1U25A

Crystal structure of selenomonas ruminantium phytase complexed with persulfated phytate in the c2221 crystal form
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
TEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myo-inositol hexaphosphate phosphohydrolase
publication title Structures of Selenomonas ruminantium Phytase in Complex with Persulfated Phytate; DSP Phytase Fold and Mechanism for Sequential Substrate Hydrolysis
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u25A01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 1u25A02
1C83A 1XBOA 4JMJA 5J8RA 5K22A 2J16B 4OHHA 2CNFA 3D44A 5EHPA 4GS0A 3AWGA 5KA8A 1OEMX 2F46A 4WU3A 4S0GA 4PVGA 4ZI4A 1LQFA 2CM8A 3H2XA 5KA4A 3F41A 2QBSA 1G1HA 1OHEA 2OOQA 2M3VA 5HDEA 5K9WA 4QUMA 1M3GA 4WOHA 3AWFA 1ZCKA 3V0EA 1U24A 1V3AA 3MOZA 2CJZA 2QDPA 1VHRA 2Q05A 3SMEA 2I6IA 4B04A 5KA9A 4BPCA 4JMKA 1OHCA 3RGQA 5BUGA 3QCDA 1BZCA 2G6ZA 1I9TA 5KA7A 4J51A 1YTNA 5K23A 3A5KA 1OEUA 4NYHA 3ZM1A 3CM3A 3EAXA 1PA9A 5GTJA 1WAXA 2B4OA 2R0BA 2IMGA 2B49A 2GJTA 2SHPA 3S3EA 2QCTA 5KA1A 2VEYA 3I36A 2H02A 2C7SA 5I6VA 5IBMA 3QCLA 2PBNA 2I3UA 1G1GA 1ZCLA 3V0HA 1YTSA 4QAHA 2H4KA 1YGUA 2RF6A 1OEOX 2GWOA 5BZZA 2VEUA 2CFVA 1U25A 3EB1A 1P15A 1PA1A 1YFOA 3QCNA 4RDDA 5KACA 2HVLA 3I80A 2I75A 3ZMQA 4GE2A 1BZJA 2JJDA 1NWLA 3V0IA 2FJNA 5IBSA 2P4DA 5MMZB 1Q6MA 1I9SA 3S3HA 2F6VA 5KADA 4D3PA 3RO1A 2F6TA 3GXGA 3QCEA 4HRFA 1YPTA 2CNEA 3BLTA 4D3RA 1YZ4A 3MMJA 1LARA 4OHIA 1C87A 1PYNA 2OC3A 3U96A 2ZN7A 3ZM0A 3QCFA 1OHDA 2I4HA 2VEWA 4Y14A 2PSZA 1NO6A 3RZ2A 3S3KA 2B4UA 2F6ZA 1C88A 2PA5A 1ECVA 3O4TA 2HB1A 3QCJA 4MBBA 5M43A 1L8KA 2I5XA 1GWZA 1NL9A 2FJMA 2I4EA 3EU0A 3V0GA 1I57A 4BJOA 3EMUA 4NNDA 4ERCA 1LYVA 2HC2A 2H03A 2Y96A 2WGPA 2OUDA 2H04A 4RI5A 4RKKA 4GE6A 1L8GA 2I3RA 1ZZWA 4PYHA 1EENA 3PS5A 2NT7A 1PTTA 1KAKA 3M4UA 4GRZA 3RGOA 4H34A 4RH5A 1YGRA 4IKCA 5K9VA 4GFVA 3EZZA 3ZM3A 3QKQA 4KYQA 2A8BA 1QZ0A 4NWGA 1QXKA 4GE5A 2H4VA 2PI7A 1Q6TA 4OHLA 5KA3A 4I8NA 4DGXA 2BZLA 5KA2A 4TVVA 2J17A 5BX1A 4Y2EA 1WRMA 3QCGA 3S4OA 1U26A 1G1FA 2CNHA 2CM3A 3NMEA 2OZ5A 2PQ5A 1AAXA 1PTYA 1XXVA 4QBWA 3D9CA 3O4UA 2NT2A 2HNQA 2HXPA 1NZ7A 1JLNA 2BGDA 1G7FA 2VEXA 2HY3A 5BZXA 5LXQB 3F9BA 2NTAA 3N0AA 3QCBA 1J4XA 1YN9A 2CM7A 3GXHA 3D1HA 2NLKA 1WCHA 2HC1A 2Y2FA 5KA0A 1FPRA 3V0FA 5AWXA 5KABA 4Z6BA 2B07A 4H1OA 4YAAA 3O5XA 4ZN5A 2CM2A 2CMBA 1XXPA 1PH0A 2H4GA 4HJPA 1KAVA 1ONYA 1YWFA 1SUGA 4AZ1A 2CNGA 4QAPA 1OETA 3OMHA 1PXHA 3QCMA 4D3QA 4OHEA 3F99A 3ZV2A 4ICZA 2F6YA 2NZ6A 1C84A 4QUNA 2NV5A 1RXDA 2I1YA 1G4US 1RPMA 4ZRTA 2G59A 3O3LA 2J16A 2QBRA 2QBQA 4WTYA 1GFYA 2F70A 1MKPA 1Q6PA 1XRIA 4R0TA 3ZM2A 1X24A 1OEVA 3D1OA 2I4GA 3BLUA 2AZRA 3S3FA 2Q47A 3D42A 4RHGA 2B3OA 2I6OA 1FQ1A 1PTVA 2F71A 3B7OA 2AHSA 1YTWA 4OHDA 3OLRA 2DXPA 4HJQA 1T48A 2FH7A 2CMCA 3CWEA 1D5RA 2ESBA 3BRHA 1Q1MA 1EEOA 4JBCA 4GWFA 3F81A 1C86A 3QCKA 4RH9A 2HNPA 2C46A 4R30A 2I6PA 2QCJA 3MOWA 2QDCA 3F9AA 1Q6SA 2QEPA 4KI9A 1ZC0A 4YR8B 2BV5A 3AWEA 4R0SA 2CMAA 1T4JA 1BZHA 3S4EA 2QBPA 1NWEA 3V0JA 2ZMMA 2GP0A 2I42A 2YDUA 5KAAA 2F6WA 2BIJA 3QCHA 1XM2A 1FPZA 4DGPA 2I6MA 2I6JA 3A5JA 5EHRA 4RI4A 4GRYA 4QBEA 1NNYA 2MBCA 1ONZA 1OESA 3V0DA 2QDMA 3D1QA 1Q6NA 4JNBA 3O4SA 3SR9A 3QCIA 2B4PA 2PT0A 1C85A 1JF7A 1Q6JA 3ZMPA 2VEVA 2CNIA 4GFUA 2F6FA 2P6XA 4NWFA 1PTUA 4NX8A 1G4WR 4WU2A 1G7GA 1A5YA 2BGEA 2A3KA 3LJ8A 5K24A 2E0TA 3QKPA 1T49A 1R6HA 2B4SA 3QCCA 3I7ZA 2HCMA 3BM8A 4KYRA 5K25A
chains in the Genus database with same CATH superfamily
2W7OA 3MEEB 3GFYA 2BM1A 5K22A 3IXQA 2CNFA 3IS9A 2EWHA 2VTEA 1YGYA 5LJ5Y 1RWNB 4YR3A 1L3TA 4A8OA 3AXKA 3I9V9 4IR9A 5CA5A 2VQFJ 4G3IA 2FDNA 3V0EA 5KT6A 1DQ8A 4DQIA 2GVZA 1V3AA 3MM5A 3U7JA 3OXFA 3QFWA 1YI2S 4B04A 3CCRS 2HQFA 4HACB 1X9WA 3JSMA 2HHPA 3Q8VA 4RPFA 2UVVA 1I9TA 1UFWA 1FDAA 3U1LA 4EGLA 4TU8A 3AOAA 2M52A 1P3DA 4CLKA 4KH1B 2QA2A 2Y1JA 5FLXU 2EC0A 4DQPA 5CYQA 1JLBA 1RT1B 2RKIB 2IPOB 1NJXA 5IBMA 3CNQP 3GMGA 1Q7YT 1XN9A 2ADBA 1NK7A 1KOOA 4NA3A 5BZZA 2VEUA 2CFXA 1UPMB 1U1QA 1NH8A 3QCNA 1HFEL 3H8YA 2HVLA 1YIJS 2PEBA 1KONA 4PG8A 5C2GA 2FJBB 1Q6MA 1AYEA 1S4FA 2YTCA 2PFDA 3QT8A 4LJMA 3BBCA 2D3O1 4F02A 4DOZA 4BCAA 2AYEA 1VHIA 2Z30B 2DH7A 3GU0A 4F4YA 3P6YC 3LGHA 2RRNA 1UKUA 4CO4A 4C8YA 1S7IA 2Z2ZA 3B82A 5L8RC 3V6JA 2PI4A 2WHOA 1NO6A 2HBRB 5B08A 4QIVA 2C2EA 2HBZB 5L9NA 5HK4A 2K3KA 1U2FA 2XGQA 4LREA 1WTBA 4OI2A 2XEXA 3Q23A 3PFOA 5KFAA 1F9HA 4NL5A 3CJTA 1C1CB 4V19X 1VQPS 4BC7A 1FRXA 5FIIA 2UZAA 3OFFA 4JYAJ 1BQXA 2MGZA 3K57A 1FRIA 2ILYA 2VA2A 3FK4A 2UXDF 5FDLB 4DMZA 3BGRA 1YLXA 2EXUA 2GMHA 3CW2C 4KYQA 2FB0A 3SZ2A 4F50A 2WVBA 1QXKA 3MEDB 2A18A 2PN6A 1OY8A 4P9SA 2JFKA 3ZM5A 4MKAA 5KA3A 2DRBA 4HI2A 4F0HA 4J90A 3GFZA 3GCXP 1WRMA 4YB5A 2UVUA 5HROB 3MPYA 3W2VB 3SMZA 4ZKAA 1MN7A 3LP2A 3PKMA 1U48A 2GC8A 3AD7C 4LF5F 3BGOP 1KTVA 3M05A 2C28A 1U2CA 4AL5A 4DQSA 1Y5NB 1H74A 3UR3C 2YPZA 1NDKA 2L9NA 3ENQA 5CZXA 1PH0A 1ONYA 3H5XA 1LWEB 3DRRB 1IQZA 2ZDOA 3ET6B 4NLQA 3L09A 1KP6A 2X1BA 2UP1A 3V2UC 4QW8A 4ICZA 4YB1P 1F2GA 2VD3A 3OPKA 3TUIC 5F8MA 3ZTQA 2B9WA 1VJQA 2V68A 2DY9A 3GP9A 4MMOA 1TK8A 4KE5A 4NXMJ 3DGPB 1X5TA 1RQ0A 2DNKA 2ZNYA 3ZM2A 1BQNA 1X24A 1V3SA 3AB2B 1YJTA 3AD8C 4C9DA 3PRBA 4CRJA 4OHDA 3H2UB 5J2QA 2HWHA 1I51B 3DI6A 5LT5A 1CJUA 4B9MA 3NAIA 2OLWA 2VC0A 1OQ6A 1E6YA 5CCLA 1FXDA 3PV8A 4OZJA 4RH9A 2IM1A 2C46A 3MOWA 3Q24A 2OO4A 6AT1B 3MZIA 1RAJA 3M30A 3IRXB 4J7CA 2J0XA 2GO9A 3UE2A 1TAUA 3MPUB 3M2UA 2YKMA 3G8SA 2RILA 3IBFB 4ZP9A 1FPZA 4ZMMA 4NMLA 4ZCKA 5HJYA 2D1CA 1RJJA 5HQ8A 4QBEA 3FSXA 3ZTSA 3G4SS 4EYHB 1SKRA 2EG1A 1I5OB 3TOQA 2OH2A 2VFVA 1GX5A 2XG8A 4NA1A 2JL9A 5DDRC 2VEVA 2F1FA 3LOUA 1P6TA 1PIEA 2VJUA 2BJ1A 5CAAA 1G7GA 3GIKA 4J9MA 3M9NB 3ZM6A 1TKXB 4O0IA 4DFPA 2XI3A 1QTNB 5L46A 2HLTA 3CDWA 4L72B 5J8RA 3D2WA 5HP1B 4OHHA 3DXSX 3G6VA 1FKAF 3MM8B 5EX3A 5G0RB 1VR6A 1V6HA 2ASDA 1FXRA 3TWZA 2Y1OA 4DG1A 3E51A 4JB8B 5E2QA 2NXJA 4CO0A 2AP6A 2BACA 4PVGA 3HFKA 1LQFA 2CM8A 3NS6A 2H65B 1B7FA 1S57A 1SQEA 3PW7A 3MVNA 5D4LA 1UVLA 1KSPA 4ZCLA 4DSFA 2QV6A 2H51B 3CJ4A 3TI0A 2ZVSA 4RW6A 3JB9k 2VFTA 1UVNA 2LFVA 2XYGB 2D3ZA 2CJKA 5IS2A 2MTLA 3VVTA 3CM3A 4GVBB 4BDPA 1WAXA 4OX7A 3A8KA 5KFVA 5KG5A 2LCWA 2MQQA 3SDEB 3DFEA 1DURA 1ZS6A 3T1HF 2DHXA 1EJ7L 3QRPA 1VQNS 4ZCIA 2V50A 2AJFE 3TW0A 2HRTA 2QX0A 5GAEU 1NUEA 3EVWA 2GCBA 4ED3A 3DOMB 3ZMQA 4LQ9A 4DL6A 2X1FA 2CAJA 1SKWA 4B3TJ 2VB6A 5D3GA 2EFNA 4B02A 4QIWD 2D9PA 4M5IA 1S1XA 4OQJA 3MMJA 5A6PA 3WC0A 4DL7A 1K0TA 1QSYA 1RAIB 4ECQA 2PA5A 3EVMA 3ISZA 5J2NB 2PC6A 2H1YA 3A8EA 1VIXA 5HMXA 2NSBA 5KFIA 5J1EA 4DZDA 2H4WB 4ID5A 2E1RA 2R8KA 2I8EA 2C2OB 4FVMA 4HKQA 2F8MA 4RKKA 2HGLA 2VQEJ 4QQBA 5IWAJ 3UDCA 5GMKa 3KNGA 4KGXB 2XY5A 3X1LB 1WOOA 3L9ZA 3ZZUA 4OZ1A 1HW8A 2ZH1A 1TMMA 1LW2B 4I7FB 3K17A 2QLXA 4XIUA 2XLIA 1FNXH 2YQ3A 2XY7A 2HS0A 4TY8B 5B0AA 3K8WA 3S4OA 2XMKA 5F0WA 1K47A 4DXLA 2CM3A 3KLGB 5F8LA 4QBWA 2IDEA 4DL2A 1OJ4A 4G1PA 1ZM3A 4CZCA 1WC0A 3G8TA 2A1BA 2VFSA 3CDEA 2LLZA 2HC1A 1NKCA 1S1TA 3M8WA 3V0FA 1TAQA 2PE8A 2B07A 2DNLA 1N6QA 1YJUA 4QYZK 1PYSB 2JFDA 2MQMA 2CM2A 4YB6A 3R2CJ 5L1JA 2ALYB 5C25B 3P49B 1DLOA 1KFDA 3BSAA 4R0JA 1DQAA 1LEOA 3R5JB 3G6XA 3OMHA 4I1TA 2HS3A 1HD1A 4C0BA 3POTB 1KQGB 3SCKE 3NRSA 2DO0A 2KHDA 4UOFA 3Q8SB 4ECUA 3NLCA 1SJQA 2EI5A 2PFFB 2W2NP 2YKPA 2BQRA 3FBFA 1T0TV 3GFXA 2MHNA 3G9CA 3KLFB 1ZH5A 2CYYA 3R7NB 2AJ0A 1IKWB 1FHTA 4C8ZA 2UUPA 1PTVA 2IAJB 2A6MA 3HVAA 2I1RA 3CCZA 2GCAA 3OSNA 1Q1MA 2GC6A 1H73A 3I0SB 2DNGA 3ITHB 3WHIA 4QWAA 4WZQA 2NZ4A 1YBTA 2LA4A 3TEGA 4C8OA 1WSRA 4YR8B 1RB0A 3GIIA 4K4YA 3KOAA 1RT3A 3UO0A 3NGSA 1RI7A 1JLFA 3AJ2A 1IKVB 2XHWA 2AYBA 1E0DA 1DFDA 1ZTWA 1Q6NA 4N47A 5DS7A 2ZH4A 2NS1B 3FBBA 3MHYA 1E8CA 4DL4A 4O3SA 2KYXA 3JAMU 4NMXA 3Q8QB 1J6UA 1GX6A 3PJWA 1QDUB 1WWHA 5THWA 2XPCA 2HCMA 2XMMA 2IRXA 3K2YA 1B64A 4HTJA 5D0EA 3DRYA 2QA4G 5B0DA 3RR8A 1Y9OA 1D8ZA 2P8IA 2OPQB 2O01C 1WC1A 4ZP7A 1BHNA 5EDWA 1OSCA 4ED6A 4ZI4A 2OPRB 1N33J 1SKUB 2AM2A 4HL9A 3KNAA 4C11A 5JUMA 3P96A 3KWMA 1B70B 2BKNA 1HNZF 5B0GA 4NWBA 2VKZG 3KDNA 3D28A 1B4SA 3MFHA 1H7WA 1NSKL 1ZYQA 2F9JA 3B6BA 2BXJA 4JI7J 3TA2A 5K8OA 2FLNA 1AW0A 1OYDA 4JV5F 2WSCC 1FI4A 1C0UB 4ZIVA 4PQUB 2H4YB 3A8JA 3OVSA 2QL7B 2W25A 1HWJA 4CTAB 4EYIB 3QT5A 2ZHBA 3RU0A 3KLHA 4DR2F 2OFGX 3HHLA 3MMAA 5KAKA 2J0SD 1XMBA 3UD4P 4OJ1A 1VK3A 4DV2J 2BE2A 3THPA 4B3OA 2KU7A 4C6AA 5C42A 1RT4B 2W24A 2DIUA 2MY7A 1S6QA 5KFXA 2CQPA 1S1UB 1EP4B 3GZ7A 2VF3A 4MFBB 1NWLA 4M5JA 2FLLA 3OJUA 3S3HA 4GVLA 5EGYA 2GMLA 4D3PA 3VHQA 1GQYA 3C2PA 1LW0A 3QCEA 3OUYA 3BLTA 3E01B 4WP9A 4NOHA 3PRDA 2ZNZA 3MPWA 2CJ9A 2IBKA 1RWPB 2KT5A 2J0QD 4OZ0A 5HMYA 3KMQA 2AV5A 1J5EJ 2ZH7A 3V0GA 3HVWA 1SL2A 4DS4A 1QJHA 2ZH6A 4ZJOA 4ZS6A 1TL5A 2KB2A 1F60B 2VOPA 1UZDA 2FZGB 4F25A 1HMVB 2BOAA 1KEKA 4BBYA 2J6UA 2DGVA 4QJVA 4PYHA 4RL1A 1XJWB 1NK9A 3ISNC 3RBZA 1PBAA 1FVQA 3KXDA 1CQNA 2YQ0A 4GO7X 4GFVA 3P4UB 1JBWA 5JXSA 3RRKA 2NR0A 1GMWD 3ADAC 3SQGA 2PI7A 2EFVA 2B51A 4JI3F 4RUBA 4GO5X 3BYRA 2XBPA 5K14A 1W2BR 2VPZB 1JLGB 4WE1A 1FK9B 2J5AA 4YQWA 4ZLPA 1Y00A 4I6YA 4CLZA 4ES3A 2V94A 1S6PB 2RUGA 3IGVA 4ZVHA 2OKQA 3BZQA 1HR0F 2BGDA 4ZDNA 3PW2A 4L76A 1DTTB 4PAAA 4IO1A 4D3HA 3D1HA 4K2XA 4C13A 1YJVA 1NRKA 4OYBA 4LBIA 2OHDA 1N48A 4URQU 1ZAXA 4ELUA 4ZPVR 2L3MA 1XXPA 2AMCB 2DH8A 5KT4A 3Q8RB 1F5BA 3CPWR 1VLOA 2MEWA 1O5ZA 1WHVA 4WK1A 3SCIE 2AT1B 2GIRA 4C48A 4DL5A 1T9YA 3CO9A 3ZNUA 4J9QA 4X4VA 4WKYA 1CULA 3EZOA 1FEHA 1IKYB 4A8XA 4A8QA 2MKCA 4Z37A 1KLNA 4OYWA 3ISND 3LPYA 2RDDA 4Y6IA 2YNGA 1YTWA 4QOTA 4OYZA 1AZSB 1RWKB 3PHEA 3NGDA 1UEKA 2ESBA 2FVSA 1WNEA 1GMVA 3OTDA 3Q86A 1JBVA 3Q22A 3BREA 3R27A 3KLVA 1P27B 1W26A 5GAHI 1RYRA 3BQ2A 1Q6SA 3LA0A 4R8UA 3NXZA 1RU1A 1NWEA 3B4DA 4I2PB 2KI2A 2I42A 3R5AA 4ED8A 1KLMA 2FHJA 2VDHA 1SIWB 2XO6A 3EZUA 1P9QC 3IG1A 2HNYB 2MBCA 1YZ6A 8AT1B 3OTOJ 3C14B 3NBPB 1VI7A 4C3LA 4ZPAA 3C16B 4CCHA 2RJZA 3TARA 4ZPDA 3O4SA 5GADU 2FJEB 2N82B 3KJFB 2J7WA 4DJBA 4OJHA 3AJ1A 2CADA 2C3OA 2NPIA 3Q89A 2F00A 4LF9J 2GIFA 2R2TA 1R6HA 4AE5A 1WDTA 3N6NA 2B4SA 2HYIB 4O3OA 4KYRA 1TVRB 4JMJA 3KK1B 4QR0A 3PJXA 2M9KA 4YDDB 1X7VA 2CVIA 4QIFA 3SV3A 4ZPCA 2AJ2A 4S0GA 3GE9A 2OFHX 2FUG9 4MIWA 4X65F 1LWCB 4PWDA 3G6YA 1X4BA 2CPXA 3UCZP 3L4BC 1X4EA 1NHKL 1N5TA 2CQHA 4KY3A 3CULA 1U24A 3MAHA 5IXUA 4NRTA 4X66F 3VGUA 2ZUGA 4ZVPB 4USKA 1ROFA 4LFBF 4U9RA 2QDPA 1VHRA 2C2RA 1IJFB 1NMEB 1OHCA 2Y8YA 2KH9A 1RTDB 3IR6B 4RO0A 3E2EA 4I4BA 5K23A 3W9HA 1FX2A 2HFVA 4M63A 4LQ3A 2FQQB 2HHHJ 3F44A 4YEAA 3EAXA 4HR2A 1T3NA 4UY8T 1YDLA 2IMOA 2MQNA 4OHYA 5K20B 2GJFA 3VF0B 4F04B 2W8LA 1M1HA 3GG1A 4DI6A 4QIGA 3U02A 3WDOA 7FD1A 5DG7A 3PXGa 3K0JA 4RZRA 5LSRA 4DV4J 1BUXA 2V2QA 3DKDA 3KUHA 2V4JA 3EB1A 4NLTA 3L7OA 3RAXA 2K1RA 3NCQA 5GMEA 4GE2A 2AZ1A 3WIVA 3IAS9 2NXNA 5H1SV 4OHWA 1TL7B 9ATCB 4P6QA 2CQCA 1YPTA 5A0YA 3UN5A 1Q1KA 1S1VA 2HFSA 2M8DB 1CQMA 1PYNA 2GO8A 1HNXJ 3PYFA 1VRTB 3MUMP 3CE8A 4M5LA 3D6MB 2FJDB 3QCJA 5D6GA 2I4EA 4BJOA 2VG7B 4NNDA 3EVOA 1LYVA 2HC2A 1XTZA 3HXMA 1HKAA 3P3DA 2H04A 3JYTA 2VUGA 2KXNB 1HBOA 4IH5A 3MM6B 1T02A 1XMOJ 2MQLA 3THVA 3K89A 1EAYC 3CD5A 3EX7B 4HH1A 2ROEA 4JI8J 3OVBA 3V4IA 2I5JA 4DGXA 5DZ7A 4OL8A 1UWBA 3MMCA 2CNHA 4ECVA 4CLFA 1EB0A 1SH2A 1IKXA 2R2SA 3M6WA 2YH1A 4C2MA 5LMNF 4A8MP 3HJFA 3W1YC 2BA9A 4J9OA 1JLNA 3FC9A 2VU5A 2OPSA 3C15A 4ZJQA 1WF1A 3KMSA 3SV4A 1J4XA 3DDKA 3FGVA 4PKDB 2HMIA 2WBMA 2BANA 1ZBTA 2F8EX 4DV7J 3QYYA 3MEKA 1URRA 3DOLB 2ZBPA 2IYGA 4DPUA 1SUGA 2CNGA 2LKZA 2GAGC 2G13A 4USUA 3F99A 2J8AA 2MJNA 4O44A 2W2PP 4QUNA 1RXDA 3KG1A 2Y67A 5AE1A 5AJ3J 1BMQB 4CI0B 3CSKA 2F70A 2EW9A 3R6GB 5KOXA 1EKRA 2PMZD 2WK4A 2HK3A 2DD8S 5IC4B 3BLUA 4P7TA 2ZOMA 3PRVA 3M8PB 4YDXA 3D0HE 2QLFB 3S01A 1DTQA 4CQ1A 3BRHA 4NZ6A 4G1QA 3CCUS 3F81A 2ZKUA 4HACA 2RU9A 1NPKA 1M90T 3I31A 3UW1A 2E1CA 2RVJA 4IDKB 2HHVA 1RTHA 1J5OB 1RWOB 3QATA 1NJWA 3MCNA 3MR5A 3V0JA 3HX9A 1JLEB 1XM2A 5A8RA 3LF0A 4O23A 4K4WA 4DGPA 2Y3YA 3CMES 3G82A 1KOHA 2IRYA 4DV1J 2VODA 4K59A 2MKSA 4NE9C 6FDRA 1N5VA 4F67A 4QBUA 4DSEA 1K73T 1UVMA 1FRKA 3JAMY 1AUSL 4RNHA 4JUZA 2VPXB 4RW9A 1G1XA 1S0VA 4OZ5A 1LNQA 4F26A 2HNZB 4DLGA 4WXOA 2IJRA 1XK8A 4X62F 3DU5A 1FO1A 2YH0A 2LDYA 4CH7A 1PBUA 4DR7F 3PX0A 2MKYA 2L08A 3WX4A 1TKTB 1Q53A 2YWWA 4UTGA 1RT2B 1C4AA 3D5MA 1G2EA 2BM0A 1G1HA 3DLGB 1OO0B 1RWMB 4K0KF 3O5TB 4P52A 3VVUA 2HLUA 1RAFB 3PO5A 5KFWA 5KFCA 1NB7A 2DCUB 2RDJA 1BQMB 1CG2A 3TVKA 1FTCA 3JSRA 5L1KA 4IH7A 2KL8A 5FDLA 1CBKA 4U67Q 3GIRA 1U4BA 1HNWF 1EHWA 3HT0A 4ZLLA 4DZ6A 1RXOB 3CC7S 2IMGA 4R0EA 1PC4A 5HVHA 5ADZA 4KPYA 1OWXA 1HARA 4KV8B 3T3FA 2AGQA 5KFTA 3W2VA 5E7OB 2H4KA 3RB3A 4FS2A 2P6TA 2QSFA 4Q7AA 4PWUA 3H25A 1P15A 3V6DB 1NK5A 1QVGR 3VV2B 2AEJA 1D9DA 1U1PA 4LBPA 1VQLS 4DSJA 2UUCF 4K5SA 2ATCB 2JVOA 1GTHA 4KO0A 1LWEA 3DRRA 1BY9A 3ET6A 3OFHA 1YRTA 4UZCA 4ICLA 3TAMB 3VQSA 3AOCA 1XEZA 3E8OA 1JKHB 3ZZOA 1BC6A 3S8SA 1FE4A 2DGSA 4DUYJ 4U7UD 4ZN3A 2CJYB 1RAEB 2WOMA 1L3KA 5IM0B 5DGBA 3T41A 3BN7A 4IFVB 3DGPA 3QMQA 3H0PA 1C1BB 1FFSB 3OHAA 2HRUA 5DQIA 4CIOA 3FQLA 4FS1A 3CJSA 4DSIA 5B0FA 1NKBA 2YY3A 1KAKA 1BWEA 3NP5A 3NCPA 1ZTTA 1YGRA 1TL4A 2BE9B 2OPPB 1XERA 1I94F 4S0MA 1KVJA 4IQMA 3VAJA 4GE5A 5HLFB 1Q6TA 1K1QA 2KHCA 5KG3A 2JOQA 2KRRA 3IRXA 1FESA 3QLHA 4Y2EA 2HFUA 2V5HG 3PZPA 3FMBA 2BOPA 1BWVA 3D66A 1AAXA 1IXKA 4D3GA 1KD1T 2ZC4A 2AX0A 3MFIA 1RYSA 4LVOP 1FNOA 2YKAA 2GVDB 2J8SA 3G87A 3QCBA 2CJQA 2NLKA 1WCHA 2V8HA 4Y28C 3CJKA 3H5UA 4YAAA 2QYGA 4JI6F 3Q8PB 4WKRA 1O0PA 3F0NA 2CG8A 2Y0BB 4GKJF 2NYHA 4Q8FA 2XSJB 2DNQA 3I56S 2R7SA 3DYAB 3QCMA 1VYAA 1X0PA 2BJ8A 2NV5A 2LXIA 1GXUA 1FRMA 5HP1A 3M2RA 2A6OA 2E9ZA 3SCLE 1PGZA 3MM8A 4B9LA 2F4VF 3OW2R 3BM7A 4IQXA 5MAOA 1SUQA 4Q5VA 1B0TA 3EGWB 1JNRB 3T5LA 2JFGA 3QSIA 4CNYA 2HWIA 4C8KA 5J2PA 1VK8A 1RGVA 1X9MA 3W7BA 2R7OA 2E5GA 2I2YA 2HNPA 1MWQA 4A8SA 4FKXA 4R30A 3GV5B 1NEEA 2VBWA 2W1BA 1NPRA 3IFEA 4GVBA 2B9YA 1T4JA 3BO3A 3DRPB 1MMNA 2UXBJ 3IRWP 3HD2A 2E1AA 4IG0B 3QCHA 4MYUA 4EO6A 2HEKA 2I6MA 2V0NA 1TKZB 2HVIA 5EHRA 4RW7B 1F1BB 1VDHA 1R0AB 5KFYA 2J9EA 5BJRA 4B3MF 2QDMA 1J27A 2VG5A 3PY8A 5BYQA 4JI5F 2JHEA 2V63A 3DC2A 4JI2F 5KFUA 3D67A 3KHLA 2ADCA 1G4WR 2HWTA 1DARA 4PRFA 2RAQA 4DV5J 3MTKA 2E0TA 3RW7A 3B8HA 3CCSS 2MKHA 3HM9A 1RWVB 1HBNB 5LJ3Y 4ENOA 3G6ES 5DLGA 1AFJA 4LF7F 1RA6A 1ZZFA 4IO9Q 1R3NA 3MR2A 5T14A 4I2QB 1QUVA 5F8IA 1RWUA 2NYIA 4QUMA 1WEYA 2Y1IA 1WHXA 2VV5A 1VC5A 4BC9A 2QG9B 5SUHA 3D6FB 3W64A 1P1LA 3MURP 2D41A 3HSJA 1NNDA 2UU9J 4I68A 3A5KA 2EVZA 1PA9A 5ETLA 4C7QA 4H4KA 1LW2A 4HHUA 4W90B 3DLEB 4HYKA 1N5YA 2N3LA 5F8JA 2F40A 2JFHA 4FF4A 2D3OR 2C7SA 1OSDA 2MPUA 4TY8A 4AYBD 3VR1A 1BXNA 1TUGB 3HVTB 3KLGA 4X64J 5KG2A 1TMJA 4ZPBA 3T1AA 1C0TB 1RHUB 4K8RA 1U25A 2B3TB 2KZZA 4LF8J 4Q43A 5A6WA 5BYRA 3QT6A 2IM2A 2IM0A 3DRXA 2IDLA 4FVCA 3AH6A 3LAMA 3AQPA 5C25A 3W8GA 3J7AN 4M1KA 5F0UA 2NZCA 5ETTA 4ZVQB 1UA1A 2ZN7A 2FHMA 1GTEA 1FJGJ 2VPYB 2E5HA 3PYDA 1C88A 4OX9F 1WEXA 2DXEA 3QAUA 3O4TA 3FEZA 3POTA 1AFIA 3PIPQ 3HHLC 4DR4J 1KR4A 5I42A 3IWLA 1P31A 3A8IA 2M7SA 5L1IA 1ELOA 4LSNB 2EG2A 2OMOA 2RS2A 3DMJB 4DV0F 5E3RA 5BR8F 5CD4A 2BW7A 1ZZWA 1HNIB 4LMZA 2IAJA 4H34A 4RH5A 3GSDA 3ITHA 4UOHA 1NDCA 5GVQA 2CPEA 4R25A 3LAKA 4KAIA 3I32A 4UY85 2R7TA 1AXQA 4LF4J 1FT8A 1NCLA 1BLUA 5KFSA 3LUYA 2VEXA 1IKVA 1HWLA 4ZVFA 2L9WA 1U02A 2QN6B 3B4MA 3TEHB 2AD9A 5AWXA 5KABA 1N34J 2HVDA 4FYXB 2DEJA 3MAAB 2W2QP 1PILA 3KDOA 2NREA 3DHXA 4DV6F 5CYJA 2HZVA 5KOWA 4IRDA 3W2WB 3IS9B 4K5RA 2DBBA 2KVQE 3HHLD 1PXHA 3MPDA 3FJ2A 5AXLA 3I5AA 3RB0A 4EEYA 3ZV2A 5E5NA 3JTOA 1C84A 4RU9A 4FF3A 1RPMA 1RCXB 2V8VA 2G59A 4N56A 4QR2A 3E3XA 4ANDA 1MKPA 3AD9C 2OPQA 2DT9A 1XRIA 4ZVOB 4B08A 1OEVA 2C3PA 2OPRA 1CS4A 1UAWA 1WEZA 3JSMB 4CP5A 1T48A 5JVHQ 1U1NA 5C2CA 4DR5F 4QWEA 4DCJB 1ZA2B 5E3CA 4ZHRA 4B3RJ 3CTRA 4GWFA 1EARA 2CG4A 2HKEA 4WP8A 1HA1A 1FWPA 1FNMA 2WSEC 2QCJA 2YWKA 1NJYA 3F9AA 3NGRA 3D4JA 3RTVA 1JMTA 1C0UA 4CTAA 1T3OA 2VKRA 3OR2A 2HHXA 2F6WA 2WTFA 3QJPA 4J9PA 2HQCA 2B43A 3HCXA 1VMBA 3I4PA 1SJ3P 1SL1A 2ZH8A 2CQIA 2VQFF 2CQ2A 1UVIA 1J2VA 1RT4A 3HZGA 1Q6JA 5AT1B 2E1PA 1M5KC 3M8SA 1S1UA 2DGTA 1EP4A 3C66A 1OIAA 1TELA 4MFBA 1A5YA 3LJ8A 1FFWB 4QW9A 1Z2ZA 3TUZC 4P7VA 3K58A 4V19J 1NAQA 4X2BA 3QCCA 4OMFG 2CQDA 4A8FA 1Q8LA 2F63A 2MQ8A 3BGFA 2F4FA 1RK8A 1WHYA 1IBKJ 4BWJA 3KK3A 5KA8A 3H90A 3N5BA 1UL3A 3UNGC 2XQCA 1S7HA 4USIA 5B09A 2V9KA 3QO9A 2MGZB 4PG6A 1K1SA 1L3SA 2PO4A 3GG0A 3NGTA 2Y0SD 4URSA 1C4CA 3HVRA 1S5ZA 3MXHP 4H4OB 5D78A 4DX6A 1NSPA 1HMVA 3GONA 2HNDA 1WJ9A 3H98A 4RWXA 4J51A 4WZMA 3SYZA 4ES2A 2B6AB 4NLWA 1SCJB 4TN2A 2YXLA 2MKJA 1N0VC 2RF2B 1RADB 5HVGA 1VQYA 4PG7A 1F9FA 1YHQS 1VC0A 3I36A 1JLGA 1FK9A 3QCLA 5DM6Q 5LXYA 1FGSA 2RF6A 2C42A 2APOA 1S6PA 2YBVA 2JEJA 3T6BA 1R0BG 1B99A 1H98A 2EFQA 2IVYA 3DRSA 3DN9A 2Z57B 4KSEB 3WQPA 4DFKA 3KLIA 2E9RX 1OS5A 1DTTA 4NYOA 4JYAF 4B17A 2BR0A 2FJNA 4G65A 3SQOP 2XC9A 1Q79A 3GYGA 2C22A 1Q8BA 3F56A 1D1UA 4TQSA 1X4GA 2W9CA 1HBMA 5HAOA 1VOMA 1H72C 2FHJD 5LSLA 1KBRA 2MQPA 2RIJA 3MAQA 1R8PA 1QAJA 4DSLA 1GAOA 4LRAA 1HPZA 3KHGA 3J7YU 4O3RA 2XM3A 3U1NA 1I57A 3HSDA 4LRCA 5ITHA 1FD8A 4OI4A 4JV0A 5KFBA 1JX4A 3KJVB 2Q66A 1CJUB 2QC3A 2RDIA 1FKOB 2HSEB 3HHNB 2ATLA 2CJAA 2ZJQQ 3O1LA 1SVDA 3NWRA 3CDAA 4AUKA 1OQ3A 4QDIA 1HI8A 1RBAA 1X5SA 2DPIA 3CO0P 4IKCA 3M30B 2ZHAA 2RSQA 4PR6A 4PG4A 2CKWA 3ZM3A 1N88A 5IC6B 1DHMA 1RAAB 1D0EA 4I8NA 4CT8A 3OXGA 4L75A 4PEOA 4Q2MA 2ZOFA 4ES1A 2PQ5A 2C3YA 5J2MB 4IRKA 1L3UA 1QTMA 2YPYA 3MPVA 4NXMF 1U49A 1IBMJ 2BYCA 2UXCJ 3W9JA 3GR1A 3KHHA 4YFUA 3QIPB 3M8RA 3C14A 3NBPA 4NZ7A 3C16A 2Y2FA 2C2NA 2KM8C 2W01A 2DTJA 5KG6A 1NZAA 4ATNA 2GJIA 3OV7A 1ZOTA 2RQ4A 3A3PB 2HAFA 2H3EB 2YX7A 3TAPA 3MD3A 2XWYA 4ETZA 5K9FA 2GC5A 3CC2S 3SSQA 3WZ0A 1KKHA 3QWPA 1YJNS 4ANEA 3KHRA 1TVRA 3BDPA 4OZ3A 2RUSA 1VIOA 4KBIA 1GFYA 1D9AA 2ASLA 4R0TA 4M5DA 1SH0A 2ZH3A 2F3JA 3TVYA 2V8PA 1LWCA 4RHGA 2B3OA 4RW6B 4YY3J 4YP3A 1TV6A 1YJ7A 2UUAJ 3VZIA 4EBDA 2CMCA 3CWEA 4M5KA 3QJJA 2H5EA 1W25A 2ZWPA 1RSCA 1SC3B 2R7QA 4DU8A 3MF5A 3NEKA 3BB5A 4GC7A 4B9TA 2VBZA 3AOBA 4HEA9 2JC1A 4UW2A 2EBEA 2ZUAA 3CCWA 4ED0A 1WKJA 3A5JA 3MCSA 4ZLNA 4EWTA 1R89A 1NK6A 2DY1A 1T9UA 3R97A 1B3TA 4ZPWR 1KDNA 4P2MA 1UETA 2WB4A 4KH0B 4JOUA 5LOQA 2AJ4A 3LWLA 2PT0A 2FJAB 4Y3CA 4GFUA 3L3CA 2F6FA 4KGMA 4DCOB 4ED5A 5B0EA 5KFLA 4C97A 5AE3A 3EICA 2BGEA 5I4MA 1RT5B 3MDFA 4PXCA 1TL7A 3HK2A 1UFKA 5ETRA 4RNMA 4TLRA 4OI6A 3ULHA 4ILLA 2ABYA 1C83A 4IYQA 3QQCD 3T5HA 2XB2D 4QYRA 2G2OA 2CZVC 2HBYB 4OI3A 1HYSA 4NLVA 2HGNA 2MHEA 2CQ3A 2DGXA 3PG9A 5AXMA 5K9WA 4LFAJ 4KPCA 1E6VB 1M3GA 4LR7A 3UCUP 4OZLA 2CJZA 4C8NA 2EK1A 3P8BB 2UUOA 4JMKA 1NBEB 2AF6A 4DR6J 3MM6A 4B3TF 2OTLS 2XS7A 1YTNA 1JB0C 1FDBA 4MT1A 1OEUA 2ZZMA 3MR3A 3GV8B 3IR7B 2HHUA 5CHCB 1QE1B 3KG4A 2QCTA 4KFBA 2CPJA 1YQHA 3TR5A 2BX6A 1UTAA 1JLQB 4X4PA 1SL0A 4DV3J 1RE1B 4J9VA 2RE1A 4UF4A 1S1TB 4Q8EA 3UR0A 1WF0A 4DR3J 1HQEB 1HD0A 1YFOA 4RDDA 2EFOA 3GIJA 4DL3A 1CJTB 1WC4A 2VDIA 4W4MA 3T5KA 2VQEF 3ILOA 2QSWA 5IQ6A 5HMZA 2DR5A 5IWAF 2E1MC 2FVQA 3I0RB 1U1LA 1X60A 3GXGA 3OHBA 3AAWB 2JLGA 4DN0A 1LARA 1ITPA 1C87A 2XULA 2ZZTA 3CC4S 4Y14A 1JLCB 5J1NA 3NMRA 1NDPA 2H54B 3MCMA 4R5PB 5E3QA 1NPPA 1U45A 2NXEA 3EU0A 1YZ7A 1I3OB 2AGPA 4ERCA 4KGVB 1K0VA 2UAGA 1X5PA 5KFDA 2MSSA 4QPXA 2ZE2B 1LQ9A 3DCAA 2VOSA 4E0DA 2DR7A 4RI5A 3M8PA 3M8QA 1HBUA 1YJWS 2XMWA 3GYXB 1VQ9S 1U47A 4GRZA 4XAKA 4QWBA 2DJWA 5LMUJ 1FWKA 2V8GA 2D3UA 1G3OA 2DHHA 2AW0A 4ID8A 3Q8YA 2CQBA 2W8KA 1X9SA 1Q78A 1QZ0A 2GX8A 2JX2A 4N5SA 4OHLA 1YITS 4DFMA 4Q2LA 3SIPB 4B3SJ 4DL0C 2BZLA 3LK7A 4IDKA 2N4CA 5BX1A 1J5OA 1JLFB 3VGTA 4DCPB 2WONA 4A46A 1ZAWA 1JLEA 3N01A 4FNHA 1RA7A 3M8ZA 1U8SA 3OLAA 3FCWA 1Q7LB 4AL7A 1W2IA 5AXNA 2OD6A 2BJDA 2AX1A 2UUBJ 3MWBA 3PDNA 1LKZA 1LK7A 2CNOB 2BV3A 1IBCB 4O0NA 2CM7A 2AYMA 4RU2A 2HQDA 1IWAA 2KJVA 3US5A 4RNFA 4ZVGA 2DR9A 2RU3A 2HAIA 5CD4H 4NYZA 2R8JA 4HJPA 1UPPA 4HVZA 1VGYA 5A5EA 3H4BA 1ZAVA 4YHHJ 1MU2A 2HNZA 2HURA 2AZ3A 2CNNB 4ITSA 2OD4A 5DQGA 2QLJB 1MLAA 1VS3A 2X1GA 2KDOA 2PMWA 3M8YA 4DR1J 1VHFA 2I1YA 5CCMA 4UQGA 2Q6CA 4O3NA 1RP5A 3PW4A 4WTYA 1S1WB 3CIMA 3N6LA 2DHSA 1RT2A 4IFYB 1KHVA 3D1OA 3L95X 1O5JA 4USTA 1F5CA 2Q47A 3OXLA 4M94A 4OLPA 3DLGA 1TL3B 1YWXA 3W61A 2DXPA 1R6VA 3FEXB 2N4DA 1S76D 1D5RA 3SFUA 3QGGA 3CGIA 1S77D 3QWUA 4YN3B 3G71S 2AGOA 5GMDA 3DLKA 1H2TZ 3BBBA 3MMAB 4F2RA 3AWEA 2BJEA 5LSOA 3QRQA 3ZZZA 2U2FA 2CRLA 2YKQA 3FRZA 4PYDA 4XPCA 2B5JB 5C42B 3OR1B 4KV8A 2Z0GA 1S9GB 1U1OA 4NCGA 3UDEA 1NNYA 1H7XA 1ONZA 1N33F 4LIRA 1S97A 4M8LA 1RDRA 4UUWA 1KC8T 3DLHA 3FVYA 1LW0B 1LWFB 2R7XA 3L7UA 3QFHA 4RX6A 3S7RA 1Q4RA 2Q79A 4UUXA 1T49A 4JI7F 4LIWA 4NEYA 5A8KB 3HHKA 4JI0J 3BKFA 3IBWA 1V5IB 2MDAA 4E2FB 3DLLQ 5K25A 2XGPA 4LSLA 4OZNA 1T03B 2OGUA 5LXRA 4FPRA 3T1YJ 3TAMA 2FY1A 4ZJLA 3BO2A 4DV2F 1JKHA 2LYVA 5DM7Q 4RLEA 5BYSA 5IM0A 2KFNA 1V5VA 3I9ZA 1UEVA 2DK2A 1UJ6A 3MEGB 3DU6A 1TTHB 1KN6A 2YKOA 5A8WA 3BGUA 1C1BA 3KJNB 2AU0A 2J7KA 3D3BJ 4QU6A 4K2JA 3M7VA 3BR9A 2ZBQA 4PXEA 1NK0A 3VZHA 2OPPA 1U6FA 1Y3JA 3UVJA 1R0CB 1N36J 1XNQJ 5HLFA 1FERA 1N32J 1R8HA 1RT7B 1H2VZ 3T19A 3ELHA 3OFEA 1J5EF 2XMVA 4EZ6A 4QAHA 2E7VA 2KYZA 1KWMA 3R5BA 2A2DA 2R7WA 4MKBA 3VAHA 1N56A 3H20A 4NLGA 3QRRA 1UEUA 2O66A 3K8VA 4ECWA 2GVDA 1XR7A 3I80A 3ENWA 1XQIA 3NNHA 3X3UA 3A12A 3WBZA 3OT9A 1O51A 1F2HA 3G96A 5F8NA 4TLQA 4USWA 3CCTA 4JP8A 4RJVA 2R8IA 1YZ4A 2ZBCA 4KKOB 3W66A 3J7Z5 2PA3A 2K2PA 1TKDA 1C2PA 4PXDA 2FIUA 3CCJS 4H4KC 3QGIA 3ZNJ1 3DGVA 1VC6A 1IR0A 4Y2MA 5M43A 1L8KA 3RRGA 4BUBA 4ECRA 1KQSR 2YNGB 4WYWA 2A10A 4DX5A 3UQSA 5GADI 3DXBA 4Z7CA 4UAGA 3AFGA 4LF6J 3OLBA 2DNZA 3HHEA 1JLAB 4LFCJ 1L8GA 3HMJG 2H48B 1YBAA 3RYLA 3M4UA 2MZTA 2RRBA 1WTFA 2CQ0A 2E9TA 2NXCA 2BABA 2ERRA 3CVKA 5H9EJ 3MCOA 1SQGA 1ZM4A 2O5DA 3W65A 1RZMA 4EFAC 3D0IE 2W4DA 2WBRA 3IG1B 3MM9B 2BJ9A 4ED4A 1NK4A 4CLSA 1QD1A 3DRPA 3N79A 2XYPB 3W60A 2FJWA 4IG0A 4Q45A 2HNQA 1RKJA 4GKKJ 3C6UA 2BQUA 5KFFA 1TKZA 4RW7A 1Z2LA 3CCVS 3F9BA 3TX8A 2ZDPA 1WKLA 2DXDA 3PIOQ 1ZM9A 1IR2A 4JI1J 3EGVA 2EKNA 3I87A 3M6VA 4MAKA 1YVFA 4O3PA 2X3GA 1LK5A 4L74A 3BQ0A 3EXCX 3OSPA 2Z4PA 2FLPA 1OETA 2BRKA 3BSCA 1U0HA 1TP7A 2LQBA 3EE3A 1CJVA 1OYEA 1B7YB 4DU7A 3H5YA 4ZVSB 4EUVA 1Y4ZB 2QBQA 2PA8D 1N5SA 2BUNA 4N41A 2V9WA 2YNHA 2R7UA 1SC4B 4WWSA 3OTOF 3CDBA 2Q43A 3QAEA 3S3FA 2ROPA 2CXEA 5DLFA 3BH6B 5C24A 1FQ1A 2CQGA 2AHSA 4FF1A 2Q1LA 4N76A 3Q2SC 3SBMA 2FH7A 3AY0A 5F3ZA 3UAGA 4FBUA 3SXLA 1S6OA 2QLWA 2Y1RI 4LF9F 1FXLA 2E44A 2W7AA 3I5BA 4DQRA 4ZIWA 2BEFA 2GQ2A 4KQZA 4KHPJ 1UW9A 3C8YA 3PW0A 3DOKA 2LU2A 1MG7A 2EFGA 2GP0A 1D09B 4X4OA 1FX4A 4NRUA 3KTQA 3CJ3A 4IOBA 1T9XA 2FC9A 2G1DA 2UVWA 4N8OA 1HQ2A 3QZ7A 2FHOB 1JIHA 2M4MA 3W3SA 1RT6A 2VH7A 1VQ6S 4I64A 2MMYA 4Y2AA 2WW8A 3CD0A 3AODA 2R8HA 1GFWB 3N5FA 3PVXA 4HI1A 1S1VB 4KRWA 5K24A 2HHHF 3M2VB 2JNJA 3GJQB 1S0OA 5M2RA 1RACB 4HDHA 3B54A 3TX0A 4G1IA 5ETNA 2EFPA 2R2UA 4IOCQ 1NK8A 3KUEA 3SEOA 2CPIA 1XMQJ 3V6KA 3H7HB 2WTZA 4DFJA 1M5OC 3O44A 1T95A 1QSSA 3QGHA 1SC6A 2JLEA 1GQQA 5EX0A 4QZVB 2W4CA 4DV4F 3JYTB 2KM8B 1OHEA 2E5LJ 2NSCA 4NEZA 2ZBRA 3AWFA 1ZCKA 1X8DA 3OBIA 3DMJA 3KJQB 2I6WA 2YNIA 3GJTB 1NO8A 2E29A 1S10A 2I6IA 3K5LA 2LMIA 3TUPA 2Q05A 2YX1A 3RGQA 2IMWP 5BUGA 4H54A 3NCRA 5F41A 2XYHB 3ZTPA 3V4IB 2DIVA 2ZM6J 4RBUA 2DCLA 2IVMA 2LQ5A 2YWGA 3N28A 2R0BA 4AXIA 2QE5A 3I96A 1IKXB 1HNXF 2QEXS 1RABB 4PXBA 1CJKB 3GIMA 4BLGA 2RT3A 1XIQA 3C15B 4IH6A 5CQGA 1KS2A 5JMNA 5ETSA 4C0OC 5F8GA 5DG9A 1QAYA 4USJC 2IHR1 3OVAA 4B9VA 3HDSA 2BANB 4AD6A 3LP1A 3ENVA 2IY5B 3HPOA 4W98A 1RHJB 1TL1A 3ZZ0A 3CMAS 3PW5A 1MROB 3ZO7A 2XSFA 2CWKA 3D6HB 4NYPA 3H40A 1T9WA 3KK2B 1XMOF 2LQJA 1IBLJ 2MYFA 1U1KA 1NSAA 3BPDA 1EX8A 5KG4A 2I9SA 1T11A 1NHUA 2P9CA 4JI8F 3CMQA 1CLFA 3MTJA 3M32A 5EWGA 1KRPA 5T7LB 3W2WA 2VEWA 4LT6A 2PSZA 4QWCA 2HQ3A 3PO4A 4WCEQ 3VGSA 3WC2A 1F0XA 1LFPA 2HB1A 4NXNJ 5IT9U 4WJBA 2D74B 4UQTA 2I5XA 1GWZA 3IA0A 3QPIA 2YKNB 5I3UB 5AXKA 1Q8IA 2H03A 2XMJA 1DTQB 2FHKA 5CXTA 4LUBA 2WRMA 4O4GB 4G1QB 3PNIA 2AIRB 5E3PA 4RNNA 3I4HX 1ZM2A 3RB6A 3LO3A 2YWEA 2GAHC 4NASA 4A8YA 2WAQD 1SV5B 2W9AA 4DV7F 2WVCA 1RTHB 5DO2A 3EZZA 4ILRA 1YRXA 2F5GA 3DLJA 3MECA 3VAKA 1VFJA 4OI1A 2JWNA 2KXHA 4RW4B 4RW8A 4WFBQ 4ECZA 3M4XA 5A8RB 3PCOB 2P9GA 1PG5B 3G82B 5D4OA 1JJ4A 3MR7A 3Q2TC 3M1VB 4CH0S 4TVAB 2ALZA 1RU2A 4HLBA 1MMDA 4CVMA 2OZ5A 3N6MA 3W62A 5AJ3F 2QL5B 3D9CA 2AKWB 2ZZNA 2PIIA 3F73A 4P75A 3A1YG 2YNFB 1RHRB 4TYBA 4FZVA 2KTQA 5LL6d 4C3KA 2IC3B 3MUTP 4AQYJ 1WOPA 4RW9B 1XNRJ 3KUGA 2VBYA 1TFWA 1RAHB 5L1LA 4PUOA 3QGPA 3W5YA 4CO3A 4F4AA 5DZ6A 4Z6BA 2B7BB 4F8RA 4H4MB 2HBQB 3LP0A 3OL7A 1Y7PA 3UD5A 2C2MB 5D0GA 2DISA 1T9VA 1SC1B 5MLCV 4AZ1A 4QF5A 3MM7B 1R8CA 3BF4A 3HKWA 2JC0A 1HNVA 3ZL8A 1Q82T 2QBRA 5M2PA 1Y5LB 3A13A 2IJNA 3IMQJ 1Y0HA 1K44A 2B4VA 4PABA 4DV1F 2GW8A 2FGOA 1CEZA 3IO1A 3D6TB 3D42A 3GV7B 2F71A 2D69A 1GG4A 4TNOA 1SJ1A 2OEMA 2VG6A 3NGUA 3VAGA 4Y00A 4G6VB 4CVLA 3GILA 2LVWA 4H4OA 1FJ7A 3CCQS 1C86A 2D7SA 1FA0A 2W2MP 4DUZJ 2K8GA 4FPIA 1N0UA 1F9EB 3RBDA 2B6AA 2BV5A 4KC5A 2CQ4A 4K4SA 2RF2A 2ZMMA 4WIIA 2QFJA 4NLOA 4BUCA 1LOUA 2DITA 2YVSA 2DRDA 4PQAA 1CPZA 1TZ0A 4PPZA 1U1MA 1ACMB 2KT2A 3TQ1A 3V0DA 3AQOA 4CWBA 3DDIA 2RHSB 1DZ5A 4JNBA 3O2IA 3SR9A 3QCIA 1K8AT 3ILLA 2RQMA 2GGPB 2NLWA 2FVPA 4KO0B 3VCDA 2ZEJA 3FFIA 3CD7A 2I0XA 4WFNQ 4ICLB 4CLLA 1S72S 3JTPA 2WOMB 1R7IA 1YX2A 3RGIA 3PEHA 2R42A 2G0IA 5C5JA 4C3MA 2DHAA 1W78A 4E8UA 2H5JB 3GSIA 1GXLA 4QR1A 5G4DA 1RHQB 1Y3KA 2XZDB 3GCWP 5KA4A 2F65A 1NLKL 1QVFR 4F4WA 1M1GA 5HDEA 4EK2A 3KJVA 4M5NA 4P2SA 4IG3B 3NL0A 1FKOA 4WXWA 2G4BA 3V5RA 2PDAA 3UPFA 5KA9A 1REVB 4JI4J 3B78A 4J9NA 2W9BA 3TJ9A 3QLHB 5F3TA 2BJ3A 2F8HA 1S4EA 2CQ1A 1UAGA 1U2RA 2B0GA 2DKOB 1NU4A 1S99A 2PBNA 2OI2A 4J9KA 4DUYF 3GB0A 2COLA 1ZCLA 3V0HA 1YTSA 5J2MA 1FE0A 1RHMB 2C1EB 4DX7A 3CJKB 1EIYB 3TP2A 2V2KA 4CLPA 4KGKA 1M5VC 1N5QA 3IGNA 4U8YA 7AT1B 3J81j 3IBCB 3QIPA 5HANA 4C12A 2HFNA 1LWXA 4I6WA 2DO4A 3AT1B 4N7TA 4OI0A 4NX9A 4P74A 4FDFA 2FVRA 2HZAA 4CVKA 1T7PA 3LTOA 1VQ5S 4B9SA 1A0OB 4D3RA 3SSSA 3H59A 3BBFA 3DM2B 3CCES 5IT4A 1VQSA 3M2RB 3UCGA 4Y65A 1DBDA 2XJAA 3CT9A 4ZVEA 1X4DA 4EBCA 3BJYA 4ZA1A 3TJ8A 1WHWA 2FJMA 3MEEA 3N0VA 4PCQA 3EMUA 1SUQB 2GJ2A 3MOJB 1FJCA 1VRQC 3ZTOA 2GQCA 3OTEA 4FKYA 4UZBA 5J2PB 4YR0A 3C3LA 1T05B 2OUDA 1HL6A 1RKIA 1U6ZA 4GE6A 1EENA 1L3VA 2AJ1A 5LM7E 3R1LA 2CJBA 3PM9A 3ONQA 4HDGA 1U09A 2HK2A 2XTJP 4X4UA 3IM9A 4WBFA 5GAGU 3V81B 3AA8A 3RR7A 2QMUB 3CIZA 4B9NA 3QCGA 2BQ3A 4I67A 3RW6A 3A4TA 1QAIA 2VG5B 3PHTA 3PJ9A 2NT2A 4WIQA 2HHWA 2HXPA 2HHTA 4MJKA 2W2OP 1RT1A 4F3OA 3R5DA 2XMAA 2RKIA 2AEFA 1KQKA 1X4CA 1RTZA 2NTAA 3GXHA 1U7LA 2OMLA 3CJ0A 5DRKA 1PSDA 4ED1A 4NLSA 3W8PA 2XMTA 2UXDJ 4ERDA 3AA9A 1Y5IB 2CPHA 3UNYA 1YWFA 3IP0A 3BEGB 4OYAA 1RT5A 5K8PA 1HLWA 2O1PA 3EUNA 4YOEA 1WDDA 1HIYA 4KIAA 5KFPA 3G2XA 1UP1A 3A3NB 4K50A 2UXBF 1HI1A 1Q16B 4ZP6A 3J80U 3QZ8A 1VQKS 5KFOA 2N3OA 1MWZA 2QZ8A 1M5PC 1UJ4A 5H9FJ 4IR1A 2CPYA 2OAUA 4LF5J 4ANCA 4OYXA 3B7OA 4QIEA 1EETB 1E6VA 2M2BA 5E3AA 2E5JA 1F3FA 5K8NA 1C1CA 3EGNA 2DNPA 5KTQA 5KT3A 1PJ6A 1D9FA 4DV5F 2AYGA 3HD1A 1N5YB 4CM0A 3EWGA 2LXFA 2MZQA 1XWLA 4R0SA 2NUHA 4FYDA 4J37A 4OYOA 5D8HB 1BZHA 5F8HA 1O6XA 4ECXA 3RRHA 3MEDA 2LDIA 1QE1A 1H6KX 4OYPA 1S79A 1WELA 1IM6A 5K8MA 5H9EK 4DWIA 4P73A 2I6JA 5HO4A 1V3ZA 1JLQA 4NLUA 5HROA 2J6SA 2MLYA 2XS5A 1S9EB 3MMBB 2BMBA 1HW9A 2V67A 1XBWA 2QLBB 5KT2A 1IQTA 1HQEA 5DJBA 4M5MA 3KKFA 1CJTA 2PMHA 2DNNA 2RQKA 2IIHA 2HPUA 3D0GE 2FYXA 2WW4A 4WU2A 3IN5A 4OYIA 2MY8A 2MZSA 1HHTP 2UU9F 3I0RA 2QFIA 4K7QA 3HP6A 1VQOS 5A5FA 1IWGA 2DR6A 2K7KA 3AHPA 3PKYA 5KFRA 5I42B 2OSQA 3EMTA 4P10A 2OEJA 1JLCA 2DGQA 4GS0A 2XY6A 4N8NA 2F46A 4R5PA 1Q86T 4X64F 2HFOA 4OFZA 4FP9A 2KRBA 3LW5C 4I6AA 3F41A 1WG5A 4URGA 2M3VA 3M6UA 2CIMA 2LEBA 4NPOA 4LF8F 2M3DA 2ZE2A 5E33A 4FYVB 1PO6A 3ZTRA 3T9NA 4BPCA 4QCLA 3VTIA 1BZCA 3R2DJ 1SPBP 2XCAA 4QWDA 1GMUA 4NYHA 5GTJA 3C6TB 2B4OA 3J81Y 5IV3A 2IYIA 2HRYA 2B49A 2DNYA 1KVKA 4F2SA 4XK8C 1FJGF 4HT5A 3K59A 2VEYA 2PI5A 5I6VA 5DGAA 3UI3A 4GMKA 3ZXWA 3EPIA 2MLXA 4DR4F 1S48A 2I38A 1OEOX 2GHWA 3FBEA 4DLEA 3FUYA 1I6JA 2MZRA 2R7VA 3R5CA 2NCKL 3NNAA 2JEGA 5HQMA 5FJ4A 1QUPA 4LF1A 4KHRA 4L3KA 2MKIA 2DNMA 5MMZB 4J9LA 4CO1A 4I56A 4DPXA 3RO1A 2F6TA 1W7KA 1QLNA 3HFVA 4ZN1A 2EKYA 3JXOA 2XZTB 2XWXA 4ETXA 5IT9Y 1FRJA 4WFYA 2OC3A 2Z2YB 1PKUA 3R3TA 1TKXA 2F6ZA 2J7UA 4LF4F 3PR4A 2DH9A 1WF2A 4MBBA 3VAMA 3NOGA 3T1HJ 1VQ8S 1CS4B 1NL9A 2N7YA 5HBMB 1S1WA 3QT7A 1FVSA 2B9XA 5G0RA 2HIQA 4IRCA 2Y96A 1BGXT 4IFYA 1RTJB 4ZHRB 2K7JA 4MIAA 1SKSA 1TL3A 1PTTA 1N34F 5FLXY 3OTCA 1DRZA 1LV5A 4WF9Q 4X4TA 2G2YA 2A8BA 5D0RA 3OR2B 3LALA 2H4VA 2JEIA 2LQ9A 5B0BA 4NLPA 4C98A 4Z2XA 3FCVA 5DDQC 1AB8A 5ETQA 4F7VA 4YUDA 1EZZB 1U1RA 3O4UA 3SDEA 2OTJS 2B5JA 3ENAA 3OR1A 1XR5A 3AB4B 1S9GA 5CYMB 2MZJA 1RTIB 5LXQB 3N0AA 1YN9A 2YQ1A 5JVGQ 3ZZTA 1FPRA 4MK8A 3KYLA 3HSGA 1LWFA 1NXIA 4NCBA 1XC9A 2CMBA 2W7PA 4B3RF 3OTBA 3DOMA 2OEKA 2VFRA 1V3RA 2ZD1B 2JH3A 3C46A 1SJ4P 1G7CB 2IRUA 1HQUB 2LA6A 1FKPB 1VLYA 5A8KA 4ED2A 4D3QA 3R7SB 2YWHA 2POKA 3KK3B 2NQPA 2F6YA 2NZ6A 4ZRTA 2V34A 2RH3A 2NUUG 3QO9B 3ZC4A 1T03A 5BXIA 3PR5B 1KHWA 1UVJA 1JJCB 1VBYA 3J7A1 1BE4A 5J2NA 4HH0A 5ETKA 5KT7A 1VBXA 4TKTA 3KLEB 2IM3A 3PX4A 3RB4A 3W5ZA 2HNDB 3OD2A 3PYZA 3OLRA 5A2QU 4L73A 4U6PA 1WC3A 5F9LA 3MEGA 2C3MA 1ZPWX 2XCPA 3DDNA 4EI2A 4OZ2A 2A3JA 2ACYA 4ZOSA 4Q0BB 4P72A 2XMUA 4ZPTR 1Q95G 1JXLA 4MH8A 1FRLA 2UV8A 2V4RA 3J7YI 2HFZA 3BR8A 1FWLA 1U0SA 2X7IA 2YDUA 5KAAA 1W7WA 1F6TA 4I7FA 4Y2CA 2Z56B 1IBKF 3DRSB 1TQLA 4YMEA 5I3PA 1RT7A 2VORA 3NWGA 2ZJPQ 1YBUA 3KLIB 3NS5A 4TYAA 3SCJE 1OESA 3C19A 1R6YA 1MSWD 3D1QA 2CZ4A 3W63A 1NDLA 5IV4A 2DGOA 4CT9A 1KVIA 1VRUB 4Q44A 2Z2LA 2W9CB 3FEYB 2LEAA 1VQ7S 2HQGA 1HBMB 1Y11A 2DEIA 4NI2B 1VBKA 4HTIA 1HPZB 2XO7A 3VAIA 2ZJRQ 4KKOA 3BN4A 2DNRA 3ETOA 1UWAA 4U8VA 2J16B 2VONA 2ILZA 1TU0B 2VASA 3UDVA 3S6EA 3TQEA 4OX6A 1ZPVA 3TJAA 4WU3A 2G9OA 2QBSA 1RLCL 2OOQA 4DPYA 4CLUA 4CYUB 2JVRA 2N7CA 1M0SA 4XTTA 3KLFA 3FQKA 2BDPA 1YK9A 3CXCR 2XZWA 6FD1A 3Q0AA 1IKWA 1JLAA 2Y68A 4BHQA 4F0MA 3NG8A 2EC2A 4ILMA 1DJ0A 1SQFA 1B0PA 4O4RA 4E98A 3I0SA 2CVEA 1FFGB 3IWXA 3JQMA 2SHPA 4CDIA 2YX4A 2HHSA 2H02A 1D3WA 3MM9A 2I3UA 2JEFA 3Q83A 1FD2A 3IC1A 1FDDA 3ILIA 5EUHA 1RBOB 3RJMB 2UUTA 5KACA 3BKTA 4F4XA 2ZWOA 1RISA 2QT7A 1P1TA 1S6UA 1HNZJ 1MW7A 3A3OB 1PCAA 3UFCX 3H42A 4HRFA 3PTWA 2V6AA 4PG5A 4JV5J 1N8RT 2QRRA 4OHIA 1KTQA 4WP3A 4RNOA 3QCFA 2I4HA 4OHZA 2RRAA 3RZ2A 3PACA 4UOCA 4DR2J 4WPAA 4OHVA 3LANA 1ECVA 4M5DB 3CWJA 5I3QA 4FN5A 1JK9B 3H2LA 5KG7A 1DAXA 4CLYA 2A2CA 3KG0A 3CD6S 5J1PA 4PWWA 1IBMF 4X4QA 2X1AA 1TV6B 2UXCF 2GVZB 2HW3A 3ZZYA 2CPDA 3MM5B 4YR2A 2C2ZB 2I3RA 4RUHA 2SXLA 3NAHA 4EBEA 3I6PA 2VOOA 2NT7A 1X4HA 4F3QA 5IT0A 3FSYA 2ZH9A 3AJDA 5EWFA 2E66A 4ZVTB 3EDRB 2VIHA 4NWGA 2L9DA 2DNOA 1S59A 2IBOA 2X3DA 2ACMA 4XPEA 2IFXA 3KFWX 5CYQB 1JLBB 2ASJA 4JV1A 3GQCA 4L6V3 4PQUA 4DPTA 1U6BA 2M70A 1Z4UA 2E7WA 4IUFA 1NSQA 2RQCA 3L7PA 2M0GB 4LSZB 4MYTA 3BV8A 4YY3F 4ZITA 3TZZA 5HN0A 3OFGA 1JXEA 1WG4A 2JZ5A 1LXJA 2E5IA 1HHSA 3W5XA 2Z2MA 2UUAF 1S12A 4ZN5A 5EN1A 4DX8H 3TUJC 3R9LA 2MZ1A 2DNHA 1URNA 1KAVA 2QYCA 4OV1A 3BO4A 3J80Y 3M2VA 4RR5A 2QIFA 4JI3J 4K4VA 3NNCA 2IJFA 1RBLA 3E01A 1HYSB 1G4US 5F9NA 2ZVIA 4RKUC 5L39A 1JXVA 1KFSA 2MJUA 3MR6A 1IN0A 1Q6PA 4OX8A 5DDOC 1HR0J 2R8GA 5RUBA 2KG0A 2OELA 3HHDA 4ED7A 2CZ9A 4NLRA 2HGMA 2FLOA 1O8BA 1YTYA 2AEMA 2FJVA 3NOCA 1GK8A 3BGRB 3FMWA 2Z58B 2KJWA 3GJSB 4FBTA 2F7VA 5CABA 3VWSA 1WSVA 3RBXA 1UJ5A 1ULRA 2BE7D 4LRFA 4OIXA 3AXMA 1NJZA 1PC5A 4FXDA 4KFBB 1R8AA 3UN2A 2QBPA 1SI9A 1S49A 2MXYA 1PJ7A 1CJKA 3LP2B 3CDUA 2IA0A 4ZLJA 1LXNA 4RI4A 2VPWB 3TAQA 2UUWA 4OHXA 1Z1ZA 4W92B 2GZOA 1MN9A 1RHKB 4LFAF 4NLDA 3GPAA 2HVZA 1JF7A 1Q0NA 3BSNA 1H3DA 1A9NB 2QA4S 2CWXA 1H0HB 4DR6F 4NX8A 1MROA 1U8WA 2WVDA 5KFEA 1T94A 4MK7A 1R8BA 2KVIA 3KK2A 1TK5A 3EM1A 1M1KT 2XLJA 2XNRA 1WG1A 3D68A 5E0OA 5KFQA 1HWKA 5T7LA 1GQEA 2VHGA 1OEMX 1BQNB 4DV3F 2YKNA 3M8QB 1HBUB 5I3UA 3EXYA 1QAXA 1GT8A 3V4MA 4DR3F 5FD1A 5J2QB 4HHHA 1IKYA 3VALA 3DI6B 3CCLS 1E6YB 1IUJA 4YS2A 4O4GA 1N52B 2KO1A 3SMEA 4LF2A 3HF5A 5H9FK 2G6ZA 5KA7A 1GEHA 1AZSA 2DGUA 4DUTA 1RAOA 3CJRA 1SV5A 1DY3A 2QGFB 3BH7B 2V4QA 2WONB 2WB1D 2RHQB 2P9EA 3M2UB 2VICA 4WFZA 4RW4A 2YKMB 2GJTA 2JDJA 2M8HA 1JNZB 2M88A 1SXLA 2B56A 3M1VA 2CPFA 4UT4A 4I2PA 8ATCB 4X65J 2PGCA 3PEJA 3RAQA 3TVZA 2YNFA 4K4UA 1PAUB 2IC3A 2R9LA 2AQ4A 2J76E 2EPIA 2HNYA 4EO8A 4EMDA 4X66J 5HL7Q 2DPJA 4LFBJ 2JJDA 3BKUA 5IBSA 2P4DA 1OY9A 5KADA 4TXSA 1MU2B 5LMUF 4H4MA 4MKVA 3HO1A 2CNEA 3NKYA 5D4PA 4I0WA 2OP5A 3BS9A 3T6JA 1SJFA 4CM2A 3CUNA 4KR0B 4RUAA 3ZM0A 4CLWA 4B3SF 3MM7A 2UVRA 5GAHU 2B4UA 3TA0A 4DG1B 4LR8A 4CNZA 2C3UA 2IVFB 1WD6A 4A47A 5GAEI 3KK1A 2R2RA 2UUBF 4WFXA 2V8DA 4U7UK 2BJ7A 3EGZA 3BPSP 3EZ5A 1CVJA 2XNQA 2HHQA 1WACA 3GWCA 3DLKB 3RGOA 4J9UE 1NHVA 4WK3A 1IR1A 4CH1A 2XS2A 3TYTA 1SJRA 1HHQA 1RTDA 4YHHF 2D9OA 2X5OA 4LR9A 5KA2A 5K5MA 4TVVA 1PYOB 4AL6A 1IVZA 4PPDA 4DR1F 4NCGB 3I5CA 1OPIA 1G1FA 2HZCA 3TRGA 4TY9A 3HT3A 1MNEA 3WX8A 1G4CA 5IQQA 1IM4A 3EJMA 2PD1A 1G7FA 2HY3A 2GFFA 1A6LA 3BDEA 4DF4A 4A8WA 2J9CA 3FZ2A 2G2ZA 3QIDA 4ELVA 4XDCA 3EYZA 4ZIYA 4WTOB 2DB1A 1B0VA 2RS8A 1ZZNA 2BKPA 2DRAA 5D3GB 1FTRA 2GGPA 1I1GA 4CLTA 2ZH5A 1X5OA 2QO3A 4K4ZA 4OYMA 1S1XB 4ECSA 4LSLB 2QA1A 5E41A 2GA7A 3FBCA 3HFZB 1AUDA 3HKZD 2FZCB 2WVFA 3HJVA 2K3IA 2GV1A 4UOGA 3BSOA 1N54B 3LGNA 1VRTA 2EK6A 3PFEA 2GMJA 5LMNJ 5J1EB 5A2QY 1P8GA 1Q5VA 5HATA 4ID5B 1FJEB 2UV8G 5A8WB 3GLJA 3NS7B 4OJGA 4NLXA 4J9RA 2ZHOA 1SBRA 2VG7A 2GNKA 3MI7X 4DQQA 1M5SA 3FKBA 5CZVA 1WOSA 2DXFA 5HSPA 4HJQA 1UVKA 1X4AA 4IG3A 1L5UA 2CA9A 3OL9A 3UVJB 1REVA 3UDLA 2WVEA 3OL6A 1OY6A 1F5AA 2KXFA 1FF2A 1UZHA 2KKHA 1GNKA 4JI0F 4LBHA 4PYAA 1Q81T 2QEPA 2F9DA 3N2AA 4KI9A 1ZC0A 2FD2A 2LECA 3HLUA 5D15A 1ZETA 3S4EA 2CJXB 4TU9A 3GFHA 2QMWA 2QTWA 2AJQA 5B0CA 4F4KA 3D7SB 4OJ3A 3N9UC 3IR5B 3T1YF 2P2CB 3BGLA 3GJRB 2EEYA 4KB7A 4GRYA 1S0MA 2NXUA 4X4RA 3CJ2A 2AM1A 2B4PA 1N6QB 5L38A 1PJ5A 1KQFB 1PTUA 4DBQA 5KFGA 2ZITA 1DLOB 4FYYB 3JS9A 1RLDA 4DEZA 1TUWA 3PYGA 1NM2A 2QJ3A 2FZKB 1YJ9S 1N36F 1XNQF 4AT1B 3DOLA 4DN9A 3DM2A 2EBGA 4P2FA 5ETVA 5JJBA 5B7WA 1N32F 3D44A 1GXTA 4PZVA 3AWGA 5KFKA 3WIUA 3V6HA 2DYAA 3NY0A 5IOLA 3TANA 3H2XA 5DQHA 5HMWA 5HQLA 4WOHA 2G1HA 3OJSA 3IM8A 2BRLA 2XHCA 1REGX 1T05A 3MOZA 2VJVA 4DDFA 3QCDA 2LQ8A 2J0WA 2M5YA 2CPZA 2KZMA 3NGKA 1AA1B 5EHHA 3G8QA 4X62J 4FNIA 1HWUA 1D8YA 1SH3A 1QSLA 2WSFC 3ETMA 4DR7J 2KT3A 1RT3B 4EZ9A 3S3EA 4C8LA 5KA1A 4Y2KA 1K9MT 3V81A 4K4TA 3CJQA 3C6UB 2R3VA 2MSTA 3JSBA 1YGUA 2GWOA 5D0HA 2CFVA 1PAEX 4K0KJ 3ZFVA 2MLZA 3R6LB 4U7CA 2MB0B 2P6SA 1PA1A 5KFMA 3GTYX 2GHPA 1OMSA 4LF6F 1RWXB 3LPEA 5D77A 4C0HA 2VFUA 3U1MA 4LFCF 2I75A 2FPHX 1BZJA 4F4ZA 4NLYA 2GHVC 1QY7A 1BD6A 2XLKA 3FCHA 3QJLA 2F6VA 1UFLA 4O3QA 4GRSA 3IWNC 1U0HB 1HNWJ 1CJVB 3G86A 5ETOA 3U96A 2NPFA 3QSYB 2CDRB 2FY8A 2YNHB 5KG1A 4M95A 3Q8UA 4DHVA 2PEHA 5C24B 3UD3P 4B9UA 4RBVA 4MKYA 4GKKF 1TKTA 1R31A 1WUUA 4C11B 2OJ3A 2HVEA 4CO2A 2ZH2A 2OUGA 2JRSA 4JI1F 1FCAA 3DLBA 1EETA 2O67A 3O8WA 4F36A 1EEHA 1EKSA 2UUCJ 3UWTA 3GR0A 1BQMA 3QKQA 4CO5A 3DOKB 4HHJA 4M5HA 9RUBA 1JQGA 3K5PA 3KLHB 4KJIA 2E7XA 3VAFA 3HHLB 3RAMA 4QU7A 2O3DA 2J17A 4HV4A 3CB4A 1WI8A 1G6BA 1U26A 2C2DA 1UCNA 3K7RA 3I82A 2ZFHA 2BE2B 4NA2A 3P5BP 4QPTA 1PTYA 4B3OB 1JWWA 1RT6B 3TZYA 4BS2A 1A7GE 1SB6A 3S1TA 1S6QB 1XR6A 1AROP 2U1AA 4ER8A 4BWMA 1S9EA 4ZP8A 3MMBA 2JLFA 2ZBIA 1OPZA 2ZC3A 4NZ0A 3SFGA 3V6DA 3O5XA 2B8QA 2G0CA 3OUYB 4V1Ak 1NKEA 2H4GA 1I94J 3ICLA 2FJXA 5T41A 1HI0P 2RNEA 3T5JA 2OSRA 2MQOA 1JJHA 4KHPF 4U96A 4OHEA 4J91A 2GIQA 3H4DA 3FNNA 3O3LA 1Y10A 1TR0A 3U27A 4MIBA 3M6XA 2VZ9A 4I69A 2DGWA 1KNZA 3PX6A 4Y2IA 1VISA 4KTQA 2YNIB 2B7CB 5HVFA 4FYWB 3HULA 3DNCA 3N4WA 4IOAQ 1ZA1B 2R7RA 4USVA 1N4LA 2HQIA 2C2KB 5KG0A 2Y66A 1RAGB 4IFVA 2LU1A 2FGCA 1EEOA 4JI6J 1CSJA 2L41A 3MUVP 4K4XA 4A8KA 3SQGB 4GKJJ 4DS5A 1AT1B 3FDSA 4LRDA 4KYZA 4USHA 4AFFA 5K14B 4WE1B 2CMAA 2VC1A 1V9OA 3LGMA 4ECTA 3C6TA 2DR8A 4XDDA 3K5MA 1XMQF 1X31C 2BIJA 4GC6A 1CC7A 2FVCA 4J9SA 3LP1B 3R1HA 2F4VJ 3MGJA 2RD5C 2BKOA 4YB7A 1TL1B 2VBXA 2V69A 2P5VA 2E5LF 1M5HA 2ROGA 4P71A 1C85A 2V2ZA 3ZMPA 2JSXA 2JFFA 1Q5YA 2CNIA 5KFJA 3SSRA 4DPWA 2P6XA 3JQKA 4TQRA 1WC6A 3M32B 5A76A 2A3KA 5DDPC 2CNLB 2CNKB 3P45B 3ZZRA 3TZXA 3JTNA 3NMAA 2WJPA 2Q3PA 2WZ1A 2XI2A 2ZM6F 2GCFA 1CC8A 3GYNA 3I7ZA 4FXWA 3SI8A 3VQTA 1WORA 1GMWA 7FDRA 2VA3A 3CEDA 1XBOA 2XSJA 3R8YA 1T8EA 3DYAA 1CULB 5EHPA 3M9OB 2HIYA 4C8MA 3K5NA 1VBZA 2WCXA 3H2VE 1X4FA 4DF8A 1S0NA 2VL1A 2X51A 5AE2A 4J5OA 4P2XA 2KFZA 4B3MJ 5HBMA 4EU0A 4JI5J 1R27B 4JI2J 1RTJA 4KHMA 3MECB 1DQ9A 4LVNP 2CDQA 3NRBA 3JSYA 2Y1LB 4RW8B 1IBLF 2LXUA 5KFHA 4Y0FA 4L3NA 3ZM1A 4R8UB 4KT0C 4ZK7M 2AWZA 4ALZA 1PYTA 3DHWC 2BBEA 5C7PA 5SZTA 3RZAA 1KLMB 3EDQB 1Q8KA 2RMLA 1WKKA 4LF7J 2BVZA 4X4NA 4N77A 2Z8QA 4NXNF 5HJXA 5L9XA 1UMJA 1G1GA 3K5OA 3CJ8A 2W4PA 3HI9A 4QYZJ 4FF2A 4U95A 4PUOB 4DSKA 4WFAQ 2OIHA 3VGVA 5CYMA 1EQMA 1RTIA 3LP0B 1R0AA 1YJRA 1X0FA 3O6QA 3MD1A 3V0IA 4RUCA 3FSIA 1I9SA 2IA6A 2LP4A 3HZEA 3J7ZT 3TA1A 3LH2S 5M2UA 2B8PA 3R7BB 4LRBA 1FEEA 2Y9HA 1HNVB 2ZD1A 3W9IA 2ASYA 1HQUA 1OHDA 1FKPA 3S3KA 5KT5A 5IZHA 4NCAA 4FXVA 1GH8A 5KFZA 1HBNA 2J9DA 2DHGA 4OLOA 2H9ZA 5KFNA 2ZKTA 1P9YA 4PWDB 3QCZA 3HN7A 1YSJA 4AQYF 2DVIA 3ZZPA 2Q6BA 2VG6B 5DETA 5ETMA 1XNRF 2WGPA 1VJWA 3KLEA 1RCOB 3FZBA 5ETPA 4I2QA 1YG0A 1TUVA 3PS5A 1NB2A 4RWWA 3ILJA 1SIZA 2B9EA 4RBTA 3CF5Q 5K9VA 3RG6A 1VCTA 5EWEA 4A4JA 3EPGA 4Q0BA 4AXJA 2Y8WA 3CCMS 3PYEA 1VQ4S 4TU7A 4HT7A 2HVHA 3TNVA 2FTRA 1APSA 4Y34A 3RBEA 1FDNA 4OX9J 3OL8A 2K06A 3M9MB 3TO8A 1H2UX 2HS4A 3OQ2A 3NMEA 4ZCMA 3I55S 2YWFA 3CJ5A 3DLEA 5IFMA 1XXVA 3THTA 2V4JB 3UN3A 1NZ7A 3LQVA 2KG1A 3RUBL 2K1RB 5BZXA 3HVTA 1UW4A 4DV0J 2L48A 1WC5A 2A0FB 5BR8J 3FFIB 8RUCA 3HSZA 2H5IB 5KA0A 1C0TA 1NZ8A 1EQ0A 2LEPA 1IJEB 4H1OA 1VRUA 2G0JA 2R4FA 4OV6A 2VTDA 5A0YB 1HWIA 4KGZB 1VQMS 4DUZF 1UA0A 4NI2A 1T9TA 4QAPA 4C4WA 1RUSA 3BQ1A 1YKWA 2CUYA 3T9ZA 3JQJA 3D9BA 2J16A 2KN4A 2MKKA 2GQQA 4F3MA 1H38A 2HG4A 1NJIT 3D54A 5U47A 4ZVRB 2I4GA 1TK0A 2AZRA 2FC8A 3FRYA 2I6OA 1HBOB 1JJ2R 4CYUA 1F3VA 5HI7A 2ZOGA 2JJ4D 3IAM9 1ICEB 3P5TL 4M5GA 1S9FA 4MTPA 4LSNA 2W9BB 1MMLA 4JBCA 4X84A 3QCKA 3LWMA 3QNWB 4DV6J 2I6PA 1HNIA 2QDCA 1QM9A 2I5JB 5CH7B 1LFWA 4ZVUB 1UWBB 3MMCB 2J9DE 2J6TA 3BYPA 4Z7YA 2RB7A 3H5SA 4X4SA 3QBCA 4F0KA 2KFYA 2BW2A 4XO0A 2BZ2A 2OPSB 3J81U 2V2VA 2AHOB 1WI6A 2QMXA 1YRUA 2HMIB 4USMA 3D3CJ 1NH7A 4DR5J 1TFYA 4JV2A 4NWFA 4JI4F 4MK9A 5D4NA 3QKPA 4WYLA 4ELTA 4IKAA 5DG8A 5GAGI 1MWYA 3MAAA 4ECYA 3R5GA 1R43A 1RWWB 2QL9B 3BM8A 1FRHA 4O44B 4A48A 2GS8A 4DPOA 3TZWA
chains in the Genus database with same CATH topology
2W7OA 4KKOA 3BN4A 2DNRA 4CH7A 2XGPA 3MEEB 4LSLA 3ETOA 3PX0A 3GFYA 4DR7F 2BM1A 5K22A 2J16B 3IXQA 2CNFA 2L08A 3WX4A 2VONA 4OZNA 1T03B 3IS9A 2EWHA 2ILZA 1TKTB 5LXRA 2VASA 1Q53A 4FPRA 3TAMA 2FY1A 3S6EA 3BO2A 1YGYA 4DV2F 5LJ5Y 4YR3A 1JKHA 2LYVA 1RT2B 4OX6A 1C4AA 1L3TA 1ZPVA 3D5MA 4WU3A 5DM7Q 4RLEA 4A8OA 3I9V9 2G9OA 2BM0A 1G2EA 4IR9A 2QBSA 5BYSA 1G1HA 2HHWA 5IM0A 2KFNA 3DLGB 2OOQA 1OO0B 4K0KF 5CA5A 3O5TB 4G3IA 2JVRA 2FDNA 4OFZA 2N7CA 1M0SA 3I9ZA 3V0EA 1UEVA 2DK2A 1UJ6A 2HLUA 3MEGB 3DU6A 5KT6A 1DQ8A 5KFWA 3KLFA 3PO5A 3FQKA 4DQIA 1V3AA 5KFCA 1NB7A 2BDPA 2DCUB 1KN6A 2YKOA 5A8WA 3CXCR 3BGUA 2XZWA 3MM5A 3U7JA 1C1BA 3OXFA 2RDJA 1BQMB 1CG2A 1YI2S 6FD1A 3Q0AA 1IKWA 4B04A 3CCRS 1JLAA 3TVKA 1X9WA 1FTCA 3JSMA 2AU0A 2HHPA 3JSRA 2J7KA 4BHQA 2UVVA 4QU6A 3NG8A 1I9TA 3BR9A 5L1KA 4IH7A 4ILMA 5FDLA 1UFWA 4PXEA 1DJ0A 1B0PA 1NK0A 4O4RA 1FDAA 3VZHA 4U67Q 3U1LA 1U4BA 2OPPA 4E98A 3I0SA 4EGLA 4TU8A 1U6FA 1HNWF 1Y3JA 2M52A 3CC7S 2CVEA 2IMGA 4R0EA 2QA2A 3IWXA 2Y1JA 1PC4A 5HLFA 5ADZA 4KPYA 2EC0A 1OWXA 1FERA 2SHPA 2YX4A 4DQPA 5CYQA 1JLBA 1HARA 2HHSA 1R8HA 1RT1B 2H02A 1RT7B 2RKIB 4KV8B 1H2VZ 3T19A 1NJXA 3OFEA 3T3FA 1J5EF 5IBMA 2XMVA 2AGQA 1D3WA 3MM9A 4EZ6A 5KFTA 2I3UA 3GMGA 1Q7YT 2JEFA 1XN9A 2ADBA 1NK7A 1KOOA 3W2VA 1FD2A 3IC1A 4NA3A 5E7OB 2H4KA 4QAHA 1FDDA 2KYZA 3R5BA 5BZZA 2A2DA 2R7WA 2VEUA 2CFXA 3RB3A 4MKBA 4FS2A 2P6TA 2QSFA 3VAHA 4Q7AA 1N56A 4PWUA 3H25A 5EUHA 1U1QA 1NH8A 3H20A 4NLGA 3V6DB 1P15A 1NK5A 1UEUA 2O66A 3K8VA 3QCNA 1HFEL 2UUTA 5KACA 3H8YA 4ECWA 4F4XA 2HVLA 1RISA 1YIJS 1XR7A 2QT7A 3I80A 1P1TA 3ENWA 1S6UA 1QVGR 1KONA 1MW7A 3X3UA 4PG8A 3NNHA 2FJBB 1Q6MA 3WBZA 1S4FA 1O51A 2YTCA 3UFCX 1D9DA 4LJMA 1U1PA 1VQLS 4DSJA 3G96A 5F8NA 4TLQA 2UUCF 4K5SA 4F02A 4DOZA 4BCAA 4HRFA 2AYEA 2DH7A 2JVOA 4PG5A 3CCTA 1N8RT 1GTHA 4F4YA 4KO0A 3P6YC 2R8IA 1LWEA 1YZ4A 2QRRA 4OHIA 2RRNA 1UKUA 2ZBCA 3DRRA 4KKOB 4CO4A 4C8YA 1KTQA 3B82A 1BY9A 5L8RC 4RNOA 3V6JA 3QCFA 2PI4A 3J7Z5 4OHZA 2PA3A 2K2PA 2WHOA 1C2PA 2RRAA 1TKDA 2I4HA 3OFHA 1NO6A 3RZ2A 4PXDA 3PACA 5B08A 4UOCA 2FIUA 1YRTA 3CCJS 4H4KC 4OHVA 3QGIA 4ICLA 4QIVA 3TAMB 3LANA 3VQSA 2C2EA 4M5DB 3CWJA 1XEZA 1ECVA 3E8OA 1JKHB 3ZZOA 5I3QA 1VC6A 1IR0A 4FN5A 5L9NA 1BC6A 1JK9B 3S8SA 4Y2MA 1FE4A 2DGSA 5M43A 1L8KA 3H2LA 2WOMA 5KG7A 1DAXA 3RRGA 1L3KA 2A2CA 3KG0A 5IM0B 4ECRA 1KQSR 2YNGB 4WYWA 2A10A 2K3KA 5DGBA 1U2FA 5J1PA 2XGQA 3UQSA 1WTBA 4OI2A 5GADI 2XEXA 1IBMF 3Q23A 4X4QA 2X1AA 3BN7A 1TV6B 3DXBA 3PFOA 4IFVB 3DGPA 5KFAA 3QMQA 2UXCF 2HW3A 4NL5A 3ZZYA 1C1CB 4V19X 1VQPS 4BC7A 1FRXA 2CPDA 3MM5B 1C1BB 3OHAA 5FIIA 2HRUA 3OLBA 2UZAA 5DQIA 2DNZA 4YR2A 3HHEA 4CIOA 1JLAB 3OFFA 1L8GA 2I3RA 3FQLA 4RUHA 2SXLA 3NAHA