1U1QA

Crystal structure of up1 complexed with d(ttagggtta(di)gg); a human telomeric repeat containing inosine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
183
structure length
183
Chain Sequence
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*GP*GP*GP*TP*TP*AP*(OIP)*GP*G)-3'
publication title Human UP1 as a Model for Understanding Purine Recognition in the Family of Proteins Containing the RNA Recognition Motif (RRM).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/dna
total genus 50
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1qA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1qA02
1KD1T 2DNLA 3G4SS 2DIVA 4CIOA 2AD9A 2XS7A 2LXIA 5LJ5Y 2DNHA 2OSRA 3UD3P 1SJRA 1SJFA 1OPIA 3CXCR 5JVHQ 1YTYA 2KM8B 4WFAQ 1YITS 2K8GA 1X5SA 1A7GE 3HI9A 4F26A 3MUTP 1WELA 5LJ3Y 1FJEB 2CPZA 2BOPA 2CQDA 4M5DB 1SJQA 4FXVA 1M5OC 1VBYA 2DGWA 2E5IA 3CMES 4WF9Q 3MURP 1WTBA 1Q82T 2M70A 3UWTA 1U1NA 4WKRA 1VC0A 3VAMA 2KRBA 4LJMA 2CQIA 1OWXA 3CTRA 1U1OA 4QU7A 1P27B 1FO1A 3CC2S 2KYXA 2YKAA 3EGZA 3G8TA 2ZJPQ 1G2EA 4QPTA 3DXBA 4CQ1A 2DGUA 3DLLQ 2KXHA 4EGLA 1YWXA 2DK2A 2DO4A 5D77A 4TU8A 3CCQS 1Q7YT 2UP1A 3RW6A 4FXWA 2YH1A 1FJCA 2MSTA 1YI2S 5DDPC 4QU6A 4TLQA 5GADU 5CA5A 2X1BA 1NO8A 3MXHP 2MY7A 2CJKA 2VODA 3VAJA 2CQ1A 3H2VE 1VQOS 2AYEA 2J0SD 3I56S 4WIIA 3MD1A 2ZJRQ 1X4HA 2HGLA 4Y00A 4LMZA 1WG1A 2HGNA 3B4MA 3JB9k 2MZTA 2M8HA 4Z2XA 1SJ3P 1WWHA 3MUVP 5BJRA 2MKJA 2D3OR 3V4MA 2MKKA 2XNRA 2QA4S 5IQQA 1ZZNA 4F02A 1K73T 2MQMA 2D9OA 2DGTA 1JJHA 2B0GA 2MQQA 3VAFA 2RS2A 1WG5A 1HD1A 2CPJA 2MZSA 1KQSR 3S7RA 3UE2A 4F25A 5DM7Q 1WI6A 3N9UC 2MKSA 2N82B 5EN1A 1QM9A 1N88A 2CQPA 1VC5A 3SMZA 5CYJA 3UCGA 3Q2TC 3G8SA 5JVGQ 1X5TA 1UW4A 2KU7A 4WFNQ 2DGSA 3FEYB 1WHVA 3CF5Q 5HO4A 3BO2A 2DISA 2KT5A 1VC6A 3BO4A 1U6FA 3BS9A 2JX2A 3MDFA 2OTJS 3P6YC 1WEZA 1ZH5A 3UCUP 1VQ7S 5LXRA 2YWKA 3P49B 1HL6A 5DDOC 1HA1A 4UQTA 1WEXA 2CQHA 2O3DA 2DHAA 2M8DB 1CVJA 2DNMA 1SJ4P 2CPIA 2DNQA 5D78A 2HGMA 4YOEA 3UD4P 2VOPA 1X5OA 1FXLA 1K8AT 2MKCA 3CCVS 2DNRA 1U1QA 2JVOA 2A3JA 4J5OA 1R8PA 3U1LA 2RS8A 1FNXH 2VONA 2RU3A 1JMTA 1X4EA 2CPFA 1SXLA 2CPYA 2V94A 5CXTA 4C0OC 2RRAA 3S01A 1KOHA 2DGXA 2DB1A 2MXYA 2M9KA 2CQ3A 1YJNS 2LKZA 2I2YA 3S6EA 1AUDA 3U1MA 2DNYA 3CCES 1WHYA 1U1LA 2CPEA 1YIJS 2DH8A 2EK1A 1K9MT 2JVRA 2XS5A 2CQ0A 1QVFR 2CQCA 2RVJA 3B4DA 1QVGR 2QEXS 1M5VC 3MOJB 4WCEQ 1URNA 1VQKS 1D8ZA 1H2VZ 2EVZA 3MD3A 3G96A 3TO8A 5ITHA 1VBXA 1M5KC 3NNAA 2G0CA 1D9AA 2CPDA 3VALA 1OIAA 2F3JA 2KHCA 1NU4A 2KM8C 2N3LA 2MJUA 1M90T 2E44A 3SDEB 4W90B 1M5PC 3CCLS 3CC4S 1WHXA 1H6KX 2CQGA 2MQOA 2LEAA 3L3CA 3IRWP 1A9NB 1W2BR 2LXUA 1WG4A 1X4CA 3NS5A 2M52A 3CD6S 3Q2SC 3EX7B 1X4FA 3CCRS 2LA4A 2DGQA 2GO9A 2U1AA 2YTCA 2KN4A 1KC8T 3THPA 4WFBQ 5LXYA 2M7SA 2DGOA 1YJWS 2MGZA 2CQ2A 4Y0FA 4W92B 3BEGB 3FEXB 2LYVA 2U2FA 1KOOA 5DM6Q 1U1KA 2JWNA 2XB2D 2E5JA 4ZKAA 3ULHA 3P3DA 4P6QA 2MMYA 3IWNC 2MZ1A 2PE8A 2VOOA 1VQMS 5GAHU 2JRSA 2DNKA 2L9WA 2MPUA 3LPYA 2DNPA 2G4BA 3NNCA 3LQVA 2D9PA 1VQPS 2WBRA 2DNGA 3VAKA 3UCZP 3MI7X 1OO0B 2MY8A 2DHXA 1WF1A 1H2TZ 3HHNB 2OIHA 2DH7A 1N8RT 1VQ9S 2N3OA 1U2FA 1N52B 2QFJA 1U1RA 2FY1A 2EK6A 2LQ5A 3R1HA 1X5PA 3VF0B 2MGZB 1FHTA 3G6ES 4A8XA 1BY9A 3THTA 2X1FA 1S79A 2X1GA 2OJ3A 1S72S 2RQCA 4TU9A 4CH1A 3PIPQ 4IOAQ 2M88A 4U67Q 2ADCA 2KXFA 1UAWA 2G1DA 3CMAS 1WF0A 5DETA 2M2BA 2X1AA 1Q81T 4BS2A 3G9CA 2LA6A 1WI8A 2LEBA 2MB0B 4IUFA 3SDEA 3ZZZA 2J0QD 1M1KT 3NNHA 4V19X 4YB1P 2ERRA 2MKHA 3J7ZT 2M0GB 1VQ8S 1U1PA 3MUMP 1JJ2R 4RU2A 2LCWA 1X4GA 2MQNA 3R1LA 2PEHA 1WF2A 5FJ4A 1RK8A 3S8SA 3CCUS 2F9DA 3RW7A 5DDRC 2KG1A 1R8HA 2ADBA 2FC8A 3TYTA 5GAEU 2NLWA 3US5A 1DRZA 2DGVA 1U1MA 2LMIA 1HD0A 3CPWR 1ZZFA 2DIUA 2KH9A 1H2UX 5IM0B 1IQTA 1U6BA 1YHQS 4IOCQ 1X4DA 2SXLA 1PGZA 1VQNS 2FC9A 2HYIB 2J76E 2CPHA 3CUNA 1NJIT 1B7FA 2YH0A 2DNZA 2MYFA 2KVIA 3CC7S 4PR6A 1UP1A 3VAIA 2AYGA 2OTLS 3D2WA 2E5HA 5GMKa 1F9FA 1FT8A 4PKDB 2ZJQQ 3NMRA 4LIRA 1DBDA 2AYMA 2BZ2A 4CH0S 2MZQA 2GHPA 2KFYA 2HVZA 2N7CA 2NZ4A 2KRRA 1X4BA 2DHSA 2MSSA 2DNOA 3H2UB 1RKJA 1PO6A 1VQLS 2K3KA 2XSFA 3TP2A 2MQPA 2AYBA 2OSQA 1N54B 2HZCA 2KI2A 4TU7A 1DZ5A 4ED5A 3VAGA 4PRFA 4C7QA 2DNNA 2CQBA 3G71S 3VAHA 3SXLA 2KXNB 1L3KA 1DHMA 2MQLA 1FJ7A 3R27A 2DITA 2E5GA 1WHWA 3PIOQ 4IO9Q 1XN9A 1P1TA 2I38A 3CULA 2RT3A 2RUGA 3J7YU 2MZRA 2L41A 2LECA 4OZ0A 3CCJS 1Q86T 2DH9A 2CQ4A 5DDQC 2DO0A 2RRBA 3CCMS 2FPHX 3BO3A 2MZJA 5GVQA 2MKIA 2L08A 2MHNA 4OZ1A 1VQ5S 2Q79A 2J8AA 3EGNA 4C4WA 2KG0A 3NS6A 2XS2A 2RNEA 1O0PA 1X4AA 1UFWA 3P5TL 2CPXA 2XNQA 2M4MA 1VBZA 2FHOB 1YJ9S 5LSOA 3I55S 4YUDA 2DHGA 3CCSS 4QQBA 5MLCV 3OW2R 1X0FA 1JJ4A 2RQ4A 4ERDA 2MJNA 1WEYA 3ZZYA 2F9JA 5GAGU 5IFMA 5LSLA 4UY8T 3K0JA 1VQ4S 5IM0A 1VQ6S 5H1SV 5HL7Q
chains in the Genus database with same CATH superfamily
1NHVA 4DX5A 1KVKA 2Y0SD 5LJ5Y 2OPPB 1U0SA 2YWEA 2AJFE 2FJWA 2EI5A 2RKIA 2D41A 4OJGA 3SQGA 3LP0A 2EG2A 3ISZA 2V5HG 3IR6B 5KFEA 4LF2A 3OBIA 1ICEB 2KL8A 1SIWB 2A10A 3DGPA 4OX6A 3RBDA 2YKQA 2K7KA 1HQEA 4C98A 3CJ5A 1P27B 1FO1A 1HBMA 4URSA 2UVUA 3P5BP 2DO4A 2PC6A 1U2CA 2CFXA 3EZUA 4MKYA 3MR6A 2QMXA 1NKCA 4O3QA 1NO8A 2KJWA 1BUXA 3C8YA 3I56S 2P8IA 4HTIA 1N0VC 4WYLA 1C4AA 3JB9k 3MZIA 2FHMA 3GJTB 4P73A 1SJ3P 4KV8A 4BWMA 5J2PB 3AFGA 1BQMA 4EK2A 3NBPB 2Q1LA 4ANEA 1XWLA 1T05A 2XTJP 3ZTQA 2VFTA 2HWIA 5DM7Q 2G2OA 3N5FA 3GFHA 3D1OA 3UVJB 3FBFA 1G4CA 2WHOA 5LXRA 2LXFA 1S48A 5DDOC 1GNKA 3RAMA 2O3DA 4LF6F 3UD4P 3DLKB 2IJRA 1FXLA 5KFUA 4AXJA 4YB6A 4NRUA 3HMJG 1TUVA 2XMVA 1JMTA 1FDBA 3ZTRA 1S1UB 3MM7A 2GQQA 4X66F 1GMWD 4A4JA 5KFSA 3PW7A 1S9GB 3ZNUA 2VASA 1FVQA 2IRUA 4DQSA 2I2YA 3QFHA 3V2UC 4LSNB 2MEWA 1WC5A 2ZVIA 1QVFR 1WSVA 3IRXA 2HHHJ 5B0AA 2WVEA 4DR2J 4QW9A 4DQIA 3IXQA 3L4BC 1JWWA 3PKYA 3VALA 3A1YG 2Z2MA 5I4MA 1NPKA 2HEKA 2CYYA 2HSEB 4W90B 2B8PA 3QYYA 3R5AA 4XO0A 2XC9A 3TVKA 1RHQB 4FF1A 3MMAA 3SSQA 3T1HF 3GP9A 3DNCA 3EGVA 2RQKA 5LL6d 1J2VA 1PJ6A 3LO3A 3D5MA 3P3DA 4U7CA 2MZ1A 5KT4A 4MIWA 1RADB 2HQIA 3O1LA 2V2KA 1ZOTA 4CO1A 1SJ1A 1WF1A 2AJ1A 4ZDNA 2W7AA 4FYWB 3AOAA 1RQ0A 4EZ6A 2YQ0A 4TQSA 2FY8A 1BY9A 1J5OA 5EUHA 1FA0A 3FBCA 4U67Q 1CQMA 1FRJA 5L9NA 1LK7A 2AJ0A 3HT3A 3TANA 2CJQA 1QUVA 1Q81T 4O23A 2L9DA 1TU0B 2WAQD 3KLFB 4EWTA 4K50A 2MKHA 3TUJC 1B70B 2R2TA 1X4GA 2GO8A 2PEHA 4DL5A 1N34F 2F9DA 1MSWD 1T11A 2MQ8A 2FC8A 2W2MP 4RW9A 2UUAJ 4DJBA 3UR3C 1XK8A 2C2ZB 1FERA 1W25A 4QYZJ 5KOWA 2HYIB 1PAUB 2ZOFA 3RZAA 4WYWA 1UP1A 3BDPA 1JB0C 1TL1B 2YNGB 1F5CA 3V6DB 1S1VB 3MTKA 4DR7J 3MTJA 3WC2A 5E2QA 3KLEB 3MM8A 1FRMA 4P74A 3PEJA 2B9YA 2CVEA 3MMCA 1N54B 4U95A 2OI2A 4IG3B 5E33A 2F5GA 2V0NA 2F8MA 4LUBA 1P1TA 2CADA 1ZYQA 5D0GA 5KFLA 1RCXB 3H59A 2W4PA 1S1TA 2BE2B 1TUGB 1ULRA 4OZ1A 3LH2S 3FBBA 1YLXA 1UFWA 2K1RA 4YFUA 4RNOA 4KTQA 2GMHA 4GC6A 1UTAA 2UUTA 2JEGA 4NA3A 4DV1F 1N33F 2ZH1A 1KRPA 1VQ4S 3KG4A 1VYAA 2WVFA 1IQZA 3G4SS 4GO7X 1U45A 2QGFB 3OLBA 3K57A 1KVJA 4IG0B 5LT5A 3D68A 1FJEB 2UXDJ 5AJ3J 3DOKB 1Q82T 3L7PA 3J81U 3CJ0A 1HR0J 4JI4F 1GEHA 1OWXA 2EFQA 3CTRA 4QU7A 2IIHA 3EYZA 2GVDB 4PG4A 1U7LA 1SUQA 2B43A 2CIMA 4MH8A 4Z37A 4KC5A 2HFOA 2J9EA 2WW4A 1QUPA 2LQ8A 2H65B 4C8NA 1HI1A 4J9MA 1JNRB 1MMLA 4NLYA 4AQYF 3TVZA 4CO5A 4OI3A 3KLHB 3CJKB 3M2RA 3CNQP 2F63A 1RE1B 3CSKA 4EUVA 3T1YJ 1X7VA 1DQ9A 4YEAA 5HAOA 4QW8A 1WG5A 2DXDA 3PYFA 2D3O1 4LVOP 1WI6A 1UPPA 3DLEB 2ZWPA 5KG1A 3HX9A 1VOMA 2VG7B 5CYJA 3A12A 3UCGA 4RW8A 3G8SA 1T03A 2ZE2B 3M2UA 4FBTA 1ROFA 4JV5F 3OR1B 2J7UA 2YY3A 1WHVA 2N4CA 1X9SA 1VC6A 4OZ5A 4ZPDA 1IKYB 3W63A 2XCPA 1HBOA 1WEZA 3UCUP 1IBLF 4X4SA 4DSLA 3M8PA 3FC9A 3OTOJ 4NLXA 2XO7A 2R7OA 4D3GA 2AGPA 4R8UA 2DNRA 3SQOP 5RUBA 4DV2F 2QL5B 3WZ0A 3RB4A 2AJ4A 3T9ZA 1LW0A 1FK9B 1NKEA 1VFJA 3LP1B 1VHIA 1L3TA 1OSDA 3CVKA 1MN9A 2HZAA 2PA8D 1RT5B 4ITSA 4LSZB 3KXDA 3F44A 4RW4A 3KK1B 1LFPA 2DXEA 5CAAA 3OXGA 4ATNA 2N3LA 3HVTA 5EWEA 2VICA 1H6KX 5E41A 4EO6A 4HKQA 1BQNB 1NAQA 1F6TA 3NY0A 1XR6A 1GQEA 2KN4A 2XULA 1FRXA 3FDSA 4UTGA 3VCDA 2BBEA 2VHGA 5LXYA 5HVGA 1U25A 5DM6Q 2E29A 2FGCA 3DN9A 4JOUA 5IWAJ 2R8JA 1R0CB 1H72C 3IA0A 3IFEA 2RRNA 2J6SA 4OI4A 3NNCA 2AHOB 2AJ2A 1S10A 4NCBA 2W24A 3HCXA 2R7SA 4QOTA 4F3QA 4ECSA 1CJUB 2VG5A 4DZ6A 3IBFB 4CM2A 1SL2A 1XR7A 1NH7A 5BR8F 3R7SB 4K4WA 2V9WA 2QYGA 1EKSA 2HNZB 3DRSB 1VHFA 3BKFA 4XK8C 5L1KA 1KTQA 3M4XA 2QC3A 4MYTA 4KGZB 1WF0A 3CMAS 1NSKL 2LA6A 1WI8A 2MB0B 5CYQB 3PR4A 1S0MA 1B0VA 4FVCA 3RRHA 4GVBA 2ERRA 1LFWA 4PPDA 3H42A 1Y3KA 1IKWA 3PW2A 4YDDB 4O3RA 2ADBA 2BANB 3IP0A 2HHXA 4K0KF 3CIZA 2ZH4A 1HNZF 1VQNS 2V6AA 4ZLLA 2B3TB 2UXBF 4DN9A 3HFKA 1NJIT 2CWXA 3GILA 3T6BA 4TKTA 3ZXWA 3RB3A 4LIRA 2E7VA 1R6VA 3PYDA 4DDFA 1UZHA 7AT1B 3TZXA 4ZCMA 4E2FB 2NSCA 2V63A 3GYXB 4WU3A 5DQHA 3G71S 4XPCA 5C24B 1L3KA 2DITA 1Y5NB 1E6VA 4DR4F 1GMUA 2QMUB 3NOCA 1AA1B 4OI2A 3PRDA 4JI6J 3W2VA 1GTEA 3LAKA 1VLYA 3FFIB 4KBIA 3KLIA 2JOQA 3K0JA 4ZP7A 2HVDA 5IM0A 1PYOB 1OPZA 3PYGA 4HI1A 4ZLJA 3FRZA 2OSRA 4F0KA 4ANDA 5HMXA 2FJDB 4CYUA 2ALYB 4UY85 4LSLB 3OUYA 1RKIA 4O0IA 2FHJD 3DOLB 1OMSA 4WKRA 2QA2A 3W3SA 1I94F 3GFXA 4ILLA 4DFJA 3W8GA 1YWXA 4DPWA 4DPOA 2R4FA 1R8AA 1BXNA 1RXOB 1FJCA 1PAEX 4USMA 3MAAB 4JI8F 4MMOA 3OLAA 3MXHP 1S0OA 4WIIA 1NCLA 3IG1B 4AXIA 3V4IB 2Y1LB 4ZPTR 5BJRA 3MAQA 1FXDA 2KZZA 1RTJA 3T9NA 3KJVA 5J2MB 1T7PA 4OLOA 3ILOA 1N88A 1QSSA 1QSLA 2C2RA 2CWKA 4ID8A 2ZBRA 3J7YI 4PXCA 3U1NA 3M8QA 2Z2ZA 1QDUB 1Y5IB 4I7FA 5D8HB 4LF5J 4DPXA 2DTJA 2IM3A 2CA9A 2IYGA 2XZDB 4IYQA 2B4OA 2RD5C 3C15A 3VGUA 3BH6B 4WK3A 3W5XA 5HP1A 3CDEA 3HF5A 2W7OA 3CDAA 2XYHB 1W2IA 2A3JA 1QAJA 2RS8A 1YQHA 4DV6J 2AEFA 4X65J 2RIJA 2P2CB 2V94A 3W9IA 4HACA 2QE5A 1TVRB 2RQMA 1AUDA 3U1MA 5ETPA 4NLQA 4RL1A 1U47A 1U1LA 2W9AA 2CPEA 1YIJS 2CQ0A 3D67A 2RVJA 3UD5A 4DR5J 2DVIA 1HLWA 3HK2A 1XMOJ 1PYTA 2QZ8A 3QIPA 4NL5A 1S77D 4IOBA 2GMJA 3M32A 1FVSA 3D66A 2V4JA 4Q8FA 3BKUA 1WG4A 2B5JB 5D4OA 2EFOA 1X4FA 3HP6A 4ELTA 9ATCB 5A8KB 2LA4A 3IWLA 2E1PA 4KR0B 5T7LB 1U2RA 2IVMA 3THPA 4J9NA 2LP4A 4XIUA 3M6XA 4ZITA 2MGZA 2CJXB 2U2FA 2JWNA 5AE2A 4ZA1A 1J5EF 2I5JA 4WJBA 2XY6A 2PE8A 5GAHU 2FVCA 4DUTA 4Q7AA 3C2PA 3I32A 3PO4A 2MY8A 1FWKA 5CCLA 5JJBA 3W65A 2YX4A 1N8RT 1LWXA 1ZTTA 5I3PA 5JMNA 1U2FA 2FY1A 1NSAA 1TFWA 1HWIA 2QIFA 3GSIA 4WP8A 2X1FA 4NRTA 4RLEA 2WOMA 2R3VA 5KT7A 2NS1B 1CS4A 4F2RA 1JLBA 5KFAA 4ECZA 1TV6B 1IR1A 4FKXA 3PW0A 2M0GB 1Q0NA 1FTRA 3VVTA 2HAIA 3CCZA 4ZMMA 1E6YB 2KG1A 1DFDA 1TMJA 2DGVA 2EFVA 2JSXA 4JI1J 4ECXA 3K5NA 1RTDB 1X4DA 3UW1A 3POTA 1IWGA 3ZNJ1 3V81A 5H9EJ 2FC9A 4F04B 3R8YA 2IAJB 3RR8A 5T41A 5F9NA 3CC7S 4FYXB 1FE4A 2BQ3A 5DQGA 3I0RA 1WOSA 4EBDA 4NCAA 3I0SB 3FEZA 3BPDA 2JC0A 4PRFA 3KFWX 1EJ7L 4F4ZA 4IO9Q 1C4CA 2GIQA 4ECTA 2VB6A 2BRKA 4V19J 3NGTA 3BO3A 1T3OA 4JV1A 1RYSA 2J8AA 5B0FA 5C25B 1X4AA 3I55S 3L95X 1SCJB 2DHGA 2BJ3A 3DDIA 5F8HA 3SZ2A 3KHHA 4DV3J 4KHRA 1T3NA 2AU0A 3AA8A 3ONQA 3SCIE 5DZ6A 4DL0C 2ZD1B 3AB2B 1VR6A 2H4WB 1A6LA 1R0AB 5AE3A 2NXUA 1T02A 4EYIB 3WIUA 2CQDA 4HL9A 3M8SA 4C3LA 1ZPWX 4FYVB 3JSMB 4ZVQB 4CO4A 1K0VA 4R5PB 1V3SA 1S6QB 2RF2A 4ECWA 2Z30B 4QWCA 3HHLA 3N6LA 1PC5A 3OSNA 3RW6A 2MSTA 3DLBA 3EXYA 4H4OB 1NK6A 1Y4ZB 4QYRA 1XBWA 3BB5A 1SL0A 4NZ6A 2XY5A 2HGNA 4FYDA 2QA4G 2EXUA 2EBEA 3FCWA 2XNRA 1TK0A 1K73T 1FX4A 2G2YA 1FXRA 3KNAA 3UR0A 3G86A 3N9UC 4RUHA 1HBUB 1QM9A 2CQPA 2V67A 2J9DA 3M1VB 1RHKB 4RWXA 3N6NA 4ELUA 2YKMB 3BO2A 1CULB 3BO4A 4KKOA 4OZNA 1WSRA 5HK4A 1ZH5A 1VQ7S 2EC0A 5F9LA 1HNXF 1Q5YA 1HA1A 4UQTA 1WEXA 1BMQB 1SJ4P 2IHR1 1REVB 5DZ7A 2MKCA 2NQPA 3AOBA 2BEFA 1TMMA 3KLVA 2CPFA 3QRPA 3HJVA 4C0OC 4CT8A 4OI1A 4IFVA 2W7PA 1CPZA 1V6HA 2DCLA 2RU9A 3LTOA 1L3VA 1UEVA 3FZ2A 2CQ3A 3DRYA 3R5DA 1ACMB 3PX0A 1JNZB 3CJQA 3T5LA 1N36F 2JVRA 2YKOA 1HNIB 2ATLA 3H8YA 4ECUA 3BSNA 3FMBA 1TTHB 4WCEQ 5IXUA 3PM9A 1JLFB 1UVIA 2P6SA 5FDLB 4IRCA 5L1JA 4M94A 2MJUA 2LDIA 1QSYA 2XWXA 3L3CA 2LXUA 3NS5A 5CYMA 1L3UA 4FP9A 4ZVUB 2U1AA 2AX1A 5HLFA 2AIRB 1Q95G 3MM6B 3AXMA 2M7SA 2DGOA 3RTVA 5DO2A 3NAHA 1WACA 1KQGB 1PCAA 2G13A 4ZHRA 1SC4B 2XB2D 2E5JA 3W5YA 3W61A 4QWEA 2JRSA 4A8QA 2UUBJ 2H4YB 4XPEA 1IBKJ 1FJGF 1DURA 3N79A 2UUCF 3UCZP 1OO0B 1RTHB 2VKZG 3J80U 2KB2A 4ES2A 3FJ2A 4LT6A 2PFDA 2QFJA 4LR8A 4U96A 4A8XA 3AD8C 4ICLB 3A4TA 4WXWA 3OQ2A 3TZZA 3FBEA 1ZAWA 3BF4A 2G1DA 2QLJB 5DETA 2M2BA 1UJ5A 2NREA 8AT1B 4FF2A 1KSPA 4G3IA 1JJ2R 4TYBA 2E5LJ 2XEXA 2F7VA 4K4XA 5GAEU 2PT0A 2N7YA 4KGVB 3CPWR 2DIUA 4USWA 4HH1A 4JUZA 3FSXA 1AZSB 4CLWA 2YXLA 2VQEJ 3H5YA 3JSBA 2VV5A 3G82A 1NLKL 4Y2IA 4C0HA 4PUOA 1FFWB 2G0JA 2OPSB 4NA1A 5J1NA 5C42A 4WTYA 3BGLA 4X4QA 1Y5LB 1V3RA 1PIEA 1M5SA 3E01A 4ZPAA 3P4UB 4J9LA 1SQFA 2WONA 2HWTA 4ECYA 4Q5VA 3Q8PB 3NP5A 3F73A 1Q8LA 1RWPB 2RUGA 1S76D 3HZGA 1EETB 2RRBA 2MZJA 2A6OA 5T14A 1VQ5S 4RKUC 4C4WA 4RUAA 1OY9A 3P5TL 4KGXB 3RG6A 2RQ4A 2KT3A 1HHQA 1NDKA 2HVHA 3LAMA 4Y34A 5H1SV 5F8LA 3D7SB 4M5JA 1TK5A 2IMWP 5E3QA 4H4KA 3O8WA 4I2QB 1SJFA 2HVIA 2BW2A 4OHXA 1M5OC 3M8RA 3BJYA 1XMQF 1IKXB 1FEEA 4IDKB 7FDRA 2I6WA 4YP3A 1UA1A 2GJFA 4I64A 3NEKA 1HQ2A 3N28A 4WU2A 4QZVB 4CQ1A 3UPFA 1FRIA 2KXHA 1FRLA 4PQUA 4DUZF 2RKIB 3SQGB 4TU8A 3BKTA 4OMFG 3QJJA 1S1XB 3BSOA 5DG9A 3HVRA 2CJKA 2DY9A 3MD1A 4ALZA 4Q2MA 3OL8A 1H3DA 3UDLA 1UFKA 4DPYA 3GE9A 5FIIA 3MECA 4KPYA 2IY5B 2B4VA 2UVWA 1C1BB 1MMDA 2DGTA 4I2PA 2XZTB 3BYPA 3LGMA 2N82B 3W2WB 3BQ2A 4B9UA 5JVGQ 3O5TB 3AQPA 2OLWA 5L9XA 2NR0A 2DISA 1TL7B 3MDFA 3R97A 1NEEA 1LXNA 5LM7E 1EX8A 3P49B 2X7IA 2HVEA 2FB0A 2CQHA 4GKJF 5D78A 4YOEA 3KLGB 5J2QA 2VOPA 1X5OA 4LF6J 2WSEC 2UV8A 3GMGA 2M3DA 1WKKA 4E98A 5DGBA 4OHWA 2NXNA 1JLEB 2IFXA 4DXLA 1NPRA 3Q83A 4M5KA 2ZVSA 1YJNS 1FWLA 2AMCB 3ILLA 5ETVA 4X66J 1NJYA 2EKNA 2CZVC 1Q78A 2PI5A 2L9NA 4UF4A 4DZDA 3I4HX 3R5CA 1ZAXA 3B4DA 3OTEA 2QYCA 4WXOA 2D69A 2VG6B 4O4GA 1WTFA 5BXIA 1ZPVA 1S12A 3PO5A 3PNIA 3LOUA 2GIRA 5BYRA 1YBTA 3X3UA 2AZ3A 3SDEB 5ETQA 3MCNA 2CQGA 4EU0A 4B3SJ 4DG1B 2K06A 1I1GA 4Y2CA 1GX6A 2UU9F 3T1HJ 1NNDA 5A8RB 1RWNB 3U02A 3DU5A 4X4OA 1R8CA 2FJAB 3BQ0A 1HW8A 5KFWA 1O5JA 5BYQA 1YRXA 3DI6A 3BGOP 4K4TA 1Y7PA 4USVA 4K4YA 2LFVA 3HHNB 5HSPA 3T19A 4DUYF 2EG1A 4WWSA 4NLGA 1UWBA 1T95A 3QIDA 2X1GA 3E51A 4ENOA 2B6AB 2HRYA 4LVNP 3GIIA 1Y10A 1Q8IA 3JAMY 1JLCA 2BOAA 4Q2LA 1B0PA 2IM1A 4OI6A 3JXOA 2RDIA 5L39A 3JTOA 1CJTA 4URGA 1TL3A 2LCWA 3UN2A 1RK8A 1UW9A 2AJQA 1RT6B 4UUXA 4NE9C 2CG4A 5HROA 3DYAA 1DQAA 1N34J 3K58A 2DRAA 3ZC4A 1YHQS 4OJ3A 4DCJB 3EJMA 1BWVA 4UZCA 1SVDA 2MYFA 1YRTA 3EVMA 2FIUA 3VAIA 5KFKA 2F4VF 2XLJA 3ET6A 1WUUA 3K8WA 2V9KA 4F4KA 2KRRA 2B4UA 4RW9B 2DNOA 4ZVSB 5IT4A 1NRKA 1MROA 4MIBA 1SPBP 4DCOB 2KI2A 4ETZA 4ED5A 4B9SA 5IC6B 2NCKL 3R27A 4MK8A 1UVJA 3DM2B 2BE7D 3RBXA 3C6TB 1RBLA 2YNHA 4PPZA 1AB8A 4NYZA 4ZVTB 3IWXA 2KG0A 3CJ4A 1Q4RA 1IJEB 1C0TA 2JFDA 1YJ9S 4LRAA 2FZCB 2PA3A 5A2QY 2ZHAA 3QLHB 3LALA 1KLMA 1S9EB 4DV1J 1N33J 1X9WA 3EWGA 2DIVA 2AD9A 4LBIA 1VRQC 1KFSA 4DV6F 2J8SA 4LR9A 4UT4A 1GT8A 4KFBA 1IKVA 1LWCA 2DGWA 1S99A 3SEOA 4OJ1A 4CLYA 2ZHBA 3EPGA 3D6TB 2EFNA 2XQCA 2KRBA 1VGYA 2J6UA 2XBPA 3TA0A 2R7VA 2O5DA 4JI4J 2ZJPQ 4DU8A 4L75A 2DR9A 2R8KA 2IMOA 4EGLA 1RHRB 2DK2A 3QO9A 5D77A 2RUSA 5J2NA 4QWAA 4PG5A 4M5HA 3MCMA 4FS1A 3HDSA 4IFYA 2Z8QA 4AQYJ 3BSAA 1WG1A 3BM7A 2AW0A 2HFZA 3GV5B 3F0NA 1WWHA 3V4MA 3N5BA 1FKPB 2YNIB 1EP4B 2A6MA 2ZH9A 1HD1A 2KKHA 2JZ5A 2OPPA 3PTWA 4MYUA 4DFPA 3A8EA 3NXZA 3A3OB 1X5TA 2IJFA 4X4PA 4JV5J 2KT5A 5B08A 4L74A 3JYTA 4USJC 1R6YA 3MCSA 3P6YC 4AE5A 3J7A1 3MPVA 4EYHB 4ED0A 1WC6A 1NK0A 5GAGI 2YWFA 1T9VA 3M2VB 3J81Y 1IBLJ 1C0UA 3EUNA 5BYSA 3SV3A 2I1RA 1HBNA 4N77A 3M2UB 3QGGA 5DRKA 3ELHA 4UOHA 4DV2J 3OPKA 2XG8A 4PG7A 1SC6A 4RW6A 2LQ9A 3DU6A 4UUWA 4DOZA 3S6EA 2CVIA 1HMVB 5J2PA 2EBGA 3NBPA 2ASLA 4ZCIA 3I6PA 2QEXS 3HM9A 4JI1F 1RT3B 2CDQA 3M30B 5ETMA 1D8ZA 2JEIA 3MD3A 3G96A 3OXFA 1D9AA 1UFLA 1NU4A 3UVJA 4JI0F 1Z2ZA 1RWWB 1N48A 1W2BR 1X4CA 3HSZA 3BR9A 1V3ZA 4C0BA 1RACB 3IGVA 2VC0A 4LF4F 3NAIA 1KC8T 3G2XA 3AXKA 1YJWS 3DLKA 3GQCA 4GRSA 3MR5A 3QQCD 4W92B 3T5JA 2JJ4D 2E1MC 3M6WA 4EFAC 2Z56B 2ZFHA 4L3NA 4QCLA 5F8GA 1Y11A 1S1UA 2Q6BA 1GH8A 2G2ZA 1VQPS 3OV7A 3AD9C 2BW7A 2KT2A 1JLQB 1FEHA 1S9GA 4ZLPA 5J1EB 4WIQA 3OL9A 2YX1A 4XDCA 3KTQA 2ROPA 4LSNA 4RPFA 2ZM6J 1UA0A 2YBVA 2W2OP 4MTPA 4I67A 3H5SA 4DL2A 1S79A 2XI2A 3DGVA 4H54A 2DR7A 1NBEB 4AL6A 1CSJA 2P9GA 2XYGB 4BS2A 2B4PA 4LFCF 3OL6A 4HDGA 4YR3A 3ZTPA 3T3FA 1TKDA 3J7ZT 4NCGB 5K9FA 2GX8A 5FLXU 2OPQB 4J9PA 3S8SA 5KT5A 1D3WA 1UVNA 2IC3B 1R8HA 2XWYA 2VQFF 4P7TA 1SKWA 1U1MA 3GYNA 1ZZFA 1NJZA 2HS3A 3PDNA 1DJ0A 1Z1ZA 3DRPB 1T9WA 2EKYA 1QJHA 3GIJA 4K0KJ 3CO9A 1HNZJ 5E3CA 1D0EA 2UXBJ 4CLZA 3QWPA 5GMEA 2JLFA 4LRCA 1IKWB 4B3MF 2E66A 2A18A 1S7HA 1FT8A 5KTQA 4RUCA 2QLFB 3NGUA 2EWHA 4CLKA 1KR4A 1HKAA 4OJHA 2W9CB 1RAGB 1RSCA 4CLPA 2CQBA 4Y2MA 3VQTA 2IRXA 3PIOQ 1RB0A 1D1UA 3BN7A 5D3GB 4TNOA 1O8BA 2CNNB 2B7CB 2DH9A 3KLFA 3W5ZA 2WK4A 2MLYA 4DR4J 3ZZRA 2DXFA 2ZKUA 3GLJA 2C2MB 1DQ8A 2H54B 4P75A 3GR1A 1KD1T 4OIXA 4CLSA 3LWMA 2V8GA 2CRLA 3CXCR 5JVHQ 1TL1A 1WELA 2YNGA 4M5DB 3V6DA 1S1VA 2HLTA 1RA6A 2E5IA 4FF4A 3KLEA 2AV5A 3A8IA 4JI5J 4L6V3 2CQIA 5GMDA 4P52A 1UEKA 5THWA 2LLZA 4IG3A 3P45B 2YKNB 4PG6A 1I94J 4ZVHA 3GIKA 3CCQS 4OYBA 2UP1A 4TY9A 5CA5A 2RHQB 2H3EB 3CCTA 2BE2A 5F3ZA 1IN0A 4JI8J 5DG8A 3B4MA 2BKPA 1HYSB 2GJ2A 4Q0BB 1CC8A 1NM2A 4OZ3A 1YJUA 1IBMF 3SSRA 5KFZA 4K4UA 3R5JB 2ROEA 4QIFA 3PVXA 4IR1A 5IT0A 5EN1A 3SI8A 3ISND 1VC5A 2QV6A 3PKMA 2O01C 3N0VA 3CDWA 1HNVA 2UUBF 3MM5A 5EHHA 3LF0A 3CF5Q 1TZ0A 2KO1A 3BBCA 3DOKA 1R43A 1NDCA 2PEBA 4I0WA 3M9OB 4FN5A 3OFFA 3VGSA 1HWJA 2CPIA 3JSYA 2HHWA 1YK9A 4PWDB 4PWWA 3VZHA 2YPZA 4TVAB 1VRTB 4XDDA 3KLHA 3CJKA 2FQQB 3SBMA 4BC9A 2MXYA 2KJVA 2LKZA 5C2CA 4KPCA 2DR6A 5ETKA 1YJVA 1MG7A 4B9TA 2AX0A 1J27A 1M5VC 2W4DA 4QR1A 2R42A 2V34A 3DLEA 1VBXA 2DBBA 2VG7A 2VQEF 3TQ1A 3PW4A 4U7UK 1MMNA 4Y3CA 2KHCA 2ZE2A 4KY3A 5KFTA 4USTA 3OR1A 4A8OA 4X64F 4ZOSA 4P2XA 1YX2A 3Q2SC 2XLKA 4ZPWR 1N5VA 3C6UB 2GO9A 3RBEA 1DARA 3ZTSA 1T9TA 2CQ2A 3QGHA 3QIPB 3OR2A 3RR7A 1WNEA 4BLGA 4ID5B 1U1KA 4I4BA 4ZKAA 2C1EB 2E9ZA 1LWFA 1FK9A 4DL6A 3LP1A 1J5EJ 4J91A 1WJ9A 1F3VA 3TJ9A 3TJAA 1TKZB 4UQGA 2HBYB 4P9SA 4NXMJ 3NKYA 4RX6A 2BJEA 1N5YB 2EK6A 1M1GA 2MGZB 2G1HA 5KOXA 1IR2A 4RNHA 3THTA 4C8MA 3KUEA 3F56A 4I68A 3UN3A 1YVFA 3VHQA 1HI8A 5KFCA 1S6UA 5IQ6A 2C42A 2J0QD 1LK5A 4YB1P 5KG2A 2HG4A 4CM0A 3BGUA 1BQNA 1KQKA 2WVDA 4CLUA 5AXKA 2DY1A 5DDRC 4A48A 2Z58B 5L1IA 2QA1A 4ZPCA 3OVAA 1REGX 2HHUA 2FVSA 3H40A 2KFNA 2YWWA 1HWLA 4ZN1A 4B3RF 4PR6A 4QIGA 1T9XA 3D2WA 3UI3A 2BM1A 2E1RA 1LNQA 3I31A 1RAHB 1CJUA 2GHPA 2Q66A 3CD5A 4WE1B 1VDHA 2MSSA 1OQ6A 3SYZA 3I96A 2BV3A 2K3KA 1JJCB 1I3OB 3POTB 3UNGC 3CCWA 2GJIA 1TQLA 3AH6A 1FJ7A 4O3OA 2E5GA 1WHWA 3WDOA 3CULA 2VPZB 2GNKA 2I38A 2MLZA 5F8NA 4K4ZA 1UWAA 2FPHX 2MHNA 2HAFA 2BABA 3J7AN 3OFGA 2XNQA 1NDPA 2VUGA 4NLPA 5MLCV 1X0FA 2BANA 2DCUB 3BGFA 2F9JA 4DCPB 2OUGA 2JFKA 2L3MA 1HI0P 4YR2A 2P9CA 1NK9A 1MWQA 4JV0A 4RR5A 1YZ7A 3FUYA 2KM8B 1YITS 5HANA 5LJ3Y 4H4MB 1OSCA 4W4MA 3D1HA 4OYXA 2M70A 5HVHA 1JQGA 1VC0A 2CXEA 1RBOB 4C11B 5ETRA 4ZLNA 1RAFB 1FE0A 2HWHA 3BZQA 1AXQA 2A1BA 3NRBA 4JV2A 2W4CA 2OFGX 3NGRA 2OP5A 1SH2A 3L09A 5E3PA 3WX4A 1UCNA 5C24A 2MLXA 3DOMB 4G1IA 3RAXA 4PABA 1U48A 3KHGA 3OFEA 4NZ0A 1VQSA 5AE1A 4B3SF 3TW0A 2GAHC 2GGPB 2MZTA 4W98A 1VJWA 3C16B 3LWLA 2HS0A 2FVRA 2PDAA 3FFIA 1GK8A 2GC8A 2QA4S 5IQQA 3MPUB 4O0NA 2MQMA 4ZPBA 2XLIA 3HD1A 2B0GA 2HQCA 3EPIA 4O4RA 1JLAB 3IR7B 1S97A 3ITHA 2OELA 2JC1A 4TN2A 2HQDA 3G6YA 3FEYB 3SCKE 4DBQA 5ETSA 4RNMA 1PG5B 4LSLA 1QAIA 2EFGA 3HLUA 1KTVA 1C2PA 3DOLA 4PYDA 4ZVOB 3D6HB 4J9VA 2M8DB 3D3BJ 2DNQA 1HNXJ 5AXLA 2AQ4A 3FCVA 3JSRA 4TQRA 3IR5B 1X4EA 5D4PA 4C8ZA 1VK3A 4QBUA 1FF2A 1CJVB 1KOHA 4UOGA 4E0DA 2DB1A 2O66A 1B3TA 1LXJA 1TKXB 3IG1A 4EMDA 1RBAA 2K7JA 3V4IA 2J9CA 4M95A 1AW0A 2YNFB 4DX6A 4KYZA 5LMNF 2XS5A 1N36J 2QSFA 3ADAC 3QZ8A 5J2MA 4K8RA 3QRRA 2EVZA 4HHUA 3SIPB 1NJWA 2C2EA 3IAM9 1GMVA 4DN0A 2PSZA 1YGYA 1GMWA 1H7XA 4O3PA 4IFVB 2KM8C 5B09A 4CDIA 1M90T 2ASYA 1RYRA 3PJ9A 3RBZA 3IRWP 1HFEL 2C3OA 4RUBA 4HVZA 3EX7B 2ACYA 4X84A 1HNWF 3KJQB 2LDYA 2IYIA 2FDNA 1ZAVA 2D74B 2EEYA 3MF5A 4LF9F 2JLEA 4Y0FA 3BYRA 1KOOA 1KWMA 2P6TA 4GO5X 3LP2A 2C3YA 4A8SA 4OHZA 2C2DA 4EBEA 3IWNC 1URRA 1VQMS 2IVFB 5A6WA 4ETXA 4NLUA 5CYMB 1TVRA 3HT0A 2Y8WA 3MI7X 2DHXA 4HHHA 1FJGJ 5CCMA 2UUCJ 1OQ3A 2CDRB 5KFMA 2LQ5A 2HHPA 4FZVA 3T1AA 4NLSA 4NEZA 2Q3PA 1HPZB 5HI7A 3AHPA 3OHAA 4C48A 4QPXA 1S1WA 3HXMA 1GFWB 1YBAA 3ZTOA 4PG8A 3QFWA 3IS9B 4B9NA 4QIVA 1TAQA 4F67A 2ZDPA 2L48A 4O44A 4KGKA 1NDLA 2AZ1A 3QT5A 3ZZ0A 5A8KA 4ZP9A 3HPOA 3KUHA 5T7LA 4G65A 1YDLA 4OX7A 1CJKB 2FTRA 3G8QA 3D0GE 4OZJA 5DGAA 1VIOA 4IQMA 3UDCA 4JP8A 4OHVA 3PRBA 5AT1B 2AYGA 1LW2B 1RDRA 3CDBA 4CH0S 9RUBA 2YVSA 2KFYA 4CLTA 4G1QB 1X4BA 1FRKA 1OYDA 4UOCA 4YDXA 1RGVA 5A0YB 3L7OA 3GYGA 2J7KA 3QT6A 5D4LA 2J5AA 3C66A 3VAHA 3M9MB 4NLVA 4PUOB 2B9XA 3GPAA 2F1FA 4PEOA 2L41A 3M05A 1TV6A 3J81j 2KFZA 5C42B 3OJSA 1QTMA 2QSWA 2RNEA 2M4MA 2FHOB 5CHCB 1E6YA 1Z4UA 2OHDA 3AJ1A 3CJSA 4YUDA 4ERDA 4DMZA 2BA9A 5SZTA 2UV8G 1RTDA 4J9QA 4CIOA 2YPYA 4NI2A 2WCXA 4X2BA 3UN5A 1SJRA 2IAJA 1UETA 1R8BA 2XI3A 3H98A 3MR7A 4CTAB 2BOPA 4FXVA 2XZWA 4WF9Q 4NLWA 1WKLA 2NYIA 4Y2AA 2XMJA 4BCAA 1XMQJ 5E7OB 4LJMA 3I0SA 3NCQA 3K17A 1YSJA 5EWGA 3RUBL 3ETOA 2B8QA 3QWUA 1X8DA 2CNKB 3TAMA 1Y9OA 3ENAA 4K7QA 4G1PA 4CH7A 2C2NA 5DDPC 4DUZJ 1G6BA 2QO3A 4DL3A 3KK3B 2ZZMA 1VQOS 2ZC3A 4HYKA 3Q86A 2Z4PA 5C25A 4DWIA 4OYMA 2NZCA 3DRRB 4L73A 4YB5A 3D0IE 2RH3A 5M2RA 1VRUB 2HRTA 4DFKA 1HQUB 1RAIB 3H20A 3VAFA 4PQUB 3MMJA 4ED6A 2BJ8A 2ZD1A 2R8IA 4N76A 1Q8KA 3ZZPA 2KU7A 1G7CB 3VGTA 1RISA 2X3GA 5KFOA 3JSMA 4LF7F 1NK7A 5D0EA 4FF3A 4R5PA 3NGKA 3JQJA 1HARA 3CD0A 2ZM6F 3SCJE 2IVYA 4ELVA 3TX0A 1SQEA 4A8YA 4GKJJ 3Q22A 1JKHB 3QJPA 3EDQB 5LMUF 1H0HB 1K1SA 4HTJA 5CABA 2F8EX 2ZC4A 4OQJA 1MU2B 4PQAA 1YJRA 4A8WA 5EX3A 4MFBB 1QE1B 3MMBB 2FJXA 3HKZD 2OD6A 1FNOA 1OS5A 1N5SA 4U8YA 4ED1A 4B08A 2H51B 2JEJA 1ZS6A 1TUWA 2EK1A 3IM8A 4B9VA 5L1LA 1ZM9A 3DHXA 1JK9B 1ZETA 4KB7A 5KFJA 4GVLA 1SQGA 1X60A 3UQSA 1M5KC 2FD2A 4ES1A 3M1VA 1KKHA 1W26A 3CC4S 2QLWA 3D28A 2YKMA 4J9OA 2HKEA 2ZH7A 2BDPA 1H7WA 1H38A 2ZH5A 1R7IA 1SI9A 3ISNC 5M2UA 2BX6A 1REVA 4URQU 5CD4A 5KFVA 2UU9J 4DL7A 3K5MA 1KS2A 2MMYA 2B51A 1JXVA 2DNKA 2HFNA 3PRVA 1UJ6A 2DNPA 2D9PA 2VDIA 3KMQA 2WBRA 1KDNA 3QAUA 2QFIA 5KFYA 5ADZA 2OKQA 1N6QA 4ZCLA 3LGHA 1HNIA 3VF0B 4DUYJ 3TRGA 3MM9B 5A8WB 5KFBA 3NCPA 2VBZA 3CD7A 1JLFA 2ACMA 5FDLA 2HHSA 2CZ9A 3TAQA 3W8PA 3AD7C 3ILJA 4MKAA 4G6VB 5I42A 2Y0BB 4OFZA 3MUMP 3NOGA 4JI5F 1WF2A 3EMTA 2V4QA 4FNIA 2NLWA 3C14B 3Q23A 1H2UX 2GVZB 2XMMA 2RILA 2XY7A 4RO0A 2SXLA 2YWHA 4DFMA 2YQ3A 1P6TA 3Q89A 1IM4A 1JLCB 3TARA 5HQMA 2XM3A 3CUNA 2YH0A 3M6UA 1EHWA 2LU2A 1CJTB 5B0DA 1RTHA 1NJXA 1NPPA 3OFHA 1YRUA 3MPYA 3HHKA 2NZ4A 3DYAB 2X3DA 2F4VJ 3W66A 2GQ2A 2BJ9A 2VU5A 1VQLS 2V2VA 3K59A 4P7VA 2AYBA 4TYAA 2W2PP 3WBZA 3KHRA 3EDRB 2ZZTA 1S6PB 1U02A 4ICLA 3R3TA 2GS8A 1DZ5A 4WKYA 3CT9A 1FTCA 4ZCKA 1UPMB 3Q8UA 4U6PA 2XGQA 1NSQA 5DDQC 4ZP6A 2EFPA 2HBQB 3DRXA 4CP5A 3EGNA 4N41A 1FDDA 3PG9A 2HHQA 2E9TA 3CCSS 1RUSA 1IUJA 5KFIA 5HBMB 1S0VA 2B9WA 5C7PA 4XAKA 3BDEA 4KHMA 3R7BB 1U0HB 1AZSA 2C2OB 2XMWA 3KK2B 3X1LB 4LBHA 3HFZB 4WFAQ 3IC1A 3D4JA 3MEEB 3THVA 2ALZA 4U9RA 3MURP 1DTQB 5KG3A 2VDHA 3VVUA 5IT9U 3AA9A 3MOZA 4USKA 3F41A 2MHEA 5H9FK 4ZPVR 2HZVA 1G2EA 2GW8A 1N4LA 1PJ5A 3GCXP 1LKZA 1NZ8A 1RWXB 1IXKA 4FXWA 3BV8A 2YH1A 4TLQA 1RAJA 3Q24A 1EETA 2ZBCA 2MY7A 2J0SD 1BC6A 4LMZA 6FD1A 2W8KA 1RT1B 2NPFA 3HVAA 4DS4A 3TEHB 2MKKA 1WC4A 4HT5A 1ZZNA 3RGIA 2JH3A 5KFHA 4NXNF 3UE2A 1RHMB 2OPRB 5J2NB 2FJEB 1TKTA 3ENVA 2NXEA 1AUSL 4I2QA 4L76A 4IFYB 3FVYA 1CC7A 2DGSA 3IM9A 5HO4A 4ZVGA 5L8RC 1IKXA 2Z0GA 4NWBA 3CGIA 4IDKA 4DR1J 2DR5A 5G0RB 4NXMF 1HL6A 1YJTA 1CVJA 2WVCA 2VL1A 3IGNA 1WC1A 4DR3F 3TUPA 1DLOB 2CJBA 4J9SA 2QMWA 1S1XA 4LRFA 1BD6A 1FNXH 2ZH8A 1ZM2A 1KP6A 3UDEA 2OEKA 3D6FB 3JYTB 4DQQA 1HWUA 4AL5A 2DYAA 1RCOB 3I9ZA 3CCES 3D1QA 2FZKB 2VC1A 2V8PA 1NB7A 1C0UB 1C1BA 1QVGR 3A13A 3MOJB 1HBNB 5FD1A 1P8GA 3W2WA 4FS2A 5ITHA 4J90A 3NNAA 2XO6A 1UJ4A 4L72B 4RW6B 3I87A 1SL1A 4N47A 2BKOA 4JI0J 1TL7A 5AXNA 3DDKA 3N4WA 3CD6S 2YTCA 3NGSA 3MEGA 2VPXB 4LF4J 4PZVA 3KLGA 2VFUA 3DLGA 3FEXB 2LYVA 4K5RA 5F0UA 2V8VA 4AT1B 3FK4A 4RNFA 2R7TA 1JLEA 3SFUA 4Q43A 4EBCA 4WPAA 3Q0AA 3GFZA 4JI2J 3MR2A 2DJWA 2B56A 4Y65A 1EB0A 5EGYA 2RSQA 1FHTA 3MEDB 3NWGA 3TUIC 2RE1A 4QIEA 2VG6A 4F4WA 2GCFA 2OJ3A 1M0SA 4TU9A 3IAS9 2FLNA 4IOAQ 1S59A 1QY7A 2GV1A 4WFZA 2LEBA 4IUFA 3HSGA 3SDEA 1Q8BA 1SV5A 4IRKA 4LFCJ 2O1PA 3PZPA 4DG1A 3GU0A 1DTTB 4MKBA 3IMQJ 4P71A 3RW7A 4RBVA 3JAMU 3TYTA 3CIMA 3TQEA 4MK9A 2R2SA 1TELA 3CMQA 2BJDA 5A8RA 2VQFJ 2F8HA 3CJRA 5D15A 4DV0J 2HIQA 1B7FA 3MPDA 2KVIA 4BHQA 2XSJB 1LWEB 2NYHA 2E5HA 4J9UE 5GMKa 2DEJA 4NEYA 2AYMA 4B3MJ 1S0NA 5LSRA 4NLOA 3MFHA 1PO6A 2H5EA 3M8YA 2NSBA 3T41A 1V5IB 4F7VA 2WRMA 1C1CB 2VIHA 2PIIA 2B6AA 1XJWB 1DHMA 2JHEA 1UVMA 2RT3A 4FVMA 3J7YU 4YY3F 4K59A 3HVWA 3TZWA 5K14A 4TXSA 4M5NA 4PYAA 3GJSB 3I4PA 2V2QA 1NHUA 1S57A 4NMXA 1RT6A 2DRBA 8ATCB 3KOAA 1VQYA 2GAGC 4J9KA 5FLXY 1YKWA 3P96A 3ICLA 2XS7A 2LXIA 4B3OB 3PEHA 2JNJA 4CNYA 3H2LA 5A2QU 2HQFA 4GC7A 3R9LA 4TY8A 3MUTP 1PKUA 2CPZA 1F60B 2W9BA 3QBCA 4HDHA 2KVQE 3CDUA 4OI0A 3UWTA 2BM0A 4CO3A 5E5NA 4X4UA 4NLDA 2FLPA 2Y1JA 4RW7B 1W7WA 4ED4A 4QPTA 2DGUA 2R9LA 1Q7YT 1RT7A 5GADU 4YHHF 3DM2A 3C6TA 1WDTA 4KO0B 1JLGB 3VAJA 4MKVA 2ZJRQ 4CLLA 2ZEJA 2APOA 3GSDA 3TX8A 2M8HA 3QLHA 2V50A 1TL4A 1KHWA 1WC3A 2XMTA 2MQQA 3GV8B 1S9EA 1IBMJ 2HMIB 3QJLA 4NMLA 1VBKA 2D3ZA 5ETTA 3V6JA 3DXSX 1KNZA 3D6MB 4DLGA 1UW4A 2PFFB 3PJWA 2HHTA 4IH5A 2PMHA 1RAAB 3OD2A 3UO0A 3ZFVA 1NK5A 2HQ3A 4AL7A 2OTJS 1SBRA 4GKKJ 4P72A 3NGDA 3DMJB 4NOHA 1EARA 5F8JA 1YBUA 4C8YA 3MFIA 1RWOB 2R2RA 2XMAA 4EO8A 1U8SA 2ZKTA 3R6LB 4PXBA 1HNVB 3U1LA 2NPIA 3MM5B 4IKAA 2VONA 1PC4A 2RU3A 4C2MA 4PXEA 1RP5A 4YMEA 1U26A 3PV8A 2C3UA 4I56A 4KH0B 4DV4J 2CNOB 2PGCA 1FKPA 2WB1D 2YNIA 1EP4A 2XMKA 3TR5A 2KDOA 1AROP 2DPIA 3FGVA 2CZ4A 1KQFB 1NK8A 2AWZA 2FYXA 2AF6A 5DLFA 2OGUA 2ZH2A 5IZHA 3A3NB 1N32J 1M5HA 3QNWB 3FQLA 1G1XA 4FKYA 5K20B 4X64J 3CCRS 2DGQA 3EE3A 3AAWB 4OYWA 3JS9A 3ZZUA 2I8EA 3M2VA 4KE5A 1FKOB 2BYCA 1RT2B 3OJUA 3HJFA 1LQ9A 4LF8J 2VOOA 2COLA 3E3XA 4BWJA 4S0MA 2HURA 2BMBA 4F8RA 3VAKA 2N4DA 5D0RA 2OIHA 1R27B 4P10A 1HMVA 2ASJA 1JX4A 3ENQA 4DR6F 3DHWC 2HNYB 3OR2B 4MT1A 5F8MA 1N5QA 4KHPF 1RT3A 3M30A 1FDAA 5J1PA 1LWFB 2X1AA 2GA7A 3U27A 3KDOA 3KUGA 4LFAF 2MQNA 2CG8A 3K7RA 3KWMA 2BJ7A 4IR9A 5KG7A 3H7HB 1RT4B 4KJIA 1RJJA 3BGRB 1XEZA 1TR0A 3I5BA 3KYLA 2CPHA 4C9DA 2DNZA 3LP0B 1S5ZA 4OYZA 1JLQA 4B3RJ 1U24A 3EVWA 5J1EA 2LVWA 5DQIA 3BN4A 2R7RA 2UXCF 1QD1A 3DGPB 3H2UB 2Y9HA 3U7JA 1HQEB 2VD3A 3TP2A 5B0BA 1HBMB 1AFIA 4ZJOA 2DNNA 4B3TF 2HFVA 5DS7A 3BPSP 3A8JA 3K5LA 3PACA 3ZO7A 4WTOB 2FHKA 5GAHI 1OY8A 3H25A 3JQKA 3OVBA 2HNDA 4NCGA 2OPQA 1VBZA 2J9DE 4KV8B 2IC3A 3ILIA 1X9MA 1BQMB 3SV4A 3ZZYA 4YS2A 4UY8T 4RU9A 1YG0A 2VF3A 3DRPA 5MAOA 1VQ6S 3HHDA 2Y3YA 1T9YA 2KYZA 1T05B 3QSYB 3W9HA 5M2PA 1NXIA 4FXDA 2FLOA 3K2YA 2OD4A 1VIXA 2HBZB 2BUNA 1VBYA 3ZZOA 4ZK7M 3K5PA 4DSFA 3VAMA 2XMUA 3W9JA 4JBCA 2W9CA 3TA2A 2KYXA 1VS3A 2QT7A 2W8LA 2E7XA 1MLAA 4N8NA 1UMJA 5D3GA 2BXJA 4DLEA 2CQ1A 3MM7B 4PAAA 4KQZA 4Y00A 1RLCL 2YX7A 4Z2XA 2E7WA 1ELOA 2OO4A 2MKJA 2D3OR 2BJ1A 2R8HA 3I82A 5HN0A 3MAHA 1BLUA 1JJHA 3IRXB 1XNQF 1KQSR 2MKSA 4OLPA 1I6JA 3NLCA 1EZZB 2HFSA 3HSJA 4WP9A 3SMZA 4OX9F 3P8BB 3M9NB 1K1QA 3FRYA 4DHVA 3JTNA 4WFNQ 4M5DA 1U6FA 5K5MA 2EW9A 5I3UA 3MMAB 2PN6A 4DQRA 4LRDA 5DLGA 2BRLA 4K4VA 1NB2A 4CNZA 4EZ9A 1GX5A 1VCTA 1XNRF 2YKNA 4FYYB 1NMEB 2WSCC 4A8FA 2DKOB 2HPUA 3ITHB 3OTDA 2VZ9A 4DV5F 5CQGA 2RAQA 1O6XA 2WW8A 5CXTA 4KRWA 4C3MA 2FJVA 1F9HA 2M9KA 2R7XA 1HYSA 1I5OB 4Q0BA 3D54A 4USUA 1K0TA 5LMNJ 1J5OB 4ES3A 1T8EA 1KFDA 1RTIA 4QJVA 3Q8RB 3E8OA 1RWVB 5E3AA 1OIAA 5D6GA 2V8DA 2R2UA 2PD1A 3TNVA 5L38A 2RMLA 1KVIA 4B02A 3HULA 3EXCX 3NG8A 3CJTA 4JI7F 1PBAA 2QX0A 3GWCA 3VQSA 3LA0A 2OAUA 3AODA 4WFBQ 2GIFA 1SKSA 1EIYB 2K3IA 4CO2A 1HNWJ 4PWDA 1U6ZA 1ZM3A 2NXJA 1KN6A 4ZP8A 4LF9J 3ULHA 3AT1B 4OZ2A 1FKAF 2HBRB 3LANA 1X31C 3PHEA 1FRHA 1VRTA 1U09A 1A0OB 1HIYA 2DHHA 2BACA 5EX0A 2VBXA 5B0EA 4QWBA 2ZOMA 2DH7A 3WHIA 2WVBA 3MM8B 3OSPA 1N52B 3MMCB 1G3OA 2IBOA 5ETOA 1CLFA 3G6ES 4M5LA 1FFGB 3LP2B 3K5OA 4X4VA 4X4NA 4JI3F 1F3FA 1S1TB 1RA7A 3D0HE 3DKDA 1KHVA 5ETNA 3C6UA 2K1RB 1AYEA 2IA0A 2Q6CA 2LMIA 3RJMB 1KEKA 4M63A 1S1WB 1U6BA 4ID5A 4IH6A 2Y1IA 3D3CJ 5GADI 4O44B 1D09B 3KDNA 1SC1B 4LIWA 2V68A 2OTLS 1F0XA 1TFYA 1T0TV 3CW2C 1TKZA 5KFQA 3WQPA 2RJZA 2EC2A 5KT2A 3OHBA 3WIVA 1VI7A 3W1YC 4X62F 4DPUA 1N5YA 3H90A 3FZBA 2OSQA 3DCAA 3SSSA 3VAGA 1B0TA 1SUQB 3SXLA 2ZBPA 3B82A 2ZWOA 1Y00A 2ZUAA 3HHEA 2ILYA 2HQGA 2WSFC 3FCHA 1AFJA 5GVQA 2J0WA 2CJYB 3M2RB 5E3RA 5CH7B 2XS2A 3VGVA 4ILMA 4DR1F 1D8YA 1T9UA 2QN6B 5LSOA 4ZIWA 5CD4H 1RLDA 2MJNA 3R2CJ 3S1TA 4ILRA 3GG0A 1EKRA 4ZIVA 2Q43A 5HMZA 4UOFA 1VK8A 3CJ8A 4USHA 3HHLD 3UD3P 4FBUA 4RW8B 2E1AA 1T03B 1YTYA 2K8GA 1A7GE 3HI9A 1YJ7A 2I9SA 2B9EA 1H73A 3GV7B 4WE1A 5U47A 3GIRA 1HBOB 3WC0A 2IM0A 1PSDA 4RJVA 1UKUA 5GAEI 3M8PB 3G8TA 1NH8A 4NI2B 5K8PA 1WOOA 3DLLQ 3I5CA 4R8UB 1F5BA 4J7CA 4JB8B 4JYAJ 4QU6A 1LW0B 2ABYA 5JUMA 4HHJA 4F3MA 3M8ZA 1DY3A 1SIZA 4Q45A 4I6YA 3BSCA 4OX8A 2VFRA 5KG6A 1LOUA 2WZ1A 4X4RA 1XQIA 1Q5VA 4R0EA 1XR5A 2Z57B 3RAQA 4WK1A 4WFXA 4RW4B 3TAMB 4ED7A 2MZSA 2ZDOA 2J6TA 2GQCA 4ECRA 3EZOA 4C3KA 4F3OA 4Q8EA 2ZH3A 3HVTB 2VBYA 2A0FB 2V2ZA 4H4MA 3TAPA 5IC4B 4C8OA 1IM6A 4K5SA 3BS9A 2BVZA 2C22A 3C19A 3KNGA 4JI2F 4C11A 4LF7J 4YN3B 2VJVA 4ZVEA 3CE8A 2HGMA 1Y0HA 2ZBIA 3EICA 4DSIA 1K8AT 4ECVA 1GTHA 1U1QA 4QWDA 2JVOA 2ZNYA 1RABB 3DFEA 1OJ4A 3DOMA 5LMUJ 2E9RX 5K8OA 2AEMA 3GZ7A 4O3SA 4QR2A 3TUZC 5C5JA 1Z2LA 2GHVC 2GGPA 2YWGA 3KG0A 2ZHOA 2VG5B 3C16A 2DNYA 3GR0A 3O3LA 4LF1A 2HHHF 2CQCA 4I69A 4RWWA 4DR2F 4N7TA 3BBFA 2OMOA 3RYLA 1ZBTA 3FNNA 4P2FA 4AYBD 1ITPA 4XTTA 2Z2YB 1XMBA 3HO1A 3QSIA 4DV0F 1JLAA 2F3JA 2KZMA 2E44A 3AB4B 1APSA 3N01A 4GVBB 2FVPA 2H48B 2M52A 2C3MA 4CCHA 1RAOA 2FGOA 2XYPB 3GB0A 2BE9B 1FD8A 3M6VA 3VWSA 1MN7A 4P6QA 3DC2A 1WC0A 3OTCA 3NMAA 1CJVA 1TKXA 4B9MA 5CZXA 1ZTWA 4YR0A 2ZNZA 2YNFA 3R5GA 3RRGA 5KT6A 3I9V9 1X5PA 2VFVA 4QYZK 4F4XA 3UNYA 4CH1A 3PIPQ 3SFGA 2CUYA 1IWAA 2KXFA 2AT1B 5EDWA 4D3HA 5HQLA 3EM1A 4PXDA 3Q8VA 1E6VB 1EQMA 4MK7A 3NNHA 3QPIA 4J37A 3AOCA 1VQ8S 1F9EB 1RHUB 1N6QB 1FX2A 4NYOA 4RBUA 3W2VB 2UUAF 2YKPA 1RAEB 4M5GA 1FI4A 2WBMA 2BKNA 4RNNA 2ASDA 1DRZA 3KLIB 1PBUA 1VJQA 1GAOA 5IM0B 3GTYX 5HVFA 1PGZA 2HHVA 3J7Z5 5I42B 1NKBA 4DR7F 3PW5A 4CYUB 2ZJQQ 1F9FA 4PKDB 3NMRA 2BZ2A 1SKRA 3OUYB 4OV6A 2HVZA 3VR1A 4LBPA 1BWEA 4A47A 1HPZA 2HIYA 3HZEA 4OV1A 2MQLA 4ZS6A 1K44A 2DEIA 2RHSB 3IS9A 4L3KA 4NPOA 4DSKA 2MKIA 1EQ0A 4IG0A 2RB7A 3NS6A 4OYPA 1O0PA 4GKKF 1NHKL 2HK3A 3QT7A 4OL8A 2VA2A 1JJ4A 5KFNA 5GAGU 1CJKA 1WKJA 2P5VA 4LFBJ 1RTJB 3KJVB 2GVDA 2FUG9 3MCOA 2VPWB 2UXDF 4F26A 5AJ3F 1LW2A 4Z7CA 2D1CA 3M8QB 4DPTA 4I7FB 4DV7J 1HR0F 4G1QA 3RB6A 1U1NA 4DV4F 4TLRA 5A0YA 1VISA 3C15B 2XHWA 3CC2S 4LRBA 2W2NP 3OTBA 5HP1B 3CEDA 2D3UA 2BR0A 4ANCA 5B0GA 2GZOA 3AJDA 2BQUA 2QL9B 3ETMA 1N32F 3T5KA 1FNMA 2Y8YA 1NZAA 1X4HA 4HACB 2MTLA 3JQMA 1SH3A 1TL5A 3T1YF 4P2MA 4HH0A 2OEJA 1IKYA 5KFRA 3AJ2A 2DR8A 1RTZA 4K4SA 4CLFA 2CPJA 5H9FJ 3S7RA 4DL4A 5KAKA 3QATA 3BQ1A 1VMBA 5HJXA 4NXNJ 3Q2TC 4LF8F 3H4DA 3V5RA 5A76A 2H5IB 3ZZTA 4CTAA 2ATCB 3M32B 4F0MA 5KT3A 2V4JB 1AT1B 3A8KA 3PXGa 2YWKA 4ZVPB 3OTOF 1RT5A 1CG2A 4ZVRB 2DNMA 2C2KB 1V9OA 2IDLA 2QLBB 1TKTB 2P9EA 5IT9Y 3CCVS 3WX8A 4DF8A 5I3QA 4DR3J 2GFFA 4J5OA 3KK1A 2I5JB 3QGPA 1SXLA 2QRRA 3M7VA 3KK3A 4M8LA 2AGOA 3S01A 1S49A 2DGXA 3VTIA 3FSYA 1L5UA 3QZ7A 2YQ1A 4KT0C 3DRRA 4U8VA 1WHYA 3OT9A 1CEZA 1QLNA 4Y2KA 1K9MT 1VRUA 2E1CA 1HQUA 2AP6A 4AD6A 2NUUG 3EVOA 2WOMB 1RWKB 1URNA 4KSEB 3GG1A 4C8LA 4KH1B 5ETLA 4F4AA 1CS4B 1JLBB 1IBCB 1N56A 2W2QP 2MQOA 2LEAA 2QG9B 1R89A 4C6AA 1RU2A 4CWBA 5HMWA 1NSPA 5IWAF 1JKHA 1UVKA 2ROGA 2HNZA 3DRSA 3V81B 4F50A 1X0PA 2VFSA 2L9WA 2MPUA 3D9BA 3MGJA 1MU2A 5CYQA 2DNGA 4MFBA 1QE1A 3MMBA 3PR5B 3DLJA 1H2TZ 3I0RB 3G87A 2VBWA 2N3OA 3ENWA 2ZITA 3MEGB 1P9YA 5HJYA 2UVVA 1CQNA 3DLGB 4F0HA 2OH2A 4CZCA 1S72S 2RQCA 4I1TA 3JTPA 1V5VA 4NLTA 4PWUA 1RHJB 3G9CA 1S7IA 4DS5A 3ZZZA 4HEA9 5HQ8A 5IS2A 2KHDA 1S6OA 4R0JA 5KFGA 5KG5A 3QAEA 3R1LA 3CCUS 4WZMA 1FFSB 7FD1A 2V4RA 2R8GA 4V1Ak 1OYEA 3MWBA 4B17A 4EI2A 3R2DJ 5K8NA 3V6HA 4BDPA 4YQWA 1S4FA 2WTFA 4BC7A 1SV5B 3TA1A 4ED3A 1KBRA 3AQOA 2CNLB 3A3PB 1S4EA 3BR8A 1RKJA 4ZVFA 1BE4A 1B4SA 3MM9A 5A8WA 4DU7A 2RF2B 2HZCA 3FKBA 2HK2A 1UEUA 2POKA 3HHLB 2B7BB 4DQPA 5IOLA 1CBKA 4FPIA 1RI7A 2HS4A 5KFDA 2LECA 3CCJS 1Q86T 4JI6F 3CJ2A 2C28A 3CCMS 4Y6IA 4YY3J 1TK8A 2Q79A 2RDDA 4NASA 4RBTA 1QAXA 2AEJA 3OW2R 3K89A 3C14A 1WEYA 5LSLA 2GVZA 1MNEA 2H5JB 3KJFB 5C2GA 2DNLA 5EWFA 2IJNA 4K2JA 3OXLA 3IBWA 4O3NA 2DNHA 2ZOGA 2W01A 5K14B 1M1HA 3QRQA 1FESA 3SCLE 1X5SA 2V69A 1Q1KA 3Q8SB 3MAAA 2RDJA 1SJQA 2IPOB 1RWMB 4A8MP 3CMES 1L3SA 4BBYA 1WTBA 4KKOB 1Q7LB 2DD8S 2VJUA 1S6PA 2YKAA 3EGZA 2R7WA 4B9LA 1HHSA 3DXBA 3TVYA 3UDVA 5LOQA 3GCWP 2FVQA 1SH0A 1YI2S 3LW5C 4TY8B 2W9BB 4FDFA 2H1YA 3FQKA 3H2VE 4YHHJ 4Y28C 3LGNA 2HGLA 1WDDA 3CJ3A 1H98A 2XCAA 3MUVP 1XERA 1XTZA 5F8IA 4DSJA 5HBMA 2D9OA 1TAUA 3NWRA 2RS2A 1K47A 2W25A 4DI6A 1U0HA 4WBFA 1RT7B 3T6JA 1IJFB 3KK2A 3AY0A 3VZIA 3PYEA 4IO1A 6FDRA 2G9OA 1Q79A 3MEEA 2I0XA 4LF5F 2M5YA 1DTQA 2JX2A 4ED8A 4KGMA 1KLNA 3KKFA 1GXLA 3MHYA 4NYPA 5HLFB 2DHAA 3O44A 4NZ7A 3NS7B 4ZN3A 2A2CA 3HHLC 1RWUA 2FLLA 4ZHRB 2IBKA 1SKUB 4X65F 2VKRA 2JEFA 1PJ7A 3DDNA 4WZQA 3GONA 4CI0B 1IVZA 3H5XA 2H9ZA 1RT1A 2ZBQA 3NL0A 2B5JA 3TWZA 5F41A 3PY8A 4DR5F 1RU1A 2DH8A 3OL7A 1GXUA 4NLRA 5L46A 3O6QA 1XMOF 1OY6A 2OPRA 3H0PA 3K8VA 5SUHA 1H2VZ 3TI0A 4CRJA 3TO8A 3CWJA 2CPDA 1ZA2B 2ZH6A 2C3PA 3VV2B 2K2PA 2UVRA 1A9NB 1MWYA 2W1BA 1R0BG 1JIHA 5G0RA 2F4FA 5CZVA 1EAYC 4K2XA 3PCOB 1TP7A 4ED2A 1DLOA 3J80Y 3RB0A 2Z2LA 2Y1RI 2IM2A 3G82B 3G6VA 3LPYA 2R7QA 1LV5A 3BH7B 3LQVA 3PX6A 4CO0A 1WORA 1FCAA 1FDNA 4ZJQA 2HFUA 2JDJA 3B78A 3M8WA 1S9FA 4UW2A 3E01B 4KIAA 4DR6J 2XHCA 5H9EK 3R6GB 2WONB 2M88A 5DG7A 4KHPJ 1PILA 2HRUA 4J9RA 2G0IA 1Q53A 4LR7A 1VLOA 3MEKA 3MPWA 1HWKA 3FSIA 1M1KT 5F3TA 4V19X 4DF4A 1U1PA 4RZRA 6AT1B 4RU2A 3TZYA 3KG1A 4LFAJ 2QLXA 2ZUGA 3LPEA 1LEOA 1MW7A 4IH7A 4F36A 3I5AA 4KAIA 4JYAF 5F0WA 1XIQA 1PYSB 5D0HA 3PJXA 5IV4A 5DJBA 1FWPA 5A6PA 1U49A 4HI2A 2N7CA 4DX7A 2DHSA 2VA3A 3C46A 1Q16B 2UXCJ 2XSFA 2CJ9A 2MQPA 3MEDA 4ER8A 4TU7A 2KXNB 4LQ9A 3W62A 1XN9A 3HKWA 5KG4A 4HR2A 4B3TJ 4LREA 3OVSA 4OZ0A 5HATA 2CQ4A 4C8KA 1B99A 2DO0A 1R0AA 1RZMA 2L08A 1KONA 1UL3A 4Z7YA 1DTTA 4P2SA 3DLHA 2CPXA 1T94A 5G4DA 2A2DA 3MECB 1F5AA 4QQBA 1I51B 5BR8J 4DV3F 4I2PB 3UFCX 2HLUA 4R25A 1S6QA 4M5MA 2DRDA 4USIA 4F2SA 2R7UA 1OPIA 2OMLA 3B6BA 2XSJA 2HNDB 1LWEA 4H4OA 2BQRA 2OEMA 1N5TA 2FZGB 4DSEA 2IRYA 1F1BB 3IO1A 3V6KA 1U1OA 4N5SA 1FD2A 1C1CA 2QTWA 5J2QB 4GMKA 4MAKA 1QTNB 4DEZA 3TOQA 3FMWA 3RU0A 4QIWD 1HBUA 2X1BA 1MWZA 2VODA 5K8MA 2AYEA 2PO4A 3L9ZA 3O2IA 4QR0A 1NK4A 2KTQA 5B7WA 1CULA 3TJ8A 1HHTP 3QMQA 5JXSA 4F02A 4FNHA 1P1LA 3PFOA 3BBBA 3T5HA 2GHWA 4M1KA 4F25A 4UZBA 3Q8YA 4O4GB 2GMLA 1GXTA 1XNQJ 4B3OA 4H4KC 4OZLA 3GFYA 2NUHA 3L7UA 4OX9J 2IA6A 3C3LA 1BHNA 2VH7A 4YB7A 3KJNB 2JLGA 2MKYA 5E0OA 2ZZNA 4AUKA 1B64A 2AKWB 3TEGA 3GJRB 1SB6A 4RW7A 2MDAA 5D4NA 4E8UA 1B7YB 3KHLA 1XNRJ 3G6XA 3KMSA 1R8PA 4N8OA 2DT9A 2F65A 2CPYA 4KO0A 4OYOA 1JLGA 5KFXA 2RRAA 5AXMA 1IR0A 4DV5J 3QGIA 3DI6B 4A8KA 5I3UB 3QT8A 2J0XA 5IV3A 3IBCB 4AFFA 2LU1A 4DX8H 1DAXA 1YZ6A 1R31A 1UWBB 3MM6A 2HMIA 5KG0A 1VQKS 3GJQB 3EZ5A 3Q8QB 2G0CA 1XC9A 2PMWA 4M5IA 1M5PC 3HSDA 3CCLS 1WHXA 2LQBA 3PFEA 2EPIA 2LEPA 1HW9A 4IQXA 3CB4A 3HFVA 1TL3B 2DPJA 2CAJA 3DMJA 1O51A 4EEYA 5HROB 4F4YA 4JI7J 1RTIB 3H4BA 1F2HA 1ZA1B 3BEGB 2UZAA 3E2EA 3MR3A 5KFFA 3PX4A 4FPRA 5KFPA 1IBKF 1WOPA 4U7UD 2G4BA 2HW3A 3RRKA 1SC3B 2F40A 2IDEA 4WFYA 3ET6B 1VQ9S 5B0CA 4ZJLA 1U1RA 4HT7A 2J7WA 2CKWA 3R1HA 3W7BA 1MROB 4X4TA 4LFBF 2JL9A 2ADCA 4MIAA 1UAWA 2AGQA 3EGWB 1N0UA 2D7SA 2OFHX 4PCQA 4IRDA 2WB4A 2YNHB 4CT9A 4JI3J 2E5LF 2OPSA 4DV7F 2VPYB 5FJ4A 1D9FA 1C0TB 3R5BA 1H74A 3GIMA 1WD6A 1U4BA 4C97A 3US5A 2X51A 1HD0A 1KLMB 2FJBB 2KH9A 1IQTA 2QL7B 4IOCQ 1FKOA 1RT2A 4WP3A 2J76E 4I6WA 4N56A 2UUWA 2XGPA 3PHTA 4ECQA 4KFBB 1Y3JA 1IKVB 4OYAA 1BQXA 1DBDA 1LWCB 2FHJA 2MZQA 4I6AA 4HLBA 4LQ3A 2ILZA 3LUYA 2HNYA 8RUCA 3HD2A 2V8HA 4X62J 1D9DA 1ZM4A 2PI4A 3B54A 4Q44A 3R7NB 5HMYA 4A46A 4C7QA 3QO9B 1UZDA 4MJKA 2QJ3A 3CO0P 1JXEA 3N6MA 2MZRA 3NCRA 4NA2A 2LQJA 1U8WA 1P9QC 1JXLA 1R3NA 1BGXT 3BREA 3W64A 1UVLA 3IN5A 2PMZD 4NX9A 1F2GA 3H5UA 2NXCA 3B8HA 1NUEA 2CJAA 5IFMA 1RT4A 4OHYA 1QAYA 2O67A 3W60A 3BGRA 4OYIA 5HL7Q
chains in the Genus database with same CATH topology
1NHVA 1TK5A 1VK8A 4CIOA 2Y0SD 5LJ5Y 2OPPB 2WCXA 5E3QA 4H4KA 2IMWP 4X2BA 2YWEA 3O8WA 2AJFE 1SJRA 3HHLD 4USHA 2IAJA 3UD3P 2FJWA 1UETA 4FBUA 2EI5A 4I2QB 2RKIA 2D41A 4OJGA 2E1AA 3LP0A 4RW8B 3SQGA 1YTYA 1SJFA 1T03B 1R8BA 2EG2A 2K8GA 1A7GE 2XI3A 3ISZA 3HI9A 2HVIA 2BW2A 3H98A 2V5HG 2I9SA 4OHXA 3IR6B 4CTAB 2BOPA 5KFEA 4FXVA 1M5OC 2XZWA 3M8RA 3BJYA 3OBIA 1XMQF 4WF9Q 1IKXB 4NLWA 1FEEA 4IDKB 1SIWB 2A10A 2NYIA 4WE1A 4Y2AA 5U47A 7FDRA 3GV7B 4YP3A 1HBOB 2XMJA 3DGPA 4BCAA 4OX6A 1UA1A 3RBDA 2YKQA 2K7KA 3WC0A 5E7OB 1HQEA 4LJMA 4C98A 3I0SA 3NCQA 2IM0A 1PSDA 4I64A 3CJ5A 1P27B 1YSJA 1FO1A 5EWGA 1UKUA 3N28A 1HBMA 3M8PB 5GAEI 3G8TA 4WU2A 3ETOA 1NH8A 4URSA 4QZVB 2UVUA 3QWUA 5K8PA 4CQ1A 3DLLQ 3UPFA 1FRIA 1X8DA 1SKRA 2KXHA 1FRLA 4PQUA 3I5CA 4R8UB 3TAMA 1Y9OA 2DO4A 4DUZF 2RKIB 2PC6A 3SQGB 4TU8A 2CFXA 3EZUA 4G1PA 4MKYA 1F5BA 4CH7A 3MR6A 4OMFG 3QJJA 1S1XB 5DDPC 4QU6A 1LW0B 2QMXA 3BSOA 2ABYA 1NKCA 5JUMA 4O3QA 1G6BA 2QO3A 4HHJA 1NO8A 4F3MA 2KJWA 5DG9A 4DL3A 3KK3B 3HVRA 2CJKA 1SIZA 2ZZMA 3C8YA 1VQOS 2ZC3A 3I56S 4Q45A 3MD1A 4ALZA 4HYKA 4Q2MA 4I6YA 3OL8A 3BSCA 4HTIA 1N0VC 2Z4PA 4OX8A 2VFRA 4WYLA 5C25A 4DWIA 5KG6A 1C4AA 1H3DA 3JB9k 3MZIA 3UDLA 1LOUA 2FHMA 3GE9A 1SJ3P 5FIIA 4X4RA 3MECA 4KV8A 3DRRB 4BWMA 5J2PB 4KPYA 4R0EA 4YB5A 1XR5A 1BQMA 3D0IE 3NBPB 2Q1LA 2B4VA 2RH3A 5M2RA 1VRUB 4DFKA 2UVWA 3RAQA 1HQUB 1C1BB 1MMDA 2DGTA 4I2PA 4WFXA 4WK1A 3H20A 3VAFA 4PQUB 4RW4B 3MMJA 3TAMB 4ED7A 1XWLA 2MZSA 1T05A 4ED6A 2VFTA 2HWIA 5DM7Q 3LGMA 2ZDOA 2N82B 2J6TA 3W2WB 2GQCA 4ECRA 3BQ2A 2ZD1A 3WC2A 2R8IA 3N5FA 4N76A 4B9UA 3GFHA 4C3KA 3ZZPA 4F3OA 5JVGQ 3O5TB 3AQPA 4Q8EA 2ZH3A 3HVTB 3D1OA 2OLWA 2VBYA 2KU7A 5L9XA 4H4MA 1G7CB 1RISA 2NR0A 3TAPA 2X3GA 5KFOA 4C8OA 2DISA 4K5SA 3JSMA 4LF7F 3BS9A 2BVZA 3MDFA 1NK7A 2C22A 4FF3A 2WHOA 1NEEA 4R5PA 1LXNA 3KNGA 4JI2F 4C11A 5LXRA 2LXFA 3NGKA 1HARA 3CD0A 3P49B 1S48A 5DDOC 2ZM6F 1GNKA 4ZVEA 3CE8A 2FB0A 2CQHA 3SCJE 3RAMA 2O3DA 4GKJF 2IVYA 4ELVA 4LF6F 5D78A 1SQEA 2HGMA 4YOEA 3UD4P 1Y0HA 3DLKB 2ZBIA 3KLGB 4A8YA 5J2QA 3Q22A 2VOPA 1JKHB 1X5OA 5KFUA 1K8AT 4ECVA 2WSEC 2UV8A 4DSIA 1FXLA 1GTHA 3GMGA 3QJPA 4AXJA 4YB6A 2M3DA 4NRUA 1U1QA 4QWDA 5LMUF 1H0HB 2JVOA 4E98A 2ZNYA 1K1SA 3HMJG 5DGBA 3DFEA 1TUVA 4HTJA 3DOMA 2XMVA 4OHWA 1JMTA 1FDBA 5K8OA 2E9RX 1JLEB 2IFXA 2F8EX 2ZC4A 4OQJA 1S1UB 3MM7A 3GZ7A 4O3SA 1MU2B 2GQQA 4PQAA 4X66F 4QR2A 1YJRA 3TUZC 4A8WA 5C5JA 2ZVSA 4A4JA 1Z2LA 5EX3A 2GHVC 4MFBB 1S9GB 5KFSA 1QE1B 3MMBB 3PW7A 2GGPA 2VASA 1YJNS 2FJXA 1FVQA 2YWGA 3KG0A 2IRUA 2ZHOA 1NJYA 3HKZD 4DQSA 2OD6A 2I2YA 1FNOA 1OS5A 1N5SA 2CZVC 1Q78A 2VG5B 4ED1A 4B08A 2PI5A 2L9NA 2DNYA 3GR0A 3O3LA 2JEJA 3I4HX 3V2UC 4LSNB 3R5CA 2EK1A 1ZAXA 4B9VA 1QVFR 2HHHF 5L1LA 1ZM9A 2CQCA 4I69A 4RWWA 3DHXA 1JK9B 3B4DA 4DR2F 1ZETA 3OTEA 2QYCA 4WXOA 4KB7A 2OMOA 3RYLA 1ZBTA 3IRXA 5KFJA 3FNNA 2VG6B 4AYBD 5B0AA 4O4GA 1WTFA 1XMBA 3HO1A 1ZPVA 4QW9A 3UQSA 4DV0F 1M5KC 3PO5A 3IXQA 4DQIA 1JWWA 1JLAA 3PKYA 3VALA 3PNIA 3A1YG 2Z2MA 2GIRA 3LOUA 2FD2A 5I4MA 2F3JA 5BYRA 4ES1A 2KZMA 3X3UA 3M1VA 2CYYA 2E44A 3SDEB 4W90B 3AB4B 3CC4S 2CQGA 4EU0A 1APSA 3N01A 2QLWA 3D28A 2YKMA 4DG1B 3QYYA 2FVPA 4J9OA 3R5AA 2M52A 4XO0A 2XC9A 3TVKA 4FF1A 3MMAA 2C3MA 2ZH7A 2BDPA 1H7WA 3SSQA 4CCHA 3T1HF 1I1GA 3DNCA 4Y2CA 1GX6A 1H38A 2ZH5A 2UU9F 1R7IA 1SI9A 3ISNC 2FGOA 1NNDA 5M2UA 2RQKA 5LL6d 5A8RB 1REVA 3GB0A 4URQU 1FD8A 5KFVA 3U02A 3DU5A 1J2VA 4DL7A 3M6VA 4X4OA 1R8CA 3LO3A 3D5MA 3VWSA 3K5MA 1KS2A 3P3DA 4P6QA 2MMYA 3DC2A 2FJAB 2B51A 4U7CA 2MZ1A 5KT4A 3BQ0A 1HW8A 3OTCA 4MIWA 5KFWA 1O5JA 2HQIA 2DNKA 5BYQA 1YRXA 2HFNA 3O1LA 1UJ6A 2DNPA 2D9PA 3NMAA 3DI6A 2V2KA 3KMQA 1ZOTA 2WBRA 1TKXA 4K4TA 4CO1A 4B9MA 3QAUA 1Y7PA 1SJ1A 1WF1A 2AJ1A 4ZDNA 5CZXA 5KFYA 5ADZA 4K4YA 4YR0A 2OKQA 1ZTWA 3HHNB 2W7AA 3T19A 2ZNZA 1N6QA 4ZCLA 2YNFA 4DUYF 2EG1A 3RRGA 4EZ6A 1RQ0A 5KT6A 3I9V9 1HNIA 1X5PA 3VF0B 4NLGA 3TRGA 3MM9B 4TQSA 1UWBA 2VFVA 5A8WB 1BY9A 1T95A 3QIDA 1J5OA 5KFBA 4F4XA 3NCPA 2X1GA 5EUHA 3E51A 2B6AB 1FA0A 2VBZA 2HRYA 4CH1A 3CD7A 4LVNP 3SFGA 3PIPQ 1JLFA 4U67Q 3GIIA 1Q8IA 2KXFA 1CQMA 1FRJA 5FDLA 5L9NA 5EDWA 1LK7A 2AJ0A 4D3HA 3HT3A 3TANA 2CJQA 2HHSA 1QUVA 4PXDA 1Q81T 3JAMY 3TAQA 1JLCA 4O23A 4Q2LA 1E6VB 4MKAA 1B0PA 2L9DA 4G6VB 2IM1A 4OI6A 5I42A 2RDIA 4MK7A 3NNHA 2WAQD 3KLFB 4EWTA 5L39A 4K50A 2MKHA 3QPIA 4J37A 4OFZA 3JTOA 3TUJC 3MUMP 1N6QB 1VQ8S 4URGA 2R2TA 2OH2A 1TL3A 2LCWA 1X4GA 2GO8A 2PEHA 4NYOA 4JI5F 1WF2A 4DL5A 4RBUA 1RK8A 2AJQA 1N34F 1RT6B 2F9DA 3W2VB 2YKPA 2UUAF 4UUXA 2V4QA 4FNIA 1MSWD 2CG4A 2FC8A 5HROA 3DYAA 1DQAA 2NLWA 4RW9A 3K58A 2WBMA 3Q23A 4RNNA 2ASDA 1DRZA 2DRAA 3KLIB 4DJBA 3ZC4A 3UR3C 1H2UX 1GAOA 1XK8A 1FERA 2XMMA 5IM0B 1W25A 1YHQS 2RILA 4OJ3A 2XY7A 2SXLA 1PGZA 2YWHA