF 1SPBP 3V2UC 3US5A 4LMZA 2WK4A 1MROB 2VQFF 2BBEA 4J9UE 1HNVA 5A0YA 4CLKA 3V4MA 3EXYA 4TLRA 4QIEA 1K1QA 2N82B 3NGDA 4I7FA 3GJRB 1SUQB 2YQ3A 4FYWB 4HH0A 4PG6A 5RUBA 5F8HA 2R8HA 2BQ3A 1NXIA 4ZPDA 2RHQB 2BE9B 5IT9U 1HI0P 2DH9A 1CS4B 3B8HA 2XHWA 3SEOA 1XR6A 4JI2F 4B9UA 3LW5C 2LDYA 1UJ5A 4CO4A 4U95A 1RWVB 4X4OA 3V81A 1ITPA 4GKKF 1EHWA 3KLVA 4B08A 1S99A 4RW6A 1N32F 2DISA 2DITA 4IG3B 3QGHA 1IVZA 1JJ4A 1F5CA 4J5OA 2NXCA 3TVYA 2C2ZB 5DQIA 4QW9A 1SJFA 4ZN3A 5JVGQ 1SJRA 4LF6J 2R7TA 4WZQA 4M95A 1YZ6A 4E98A 2PSZA 5GAGU 1GFWB 5GAHI 5IV3A 3HMJG 2ZH4A 2DNQA 4PG5A 1UETA 2HGMA 1HWJA 2MGZA 3HFKA 3MEDB 1ACMB 3AH6A 3I4HX 3I4PA 1FJGJ 2KHDA 1HIYA 2R8IA 1K9MT 2YKNB 1S1WB 2WVFA 3WIUA 2DNZA 2J0QD 5D4PA 3BDPA 4K50A 1YJ9S 2E1CA 1NEEA 2OP5A 5JJBA 4X4QA 2RHSB 1IR0A 2E1PA 4LF4J 2VQFJ 2NPIA 1S1TA 5EX3A 2L9DA 1WC0A 4LVNP 5DDQC 1HNXF 2CJKA 2YXLA 2E9ZA 3E2EA 3NWGA 3BO4A 1LOUA 3AODA 1ULRA 1BD6A 1T95A 4GO7X 3CJKB 4OYIA 1XIQA 2A3JA 5B0DA 1IWGA 5HATA 3H5YA 1M0SA 4KHMA 3PW4A 3OSPA 1T3NA 2WOMA 1D9DA 4UUXA 5DDRC 1ZTTA 5J1EA 5JVHQ 4PQUB 1S6QA 4Y0FA 3CCSS 3CJQA 2HRUA 5G0RB 1S7IA 4ECZA 1P9QC 4BBYA 2NSBA 1A7GE 3O5TB 3SQGB 4DR5J 4ZHRA 1WC4A 5L8RC 3QIDA 2V2VA 1XNRF 4NI2B 2HIYA 4FYDA 4ECQA 1TVRB 3MCOA 5IFMA 2OIHA 1H2VZ 2VA2A 5EX0A 3W5ZA 4B9TA 2KZZA 2MXYA 1K8AT 3SCJE 3QZ7A 3OXGA 3HHDA 3AT1B 2AU0A 3TA1A 3QJJA 3TA0A 1FHTA 1RTJA 5LL6d 3DI6B 3RAQA 4UOCA 1PGZA 3KK1A 1NU4A 2DR6A 1R31A 2I1RA 2KYZA 4B02A 5I4MA 3L09A 4XIUA 3CD7A 1BXNA 2DTJA 3PR5B 1UA1A 1NDLA 4MK8A 1S0OA 1VQYA 4ES2A 2LQJA 5A0YB 2Y9HA 1RBLA 1RUSA 5K14A 4WF9Q 4LIRA 2COLA 5CYQB 2U2FA 2QT7A 3TJ8A 1I51B 1HFEL 2AZ1A 2VPZB 1Z2ZA 2VG6B 3AJDA 1N88A 1SCJB 2JVRA 2YKQA 3PRBA 3J7Z5 3DXSX 1KSPA 4Q2MA 3K89A 4ZVSB 4P52A 2P6TA 2D74B 1MLAA 3IS9A 2ILYA 4B9SA 1VBKA 3MR3A 4DUZF 5B0AA 2RUGA 2J0WA 3GV5B 4DR7J 2XCAA 1I1GA 5C25B 2CJAA 3DN9A 1YDLA
chains in the Genus database with same CATH topology
3JSRA 1IKXA 4F3MA 3PEHA 2OO4A 3DOKB 5T7LB 4O3OA 2V8VA 3BS9A 3GIMA 4NLSA 3CB4A 2ALZA 4YEAA 4X84A 5E3QA 2XMWA 2XY5A 3BSNA 2E5GA 3SXLA 5KFHA 5C42B 2AYGA 3KLHA 4DV2F 3UPFA 3IGVA 1PC4A 1O51A 3NBPA 4GKJF 5AXMA 1HW8A 3PX0A 1S0VA 4URQU 3JYTA 2LKZA 2P9EA 5D3GB 2ZZMA 3NAHA 1YI2S 2OPSB 4CT8A 2XMJA 2ZOMA 1OPZA 3DRPB 4OX7A 2KM8C 3HVWA 4MIBA 2HAIA 1YRTA 2CJBA 1JX4A 1KRPA 2RU9A 3GV8B 4WIIA 4GMKA 5HLFB 2F8MA 3HVTB 3THVA 2E5IA 2LU2A 3IC1A 1Y3JA 2B9YA 1HQEB 3UCZP 1QVFR 1OIAA 1UVKA 2C2EA 1RA6A 4MIWA 1YSJA 3TVKA 1N6QA 1T05A 3TAMA 2V4JB 2EBEA 2B5JA 2IC3A 4ECXA 2LXUA 1DFDA 2PMZD 2YH0A 3JTOA 3N5FA 2DIUA 5IS2A 3KK2A 2MQNA 1S48A 1KR4A 2CRLA 2XSJB 3JB9k 2UUAF 4JI3F 5B08A 2KYXA 4TY8B 3G9CA 3HHEA 2JOQA 4X62F 3CCTA 2IBKA 3QGIA 3J7A1 4O3PA 3KJVB 4C8LA 2BE2A 1JXLA 2EFNA 3R27A 4RNFA 3ZZ0A 2R7VA 2OAUA 2CQDA 1LWCA 1WWHA 2MYFA 2UUCF 3MMAB 1SIZA 5B0CA 3CUNA 4NLWA 2HHVA 4NLYA 3MAQA 1TK5A 2DNRA 4B9LA 2CJQA 3H2VE 4J9NA 3MEGB 2VPYB 7FD1A 4AQYF 2DD8S 5JXSA 4FXVA 1K0VA 2FHMA 2N3LA 3O1LA 4C7QA 1T03A 1NKBA 2PIIA 5LXRA 4CIOA 4IFVB 5KG2A 5A8KB 5BJRA 1DQAA 1S6QB 3DU5A 3TARA 3HLUA 4G1QA 4DR1F 3RB3A 2V2KA 5HN0A 2WOMB 4O0IA 4DS4A 2M8DB 2KT5A 5GAEU 4PRFA 2V8DA 4Y34A 3ULHA 1UJ4A 2OPQA 2RF2A 2IVYA 4DSLA 1HQUA 4PQAA 2GC8A 2GO9A 3OTOF 2FHJA 4EYHB 4MMOA 2MHNA 2QMWA 2VOOA 5D4OA 2CVIA 3DLJA 1DTTB 1OS5A 5KFXA 4J9SA 4JV2A 2N7CA 5SZTA 3JTPA 4DQQA 2R2RA 1RT5B 2MY7A 4O4RA 3JSBA 1NAQA 2F3JA 1S6OA 2CPJA 3DRSA 3L7OA 4WK1A 5GVQA 4ERDA 3I5CA 3CCLS 2KO1A 3G6VA 4LF7F 3VAGA 2L41A 3ENVA 2OTLS 3I55S 4O3SA 3VALA 4ZVHA 1G3OA 1KD1T 2J0SD 5KFYA 3M6VA 2HNZA 2VQEF 2O3DA 2HLTA 2ILZA 1R8CA 2FJEB 2EBGA 4K4VA 1N33F 3UD3P 3KLFA 4DMZA 2V8HA 2CPDA 1PSDA 4UY8T 2K2PA 3I0SA 4M1KA 5SUHA 5E0OA 1U48A 5EDWA 5EUHA 3VCDA 4NCGA 4K4TA 4OHXA 4IRKA 1JLQA 2LEAA 4WCEQ 4DQPA 4NXNF 1MROA 2A2DA 2MKKA 3SFGA 4RKUC 3OLAA 5E5NA 2P5VA 1LXNA 1TAQA 2HNZB 4C97A 5CA5A 2PA8D 2Q6CA 2R8KA 3RRGA 3NNAA 1V9OA 3P5TL 2IHR1 2IVMA 2J0XA 3D54A 3VAIA 2IFXA 4IUFA 1RDRA 4ED2A 4C11A 5KG7A 2JEJA 5IQQA 1GXUA 4PXEA 1K0TA 3TOQA 2IMWP 2N4DA 1HBMA 1GTHA 3T5KA 3FSIA 4KPYA 4OZJA 4BHQA 5CH7B 5KT6A 2JC1A 1F2GA 2LDIA 1R8AA 1Y4ZB 3T5JA 3HVAA 4NPOA 3RRKA 1L3VA 3DNCA 1N5VA 2KTQA 4CNZA 1RT2A 3Q8QB 3R5AA 3QPIA 1GAOA 3CTRA 3CIMA 4XPCA 3BN7A 1H6KX 1TKZA 2VUGA 2YX4A 4EZ9A 2XB2D 3KLEA 3J81Y 3LH2S 2KXFA 3TA2A 1NK5A 4ED5A 3ISZA 4QWBA 1MSWD 2OPQB 1HMVB 1WEZA 5CZXA 4J9MA 4NCBA 4X4UA 5F41A 2HS4A 4QBUA 5J2PA 2DO0A 2C3MA 2F1FA 1XWLA 4FP9A 2KFNA 3M2VA 2YNGB 2RT3A 4A8QA 4IOBA 5DLGA 4PKDB 4ED7A 4LSLB 2M7SA 2OPRA 4C0OC 5H9EJ 1UKUA 3B4DA 3U02A 2K8GA 1NJZA 3I5BA 4FXWA 3K7RA 1B7FA 4KT0C 4A8WA 1S97A 1JNRB 2K3IA 2ASYA 4HTJA 1JLBB 4OX9F 3Q2TC 3M32B 4FPRA 1LW2A 4CO1A 3DOMA 1CVJA 4DR7F 5KG3A 3V6KA 3PKYA 4OJHA 3CSKA 1X4FA 1Y5NB 2XS5A 3FGVA 3CMAS 5KFGA 4DLGA 2JEIA 3MDFA 4F50A 2DR7A 2BR0A 4HDHA 4ECYA 4DQRA 5KOXA 2LCWA 2E44A 4IOAQ 4H4KC 3CT9A 2G9OA 2ZH2A 1OQ3A 4IRDA 2C28A 2M52A 2A18A 1KNZA 4PG8A 1SQEA 3IO1A 2IJFA 2EG2A 3DRRA 1C1BA 2MZ1A 3SZ2A 3I5AA 2W24A 4KGMA 2MQPA 3G96A 1RKJA 2BVZA 2M88A 4I67A 4NLTA 1BY9A 2DGTA 2Z0GA 5F9NA 3M6WA 1Q81T 4KIAA 4ZA1A 1LK5A 3CDUA 1QE1B 1Y0HA 4QR0A 3H2UB 5DDOC 2UXBF 4O4GA 1ZYQA 5IM0B 3OUYB 1MU2A 4X2BA 2VB6A 4MKAA 2MKJA 2CQ0A 3CJ0A 2DPJA 4ZP6A 4RUAA 1RT6A 3CJKA 3H5UA 2DRBA 1B64A 3BN4A 3DRYA 1ZETA 3MD1A 2RF2B 4MTPA 1D8YA 3BQ1A 2CPFA 1J2VA 1R6YA 3TUJC 5EWGA 2UU9F 5LMNF 1NH8A 3M6XA 4UQGA 3OVSA 1R8BA 3SSQA 4ILLA 2DGWA 4IFVA 1FDBA 2P9GA 2RKIB 4ES3A 2IA6A 3MOJB 1WF2A 3NLCA 4RNOA 1QSSA 3QJLA 1T03B 1YQHA 2G13A 3CGIA 2MGZB 1W2IA 2DPIA 3IR7B 1KEKA 2MQOA 3KK3A 2DRAA 1OO0B 5DG9A 4J9QA 1VQ8S 4LQ3A 2QA4S 2Q3PA 2XMKA 2Z2MA 1CG2A 1TZ0A 4OHZA 3ZC4A 4RW9A 2KHCA 4CO5A 1SH2A 4QOTA 4FZVA 1HPZB 4M5DA 3W3SA 5CYQA 1S1VB 2F7VA 3C3LA 3RAMA 4FF4A 3CVKA 5IZHA 3MM8B 1Q8IA 3LAKA 2W9BA 2J9EA 4DG1A 1RT4B 2EKYA 3BJYA 2AQ4A 3K57A 1A6LA 2I5JB 4HL9A 5F8IA 3MEKA 3OL7A 3GILA 1U1QA 2CKWA 2B0GA 2BDPA 5I42B 3UI3A 1IQTA 1GTEA 2APOA 4DFPA 2HFNA 1T05B 5F3ZA 1FRHA 3FEXB 2J7UA 2W7AA 2I8EA 2XLJA 1NH7A 2OH2A 3TAQA 3POTB 1AROP 3B82A 3F56A 2JEFA 3TR5A 2N4CA 4FNIA 2KFZA 4H54A 1VS3A 2HQ3A 2YX1A 3FSYA 3CPWR 4EO6A 2A2CA 2WHOA 3DGPA 1RTIB 3NKYA 3RB6A 2ZNYA 3PACA 2B9XA 4RW8B 2OPSA 5DQHA 3BSOA 1WD6A 3V6JA 2J6SA 1AFIA 1T94A 2D3OR 2RRNA 1WF0A 2LXFA 2RDIA 3DMJB 3PNIA 2ROGA 3HZGA 2HMIB 3RTVA 5IM0A 4ZPVR 1QE1A 2UP1A 2MQLA 4OFZA 3EPIA 2D9OA 4JBCA 4ETZA 2GW8A 4BDPA 1NJYA 2DHXA 2JLFA 3GG1A 3M05A 5E3RA 2IBOA 2DGVA 1YGYA 2JH3A 3DOKA 3LWMA 1TQLA 2FC9A 2MJUA 3B4MA 5E41A 4J9OA 2NR0A 3ZZUA 3FRZA 3NP5A 3KKFA 4NLGA 1UEUA 3LANA 2CQCA 4Q43A 4DL0C 4J9RA 1FRLA 1TP7A 2YWGA 1LFWA 1X4BA 2V8GA 4NL5A 2KXNB 2Q6BA 2XULA 1U8SA 3VR1A 1HBNA 3CC7S 3OL9A 2Y0SD 3GMGA 1DJ0A