1U1QA

Crystal structure of up1 complexed with d(ttagggtta(di)gg); a human telomeric repeat containing inosine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
183
structure length
183
Chain Sequence
b'KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*GP*GP*GP*TP*TP*AP*(OIP)*GP*G)-3'
molecule tags Transport protein/dna
source organism Homo sapiens
publication title Human UP1 as a Model for Understanding Purine Recognition in the Family of Proteins Containing the RNA Recognition Motif (RRM).
pubmed doi rcsb
total genus 50
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1qA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1qA02
4UQTA 2DIVA 1P1TA 1PGZA 2FY1A 2KXHA 2PE8A 2FC9A 1DRZA 2XS7A 3MXHP 3BEGB 2N3LA 5GAHU 2HVZA 4WFAQ 1N8RT 2E5GA 1L3KA 2MZJA 2Q79A 1QVGR 1H2VZ 2DH8A 2DNRA 1U2FA 2QEXS 2MZTA 3SXLA 1U1MA 3CCUS 2AYMA 1XN9A 3MDFA 4ERDA 2FHOB 2MQPA 1VC6A 2ADBA 2ZJPQ 1FHTA 2DGUA 1H6KX 1WWHA 3J7ZT 2JWNA 4A8XA 1IQTA 2QFJA 3Q2TC 3VAMA 1F9FA 3UCUP 2FPHX 2KM8B 4LIRA 3R1HA 5LJ3Y 1UP1A 2G1DA 4QU6A 2UP1A 1FXLA 2E5JA 2LXUA 1SJ4P 2DNMA 2DNKA 5D78A 1WI6A 2M8HA 2YH0A 3ZZZA 2KH9A 1VQ7S 2XSFA 3OW2R 2CJKA 1YIJS 2AYGA 1FJCA 1VC5A 1X4CA 1JJ2R 2G4BA 5CXTA 2MJUA 1CVJA 3MD3A 2CQ1A 2N82B 1KOOA 2DGXA 3I55S 3PIPQ 2QA4S 2MQOA 2F3JA 1U1OA 1X5SA 1WF0A 1W2BR 1RK8A 1VBXA 1DZ5A 5JVHQ 3G8SA 4TU9A 2YWKA 1VBYA 1WHWA 2MKHA 4FXVA 2DIUA 1WI8A 3Q2SC 2LECA 1R8HA 3EGNA 2N3OA 2KU7A 4TU8A 3CULA 1FJEB 3R27A 1WEZA 2ERRA 1X5TA 2RS2A 4QPTA 3UCGA 3DXBA 4YB1P 1A7GE 2MQQA 2MYFA 3FEXB 3S01A 3G96A 3MUMP 5LXYA 2RU3A 2KXFA 2GHPA 2DNNA 2XB2D 2LKZA 1VBZA 2DISA 4EGLA 1M5OC 2DHXA 2LCWA 1X4AA 4Z2XA 3THPA 2MMYA 5EN1A 2HGNA 2DNHA 3J7YU 2WBRA 1WELA 2MKIA 2ADCA 2LMIA 1WG4A 2J76E 3CCLS 1M1KT 3RW7A 4P6QA 5IFMA 2OSRA 2LYVA 4WCEQ 1U1LA 3THTA 1VQKS 2DGSA 5DDOC 1WHYA 1X4GA 3B4DA 1QM9A 2MGZA 2DNOA 2KI2A 5LSOA 1WF1A 4TLQA 1G2EA 2X1GA 3BS9A 2KM8C 4WKRA 1DBDA 2JVRA 2I38A 2MJNA 2CQ0A 1ZZFA 2D9OA 2OIHA 2M9KA 1VQMS 2KXNB 2DHSA 2MZSA 1S72S 1ZH5A 2CPZA 4QQBA 3G9CA 3CCRS 3UWTA 1OPIA 2HGMA 1VC0A 1HD1A 4C7QA 2U1AA 3SMZA 2KG0A 3NNCA 2AD9A 2CPXA 2DNLA 2MKSA 2RQ4A 3CTRA 2DNPA 2DGWA 4LMZA 3TYTA 2EK1A 3HI9A 1U6FA 3CF5Q 3S6EA 3MUTP 3CCQS 3G4SS 1M5KC 3D2WA 3MURP 3R1LA 4OZ0A 2J8AA 2M4MA 5D77A 1PO6A 2DB1A 1YWXA 3NNAA 1X0FA 2XNRA 1U1RA 2RQCA 1X4HA 1Q86T 1ZZNA 1JMTA 3CPWR 5FJ4A 3P5TL 4PR6A 2RNEA 1HA1A 2HYIB 2MY7A 2L41A 4C4WA 1Q82T 4ED5A 2CQBA 2KT5A 4C0OC 4YUDA 2E5HA 3BO4A 1OO0B 2AYEA 3NS5A 5MLCV 1VQ4S 4W92B 2M2BA 4IUFA 2DITA 2MKJA 3CMAS 3CXCR 1N88A 1X4EA 2YTCA 3U1LA 2NLWA 2OTJS 5LJ5Y 2VOOA 1VQOS 2MXYA 2EVZA 1KD1T 1H2TZ 3MUVP 4V19X 5LXRA 5DDPC 4IOCQ 3P3DA 1NO8A 3S8SA 3VAIA 2B0GA 1UFWA 2M52A 4BS2A 2PEHA 2DNGA 2CQPA 5DM7Q 1Q81T 2G0CA 2RVJA 2HGLA 1YTYA 1SJRA 3SDEB 1BY9A 2DNQA 2VOPA 4CH1A 3CC4S 1OWXA 4J5OA 2J0SD 4IO9Q 5IM0A 3V4MA 2EK6A 5GVQA 1SJFA 4F26A 2L9WA 4FXWA 2D3OR 3JB9k 3NMRA 2RRBA 2ZJQQ 1M90T 3RW6A 2MZ1A 1K73T 2FC8A 1X4FA 2DNZA 5GADU 3VAFA 3VAGA 2L08A 2RT3A 2ZJRQ 5DDRC 2DHGA 2CPHA 2MKKA 2YKAA 2MY8A 2KG1A 2K3KA 2LA6A 1U1NA 1R8PA 3DLLQ 2XS5A 5CYJA 4CQ1A 1YITS 2M8DB 2KFYA 1FJ7A 1D9AA 2RS8A 1WTBA 4OZ1A 1URNA 2KYXA 1A9NB 4M5DB 1NU4A 1OIAA 5H1SV 2CQ3A 1JJ4A 2OTLS 2YH1A 1VQ6S 3MD1A 2OJ3A 1X5PA 2X1BA 3BO3A 3VAKA 1VQPS 2CQ4A 2JVOA 4WFNQ 2XS2A 3MOJB 2KHCA 1VQ5S 1U6BA 1P27B 3P6YC 2MKCA 5LSLA 3CC2S 2MGZB 3H2UB 5JVGQ 1RKJA 2F9JA 2OSQA 1YJNS 5GAGU 1YJWS 1K8AT 2KN4A 2KRRA 1U1KA 3NNHA 2I2YA 2CQIA 2GO9A 2RUGA 2X1FA 2J0QD 2CPIA 1N52B 1WEYA 3ULHA 4F25A 5IM0B 1WHVA 2D9PA 3CMES 2LXIA 5HL7Q 2VODA 1U1QA 2U2FA 3SDEA 2DHAA 2MB0B 3HHNB 2BZ2A 1O0PA 3U1MA 1FNXH 2MQLA 2CQHA 3UD3P 1X4DA 3G8TA 1H2UX 1X4BA 3CCMS 2F9DA 2MZRA 3G6ES 2RRAA 1KOHA 2MSSA 3EX7B 3CD6S 2N7CA 3CCVS 3UD4P 3H2VE 4F02A 1K9MT 2V94A 1YI2S 2MPUA 1WG1A 2DH7A 2DGOA 3K0JA 4QU7A 2E44A 2CQ2A 2O3DA 1WF2A 5HO4A 1M5VC 1SJ3P 3ZZYA 3VF0B 2XNQA 3VAHA 2CPDA 4Y0FA 4RU2A 3CC7S 2K8GA 4WFBQ 3TO8A 2X1AA 2CPJA 5DDQC 1KQSR 2MSTA 4WIIA 3BO2A 1B7FA 2LEAA 1WHXA 3CCES 4W90B 4CH0S 4Y00A 3N9UC 3UCZP 2M0GB 2DO0A 3VAJA 1UAWA 3PIOQ 2M7SA 4YOEA 3B4MA 5CA5A 3CCSS 2NZ4A 2LA4A 2DGQA 5DETA 3TP2A 1X5OA 2DGTA 2MQMA 2CQDA 1KC8T 1AUDA 2AYBA 2VONA 1QVFR 1HL6A 2KRBA 1N54B 1VQNS 3CUNA 4LJMA 2LEBA 5GAEU 2M70A 2CPEA 2CPFA 1SJQA 2DGVA 1FT8A 3UE2A 4TU7A 2LQ5A 3US5A 1D8ZA 4WF9Q 3L3CA 3G71S 2A3JA 2DNYA 4PKDB 1UW4A 2M88A 2JRSA 3CCJS 2BOPA 2JX2A 2SXLA 2DK2A 5ITHA 1M5PC 1Q7YT 1JJHA 2HZCA 3FEYB 1FO1A 1DHMA 4U67Q 5GMKa 2CQCA 3LQVA 2DO4A 4UY8T 5DM6Q 1VQ8S 1WG5A 3MI7X 1HD0A 1VQ9S 2MHNA 2E5IA 1S79A 3I56S 1VQLS 3LPYA 3NS6A 2CQGA 1NJIT 2MZQA 3S7RA 3P49B 1YJ9S 2MQNA 3IRWP 1YHQS 4ZKAA 3IWNC 5IQQA 2KVIA 4PRFA 4CIOA 5BJRA 2CPYA 3EGZA 1U1PA 3VALA 2DH9A 1SXLA 4IOAQ 1WEXA
chains in the Genus database with same CATH superfamily
3WIVA 4UQTA 4JYAF 3WDOA 1P1TA 4LBPA 1UWAA 3BQ0A 2WVBA 1PG5B 1LNQA 2EXUA 2HQCA 2FY1A 3IBCB 4UF4A 5KG5A 2PE8A 2YNIB 3AXKA 3UQSA 3DFEA 2XTJP 3BEGB 1F3FA 2QYGA 4YB7A 3R5DA 4WFAQ 3V4IA 3RB3A 1TK8A 1CULB 2GAHC 3AXMA 4RW8A 1L3KA 4FKXA 3DOKB 1H2VZ 3O2IA 5IOLA 1XMOF 1ZYQA 4R5PB 2GW8A 4DV5J 1DQ9A 3I9V9 2GJ2A 1JLEB 1YVFA 2PEBA 1MU2B 5J1EA 3ILIA 2QEXS 1SKSA 2HBYB 3DOMA 3G87A 2MZTA 4IYQA 4C8ZA 3SXLA 1FX4A 3MAQA 3RU0A 1Q5YA 3HX9A 4MAKA 5AE3A 2IM0A 2V4JA 3MDFA 1YRUA 4DU7A 2FHOB 2MQPA 3PEHA 4ERDA 2ZJPQ 4HHUA 4I69A 1URRA 1BMQB 1FWKA 2YKQA 2DGUA 4EBDA 1WOSA 4F0HA 1WWHA 1HMVB 4QBUA 2GHVC 3J7ZT 4CNYA 4TY8A 3GV8B 3T1YJ 4J9LA 2IM3A 4NYZA 4O3OA 1R8BA 3PM9A 4KV8A 3VAMA 2B5JB 4ANCA 2G13A 1VQYA 2WBMA 4Y28C 4DPWA 4JI6J 3OL6A 3MPVA 3JSMA 4EO6A 3UCUP 3DLHA 3W63A 3H25A 2GIFA 5J2QA 3GLJA 4PCQA 4DUYF 1CJTA 5JUMA 1I3OB 2G1DA 5J2NA 4F8RA 4JI4J 1Y3KA 5B7WA 2QJ3A 3Q8QB 2Y8WA 3CEDA 4QU6A 4G1QA 1FXLA 4ECQA 3MECB 3OBIA 5MAOA 1SJ4P 4Z7CA 3H5UA 3TX8A 2V2ZA 4LF7F 1MROA 2P6TA 2BX6A 3TA2A 1QSYA 2RILA 5KG4A 2KH9A 1ROFA 4UOCA 2QN6B 1S97A 3ICLA 2XSFA 1T05B 1V3ZA 3LUYA 1W26A 4CLPA 2C22A 2P6SA 3M2RB 4RBTA 2E7WA 5KFNA 3OJSA 1XMOJ 2IDLA 4KGMA 4Y2CA 1VC5A 1FJCA 3QJJA 1X4CA 3BH6B 3FCVA 2C2DA 1RT4B 2HQGA 5HQ8A 4GO7X 2G4BA 2ABYA 4K4TA 1EETB 2JL9A 4PWUA 3TUIC 4A4JA 1KOOA 2DGXA 3CJQA 3TANA 3MM9A 1KEKA 2GO8A 1T9VA 2CZ9A 1VJWA 3FBCA 3FBBA 3DOKA 2PMWA 4DPYA 4JI0F 2DTJA 4O3RA 4Q43A 1DZ5A 2OEMA 3JS9A 4C98A 4EEYA 3M1VB 3OSNA 2HFNA 3GIKA 2DR7A 4ZPCA 1S4EA 2P5VA 2RUSA 3DLGB 4HYKA 1C2PA 1HI8A 1T9YA 3KHGA 4NLPA 1S12A 4M94A 4FXVA 3JXOA 2DIUA 2YWEA 3IBFB 4GRSA 4PYAA 4KPCA 2LECA 3EGNA 1GMVA 2KU7A 1JLFA 2HG4A 2GVDB 3HHLA 3MWBA 2EG1A 1RTDB 2R7TA 1RYSA 3R27A 1FF2A 2ERRA 3CW2C 4I6WA 1X5TA 2HZAA 3W3SA 4Q2MA 3IG1A 1IQZA 3DHWC 4KQZA 5E33A 3HVTB 2H65B 2Z8QA 1QSSA 4FYXB 2YVSA 2MYFA 3ISNC 1RT3A 3ENAA 5IWAF 3OTOF 5DQHA 1FKOA 3IS9A 3D0HE 4DUZJ 2B9WA 2DNNA 4URQU 1NK5A 2OH2A 1XNQF 2IPOB 4HI2A 3LO3A 1PYOB 5L1LA 1VBZA 1UVNA 2ZE2B 2BM1A 4IO1A 4PXEA 4P2FA 3DOLB 1BQXA 4IKAA 2W2MP 1X4AA 3GE9A 3B78A 3EJMA 2BV3A 3KUEA 1OQ6A 1XMBA 3HXMA 3HVRA 2E7VA 4NI2A 2DNHA 1GXUA 1F5BA 2IBOA 5AXMA 1WACA 5D6GA 5A8WA 5D0RA 1TKTA 4JUZA 3FQLA 2G2ZA 4GKKF 3CMQA 3SZ2A 1IR0A 2J76E 3RAXA 1KSPA 2MDAA 2HWHA 5IFMA 5K20B 4DQPA 5J1NA 1U26A 4B9MA 4CRJA 3QIPA 3OT9A 4ZVQB 1ZAWA 1VQKS 4AL5A 2DGSA 3TQ1A 3QLHB 3EDQB 1ZBTA 4NEZA 2N4CA 5H9FJ 1TL4A 5DDOC 1IBKJ 2A0FB 8ATCB 1L3SA 3SFGA 1R27B 4UZBA 1RAEB 2YKMB 1FD8A 1TZ0A 2KI2A 4MYTA 2G1HA 2WVDA 1WF1A 1F3VA 3ISND 1U6ZA 4TLQA 4YB6A 3BN4A 1FKAF 3BS9A 4MIWA 1CC8A 1GNKA 3GU0A 4WP3A 4DR4F 2JC1A 3QNWB 3DLBA 2FHMA 5F8LA 4QWDA 2ZH7A 4J9QA 3ELHA 2OIHA 1NSKL 1KQKA 2R3VA 2VKRA 1HLWA 3DLEA 5HQMA 5EWGA 4AYBD 3V6HA 4DF8A 5F0UA 2EEYA 3T1HJ 1N36F 4DSFA 4L3NA 4DR7J 2MEWA 3MEDB 2J0WA 2RE1A 3G9CA 3UVJA 2VFTA 4P2XA 2JH3A 3DOLA 4RW7B 2ASLA 1HD1A 2KL8A 4DFMA 1PAEX 5A8RA 4I2QA 1TUWA 4NLRA 4ECYA 1S77D 1JLGB 2ZZTA 1PBAA 2AGPA 4YEAA 3ONQA 1A0OB 2WONB 2IRYA 2QO3A 4JI8J 3I5CA 2ZH3A 1TL1A 3HJVA 2NPFA 4AT1B 2XMKA 4UOHA 4DI6A 1RTZA 5KFUA 1YBTA 2VG5B 4N47A 2OHDA 3J80U 5L38A 2XO6A 3CF5Q 2ATLA 3S6EA 3MUTP 1HBOB 1K1QA 1T9XA 3HHLD 1RTIB 1M5KC 1M5HA 2W7OA 1VK8A 5H9FK 2K7JA 1UFLA 4MMOA 3MURP 3R1LA 3RB4A 1RTHA 3CJKB 1S7HA 1R0AA 1XC9A 2KKHA 1RT1A 2M4MA 4JBCA 4ES3A 1KQFB 1T7PA 2V4QA 2V68A 2HK2A 4Q7AA 3LP1A 2XNRA 4AXIA 1JLAB 3JTOA 4L3KA 4UW2A 3KMSA 1JB0C 3SIPB 1NJZA 1FCAA 2D41A 1W7WA 4WJBA 3KLFB 5FJ4A 2OEKA 3P5TL 5IC6B 2BW2A 1VISA 1GXTA 4CM2A 1LEOA 1NCLA 1V3RA 2HAIA 4OYIA 3C6TA 3H7HB 2L41A 2HYIB 3KK2A 1LXNA 1RWOB 3KG1A 3RAMA 2P9GA 3CJ0A 3MFHA 2CQBA 1FI4A 1X9SA 1HNZJ 1LW2A 2IBKA 4DPUA 1RBLA 3BO4A 2GGPB 5LOQA 1EETA 4P7VA 5J2PB 1RCXB 5MLCV 4NCAA 1CPZA 3NGRA 1CQMA 1C0TB 3DGPA 4L75A 4F4YA 1MWQA 3OR1B 4N77A 3HSJA 1U49A 3LOUA 4ZVTB 3CXCR 4JI1F 3AD7C 2EKNA 3C15A 1HPZA 2KZMA 5BYQA 2XMTA 2HMIA 3QFHA 2V5HG 1Z1ZA 4ZLPA 3AJ2A 3T6JA 1N6QB 3IG1B 3CMES 4LF9J 3M2VA 1A6LA 4V19X 1B0PA 2B4PA 4L72B 5DDPC 2Z56B 4FZVA 3AD9C 1BWVA 2ACYA 4DDFA 5HMZA 1B0VA 3S8SA 2A10A 1RT6A 4LREA 1UFWA 1F2HA 2L3MA 2BXJA 2GMJA 4NLWA 3VVTA 4BS2A 4B02A 2ZZNA 3PR5B 3UDVA 3M30A 4LUBA 2W2OP 1F0XA 5AXKA 1Q81T 2HNYB 3O44A 4JI3F 1YRTA 2DCLA 2RVJA 3GWCA 4PAAA 1GAOA 3NGKA 2H51B 5C25A 3BGUA 1JNRB 3ZNUA 4C11B 3FKBA 3CC4S 3NY0A 3ZO7A 1AUSL 1NK7A 1RAJA 4DCJB 4IO9Q 3X3UA 2GQ2A 3V4MA 2CZ4A 5GVQA 3MM7B 5CHCB 4F26A 4KAIA 2KT2A 3J81U 4A8FA 1ZM3A 4FXWA 3NMRA 3OFHA 2RRBA 4ZPAA 4ELUA 2NXNA 4KGXB 2E9ZA 5KT2A 1XERA 1PJ7A 2FC8A 1X4FA 1PC4A 4KB7A 4P75A 3VAFA 4GC6A 2VPWB 3LGMA 2YKOA 2UUCF 5CD4A 2AGOA 5DRKA 3BQ2A 2CYYA 4KGKA 5KFXA 1RP5A 1HBNA 4E2FB 2YKAA 2YNHA 5EWEA 1IBLJ 1MU2A 2XO7A 5D4PA 5KG2A 2V67A 1GTHA 4J9OA 3A8IA 5KFYA 3MMAA 3DLKB 1U1NA 2GQQA 2E7XA 2XWXA 1VRTA 2IRUA 2V4RA 3PO5A 1ACMB 2ZBIA 3BSCA 4FBTA 2C2KB 2VG7A 4RW8B 5HAOA 1HNWF 1R31A 1SQGA 4DV0F 3LW5C 2KFYA 2M8DB 1FJ7A 1SQFA 1FFGB 1RDRA 3CD5A 3QATA 4FP9A 3W8GA 1CJKB 5J2NB 3KNGA 3CDWA 3M30B 2CFXA 2R7XA 1CS4B 2KYZA 2Z57B 4M5DB 1N34J 3K5NA 5ETMA 2MLYA 3DHXA 3R8YA 4G1PA 4KHPJ 3H90A 4DLEA 1FA0A 3W9HA 4RUBA 1VQ6S 2AJ0A 2DR8A 2LLZA 3B82A 3M2VB 2QLFB 1NHUA 3L7PA 2VQEJ 5KG1A 4KFBA 3TQEA 2JVOA 1UVIA 3NOCA 1HQEA 4WFNQ 4DL6A 3PJXA 2KHCA 1QE1B 5F9LA 1VQ5S 4GVBA 3CDUA 1HPZB 4DR2F 3HDSA 4OYWA 5CYMB 4XDDA 5LSLA 2MGZB 1XMQJ 1RKJA 1BUXA 2XBPA 1IM4A 3HFKA 4OZJA 4KSEB 3PR4A 5GAGU 1YJNS 4LQ3A 3E2EA 3ENVA 1CLFA 4RW4A 2E1CA 1QLNA 2OP5A 4FYYB 1HWJA 2KN4A 4FNIA 4USVA 4ZMMA 1DQAA 4DEZA 2HHHJ 3FSIA 2JSXA 1XIQA 3MM8A 3M6UA 2L9DA 1M1GA 2GO9A 4X62J 2PI5A 3DNCA 3IR6B 1JNZB 5ETQA 4WTOB 3DDNA 5IM0B 3KDNA 3JAMY 4ICLA 3QGHA 1VK3A 5F8JA 2EFPA 1QDUB 5AE2A 3M4XA 4OI1A 3OVAA 2QT7A 2VB6A 2DY9A 1GQEA 2JZ5A 4I64A 4J9UE 3SDEA 3KLEA 3PW0A 1MW7A 2DHAA 3IR7B 3AD8C 4ANEA 3HHNB 1S1VB 2P2CB 4LVNP 4Q8EA 5FLXU 8RUCA 5B09A 1FNXH 3FDSA 1TV6B 1UJ4A 4M1KA 4ZP9A 4JP8A 4NCGA 2MQLA 3GIMA 1H2UX 2IVYA 3WQPA 4QYRA 2VUGA 1X4BA 3HFZB 5BYSA 4RL1A 4IG3A 2QIFA 2XC9A 3FSYA 2V69A 4RPFA 1NKCA 1QTNB 4DV6J 3NGUA 3RZAA 1LQ9A 2XWYA 4O0NA 2V2KA 4P72A 3H4DA 1I94F 2UXCJ 3IMQJ 3BGFA 4NE9C 5HSPA 3CCVS 4LSZB 2B8PA 4N5SA 4J9RA 4DR1F 1S1WB 2Q1LA 2Y3YA 2V94A 3R2DJ 2A1BA 4PXBA 2B56A 2C3PA 3K17A 4LSLB 3K0JA 2E9TA 1HR0J 2R7RA 4C8LA 1UJ5A 1YJ7A 3CDEA 4HR2A 4TYAA 4ZVEA 4LRCA 2CQ2A 2O3DA 2QL9B 1PC5A 3ZZYA 4FF2A 3M8SA 4F4XA 5E3CA 5C5JA 4PWWA 1OQ3A 3TO8A 5J2MB 2HIQA 3AA8A 3EPGA 2HSEB 4ILLA 2HVIA 1HARA 1U25A 3P49B 1DY3A 3TA0A 4RNOA 2R7VA 4NLQA 3C8YA 4KH0B 3AJDA 3F0NA 4PXDA 1GK8A 3KHRA 1ZETA 3EZOA 3BO2A 4LRFA 3EDRB 4V1Ak 1S0VA 2CAJA 3DI6B 2F40A 4HTJA 3IXQA 4ZVHA 5U47A 4NX9A 4CH0S 3J7YI 4DSEA 3N9UC 5AT1B 3C3LA 1HBNB 1U45A 1J27A 4RW4B 1RA6A 3VAJA 2MHEA 1IM6A 4WFXA 4J9KA 1UAWA 2CNNB 3UO0A 1UWBA 1YK9A 3PIOQ 3N79A 1LWXA 4L6V3 4BLGA 2IVMA 2HHUA 3CCSS 4X66J 1R3NA 3UR0A 1XNRJ 4QWEA 1EX8A 2NZ4A 1NB2A 2GFFA 2OMLA 2DGQA 4QR0A 1KLNA 3D1HA 2K3IA 3TVZA 2VBWA 3GP9A 1SKUB 2CQDA 2G2OA 3QT7A 4QWBA 5KFAA 7AT1B 5KFDA 3CDAA 2AYBA 2MLZA 1LFWA 2VONA 2I1RA 5F41A 1RT2A 5FD1A 1N54B 1REVA 4EWTA 3P8BB 3CUNA 4LJMA 1LWCA 1WORA 3V6DA 1EB0A 5GAEU 2M70A 3POTB 1HBUA 1SQEA 3L4BC 4RBVA 2DGVA 1SJQA 1TKXA 1FT8A 3ZTOA 3GZ7A 3TWZA 2AJQA 4B9VA 1LK7A 1N33J 4IFVB 4UOGA 2Z2LA 3JQMA 3I5BA 2KFNA 2DT9A 3HVAA 2HNZA 1DTTB 3T1AA 2R4FA 3PACA 4M5GA 4OIXA 2UUAJ 2VH7A 4WKYA 3CJSA 1RE1B 4HT5A 4PKDB 2JLFA 1IXKA 2EFVA 1JQGA 3HULA 4C48A 2VBYA 4Y2IA 2JRSA 2ZM6J 1U0HB 2QSFA 3H98A 3N6LA 3QSIA 4B08A 4D3GA 4RNMA 1JLFB 1RI7A 1SC4B 2DK2A 1M5PC 4K50A 1Q7YT 5DZ7A 1RHMB 1DTQA 2HZCA 1AW0A 1ITPA 5T7LB 3TEGA 5C2GA 5GMKa 3OJUA 1W25A 3HHEA 3N6MA 4CT8A 3ETOA 4ZJQA 1B3TA 3JYTB 4P9SA 3A3OB 2B7BB 2EW9A 5AJ3J 1TQLA 2XZWA 2IY5B 1XR6A 2OPPA 1FE4A 3Q89A 5DM6Q 3CT9A 4KC5A 4HH0A 5D15A 3R5GA 1WG5A 3BH7B 5HN0A 1HD0A 4X66F 2QMUB 4ETXA 3JSYA 3TZYA 1JX4A 2MHNA 2P9CA 2VC0A 4WP8A 2CRLA 4DSKA 1B64A 2RQKA 4HHHA 4I68A 4ECUA 3JYTA 3QWUA 5ETVA 3MZIA 4FS1A 4ZPWR 3KHLA 3NP5A 2Q6CA 1NAQA 2VG6A 3R7SB 2HVHA 1SBRA 4H54A 4WE1B 3TA1A 3ZZRA 2VJUA 5IS2A 4ZHRA 1R0AB 3NG8A 2JHEA 3LGNA 2MQNA 2J9CA 2WZ1A 3QT5A 1N4LA 4NLOA 2F63A 3OL9A 5IQQA 2HHSA 3KUGA 1NJYA 1OY6A 4CIOA 3IR5B 3OTBA 5BJRA 3OV7A 4X4OA 2MQ8A 2HLTA 1S6PA 2BANA 3BV8A 4LF7J 2JLGA 3VALA 1Q0NA 2DH9A 3CNQP 2X3DA 2GA7A 2X3GA 3C14A 1HW8A 3BKFA 3E3XA 4PXCA 3ZTSA 5C42B 4JI3J 1JLGA 5KFTA 5L9XA 1SIWB 2W25A 1UPMB 2A18A 2KXHA 3UD5A 2JFKA 1CJTB 1Q8BA 1VFJA 4EU0A 1K1SA 4Q5VA 1IN0A 1ULRA 2J5AA 1F9HA 2WOMB 1CJUA 3H20A 3MEDA 3NWRA 5GAHU 3T3FA 2HVZA 2Q43A 2HKEA 1WC5A 3CB4A 3C6TB 3ZXWA 2OPSB 1N8RT 4R8UA 2UVUA 3BB5A 2I9SA 3UR3C 4FS2A 4ECZA 4NA2A 4ZVSB 1XR5A 1UCNA 3PHTA 2DH8A 4E8UA 3EXCX 4A8KA 2DNRA 5H9EK 1Y10A 3PW4A 2LU1A 3MGJA 1N0UA 4U7CA 4UZCA 1U2FA 3FNNA 2WTFA 3BM7A 4YDDB 3N28A 3WC0A 3L7UA 3BBBA 1UTAA 1EP4B 1NMEB 2KHDA 5DGBA 4C0BA 3CCWA 4I6AA 4P7TA 1U1MA 4U9RA 2AYMA 2QRRA 1VRUA 2HEKA 4PG4A 4G1IA 2WB4A 4NLTA 1FHTA 2CKWA 3R9LA 2WW4A 1JWWA 4HACB 1SUQA 5A2QU 5B0AA 2DRAA 2ZWOA 1VQSA 3O3LA 1T94A 3O8WA 4OYXA 2XMMA 1IKVA 3EYZA 4IR9A 2J7UA 1NLKL 4A8XA 2QFJA 4DZ6A 2OFGX 4F4ZA 2UVRA 1CBKA 2C28A 1S1TA 2PMHA 3AQPA 2YXLA 1C4CA 3RYLA 3MR2A 2CNLB 4CO2A 4JV5J 1Y5LB 3IA0A 1RTJB 1RBAA 5LJ3Y 4K8RA 4CLYA 5EX3A 3G82B 4C3KA 2DPIA 3UVJB 5CD4H 4QIVA 2XLIA 5E41A 3J80Y 1S9GA 2E5JA 1S1TB 4QIFA 3SCJE 1JKHA 2Q3PA 2XZDB 4K59A 4Q0BA 2YNGB 1G3OA 4Y2KA 4X4SA 3IGVA 1WI6A 1HBMB 2YH0A 3OW2R 2UXBJ 3QYYA 2CJKA 3I9ZA 1PJ6A 1RAAB 2C42A 2VU5A 2OFHX 2XMUA 3KK3B 5GAEI 2FZGB 5KFHA 4R0EA 3IM8A 4OI6A 3W66A 2VPYB 1NDCA 2O67A 1KONA 3DDIA 1LOUA 1RWMB 2CQ1A 2K2PA 2WVCA 3GCWP 3R97A 3T19A 5JJBA 2XMJA 2ZH5A 1BQMA 4AQYJ 2MQOA 2R2TA 4JI5J 1NK8A 4U8VA 3CGIA 3M9MB 4USUA 1WF0A 4C8MA 2V6AA 2C2EA 3MOZA 2K7KA 5A6WA 1W2BR 2B8QA 1VBXA 3C66A 2RDDA 1TMJA 1S1XA 5AE1A 5I3QA 3G8SA 2RQMA 4TU9A 2HFOA 3ADAC 5HANA 5GMDA 1VBYA 3BN7A 3RR8A 2CJXB 1FFWB 3HSDA 4A8SA 3FK4A 3W7BA 5C42A 3DM2B 5DS7A 3Q2SC 4DL2A 1SKRA 1N5TA 3Q8RB 3C6UB 1FDDA 1FKOB 3W2VA 5KT4A 1J5OA 4TU8A 2HHPA 1FJEB 4KRWA 4EYHB 1WEZA 2RKIB 4KY3A 4L74A 3ZZPA 2RS2A 2X7IA 1KHVA 2P9EA 3UCGA 4FF4A 3EVWA 2ASYA 2HWIA 3DXBA 3HSGA 1MROB 4H4MB 4JI8F 4AFFA 2HBZB 3FEXB 1DAXA 3BSAA 2DD8S 3S01A 1RBOB 3PXGa 1L3VA 3OL8A 2KXFA 1F9EB 2GHPA 1JLQB 1RXOB 4G1QB 3ZC4A 1NK4A 5K9FA 1RLCL 2YKPA 1HI0P 1RCOB 1S7IA 2KJVA 1D3WA 4C97A 4OV6A 1DJ0A 3M6WA 4X65J 2RU9A 4J9MA 4IQXA 1M5OC 4RUAA 1VIXA 2DHXA 3D6HB 2XEXA 4MIBA 3THPA 1HNIA 4Z2XA 1EQMA 1Y11A 3NCPA 2C2NA 2W8LA 4TY9A 1H3DA 2AX1A 2BQ3A 1TL3B 2RH3A 4CI0B 4JI5F 2ADCA 3KTQA 4DV3F 5DO2A 4WTYA 2Y0BB 3D6TB 2JLEA 2FY8A 3KXDA 3MCSA 2AJFE 3MM5A 3RW7A 2FJXA 4GKJF 1RB0A 2OSRA 2LYVA 2YWFA 5F8NA 3TEHB 1V5VA 2R7SA 2YNHB 3I0SB 4C3LA 4DR6F 2JNJA 1NSAA 4Q2LA 4YN3B 3DRRB 2AV5A 1B7YB 3AB2B 3AOAA 2DNOA 3JTPA 4DX7A 4DG1A 5GAHI 4ATNA 4IR1A 4NLGA 4K4VA 4QCLA 3B6BA 3PYDA 5B0GA 3ZNJ1 4WKRA 4KFBB 4CO1A 3WC2A 2JVRA 4WU3A 2I38A 3RRGA 2MJNA 1Z2ZA 3FGVA 3DLJA 4O44A 4P10A 1UKUA 4QYZK 1LWFA 2D9OA 3QWPA 5KFLA 2M9KA 2FQQB 2OI2A 4C11A 3MECA 2W24A 4LQ9A 4FYVB 4NA1A 2YKNB 4M5DA 5C2CA 4DL4A 4B3RF 1NKBA 4QQBA 3WHIA 3CCRS 4O4GB 4ZPBA 2HVEA 2LQBA 3RRHA 1TFWA 1NPKA 2AW0A 4BWJA 1G6BA 3GYNA 2CPXA 2XGPA 1P8GA 1REVB 1RISA 1JLQA 4KHMA 1RAFB 3EVOA 1F1BB 4LF5J 4ENOA 4NLYA 2NYHA 2VG7B 1E6VB 2MKSA 2RQ4A 3MEGB 1NM2A 2QA2A 1SL0A 1AA1B 3EXYA 2DGWA 2R7OA 1Y4ZB 3HHDA 2NYIA 2YNFA 2V8DA 3NEKA 2PC6A 1U6FA 3I0RB 1KS2A 1WC4A 2FLOA 1G7CB 3KLIB 3LAKA 3MEKA 3SSSA 4ZPVR 3MPDA 4DG1B 3G4SS 1T3NA 3NMAA 4JV0A 3D2WA 1GMWD 5A76A 4OX6A 1IR2A 1O6XA 1T11A 2JEGA 1HHQA 5HJXA 1ZM9A 2J8AA 3M05A 3CJ4A 5D77A 4DPOA 1R8AA 4F36A 1X8DA 2GGPA 2DXFA 1PO6A 1YWXA 3NNAA 1DARA 1JLEA 2ZD1A 1X0FA 2XZTB 4ZCLA 2RQCA 1RT7A 1HQUA 4P52A 5T14A 1JMTA 3KFWX 2W7AA 2DEJA 2FUG9 3PX0A 1DLOB 1NRKA 5ETNA 2G0JA 2V63A 4I7FB 4J9SA 2MY7A 4ITSA 3GILA 3F73A 2XY7A 1HNXJ 1KFSA 3MM6B 3OUYB 4C9DA 1YBUA 4C4WA 1IKYA 5KT6A 5EWFA 4USHA 4C0OC 1B70B 5AXLA 2HNYA 4YUDA 3KHHA 4WIQA 2RD5C 3MEEA 2BJEA 2H4WB 5KFPA 3NS5A 2ASDA 1VYAA 1VQ4S 1KKHA 2R8KA 4B3MJ 2AT1B 4NLDA 2H1YA 2M2BA 3H4BA 4XPCA 5D3GA 2W4CA 3OSPA 1V3SA 2HQ3A 3CMAS 2VFUA 2NUUG 4ECXA 1FRHA 2LQJA 2YTCA 5LM7E 1NDPA 1Q78A 4H4MA 5IWAJ 1N34F 1SC1B 5LJ5Y 5BYRA 2VOOA 3M8WA 1N6QA 3TRGA 3FFIA 4DUZF 2R7WA 1KD1T 5CYQA 4JI7F 3MUVP 4WBFA 5B0FA 2A2DA 2HIYA 5CAAA 2IDEA 5IXUA 5KTQA 4DL3A 4ZVPB 4PPZA 4BC9A 5G0RB 1AFIA 2HRUA 3P3DA 1WC0A 3AQOA 2B4UA 3P96A 4C2MA 4LFBJ 2IC3A 2H48B 4I2QB 2D3UA 2J9DA 4HLBA 1KHWA 3TARA 4EI2A 2NSBA 4OYAA 5DM7Q 1S1VA 2IMWP 5L1IA 1R0BG 3W62A 2VFSA 3EZUA 3IRXA 4AL6A 3PG9A 2PN6A 4F4WA 2VOPA 1TUVA 1SH3A 2ZWPA 4CH1A 2FVCA 1NH8A 1OWXA 1SV5A 1XQIA 3W1YC 5GMEA 4N8OA 2CJYB 3LP2B 3NRBA 4Y2MA 4DZDA 1SJFA 1VR6A 1SCJB 3WIUA 3V81B 3PKMA 2D3OR 3JB9k 2HQFA 2JOQA 2HFSA 4NLXA 2C1EB 1RWVB 1Q79A 1FK9A 2MZ1A 1K73T 5I42A 3VAGA 2HFVA 1IJEB 2HPUA 1RT1B 1VOMA 3BYPA 4MKBA 5DGAA 1H7WA 2A6MA 4XTTA 4OFZA 2BABA 3M32A 5DG7A 2DHGA 5K8MA 3B8HA 4DQIA 1TP7A 3OR2B 3W9JA 4BCAA 4GC7A 2LA6A 4CO4A 4ES1A 1K0VA 2QLBB 3K58A 3DRYA 2UZAA 1F6TA 2QL7B 1Z4UA 3IWXA 4LRBA 3SSRA 2FVQA 3CIZA 1B4SA 4Q8FA 4CQ1A 2HW3A 1YX2A 4FN5A 3QRRA 3N4WA 3MTKA 7FD1A 2K1RA 2VBXA 3JQJA 2NUHA 3ILLA 4OI2A 2NREA 2RS8A 1WTBA 4OZ1A 4OLOA 2R7UA 1KVIA 3A8EA 1U09A 4OX7A 4CNZA 2ZOFA 1B99A 3NS7B 1HWUA 4RW6A 4DN9A 6AT1B 2D1CA 1NU4A 3H59A 3BQ1A 3V2UC 1FNMA 3IS9B 4DOZA 2BE2B 2FGOA 2ZVSA 4DX6A 4UT4A 4DV1F 3RTVA 1MNEA 1LW0B 1UVKA 1X5PA 2X1BA 2YH1A 3BO3A 1H98A 1S6PB 2BANB 3V6JA 4ZPDA 5CYQB 5H9EJ 2CJQA 3VAKA 1JXLA 1VQPS 2CQ4A 2OPRA 3T5HA 4O3PA 5F8GA 3MOJB 2EPIA 2QC3A 3NOGA 3KJQB 1EAYC 2GVDA 2MKCA 3H2UB 2OSQA 3FQKA 1K8AT 2VG6B 3GJTB 3B54A 1TVRB 5G4DA 1M5SA 3R6LB 1U1KA 2AHOB 2ALYB 1DQ8A 2OELA 2CQIA 4QR1A 3RBZA 2X1FA 4KR0B 4OYBA 4A8WA 4MKYA 4X4UA 5FIIA 1N52B 1WOOA 2OEJA 4F25A 5DG9A 4CLTA 3ZZ0A 1MWZA 1WHVA 1EKSA 2KO1A 2LXIA 2BJ3A 4ES2A 5HL7Q 5HLFB 1NK9A 2CJ9A 1U1QA 3TUZC 1QTMA 1RT7B 2U2FA 1SL2A 4FPIA 5D4LA 4LFAF 1HWLA 4A8YA 4FXDA 2CJAA 2HHWA 2B9EA 5K5MA 4NWBA 1O0PA 1QAJA 3KOAA 1FJGF 3VWSA 4DS4A 1RUSA 2FJBB 2ROEA 2BR0A 4P73A 2E9RX 3HLUA 1TL7A 2BJ7A 2LQ9A 2XM3A 1HNZF 2BE7D 1VDHA 4NZ0A 2RSQA 3O1LA 1RT3B 2KB2A 3A12A 4M5KA 1YZ6A 1E6YB 3MR7A 3Q8YA 1KOHA 2BKPA 1HYSA 1W2IA 2APOA 2HS3A 4CLKA 1N32J 2UUAF 4KIAA 2H3EB 4FF1A 2WSEC 2G9OA 3ISZA 1FDNA 3UD4P 4F02A 1RTDA 2HNZB 3LP0B 4OHVA 1RABB 2C3MA 3KUHA 4OZ2A 3KK1A 2YWHA 1YI2S 4UQGA 1RWWB 1QSLA 2DH7A 2DGOA 4ZHRB 1C1BA 1CJVA 1U8SA 1D1UA 3O5TB 5ETPA 3AODA 3M2UB 4FNHA 3V6DB 4WFZA 3NCRA 2DVIA 5HO4A 1WKJA 2ZBCA 5J2QB 1SJ3P 3VF0B 2XNQA 4PABA 1H74A 3LA0A 4ECTA 1IR1A 3I31A 4RU2A 1FKPA 4USTA 1BQNA 4GKJJ 4IRDA 5HLFA 1RU2A 2X1AA 1Y5NB 4KV8B 2CPJA 3TOQA 4DCPB 5CCLA 5E3QA 1Y5IB 1BHNA 4ED8A 4DSLA 1PYSB 4WIIA 1HMVA 3LP1B 3VTIA 1Z2LA 1HHTP 1FDBA 4HH1A 3OLAA 4ZJOA 1JLBA 3MR5A 3FSXA 3Q83A 3GG0A 4LF8F 1U2CA 2M0GB 1NUEA 2IVFB 3U7JA 4DMZA 2DO0A 4ETZA 2V4JB 1RTHB 2JJ4D 3CJKA 3AT1B 4YB5A 1DTQB 3IAM9 4U6PA 3K8WA 3Q86A 2M7SA 1FESA 4MK7A 5CA5A 2CJBA 2IAJA 2UVWA 1SIZA 2QG9B 1S9FA 1FWPA 2HBQB 4K0KF 4M5IA 3OTCA 3JSRA 1X5OA 5DLFA 2D69A 1I6JA 2FLLA 4FDFA 1TL1B 4PG8A 5HVHA 5IC4B 1GMWA 3EZ5A 3MMCB 3VGUA 4C8KA 2XG8A 3H40A 3RBEA 1S0OA 1VQNS 4DL7A 5A8RB 4CZCA 1CG2A 5HMXA 4JI2F 4DV0J 1NB7A 2CPFA 4KKOA 1KVJA 2JEIA 3D6FB 4TU7A 2LQ5A 1NJWA 4JV1A 2FJEB 4WF9Q 4X64F 1JIHA 1HWKA 1LK5A 3MF5A 1Q1KA 3DRPA 3R5BA 3PEJA 4IFYB 5B08A 3L3CA 1P1LA 2B5JA 2CNKB 2Y1LB 3MFIA 2DNYA 3QAUA 4KO0B 1P6TA 1XMQF 2ZH1A 2YWWA 1HWIA 4B3OB 1QAXA 1UW4A 3NAIA 4LF4J 4F67A 2RKIA 4DS5A 1X9WA 3PJ9A 3M9OB 2CNOB 2R2UA 5IT0A 3BGOP 1O5JA 1M0SA 1IBMJ 1F2GA 4LBHA 2E1MC 3DC2A 3V5RA 4I4BA 3BREA 1V6HA 3KLVA 4PUOA 2CQCA 5J1EB 5HP1B 1R6YA 2R7QA 1R7IA 1BGXT 3ET6B 2B4OA 4AE5A 3HMJG 2KZZA 3ILJA 2DO4A 2XYPB 1VQ8S 4ZLNA 3CE8A 4ICLB 3G6XA 2G2YA 2ROPA 4X62F 2UXDJ 4NI2B 4RW9B 4ECRA 2FLNA 1IBKF 1NDKA 2NSCA 3ET6A 3L7OA 2AJ1A 3IO1A 3PRVA 2AQ4A 3DN9A 1VQLS 3LPYA 3LTOA 4HKQA 4ZLJA 3K5PA 3CWJA 4NXNF 2R8GA 2R42A 1VHFA 2AJ4A 3E01A 1FTRA 1WJ9A 3H0PA 2ZH2A 5K8PA 4JI2J 2OAUA 2OMOA 3BR9A 3IRWP 3FCHA 1YHQS 3LGHA 3QQCD 5D4OA 1SKWA 1F60B 3SI8A 4DR1J 3R5JB 1KQGB 1OYDA 5ADZA 2IFXA 4PYDA 1WC3A 5CQGA 1EKRA 1UFKA 1N36J 1CEZA 2L9NA 4LFBF 2H5EA 1E6VA 1KTVA 3DDKA 4DV6F 2E29A 1SXLA 2VD3A 2HQDA 2HS4A 3HHLB 1WEXA 4IOAQ 1RAHB 1S9GB 3FJ2A 3GB0A 2DIVA 4MK8A 4J7CA 4EK2A 2RDJA 3AAWB 1U47A 5BR8F 4FYDA 1FVSA 3G2XA 4KKOB 1IJFB 1ZM2A 2B7CB 3NLCA 3KLGA 3M8QA 4DX8H 1DRZA 3JQKA 3MMBA 3CD7A 1ZAVA 3C16B 4ANDA 4PQUA 4N76A 2N3LA 3HP6A 1RHQB 2NXEA 4EYIB 2AP6A 1AZSA 2E5GA 3HSZA 4HL9A 1LWFB 5ETTA 3ZTQA 1N5VA 2MZJA 2Q79A 5GADI 3Q0AA 5KFVA 1HQUB 3PKYA 4KGVB 3MMAB 3CJ2A 2IA6A 2AU0A 3AOCA 2P8IA 1FX2A 3FCWA 1MWYA 4RNFA 3QGIA 1XN9A 3HFVA 1KLMA 2LP4A 2WVFA 3BKUA 1VC6A 2Z2YB 3W5ZA 1T9UA 3UNYA 1S6UA 3AB4B 3G86A 5HK4A 4GVBB 5CCMA 3I0RA 2XY5A 4CLSA 2BVZA 3LF0A 1FVQA 2IRXA 2C3UA 3MM5B 4OI3A 4QOTA 3BKTA 4EZ9A 2V9KA 1RU1A 4DBQA 3QGPA 3UN5A 1O51A 3HZGA 4ED4A 4YR0A 1Q8LA 3ENQA 3D7SB 2WOMA 2FPHX 5HQLA 4WXOA 3F41A 5IT4A 3Q23A 3BF4A 1CS4A 3R1HA 1QAIA 2ZKUA 3GIRA 5F3TA 4C8YA 1UP1A 4DV1J 4LR8A 3PY8A 1S76D 1PKUA 4LFCJ 1RT6B 2DRDA 2UP1A 2E1AA 3TW0A 4RLEA 1S99A 3GONA 3I5AA 4NLUA 2DNMA 5D78A 4CLUA 3OFGA 1VRTB 2BOPA 4NPOA 3ZZZA 2CUYA 4MTPA 2IA0A 4EUVA 2Y8YA 3W61A 4G3IA 1KFDA 3AOBA 4M5HA 2IAJB 5D8HB 2VZ9A 4NL5A 4DV2F 1Q53A 3C6UA 2FHJA 3I4HX 3W2VB 3DRRA 4I6YA 1KLMB 1Y00A 4DPXA 1FXDA 4QJVA 1C0TA 3QPIA 4X84A 3LWMA 3GV7B 1CVJA 2UXCF 4WK3A 3NCQA 2OO4A 2QFIA 3KG0A 4MH8A 4DR6J 1JLCA 2UUCJ 1SC3B 2N82B 1KVKA 3ZTPA 1APSA 3I55S 1UJ6A 1NXIA 1VI7A 2EBEA 2ZUAA 2F3JA 4Y34A 4CCHA 1U1OA 1RACB 1HNWJ 1VJQA 1X5SA 2C2MB 2QTWA 1C1CB 4A8QA 5HROA 1TL3A 2NPIA 1BE4A 1CULA 4ZP6A 3OVBA 1FKPB 4P2MA 3W8PA 2WB1D 3CCTA 2VL1A 3VCDA 3GV5B 1BQMB 3D6MB 2Y1RI 1FRJA 3GYGA 2WK4A 1X7VA 2YWKA 3C19A 1WHWA 4WXWA 4J37A 2HWTA 2W4PA 1C4AA 2BUNA 5LMNJ 3UDEA 2R2SA 1WI8A 1R8HA 1VLYA 1WOPA 1EHWA 4QR2A 3M8PB 2BW7A 4M5LA 1VCTA 3CULA 4FVMA 5A8KA 5KAKA 5K8NA 3BJYA 2VG5A 2FTRA 2QL5B 2Z2MA 1OSCA 4QPTA 1NK6A 2W8KA 1X9MA 4KHPF 2RF2B 1L5UA 1QD1A 1A7GE 4LRDA 4DL0C 2MQQA 1XNQJ 5C7PA 2VQFF 1SC6A 2WONA 3MCMA 3C15B 5LMUJ 4F4KA 2ZDOA 4K2JA 5LL6d 1IKWA 1Q7LB 3F44A 2PDAA 2BJ1A 5AXNA 1AROP 2QA4G 4CO3A 3QMQA 3POTA 1Y9OA 5E3AA 4OHYA 2LCWA 3UN3A 1MMNA 4NLSA 3EGVA 2MMYA 2VQEF 3OTEA 4O4RA 5EN1A 4ECSA 1RKIA 1X31C 2COLA 3PTWA 2V0NA 5EGYA 4ELTA 4ZITA 2H5JB 4M63A 1T8EA 4F3OA 2VICA 2AWZA 1FRKA 3A1YG 3G8QA 2F65A 2LMIA 1Q8IA 3DRSA 3IP0A 3CCLS 1CQNA 4DV7F 4ALZA 3HF5A 4RU9A 4WCEQ 2ZZMA 1U1LA 2AZ3A 2W7PA 4B9NA 4RO0A 3V6KA 2HBRB 1U4BA 3RJMB 3I6PA 2GIRA 2PA3A 4I1TA 4CYUB 1WHYA 4OZ5A 5KG0A 1X4GA 2BBEA 3B4DA 4CYUA 3QRPA 2ZNYA 3QJPA 2GHWA 3UN2A 5LSOA 3QLHA 3SQGA 4ZK7M 3R6GB 4WFYA 2F7VA 3OHAA 3TVYA 2EBGA 1WSRA 2RRNA 3FEZA 1J2VA 5EUHA 3TZXA 1D9DA 4B3TJ 4BBYA 1G2EA 1WC1A 1ZA2B 1GXLA 2V34A 2HS0A 2OPRB 4L73A 2YX1A 1H7XA 4H4KA 4MFBA 4RJVA 3T1HF 2NXJA 3A3PB 3T9NA 1TKTB 2W9BB 4IRKA 1VQMS 3QSYB 4DFJA 4QIWD 5HBMB 5L9NA 3HZEA 1FXRA 2DHSA 2MZSA 2UUBJ 1ZH5A 2F5GA 1R0CB 3UWTA 2YQ3A 4LF1A 5LMUF 2BE9B 2HFZA 2FD2A 2U1AA 1RTJA 3SMZA 1NHVA 5KFJA 1NZAA 2KG0A 3NNCA 4M5MA 1RWKB 4UUXA 3TX0A 3PX4A 2AD9A 3QRQA 3T6BA 4CTAA 5I3UA 2DNLA 3VZIA 1RWUA 5HBMA 3UDCA 3PDNA 5G0RA 3BGRB 4MT1A 1ICEB 2ZFHA 1R6VA 2DNPA 2YQ0A 3AA9A 2HMIB 1MG7A 1IKVB 3BDPA 2EK1A 5KFGA 4K7QA 1G1XA 2E5LJ 3QIDA 4GO5X 2WCXA 5KFCA 3SQGB 1OJ4A 4OHZA 3CCQS 3C46A 5F8HA 4PWDA 4LR7A 3GFYA 4XDCA 2VA3A 3AFGA 2BKNA 3H8YA 1K47A 2QSWA 2AGQA 4CO0A 4KBIA 3NGDA 2JEJA 3EM1A 1NPPA 1UZDA 1U1RA 1GTEA 3PYGA 4UTGA 4CM0A 1PCAA 1Q86T 5HATA 3CPWR 4J9NA 2DR5A 1X0PA 2V9WA 4URSA 1HA1A 4R0JA 1SV5B 1UW9A 2WSFC 1NHKL 4DQRA 4F3MA 3OXGA 1Q82T 1F5CA 2XY6A 3NGSA 5F3ZA 3D4JA 1CJUB 1NZ8A 1YBAA 3CJTA 2XSJA 5EDWA 3TAMA 2E5HA 4YFUA 1D0EA 3D28A 4CDIA 1OO0B 3TAQA 1H38A 4WU2A 3A3NB 3N5FA 4W92B 3BSOA 2LEPA 1RT4A 1IKWB 1FEHA 3BBFA 4F3QA 5F8MA 3CVKA 2DITA 3U27A 3KJVA 2MKJA 3G6YA 4IUFA 4N41A 5EHHA 4X4VA 5BXIA 2GZOA 3KLIA 5ETOA 3U1LA 2XI2A 2NLWA 3GPAA 4HDGA 4C0HA 1NEEA 1HQEB 2MXYA 3ZZOA 1WSVA 4LR9A 5A0YB 4DV4F 2IIHA 2RDIA 3VGTA 5KT7A 5BR8J 1HYSB 1WDDA 3DU5A 5B0DA 5K14B 1Y3JA 1D9FA 1SJ1A 4IOCQ 2UU9J 4X65F 3OXLA 4E0DA 1GX5A 1NO8A 1ZS6A 3VAIA 1S48A 2B0GA 3E51A 1J5EJ 2M52A 4RKUC 2XCAA 3W65A 2BQRA 2GCFA 4TKTA 2DNGA 4O3QA 4K5SA 4NASA 3K5LA 1QUVA 3A8KA 4O4GA 2D3O1 1HHSA 1LWEA 2K06A 1V9OA 4NLVA 3BDEA 3SFUA 1RAOA 5KFKA 1DFDA 1SJRA 4I0WA 3HO1A 2EFOA 1BY9A 2DNQA 1WDTA 4NRTA 1NSPA 4LSNA 4B3SJ 2CZVC 1SH0A 1XBWA 2XHWA 3IBWA 3SCLE 4DR3J 1N0VC 4Z7YA 4WYLA 1HNVB 1MMLA 1WUUA 1WNEA 4PWDB 4TXSA 1UA0A 4F50A 1Q95G 4WPAA 1P9YA 4F4AA 4DCOB 3ZTRA 4YHHF 4CLZA 2ZDPA 2ZJQQ 2CDQA 1M90T 3RW6A 3CCZA 2LU2A 2DNZA 1IBLF 4CP5A 1TK0A 1S0MA 4LF2A 2L08A 4USKA 4YP3A 2ZJRQ 2F4VF 1D09B 4K4SA 1ZAXA 2Z30B 4K4ZA 1S6QA 2CPHA 2MKKA 2J9DE 1FEEA 2IJRA 3VV2B 2KG1A 2K3KA 3DI6A 3GR0A 3D66A 2OKQA 1I51B 2ZHAA 3MAAB 4ZCKA 4C6AA 1QY7A 3T5KA 4AD6A 1R8PA 3MM7A 1GH8A 3DYAA 3PW7A 4ZJLA 2Y9HA 5CZXA 4BC7A 2EFNA 4B3RJ 1T03B 2XS5A 3AHPA 2OUGA 5CYJA 1AZSB 2H9ZA 1RHKB 5J2MA 1YITS 3EICA 4F7VA 5B0BA 2EI5A 2BRKA 3HHKA 3M8ZA 4IDKA 4RW6B 2XLJA 5KFOA 3C16A 4CLWA 4USMA 1URNA 1HBUB 4ZIVA 2XLKA 3D1QA 3DGVA 4V19J 1AYEA 4LF6J 3NWGA 5D0HA 4ZCMA 4DUTA 2ZEJA 3BPSP 3PJWA 1OIAA 1PAUB 2JDJA 2CQ3A 1RT2B 3IFEA 3HHLC 4IG0A 5H1SV 1UVLA 3W5XA 2HNDA 2OTLS 1N5QA 3MD1A 5DQIA 2OJ3A 2IYIA 4FBUA 4E98A 2WRMA 4J91A 2E1PA 1S49A 2AIRB 2QV6A 4OJ1A 3Q8UA 4LVOP 2IM1A 4TY8B 1K0TA 4OYMA 3DMJB 4M5NA 2Z58B 2PD1A 1U6BA 1P27B 2DHHA 1I1GA 4ED7A 1WKKA 1Q8KA 3VR1A 3QZ7A 2F9JA 4LBIA 4DXLA 2HHHF 4X4PA 2NCKL 4NCGB 3J7A1 2R8JA 1UETA 4LF8J 4K2XA 3D0IE 4DHVA 2Y1JA 2F4VJ 1X60A 2BJ8A 4BHQA 2NS1B 5F0WA 4ZLLA 4R5PA 3RG6A 3KLHA 2VBZA 2J0QD 4OI0A 2GC8A 4YS2A 2BYCA 5CH7B 1XWLA 2VFVA 4JOUA 4ECVA 4IRCA 1T0TV 2PGCA 2D9PA 2GIQA 2C3OA 2VODA 4DFKA 5KG7A 3AY0A 4OZ3A 5L46A 3IRXB 1MMDA 4X4QA 1HNIB 2MTLA 1FNOA 1HW9A 1VGYA 2QLXA 3K7RA 3KLHB 4KT0C 5E0OA 2BZ2A 3M8QB 2V8GA 1YG0A 2ZM6F 4DPTA 4KJIA 3HKZD 3SYZA 2CQHA 2DKOB 1X4DA 1IKXA 1UZHA 1TL5A 4ZDNA 3IN5A 2EFGA 2B6AA 2FGCA 2I6WA 2QLJB 1OPZA 3GJSB 3KWMA 4D3HA 3G6ES 4AL7A 1I94J 3P45B 2RRAA 1S1UA 1IWAA 3UNGC 2FVRA 2AEFA 4ZIWA 4X64J 2MSSA 4H4KC 1UVMA 2XULA 3JTNA 3L95X 3PHEA 5J1PA 4JYAJ 2XI3A 2H5IB 2C3YA 1RA7A 4K5RA 2N7CA 4QWAA 2CWXA 2ZBRA 1HFEL 2YNGA 2RB7A 5E5NA 2IM2A 1XTZA 3BYRA 4PZVA 2B6AB 3LWLA 2DEIA 4HTIA 1YSJA 1WG1A 2MPUA 3E01B 3QJLA 3I4PA 5B0CA 2KJWA 2FJDB 3D0GE 2W4DA 3GYXB 4DN0A 4Y3CA 3K5MA 2F4FA 1OYEA 2E44A 1RT5A 2EFQA 1K44A 3MEEB 4FKYA 1CJKA 4U95A 3QZ8A 1M5VC 1HR0F 3VAHA 2CPDA 3MM6A 3CJ5A 2K8GA 3MMCA 3OUYA 3ZFVA 4ZVRB 2PI4A 3HJFA 1KR4A 3N01A 2DXDA 4I7FA 4USWA 1N5YB 4ZPTR 4I67A 1BWEA 1KQSR 2UVVA 2D7SA 4K4WA 3DLKA 2DXEA 1PILA 4IH5A 1FERA 2ZD1B 1B7FA 2LEAA 1H72C 1WHXA 5ETKA 4KGZB 3X1LB 1FD2A 1Q5VA 3GJRB 1YLXA 3NKYA 3UCZP 1T95A 4F2RA 1S6QB 2CXEA 2OLWA 1VRUB 1M1HA 2HRTA 1U8WA 2WW8A 3D54A 4PG5A 5K8OA 4DV5F 1D8YA 5CZVA 5I3PA 3U1NA 3KK3A 4U7UK 4UY85 3OVSA 3TVKA 4NEYA 1YGYA 2H4YB 2KDOA 2YX4A 2CG8A 2LA4A 2YNFB 3H2LA 3LANA 1QUPA 5DETA 3TP2A 2DGTA 2KT3A 4M5JA 2MQMA 3SCKE 3EUNA 5E3RA 3U02A 2DCUB 3KKFA 2QE5A 1KC8T 2DRBA 2NR0A 3UPFA 1QVFR 4MYUA 4C8NA 1JKHB 3T1YF 1HL6A 1YJRA 2HHTA 1VLOA 4IG0B 1U0SA 3A13A 3PYFA 4H4OA 3LAMA 1IVZA 2V8VA 2QYCA 5M2RA 1WD6A 3FBFA 1PJ5A 3S1TA 2E1RA 2ZE2A 4ED2A 3FRYA 5KFEA 3HD1A 2CG4A 1AT1B 3UE2A 2W9CA 2J0XA 1D8ZA 1FRIA 2Z2ZA 1S5ZA 3M8YA 4Y6IA 5KFSA 3G71S 4JI4F 4ZA1A 1T03A 4O44B 4OHXA 1IWGA 3D1OA 5L39A 1R43A 3HVTA 2HHQA 2RHQB 2M88A 1ZPVA 1ZOTA 2HHXA 3IM9A 3CCJS 1XEZA 2DBBA 1S6OA 2R2RA 1GT8A 1GFWB 2KVQE 3D68A 5M2UA 2SXLA 3M8PA 4Y2AA 4YDXA 4TVAB 1L3UA 4DWIA 3QBCA 3GTYX 3IGNA 1OS5A 4WE1A 2OD4A 5J2PA 2PO4A 4EZ6A 3LQVA 4K4YA 1RYRA 3TAMB 1P9QC 4OV1A 2BJDA 2RIJA 2ZH8A 2UUWA 1U02A 5D0EA 3SCIE 3TJ9A 4DSIA 1YRXA 1OMSA 3MI7X 1VQ9S 4MIAA 2VASA 3KLFA 1BQNB 2E5IA 4NZ6A 1S79A 2OPPB 3R5AA 4KH1B 4RUHA 3HPOA 3I56S 3FBEA 2HQIA 2W2NP 3MM9B 2HVDA 5KT3A 1H73A 1JLCB 4B17A 3EPIA 3D5MA 3GR1A 4NXMJ 2V2VA 1AXQA 1RWXB 3ETMA 2CQGA 2VDHA 1YDLA 2B9XA 3S7RA 5HVGA 3TJAA 1RTIA 3LP0A 1YJ9S 3M2RA 4ZKAA 1U0HA 4YR3A 2PFDA 3W2WA 2KVIA 5A0YA 2FLPA 3BR8A 4PRFA 2UU9F 2AF6A 5IT9Y 3MMJA 2EG2A 2HLUA 4CH7A 2BKOA 3M6XA 3M7VA 1J5OB 2BE2A 1YJVA 5KFRA 3OR1A 3DM2A 4IFVA 3UW1A 4Y65A 2GVZA 1PGZA 3SSQA 3OTOJ 2HRYA 3R3TA 2FC9A 1IUJA 1R8CA 2BJ9A 4O23A 4O3NA 4TQSA 2XMWA 4QIGA 2QZ8A 3OL7A 2XS7A 3MXHP 2XGQA 3H5XA 2I5JB 1RGVA 2WVEA 5DQGA 2GNKA 2K1RB 4PG6A 4USIA 4UUWA 4YHHJ 1QVGR 4DR2J 2ALZA 4MFBB 9RUBA 3K57A 1U48A 1NKEA 1TU0B 4GKKJ 3PZPA 1OSDA 3OR2A 4ZVGA 1AB8A 3K5OA 4WWSA 3M32B 3I87A 2BEFA 2B9YA 2IJNA 3CCUS 4ECWA 1Y0HA 2W2PP 1WC6A 3SEOA 2ADBA 3DOMB 2BA9A 3SBMA 3QIPB 2ZBQA 1H6KX 2CVEA 5KFQA 3PFEA 4I56A 3BSNA 5T41A 3RAQA 3GG1A 2JWNA 4TQRA 2ZC4A 3KJNB 3Q8SB 4WK1A 4TLRA 1IQTA 3GMGA 2PT0A 3Q2TC 2RAQA 4U96A 5ETSA 4AXJA 2FHJD 1BLUA 1DTTA 4MJKA 2R8HA 4A8MP 4NRUA 4X4TA 3V4IB 1F9FA 3N6NA 4DR4J 1OY9A 4IOBA 3M6VA 3TZZA 2F8EX 2KM8B 4LIRA 4HDHA 2DPJA 1TKXB 1PYTA 2V8HA 3GFXA 2YNIA 1C0UA 1H0HB 1C0UB 5IV3A 4DFPA 1UEKA 3G6VA 1RJJA 4H4OB 3OXFA 3TI0A 4QPXA 1FRLA 2NXUA 4LSLA 3T41A 5L1KA 4DL5A 2LXUA 1BC6A 2AZ1A 2PMZD 3D9BA 3MPWA 2DNKA 3P4UB 2ROGA 1NDLA 1SPBP 3GSDA 4ZS6A 3M9NB 2M8HA 1FRXA 1S57A 1S9EB 2IJFA 3F56A 1VQ7S 2NXCA 5M2PA 1YIJS 1CSJA 4L76A 3Q8PB 2AYGA 1UWBB 4OHWA 2YKMA 2YPYA 1IKXB 1XR7A 3CJRA 2RJZA 5CXTA 2MJUA 2ACMA 4I2PB 4R25A 3MD3A 1TV6A 1EP4A 2YPZA 3FZBA 5KG6A 1FK9B 2BQUA 2V8PA 4JV2A 4A8OA 2AX0A 2BACA 2QA4S 1NNDA 3PIPQ 2VPZB 3V81A 4QZVB 3KLEB 2OGUA 3LP2A 4IH6A 2VJVA 4DQSA 4P2SA 4U7UD 1N5YA 3J81j 2FJAB 1RK8A 2OPSA 3CJ8A 2AKWB 2D3ZA 4NMLA 5JVHQ 2BDPA 4X2BA 1Q4RA 3RR7A 2J9EA 3TNVA 3W60A 2VHGA 4B9LA 4KTQA 3ZZTA 5LSRA 3EVMA 1HI1A 3J81Y 4ILRA 2LQ8A 2MKHA 1RSCA 1RWPB 2GQCA 1RHUB 3Q8VA 2Q6BA 2M3DA 2FIUA 2FB0A 2YBVA 4HT7A 2AEMA 2W9AA 4WZQA 2UV8G 2N3OA 6FDRA 4LF9F 1IBCB 4DQQA 1VIOA 4BWMA 4EBEA 1TKZB 5FDLA 4NXNJ 5A6PA 1N33F 4UOFA 3TZWA 3FFIB 3CDBA 4XPEA 2QMWA 1EIYB 4KE5A 4DX5A 1KNZA 4P71A 2Z4PA 5THWA 4YB1P 1V5IB 4ILMA 1FDAA 2A2CA 3KG4A 3MEGA 6FD1A 2B43A 3G96A 4RR5A 3WX8A 4DUYJ 3DRPB 5LXYA 2RU3A 3MUMP 2VPXB 2E5LF 1U24A 4URGA 2WHOA 2BMBA 2ILYA 3LALA 3MR6A 2XB2D 3HM9A 2CADA 2LKZA 3I96A 3KJFB 2DISA 2PA8D 2NZCA 5KFFA 2DJWA 4EGLA 5D0GA 3HVWA 2ZBPA 4IDKB 4Z37A 4U8YA 1T02A 2C2OB 2YKNA 1MN7A 5EX0A 3A8JA 5KT5A 3VVUA 2ZH4A 1SL1A 4DV2J 2HGNA 4OQJA 7FDRA 3HCXA 3J7YU 2WBRA 3UDLA 1WELA 1RAGB 1TUGB 4XAKA 4ZP8A 2MKIA 2OPQA 2ZKTA 2DYAA 4USJC 3DYAB 1WG4A 1M1KT 3CSKA 4N7TA 5L8RC 3Q22A 2Y0SD 2JC0A 4P6QA 3W64A 1S0NA 2PSZA 3MM8B 2VKZG 3JSBA 4NA3A 3T9ZA 2BRLA 3THTA 5F9NA 4NMXA 2W1BA 3L9ZA 4XO0A 3HT0A 1FFSB 1RLDA 3NAHA 4ZCIA 2VV5A 4B9TA 2J6TA 1QM9A 2MGZA 4RUCA 3EMTA 3I0SA 5E3PA 1FRMA 1SB6A 5KFZA 3PVXA 3T5LA 1QE1A 4JI0J 2O1PA 2X1GA 1T05A 2KM8C 1UPPA 4OZLA 1DBDA 5SUHA 2I0XA 4DR5F 1LFPA 3VGSA 3MCOA 2CQ0A 1ZZFA 3PRBA 4ED3A 3VHQA 3O6QA 2J8SA 4LSNB 1YJUA 2GS8A 3CIMA 2KXNB 2Z0GA 1S72S 2CPZA 3VGVA 4PQUB 1OPIA 4MK9A 2HGMA 1VC0A 4C7QA 2RHSB 4WYWA 2IHR1 4LRAA 1T9TA 3I32A 3M2UA 1LWCB 1LKZA 1TAQA 2VDIA 3W9IA 3R7NB 4A48A 1EQ0A 3L09A 5DLGA 3KK1B 3PX6A 4FVCA 1TAUA 4K4UA 1VMBA 4ER8A 3CTRA 2YWGA 1UVJA 5D4NA 4LMZA 3TYTA 2ZOGA 4FPRA 3SV4A 3MAAA 4WP9A 4DR3F 3HI9A 4QW8A 2HAFA 1SVDA 2XQCA 3DCAA 4TYBA 3KJVB 2GV1A 1T3OA 4MKAA 3R7BB 2CVIA 4OZ0A 4OI4A 3K59A 4DF4A 4ID5B 4M8LA 2ZNZA 3W5YA 2DB1A 4F0MA 2VF3A 3J7Z5 4OZNA 4Q44A 2LFVA 4RW9A 1X4HA 1ZZNA 1KN6A 2G0IA 1VBKA 4F0KA 3GIJA 2OPQB 4PR6A 2RNEA 2UUTA 3E8OA 4ZN1A 4OJ3A 1REGX 2ZOMA 4ZP7A 4ZVFA 4K0KJ 4ED5A 5JMNA 4DR5J 5C25B 4OMFG 4NXMF 1YJTA 3RBDA 2KT5A 5CABA 1LWEB 1RZMA 3PO4A 4OX9J 1N5SA 1RT5B 1PBUA 4RX6A 1S4FA 2PIIA 2XMVA 2AYEA 5HI7A 2FVSA 2MKYA 4JV5F 3RRKA 1ZTTA 2LVWA 2J6UA 5B0EA 1N56A 4W4MA 4LF6F 3GFZA 3AJ1A 1N88A 1X4EA 4B3MF 1KP6A 2FYXA 2OTJS 4FF3A 2FZCB 2FDNA 3PCOB 1ZTWA 4ED6A 3QO9B 4PQAA 1VQOS 3R5CA 2EVZA 1AFJA 1H2TZ 2IMOA 1S1UB 1NBEB 4DR7F 1TKZA 3N5BA 5FDLB 1LW0A 4CT9A 2CWKA 2N7YA 4IG3B 3CJ3A 4F04B 5LXRA 2M5YA 4Q0BB 2X51A 1JXEA 3DKDA 4IFYA 4LF4F 3DGPB 3GFHA 3TUPA 4CLFA 2PEHA 3G82A 1YQHA 3VQSA 2DR9A 2HK3A 1VHIA 4CLLA 3TAPA 2CQPA 4RW7A 3R2CJ 4QW9A 1LW2B 4GVLA 5E2QA 3SQOP 2G0CA 1YTYA 2HGLA 5KG3A 1IBMF 3SDEB 4O0IA 5C24A 1S1XB 4PPDA 4IQMA 4J5OA 1QJHA 1UMJA 5JXSA 5ETLA 5IV4A 3IAS9 2J0SD 5IM0A 1KTQA 2EK6A 4EBCA 2C2ZB 3GCXP 2L9WA 1VS3A 1JLAA 2CDRB 4TN2A 5DJBA 2QGFB 3RB0A 5HP1A 1NPRA 4HACA 1LV5A 1JK9B 2ZHOA 4PUOB 5GADU 4NOHA 4I2PA 2RT3A 4B3TF 4OL8A 2XYGB 1NSQA 5DDRC 2BM0A 4OX9F 2GJIA 4GMKA 5I42B 3K2YA 5CYMA 2MY8A 1HBOA 1YKWA 2VFRA 1PIEA 2B4VA 3BZQA 3THVA 2L48A 1S9EA 2ASJA 4ZVOB 3DRSB 2EC2A 2AEJA 5KOXA 1RADB 3BPDA 3K8VA 2UV8A 1KRPA 3NL0A 5A8WB 3RUBL 3BBCA 3LPEA 4OYPA 4QIEA 4J9VA 4R8UB 3SV3A 1XNRF 4G6VB 4YMEA 1UL3A 5I3UB 3TR5A 4CTAB 3OFFA 1KWMA 1F5AA 2ZVIA 2ZH6A 1D9AA 1TKDA 2QMXA 3H42A 3OFEA 4OX8A 2HURA 2KYXA 5HMYA 3OLBA 2NQPA 2MLXA 3PW2A 2UUBF 2N4DA 4O3SA 1A9NB 1OY8A 3Q24A 4JB8B 4YY3F 4KYZA 4CWBA 5SZTA 1JJ4A 2FHKA 1VRQC 4HHJA 3ENWA 3ITHA 3ZZUA 2HHVA 4OYZA 3IWLA 4OJHA 2RF2A 3GSIA 2XS2A 4EMDA 4QWCA 2C2RA 3W2WB 1SUQB 2GMLA 3FZ2A 2V50A 3I82A 3P6YC 1NK0A 3CO0P 4RNHA 4IH7A 3CC2S 5JVGQ 4RZRA 4OYOA 1TELA 4MKVA 5D3GB 3PV8A 2GMHA 2XMAA 1YJWS 1UEVA 3HD2A 2WAQD 3P5BP 2KRRA 4QYZJ 1JLBB 4YR2A 3NNHA 3DLGA 2I2YA 3FMBA 2ZH9A 2RUGA 2POKA 4DV3J 2CPIA 2LXFA 5DZ6A 2ZUGA 1WEYA 3ULHA 4X4NA 1HNVA 4DU8A 4W98A 5RUBA 3A4TA 1DLOA 2JFDA 3GJQB 9ATCB 4ED0A 5AJ3F 3WZ0A 4YQWA 1O8BA 3EWGA 2W9CB 5E7OB 2JEFA 5HJYA 3MR3A 2I5JA 1SI9A 3QT8A 2MB0B 1MSWD 4B9UA 2CA9A 3KYLA 3PRDA 3U1MA 1I5OB 2W01A 4HI1A 1JJCB 3OTDA 4J90A 4PG7A 4LFAJ 5T7LA 5L1JA 1Y7PA 2GVZB 3MTJA 3UD3P 1C1BB 1CJVB 1G4CA 3G8TA 4BDPA 3JAMU 3GQCA 4ZOSA 4M95A 3C14B 5IQ6A 5IT9U 3NBPA 3CCMS 2F9DA 5K14A 1FJGJ 2MZRA 2J7WA 2D74B 1SH2A 1N32F 1HQ2A 1LXJA 2PFFB 4YY3J 3PFOA 5A2QY 3EX7B 4LF5F 3NGTA 4EO8A 2FVPA 3CD6S 5KOWA 5KFMA 4NYPA 3HKWA 1E6YA 4HVZA 1BXNA 4S0MA 5FLXY 2ZC3A 3H2VE 3QT6A 5A8KB 2H54B 3ITHB 3OHBA 1K9MT 3NBPB 2ZITA 5KFIA 1RHRB 2YX7A 4FYWB 1FE0A 2QA1A 3LH2S 4DV4J 1TL7B 4LFCF 4EFAC 4QU7A 4NCBA 1TFYA 2QLWA 1FTCA 5LT5A 4NZ7A 1JXVA 1WF2A 1KBRA 3D3BJ 5DG8A 2FJVA 1CC7A 1J5EF 2J6SA 4B3SF 2XSJB 4ELVA 4F2SA 1XK8A 1WKLA 4ZN3A 5HMWA 3JSMB 4Y0FA 4G65A 3AH6A 3KK2B 3M1VA 4WFBQ 2IYGA 4HEA9 3CC7S 2GAGC 1BD6A 2B51A 2F8HA 3EE3A 2XHCA 1C1CA 2F1FA 3IC1A 1EZZB 5HROB 5DDQC 3RB6A 3HK2A 2MSTA 4ID8A 3RGIA 2KFZA 4J9PA 1L3TA 4RBUA 4ZVUB 3PW5A 1U7LA 3CCES 4W90B 3DRXA 4LT6A 1TVRA 4Y00A 4XK8C 2O5DA 2ZHBA 2O66A 3MAHA 3DXSX 1TTHB 3KMQA 2VA2A 3UFCX 4C3MA 2YQ1A 4XIUA 2A6OA 4CO5A 4YOEA 5LMNF 5IZHA 3GIIA 4RWWA 1TR0A 3B4MA 4P74A 2E66A 2F8MA 2ATCB 2DY1A 1ZA1B 3CO9A 1HNXF 3TUJC 3FRZA 3KDOA 1YZ7A 3FMWA 4ED1A 4KHRA 1S10A 3UI3A 1AUDA 1RAIB 3BGRA 2LDIA 3H5SA 1UEUA 5KFWA 3DLLQ 2KRBA 2VC1A 5C24B 4TNOA 4JI7J 3RBXA 2W2QP 5I4MA 3MPUB 4A47A 2FZKB 2B3TB 3PNIA 3HT3A 2CIMA 4AUKA 1PSDA 2EWHA 3MMBB 2LEBA 3MCNA 4PEOA 2CPEA 1RHJB 3DU6A 3US5A 1ELOA 2XYHB 2DR6A 1NJXA 1TK5A 1MLAA 3EGWB 3MPYA 3VZHA 2ILZA 1FWLA 2A3JA 1S1WA 3DLEB 4NYOA 2V2QA 2VIHA 2Y1IA 4DLGA 5F8IA 2UXBF 2VQFJ 4C8OA 2W9BA 1WTFA 2BOAA 4LIWA 5KFBA 3QO9A 2GJFA 2XCPA 1GMUA 1TMMA 2EC0A 3J7AN 1HKAA 1Q16B 1EJ7L 2AJ2A 3WBZA 3ILOA 2JX2A 8AT1B 4A46A 5ITHA 4DV7J 1GEHA 2AMCB 1JJHA 4K4XA 3FEYB 3FC9A 1FO1A 3VQTA 3M8RA 1DHMA 3C2PA 4U67Q 3TJ8A 4OLPA 2R8IA 2I8EA 3NXZA 2KTQA 3PYEA 3OD2A 1GX6A 2OD6A 3QAEA 4Q45A 1IKYB 2Q66A 1MN9A 2RMLA 4DJBA 3FVYA 4UY8T 2UXDF 2EKYA 3QFWA 1N48A 1DURA 1RQ0A 4AQYF 1KDNA 5ETRA 3KNAA 4JI6F 4RNNA 2YY3A 1ZPWX 1T9WA 4OJGA 2WSCC 1B0TA 1R89A 2O01C 3OQ2A 4KPYA 3K89A 1HIYA 1S59A 2QX0A 3MHYA 1XJWB 2HZVA 3KLGB 3QGGA 3WX4A 4ID5A 2IC3B 1NH7A 3D67A 4WZMA 1QAYA 5HVFA 3NS6A 3CD0A 1JJ2R 1NJIT 2MZQA 4B9SA 3T5JA 1UA1A 2HFUA 2J7KA 3FUYA 3D3CJ 3DMJA 4RWXA 3OPKA 4N8NA 3IWNC 2FJWA 2LDYA 1U2RA 1EARA 4DSJA 2CPYA 4JI1J 4B3OA 3BGLA 1HBMA 5GAGI 4KO0A 2R9LA 3EGZA 4N56A 1U1PA 1ZM4A 4X4RA 3H5YA 2HNDB 1RWNB 2GX8A 3N0VA
chains in the Genus database with same CATH topology
4JYAF 4UQTA 3WDOA 1P1TA 3BQ0A 2FY1A 5KG5A 2PE8A 2YNIB 3UQSA 3DFEA 3BEGB 4YB7A 3R5DA 4WFAQ 3V4IA 3RB3A 1TK8A 4RW8A 1L3KA 3DOKB 1H2VZ 3O2IA 1XMOF 1ZYQA 4R5PB 2GW8A 1DQ9A 3I9V9 2GJ2A 1JLEB 1YVFA 5J1EA 1MU2B 2QEXS 1SKSA 3DOMA 2MZTA 4IYQA 4C8ZA 3SXLA 3MAQA 3RU0A 4RU9A 3HX9A 4MAKA 5AE3A 2IM0A 2V4JA 3MDFA 1YRUA 4ERDA 2FHOB 2MQPA 3PEHA 2ZJPQ 4I69A 1URRA 2YKQA 2DGUA 4EBDA 1WWHA 1HMVB 4QBUA 2GHVC 3J7ZT 4CNYA 4TY8A 3GV8B 4J9LA 2IM3A 4NYZA 4O3OA 1R8BA 3PM9A 4KV8A 3VAMA 2B5JB 2G13A 1VQYA 2WBMA 4Y28C 3OL6A 3MPVA 3JSMA 4EO6A 3UCUP 3DLHA 3H25A 5J2QA 4PCQA 4DUYF 5JUMA 2G1DA 5J2NA 4F8RA 4QU6A 1Y3KA 5B7WA 3Q8QB 3CEDA 4G1QA 1FXLA 4ECQA 3MECB 3OBIA 5MAOA 1SJ4P 3H5UA 3TX8A 4LF7F 1MROA 2P6TA 3TA2A 1QSYA 2RILA 5KG4A 2KH9A 1ROFA 4UOCA 1S97A 3ICLA 2XSFA 1T05B 1V3ZA 3LUYA 2C22A 2P6SA 3M2RB 4RBTA 2E7WA 5KFNA 3OJSA 1FJCA 4KGMA 4Y2CA 1VC5A 1X4CA 2G4BA 2C2DA 1RT4B 5HQ8A 4GO7X 2ABYA 4K4TA 1EETB 2JL9A 4PWUA 3TUIC 4A4JA 1KOOA 2DGXA 3TANA 3MM9A 1KEKA 2GO8A 1VJWA 3DOKA 4JI0F 2DTJA 4O3RA 4Q43A 1DZ5A 4C98A 4EEYA 3M1VB 3OSNA 2HFNA 3GIKA 2DR7A 4ZPCA 2P5VA 3DLGB 4HYKA 1C2PA 1HI8A 3KHGA 4NLPA 4M94A 4FXVA 2DIUA 2YWEA 2LECA 3EGNA 2KU7A 1JLFA 2HG4A 3HHLA 3MWBA 2R7TA 2EG1A 1RTDB 1RYSA 3R27A 1FF2A 2ERRA 4I6WA 1X5TA 3W3SA 4Q2MA 3IG1A 1IQZA 3DHWC 4KQZA 5E33A 3HVTB 1QLNA 2Z8QA 1QSSA 2YVSA 2MYFA 3ISNC 1RT3A 5IWAF 3OTOF 5DQHA 1FKOA 3IS9A 3D0HE 2B9WA 2DNNA 4URQU 1NK5A 2OH2A 1XNQF 4HI2A 3LO3A 5L1LA 1VBZA 1UVNA 2ZE2B 2BM1A 4IO1A 4PXEA 3DOLB 1BQXA 4IKAA 1X4AA 3GE9A 3B78A 2BV3A 3HXMA 1OQ6A 1XMBA 3HVRA 2DNHA 1GXUA 1F5BA 2IBOA 5AXMA 1WACA 5D6GA 5A8WA 1TKTA 4JUZA 3FQLA 4GKKF 3SZ2A 1IR0A 2J76E 3RAXA 1KSPA 2MDAA 2HWHA 5IFMA 4DQPA 5J1NA 1U26A 4B9MA 3QIPA 1VQKS 1ZAWA 4AL5A 2DGSA 3TQ1A 3QLHB 1ZBTA 2N4CA 5H9FJ 1TL4A 5DDOC 1L3SA 3SFGA 1R27B 2YKMB 1FD8A 1TZ0A 2KI2A 4MYTA 3ISND 1WF1A 4TLQA 4YB6A 1U6ZA 1FKAF 3BN4A 3BS9A 4MIWA 1CC8A 1GNKA 4DR4F 2JC1A 3DLBA 2FHMA 5F8LA 4QWDA 2ZH7A 4J9QA 2OIHA 1KQKA 2VKRA 3DLEA 4DF8A 5EWGA 3V6HA 4AYBD 5F0UA 1N36F 4DSFA 4L3NA 3MEDB 2J0WA 2RE1A 3G9CA 2VFTA 4RW7B 2JH3A 3DOLA 2ASLA 1HD1A 4DFMA 5A8RA 4I2QA 4ECYA 4NLRA 1S77D 1JLGB 2AGPA 4YEAA 3ONQA 2WONB 2IRYA 2QO3A 3I5CA 2ZH3A 1TL1A 2NPFA 2XMKA 5KFUA 2VG5B 4N47A 5L38A 3CF5Q 2ATLA 3S6EA 3MUTP 1HBOB 1K1QA 3HHLD 1RTIB 1M5KC 1M5HA 2W7OA 1VK8A 2K7JA 1UFLA 4MMOA 3MURP 3R1LA 3RB4A 1RTHA 3CJKB 1S7HA 1R0AA 1XC9A 2KKHA 1RT1A 2M4MA 4JBCA 4ES3A 1KQFB 1T7PA 2V4QA 4Q7AA 3LP1A 2XNRA 4AXIA 1JLAB 3JTOA 4UW2A 3KMSA 1JB0C 1NJZA 1FCAA 2D41A 4WJBA 3KLFB 5FJ4A 3P5TL 2BW2A 1GXTA 2HYIB 2HAIA 1V3RA 2L41A 3C6TA 3KK2A 1LXNA 3KG1A 3RAMA 2P9GA 3CJ0A 3MFHA 2CQBA 1X9SA 2IBKA 1LW2A 3BO4A 2GGPB 1EETA 4P7VA 5J2PB 4NCAA 5MLCV 1CPZA 4F4YA 1C0TB 1CQMA 3DGPA 3OR1B 4N77A 1U49A 3LOUA 3CXCR 4JI1F 1HPZA 2KZMA 5BYQA 2XMTA 2V5HG 1Z1ZA 4ZLPA 3AJ2A 3T6JA 1N6QB 3IG1B 3M2VA 1A6LA 4V19X 1B0PA 2B4PA 4L72B 5DDPC 4FZVA 2ACYA 4DDFA 5HMZA 1B0VA 3S8SA 2A10A 1RT6A 1UFWA 2L3MA 4NLWA 2BXJA 2GMJA 2ZZNA 4BS2A 4B02A 3PR5B 3M30A 4LUBA 1F0XA 5AXKA 1Q81T 2HNYB 3O44A 4JI3F 1YRTA 2DCLA 2RVJA 3GWCA 1GAOA 3NGKA 5C25A 3BGUA 1JNRB 4C11B 3CC4S 1NK7A 1RAJA 4IO9Q 3X3UA 2GQ2A 3V4MA 2CZ4A 5GVQA 3MM7B 5CHCB 4F26A 4KAIA 2KT2A 4A8FA 1ZM3A 4FXWA 3NMRA 3OFHA 2RRBA 4ZPAA 4ELUA 2E9ZA 5KT2A 1XERA 2FC8A 3QJJA 1X4FA 1PC4A 4KB7A 3VAFA 4GC6A 2UUCF 2VPWB 3LGMA 2YKOA 2AGOA 5DRKA 3BQ2A 2CYYA 4KGKA 5KFXA 1RP5A 1HBNA 2YKAA 2YNHA 5EWEA 1MU2A 2XO7A 5D4PA 5KG2A 4J9OA 1GTHA 5KFYA 3MMAA 3DLKB 1U1NA 2GQQA 2E7XA 2XWXA 1VRTA 2IRUA 2V4RA 3PO5A 3BSCA 2ZBIA 4FBTA 2VG7A 4RW8B 1R31A 2M8DB 4DV0F 3LW5C 2KFYA 1FJ7A 1RDRA 3CD5A 4FP9A 5J2NB 3KNGA 3CDWA 3M30B 2CFXA 2R7XA 2KYZA 4M5DB 3K5NA 3DHXA 4G1PA 4DLEA 1FA0A 1VQ6S 2AJ0A 2DR8A 2LLZA 3B82A 3M2VB 3L7PA 1NHUA 5KG1A 4KFBA 1UVIA 2JVOA 4WFNQ 1HQEA 4DL6A 3PJXA 2KHCA 1QE1B 5F9LA 1VQ5S 3CDUA 1HPZB 4DR2F 3HDSA 5CYMB 5LSLA 4XDDA 1RKJA 2MGZB 3PR4A 2XBPA 1IM4A 3HFKA 4OZJA 4KSEB 1YJNS 5GAGU 4LQ3A 3E2EA 1CLFA 3ENVA 4RW4A 2E1CA 2OP5A 1HWJA 2KN4A 4FNIA 4ZMMA 1DQAA 4DEZA 3FSIA 2JSXA 3MM8A 3M6UA 2L9DA 2GO9A 2PI5A 3DNCA 3IR6B 1JNZB 3DDNA 5IM0B 3JAMY 4ICLA 3QGHA 1VK3A 5F8JA 2EFPA 5AE2A 3M4XA 4OI1A 3OVAA 2QT7A 2VB6A 1GQEA 2JZ5A 4I64A 3SDEA 3KLEA 3PW0A 1MW7A 2DHAA 3IR7B 3HHNB 1S1VB 4LVNP 4Q8EA 5B09A 1FNXH 3FDSA 1TV6B 1UJ4A 4M1KA 4ZP9A 4NCGA 2MQLA 3GIMA 1H2UX 2IVYA 5BYSA 4QYRA 2VUGA 1X4BA 4IG3A 2QIFA 2XC9A 3FSYA 1NKCA 3RZAA 1LQ9A 2XWYA 2V2KA 3H4DA 1I94F 3BGFA 3CCVS 4N5SA 4J9RA 4DR1F 1S1WB 2Q1LA 2V94A 2A1BA 4PXBA 2B56A 2C3PA 4LSLB 3K0JA 2E9TA 2R7RA 4C8LA 1UJ5A 3CDEA 4TYAA 4ZVEA 2CQ2A 2O3DA 1PC5A 3ZZYA 4FF2A 3M8SA 4F4XA 5E3CA 5C5JA 1OQ3A 3TO8A 5J2MB 3AA8A 2HIQA 3EPGA 4ILLA 2HVIA 1HARA 1U25A 2R7VA 3TA0A 4RNOA 4NLQA 3C8YA