1U25A

Crystal structure of selenomonas ruminantium phytase complexed with persulfated phytate in the c2221 crystal form
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
TEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Selenomonas ruminantium Phytase in Complex with Persulfated Phytate; DSP Phytase Fold and Mechanism for Sequential Substrate Hydrolysis
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
molecule keywords myo-inositol hexaphosphate phosphohydrolase
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u25A01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 1u25A02
2C46A 3ZV2A 3D44A 2HNQA 4GE6A 5AWXA 3S3FA 1G1GA 3I36A 2PA5A 1ONZA 4J51A 1YGUA 3S4EA 5K23A 1AAXA 2CM8A 4R0SA 5KA4A 2FJNA 1OHDA 2QBSA 3NMEA 4IKCA 2CNEA 5KA7A 2JJDA 1XXVA 2H02A 1QZ0A 4GFUA 4MBBA 1WAXA 4S0GA 4D3PA 5IBSA 2H4KA 1EENA 1Q6MA 3V0JA 1C88A 4Y2EA 1OHCA 2Y96A 4Y14A 2NTAA 2HC1A 5GTJA 2B49A 4HRFA 5BZZA 5MMZB 1G4WR 4QAPA 2BGDA 2YDUA 3QCHA 2A3KA 5KADA 5BZXA 4BJOA 4PVGA 1L8GA 1PH0A 1ZZWA 2SHPA 1Q6JA 2I3RA 3AWGA 4YR8B 2PI7A 2NLKA 3AWFA 2NZ6A 4PYHA 2J16B 2I3UA 2OC3A 3M4UA 4GE2A 1P15A 2CNGA 4YAAA 1YGRA 4D3RA 2WGPA 2QBQA 2NT7A 3V0HA 1I9TA 1OEOX 2F6YA 3ZM2A 1OEMX 1ONYA 1ZCLA 2CNIA 2I4GA 3ZMQA 4JMKA 2HY3A 4H34A 2G6ZA 3ZM3A 3QCBA 2VEWA 2B4SA 1OETA 5J8RA 4OHLA 1WRMA 2AHSA 1RXDA 4NNDA 3S3EA 2B3OA 4GE5A 2H03A 1YWFA 2QDCA 5M43A 1MKPA 1JLNA 3BM8A 2CFVA 4KYQA 2ESBA 2I6OA 3V0FA 1BZJA 1I9SA 2J17A 3O4TA 4OHEA 3BRHA 2PSZA 2H4GA 4R0TA 1PTTA 5K25A 2A8BA 3EAXA 1V3AA 2GWOA 5KABA 1PTYA 3I80A 3QCJA 1C85A 4AZ1A 1QXKA 1XM2A 2F6TA 3ZM1A 3QCMA 1OHEA 4WOHA 3F9AA 2QBRA 2CJZA 3LJ8A 1I57A 1BZCA 1PYNA 1L8KA 4ZI4A 1PTUA 3RO1A 1X24A 4NWFA 1C86A 2B4PA 3MOZA 2CMBA 1G7FA 4HJPA 2HNPA 3ZMPA 2P4DA 1XBOA 2Q47A 1T48A 2OZ5A 3CM3A 1Q6SA 5I6VA 3QCDA 3EU0A 3U96A 5K9VA 1C84A 3QCKA 5KAAA 3QCCA 2VEVA 2I5XA 3V0DA 5IBMA 3GXHA 2OOQA 2I4HA 1J4XA 3MMJA 4NYHA 2VEUA 4DGPA 1LQFA 3F9BA 4RKKA 4QAHA 3MOWA 1KAVA 5KA2A 3F99A 4RI5A 2C7SA 2I6MA 3BLUA 1YTNA 1LARA 2Y2FA 2F6VA 2CM7A 1M3GA 1YZ4A 2BIJA 5KACA 1T49A 2Q05A 4ZRTA 1C83A 2B4OA 4ERCA 3AWEA 4RHGA 1ECVA 5KA3A 2VEYA 1C87A 5LXQB 4OHHA 1FPZA 2ZN7A 2PT0A 2QCJA 5K9WA 4RH5A 2M3VA 5KA1A 2F6WA 2F6FA 4B04A 1Q6TA 2QEPA 1NO6A 4KYRA 3D9CA 2BZLA 1PXHA 2QDPA 2CM3A 1ZC0A 1FPRA 3EB1A 2PQ5A 4WU2A 3A5KA 2G59A 2F70A 1PA1A 3QCFA 3O5XA 2CM2A 3BLTA 4NWGA 2H4VA 5K24A 4I8NA 4JBCA 1LYVA 2I6PA 2CNHA 2IMGA 4OHDA 1Q6NA 2DXPA 5EHPA 3F81A 2NV5A 4KI9A 4WU3A 3QCEA 1PTVA 1NWLA 4QUMA 4JMJA 1FQ1A 4GS0A 3QKQA 3V0IA 4JNBA 1U25A 1G4US 3A5JA 3QCIA 1VHRA 4HJQA 1YN9A 3OMHA 4ZN5A 1GWZA 2NT2A 2PBNA 1YTWA 1Q1MA 2ZMMA 3N0AA 1YFOA 2HCMA 2BGEA 2CNFA 1YPTA 1RPMA 2H04A 4GRYA 1SUGA 2F71A 2HC2A 2I4EA 3O4UA 3V0EA 5BX1A 1NL9A 3EZZA 1G1HA 3QCGA 4WTYA 1NZ7A 2I6IA 3EMUA 3F41A 3QCNA 1XRIA 2F46A 1GFYA 2FJMA 2I42A 3OLRA 2CMCA 2QBPA 2R0BA 1A5YA 3D1HA 1OEUA 3O4SA 2MBCA 2HVLA 3D1QA 5KA0A 2F6ZA 3PS5A 4QUNA 2QCTA 4RDDA 3S3KA 4RI4A 4GFVA 2QDMA 2B07A 3GXGA 3S4OA 4RH9A 3RZ2A 3H2XA 3S3HA 2J16A 5BUGA 3O3LA 1WCHA 4NX8A 2HXPA 5HDEA 2BV5A 2GP0A 5KA8A 2HB1A 2I1YA 1XXPA 1D5RA 2OUDA 4ICZA 3ZM0A 4D3QA 4OHIA 1BZHA 2P6XA 2I6JA 2B4UA 2VEXA 4H1OA 1NNYA 1OESA 4GWFA 2I75A 1NWEA 4TVVA 1PA9A 3I7ZA 1R6HA 2RF6A 1U26A 1JF7A 1T4JA 3QCLA 2AZRA 1G1FA 1KAKA 2CMAA 4GRZA 4QBEA 4BPCA 1EEOA 1YTSA 4QBWA 3RGOA 3V0GA 1OEVA 5K22A 3D42A 3SMEA 2GJTA 5KA9A 2FH7A 4Z6BA 2E0TA 3RGQA 4DGXA 1Q6PA 3B7OA 3CWEA 1U24A 1G7GA 4R30A 3QKPA 3SR9A 3D1OA 5EHRA 1ZCKA
chains in the Genus database with same CATH superfamily
2FJWA 3D6MB 3MM6B 4E0DA 3BEGB 2CPJA 2G0JA 3PW4A 2UVUA 1J2VA 4QWBA 1RAHB 1B0TA 3NAIA 4KYZA 2UVWA 3HN7A 3QCDA 1A6LA 4GE6A 1HA1A 2ZJRQ 4Y34A 3HHNB 3S3FA 3VAKA 4X4QA 1TAUA 4YB6A 2ZBQA 4DV5J 1ONZA 2B8QA 2XMVA 4OZ1A 4C6AA 2AQ4A 3P5BP 4BDPA 3VGTA 3MM5A 1KAVA 2NZCA 2Z8QA 3S4EA 2HNYB 3UR3C 5K23A 5D0EA 1YRXA 3OL8A 3N5BA 2CDQA 2VFRA 1N5TA 1QAJA 2VHGA 5H9FK 1MN9A 3GYNA 3PCOB 4HHHA 4DPXA 5L9NA 4DV1F 2VA2A 3GMGA 3L7PA 2QA4S 2CM8A 4KSEB 2OGUA 1T0TV 4JUZA 1HBOB 4R0SA 5KA4A 1N33J 4F36A 1M5SA 2H4YB 3I9V9 2HW3A 2QBSA 4Q7AA 1XEZA 2FC9A 1KOOA 2ACMA 2QZ8A 5DG8A 3QBCA 4DQQA 1HFEL 1TTHB 4HDHA 1IBLJ 4QU6A 3NMEA 1IR2A 4WIIA 3CJ3A 4ANDA 2MKJA 3R8YA 2HQIA 4HT5A 4MIWA 5BR8J 3UCUP 2JJDA 1SVDA 1TFYA 2G9OA 4DQSA 1WELA 4OYAA 4NLSA 2LLZA 2A1BA 3E3XA 3JSBA 1VFJA 2G1HA 4EBEA 4V19X 3UD5A 4F2SA 3UDCA 1UWBB 2MEWA 2YXLA 3LANA 3NS5A 4G1PA 5DG7A 2XTJP 3DOMB 4MBBA 1WAXA 2PA3A 1M1GA 5T41A 3E2EA 4D3PA 1C0UB 2VOPA 1RTDA 5KFTA 4L76A 4NYPA 5FDLA 2RD5C 2KM8B 1S77D 2KTQA 5AT1B 2FLPA 1OHCA 2EG1A 2HBRB 1NDPA 3BS9A 1RAOA 5GAHU 3GIJA 3ZL8A 2F9JA 2Z2LA 3BPDA 3UVJA 3MWBA 4NLRA 3MR6A 3V6DB 1S0NA 4Y14A 3P6YC 3M2VA 4MFBB 4OJ1A 3HVWA 4B3MF 4ED5A 3ILOA 3PEJA 2MB0B 1R8CA 1EAYC 1U1NA 1HI8A 1R31A 2A0FB 2Z30B 3BR8A 3GFXA 1RYRA 1S6PB 4HRFA 2BGDA 4UAGA 4H4OA 5C2GA 1LWCB 1SPBP 1UZDA 2ROEA 1YI2S 4PVGA 3OLBA 3UO0A 4JV1A 4DU8A 1S76D 2UUBJ 1FKPA 4P71A 1VQMS 3KJFB 3PIOQ 4DV4J 3BJYA 5F3ZA 3AA9A 2EC2A 3KDOA 4Q5VA 2R8HA 4LFAF 1WNEA 1NK4A 2K7KA 4M5DB 3M9MB 1FVQA 1G4CA 3KG4A 4U8VA 5A6PA 3X1LB 2NZ6A 1RTHA 4YQWA 2QEXS 2IM0A 3D5MA 3EICA 1B64A 3BN7A 3TZXA 1LV5A 3I55S 4M5NA 3DC2A 1HNXJ 3BGUA 1JXVA 3EM1A 3OR1B 5HMZA 2LEBA 1DLOB 2JC0A 1YGRA 4D3RA 2R2RA 2NUUG 1TV6B 3BREA 1X9SA 1SL2A 2NT7A 1Y0HA 1ZZFA 4JI4J 3W2WB 1IJEB 2IDLA 4DUTA 1LQ9A 2ZBCA 3GE9A 2NCKL 3DRYA 3UD4P 1U47A 4DJBA 4NCGB 3J7ZT 2X1AA 3CPWR 3DLLQ 3KOAA 3V6KA 3M2RB 4TY8B 2WB4A 4CLFA 3OJSA 1I9TA 2Z2MA 1ONYA 2I4GA 3ZMQA 1JLCA 3TRGA 4CO0A 1OSCA 3PRDA 1SH2A 5DM6Q 2YKMB 4ETZA 1KQSR 1AT1B 3PM9A 4D3HA 1HWUA 2GGPA 1X4HA 1SQFA 2VKZG 5GAEU 3SI8A 1Z4UA 2VODA 2B4SA 2VEWA 5G0RA 5FLXU 3OHBA 1A9NB 4W92B 3CULA 1FF2A 4QBUA 4DX7A 3UDLA 4CI0B 2BQ3A 4OHLA 2HVDA 2PMHA 3T6BA 2AHSA 1RXDA 1N36J 4O4RA 4L6V3 1S1WA 2F5GA 3MTJA 1RAGB 1VRQC 4J9NA 3S3EA 3AODA 2ZVIA 4IFVA 4RX6A 3KK1B 3BQ1A 4O0NA 3MM9A 1RACB 1YQHA 3B54A 3I4PA 3ZZPA 2H03A 1JJCB 1YWFA 5HMYA 2QSWA 5M43A 2IDEA 5T7LB 2YX1A 1R6YA 2W8KA 3VWSA 2FDNA 4DCOB 2VTEA 1S97A 1MKPA 2W7OA 1EB0A 1JLNA 1S7IA 4AZ1A 2J0WA 2XWXA 3SMZA 3FK4A 4ZCKA 1L3SA 4U7UK 3MEDA 2XMAA 5J2QB 4C4WA 3AB2B 1WSRA 1VOMA 1YBTA 2OD4A 2QE5A 4XK8C 1U6ZA 4DV4F 3W9JA 4EYIB 3G6YA 4M5GA 3UD3P 4DMZA 2I0XA 2J17A 1SH0A 3CJTA 1LWXA 1FA0A 3BSOA 1TQLA 2H4GA 4R0TA 2CFXA 2I38A 1N32F 2CQCA 1PTTA 5KT4A 2RUGA 3HHLB 5CH7B 2DY9A 2AM2A 5BZZA 2AYMA 5L39A 4ZP7A 4X64J 3H2LA 4ATNA 1D8YA 3AXKA 4Q0BA 3MMCA 4Q2LA 1VQPS 2PMZD 4R0EA 2ADBA 4DFPA 3RR8A 3GYGA 4YMEA 1OYEA 3AA8A 4OX9F 4LF7F 1TKZB 5DDOC 3OUYB 4QU7A 2K1RB 2WOMB 2YKQA 2BRLA 2WVFA 4FS1A 1N34J 3FRZA 1I5OB 2WBRA 3CCSS 3G87A 1X4BA 1QTNB 2HK3A 4OZ0A 3VZHA 2ASJA 1W7KA 3F9AA 1HNZJ 4OYOA 4BLGA 4IRCA 3RBXA 4A47A 3PNIA 4IG3B 1B7YB 3BBBA 4BHQA 4Q45A 2CXEA 4PWUA 5CZXA 2CPIA 3GYXB 3DRPA 4I2PB 4C0BA 2DNPA 4CWBA 2GFFA 1RI7A 3I9ZA 4NYZA 4DI6A 3LGHA 4ZN1A 1WORA 2VB6A 1RAIB 3NP5A 1DTTB 2CJKA 1VQNS 3M8WA 2WW4A 3PEHA 3J7YI 4FF3A 3OR2B 4KHPF 2VTDA 4ILLA 2FZCB 1RT3A 2HIQA 2CYYA 5HATA 1FRLA 5SUHA 3PX6A 2QA1A 1F9EB 1T9XA 3ZMPA 2YY3A 1RU2A 2YWHA 3DLEB 3IGNA 2BXJA 1WKKA 2CA9A 1SV5A 2DT9A 1XBOA 1GTEA 1YG0A 3FCHA 4YR3A 2B7BB 2XZTB 3GIKA 1FCAA 4URSA 5M2PA 4F4XA 4DPYA 4URQU 3KLGA 1N6QA 2FLNA 3EU0A 2V4QA 1JWWA 1S59A 1TP7A 4K59A 2Y1RI 4EMDA 1J5OB 1KLMB 3DRSB 2CNLB 3GILA 1PTYA 3QCKA 3DN9A 2RNEA 3L7UA 3HT3A 5I3UB 1MROA 3WX4A 3H59A 2JLFA 2RH3A 2DXFA 2VEVA 1QD1A 3LH2S 2IJFA 4NLWA 4LJMA 3CCWA 4ZVPB 3MPWA 5HJXA 4B02A 1VK3A 1Y10A 3I0SB 1F3FA 5KFYA 5F8GA 2W9CB 3NBPB 2CJQA 5A0YB 3J7AN 2FJNA 5KFSA 1S72S 1VRTA 4ECQA 2HGLA 3IWLA 2LP4A 3O6QA 4M5DA 2VDIA 4WP8A 2OSRA 4YR2A 5IXUA 4ID8A 1U1LA 1TU0B 4IOAQ 5F8JA 1ZPWX 3GSDA 1UKUA 2OEJA 3R2DJ 4ED6A 1EP4B 4U95A 4J9MA 3KTQA 3KNAA 3HFVA 1T02A 2QG9B 3N28A 2I6MA 3CJSA 1FJGF 2JHEA 3BH6B 2XSFA 4ZPBA 1KR4A 4O3RA 5G0RB 5L9XA 1LARA 2F6VA 4CNYA 3RYLA 1ZM3A 1RT1A 1U6FA 1DQ9A 3HZGA 3N01A 3R5GA 3QGGA 1CJUB 1RT2B 1VQ8S 1S1VA 2E1RA 3PYEA 3S7RA 3PXGa 1F5BA 3TVKA 4NA2A 4QWDA 4IO9Q 3EDQB 1H6KX 1N5SA 2R4FA 1BXNA 2AEJA 5D3GB 5D3GA 3H0PA 4ZPVR 2VC1A 2V0NA 3MECB 3VAGA 4JI5F 4ZRTA 1IWAA 2KRRA 1NJZA 5IFMA 1JKHB 2FLOA 1RAFB 2WONA 2X51A 4AL6A 2BQUA 2QRRA 4FKXA 1FJEB 4IRKA 3CUNA 2H1YA 2AGOA 2DIVA 1ZAXA 1HQ2A 5LXQB 1HBNA 1KDNA 4OLOA 1PAEX 3W2VA 4BCAA 1RE1B 3PG9A 1GH8A 3BKFA 3UI3A 5B7WA 3BPSP 2ZN7A 3AD7C 2OFGX 2DPIA 5B0GA 2QCJA 3CCRS 2B6AB 4FBTA 2L41A 1FKPB 2AW0A 5E5NA 1VRUA 2CJXB 4DS5A 3POTA 4K2JA 4N5SA 1SUQB 2POKA 2ZNZA 3HSZA 3DGVA 3P3DA 3WHIA 2YBVA 4Q8FA 3NNAA 1DFDA 1KTQA 2UP1A 5EN1A 1WHXA 4FS2A 2I4HA 2E66A 1CJKB 2YTCA 3B78A 5E2QA 1JLEA 3TEHB 4C98A 4DCJB 2AEFA 3MPYA 4RUCA 4DV7F 2HNDA 1G3OA 3BGOP 3DXBA 4ZVOB 1MWZA 2W7AA 3M8ZA 4A8XA 2HHQA 3TOQA 2AEMA 3D9CA 4KPYA 1T9WA 2MQQA 3MM5B 3QT6A 5HSPA 4ZS6A 1YIJS 4R0JA 3FKBA 1RHJB 3NCRA 2V9WA 2V4JB 5GAHI 1FPRA 3GIIA 4WU2A 1Q4RA 4C3KA 2LVWA 1AZSB 2NSBA 5DG9A 3BSNA 3WX8A 2C2RA 1N36F 2RHQB 4WZMA 1E6YA 4FP9A 4M5IA 4JMKA 3MM6A 2XMKA 4G1IA 2GCAA 3JQKA 1TZ0A 3N6NA 3ITHA 4CVLA 5D15A 1E6VB 1PA1A 4MT1A 2HPUA 1RAJA 4NWGA 4GVBA 2J8AA 3CJKB 2B5JA 1R6VA 1TUWA 2GO9A 2ROPA 1TFWA 5BYSA 5ETKA 1FDDA 2H4VA 2E29A 2C3UA 2KT2A 1DTTA 2GZOA 2N4DA 3QJPA 3GJSB 1G1XA 4PG6A 2CJYB 1Q53A 1AW0A 4JI2F 1LYVA 1PGZA 1VHIA 5DDQC 4CLYA 3RZAA 3IAM9 2CNHA 2HRUA 2XMMA 3DRPB 2ZBPA 3FEYB 4NEZA 2OMOA 2AJ4A 3GJQB 2EFGA 3GR1A 2HFSA 3IG1B 1GAOA 4HEA9 4EBCA 4PRFA 2DNHA 4CO5A 4YR0A 3V6JA 2YQ3A 2V8VA 2DH7A 4YHHF 1IR0A 1RLCL 5IC4B 1QE1A 3QCEA 2ZZNA 4DV1J 1NWLA 4NZ6A 2RQMA 1NKBA 5B08A 2YWGA 3RB6A 2OMLA 3B82A 2K1RA 2WOMA 4WFZA 1K9MT 1UA1A 1QDUB 1SC1B 3IXQA 3CTRA 4DEZA 5CD4H 3BQ2A 2AJ0A 4C8KA 3ETMA 5HBMA 1L5UA 3DGPA 4PXCA 1KQKA 5IM0B 5MLCV 5CA5A 3M8YA 2CPHA 1YLXA 2VC0A 1RKJA 3GFYA 4B9MA 1S1UA 1L3KA 5GAEI 3M8SA 1SH3A 3QAUA 2O01C 1YN9A 3C14B 5I42A 4ZN5A 1XQIA 5B0DA 1R0BG 3OXGA 5SZTA 3TAQA 2PBNA 2W2NP 4KO0B 4I2QA 5HLFB 2GCBA 1NB2A 3G6ES 4O3NA 2OTJS 2G0IA 3P96A 2R8IA 4P75A 2BGEA 3QFWA 1GMWA 5AE1A 5KA3A 2G1DA 3KLHA 5HQMA 1V5VA 2QX0A 3C14A 2AP6A 3KLEB 4TXSA 1PSDA 4E98A 4H54A 4O4GB 2XGQA 4KHPJ 2M8HA 3WIVA 3TNVA 4GRYA 1SUGA 2DNMA 3DGPB 1BMQB 3U1NA 5IM0A 4X4OA 3CVKA 4OFZA 3VAFA 1UAGA 3O4UA 2XY7A 3MM9B 4A48A 1PYOB 3HHLD 4LQ9A 2ZWPA 1JNZB 3QMQA 2LQ9A 4ZPTR 2BBEA 3DHXA 4YY3F 4GC7A 3EZ5A 3W3SA 3K58A 1MSWD 4TLRA 1CPZA 1NZ8A 3QCGA 3J81Y 3LALA 2ATCB 1CBKA 4I6AA 2I6IA 1S1XA 2NXUA 3MXHP 1W7WA 3GB0A 1U4BA 4FZVA 4J90A 2M9KA 3TO8A 1JB0C 5D4NA 1VC5A 4PUOB 1Z1ZA 2ASDA 5L1LA 2OH2A 1YSJA 3QGHA 2FJMA 4OYXA 1KVIA 1O0PA 1KVKA 2V9KA 1C1CA 3ZXWA 2F7VA 4DQIA 2MMYA 3CD6S 3KJQB 3AB4B 3OLRA 3ZM6A 3QAEA 5CXTA 1SJQA 3V81B 1R0CB 1NH8A 1JLBA 4N77A 1T8EA 3JYTB 2E1PA 2R0BA 1A5YA 2B9YA 2CQIA 2ZITA 1CC7A 4LF2A 4NCGA 3VGUA 1OEUA 2R8JA 2CQPA 2ILYA 1NHUA 1X0PA 2F4FA 2NXNA 3ONQA 4R8UA 4RNFA 3RB0A 3CE8A 2F8MA 3D1QA 2MQMA 3QT8A 3HO1A 2JSXA 2F6ZA 2XMTA 3QJJA 4B3SF 2MLYA 4U67Q 1U1MA 4JI4F 3PW7A 3DRRB 2QC3A 1YHQS 4LFCJ 2C28A 1VBYA 1B7FA 4IFYA 4XDDA 3WDOA 4RI4A 2J9DA 4DR5F 4CO3A 5IT9U 2BE2B 3QT5A 3S4OA 4PAAA 3W5XA 2ASLA 4HR2A 4M95A 4RH9A 2H48B 5ETOA 2J16A 3U27A 5G4DA 1S12A 1FTRA 2IY5B 4HTJA 1F1BB 3TUZC 2FQQB 4ZLNA 2OPQA 4RBVA 4K8RA 3V2UC 1E8CA 1WG4A 2I6WA 2O66A 4KIAA 4ZVFA 1RAEB 3ZNJ1 4CP5A 3J7YU 5J2PA 4NLQA 2IA6A 4M8LA 4ZA1A 2UUCF 3L7OA 1IKVB 3MUTP 3HI9A 5DDRC 4F50A 2DGUA 4DR7J 1U2RA 3DLGB 2LMIA 3MPDA 4DV6F 1R0AA 2NR0A 3EXCX 2A6OA 2X5OA 1ITPA 1KC8T 2LQ8A 2VEXA 3M1VB 4GKKJ 3LA0A 2ZVSA 2UXBJ 3CMQA 1RTZA 1VQYA 3DCAA 4PEOA 2B6AA 4A8WA 2F4VF 2HHHJ 3IRXB 1NUEA 4DL2A 1NWEA 3GIRA 4KRWA 2K7JA 4Y2AA 1N33F 3ZC4A 2EFQA 2L3MA 2KHCA 3CDEA 3DDNA 1IBLF 4F26A 1RISA 2Q6BA 4WFNQ 2CPZA 4GKJJ 1WOPA 1JF7A 2GO8A 4F25A 2IM3A 4LIWA 2CMAA 1F5CA 2JEJA 4DL5A 2BJ9A 4QBEA 3BBCA 2C3YA 4KT0C 1AB8A 1SQEA 2XBPA 3RAXA 1T03A 4X84A 1N32J 2U2FA 2W2QP 2CIMA 3JQJA 4C0OC 1XR6A 1TL7B 3OL7A 4X4VA 5K22A 1S9EA 1VJWA 4DSEA 3SMEA 3AT1B 4NLXA 4F3MA 3W5ZA 4QYZK 2V4JA 4X4TA 5A5EA 1BQMB 1OJ4A 2A6MA 2BJ1A 5DGBA 3CNQP 2AF6A 2IYIA 2W4CA 3HSJA 3ZNUA 4DFJA 3BDPA 2QN6B 4OX9J 4FF2A 3BDEA 4I7FA 1C0TB 3N6LA 3WQPA 2YVSA 3RGQA 1HBOA 3BYPA 3HHLC 2Y1LB 1R0AB 2EEYA 3B7OA 1FO1A 2XZDB 1UFWA 4Z6BA 1BE4A 4UOCA 1B0VA 1CJKA 1JIHA 2VD3A 2Y0SD 1NSQA 1G7GA 1VMBA 4NZ0A 3T5LA 1VBKA 3QKPA 1RADB 2X1GA 2YWFA 5K14B 3ZZRA 3Q8QB 3CMES 3M6VA 4TNOA 1VQ5S 3U1LA 3QRQA 1KBRA 2HLTA 3NWRA 2KZZA 3FGVA 4PR6A 3ZV2A 2C2KB 2I1RA 4RO0A 4IOBA 3J7A1 1ZAWA 4NOHA 1EHWA 2HNQA 1KSPA 3OTCA 1P9YA 1NBEB 5GMKa 4DG1B 4MKVA 2LECA 3I0SA 3MVNA 2GQCA 4HDGA 2VASA 1YGUA 4MK8A 2BKOA 1NKCA 4UY8T 1XJWB 4DV0J 1RHQB 5ETNA 2DBBA 1WACA 2P6SA 4ZVQB 3VV2B 1KONA 2BW2A 5JXSA 2XI2A 1S6QA 3MAQA 4ELVA 4DL6A 5EDWA 2B9XA 1UP1A 2VQFJ 1HNXF 5CYQB 3I6PA 3FJ2A 2VPXB 4LSNA 1N6QB 3M6UA 4RW6A 3S01A 3HKWA 3KK2B 1TUVA 2P2CB 2OPPA 3J81j 2Y8YA 2JFDA 3DNCA 4K0KF 5HAOA 2HAFA 2UXDJ 1H2UX 2M3DA 3V81A 2LXUA 4OJGA 2Y1OA 5HMXA 3GFHA 4U96A 3FSIA 2R7RA 2VQEF 3HVAA 1XXVA 2W01A 1Q5VA 8ATCB 1RTJB 4JI8J 2KL8A 2QTWA 2HFNA 4M1KA 1PO6A 1TVRB 3BGRB 4I4BA 4CLKA 5DM7Q 4ZIVA 3ET6A 1K8AT 1T9YA 4CLSA 4U8YA 1KFDA 3MUMP 2CPYA 1NJXA 3QO9B 4S0GA 1ZM4A 4J9UE 5IBSA 1NNDA 1OQ3A 4MYTA 2Y1JA 4MIBA 4M94A 1JXEA 4RUBA 4Q8EA 2CQBA 3V0JA 3NAHA 1DAXA 4CLPA 4ECZA 1IBMF 1UAWA 3QCZA 2A3JA 1Q1KA 1VRTB 3OHAA 1WEZA 3MCNA 3A12A 3NGKA 4WK1A 2NTAA 3BKTA 4ID5B 5IC6B 2JLGA 3GSIA 1JJ4A 2GJFA 2DHXA 3MCMA 1DURA 4QW8A 1HI1A 3KLEA 1BQNA 4P74A 2H54B 2J0QD 3O2IA 1MROB 2HNZB 2HURA 3AFGA 3TVYA 3FCVA 3JSMB 4O44B 2C2EA 2UU9J 1VQ6S 1NJIT 4NMXA 2BE7D 2H9ZA 1CC8A 1RWNB 2YQ1A 4HH0A 2YDUA 4G6VB 2A3KA 3QCHA 1UVLA 5C5JA 1GT8A 5KFXA 1ZTWA 3IAS9 5K20B 5T14A 2UXCF 4ZVRB 4B3RJ 1V5IB 3MAAB 3M8PA 3I0RB 1DHMA 2HMIA 4LF4F 2SHPA 5KT3A 5KFZA 4ES2A 3AQOA 1D8ZA 1CJVA 9RUBA 2E9ZA 1CJVB 1PG5B 1YBUA 2CQ2A 3BV8A 3NOCA 1NXIA 4X4PA 2HZCA 1TKDA 3ETOA 4DR2F 1WG5A 5HL7Q 3M8PB 2G59A 1KQFB 1TUGB 2AGQA 2OC3A 4G65A 3FBEA 5HMWA 4BC9A 1VC6A 4XPCA 1QUVA 1YJUA 1U0SA 2HFUA 3KJNB 2X1FA 3CJRA 3D6FB 3M8QA 5C42A 5K8PA 3UPFA 3VAHA 1VISA 2VU5A 4P10A 4NWBA 4A8QA 2WSEC 4MYUA 3J7Z5 1P15A 1X4DA 2W2OP 4ETXA 3D66A 3EX7B 4YAAA 1C85A 2F9DA 1X9MA 4FYYB 2C2DA 2XHWA 4LF7J 2QBQA 2EXUA 4DPWA 3MHYA 3PRBA 4FF4A 1Q95G 3VHQA 2VG6B 4LFCF 3LGMA 4CT8A 3HKZD 2XHCA 2K3IA 4KFBA 5LXYA 3DI6B 2VQEJ 5BR8F 1IKXA 3PKMA 4PQAA 3UFCX 3KK1A 3ZO7A 1KOHA 2XMJA 3BR9A 3H8YA 5HK4A 3T1AA 2R7QA 5AE3A 1QJHA 1OO0B 3DYAB 4QZVB 1SIZA 4X4SA 2CZ4A 3LP0B 1X9WA 1NJWA 2DR7A 3AOAA 4F4YA 4H34A 4WKYA 2DD8S 4NZ7A 1K1QA 1Q7YT 1BLUA 2YKAA 1WDTA 1GNKA 1HBNB 5J8RA 1FD2A 2Z58B 2D3O1 2G2ZA 1GX6A 3UAGA 4Q0BB 2FVRA 4NNDA 2JNJA 2UUCJ 3EGNA 1JQGA 4OHYA 2ZKTA 4USIA 1TR0A 5C25A 4I0WA 1BC6A 1Q78A 1PYSB 4NRUA 4TY8A 2B3OA 2ACYA 5BXIA 3JSRA 1YKWA 1S49A 2C2OB 2W2PP 3F56A 4OI2A 4RW6B 4EUVA 4DSKA 1U6BA 4GKKF 4DUZJ 3GTYX 1MN7A 2CNKB 1S6QB 2Y0BB 4X4UA 2QDCA 3DOKB 3TUJC 3PYZA 5D78A 1VLYA 4NXMF 3J80Y 2ZDOA 2KXHA 4X66J 2MKYA 3QZ8A 1GXTA 2KXFA 1HYSB 4OIXA 3N6MA 3TI0A 3C2PA 4USKA 1HD0A 4Y6IA 4O3OA 3A3OB 1FDBA 5T7LA 2VPWB 3QIPB 4C11A 3Q8SB 4EZ6A 1MWYA 4LRDA 4DUYF 1S0VA 2ESBA 3T5HA 2I6OA 4BUCA 3TAPA 2E9RX 4EYHB 3GP9A 1BZJA 2LXIA 1V9OA 2VUGA 2PO4A 4UUXA 3IGVA 2AU0A 4OHEA 1RKIA 3NOGA 4HHJA 2QMUB 5A8WB 1X5SA 4P2XA 4ZVUB 2VG5A 3CCLS 3AOCA 4USVA 2OPSB 4LFBF 3AXMA 4P2SA 1GG4A 3KLIB 4Z7YA 3PYFA 3OSPA 5E0OA 1V3AA 2IVYA 4FVMA 3NBPA 5A0YA 1LWFB 1CSJA 2BJEA 3N5FA 3LAKA 4H4OB 4ZOSA 1C4AA 1ZA2B 2B8PA 3LPEA 4BC7A 2LU2A 4GC6A 4JI7J 3D0GE 1APSA 1P9QC 4CH0S 4NCAA 2F6TA 4GRSA 3QCMA 1OHEA 3IO1A 2QIFA 4NYOA 3MPUB 1HYSA 4JYAJ 2IRYA 2QBRA 1ZPVA 1SC6A 1J5OA 4DV3J 1UJ4A 3UR0A 2ZH2A 4JOUA 3M2RA 3D6HB 1NPKA 3D54A 4PYDA 4K4XA 1NH7A 5LOQA 1PCAA 1BZCA 1S9EB 5EX3A 2EPIA 3HJVA 3ZZYA 2FJDB 4TU7A 3M32A 1PTUA 1NHKL 1X24A 4NWFA 1CJUA 1RT2A 2OAUA 4QF5A 1WHYA 1U8WA 4Y2CA 1PKUA 1XMOJ 5ITHA 2DR8A 3DOMA 4DX8H 1IKWA 4PG8A 3O5XA 2DXEA 1NPRA 1UWBA 3MOZA 1Y5LB 3ZFVA 4USMA 5JJBA 3AD8C 3AD9C 3CD5A 1MW7A 3V5RA 3TA0A 3H25A 3BGFA 3G6XA 4LF6J 5F3TA 1LWFA 4UOHA 5D4LA 2X3GA 1WSVA 4DV0F 3TUPA 1RTHB 5AXKA 2B9EA 2BM1A 5B09A 5F9LA 4O0IA 3G86A 2HGMA 3PVXA 3NY0A 4C13A 1SC3B 2AWZA 3C6UB 4IH6A 4DUZF 1OMSA 2E44A 1XMBA 4XO0A 2Z2ZA 4J9VA 4YFUA 3R6GB 2M5YA 1FKAF 4AYBD 4B3TJ 3CM3A 4P2FA 3K8WA 4AXIA 4ZDNA 3HLUA 3OLAA 2HVHA 2FVCA 1OSDA 2R42A 4U9RA 5HP1B 3M6WA 5IT9Y 4RBUA 2DPJA 1AFJA 3Q2TC 3U96A 3M6XA 3CJ2A 2CPEA 1C84A 1UEUA 3SSRA 3TANA 1GX5A 5KG3A 2YWWA 3LQVA 1RCXB 3Q22A 4ZIYA 4ZCLA 5IBMA 3M8QB 4FYVB 2I5JA 5C42B 1KLMA 2XQCA 2J9EA 1J4XA 3EVMA 3TJAA 3MMJA 2R9LA 1Q79A 4DGPA 3UVJB 3OBIA 1LQFA 1H7WA 3W8GA 4QIEA 4OZ2A 2VL1A 2WB1D 1GQQA 5H1SV 5HROA 5A76A 1D9DA 1KN6A 2KFNA 3EXYA 4JI7F 5KA2A 2NXCA 4A8SA 3M9NB 3DLBA 4L3KA 4IO1A 1U09A 3I5BA 1IBMJ 1VQKS 4B3SJ 2FZKB 5B0AA 4ANEA 2DEJA 2U1AA 1N52B 2ZOGA 2VKRA 1WKJA 2CQDA 3MEDB 1RGVA 5C24B 4LMZA 4DL0C 1N0VC 3AJDA 2Y2FA 1XR7A 1REVA 3JSMA 5DLGA 4RU2A 1RBAA 3L95X 2V69A 4IQMA 2YPZA 3W66A 4R8UB 4B3OA 1FRKA 1TAQA 1YRUA 2DR6A 5F8NA 4Y2MA 1HI0P 4LBPA 1E0DA 1KTVA 2JRSA 4DCPB 2ZH7A 2MQLA 2WBMA 3ZZUA 4ZIWA 3IMQJ 1XNRF 4MTPA 1EX8A 3MD3A 1T49A 3I5AA 2Q05A 4ES3A 2CWXA 4IG3A 4AQYJ 3SXLA 3R97A 1C83A 1W25A 2B4OA 4DBQA 3NMRA 2BJ7A 2LXFA 5L38A 2UV8A 2RQ4A 2YNGB 3FVYA 3GFZA 3LP2B 3NLCA 5KT6A 4DV6J 3R5AA 1LXNA 1ZH5A 4B3OB 3I32A 1FTCA 5C7PA 1U0HA 4FYWB 2OD6A 3GQCA 4JV5F 1Q8IA 4DQPA 1NZAA 2EG2A 1LOUA 3GU0A 3MMCB 1KP6A 3MEKA 1FPZA 5K8MA 1XC9A 1RHMB 3HFKA 3KLFB 3IWXA 5H9EK 1RXOB 1R43A 2Y8WA 2DNLA 5K9WA 3UCGA 3HHLA 2CAJA 3G8SA 4A8MP 1H74A 3LK7A 4RH5A 4ZPDA 1WG1A 3T19A 1FNXH 1HQUB 4PYHA 4NPOA 3T41A 1X4AA 1T9TA 5KFOA 2HHVA 4PQUA 2F6WA 5F8IA 2AKWB 2QSFA 3HCXA 1VR6A 2VZ9A 2D9PA 2GC8A 1B99A 2RE1A 2WZ1A 3OXFA 3PHTA 3EWGA 1Y7PA 2CQ3A 3RRKA 5KFRA 3KMSA 4UTGA 1KS2A 1N88A 2B51A 4QIGA 4ED3A 4TYBA 4YOEA 1NO6A 2EKNA 1P1LA 2ZUGA 3BO2A 3TP2A 3VAJA 3GJTB 1HPZB 1RZMA 2MQPA 2DHGA 3D68A 2DJWA 1UW9A 2M4MA 4JB8B 4B17A 2VFSA 4C8OA 4QOTA 2C3MA 4QWCA 2QA4G 5HBMB 2PQ5A 1RJJA 2DRDA 4QJVA 4OYPA 4WK3A 2ZH4A 4LF8F 4OYMA 3Q8RB 1UA0A 2XS7A 1LK5A 4KPCA 3PDNA 4QYZJ 5GMEA 2HQFA 3WBZA 3W9IA 4TU9A 2DY1A 2Y3YA 1NK5A 1Q5YA 1N8RT 2HS0A 4WE1A 3T9NA 1KHVA 4URGA 1AUSL 3MFIA 3QRRA 3E51A 4UY85 1R3NA 3MEEA 3NRBA 2MYFA 2RUSA 2DGXA 5A8RA 1UMJA 2UAGA 3OPKA 1QE1B 4NXMJ 2MZTA 3KK2A 4ZITA 4UZBA 2DYAA 3D0HE 3OFGA 3Q2SC 4DHVA 2D7SA 2BMBA 2OFHX 3MZIA 5A2QY 4J9PA 1VC0A 1C0TA 1XNRJ 1WOSA 3IG1A 3NGDA 1IBCB 4LRFA 3M2VB 4MFBA 3RB3A 3LOUA 5DS7A 1YJNS 2IMWP 1U2FA 1Y5IB 3NCQA 3KHLA 2Z4PA 3TA1A 3D2WA 1FXLA 3OFEA 2PFFB 2MJUA 5L1IA 2NV5A 4KI9A 4BWMA 1UCNA 2B5JB 2GHPA 1DLOA 1HW9A 4C48A 4NCBA 2HQCA 2E1AA 4X2BA 2Y67A 1M90T 9ATCB 4X4RA 7FD1A 2J6SA 4WFBQ 4CVMA 2CPFA 2LFVA 4ZP8A 2M2BA 3RBDA 1RTDB 1RSCA 1D9AA 2VF3A 3FBCA 2VOOA 1FVSA 3MMAB 3AJ1A 2XYHB 4DG1A 5KOXA 3R1LA 1ZBTA 2MY8A 3N0VA 3KLIA 1NO8A 2ZFHA 1WOOA 2YWEA 1U1QA 4A8FA 2IAJB 3ADAC 4DV3F 5L1JA 3SIPB 5L46A 3T3FA 3A5JA 4ED1A 1HIYA 4DV7J 1VHRA 2R2SA 3KK3B 3FRYA 2Q6CA 2ZEJA 2XWYA 4N8OA 2HNDB 2PMWA 2QL5B 5ETVA 5IQ6A 2GMLA 2ZH3A 2ZH6A 4KKOA 1YFOA 3NCPA 4J9SA 2UUWA 1S6PA 2HCMA 4LF1A 1D1UA 2VPZB 2ZC3A 3BBFA 3R7SB 5KFFA 1YBAA 2LEAA 2LKZA 2P9EA 4RNNA 4LF8J 4KQZA 1J6UA 3ELHA 2JEGA 1VRUB 2QL7B 5JVHQ 2H04A 2DNYA 4NLYA 2HC2A 1MLAA 4EGLA 4B3MJ 2YNFA 2IM1A 1RWUA 3NS6A 1EKRA 2KB2A 2XCAA 2I9SA 3K89A 4LBIA 2KFYA 1NL9A 3EZZA 1T9VA 2B4VA 2BE2A 3MURP 4J37A 3VALA 2DR9A 4B3TF 2PFDA 1NZ7A 4IFYB 2N7CA 4ZPWR 2L08A 3WZ0A 2OTLS 1FRIA 2KZMA 3F41A 3QCNA 2PDAA 3OTBA 5EWFA 5A5FA 2GVDA 3TUIC 2XS5A 1QM9A 3MM8A 3V4MA 8AT1B 3DLJA 5CAAA 1HNWF 3Q89A 3MPVA 1K47A 1TL1B 3MECA 4FNHA 2GV1A 4RJVA 4NLGA 3IBCB 4YEAA 5ETLA 3EUNA 3T5JA 5CZVA 1S0MA 3IR5B 3NNHA 3TR5A 2XNQA 4AE5A 2CMCA 2MPUA 2HFOA 5MMZB 3O4SA 3D1HA 5KT5A 3M1VA 1TELA 3DI6A 1NAQA 5THWA 5DQGA 1GMUA 2P8IA 3JAMU 4DSJA 3ZM0A 1CG2A 1Q0NA 2GVZA 2BZ2A 3FUYA 2VBZA 4NE9C 4WXOA 1DY3A 1NRKA 2OELA 4OX8A 3K57A 4QPXA 1S0OA 3QGIA 4PWWA 1R27B 3US5A 2GQ2A 5B0BA 3GJRB 3H5YA 3RRHA 3JB9k 2HHSA 2GC5A 2E5LJ 5I3QA 3LO3A 3S3KA 1R8AA 1UPMB 3ICLA 2N82B 3V4IB 1RP5A 3ZM5A 2B07A 3GXGA 3QYYA 1T9UA 3MM7A 1ULRA 2CZVC 4F0MA 3IS9A 5KG6A 2XZWA 5JMNA 1JLGA 3Q8YA 2GNKA 1OY8A 1AXQA 5F9NA 3LW5C 1WJ9A 2HXPA 2OUGA 4FXWA 2BV5A 5HDEA 2GIFA 2E7VA 2WK4A 1RT7B 1VGYA 1OIAA 2P5VA 3PR4A 4RNHA 1HPZA 1YJVA 2I1YA 4J9KA 2CWKA 4RNMA 2VH7A 4FBUA 4G1QB 1D5RA 4K4WA 4P52A 2GAGC 2OUDA 2NXEA 2J5AA 2L48A 3BGLA 3KNGA 2F8EX 4P6QA 5I42B 2DH9A 2RDDA 5IZHA 2B4UA 3HPOA 1Q8LA 4EZ9A 1RT7A 3N9UC 5H9EJ 3EMTA 1H73A 4KGVB 2FGCA 1B3TA 2DVIA 1OESA 3TYTA 2R7XA 3HXMA 4GWFA 3OTEA 1YZ6A 4K50A 2RT3A 2KRBA 5E3PA 3I7ZA 1S6UA 4CCHA 2G13A 2HVZA 3MGJA 4L72B 4N8NA 1JXLA 1SJ4P 1LEOA 1H72C 4N7TA 2G2OA 5ETRA 5GVQA 2NS1B 4PKDB 3W8PA 4ZVSB 5K8OA 4DF4A 3OR2A 2W7PA 2AGPA 3TA2A 3ULHA 2D3OR 1U45A 2N7YA 4TKTA 2OJ3A 3SCKE 1T4JA 2QL9B 4O23A 4Y00A 2XS2A 1LK7A 2HS4A 2LDYA 5K5MA 3CCVS 2RS2A 2D69A 4B9VA 3V0GA 4QBWA 3RGOA 1X7VA 5D0RA 4ENOA 4DR6J 2Q47A 3QIDA 3U1MA 2H4WB 4J9RA 5FD1A 3D42A 3A1YG 5LM7E 1WTFA 2MZSA 3N4WA 4KH0B 5KA9A 2KN4A 2HQGA 3BB5A 3L9ZA 5CYMB 3VF0B 2DGTA 5KFPA 1B70B 2FZGB 2HRTA 4I64A 3VR1A 2ZJPQ 4LSNB 2IBKA 4NXNF 3OTDA 2ZBIA 1RA7A 3KLHB 3MR2A 3DLKA 1U24A 4FVCA 3SCLE 4QWAA 4KHRA 3H2UB 5KG0A 1VQ9S 2DK2A 5C24A 2YKOA 4KO0A 5A2QU 2RQKA 3TVZA 4DZDA 4ED0A 1SBRA 3ZTQA 5DGAA 3H42A 1Q86T 4R30A 1C1BA 4FPIA 4F4KA 4PPDA 5DZ7A 5LMUF 3SR9A 2FHJA 1TK8A 2ZD1B 1ZCKA 2C46A 2ZDPA 3PO5A 2XC9A 2F1FA 4KBIA 2MQOA 3D44A 2XULA 1F9HA 3K17A 3U02A 3T1HJ 1YJ9S 1WC6A 4ZMMA 3Q0AA 3LWMA 2AD9A 4LF5J 1KLNA 1G1GA 2E1MC 2W1BA 4WBFA 2PA5A 3W62A 3F99A 3I36A 4J51A 3GV8B 4C8YA 1FFWB 1RHKB 2BIJA 5KFBA 2YH0A 2YX7A 4DR7F 4KAIA 4OYWA 4RW8B 1N5QA 1G6BA 3LP2A 2VBWA 5KFCA 1UVKA 3CIMA 5B0EA 3PIPQ 4J9QA 3DXSX 5KG5A 4DZ6A 2KG0A 2EFOA 1ZS6A 1AAXA 3IM8A 4ICLA 2APOA 1FD8A 2QLWA 1UJ6A 2QLFB 3OT9A 4IYQA 2KDOA 4EO8A 3OSNA 4DR3F 4USTA 4NLTA 1VQOS 1OHDA 1TK0A 1SUQA 3CIZA 4IOCQ 1TL5A 4LRCA 3M30B 3ZTRA 3OTOJ 4IKCA 2AJ2A 1ICEB 4QIWD 1T94A 2RQCA 4JP8A 4ECYA 3BO3A 1VK8A 2H3EB 5J2NB 1M5VC 2F6YA 4GKJF 1X8DA 4J5OA 5D77A 1YX2A 5J2MB 2NXJA 3HX9A 1YJRA 3UN2A 2W24A 3T5KA 2H02A 3G96A 2PI4A 2BA9A 1M1HA 3WIUA 1YJ7A 3NGTA 2DRAA 4ZJOA 2H4KA 2XO7A 1EENA 2RF2B 3CC2S 1C88A 1Q6MA 5KFVA 3CDUA 5B0CA 1CVJA 4MK9A 2Y96A 2YNFB 4CZCA 4YDDB 4QR0A 2LQBA 3QRPA 2CQ0A 2PE8A 3R7NB 1WHVA 3M8RA 2I5JB 2XB2D 2ZH5A 3OFFA 3QWUA 2HC1A 1XR5A 2XYGB 2IC3A 3BO4A 2PIIA 1NSKL 1PJ6A 1X4GA 4ZP6A 4HVZA 4EFAC 3ILLA 5HVGA 3PHEA 4QW9A 4ZLPA 3DMJA 3FFIB 2FHJD 3CF5Q 5A8RB 4UQGA 2V8GA 1IM4A 1N5YA 5KADA 5BZXA 2R7UA 3GONA 3SV4A 4BJOA 3ENWA 2WAQD 2IA0A 1W2IA 3CB4A 2OPRB 1L8GA 1ZZWA 5IV4A 1B0PA 2DGOA 2JJ4D 4NI2A 5AE2A 4P73A 4KGMA 4OHVA 4JI5J 2FIUA 1T7PA 2RSQA 2I3RA 1GQEA 3S6EA 4HL9A 3UQSA 3AWGA 3H7HB 2VDHA 2ZNYA 4ZVTB 1Z2LA 1R8BA 4ILMA 1QVGR 2J16B 3IA0A 2I3UA 1VQSA 5CCLA 1G7CB 1IKYB 3R27A 4GE2A 4N76A 3LP1B 1HNVB 3W5YA 2KG1A 4CIOA 1JLQB 4M5JA 1X5OA 1JK9B 2IC3B 2R8KA 3UDVA 4K4YA 2J6UA 3DHWC 2P9GA 4EK2A 2HHTA 1UFKA 1WHWA 2NSCA 4LIRA 2WGPA 1S1TA 1SJRA 4V1Ak 4ECWA 2KYZA 3D4JA 3KLGB 3ZZ0A 5HJYA 4K0KJ 2QT7A 1RDRA 2AIRB 2BX6A 2V50A 1S7HA 2VONA 2CVEA 3FEZA 4PG4A 3TARA 1CEZA 1PJ5A 2PGCA 4P9SA 3MUVP 4AL7A 4XTTA 3CGIA 3PV8A 4M5MA 1AYEA 3KLFA 2EFNA 2A10A 2JVRA 4NASA 3TQEA 1Q81T 2G6ZA 3QCBA 3AAWB 3SBMA 1RT3B 2DNNA 3O5TB 4JV0A 1V3ZA 3A3NB 3S1TA 7FDRA 2DGVA 2KKHA 4OHZA 3A8KA 2F63A 1WRMA 4DV2F 4X4NA 3AY0A 4AD6A 4N56A 1EP4A 2VG7A 2OPSA 5KTQA 3F0NA 2VV5A 3GLJA 1UWAA 3W60A 5A8WA 3G8TA 4FYDA 2QMXA 4AT1B 1YZ7A 1W2BR 1HR0F 4QR1A 4L74A 2VICA 2HZVA 1W78A 1FRXA 3R5JB 3V6HA 1K73T 4OZNA 4JI0F 5E41A 4UW2A 3U7JA 1YVFA 2WTZA 4KY3A 3H5UA 4KB7A 2UXCJ 2C2NA 2EKYA 1MMNA 3K5LA 2DKOB 4AFFA 1XTZA 2FB0A 2MXYA 3ZZZA 3RTVA 2CFVA 1RWXB 2WJPA 3C66A 4KYQA 2CQGA 3BYRA 3PJWA 2P6TA 3CWJA 4FNIA 5D0GA 3VQSA 3QJLA 1S1UB 4GMKA 1BQXA 4CLTA 1H98A 2WW8A 3CDWA 1RWWB 1M1KT 1XNQF 2Q1LA 4LSLA 1SV5B 3BRHA 2DGSA 4IH7A 3ENAA 1RCOB 2YKNA 3DKDA 4OI4A 4K4TA 3KMQA 5K25A 3I0RA 2J0XA 5KFNA 2RVJA 1L3TA 2O67A 2YQ0A 2LEPA 2RKIB 3FSYA 1H7XA 5I3PA 5KABA 3JQMA 1OY6A 5KG2A 2LU1A 1N56A 1QXKA 1XM2A 2JEIA 1GMWD 2XPCA 1QSSA 2RRBA 5B0FA 3BM8A 4KR0B 2UUAJ 1LW2A 1FXDA 3G82B 4HTIA 2D3ZA 4WPAA 4WOHA 3PKYA 4U6PA 2NPFA 2F3JA 2CJZA 5ETPA 4U7CA 1SKRA 4YDXA 5HP1A 4KGZB 2KJWA 4OV1A 2Q79A 1ZTTA 1PYNA 2C3OA 4CLLA 4ZI4A 2VG6A 2EI5A 1Q82T 4LRBA 3MMBB 4IR9A 1FFSB 3I87A 1P27B 1Q8KA 3TZYA 3DRXA 4KTQA 1C86A 3HDSA 1QVFR 3D67A 2DO4A 2I8EA 1S57A 1FXRA 3DU5A 4CH7A 4Q2MA 1CJTA 2SXLA 3NGUA 4LF5F 1M5KC 1VYAA 3NEKA 1J27A 1VHFA 2GIQA 4DV5F 4F4ZA 2JFFA 2NYHA 5KG7A 2BKNA 4HJPA 1IXKA 2WHOA 2HNPA 1EQMA 2GGPB 3HD2A 1Y4ZB 2DXDA 3SDEB 1OPIA 3D9BA 4DPUA 1UW4A 4RW7B 4UOGA 3GG1A 1PC5A 4MKBA 1HMVB 1RT5A 3M32B 2MSSA 2VQFF 1IBKJ 4DF8A 1FRJA 4IDKB 3EDRB 1AZSA 4ZK7M 4PWDB 1Q6SA 4X66F 4CM2A 3MOWA 2RDIA 1U2CA 2WCXA 3D6TB 1HLWA 2QYGA 3W2WA 2UXDF 5J2QA 4WFYA 5EWGA 3PX0A 2JL9A 1K44A 1S9FA 1YGYA 1JBWA 4M63A 2F00A 3MOJB 1SB6A 3OR1A 4NLPA 1BGXT 3MI7X 1ZETA 1DZ5A 2ZBRA 2I5XA 1D3WA 1JLQA 3C15B 3V0DA 3PACA 1SKWA 3GXHA 1CS4B 5A8KA 1MMLA 2J8SA 4DR4J 2KI2A 4NYHA 1DRZA 4DSFA 1PBUA 3AOBA 3JTNA 4WJBA 4RKKA 1FWLA 3K7RA 2FPHX 1VQLS 1RUSA 3POTB 4LF6F 1X60A 4PG7A 4WF9Q 3HULA 1WI8A 3CD0A 2RHSB 2JEFA 2J0SD 2HHWA 1RBLA 4JI3J 4LREA 3MR5A 3KDNA 1S4EA 2ALZA 1N34F 3KXDA 1NDKA 3T1YF 4PPZA 2C7SA 4Z7CA 1S4FA 5KFJA 3BLUA 4BWJA 4LQ3A 1QY7A 2CNNB 4DR5J 4CTAB 2KU7A 3PTWA 2MKCA 5LSLA 1N5YB 4V19J 4FPRA 4ED2A 1FT8A 3K5MA 4TU8A 4P2MA 4F4WA 5IT0A 1H3DA 4ERDA 4USWA 2MZ1A 1M3GA 2CM7A 2MTLA 4PZVA 3V6DA 4JI6J 5FLXY 2AYEA 1YZ4A 1UL3A 2M0GB 3TX8A 3Q24A 5KACA 1DJ0A 3JXOA 1KWMA 5KFLA 1V3SA 3A13A 3AJ2A 2Q66A 4Y2IA 1WC4A 2R2UA 1CQMA 4WP3A 2W2MP 1KD1T 1QLNA 3N2AA 2OEKA 1IUJA 1NMEB 2YPYA 1DQAA 3D7SB 5ADZA 1T03B 4USUA 3A8EA 3HZEA 2VJUA 4CLUA 2AYGA 1EQ0A 2JFHA 3QLHB 1C87A 4WTOB 3CD7A 3NRSA 2COLA 2XM3A 2E7XA 1QUPA 2FUG9 3BN4A 2EBEA 5KFMA 2UXBF 5DJBA 4OHHA 3AQPA 2QGFB 3OVSA 1HNIB 1S10A 4LR7A 3VVTA 4ZN3A 1TMJA 4CLZA 4RWXA 4ECTA 2VG5B 1GEHA 4H4KC 3BSAA 3NGSA 1IN0A 1H2VZ 3M30A 3THPA 1MWQA 8RUCA 4OI0A 2VOSA 4OQJA 2JWNA 5KA1A 5K14A 3H2VE 2V2ZA 4OZ5A 1F3VA 1BWVA 1LWCA 1SXLA 2IMOA 3QIPA 4MK7A 3TEGA 4C11B 2X3DA 3LWLA 1F2GA 5KG4A 4KKOB 1U1KA 2QEPA 4OHWA 4PCQA 4CM0A 1LFWA 3EYZA 3NMAA 2W4DA 4LBHA 1NDLA 2LYVA 2FJBB 2JVOA 2KHDA 2ZOFA 3KHHA 5I3UA 1X5TA 2G2YA 2XLKA 1PXHA 2CNIA 2QDPA 3DRSA 2OPQB 3FZBA 2GMHA 2R7SA 2CM3A 1ZC0A 1I3OB 1TL3B 2V34A 2PC6A 1ZAVA 2VBYA 5E3QA 4NXNJ 4ECVA 1TL7A 3IN5A 1WWHA 4AL5A 3KLVA 4C12A 4KGXB 4XAKA 3R6LB 5FDLB 3UNYA 2ZD1A 5GADU 4DSIA 4K4ZA 2BANB 3KG1A 3WC0A 2V4RA 2QLJB 3I96A 2QV6A 3W1YC 5EHHA 4RLEA 1EKSA 5AJ3F 1T3NA 1ECVA 3R5DA 3CCJS 4FYXB 2MKHA 4DLGA 5I4MA 3KHGA 5J2MA 1Y3JA 1EETA 3CJ4A 3AH6A 3E01B 5M2UA 1AA1B 1M5HA 2MKSA 2UZAA 1BQNB 1Y11A 2VA3A 4WKRA 1YJTA 2J76E 3QATA 4JBCA 3IR7B 5A8KB 3LP0A 3C3LA 1WC5A 2H65B 2W9AA 1I6JA 2WSCC 2FVPA 2PA8D 5HQLA 2D1CA 1VQ4S 3G9CA 4NL5A 1IKXB 1KEKA 4I67A 1T11A 2IMGA 4OHDA 1URNA 1Q6NA 2Q43A 4CQ1A 4QWEA 2E9TA 4IH5A 5EHPA 1WC1A 4BBYA 2CG4A 4ZCIA 1ELOA 1FX4A 4IG0B 1FI4A 4LFBJ 1A7GE 4JV2A 4NLDA 3IRWP 4JMJA 2H5IB 3BGRA 2L9NA 5IWAJ 3HJFA 3H5SA 1UVIA 2JDJA 1GXUA 4RW9A 4GS0A 3H90A 4P72A 1X4EA 3RAMA 3QKQA 4H4MA 3V0IA 5EWEA 4OLPA 4TY9A 3ZTSA 2AMCB 1H2TZ 1X5PA 4OMFG 5KFHA 3PZPA 3T1HF 3RJMB 1B4SA 3GPAA 3SZ2A 1U25A 3DM2B 5IQQA 4JI8F 4JNBA 1JX4A 2ZZMA 4KV8B 1HBUB 6FDRA 3KUEA 1GXLA 1YJWS 2NREA 2ZZTA 1FGSA 1UEKA 1R8HA 1YTWA 4K4SA 1Q1MA 3N0AA 2QFIA 2CPXA 1RAAB 3H98A 2HWTA 2ZHBA 2A2CA 3N79A 2GJ2A 1XN9A 2MHEA 1DTQB 4ZPCA 5GADI 2CVIA 4DSLA 2CNFA 2KH9A 3CJ8A 2HVEA 4KV8A 1XMQJ 4LR8A 3EZOA 4MAKA 2OKQA 2IIHA 3W64A 3DM2A 1RPMA 1YPTA 2HFVA 5AXLA 4USJC 4X65J 2XMWA 1EIYB 3Q8PB 1KVJA 4RKUC 2BZLA 2I4EA 3V0EA 3HP6A 4Y65A 2R7WA 1JLGB 4OHXA 1RYSA 1FESA 1NCLA 5EX0A 4EI2A 2N3OA 2B0GA 1FDNA 2BE9B 2PN6A 2RRNA 4OZ3A 1FKOB 4OYIA 5AJ3J 5BX1A 2MLZA 2VG7B 1XK8A 1UFLA 3PW0A 4RZRA 2VFUA 2YNGA 2FJEB 5U47A 4JI2J 4K4UA 1XRIA 3KYLA 3BH7B 2F46A 3MDFA 3W7BA 4L3NA 1GFYA 1Y00A 4QQBA 5KFKA 2GVZB 2Q3PA 1I51B 2ZE2A 3IFEA 3ZTPA 2NZ4A 4LFAJ 4L75A 5ETMA 1BWEA 3L4BC 3K0JA 2B3TB 1RT4B 2XCPA 2CJ9A 5KOWA 3IC1A 3EVOA 1BQMA 4C8NA 2QBPA 1FE4A 4O4GA 4HV4A 2FJAB 2HBYB 3SFUA 2MBCA 3HHKA 1F5AA 2IBOA 3C8YA 2RDJA 4A8YA 4KGKA 1UETA 1FE0A 2DB1A 3M2UA 4KHMA 4EEYA 1NB7A 3PS5A 4G1QA 1NDCA 4QUNA 3Q8UA 4ALZA 2VFTA 1NLKL 3B4DA 3JTOA 1AFIA 4OJHA 1FJGJ 1HNVA 4N47A 4UUWA 1MU2A 2KYXA 3HD1A 5CABA 3RZ2A 1HHSA 4IR1A 1F9FA 1RT6A 1HQEA 5BUGA 2AZ3A 2E5JA 2ZWOA 4RPFA 2DGQA 2MSTA 4OX7A 5D0HA 4O3PA 4DDFA 1TL3A 1V6HA 4PXDA 5K8NA 3MM7B 2GP0A 4NX8A 1T3OA 3GV7B 2KFZA 5KA8A 4OI6A 2HB1A 2C42A 4DLEA 3P4UB 2IVMA 4XDCA 1VBXA 1M5PC 3RB4A 4OZLA 1XXPA 2M70A 2A2DA 3NGRA 4DPTA 3G6VA 2E5IA 4DV2J 1FK9A 2KVQE 3DU6A 1F6TA 3FSXA 2MKKA 1XMQF 1F60B 2B7CB 4ES1A 3RBZA 4D3QA 2CPDA 3CO0P 3GG0A 4R5PB 3L3CA 2NQPA 1ZZNA 4C9DA 2P6XA 3QFHA 3CJ5A 1YITS 1YDLA 1JLFA 2AJFE 2EK6A 3CDBA 2XO6A 3KJVA 4H1OA 2BOPA 3IBFB 4TVAB 4YY3J 4YB1P 3QZ7A 3R9LA 1WEXA 3C6UA 1F0XA 4QAHA 1BD6A 4TVVA 1RLDA 1RT6B 4CDIA 4DR3J 1PIEA 3RGIA 4MH8A 2CZ9A 3R1HA 1QSLA 2IYGA 2RF2A 1EETB 5KFGA 4D3GA 5IS2A 2MGZB 1VI7A 1HWKA 1C0UA 2C2ZB 2AX0A 1HWJA 1PJ7A 4ZP9A 3ZZOA 3HVTA 3OL9A 2BACA 4A4JA 3K5PA 3QLHA 5LSRA 2AZRA 4Y3CA 3UNGC 2ASYA 3HVTB 4PG5A 3LF0A 2BVZA 2VJVA 3M2UB 1QAIA 4UZCA 4BPCA 1FFGB 1JKHA 2HBQB 4Z2XA 4X62J 2KM8C 3MFHA 1EEOA 1OEVA 4LR9A 3VAMA 2K8GA 2RMLA 3PX4A 5LMNJ 4LVNP 3R2CJ 4QR2A 1FNOA 1CQNA 3UE2A 1N4LA 2FH7A 4PXEA 4USHA 1X4CA 1KHWA 1S1VB 3O8WA 2FVQA 4OI1A 2XY5A 5KG1A 2IFXA 2E0TA 4AUKA 1OQ6A 2D3UA 1RT1B 1WI6A 3FEXB 1I94J 3CWEA 2BDPA 1M5OC 4JYAF 3OFHA 3RUBL 2HVIA 4CTAA 1TK5A 4PUOA 2HHPA 2E5HA 5ETQA 2HGNA 3A8JA 3OV7A 3Q23A 4LRAA 4O3QA 3VVUA 2FLLA 2DNGA 4GO7X 1YWXA 2GQQA 3SSQA 3B4MA 4HI1A 4NMLA 2B43A 4YUDA 5J2PB 4NLVA 4EBDA 1EARA 3K8VA 3GCWP 5HROB 2XYPB 2L9WA 1VLOA 2IAJA 2JOQA 3AHPA 2DNOA 1SC4B 2IJRA 3Q86A 4TYAA 4ZVHA 2JFGA 4CVKA 3IP0A 3RRGA 1X31C 2ZKUA 1PILA 5AWXA 3MCSA 2K2PA 1RHUB 3R7BB 4JI1F 4MKAA 4F7VA 1WDDA 2RB7A 1HL6A 2WRMA 2Z57B 4PABA 3TAMB 1FRHA 2XG8A 3A4TA 4QIVA 4Y2KA 5LSOA 2KXNB 5IOLA 3H4DA 2Z2YB 3DRRA 3GWCA 3CCES 2YNHB 2KVIA 1R89A 1TL4A 2IRXA 1JNRB 2GA7A 2WONB 1J5EJ 2DNZA 4QPTA 2X7IA 3BM7A 1F2HA 2HHHF 3EVWA 2EFVA 4ELUA 4A46A 4R25A 4ZVEA 1X0FA 3J81U 4IDKA 3P8BB 4PWDA 4ED7A 3NXZA 2CQ4A 1HMVA 1RT5B 2WVBA 1S6OA 3JTPA 2RILA 3R5BA 4NX9A 3HVRA 1RT4A 2L9DA 1FHTA 2HQ3A 1QZ0A 1ZOTA 2CNEA 3SDEA 5KA7A 4I68A 1C1CB 5KFAA 4DXLA 3HMJG 2VBXA 2ZE2B 3CJ0A 3ILJA 1NK8A 4RW9B 3UN5A 1LW0A 1U0HB 3ZM1A 5DZ6A 1UVJA 4X62F 5F8LA 3KKFA 2R2TA 3MEEB 3HSDA 4OL8A 3M9OB 3O1LA 1H0HB 3LGNA 3OXLA 1Y3KA 2W9BA 4GFUA 1Y5NB 2Z0GA 3B6BA 1GMVA 3MTKA 2FC8A 2J7UA 3DYAA 2KJVA 1FKOA 2P9CA 5L8RC 3EPGA 3F73A 4DL4A 3MAHA 4Y2EA 4A8KA 1HARA 4HYKA 2N4CA 5IV3A 3TWZA 1LFPA 4KFBB 4NLOA 4W4MA 3M05A 2HRYA 4FXVA 1RHRB 4CNZA 3TZZA 4ILRA 5LJ3Y 4J9OA 2FJVA 3E8OA 2R3VA 1CS4A 3QT7A 5E3RA 1HR0J 5GTJA 1KFSA 1GFWB 1DTQA 2H5JB 3CO9A 4UQTA 7AT1B 3CEDA 4O3SA 5D4OA 4OYZA 2EWHA 2FY8A 3MCOA 1XBWA 1G4WR 5J1PA 3OUYA 4JI0J 1P6TA 2EC0A 3DFEA 3QSYB 1CLFA 4QAPA 1UZHA 2ERRA 1RWPB 3JAMY 4ZLJA 3S8SA 2DRBA 2RKIA 2V6AA 1VIOA 2AT1B 4FKYA 4NLUA 3CXCR 1Y9OA 1PH0A 4RW4B 2E1CA 2AHOB 1HBUA 3DDKA 2M88A 3ENVA 4HHUA 5F0WA 1OWXA 4WFXA 1TKXA 1XWLA 1UJ5A 4U7UD 1Q6JA 3DLEA 2KT5A 3TJ9A 2CQHA 4YR8B 2PI7A 3AWFA 2MZQA 2OIHA 1TKTB 2AJ1A 3VAIA 4DR1F 5CCMA 1S9GB 3M4UA 1PAUB 1JJHA 1XNQJ 2Z56B 4HLBA 3T9ZA 4C8ZA 2RRAA 1ZM9A 3P45B 2DNKA 3MEGA 1AUDA 2GIRA 3HM9A 3A8IA 2J7KA 3WC2A 3G4SS 1U1RA 4HACB 1RABB 4K5SA 2CNGA 2PEHA 3FDSA 1RWOB 2GMJA 1I94F 3OQ2A 4IQXA 1SCJB 2QYCA 2W8LA 3LUYA 4I2PA 2A18A 2V8HA 4LVOP 1LXJA 2V67A 3NKYA 5AXMA 2V68A 4C0HA 4ZHRB 2AYBA 1HNWJ 1OEOX 1PBAA 3TJ8A 1R8PA 5D8HB 3RBEA 1EJ7L 5DO2A 4NEYA 4IFVB 1OEMX 4RR5A 3HHEA 3IR6B 1YTYA 3OVBA 2IPOB 2HY3A 2BOAA 4RBTA 3QO9A 1JJ2R 3UCZP 5LXRA 4C7QA 2EVZA 3K5OA 3UW1A 3ZM3A 1HNIA 3F44A 3HFZB 2JZ5A 2QLBB 5H9FJ 3W2VB 4CYUB 2H5EA 1OETA 1KNZA 1RTJA 1XMOF 4BUBA 3H40A 2BEFA 1WF0A 3W61A 4C97A 2FHKA 5MAOA 2UVVA 2OZ5A 3HHDA 2BANA 5GAGI 2MJNA 2BV3A 1HD1A 4LSLB 1O8BA 1RQ0A 1FERA 2KO1A 4WWSA 1O5JA 4GE5A 2VORA 4GO5X 3PJXA 4FDFA 5CYQA 4WYWA 5F8MA 4Y0FA 2ZH1A 3TQ1A 1L3VA 3THTA 2ROGA 1RB0A 1FDAA 2NUHA 3M4XA 3NWGA 1XIQA 1QSYA 2LA6A 4LF4J 3FMBA 2UUBF 2LA4A 3PYGA 2ZH8A 4DS4A 2ZC4A 1T05A 1NM2A 4Q43A 3V0FA 3KWMA 3KK3A 4DR2J 1I9SA 1CULB 4B9UA 3ISND 2CJAA 3NNCA 3O4TA 1Q16B 3FC9A 5HVHA 4F04B 4FN5A 2PSZA 3HT0A 1BY9A 4HT7A 1PC4A 2OEMA 2MDAA 4LUBA 3SFGA 5C2CA 3EGZA 1S1WB 4NI2B 2DEIA 3MR3A 2A8BA 3TW0A 3EAXA 2K3KA 1CULA 2OPRA 1S48A 4QDIA 1IQTA 1K0TA 3SQOP 3JSYA 4F2RA 1T05B 2GWOA 3MMAA 4TN2A 3I80A 2XLIA 3QCJA 2IRUA 5KFEA 1WF2A 2ZUAA 3C15A 3LTOA 3W63A 1QTMA 3EGWB 3KFWX 2H51B 2LQ5A 5E3AA 5KFUA 1RTIA 2J9CA 3VCDA 5BYQA 4ITSA 2YKPA 2J7WA 2RU9A 2YKMA 3SSSA 2JH3A 4ECSA 2B49A 1SKSA 2XSJA 1JLCB 5ETTA 3PJ9A 4FF1A 5J1EB 1NEEA 4ECUA 3LJ8A 3OW2R 1C2PA 1U49A 1IM6A 2J6TA 3W65A 2R7TA 3PFOA 1JLAB 4YS2A 2HAIA 2YWKA 1JLAA 2CJBA 4NA1A 3PO4A 4BS2A 1I57A 1L8KA 2AX1A 4OV6A 4DU7A 4KC5A 6FD1A 1LWEA 1S1TB 5GAGU 4JI6F 5J1EA 3RO1A 1TV6A 2EBGA 2MLXA 4F67A 4M5KA 2B4PA 2EW9A 4WYLA 2IM2A 2DHSA 1RTIB 1N5VA 4H4KA 4F0KA 5DQIA 2CMBA 1WF1A 3EE3A 3QPIA 4M5LA 1PYTA 4DX6A 1ZA1B 3K5NA 1G7FA 3KUHA 1IKYA 4XPEA 5RUBA 1V3RA 4X65F 4ZCMA 1NK7A 4IUFA 3FZ2A 1CJTB 3C19A 2X1BA 1O5ZA 3M7VA 1U1OA 1UPPA 4WE1B 5F41A 3IRXA 2P4DA 3SCJE 1LNQA 4JV5J 4N41A 1SKUB 2VPYB 3JS9A 4UT4A 3OJUA 1T48A 4EU0A 2Y66A 5I6VA 1U1PA 1JMTA 1RWVB 1M0SA 1U02A 1D9FA 4E8UA 4CO2A 3LAMA 1HW8A 5K9VA 1FRMA 2D9OA 5LL6d 2W9CA 1IWGA 4W98A 3I56S 5J1NA 1IKVA 5KAAA 1FK9B 4CH1A 3QCCA 1Q7LB 4DUYJ 4DN9A 2ZH9A 4LSZB 4ECRA 1UEVA 1D09B 3CT9A 2MKIA 1FWKA 2XY6A 1RBOB 4DWIA 2HHXA 1TKZA 3LPYA 3BSCA 2RJZA 3DOKA 1NK9A 2OOQA 5KFQA 1S5ZA 2JX2A 3G71S 4Y28C 2BYCA 1EEHA 2VEUA 3FBFA 4W90B 1S9GA 3F9BA 4UOFA 4PQUB 1HQEB 2OI2A 3V0HA 2YKNB 5E7OB 1BUXA 4QIFA 1HQUA 1YK9A 4ZJQA 3EPIA 1ZYQA 4B9NA 1P8GA 4MJKA 4LF9J 1HWLA 2G4BA 2CRLA 1ZCLA 4F3OA 4RW4A 2PD1A 5D6GA 2GJIA 1C1BB 4RI5A 2DHAA 3DDIA 5DRKA 5JUMA 1YTNA 1VS3A 2DNQA 2FYXA 3MD1A 1HNZF 5HANA 3UDEA 2V8PA 4CYUA 1XERA 3DLKB 3KHRA 3SYZA 2HHUA 4CO1A 3CCQS 3MR7A 2DHHA 1U7LA 4MKYA 2FD2A 2CADA 4ANCA 3JYTA 5CYMA 4YB5A 2MHNA 3VZIA 4DPOA 2Y1IA 1OY9A 2DGWA 5DDPC 4KJIA 3GR0A 4WIQA 1VIXA 4B3RF 2GCFA 2V2VA 2DH8A 3L09A 3NS7B 2UVRA 4WFAQ 2FHMA 4B9TA 4RUAA 2RAQA 1Z2ZA 4I69A 3K2YA 2DISA 4ZHRA 3EJMA 4ERCA 3AWEA 3GCXP 2Y68A 4J9LA 4RHGA 2QMWA 2DITA 2QA2A 3I82A 4C8MA 2W9BB 5F8HA 4K4VA 4G3IA 2DCUB 3T6JA 1LW2B 4DR1J 2VEYA 3H4BA 2NYIA 1NK6A 4RW8A 2OO4A 4HACA 3RAQA 2BJDA 3SCIE 2D74B 4YHHJ 5CHCB 1KRPA 1VBZA 3A3PB 3CC7S 3H20A 2C22A 3ISNC 3IM9A 3GIMA 4RU9A 1R7IA 1TKTA 2OP5A 2PT0A 4ZJLA 3J80U 1HKAA 1WUUA 2HWHA 3D0IE 3HK2A 4S0MA 5KT2A 5HVFA 5LJ5Y 2WTFA 1EZZB 1TKXB 2CDRB 3QSIA 2E5GA 2OPPB 2VFVA 5EUHA 4RWWA 4F4AA 4IKAA 4OI3A 4EWTA 2XGPA 5E3CA 3CMAS 2HSEB 2CUYA 4B08A 4ZLLA 1HHTP 2F6FA 4P7VA 4CRJA 4ECXA 5DETA 1SIWB 3H5XA 2YNIB 4WZQA 1HWIA 4B04A 4DR4F 1Q6TA 4KYRA 2ABYA 2EFPA 2YNHA 3BF4A 2HNZA 1K1SA 2I2YA 3W9HA 4FXDA 1S79A 1WC3A 3SEOA 1GK8A 1RWMB 5LMNF 3TAMA 3IWNC 2KT3A 2MQ8A 2R7OA 2V2QA 2V63A 2HWIA 3FQKA 3ISZA 1WTBA 2NPIA 2ATLA 3EB1A 2WVDA 1RA6A 1ZM2A 2CG8A 3C6TB 1S99A 3R5CA 3OVAA 1SL1A 4B9SA 1OYDA 4WXWA 1SJ3P 3C16B 4DL7A 1W26A 1NK0A 4QCLA 3FBBA 1SI9A 3RW7A 2HBZB 4L73A 5LT5A 3A5KA 3FCWA 2F70A 1FWPA 4F8RA 3QCFA 3ET6B 2B9WA 1RK8A 3FNNA 5E33A 3PW5A 1UVMA 4OYBA 2QLXA 1O51A 4AXJA 3ZTOA 4YP3A 4NA3A 2CM2A 3BLTA 1IJFB 2FTRA 1IVZA 3DMJB 3FFIA 3VGSA 4I56A 3CCMS 5K24A 2DR5A 4I8NA 2HG4A 2MZJA 5M2RA 4ZKAA 4K2XA 2W25A 1YRTA 1IKWB 2FGOA 1O6XA 2QFJA 4J7CA 4C3MA 1H38A 4JI1J 1WD6A 5DLFA 2I6PA 1LWEB 2QO3A 2WSFC 1P3DA 3VTIA 4EO6A 4I1TA 2HZAA 4XIUA 1T95A 1TL1A 3I4HX 2O3DA 3PW2A 2PI5A 5ETSA 1Q8BA 3CCZA 3PFEA 3C46A 2XNRA 2DXPA 5HN0A 3F81A 2LQJA 4WU3A 2V8DA 3MM8B 2XSJB 3SQGB 5HO4A 3K59A 4RNOA 3CCUS 4X64F 1PTVA 4QUMA 2J9DE 4GVBB 3CJKA 3BZQA 2DTJA 3I5CA 5CD4A 1NJYA 2OHDA 1MG7A 3RG6A 4DOZA 3P49B 3ITHB 4TQSA 1FQ1A 4DL3A 3LP1A 3OTOF 2MQNA 2XEXA 5BJRA 3DLHA 1E6YB 4CT9A 2AJQA 2YX4A 2UUAF 2RIJA 3Q8VA 1WC0A 3OD2A 2E5LF 1N48A 2DNRA 3CSKA 1U8SA 4DN0A 4YB7A 1G4US 2CQ1A 2FY1A 1I1GA 3QCIA 4HH1A 1A0OB 3V4IA 3G2XA 1JLFB 3KJVB 2HIYA 2ZJQQ 1OPZA 2UV8G 2UUPA 4HJQA 3HSGA 3OMHA 4RL1A 3UN3A 2HEKA 1GWZA 1UVNA 1P1TA 3DLGA 2IVFB 2NT2A 1JLEB 2LCWA 2YH1A 2ZMMA 2CNOB 2GW8A 3D3BJ 4C3LA 1NPPA 1NU4A 3CJQA 2BM0A 3PR5B 1DARA 4GVLA 2BJ8A 2HNYA 1URRA 2NLWA 2XI3A 1IR1A 4I7FB 3PY8A 1RU1A 2BJ3A 1VCTA 2LDIA 1JBVA 2F71A 1DQ8A 3PRVA 4TLQA 3BQ0A 3KUGA 1SJFA 3PYDA 1L3UA 1SL0A 3GZ7A 2WVCA 3QWPA 3TX0A 3QNWB 5C25B 2UU9F 1G1HA 5K9FA 3VQTA 4WTYA 2N3LA 4PXBA 4YN3B 1IBKF 2F4VJ 3RW6A 2GX8A 3DOLB 2DIUA 3NL0A 2C1EB 5D4PA 3CDAA 1HBMB 2ALYB 5KFIA 2ADCA 3CC4S 2GHWA 2XJAA 3EMUA 1WKLA 2WVEA 3DOLA 3G8QA 4ER8A 4K5RA 2BRKA 1N54B 3IBWA 1SQGA 3MF5A 5JVGQ 2AM1A 2MGZA 4MIAA 1VQ7S 4F02A 1X4FA 3D3CJ 4ELTA 5J2NA 4KE5A 2QJ3A 3BKUA 3D28A 3X3UA 2I42A 2M52A 4DFKA 1QAXA 5GMDA 4ZPAA 4A8OA 4DR6F 3TZWA 2V2KA 2ZOMA 1NSAA 2DO0A 4QYRA 2FJXA 2NLKA 3OL6A 4OX6A 1GTHA 4C8LA 1NHVA 2HVLA 3CCTA 1IQZA 4R5PA 2GS8A 1SJ1A 2HLUA 4ICLB 3FMWA 4LF9F 5FJ4A 2MY7A 5IWAF 1AROP 3O44A 2M3VA 5KA0A 1C4CA 3P5TL 4OZJA 4JI3F 4CLWA 2QCTA 3T1YJ 2ZM6J 1S1XB 4RDDA 1FX2A 4ZVGA 4Q44A 1FEHA 4ED4A 4Z37A 2R7VA 4K7QA 4TQRA 2HS3A 1BHNA 3MEGB 2QDMA 2BKPA 1D0EA 4HKQA 4GFVA 3H2XA 3S3HA 1WEYA 2GHVC 5KAKA 5KT7A 2JFKA 3VGVA 1REGX 3HF5A 4I6YA 2G0CA 5LMUJ 1FJCA 3O3LA 2IJNA 3I31A 4OJ3A 2HKEA 4PYAA 2ZHAA 1WCHA 3ZM2A 1MU2B 1HHQA 3Q83A 2BR0A 2GAHC 5EGYA 2OSQA 2ZHOA 3MAAA 2HMIB 2F65A 4LT6A 2BW7A 5HI7A 2C2MB 1ROFA 4WP9A 5A6WA 3KG0A 4AQYF 2RS8A 1GQYA 3ENQA 2JLEA 1N0UA 2IHR1 4WCEQ 2Y9HA 1VDHA 3SQGA 5KFDA 1DBDA 1KQGB 2YNIA 4I2QB 4O44A 2RU3A 3GV5B 5HLFA 4ICZA 2AV5A 2UUTA 4F3QA 6AT1B 4OHIA 4P7TA 1ACMB 1BZHA 3ILIA 2I6JA 3RU0A 3QQCD 5HQ8A 3RR7A 1J5EF 1KKHA 5CQGA 1NNYA 5KFWA 1JLBB 4E2FB 4ID5A 4HI2A 2FHOB 2HFZA 1FEEA 4CO4A 3QGPA 2HQDA 4RW7A 1G2EA 2I75A 2F40A 3EZUA 2V94A 4H4MB 2K06A 2AZ1A 1U48A 3UWTA 2M8DB 1PA9A 2M7SA 3R3TA 2ILZA 3IS9B 1FJ7A 1R6HA 2RF6A 1MMDA 4UF4A 2DCLA 4DFMA 1QAYA 2W4PA 1U26A 5F0UA 3FQLA 5L1KA 3QCLA 3ZZTA 3EGVA 3THVA 4J91A 5AXNA 1G1FA 1KAKA 4GRZA 1TVRA 3B8HA 4IG0A 1K0VA 2GC6A 4RUHA 2BUNA 2E7WA 1LW0B 2JC1A 1YTSA 2B56A 2O5DA 3MMBA 3C16A 4F0HA 2BABA 2PEBA 2V5HG 5FIIA 3CW2C 4B9LA 3C6TA 4KH1B 4NRTA 1NKEA 1VJQA 2C3PA 2GJTA 2BQRA 1TMMA 5IT4A 2XLJA 4IRDA 2UUOA 2F8HA 1UTAA 4ED8A 2VIHA 1P31A 4DGXA 3G82A 4C2MA 1Q6PA 2MZRA 2ZM6F 2D41A 3SV3A 1MNEA 1REVB 2OLWA 3E01A 4DX5A 2FVSA 2EK1A 2GVDB 5DQHA 1NSPA 2CKWA 3NG8A 2R8GA 4I6WA 1HBMA 5BYRA 2HK2A 4M5HA 4DQRA 1OS5A 1FNMA 1E6VA 1LKZA 2O1PA 3D1OA 2HYIB 2XMUA 5CYJA 5EHRA 4MMOA 1RWKB
chains in the Genus database with same CATH topology
2FJWA 3MM6B 4E0DA 3BEGB 2CPJA 3PW4A 2UVUA 1J2VA 4QWBA 2UVWA 1B0TA 3NAIA 1A6LA 4GE6A 1HA1A 2ZJRQ 4Y34A 3HHNB 3S3FA 3VAKA 4X4QA 1TAUA 4YB6A 1ONZA 4OZ1A 2XMVA 2AQ4A 4BDPA 3MM5A 3S4EA 2Z8QA 2HNYB 3UR3C 5K23A 1YRXA 3OL8A 3N5BA 2CDQA 2VFRA 1N5TA 1QAJA 3GYNA 4DV1F 2VA2A 5L9NA 3GMGA 3L7PA 2QA4S 2CM8A 4KSEB 4JUZA 4R0SA 1HBOB 5KA4A 1M5SA 3I9V9 2HW3A 2QBSA 4Q7AA 1XEZA 2FC9A 1KOOA 5DG8A 2QZ8A 4DQQA 4QU6A 3NMEA 1HFEL 4HDHA 4WIIA 3CJ3A 2MKJA 2HQIA 4HT5A 4MIWA 3UCUP 2JJDA 1TFYA 2G9OA 4DQSA 1WELA 4NLSA 2LLZA 2A1BA 3E3XA 3JSBA 1VFJA 4EBEA 4V19X 4F2SA 3UDCA 1UWBB 3NS5A 3LANA 4G1PA 1QZ0A 5DG7A 4MBBA 1WAXA 2PA3A 5T41A 3E2EA 4D3PA 1C0UB 2VOPA 1RTDA 5KFTA 5FDLA 4NYPA 2RD5C 2KM8B 1S77D 2FLPA 1OHCA 2EG1A 3BS9A 5GAHU 3GIJA 2F9JA 2Z2LA 4Y14A 3MWBA 4NLRA 3MR6A 3V6DB 1S0NA 3P6YC 3M2VA 4MFBB 4OJ1A 3HVWA 4B3MF 4ED5A 2MB0B 3PEJA 1R8CA 1U1NA 1HI8A 1R31A 3BR8A 3GFXA 1RYRA 4HRFA 1S6PB 2BGDA 4H4OA 1LWCB 2ROEA 1YI2S 4PVGA 3OLBA 4JV1A 1S76D 1FKPA 1VQMS 3PIOQ 3BJYA 5F3ZA 3AA9A 2R8HA 4Q5VA 4LFAF 1WNEA 2NLKA 1NK4A 2K7KA 4M5DB 3M9MB 1FVQA 3KG4A 3X1LB 2NZ6A 5A6PA 4PYHA 1RTHA 4YQWA 2QEXS 2IM0A 3D5MA 1B64A 3BN7A 1LV5A 3I55S 3DC2A 3BGUA 3OR1B 5HMZA 2LEBA 1DLOB 2JC0A 1YGRA 4D3RA 2R2RA 2NUUG 1TV6B 3BREA 1X9SA 1SL2A 2NT7A 1Y0HA 1ZZFA 3W2WB 1IJEB 1LQ9A 2ZBCA 3GE9A 3DRYA 1U47A 3UD4P 3DLLQ 4DJBA 4NCGB 3J7ZT 2X1AA 3CPWR 3KOAA 3V6KA 3M2RB 4TY8B 2WB4A 1I9TA 3OJSA 1ONYA 2Z2MA 2I4GA 3ZMQA 1JLCA 3TRGA 4CO0A 1OSCA 3PRDA 1SH2A 5DM6Q 2YKMB 4ETZA 1KQSR 3PM9A 4D3HA 1HWUA 2GGPA 1X4HA 2VKZG 5GAEU 3SI8A 2VODA 1Z4UA 2VEWA 2B4SA 5G0RA 3OHBA 1A9NB 4W92B 3CULA 1FF2A 4QBUA 2BQ3A 3UDLA 4CI0B 4OHLA 2PMHA 3T6BA 2AHSA 1RXDA 4O4RA 4L6V3 1S1WA 3MTJA 4J9NA 3S3EA 4IFVA 4RX6A 3KK1B 3BQ1A 3MM9A 1YQHA 3I4PA 3ZZPA 2H03A 1YWFA 5HMYA 2QSWA 5M43A 5T7LB 2YX1A 1R6YA 2W8KA 3VWSA 2FDNA 1S97A 1MKPA 2W7OA 1JLNA 2J0WA 2XWXA 3SMZA 4ZCKA 3BM8A 1L3SA 4U7UK 3MEDA 4C4WA 5J2QB 3AB2B 2OD4A 1VOMA 2QE5A 4XK8C 4DV4F 4EYIB 1U6ZA 3G6YA 3UD3P 2J17A 2I0XA 1SH0A 1FA0A 3BSOA 1TQLA 2H4GA 4R0TA 2CFXA 2I38A 1N32F 2CQCA 1PTTA 5KT4A 2RUGA 3HHLB 5CH7B 2AYMA 5L39A 4ZP7A 3H2LA 4ATNA 1D8YA 4Q0BA 3MMCA 4Q2LA 1VQPS 2PMZD 2ADBA 4DFPA 3RR8A 4YMEA 4QU7A 2NQPA 3AA8A 4OX9F 4LF7F 1TKZB 5DDOC 3OUYB 4AZ1A 2K1RB 2WOMB 2YKQA 2BRLA 4FS1A 3FRZA 2WBRA 3CCSS 1X4BA 3VZHA 4OZ0A 2ASJA 3F9AA 4IRCA 4A47A 3PNIA 4IG3B 4BHQA 4Q45A 4PWUA 5CZXA 2CPIA 3GYXB 3DRPA 4I2PB 4C0BA 2DNPA 2GFFA 1RI7A 3I9ZA 4NYZA 2VB6A 3NP5A 1VQNS 1DTTB 2CJKA 3PEHA 3J7YI 4FF3A 4KHPF 3OR2B 4ILLA 1RT3A 2HIQA 2CYYA 1FRLA 5SUHA 3PX6A 2QA1A 3ZMPA 2YY3A 2YWHA 3DLEB 3IGNA 2BXJA 1XBOA 2DT9A 1SV5A 1GTEA 1YG0A 3FCHA 4YR3A 2B7BB 3GIKA 1FCAA 4URSA 5M2PA 4F4XA 1N6QA