1U1QA

Crystal structure of up1 complexed with d(ttagggtta(di)gg); a human telomeric repeat containing inosine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
183
structure length
183
Chain Sequence
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*GP*GP*GP*TP*TP*AP*(OIP)*GP*G)-3'
publication title Human UP1 as a Model for Understanding Purine Recognition in the Family of Proteins Containing the RNA Recognition Motif (RRM).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/dna
total genus 50
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1qA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1qA02
1VQ8S 4CH1A 1M1KT 2O3DA 4WFNQ 3US5A 2RQ4A 3IRWP 1G2EA 4ED5A 1SJ4P 3Q2TC 2AYBA 2KI2A 2XSFA 2DHSA 5DM6Q 2QFJA 2KRRA 3THTA 1M5KC 2V94A 1VQNS 2OIHA 2K3KA 1NO8A 2M88A 2MKIA 3CCJS 1U1OA 4QU7A 2DO0A 3UCUP 2N3LA 1YWXA 2KG0A 5DDRC 2G4BA 2M4MA 2MHNA 2LQ5A 2G1DA 5DDQC 5MLCV 3P5TL 1U1MA 2F3JA 3CPWR 2CQBA 2E5GA 2VODA 1U1PA 1WF2A 2RS8A 4M5DB 1OPIA 2ZJQQ 1OWXA 1U6FA 2DNGA 2KH9A 2DGUA 2CQHA 2E5IA 3ZZYA 2JX2A 1VQ5S 3ZZZA 3K0JA 1U1QA 2VOPA 3MUVP 3G8TA 5DM7Q 4U67Q 2MZTA 2MY8A 1UFWA 3R1LA 2EK1A 1VC6A 3VAMA 1M90T 1UP1A 1H6KX 3BS9A 2KT5A 2LKZA 3EX7B 1U1LA 2KRBA 2L9WA 3SDEA 3I56S 1DZ5A 2RRAA 2PE8A 1VC0A 3LPYA 2J0SD 1WG1A 3RW7A 2MQOA 2L41A 4WFAQ 1JJ2R 3VAHA 3OW2R 1Q82T 1VQ9S 1U1NA 3G71S 3NNCA 4CQ1A 1M5OC 3VAKA 3V4MA 2RS2A 1FJCA 2DHAA 2DIUA 3LQVA 2YTCA 2D9OA 3MD1A 2FPHX 4QU6A 1H2TZ 1X4DA 2DNRA 2YH1A 1K8AT 1W2BR 1WHVA 2MMYA 2SXLA 5LXRA 2RRBA 2RVJA 4YUDA 1R8HA 3CXCR 4LIRA 2RNEA 2KG1A 2MZRA 3VAGA 2FY1A 2F9DA 1F9FA 2QEXS 5HO4A 1KQSR 2D9PA 4IOCQ 1YJWS 2ZJPQ 1X4AA 5IM0B 3UCGA 1OIAA 5JVHQ 2MZSA 1JJ4A 1X4FA 5IQQA 2X1GA 1KC8T 2DNKA 2MQNA 3THPA 2N7CA 3MXHP 2RU3A 1L3KA 2DNQA 2CPJA 1SJQA 2BZ2A 1M5VC 2F9JA 1SJ3P 2CPEA 2HZCA 3H2VE 2X1AA 2CQIA 4UQTA 3CD6S 4PKDB 5LSLA 3BO2A 2LA6A 2U2FA 1VBYA 1DHMA 3CCSS 2DISA 2XS2A 2CQDA 2DGWA 2CPYA 3SMZA 1X4CA 4IO9Q 2XS5A 2DGOA 3G6ES 2ZJRQ 1HL6A 2KXHA 5LSOA 3CCMS 5HL7Q 5DDOC 2MSTA 3CCVS 2HYIB 2DGTA 5BJRA 1M5PC 1ZZFA 5GADU 1PO6A 4Y0FA 2A3JA 3CULA 2OJ3A 4IOAQ 4LMZA 2J8AA 2CJKA 1NJIT 1NU4A 4V19X 1HD0A 2DHGA 5LJ5Y 2HVZA 1K9MT 3J7YU 3CMAS 1VQ7S 1VQMS 2MQPA 1X4GA 2KFYA 2KU7A 3MI7X 2LYVA 1S79A 4W92B 3I55S 2M7SA 4TU8A 1Q7YT 2NLWA 4OZ1A 2DGQA 3CF5Q 5GVQA 2WBRA 5IM0A 2JRSA 2MQMA 1X0FA 3P49B 3DXBA 3CUNA 2E5HA 2X1BA 2DK2A 5GAHU 3N9UC 2DGVA 2JVOA 2YKAA 2DITA 1D9AA 4C0OC 3UD4P 4LJMA 1X4EA 5LJ3Y 2ERRA 2YWKA 4QPTA 4TLQA 1N52B 3G96A 2QA4S 2N3OA 2MZ1A 1WHWA 2MXYA 2CPXA 2DNYA 1X4BA 2MSSA 2KXNB 3G9CA 3PIPQ 2RQCA 2AYGA 2I2YA 3FEXB 5CA5A 2ADBA 1UAWA 4FXWA 2CQCA 2KN4A 3IWNC 4ZKAA 3D2WA 3TP2A 2DO4A 2ADCA 1JMTA 2MKCA 5H1SV 2CPFA 2CQPA 1HD1A 1RKJA 3CCQS 1WTBA 1FT8A 3EGNA 4UY8T 2D3OR 1X5PA 3JB9k 2HGLA 1O0PA 4F25A 4IUFA 2PEHA 1H2VZ 2J0QD 2KXFA 1FJEB 2KM8B 4WFBQ 2MPUA 2HGMA 1WF0A 2DH8A 1VBZA 2LECA 3Q2SC 4YOEA 2EK6A 1N54B 5GAEU 4J5OA 1QVGR 5DETA 1H2UX 2GHPA 4CIOA 3CC2S 2XS7A 4WF9Q 1VQPS 1WG5A 2XNQA 1X4HA 2Q79A 1S72S 3U1MA 3VAIA 3PIOQ 2XB2D 1K73T 1YIJS 4WCEQ 1WEXA 3SDEB 3MUMP 1N88A 3B4DA 1U1KA 1VQLS 2VONA 2LCWA 1FHTA 2G0CA 2J76E 4WIIA 5JVGQ 3VF0B 2CPIA 4TU7A 3G4SS 3S6EA 2FC8A 4OZ0A 4C7QA 3L3CA 3S7RA 3NNHA 1KOHA 1KOOA 2RUGA 1VQOS 2LMIA 3HHNB 1WI6A 2DGXA 1CVJA 1WWHA 5GMKa 2XNRA 2MZQA 3NMRA 1Q86T 1ZZNA 3CCLS 3S01A 2U1AA 3UCZP 2CPDA 2M2BA 3VAJA 2YH0A 1RK8A 2MQQA 2CQ0A 1FNXH 2GO9A 2OTLS 2DGSA 2DNPA 1R8PA 2KVIA 4P6QA 1AUDA 2DH9A 2DIVA 3CTRA 2MGZB 5D77A 3P3DA 1KD1T 2AYMA 2MYFA 4CH0S 3CMES 3RW6A 1X5SA 3NS6A 4A8XA 4EGLA 3CCES 3NS5A 2KHCA 4BS2A 3UD3P 3FEYB 4RU2A 3CCUS 3MURP 1WHYA 3G8SA 2OSQA 3S8SA 1URNA 3EGZA 2CQ1A 5IFMA 2DNOA 4FXVA 1B7FA 2E44A 3MDFA 4Z2XA 4F02A 2DB1A 3H2UB 2DNZA 2JVRA 4PR6A 2M70A 1WELA 1BY9A 2M0GB 2E5JA 2CQ3A 2UP1A 1A9NB 3TO8A 2MZJA 1YITS 1N8RT 1OO0B 5GAGU 3TYTA 1QVFR 2M9KA 1YJNS 4W90B 2FC9A 3MOJB 1ZH5A 1WEYA 3MUTP 1SJFA 2HGNA 2MB0B 2M8HA 2I38A 5D78A 2VOOA 2MY7A 4YB1P 2DNLA 1U2FA 1WF1A 3P6YC 3BO3A 2EVZA 2AYEA 1DBDA 2OTJS 3ULHA 2CQ2A 3CCRS 4C4WA 3VALA 2DH7A 2CPHA 2FHOB 1DRZA 1PGZA 1WG4A 1QM9A 3CC4S 2BOPA 3NNAA 1A7GE 2DHXA 3SXLA 2B0GA 4ERDA 3UWTA 1SXLA 3BO4A 5DDPC 1FJ7A 1XN9A 1YJ9S 2OSRA 1YTYA 2K8GA 1U1RA 3R27A 3MD3A 3VAFA 1WEZA 3CC7S 1VQ4S 2DNMA 2CQGA 3U1LA 1UW4A 2DNHA 2LXIA 2LXUA 2MJUA 2MJNA 2MQLA 2M8DB 4WKRA 2KYXA 1VC5A 2MKKA 4F26A 2NZ4A 1X5TA 2MGZA 3DLLQ 1JJHA 1P27B 4QQBA 3BEGB 2X1FA 2M52A 3B4MA 5ITHA 1WHXA 1VQ6S 5FJ4A 1VQKS 1VBXA 2RT3A 3UE2A 2MKSA 3J7ZT 1P1TA 2MKJA 2LEBA 2LA4A 3HI9A 1YI2S 1U6BA 1IQTA 1SJRA 2N82B 1Q81T 4TU9A 1YHQS 2MKHA 2L08A 2LEAA 2KM8C 5CYJA 4PRFA 1FXLA 1HA1A 2CQ4A 2JWNA 1D8ZA 1FO1A 4Y00A 5LXYA 3R1HA 2AD9A 1X5OA 2DNNA 2CPZA 5EN1A 1WI8A 5CXTA
chains in the Genus database with same CATH superfamily
1NKCA 1DLOA 3UDEA 1EP4A 2J0XA 4ED5A 1RT1B 1FD2A 1CQNA 5K8NA 4CYUA 3D5MA 2KZZA 2ZNZA 4HR2A 2DHSA 2C1EB 4OX6A 2XULA 3TA0A 5DDRC 1N0UA 1QDUB 1KHWA 3D1HA 3KDOA 4BDPA 2LDIA 1WF2A 1NB7A 2K7KA 5KT3A 2HHWA 1B0VA 3MUVP 1LK7A 3DDIA 1T3OA 4C3LA 1DURA 4USUA 2QL5B 3GONA 2VPXB 3W2VB 3CDWA 1UZDA 2V0NA 1X9MA 2L41A 4WFAQ 5D3GB 1VQ9S 3QJLA 4S0MA 1FKOA 3L7PA 1B7YB 2DHAA 2RB7A 4WFXA 2KJVA 1Q78A 4DR7F 1EX8A 4IFYB 4RU9A 5E41A 5C2GA 4AL6A 2OPQB 1HR0J 1Q16B 1RWXB 4X2BA 2D9PA 4DUYF 5ETQA 4KGMA 1WOOA 2HHXA 1AZSA 3T5HA 4B3RF 4DV2J 2MZSA 3BKUA 4ZVTB 3I9ZA 4Y2KA 2MTLA 1M5VC 2HZCA 2X3DA 1BQXA 3G6YA 2CFXA 4PKDB 5LSLA 1NK0A 2XMMA 3HHEA 3SV4A 1FDNA 2OPRB 4O3RA 4O0NA 4IO9Q 2BRKA 4ZA1A 2XY5A 5HL7Q 3DXSX 2YX7A 4C11A 1ZAXA 5LT5A 4R5PA 2CJKA 5KT5A 1NJIT 3BBFA 2DCLA 4Q44A 1VQ7S 4EK2A 3TANA 2EFVA 3RAXA 2DEIA 3TAPA 2XSJA 1JLBB 5DGAA 4NLYA 4DL5A 3T5LA 4DFPA 2X1BA 2DK2A 2OAUA 1BQMA 2E7VA 1R89A 4G1IA 3V6DA 1RU2A 3NGSA 2LU2A 2FLLA 1RP5A 1HWIA 2EPIA 5IXUA 4NA1A 3LANA 5DGBA 4IUFA 2EC2A 4LFCJ 2J0QD 2CNNB 3A8IA 1S1VB 5B0GA 3AXMA 1FJEB 3BKFA 1HARA 3PX4A 4KH0B 3RAQA 3TOQA 3HVAA 2LECA 4HHUA 4O3PA 2ZOMA 3ISND 4FF1A 1ELOA 4G1QB 4V19J 3VTIA 3CDUA 2B43A 3IMQJ 2GQQA 2XI2A 2EXUA 5KFIA 5HVHA 1X4HA 2Q79A 1RHUB 1NLKL 3DKDA 3JSBA 1FRJA 3MUMP 4DPWA 5HBMB 1LKZA 4E2FB 4KKOB 2ZWOA 4DR3F 3Q8PB 4IRDA 2PFFB 1YJVA 4G1PA 3HHNB 1FXRA 2XBPA 3ENVA 4DQPA 4K2JA 5AXNA 4OYZA 4DCJB 2IAJA 4EFAC 4X65J 1ZETA 4C8LA 3P3DA 4EO8A 2XGQA 1J5EJ 4OI0A 2AX1A 3CJ0A 4LREA 5IS2A 1QAXA 1AXQA 3JTNA 4LF8J 5KG4A 1WC0A 1U0HB 3TUPA 1B7FA 3DI6B 4B3MJ 1BWEA 2E5JA 4GKKF 1CC7A 4KO0B 5KFMA 1UKUA 3TYTA 2QX0A 5JUMA 1VQYA 3IG1A 2R9LA 2EFNA 4O4RA 2OUGA 2PC6A 4IG3B 4PABA 5HQ8A 1FRIA 3MMBA 3EXYA 3TJAA 1HQEB 2HAIA 5KFGA 1WKKA 4R8UA 1WOPA 2B5JA 3W65A 1A7GE 2HHPA 1FJ7A 1JXEA 4LF6F 3C15A 3CC7S 1R6VA 4OLOA 4DG1B 1BC6A 1FXDA 1WC4A 1NDLA 1IM4A 2HIQA 4B08A 4FYXB 5KFCA 4FF3A 2M52A 3OL6A 3UVJB 1W25A 3PXGa 1HYSA 2MKJA 3KFWX 1CJUB 2QA4G 4XPEA 2BQ3A 2OPPB 3T6JA 4PRFA 3KHLA 1UWBA 2CQ4A 2Q6BA 2QE5A 4QBUA 1LWCB 4L73A 3BBCA 1RAEB 2Z58B 1Y3KA 2YY3A 1NO8A 2A18A 3Q8UA 2KG0A 1REVA 2VL1A 3P5TL 4QIWD 2HHQA 1S9GA 2BYCA 3EJMA 4JV5J 1FA0A 3JTOA 5KT7A 2BW2A 2CQHA 1JQGA 3ZFVA 1F9EB 3UDLA 2DYAA 3R1LA 1CULB 2E1RA 3IRXA 3MM6B 4P2MA 2AW0A 3DRRA 1H6KX 1PKUA 4CLUA 2VC1A 2QSFA 4H4KA 3D66A 3RW7A 1I51B 3QT7A 3KTQA 2G9OA 4KAIA 3I96A 4ZVOB 2KZMA 1FK9A 4FYVB 1WKLA 1IQZA 1WHVA 4N5SA 3A3NB 1OY8A 3VGSA 5A8WB 4ZCMA 3VAGA 1LWEB 2BJ9A 1NSQA 3PO4A 1S4EA 5KFOA 3BQ2A 1IXKA 2NXNA 2XHCA 3L95X 3O44A 4UZBA 3MXHP 2R7UA 1MU2B 4P9SA 4X62F 3HO1A 3OHBA 2OI2A 2OMLA 2CKWA 3DU6A 4ELVA 2IMOA 4Q5VA 2ZJRQ 3FMWA 2PT0A 3HT3A 4I69A 3QZ8A 2HQ3A 2OJ3A 5G0RB 2JLEA 3C6TB 3DRYA 3VGTA 2HWTA 3NP5A 4KHRA 1Q7YT 3RTVA 5IM0A 2MLYA 1SCJB 3KJVB 4LQ3A 1LOUA 2K06A 3WX8A 2QLJB 3DLJA 2XQCA 1N33F 3Q23A 4JI1J 4URQU 1RWMB 4MMOA 1KLMB 1RHJB 2B9YA 2YKAA 4WXOA 3M2VA 4DPUA 3DRSA 1N5VA 2ADBA 2YX4A 5HATA 5T7LB 1RACB 2R7QA 4WP9A 3H8YA 3FK4A 1N34F 2XCAA 2GMHA 4JUZA 4OHWA 4ECXA 2D3OR 3W2WA 2BEFA 1FRXA 1QAJA 1DJ0A 2ZVSA 3FQLA 4DX7A 1N6QA 1F2GA 1IKWB 3L7UA 1WF0A 1VBZA 2CADA 4ENOA 4YOEA 3QT6A 2NYHA 3GU0A 2BANA 4YB5A 4NE9C 2R7RA 3IAM9 4RBVA 4WYLA 3VAIA 1YIJS 4OI2A 3KYLA 2VONA 2E9ZA 3ILOA 1BD6A 4IYQA 1NRKA 2A0FB 4FPIA 4TY8A 4ED4A 1KOHA 3FZBA 4MT1A 4ZCIA 1VQOS 3NGTA 2GQ2A 1K1SA 4G65A 4X4OA 4XDCA 3E8OA 3VAJA 3CJ4A 2H4YB 2CQ0A 1UL3A 1TKTB 3KJQB 3MM5A 2W2MP 1RXOB 4KHPJ 2HHVA 3JSMB 2YKMA 4DL3A 1AFIA 3QLHB 3DN9A 3NS5A 2VASA 2CXEA 1CJKB 4C97A 5T41A 4M5IA 4KTQA 5A8KB 3O5TB 3RRHA 4EI2A 1ZA2B 2EKNA 3JSRA 1KDNA 4DQRA 3B78A 3M05A 1WELA 2MDAA 2HURA 4DR2F 2H51B 4Y6IA 3WIVA 1YJUA 3MUTP 2MB0B 2M8HA 1YZ6A 4ER8A 3BO3A 2GCFA 1DBDA 2RKIA 3ULHA 3IBFB 3DOLB 3HMJG 1S9EB 4MK7A 2B9XA 3TJ9A 2DR7A 1DQ9A 2HK2A 2ZH1A 1S6PB 1S59A 1H0HB 2IRYA 4DI6A 2B0GA 4P71A 4WK3A 1X31C 2W9CA 2K8GA 3R27A 2WB1D 2F4VJ 2X3GA 4FKXA 4AD6A 3TI0A 2R2SA 2EWHA 2LXIA 2LXUA 1TL3B 2LP4A 4WTOB 4JI6J 2VD3A 3RBZA 3D28A 4NLGA 3GMGA 4HDHA 3M1VB 5AT1B 1Q95G 3W7BA 2BR0A 5L38A 4NMLA 2UU9J 2YNGA 1SJRA 4TU9A 5CYJA 1VS3A 3M2RA 3W5YA 3KLGA 5C7PA 1OY9A 4QJVA 3FEZA 1YDLA 2C2KB 1SJ1A 2ZVIA 2KRRA 2QFJA 2JHEA 1HWLA 1DAXA 3OSNA 3U02A 3DGPB 4USIA 2LEPA 3FBEA 4O4GB 2XLIA 2ATLA 4JI7J 1URRA 3C19A 1LWFB 2D69A 3NEKA 4OL8A 4I2QA 5SUHA 4OX9F 2NZCA 3KLEA 2ZH3A 2JJ4D 1WG1A 4Z37A 2W8LA 1YVFA 2Z30B 1EIYB 1GTHA 3FMBA 3QFWA 3RAMA 3HD2A 4QU6A 1XK8A 3CJKA 5KFXA 3CJSA 2V8PA 5EWEA 4M5LA 2LDYA 5K5MA 1MROB 4DCOB 3G6XA 3DOMB 2FY1A 4M63A 1VYAA 2ZM6F 4C8NA 3DDNA 4NXNF 5AXMA 2IRXA 3HLUA 3UI3A 2P6SA 4H4OB 5KT4A 1RT4A 4JI0J 2HWIA 2DBBA 4HYKA 2ZDPA 1GEHA 1Z2ZA 4FYYB 4NLUA 3ILJA 5HROB 4A8YA 3IR7B 2BM0A 4AUKA 2CQIA 1KQGB 4DR6J 4UQTA 3H40A 2LA6A 3D0IE 2X51A 2IC3B 3HM9A 5AXKA 2CPYA 2XS5A 2ZC4A 1T03A 1ICEB 1U26A 5DDOC 4ICLA 1XNQF 2DY1A 1M5PC 1FX4A 4CM2A 4ZJQA 4DV3J 1VK8A 1K9MT 1VQMS 3MTJA 4J9QA 2OEMA 4N56A 2WSEC 1XC9A 3CF5Q 5LOQA 3MECB 2JRSA 3O3LA 1HBNA 4P7TA 2ASYA 4DQIA 2WW4A 1UZHA 2FLOA 4HI1A 2HZAA 1YSJA 3R3TA 4QWBA 2EFPA 3OT9A 2QSWA 2B56A 2F7VA 3WX4A 1X4BA 2AYGA 1NDPA 3GIKA 1MMDA 2EG1A 1T7PA 1QSYA 4K4YA 4KRWA 3GG1A 2W7PA 3R2CJ 2A6MA 3SQGB 4ZP7A 4F8RA 4QR0A 4DSIA 2BA9A 3AH6A 2E1CA 4ZN3A 4C3KA 2YNIB 1U25A 2HBZB 4M5DA 1FVSA 1RCOB 4ZP6A 1S49A 3FVYA 2XO6A 2ZD1B 2XLKA 4IOBA 3IXQA 4DV6F 1PYTA 2H48B 4GC6A 1KRPA 2HRUA 2KFNA 3EZUA 2Q6CA 2RUGA 4LT6A 3C16A 2RUSA 4Q43A 2Q1LA 3NGKA 2RRNA 1LQ9A 3Q8YA 2FJDB 3H20A 3K58A 1LFWA 1GT8A 3G86A 3N5BA 2QN6B 4ALZA 1PC4A 5KG1A 4CTAB 1QUPA 1KD1T 3T1YF 1S97A 3HZEA 2CAJA 3CMES 4A8FA 1TKZB 4NLTA 5J2NB 1URNA 1WUUA 1NJZA 3LO3A 5IFMA 5KG5A 3ZZRA 2PMWA 2XWXA 3D6HB 1RYRA 1NK6A 1EJ7L 1OJ4A 4LBIA 4Z7CA 1BY9A 2AGPA 2B4VA 2ZKUA 3VQSA 5M2PA 2JEGA 4ZMMA 5BXIA 1U2FA 2N4CA 3DNCA 3K8WA 1DQ8A 4I0WA 1TR0A 2DXFA 3T1AA 1HHSA 3E2EA 1UPMB 1HQUB 1WC3A 3PG9A 4M8LA 2X7IA 5KT2A 2M8DB 2KYXA 4QCLA 1X5TA 3DLLQ 1TKDA 3PKYA 3QSIA 4P75A 1VBXA 3M8PA 2V67A 3W60A 1AB8A 3CJ3A 4PQAA 4QYRA 1TAUA 4OYBA 5K8PA 1U0HA 2H5JB 3DI6A 3NBPB 2MLXA 4OFZA 1X5OA 4TN2A 2QT7A 3TZXA 3VZHA 4KO0A 4URGA 4WFNQ 3US5A 4URSA 1TMMA 3DMJA 2PFDA 4DR7J 1YWXA 1SKWA 4QOTA 1U1MA 4DZ6A 5GAHI 2R7TA 3NCQA 3ZNJ1 2RS8A 2R2RA 2HNYA 1CJVB 4DG1A 2RH3A 3MCSA 2KT3A 1TTHB 2LQJA 3SDEA 3BJYA 2GX8A 4ZLNA 5C25B 3PFEA 3T9NA 2MQOA 4EEYA 1JJ2R 2O5DA 1HNWF 2GIFA 3HFVA 2XGPA 4X4SA 2XYHB 5KFUA 2V2ZA 2VBYA 3E01B 2SXLA 4FBTA 1APSA 2MZRA 4RW7B 1PILA 3ETMA 3JTPA 2H4WB 4J9RA 1RWOB 1RKIA 4JI4F 2V8GA 4C8MA 2JLGA 3BGOP 5I42A 2X1GA 4DSJA 2BUNA 4GO7X 3W5ZA 1CULA 2VG7A 3AY0A 3DU5A 2OHDA 4K0KF 4IQXA 4HTIA 5C2CA 4DWIA 1T9UA 1VISA 2GVDA 2EFOA 3Q8VA 2DISA 1E6YB 2CQDA 2C3OA 4PPDA 3KWMA 4EU0A 3HFKA 3LF0A 4OZLA 4PUOB 4NLPA 2DGTA 2J6TA 2IA0A 3RYLA 5L1KA 1T9XA 4LMZA 3CVKA 5LMNF 3IWXA 4KSEB 2VB6A 1NEEA 2RQKA 3R5DA 2FHJA 3KG4A 2M7SA 4ZJOA 3K5NA 1RBOB 4TYBA 4ANCA 4QIFA 4CO4A 5IC6B 1QSLA 3MR6A 1FEHA 3CIMA 4C0OC 3UD4P 3PW7A 1MU2A 4P52A 3MR3A 5B0FA 4OZNA 2YBVA 1H7XA 4XDDA 1WHWA 3SEOA 3KLVA 1FE0A 3MMAB 2I2YA 4P2XA 3FEXB 3VGVA 1UAWA 4E8UA 3I4HX 2YKQA 1JJCB 2CQPA 1HD1A 1B0TA 1PSDA 3NMAA 3HPOA 4CLLA 3OD2A 4ECQA 3V2UC 1BUXA 1WORA 2FZGB 2KT2A 3C6TA 1SBRA 2Y9HA 1RAJA 1UJ6A 3FZ2A 3CDEA 5G4DA 4LRDA 4DS5A 1U1KA 2UUCF 4KFBA 1RA7A 1FJGF 3MM9A 2LCWA 3BYPA 1FHTA 3OVSA 1IR2A 5I3UA 4HTJA 1BMQB 1SIWB 2OLWA 4C7QA 2CDQA 4IDKB 3LUYA 4WE1A 3DLKA 6FDRA 3QGPA 1Q8LA 3L9ZA 2UXBF 2LMIA 1LK5A 1VRTB 2BJ7A 3KMSA 2XM3A 2MQQA 3FKBA 4ID8A 1N32F 1AUDA 2H9ZA 1TK8A 2WVDA 4RW8B 4E98A 3PR4A 2VQFF 1H72C 1IKWA 3AD7C 5J2MB 1U24A 3PDNA 4EGLA 3EDRB 1RTIA 4OYOA 1P8GA 3EGZA 3OTDA 4HKQA 4Z2XA 2V8DA 4L3KA 2A2CA 2DNZA 2M70A 4IG0A 2M0GB 4PXBA 3AA9A 1YITS 1NMEB 4X4VA 3QWUA 2BX6A 2FC9A 3Q8RB 2DRBA 4ANEA 3U27A 4HT7A 2MY7A 2EVZA 2BQRA 3MPYA 4NEZA 1IJEB 4DV4J 4USWA 4MIAA 2DHXA 3SXLA 1QTMA 4DCPB 3PW0A 2BVZA 3D6FB 4MFBB 3MHYA 3MD3A 3MEEA 1UW4A 3MM8B 5IWAF 1B4SA 4U7UD 2MJNA 4MIWA 4ZVFA 3OV7A 4J7CA 1TELA 2CRLA 2C2OB 4Y2CA 4CLWA 1FCAA 2MKSA 3C8YA 3J7ZT 3SI8A 4QR2A 4DHVA 1VDHA 2JWNA 1FO1A 1RAFB 8ATCB 1HBUB 1RHQB 3J7YI 3R8YA 2AYBA 1C1CA 2UVVA 1VJQA 1S1TA 5A8RB 1HR0F 3EE3A 1P1LA 1FRLA 1NK7A 2E5GA 1Y10A 1LW2B 4OYWA 2WSCC 3VZIA 1IWAA 1R31A 4NRUA 4DV2F 2IJFA 1FWLA 2VZ9A 1RWVB 2RF2A 5HVGA 2MZTA 1JX4A 1SC1B 1VC6A 4DF4A 3CO0P 2LU1A 1T11A 5AE1A 1NH8A 1DZ5A 1QE1B 4NLQA 3M8WA 1YRTA 3VAHA 4X62J 5MAOA 1HIYA 4LRFA 2NSBA 5F3TA 5THWA 5KG6A 5KFHA 4RBTA 4DL2A 3KNGA 4KYZA 5K8MA 4ATNA 4C3MA 4RZRA 2YQ1A 1R6YA 3QGGA 5FD1A 1W2BR 2OD6A 3I9V9 3R5AA 5HO4A 5J2PB 3NOGA 4JI2J 1Q4RA 4IQMA 3DGPA 1TL1B 2DNKA 1HBOA 4P2SA 1JXLA 1SJQA 4YDDB 1T3NA 3TA1A 1HI0P 2BM1A 1N33J 3GV8B 3LW5C 4JBCA 4LSLA 3ZC4A 3CO9A 4KY3A 5BYRA 4RUAA 2HVIA 1W26A 2W9AA 4O44B 2CZVC 1N48A 4EO6A 3V81A 1N0VC 2V4RA 1MWYA 2MHEA 1M5HA 1HL6A 3RB6A 3KUHA 2NSCA 5LSOA 4DFJA 3NS7B 3FCHA 1TVRB 2XZDB 3M32A 4CNZA 4LFCF 2ZKTA 1N34J 3Q22A 3WBZA 4NLXA 3BM7A 3FNNA 5A2QU 2OEJA 5FLXU 3K5PA 3PHTA 4I6YA 5GAGI 2IFXA 3IWLA 5GAHU 2DGVA 3GJSB 3IS9B 2CNKB 1QY7A 2L9NA 5A6WA 5K20B 1KVIA 1JKHB 2JDJA 4UY85 3IR5B 3DYAA 3AB2B 2IC3A 5F9LA 1DLOB 3D68A 3TP2A 1TUVA 1EP4B 2H65B 3OTOF 2MKCA 1VHFA 4CYUB 1LW0A 1EHWA 1YKWA 2PMZD 5CCMA 3MAAB 2V6AA 1O0PA 4W4MA 3AT1B 1X7VA 2P5VA 2XMTA 1OQ6A 2ROPA 2O66A 4X65F 4OI1A 4USVA 5B7WA 3TZZA 1J5EF 1Q0NA 1L3SA 1KHVA 2WONA 1RBLA 3I5AA 3J7Z5 5DETA 4ZVQB 1N4LA 4LF8F 1EETA 3MECA 3U1MA 3OR2B 1F9HA 4GVBB 1ZTWA 5JJBA 5H9FK 3HSDA 4CRJA 3HX9A 2JFKA 3P45B 4WIIA 5JMNA 3AQPA 3VQTA 1FKOB 3UDVA 3MM7B 2Q43A 4FNHA 4ZP9A 3KLHB 1CVJA 5GMKa 3HVWA 6FD1A 1Q86T 2I6WA 2YH0A 4LQ9A 1G4CA 4L75A 1MWZA 3LP1B 2XY6A 1RAAB 1AZSB 2AYMA 2MYFA 3H98A 5EUHA 3M30A 2R42A 1VQSA 4ZPAA 2CQ1A 3JSYA 4KE5A 1YGYA 2E44A 3MDFA 5CH7B 1GTEA 4ECYA 4OZJA 1UVKA 2PI4A 1RGVA 2KL8A 2H54B 1BGXT 2JH3A 4I2PB 2HGNA 1I1GA 2XMJA 2Y8YA 1KEKA 1N5QA 3RRGA 3LP0A 4ILMA 1U4BA 1MN7A 3KLFB 1D09B 4R5PB 3HULA 1HWJA 4ERDA 5A76A 2A10A 4JV5F 2J9EA 3RBEA 3MAHA 2IY5B 5J1NA 3A13A 2IYIA 1UTAA 2IM0A 3OHAA 1JJHA 1HHQA 4A8MP 2M5YA 2Y1LB 4C6AA 1HKAA 2FLNA 5ETPA 1BQMB 3UE2A 3IN5A 5J2NA 4NOHA 2MKHA 3V6DB 4R0EA 5GADI 2NPFA 3GP9A 3AD8C 3KHGA 4DDFA 2AD9A 4USTA 1X0PA 1U48A 1A6LA 3R5JB 5KFBA 2O3DA 4RBUA 1KFSA 3G6VA 4OI6A 1M5KC 3I31A 2K3KA 2M88A 1U1OA 4FYWB 2DO0A 3JYTA 3FFIA 4USJC 1KFDA 2HHTA 2CZ9A 5EGYA 2IM1A 1CS4A 2JOQA 2AHOB 1Q1KA 4CNYA 1OWXA 4NXNJ 4DV1J 2EBGA 3GYNA 1Q8KA 3FBFA 2DR9A 3VAMA 4Y2IA 5AJ3J 1NPKA 3KHRA 4A8OA 2VA2A 2QA1A 4PQUB 2AJ0A 2RRAA 4LSZB 3PM9A 4O3SA 2DXDA 4YMEA 2VFSA 4KHMA 1RTHB 3HF5A 2RS2A 3H59A 3C6UA 3LQVA 2D9OA 2FPHX 1NPRA 2E9RX 1ITPA 4ECTA 2QYGA 2OP5A 5GMEA 1R8HA 4U95A 4FF2A 4C8ZA 2FGOA 2IAJB 4Q8EA 1MMNA 3FCVA 2OELA 1S1XB 1TL4A 4F0HA 4C8OA 3Q89A 4JI1F 3MEGB 1CJVA 2R8JA 2YNFB 1GAOA 3HVTB 1TL5A 1SL0A 3LAKA 4LF9J 2NQPA 3UDCA 3ENQA 4LF7J 1NHUA 1SKUB 1BQNA 4IH5A 2IJNA 3IG1B 1D9FA 2EBEA 2FHKA 1OYDA 1X4CA 4A47A 2CVIA 2APOA 2RHQB 1M1GA 5F8JA 4LFBJ 4KIAA 4R8UB 2B5JB 1R27B 3PFOA 5KFDA 5RUBA 2DHGA 3NCRA 4BC9A 1FDAA 2FUG9 3J7YU 5DQHA 3C15B 2MQPA 1R43A 2G2YA 3MGJA 1SV5A 4RW7A 2GW8A 1D0EA 2HK3A 2MQMA 3BB5A 3N9UC 3VV2B 1HYSB 4OYAA 4E0DA 3N28A 4LJMA 1X4EA 5D0GA 4KGKA 4DV6J 3SCLE 3G96A 2QA4S 2N3OA 1K1QA 1RT6B 3QBCA 2E5LJ 4K4WA 2CQCA 4M1KA 1QUVA 2ADCA 1VLYA 2R7WA 3VR1A 2OH2A 1REVB 2DPIA 1OS5A 3DLHA 1S9GB 4WZQA 4KHPF 2MPUA 1WSVA 2DH8A 1VLOA 3UNYA 1T05A 1NK5A 2QYCA 5KFZA 4HVZA 4J5OA 4CIOA 2GHPA 4LF5J 3M9NB 3T1YJ 3IRXB 3HSGA 1D1UA 3DRRB 4F4AA 4WCEQ 4F0MA 1AW0A 1RU1A 2UXDF 4DV0F 4XTTA 1TP7A 3N5FA 1JLFA 2DKOB 4PWDB 3GWCA 1VBKA 4C8YA 6AT1B 3H5UA 1TZ0A 4X4QA 2UUBJ 1FK9B 2XNRA 4ETZA 2WHOA 1HNVA 3ISNC 3C2PA 3TAMA 4K5RA 3CCLS 3UCZP 3WQPA 2ATCB 3D0GE 3OFFA 2F4VF 1PJ6A 2XC9A 4JI6F 4WJBA 4OYXA 5DG7A 4O3QA 1YJRA 1X5SA 2W1BA 2ZDOA 4JI8F 3CCUS 4QW9A 2A6OA 1CJTB 4X4TA 5CYMA 4BWMA 3H2UB 4K4SA 5D0HA 2ZH7A 1FF2A 4RWWA 4CLTA 3DRPA 3T1HF 1BXNA 2HRTA 5GAGU 1RWUA 1I94J 4W90B 3HK2A 3I5CA 1UETA 1U0SA 1FNMA 2AGQA 4C4WA 1JXVA 1DRZA 2P9GA 2ZZNA 5H9FJ 1VRTA 2CNLB 3HHKA 4OV1A 4ZHRA 2BMBA 1U1RA 4LF4J 2FJWA 3T5KA 1U2CA 2DNMA 1WOSA 1XEZA 3B82A 1H3DA 2PA3A 1IKXB 3D7SB 4A8KA 2X1FA 4JI7F 2AJFE 5J2MA 1WHXA 4Y34A 3BREA 1AUSL 1P1TA 1R0AA 3M2VB 1NK9A 1GXUA 2O1PA 2BJ8A 1U6BA 4LRBA 1Q81T 4DL7A 4M5KA 1YHQS 3OQ2A 1FXLA 3QAUA 4U7UK 4OJ1A 1LXJA 3WC0A 3FC9A 2G0JA 2ZH6A 3IRWP 2EKYA 3Q2TC 2VBXA 2PIIA 4OIXA 1G3OA 3X3UA 2M3DA 3IAS9 2W4DA 5DZ6A 2VODA 2ZBRA 1XWLA 2Z0GA 4D3GA 3NCPA 4F36A 3DLBA 1DFDA 3K0JA 5M2RA 2BANB 4Q0BA 2UUAF 1A0OB 5EWGA 4DR6F 1JLAA 4TY8B 4UOCA 1F6TA 4BLGA 1SB6A 1EKSA 2RD5C 2D1CA 3V4MA 1FJCA 4PZVA 1MG7A 3TA2A 4WU2A 1RHKB 3CJ2A 4KV8A 4UT4A 3VCDA 5CD4A 4DV3F 1YQHA 3MM5B 1OY6A 1NHKL 4EZ6A 3ZZPA 2ALZA 2VDHA 1F5AA 4IH7A 3UCGA 5LMNJ 4B9MA 1D9DA 3H4DA 1H73A 4EWTA 3PRDA 1KC8T 3THPA 5HK4A 1MN9A 4CM0A 3V4IA 2VKZG 1SJ3P 4G6VB 2JEIA 1U47A 3FBCA 4K4VA 3A12A 5B0AA 4AL5A 3LGHA 1RI7A 2NUUG 5B0CA 3PYFA 3WDOA 4K2XA 3I0RB 4PG4A 2RKIB 4NCAA 8AT1B 1HBMA 4OZ2A 3HVRA 3PACA 5GADU 3H5XA 2OKQA 5L1IA 3NRBA 2IYGA 4PWUA 5ETTA 4UUWA 3TZWA 1S7IA 4W92B 3D1QA 4OYPA 1W7WA 4TQRA 2GAHC 2NLWA 4J9SA 4XPCA 4YS2A 1V3ZA 3AQOA 3M6XA 2PA8D 1HMVA 4MJKA 2HLTA 3HKWA 3I6PA 2YNGB 2ZH4A 2FJXA 3ZTSA 1QAYA 2VBZA 4TKTA 2MEWA 2UUCJ 2EI5A 3ADAC 3CW2C 5CA5A 3KDNA 3KLGB 5HMYA 5FDLA 1U8SA 3GV5B 4ED2A 2QLBB 2C2DA 5J1EA 2AU0A 1DTTA 3MMJA 3UPFA 3HHLD 5C24B 5HN0A 4DPTA 5BYSA 3UW1A 3ZTPA 1R8CA 4ZPWR 9RUBA 2WVFA 4IFVA 2YWGA 3K5LA 1WG5A 1PAEX 3N4WA 2KYZA 4DU8A 2XNQA 3H90A 1NSPA 4O3OA 3K59A 4I2QB 2LQBA 3D4JA 3MPDA 2QV6A 3KLEB 4DN0A 2J76E 4ZP8A 4MTPA 2V4JA 3V6KA 3KHHA 2ACMA 2FC8A 1NDKA 4OZ0A 1JKHA 2KKHA 3K2YA 1KOOA 2FYXA 3CJKB 5D15A 4L72B 1VRUA 2GHWA 4JI5J 3BYRA 2BJ3A 3Q8QB 3UR3C 2MKYA 3W62A 1N5YA 1FNXH 3M8QA 2VC0A 4OLPA 2OTLS 2DGSA 1ZYQA 3MAAA 3TUIC 1R8PA 1GNKA 5D6GA 2DIVA 1T0TV 1RT4B 2Z2YB 2YKOA 2HZVA 2EW9A 4K4TA 1ZOTA 2VQEJ 1GX5A 5IWAJ 1ZM4A 3GYXB 1TK5A 1RHRB 2OSQA 1KNZA 2DNOA 3QRQA 2DPJA 4OJHA 3OR2A 1A9NB 4C2MA 4GVBA 1F60B 1RISA 5DLGA 2K3IA 1L3UA 2XMKA 2L9DA 1HNZJ 3OTCA 1T03B 1WDTA 4ICLB 2B51A 3DFEA 3MM7A 3CC4S 2V5HG 3KLHA 2IJRA 1YJ9S 1QSSA 3EZ5A 1WEZA 2HIYA 2ZHBA 1VQ4S 3BR9A 3EMTA 2Y0BB 1KR4A 4YDXA 1WD6A 3LP1A 2K7JA 2OGUA 3ITHA 4FXDA 1HBNB 3I5BA 1TKXA 3A8JA 3ILIA 1YZ7A 3OXLA 4NLVA 1IKVB 4CT8A 5FJ4A 2B3TB 3M8RA 2LA4A 2XYGB 4KH1B 2WOMB 1Y5NB 4Y00A 2NREA 4KBIA 2YQ0A 3ZZ0A 2MQ8A 3PRVA 2ZUGA 1J27A 4I6AA 2QO3A 2RQ4A 4I2PA 1LFPA 4LF2A 1R8AA 3DHXA 3J7A1 4KR0B 4QU7A 3UCUP 3DOKA 3N0VA 4RUHA 2G1DA 3KLFA 5HP1A 3MR7A 4C8KA 4BC7A 2B9WA 1RB0A 4M5DB 2YWWA 1JLGB 3H25A 3OUYA 3U1NA 2E5IA 2QL9B 3G82A 1VQ5S 4AXIA 1DY3A 2W9BA 3CIZA 2EEYA 4LRCA 2DHHA 3W1YC 2HFVA 4YR0A 3OVBA 2O01C 2KO1A 4C48A 3HZGA 1VC0A 2JC1A 4ED6A 1DTQA 2BABA 1M5OC 4RWXA 2YTCA 3C16B 2BKNA 3ILLA 1X4DA 2FJVA 4F4YA 1KTQA 4QYZK 1TQLA 2RVJA 5J2QA 2FHJD 1L5UA 3K5MA 4LIRA 2KG1A 5DO2A 1W2IA 3EDQB 4PG6A 1SI9A 5K14A 3KK2A 3PKMA 2JFDA 4USKA 4ZVRB 2UVWA 2ACYA 5M2UA 4BCAA 4HH0A 3HHLB 1KS2A 5IQQA 3OJUA 4HHHA 3ZO7A 2BACA 5FLXY 1JLCB 3EXCX 3EVMA 4B9SA 4DV7J 2E1PA 2X1AA 2CDRB 4PQUA 3O1LA 2JLFA 5IT9Y 5E3AA 4YB7A 5DJBA 3GFZA 4N77A 1ZPVA 4IH6A 4YFUA 3PTWA 3CCMS 2UVRA 1RTHA 4JOUA 3M9MB 4ZPCA 1SUQA 1ZZFA 3OTOJ 4H54A 2PI5A 2ALYB 3MOZA 3ZZTA 3QIPA 3B54A 3JQKA 4FKYA 4IR9A 4ECVA 1IBCB 4W98A 2WVCA 2KFYA 3MI7X 5IV4A 4FVMA 2ZH2A 1S1XA 4DX5A 3W9HA 3F41A 1CQMA 3T41A 3M8PB 1FKPA 3R6GB 3MEGA 3FBBA 2YNFA 2QG9B 3HVTA 4LSNB 5GMDA 2MZ1A 1DARA 2BDPA 2UZAA 1IBLJ 1RTJA 2PGCA 2RQCA 2A2DA 4KGVB 3MFHA 2C2MB 5E3RA 2J7UA 1XJWB 2GV1A 1JLQA 4ZVGA 1V9OA 4CO3A 3EGNA 5F8IA 3W63A 2B9EA 3DMJB 1R7IA 1X5PA 4YEAA 2PEHA 3BDPA 2WB4A 3CT9A 2HNYB 3QPIA 1N54B 2IVYA 3A3PB 1ULRA 4FP9A 2XB2D 1JLEA 4YHHF 3SDEB 4U96A 4PPZA 2GIQA 2CPIA 1NUEA 4N41A 2IIHA 4ECRA 1NAQA 5C5JA 1RT6A 3IBCB 1SL2A 3TWZA 5F9NA 4DV4F 1NJXA 4YB6A 3PX0A 2CPDA 2M2BA 4WBFA 4K4UA 3MMCA 2GO9A 1K44A 1PIEA 1FFGB 5LMUJ 2J6SA 3R6LB 5I42B 1O6XA 3FSIA 1R8BA 3MURP 3CDBA 2E66A 2AJ1A 3BGRA 4FXVA 4F02A 2VG7B 2DVIA 2JVRA 4H4MB 5KFVA 2O67A 3VVUA 2GVDB 3M8ZA 2LLZA 3LTOA 5KFTA 3EGVA 4PWDA 4CO0A 1Q53A 3VALA 5JXSA 1Y4ZB 3K8VA 1WG4A 2COLA 2Y8WA 4DXLA 2AZ1A 2UXCJ 4HDGA 1VC5A 4X4NA 1Q5YA 4IKAA 2GIRA 5BR8J 2BRLA 2LEBA 3BKTA 1CJTA 4X66F 2F8MA 4PAAA 2CPZA 3MPVA 3UN5A 5KFAA 2ZHAA 1G2EA 3W64A 3P96A 3A8EA 3KG0A 2HMIA 1VQNS 4UUXA 5HVFA 3W9IA 1LXNA 5F3ZA 2F3JA 4NZ7A 3CPWR 3X1LB 2CQBA 4NX9A 4XO0A 1AROP 3BGFA 4JI2F 1GMVA 3I32A 1F3VA 3U7JA 3OVAA 3G8TA 2BV3A 4U67Q 1IKXA 1C2PA 1RAOA 3HKZD 1T9YA 4KFBB 3MM9B 1SIZA 2DJWA 4I1TA 1KQFB 5EHHA 1HPZA 5I3UB 3IC1A 2J0SD 3MCOA 3GB0A 4WE1B 3DLKB 4IRKA 3FGVA 3K17A 3QYYA 2DTJA 4F3OA 3MD1A 2UUWA 2YH1A 2DD8S 5ADZA 2G2OA 3J81Y 3NGDA 3H42A 4HL9A 2VIHA 3RB3A 2B4UA 4ZS6A 2FB0A 3AOBA 1T9TA 2ZJPQ 1Q5VA 3GJRB 3PJXA 4PG5A 4ES2A 1SC6A 1RTIB 4J9NA 3TVZA 4K50A 2RU3A 3MCNA 4NMXA 2CPJA 1S0VA 3GJQB 1MSWD 1UEKA 3VWSA 4YY3F 4EUVA 4IG0B 4U7CA 1VCTA 3RR8A 4X64J 3DRXA 1REGX 2UV8A 2XS2A 5F8GA 1GXLA 4MKVA 3GFXA 4RLEA 1UFLA 2C3PA 1PO6A 1RWNB 1FDBA 3R7BB 5ETNA 4MYUA 5L39A 3T5JA 2IA6A 3MEEB 2LYVA 5EX3A 4OZ1A 3PYEA 4CLFA 1X0FA 4QYZJ 3DXBA 3BN7A 4ED3A 3GSIA 2R2UA 3CMQA 2ROGA 5F0UA 1P6TA 1FD8A 1D9AA 3PHEA 5F8NA 4MK8A 5IC4B 1N52B 4OHYA 2UXDJ 2MSSA 4F4KA 3QWPA 4DV0J 2J6UA 2IBKA 2VFUA 2NXCA 3I0RA 2FY8A 1C1CB 3QRRA 1WTBA 1S1TB 2VPYB 5E0OA 4OYIA 2H5EA 2B6AA 3NLCA 1XMBA 2DR6A 1RT2B 4J9VA 1T94A 2PSZA 3DM2A 1RUSA 2RF2B 3EICA 2FVPA 4B3SJ 4QIVA 1VQPS 3UO0A 3PY8A 4JI8J 4JYAJ 2C3MA 3E51A 2EG2A 2I1RA 3EYZA 4TU7A 2IVFB 3L3CA 3S7RA 1UEVA 2G1HA 3T1HJ 2HG4A 4V1Ak 3NMRA 3HFZB 1UVLA 5E3CA 2GMLA 1ACMB 4UOHA 4ZDNA 2FJBB 2I5JA 1ZM9A 3GIMA 1RWWB 2Y3YA 3QQCD 5D77A 5C24A 1UPPA 1C4CA 5ETLA 4DOZA 1Y5LB 3QO9A 3TEHB 3TZYA 2WW8A 1HBOB 1B99A 1J5OA 3Q24A 4HHJA 2WSFC 4AQYF 4I64A 3GIJA 3N79A 2DB1A 4DR1J 1M0SA 3KJFB 1RQ0A 2UP1A 2MZJA 4LSLB 2QRRA 1OO0B 5ETVA 1SJFA 2HAFA 3V81B 4YB1P 2HBQB 3CCRS 2V2QA 2R8IA 4EBDA 2FHOB 1QM9A 3M32B 5A0YA 1C0TA 2R7VA 2QMWA 3B8HA 3GFYA 4LFAJ 4I67A 4DV1F 2UUTA 3BH7B 4ECZA 1RE1B 2UV8G 4F26A 5AJ3F 4ZCLA 4QWAA 1YX2A 4ED7A 2MLZA 3PEHA 2ZNYA 4BHQA 4DMZA 2UUAJ 3UFCX 4OI4A 5EDWA 3JQJA 2NXUA 1ZA1B 3OPKA 2ASDA 1BE4A 3OR1A 5EN1A 2HS4A 3DYAB 3CJ8A 1VQ8S 3Q83A 1N36J 1M1KT 4DJBA 4F0KA 4J9OA 1F2HA 1SJ4P 1LW0B 3IA0A 2VH7A 1CG2A 4J9KA 1RT3A 2CA9A 2M4MA 4O3NA 1S9FA 3DLEB 4N8OA 2HVEA 4CDIA 4PG7A 2QLWA 1IBMJ 2DGUA 2WONB 4Y65A 4B3OA 1ROFA 3IFEA 3AA8A 3ZZZA 5DM7Q 1EETB 1RHMB 3CD5A 4WWSA 4LF9F 3QAEA 1IKVA 3CD0A 3CNQP 4RW6A 2R3VA 4LF7F 3CCWA 4LRAA 1YJ7A 3BQ1A 5KFEA 1Q82T 1SVDA 4OV6A 3G71S 2WOMA 1RT5A 2BXJA 2DNRA 3QT5A 4YP3A 2VU5A 2XMVA 4LFBF 4Q45A 2MMYA 2RRBA 3NOCA 4J91A 1U02A 2NXJA 2GVZA 2B4PA 1F9FA 4TY9A 4IOCQ 1YJWS 3F0NA 5C42B 4NLWA 3AOCA 2XZWA 1HI1A 3QGIA 4DS4A 4KC5A 2RIJA 3EWGA 4GO5X 3WC2A 1JLGA 3M30B 3EPGA 2N7CA 1I5OB 3NWRA 1XQIA 3MWBA 3J80U 1NCLA 4FDFA 5ETKA 1VBYA 1S0NA 2E5LF 2YNHA 1DQAA 5HJXA 3LP0B 3EM1A 3R7SB 5B09A 4RR5A 5BJRA 3OJSA 2EC0A 1UFKA 4P74A 2A3JA 3CULA 4IOAQ 2CJAA 5KG2A 2BOAA 3HJFA 4G3IA 5LJ5Y 3CMAS 3SBMA 4YR3A 2ZC3A 4AT1B 1ZM2A 4LF5F 1T8EA 1T02A 1M1HA 3ET6B 1V6HA 2ZE2B 2E5HA 1SKRA 1B70B 3KG1A 1RCXB 3HHLA 1IM6A 1JLCA 1VOMA 2ERRA 1VIXA 1WC6A 1HNXJ 2YKNA 2ILYA 3G9CA 2VUGA 2IPOB 3IWNC 2UUBF 2DO4A 2H5IB 4K59A 2KFZA 5HAOA 1Z1ZA 4M5NA 3CCQS 4Y28C 3M8SA 5KOWA 4OJGA 3FFIB 3JYTB 4J90A 1CS4B 4C9DA 2FLPA 3KOAA 2HLUA 4QIEA 2KM8B 1LV5A 2AJQA 2HRYA 1S1UA 4DV5J 2DCUB 3TX0A 5E5NA 2WK4A 4WF9Q 4DSFA 2AV5A 1S7HA 3IM9A 1SKSA 5FIIA 2PO4A 1TMJA 1RZMA 3G87A 4ZN1A 3DCAA 3JS9A 4ELUA 2JC0A 4WK1A 4UZCA 3K5OA 1I94F 1EB0A 3MPWA 4LSNA 2FVSA 4EZ9A 4ZPVR 2QL7B 3VGUA 3C6UB 5B0BA 2CJ9A 1T9WA 4OZ5A 1U49A 1H7WA 1UW9A 3C14B 4F7VA 2JNJA 5LM7E 1B3TA 1JNZB 4LF1A 4A8SA 4LF4F 4F04B 2VKRA 1WJ9A 3CJQA 4FBUA 3N6MA 2WAQD 4CH0S 3VVTA 2HHSA 3R5BA 2C3UA 3BR8A 1NB2A 4CLKA 1QLNA 4DX6A 3J7AN 3G8SA 3BZQA 4ZIVA 1MLAA 4OI3A 4F3QA 3OL9A 4JV0A 3GIIA 4OX7A 1UEUA 1VFJA 1BQNB 2M9KA 4PWWA 4UOFA 5DQIA 2OTJS 3OXGA 2FZCB 2BOPA 4MH8A 1SXLA 5CQGA 2R2TA 4NCBA 4GKJJ 4KB7A 4MKAA 4NASA 1SV5B 2CG8A 3I82A 1RAHB 2MKKA 2BKPA 4HH1A 4ZLLA 4C0HA 4O23A 1VRQC 1FX2A 1SC3B 7AT1B 3FRZA 2D3O1 1SH3A 2RT3A 4FNIA 1U6ZA 2JEJA 1VK3A 2IDLA 1IQTA 4KGZB 2QJ3A 2J9DA 4EBEA 2ILZA 3ZZOA 4FN5A 2ZZTA 4H4MA 2DNNA 2XHWA 1V3RA 4RUBA 3CD7A 2AWZA 1NHVA 4NLOA 2OO4A 2C22A 1JK9B 1Y00A 3LP2B 2XSFA 2JL9A 2XCPA 2OIHA 3CCJS 1KONA 4ID5B 4H4KC 4TVAB 4CO2A 1U1PA 3T6BA 2C2RA 1T05B 2F65A 5F8MA 2VF3A 4LR7A 1FERA 4WFYA 1M90T 3A4TA 1I3OB 2BE2A 1KQKA 3PNIA 3TJ8A 1HW8A 2KVQE 3PR5B 3I56S 1IUJA 1JLFB 4RW9A 4LBPA 2HSEB 3W9JA 1F5BA 1CSJA 1NH7A 3K89A 4LBHA 2NR0A 3TRGA 5CYQA 5DS7A 5ETRA 1HNVB 3I4PA 2QLXA 3TAMB 1CLFA 3BGLA 1HI8A 3L09A 3MAQA 2V34A 2QGFB 1OIAA 3G8QA 4I7FB 1JJ4A 5KT6A 3M6WA 1FI4A 4HI2A 2MQNA 4DR5J 2AGOA 2AEFA 2AJ4A 2ZITA 3H2VE 4JP8A 3S1TA 5CYMB 3BPSP 1NJYA 3DRPB 2YXLA 2Y0SD 3I0SB 3PRBA 5L1LA 2N7YA 1TUGB 2AJ2A 2WVBA 1F3FA 1TL7B 4NLDA 2BJ1A 4ZHRB 3P4UB 4NCGA 1X8DA 1NU4A 3SCIE 4WP8A 3ZXWA 3D3BJ 5D4LA 4MKBA 4RX6A 2DGQA 5KFNA 5GVQA 1F5CA 4RPFA 2IVMA 2ZBQA 1R0AB 3FCWA 3KK3A 2DITA 1UVNA 4WKYA 3ETOA 2WTFA 4YHHJ 2HNZA 4JV2A 2MXYA 3FUYA 2CUYA 3K57A 1ZPWX 3I87A 1XMQJ 1XMOF 4ZKAA 3D2WA 5B0DA 1S77D 2LFVA 4JI5F 5H1SV 1VR6A 3SQOP 2D74B 4NYZA 4UY8T 4MYTA 2RQMA 4B3TF 2DEJA 4PXDA 3JB9k 5B0EA 2XEXA 5L9XA 1Y9OA 4L3NA 4WFBQ 5F8HA 2V9KA 3Q2SC 2BQUA 2IRUA 2VQEF 3EVWA 1NM2A 1GQEA 3MR2A 4Q0BB 4Y2MA 2KB2A 3QSYB 4DR4F 5E3PA 4X4PA 5I3PA 3PIOQ 4CCHA 2DR5A 2W24A 4ZPDA 2HQFA 1JLAB 4OX8A 2W01A 3B4DA 2R4FA 4KQZA 2G0CA 2IBOA 5KG7A 4J9MA 4IO1A 2F8HA 3A1YG 3ZTQA 1XR5A 2C42A 1NNDA 1HNZF 3TQEA 2QZ8A 1C4AA 2QMXA 3T9ZA 1YG0A 4KV8B 1GMWA 5DRKA 4NXMJ 4UTGA 1IWGA 2DNPA 2GNKA 4ES1A 3NG8A 2NCKL 3RW6A 3NS6A 3M9OB 1RT2A 3D54A 2KHCA 1RAIB 2VFRA 3KLIA 3V4IB 1Q7LB 1MNEA 2R7OA 4DU7A 4PR6A 3TO8A 3QZ7A 3RR7A 1O8BA 2Z2ZA 4K8RA 1WEYA 5D8HB 4X66J 1JNRB 2DNLA 1HNIA 4MK9A 3OL7A 4YN3B 2V9WA 3OBIA 1UVJA 1LWXA 1HBMB 1SQFA 2OMOA 5K9FA 3GFHA 3LPEA 1UA1A 2VFTA 1EQ0A 1XN9A 2HFUA 1IBKJ 4XIUA 1YTYA 1WNEA 2CQGA 2V69A 4OHXA 4ZITA 5J1PA 5HLFB 1P27B 4RNMA 3Q8SB 1WKJA 2VPZB 5L8RC 4I56A 3H5YA 2Z8QA 1HW9A 1EQMA 1HMVB 5ITHA 2BJDA 2PN6A 1KN6A 3Q0AA 4RKUC 1S0MA 3JAMU 2YWHA 5D0EA 1KKHA 4ZVEA 5FDLB 4J9PA 4OHVA 5J1EB 3QMQA 1DTTB 2DXEA 3H5SA 1G7CB 2GA7A 2OFHX 5DDQC 3IGNA 4U8VA 4RNFA 2ZJQQ 5F0WA 2G0IA 4JV1A 4IFVB 5KFYA 2DRDA 4WP3A 2VOPA 4WXWA 5T14A 4DX8H 3OFGA 4DV7F 3EX7B 1U1LA 1IKYA 5DZ7A 2HVHA 4ECSA 1ZBTA 3KK1A 3DGVA 2V4JB 3LPYA 5CD4H 5BYQA 1QTNB 3OW2R 1UVMA 2AEJA 1U1NA 3GR0A 4YY3J 2FVCA 3MPUB 3IBWA 4NI2B 3VAKA 1RLCL 3PZPA 1VRUB 4P2FA 1SC4B 4PEOA 4KJIA 1FNOA 2RMLA 8RUCA 1N5YB 3M8QB 2YQ3A 3C66A 3BN4A 4M95A 3DLEA 1RYSA 2K1RA 3BDEA 2BZ2A 1UMJA 1YBAA 3BO2A 2U2FA 2J9DE 1IBLF 1DHMA 1YJTA 5F8LA 4M5MA 4K5SA 2DGWA 3O6QA 2D3ZA 3KUGA 3LGNA 2DGOA 3CGIA 4CWBA 3GV7B 2OPSA 1PBAA 1V5IB 2NS1B 2MSTA 2HWHA 2AX0A 4BWJA 3PW2A 2JZ5A 4Y0FA 2Z57B 2ZBCA 2ZWPA 1HD0A 2VG6A 1S79A 3I55S 4TU8A 3POTA 4FS1A 4HT5A 2WBMA 5KOXA 5C42A 2CJBA 3ITHB 2DT9A 1TKXB 4HACA 3CUNA 2HNDB 2FZKB 1XNRJ 1JB0C 3HD1A 3SFGA 3RBXA 1I6JA 1CC8A 4KPCA 2HBYB 4P7VA 1RTZA 1PYOB 2KXNB 1B64A 5I3QA 3B6BA 3SIPB 1L3VA 2KN4A 1H38A 4JI3F 4U9RA 1RT1A 2CPFA 2CYYA 3RRKA 2ZH9A 3M4XA 4P73A 1WACA 3DOKB 4F25A 2VICA 5HP1B 3FDSA 2KXFA 5HJYA 4WYWA 2HHHF 4QR1A 5LMUF 3PYGA 3OUYB 3NGUA 3G82B 4QWCA 4A8QA 4L6V3 1H2UX 2CWKA 2W25A 3OSPA 2W9BB 2J5AA 3AOAA 1GMUA 3ET6A 2ZE2A 3DHWC 1N88A 3SZ2A 3DLGB 2E7XA 3W2VA 5D4OA 4OZ3A 4AQYJ 2V63A 4DUZF 1RDRA 2XLJA 5D3GA 4Y3CA 1DTQB 3D3CJ 4YQWA 1S6UA 3AJDA 3HHLC 2F8EX 1WI6A 1PAUB 1RWPB 5HMZA 4IFYA 2GJ2A 2BW7A 5J2QB 1X9WA 2OPQA 3ZTOA 1O51A 4ZVHA 1S5ZA 5K14B 3KK2B 2E7WA 1LEOA 4P6QA 4U6PA 2UXCF 2JSXA 2YWEA 2XMWA 3OLBA 1BLUA 3PJWA 1Z2LA 4R25A 5BR8F 3R2DJ 2LXFA 2I9SA 4AE5A 4A4JA 2XTJP 4LIWA 1QVFR 2EFGA 2OPRA 2VOOA 5KG3A 2GS8A 3PW5A 5AXLA 1SUQB 1C1BB 2ZUAA 4NEYA 2R7XA 4DL6A 3NWGA 4GC7A 3C14A 3QIPB 3GLJA 2XMAA 4TNOA 2DNHA 1FVQA 2GJFA 2NZ4A 1RLDA 1ZAWA 4QQBA 1JLBA 5KFKA 4OYMA 4FS2A 1RSCA 1FKPB 1VQKS 2N82B 1TAQA 4X84A 2L08A 3T19A 1OPZA 3QATA 1HA1A 3L4BC 1D8ZA 1RTJB 3LGMA 5LXYA 4PXEA 1VI7A 2CWXA 2Z2MA 1JLQB 4EYIB 4UQGA 1BWVA 3THTA 2V94A 2AEMA 3RUBL 3BQ0A 1S1VA 4DFKA 3GZ7A 3M8YA 4Q7AA 1OPIA 4MKYA 2DNGA 2KH9A 4G1QA 2J0WA 3UD5A 1UCNA 2EFQA 4RNNA 3F73A 1UFWA 2BBEA 4DZDA 2V4QA 1EAYC 1JLEB 3KUEA 4ZVSB 2R7SA 3LOUA 2OFGX 2W2OP 4OHZA 4CLSA 1B0PA 5HBMA 2PE8A 4X64F 5D0RA 2FD2A 3J80Y 1UJ5A 4KKOA 5EWFA 1IR0A 3TW0A 5K8OA 4CQ1A 3SCKE 7FD1A 1R3NA 2DIUA 4RUCA 1K8AT 5GAEI 2AMCB 3SFUA 2OEKA 3LP2A 3QFHA 3MMCB 4CP5A 2K2PA 4FYDA 4ID5A 3GIRA 4PYDA 4CLYA 2H3EB 5JVHQ 1HWKA 3H7HB 1YBUA 3L7OA 1S12A 3H0PA 4DN9A 3M2UB 5SZTA 1L3KA 3SV3A 3BGRB 2F9JA 1N5TA 2I0XA 3IO1A 4DBQA 3HP6A 3M7VA 2VBWA 4N8NA 3D9BA 5HMWA 2FJAB 3KKFA 2RSQA 4O0IA 4NZ0A 1GH8A 1RABB 2PMHA 4IG3A 3H2LA 2VG5B 1EZZB 1HQEA 3AD9C 1JIHA 5IOLA 4P72A 3R5GA 5KFPA 1KVKA 2HQIA 1X4GA 4DUYJ 1S4FA 4ITSA 1S6QB 4NZ6A 1VMBA 4B3RJ 4B3SF 1XERA 4EBCA 1IN0A 1CPZA 4I7FA 4B9NA 4JYAF 5KAKA 3UVJA 3PYDA 2GC8A 2D41A 1RT7B 3A8KA 3UN2A 1CJUA 2CJQA 2OPPA 3GCWP 2DNYA 3P5BP 4DUTA 1EARA 4FXWA 1LWCA 1J2VA 1KP6A 3I0SA 1XBWA 1D8YA 1FT8A 1R0BG 3V5RA 2HMIB 3OL8A 3GJTB 1TL7A 3CCTA 3LH2S 3RJMB 1TV6B 2ZHOA 4AFFA 2CNOB 4LR9A 1RTDB 4UF4A 2G2ZA 4L74A 3C3LA 3WIUA 3HT0A 3OTEA 3ONQA 3MM6A 3ELHA 1S72S 3W5XA 3TQ1A 4M5JA 2B8QA 2AZ3A 4DR1F 3MCMA 1Y0HA 5AE2A 3OLAA 1FTRA 1HPZB 1X60A 2FIUA 5JVGQ 3AFGA 3VF0B 1TU0B 3S6EA 1F0XA 2GZOA 2RAQA 3NNHA 4Q2LA 4CI0B 5B08A 1WWHA 4DPOA 2FVQA 2U1AA 2PD1A 5A8WA 5IT4A 1NKBA 3PW4A 3TUJC 2XY7A 2QTWA 1LWEA 1TFYA 3QT8A 2KVIA 4LFAF 2ZBPA 3GYGA 5E3QA 5AE3A 4FVCA 2AQ4A 3CCES 1Y5IB 3TNVA 4RU2A 1S6OA 3BSOA 1T95A 1U7LA 1S48A 3CWJA 2F63A 3EVOA 2RHSB 3CJ5A 3AJ2A 4DR3J 2HFOA 5KFJA 2ZBIA 1N36F 4L76A 1WF1A 2PDAA 2CQ2A 4DPYA 2XO7A 3CE8A 2L3MA 1PGZA 3W8GA 2KJWA 3CJRA 3QJPA 4WTYA 3UWTA 3BO4A 3KNAA 2OSRA 5G0RA 4B9TA 3VAFA 2W7OA 1IBMF 2MJUA 4PXCA 2MQLA 5A6PA 2VA3A 4WKRA 1PBUA 2J7WA 1P9QC 2BKOA 3KJVA 3SSSA 1SQEA 4DQSA 1SL1A 1KLMA 4DLEA 4UOGA 3NKYA 2KTQA 4GKKJ 2C2ZB 1RAGB 1WI8A 5CXTA 1N5SA 2NUHA 4USHA 5T7LA 2GO8A 1XIQA 2W4CA 2KI2A 4ETXA 5IQ6A 4C98A 2P6TA 3D6TB 4LVNP 2B6AB 2CG4A 2GGPB 2G4BA 4C0BA 2MHNA 4IR1A 4LF6J 3RB0A 2HS3A 3D6MB 1FRMA 1U6FA 2HQCA 1XR7A 3DM2B 3ZZYA 2FJEB 4DSEA 3SSQA 4F50A 1D3WA 1C0UB 5CCLA 5HLFA 2CIMA 4LR8A 3MR5A 2QMUB 3MEDB 2Z56B 3AB4B 3IM8A 5L1JA 4F67A 2B8PA 1S10A 3GG0A 3NAHA 3OFEA 2ASJA 3NNCA 5LL6d 3R97A 3W8PA 1Q79A 2F4FA 2YWFA 4WZMA 2LVWA 1CBKA 1SH0A 1U45A 4RNHA 5KFLA 2A1BA 2I5JB 3EGWB 1RJJA 1TKTA 2F9DA 3UR0A 4J9LA 1X4AA 5H9EK 5U47A 3JSMA 4WIQA 2KHDA 4RO0A 4CH7A 3QO9B 3QLHA 3HXMA 4ECWA 1V5VA 1CJKA 1J5OB 4B9VA 2HW3A 5A8KA 1FWPA 1SPBP 3MF5A 3RG6A 2YPZA 1O5JA 3ICLA 3CD6S 1HNXF 3CSKA 3CB4A 5E33A 2QA2A 4ZPBA 3SMZA 3LWLA 3AXKA 2JEFA 1NDCA 3DOLA 4NI2A 1S9EA 2HQGA 1Q8IA 2R8HA 2NYIA 1XMOJ 2HYIB 5A0YB 1S6PA 2AF6A 1C0TB 3E3XA 2J8AA 4HEA9 3A3OB 4V19X 1JWWA 4B3TJ 1PG5B 4DV5F 3HCXA 1TL3A 4CO1A 2FDNA 3P8BB 4F3MA 2E1AA 2WBRA 4CO5A 1UJ4A 3R7NB 3V6JA 3W66A 3P49B 3M1VA 1S1WB 1VJWA 4DR4J 1E6VB 4B02A 2XG8A 4GVLA 2B7BB 1AA1B 1NKEA 3OR1B 3NAIA 1KLNA 3OFHA 3TAQA 3AAWB 4A8WA 4NA2A 1XR6A 2ZZMA 3BBBA 1JMTA 2P9CA 2DRAA 1RKJA 4PCQA 4WU3A 4ELTA 2WRMA 4ZLPA 4RW4B 2BJEA 2HGLA 1RT3B 3KXDA 4ZPTR 1WSRA 2HGMA 1PJ5A 1RBAA 2CVEA 1M5SA 4B3OB 5GAEU 3IR6B 1UVIA 2Z2LA 3CC2S 4P10A 4O4GA 3Q86A 2C3YA 4KPYA 1LWFA 2RJZA 4QPXA 3HSZA 1VQLS 2UVUA 4RW6B 2HNDA 1Q8BA 3CCZA 2GJIA 1Z4UA 1YBTA 2V68A 4F4WA 3QNWB 3G4SS 1UA0A 1RT5B 5CHCB 4R0JA 4M5HA 4HLBA 2DY9A 5CAAA 1MROA 2G13A 2GVZB 4XAKA 3DOMA 1RK8A 4CZCA 4GKJF 1BHNA 1NJWA 4H4OA 5KFSA 2MGZB 1MWQA 4A8XA 4BS2A 3FEYB 4MAKA 5HROA 5D4NA 2HPUA 1SQGA 5IT9U 2E9TA 1HWUA 3DLGA 1N8RT 4ZOSA 2YNHB 1YJNS 3JAMY 1K0VA 2QC3A 2Y1RI 1H74A 5D78A 1VIOA 2D3UA 4ECUA 5HANA 4FZVA 3OXFA 3IGVA 2DH7A 1KTVA 4LVOP 3TVKA 2RDJA 4OMFG 2HFZA 3KMQA 3ZTRA 1TFWA 2HEKA 2AP6A 3D0HE 4ZLJA 3U1LA 4B17A 3LAMA 3GTYX 2CJXB 4KT0C 3EZOA 4I4BA 3B4MA 4B3MF 3O8WA 1VQ6S 3THVA 4ZVUB 5A2QY 2IM3A 1ZS6A 2VHGA 1HHTP 1NK4A 2KM8C 1ZM3A 2YKNB 4DR2J 4K4XA 3GILA 3SCJE 4DLGA 4N76A 5ETMA 2VFVA 3BSAA 3PCOB 2LQ8A 4NWBA 3O2IA 5DM6Q 4NRTA 2Z4PA 3KJNB 1NZAA 2N3LA 3SQGA 5I4MA 3SYZA 2LQ5A 5MLCV 3ZZUA 1C1BA 4Q8FA 4NLRA 2YNIA 5CABA 1S1UB 2WCXA 4N7TA 1IJFB 2W7AA 1U1QA 4DR5F 2MY8A 2EK1A 1OYEA 3NGRA 1TUWA 2ZD1A 3K7RA 1NK8A 1OMSA 2LKZA 2KRBA 2L9WA 1WC5A 2FQQB 1YLXA 3PX6A 1GXTA 2V50A 4ED1A 4NYPA 2Y1JA 2HFNA 4CLPA 1FEEA 1HQ2A 5KFWA 3JXOA 4PG8A 1FRKA 3H4BA 2ASLA 4C11B 1MMLA 1H2TZ 1PJ7A 1GX6A 1OSDA 3DC2A 5LXRA 5IZHA 4YUDA 3CXCR 2RNEA 4ILRA 1F1BB 1L3TA 2QEXS 4CTAA 2XSJB 2XZTB 1S76D 1MW7A 5DG8A 2H1YA 1H98A 2GHVC 4QZVB 1NSKL 3HJVA 1YRUA 3PO5A 1X4FA 4OJ3A 4GMKA 3NY0A 1TKZA 3TEGA 1NPPA 4NYOA 2E1MC 2DNQA 2CPEA 2GQCA 4N47A 1N56A 4ZK7M 5KFRA 4ZCKA 1FDDA 3FRYA 4OX9J 2VJVA 1V3SA 1ZAVA 4IRCA 2IDEA 3CCSS 5HQMA 1XMQF 4WPAA 4ES3A 3G6ES 4B9LA 2KXHA 1ZTTA 4M94A 3CCVS 4ZIWA 5E2QA 4D3HA 3BF4A 4JI3J 1HQUA 4RL1A 2Q66A 1FE4A 1Y7PA 2ZM6J 1S99A 3HSJA 2KU7A 2ZH5A 2XYPB 4X4RA 1GFWB 5DG9A 1K47A 3M6VA 2HHHJ 4DL0C 2POKA 2W4PA 3TARA 3M2UA 4AXJA 3MFIA 5LJ3Y 1PYSB 5H9EJ 2B7CB 2YWKA 4QPTA 4TLQA 3WZ0A 4DF8A 2CPXA 3NBPA 5HMXA 3PIPQ 1GMWD 1XTZA 4DUZJ 1NSAA 2CJYB 1XNQJ 4NXMF 5HSPA 3ENAA 2QFIA 2VG5A 1SH2A 1CEZA 5F41A 2VJUA 4DL4A 2IHR1 2D7SA 4U8YA 2BE9B 3N01A 2XS7A 1S6QA 5CZVA 3QGHA 2BE2B 2F40A 4AL7A 1WEXA 1QJHA 5C25A 4RW9B 5KG0A 1RT7A 4ED8A 3TX8A 3J81U 3MMBB 5KFQA 5CYQB 1P9YA 3FSYA 2DGXA 4X4UA 2MZQA 5HQLA 2GFFA 3E01A 1ZZNA 2WZ1A 3S01A 1G1XA 4M5GA 3TVYA 1IBKF 4J37A 4ILLA 4LUBA 3AODA 2PEBA 2DH9A 3J81j 1TV6A 3LWMA 4ZVPB 1RTDA 2F5GA 1U09A 4XK8C 3UD3P 2HHUA 5KTQA 3RU0A 3GSDA 2W2NP 2NXEA 2L48A 2IMWP 1GK8A 2ABYA 1UWBB 3TR5A 1FWKA 5LSRA 2RILA 2CQ3A 3NXZA 3LA0A 3UNGC 2RU9A 1E6YA 3FQKA 2W2PP 1KBRA 4DQQA 2VPWB 4PUOA 1RADB 5CZXA 2RDIA 2F1FA 3IP0A 3RGIA 1KWMA 4NCGB 1X9SA 2C2NA 4TQSA 4EMDA 3T3FA 1WC1A 1VHIA 3CDAA 2Q3PA 4A46A 1PCAA 5ETOA 4DSKA 3BEGB 1QAIA 5DQGA 1KVJA 4WFZA 3KK3B 2HBRB 2HKEA 2HNZB 3BSNA 2W8KA 3R1HA 2FTRA 3N6NA 3MMAA 4EYHB 2XMUA 1AT1B 4CH1A 1T9VA 5D4PA 4F2RA 2FHMA 2Y1IA 1UWAA 3MZIA 2MKIA 4CT9A 2J8SA 2YVSA 2J9CA 5IT0A 4KGXB 4UW2A 5IV3A 5L9NA 1S0OA 3D67A 1KSPA 1G6BA 2JX2A 2UU9F 1AYEA 1AFJA 4I68A 1PC5A 3BGUA 1UP1A 1FFSB 3BS9A 2WVEA 3D1OA 2KT5A 2ZH8A 4NA3A 1FFWB 3CEDA 4F4ZA 3MEKA 4QW8A 4IDKA 1U2RA 3W3SA 1RA6A 3G2XA 2FVRA 2ZFHA 4MIBA 4QWEA 3RBDA 2W2QP 1KQSR 4USMA 2GGPA 1FTCA 5IM0B 3PEJA 3PVXA 3C46A 2V8VA 4RW8A 3AJ1A 4CLZA 3RZAA 2GMJA 4DSLA 3SSRA 2ZOGA 5L46A 1Y11A 3KLIB 1XNRF 3DRSB 1YRXA 4ANDA 3QJJA 3BSCA 1C0UA 2V2KA 2P8IA 4K7QA 4BBYA 2V2VA 3QRPA 3GR1A 3VHQA 2NPIA 1R0CB 1NZ8A 2E29A 3MEDA 4B9UA 1HNWJ 1HNIB 2RE1A 4FF4A 4DPXA 1FRHA 1TK0A 1HFEL 4DEZA 3DDKA 2P9EA 3W2WB 2RDDA 1Y3JA 4K4ZA 5ETSA 1N6QB 3R9LA 2J7KA 2R8KA 4Q2MA 4JI0F 2HVZA 4MFBA 3MM8A 4RNOA 1WDDA 4FPRA 1OSCA 3EUNA 4JI4J 3AHPA 2IM2A 2I8EA 1OQ3A 2CZ4A 3F44A 2ZOFA 4RJVA 2JVOA 4ED0A 3BV8A 4K0KJ 4TLRA 4DFMA 1S57A 4F4XA 1U8WA 1HBUA 2GAGC 2QIFA 2ROEA 2HQDA 3UQSA 5E7OB 2KDOA 3PJ9A 4QWDA 3WHIA 5DLFA 5A8RA 2LQ9A 4NL5A 1H2VZ 4AYBD 4A48A 4GRSA 2YKMB 3BH6B 4PYAA 1LW2A 1IVZA 2AIRB 3JQMA 2N4DA 2EK6A 4YR2A 1QVGR 3LALA 1HLWA 1K73T 1RWKB 1S1WA 1IKYB 2YX1A 3KK1B 3GQCA 3UN3A 1E6VA 1QE1A 3ENWA 2C28A 4F2SA 4ZJLA 2VV5A 7FDRA 2AKWB 3ZNUA 3FJ2A 2P2CB 2W9CB 3EPIA 3W61A 4NLSA 2HFSA 2QLFB 2XWYA 4RW4A 2OD4A 2YPYA 9ATCB 3CTRA 1QD1A 5J2PA 3MTKA 2K1RB 4JB8B 3TUZC 1IR1A 1TL1A 3OTBA 1FKAF 4J9UE 3HHDA 1WHYA 3S8SA 4TYAA 3M2RB 3GPAA 3RB4A 3GE9A 1FJGJ 1LNQA 1WTFA 1K0TA 2VDIA 4Y2AA 2B4OA 2ZEJA 5HI7A 3MOJB 1ZH5A 2XI3A 4Z7YA 2I38A 4QIGA 4O44A 1NBEB 3P6YC 3R5CA 3BPDA 2AYEA 2OPSB 1NXIA 2UXBJ 2CPHA 1TVRA 2BE7D 3CJTA 3NNAA 1FESA 2V8HA 2HS0A 5DDPC 2YKPA 2VG6B 1N32J 3POTB 2AT1B 3N6LA 2VQFJ 3GCXP 5EX0A 2MGZA 1YK9A 2R8GA 4HACB 2FGCA 1VGYA 1EKRA 3HDSA 3QIDA 3NL0A 3FSXA 2C2EA 3IS9A 4TXSA 2DR8A 3HI9A 1YI2S 4NPOA 3PV8A 2LEAA 2HVDA 3F56A 3V6HA 3ISZA 3M6UA 4OQJA 5KFFA 4I6WA
chains in the Genus database with same CATH topology
3J7YI 1JLQB 2ZHAA 4EYIB 1DLOA 1NKCA 4UQGA 1EP4A 2J0XA 4ED5A 1RT1B 1G2EA 1FD2A 2AYBA 1CQNA 5K8NA 3D5MA 3P96A 3A8EA 2ZNZA 2KZZA 1C1CA 2DHSA 4OX6A 3THTA 3KG0A 2HMIA 2V94A 1VQNS 2UVVA 1S1TA 4UUXA 5A8RB 2XULA 1HR0F 3TA0A 1P1LA 5DDRC 1LXNA 5F3ZA 2F3JA 3BQ0A 1N0UA 4NZ7A 3CPWR 1FRLA 2CQBA 4NX9A 1NK7A 3X1LB 1S1VA 1KHWA 2E5GA 4DFKA 3D1HA 3GZ7A 1AROP 1LW2B 4XO0A 2LDIA 1WF2A 2WSCC 3BGFA 4JI2F 3VZIA 1R31A 4Q7AA 1NB7A 4NRUA 4DV2F 1OPIA 2IJFA 2K7KA 3I32A 5KT3A 4MKYA 2HHWA 2DNGA 3U7JA 2KH9A 3OVAA 1B0VA 2J0WA 4G1QA 2VZ9A 2RF2A 3MUVP 2EFQA 3G8TA 2BV3A 4RNNA 3F73A 4U67Q 1LK7A 2MZTA 1UFWA 1JX4A 2BBEA 1VC6A 2V4QA 4DF4A 1IKXA 1C2PA 1JLEB 1T3OA 4C3LA 1DURA 2LU1A 3HKZD 4KFBB 2R7SA 3LOUA 2VPXB 2OFGX 3W2VB 5AE1A 3MM9B 1SIZA 2DJWA 4OHZA 1NH8A 3CDWA 1DZ5A 4I1TA 1B0PA 1KQFB 5HBMA 2PE8A 5EHHA 1HPZA 5I3UB 1QE1B 4NLQA 3IC1A 4X64F 2J0SD 2V0NA 1X9MA 2L41A 2FD2A 3J80Y 4WFAQ 1YRTA 1UJ5A 4KKOA 5EWFA 3VAHA 5D3GB 1VQ9S 1IR0A 3TW0A 5K8OA 5MAOA 3QJLA 3GB0A 4WE1B 3DLKB 4CQ1A 3FGVA 3SCKE 4IRKA 1FKOA 3L7PA 3QYYA 2NSBA 7FD1A 1R3NA 2DTJA 2DHAA 2DIUA 3MD1A 5F3TA 5THWA 5KG6A 5KFHA 4F3OA 2RB7A 2UUWA 4RBTA 3KNGA 4WFXA 4DL2A 4RUCA 2KJVA 1Q78A 5K8MA 4ATNA 4C3MA 2YH1A 4DR7F 4RZRA 2DD8S 4IFYB 1K8AT 1R6YA 3QGGA 5ADZA 5FD1A 1W2BR 4RU9A 5GAEI 3J81Y 5E41A 3NGDA 3SFUA 4AL6A 2OPQB 4HL9A 3LP2A 3MMCB 2OD6A 3I9V9 3RB3A 2B4UA 3R5AA 1Q16B 4ZS6A 2FB0A 4X2BA 2K2PA 5HO4A 2D9PA 2ZJPQ 4FYDA 4ID5A 4DUYF 3PJXA 4KGMA 4PG5A 4ES2A 5J2PB 2HHXA 3T5HA 4B3RF 1SC6A 5JVHQ 1HWKA 2MZSA 1Q4RA 4IQMA 3DGPA 1RTIB 4J9NA 3TVZA 4K50A 3L7OA 1TL1B 3I9ZA 4DN9A 2DNKA 1HBOA 4Y2KA 3M2UB 4P2SA 5SZTA 2RU3A 1L3KA 1JXLA 3SV3A 2CPJA 1SJQA 1M5VC 3BGRB 2F9JA 4YDDB 1S0VA 1N5TA 1T3NA 2HZCA 3TA1A 2I0XA 1HI0P 1MSWD 1BQXA 3IO1A 3G6YA 2BM1A 2CFXA 3VWSA 4DBQA 4YY3F 3GV8B 4EUVA 4IG0B 4U7CA 3LW5C 4PKDB 5LSLA 1NK0A 3RR8A 2XMMA 3HHEA 4JBCA 4LSLA 3HP6A 3ZC4A 3DRXA 2VBWA 3CO9A 3SV4A 4N8NA 5HMWA 5BYRA 4RUAA 2FJAB 2HVIA 2UV8A 2XS2A 1FDNA 3KKFA 2OPRB 2RSQA 2W9AA 4O0IA 4O44B 2CZVC 1N48A 4EO6A 3V81A 1N0VC 4O3RA 4IO9Q 2BRKA 5F8GA 4NZ0A 2V4RA 1GXLA 1MWYA 2MHEA 1M5HA 4ZA1A 1GH8A 1HL6A 3RB6A 2XY5A 2NSCA 5LSOA 4DFJA 2PMHA 4IG3A 3DXSX 3GFXA 4RLEA 3H2LA 5HL7Q 2YX7A 3FCHA 4C11A 1UFLA 1ZAXA 5LT5A 2C3PA 1TVRB 2VG5B 1PO6A 3M32A 4CNZA 1HQEA 4R5PA 1FDBA 4LFCF 2ZKTA 1JIHA 2CJKA 5KT5A 1NJIT 2DCLA 4MYUA 3Q22A 4Q44A 5KFPA 1VQ7S 5L39A 3T5JA 2IA6A 2HQIA 1X4GA 3MEEB 3WBZA 4NLXA 3TANA 3BM7A 2LYVA 1S4FA 3FNNA 4ITSA 5EX3A 1S6QB 4NZ6A 1VMBA 2EFVA 3RAXA 4OZ1A 3TAPA 2XSJA 4B3SF 1XERA 3K5PA 5GAGI 4I6YA 1X0FA 1JLBB 4EBCA 5DGAA 4QYZJ 1IN0A 4NLYA 1CPZA 3DXBA 3BN7A 3T5LA 4DFPA 4DL5A 2X1BA 4I7FA 2DK2A 4ED3A 4B9NA 2OAUA 2IFXA 3IWLA 1BQMA 5GAHU 2R2UA 4JYAF 5KAKA 2ROGA 2DGVA 3IS9B 2GC8A 5F0UA 2D41A 1P6TA 1FD8A 1RT7B 1D9AA 1R89A 1QY7A 3PHEA 5F8NA 2L9NA 4G1IA 4MK8A 2CJQA 2OPPA 5A6WA 1N52B 3V6DA 1KVIA 4OHYA 1JKHB 2JDJA 4UY85 2LU2A 2DNYA 2MSSA 2FLLA 4F4KA 3QWPA 3IR5B 4FXWA 3DYAA 1RP5A 3AB2B 2IC3A 5F9LA 1DLOB 1LWCA 3TP2A 2J6UA 1J2VA 1TUVA 3I0SA 2IBKA 1EP4B 1HWIA 3OTOF 2MKCA 1XBWA 2VFUA 1VHFA 2EPIA 5IXUA 3I0RA 4NA1A 1LW0A 1C1CB 2PMZD 1WTBA 1D8YA 1FT8A 2HMIB 3LANA 3V5RA 5DGBA 1S1TB 3OL8A 2VPYB 5E0OA 5CCMA 2H5EA 1O0PA 3CCTA 3LH2S 4IUFA 2B6AA 1X7VA 1TV6B 2P5VA 2XMTA 2J0QD 2ZHOA 1OQ6A 1S1VB 2ROPA 3NLCA 5B0GA 4AFFA 1FJEB 2O66A 4X65F 1XMBA 1HARA 3PX4A 1RTDB 4OI1A 3RAQA 3TOQA 3HVAA 2LECA 4O3PA 5B7WA 1RT2B 2ZOMA 1J5EF 3ISND 4FF1A 1L3SA 1KHVA 1ELOA 1T94A 4G1QB 2WONA 2PSZA 4V19J 3I5AA 3DM2A 3VTIA 3CDUA 3J7Z5 3C3LA 2B43A 2RF2B 5DETA 2GQQA 2XI2A 2FVPA 4QIVA 5KFIA 1N4LA 1VQPS 4LF8F 1EETA 3OTEA 3ONQA 3MM6A 1X4HA 2Q79A 1S72S 3MECA 3U1MA 3TQ1A 3PY8A 3OR2B 3JSBA 4DR1F 1FRJA 3MUMP 1ZTWA 5JJBA 1Y0HA 2C3MA 5AE2A 3OLAA 5HBMB 1LKZA 1FTRA 1HPZB 3E51A 3HX9A 2EG2A 2FIUA 4KKOB 2JFKA 4WIIA 5JVGQ 2I1RA 3VF0B 4DR3F 3EYZA 4TU7A 2IVFB 1F0XA 3S6EA 3Q8PB 3L3CA 3S7RA 1UEVA 3AQPA 3VQTA 3NNHA 1FKOB 4Q2LA 4IRDA 3MM7B 2PFFB 1YJVA 2Q43A 4FNHA 4CI0B 4G1PA 2HG4A 4ZP9A 5B08A 3HHNB 2XBPA 1FXRA 3KLHB 1CVJA 1WWHA 5GMKa 4DPOA 3HVWA 3NMRA 3ENVA 2FVQA 6FD1A 1Q86T 4DQPA 1UVLA 5E3CA 2U1AA 2GMLA 2PD1A 5A8WA 5IT4A 5AXNA 2YH0A 3PW4A 1NKBA 4LQ9A 3TUJC 4ZDNA 2FJBB 1MWZA 2XY7A 2I5JA 1LWEA 1TFYA 2IAJA 3LP1B 2KVIA 2XY6A 1ZM9A 4EFAC 4X4VA 3GIMA 4LFAF 1ZETA 4C8LA 5D77A 3P3DA 5C24A 4EO8A 2XGQA 1C4CA 2AYMA 2MYFA 4DOZA 5E3QA 3H98A 5AE3A 4FVCA 2AQ4A 1Y5LB 2AX1A 4OI0A 5EN1A 3CJ0A 3QO9A 5IS2A 3CCES 5EUHA 1QAXA 1Y5IB 2WW8A 1AXQA 3M30A 3TNVA 4RU2A 1HBOB 1VQSA 3JTNA 5KG4A 4ZPAA 1S6OA 1J5OA 3Q24A 4HHJA 2CQ1A 3JSYA 3BSOA 1T95A 2WSFC 4KE5A 1B7FA 3DI6B 1YGYA 2E44A 3MDFA 5CH7B 1GTEA 4I64A 3GIJA 1U7LA 3N79A 4AQYF 4ECYA 2DB1A 1S48A 1M0SA 3CWJA 1BWEA 1RQ0A 2E5JA 4OZJA 2UP1A 4GKKF