1U25A

Crystal structure of selenomonas ruminantium phytase complexed with persulfated phytate in the c2221 crystal form
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
TEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Selenomonas ruminantium Phytase in Complex with Persulfated Phytate; DSP Phytase Fold and Mechanism for Sequential Substrate Hydrolysis
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
molecule keywords myo-inositol hexaphosphate phosphohydrolase
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2004-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u25A01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 1u25A02
2HB1A 1JLNA 2G59A 2QEPA 3V0EA 3ZV2A 1OESA 3F9AA 3A5KA 2QBQA 2G6ZA 2CNHA 2OOQA 2PA5A 2I4EA 5BZXA 3QKQA 2I6JA 3MOZA 1PTVA 2I42A 4QAPA 3V0GA 1C85A 5EHPA 3ZM1A 2NLKA 2AHSA 4J51A 3I7ZA 4JNBA 1OEMX 1NL9A 4DGPA 1YPTA 4RHGA 4YAAA 2F6TA 3LJ8A 1YTNA 2CFVA 1ZCKA 5BX1A 2F6WA 1XRIA 3F9BA 1NO6A 3D42A 1V3AA 1YN9A 4NWFA 4TVVA 5K9WA 2B4OA 3I36A 1G1GA 2I3RA 3S4EA 2B4UA 4GE2A 2Q47A 2I6IA 4Y2EA 3D1QA 2HC2A 2BIJA 2H03A 2HY3A 2FJMA 2VEWA 4GWFA 1WAXA 2B3OA 1PA1A 3QCBA 2SHPA 2FJNA 3PS5A 2NZ6A 5AWXA 3BLTA 2CM7A 1Q6MA 3CWEA 2CMCA 2HNPA 2I6OA 1YFOA 1FPZA 2FH7A 4DGXA 1C87A 1OETA 4H34A 1RPMA 1T48A 2VEUA 1C88A 2I4GA 1NWEA 4I8NA 4RKKA 3N0AA 3RZ2A 1SUGA 2F6FA 1Q6JA 3QCJA 4RI5A 2BV5A 1U26A 4R30A 1FQ1A 2J16B 1Q6NA 4OHIA 1OHEA 4Y14A 5LXQB 4RH5A 2CNFA 5M43A 2NV5A 5KAAA 3EZZA 4ZRTA 1YGUA 1X24A 4QBEA 4Z6BA 3EMUA 2QDPA 3QCKA 4KYRA 4AZ1A 2VEXA 1FPRA 2WGPA 1PXHA 2GP0A 3V0JA 5K22A 4GE5A 4D3QA 2HNQA 3QCHA 2I6MA 2CM3A 4MBBA 2E0TA 2CNEA 3D1OA 2HC1A 1M3GA 3QCGA 1RXDA 2NT7A 3NMEA 2CJZA 2QBRA 1G4WR 2QBSA 2R0BA 4NX8A 5K25A 1C86A 1LYVA 2IMGA 2ZN7A 3S3FA 3O4TA 2Y2FA 1L8KA 1BZJA 4KYQA 4OHHA 5K9VA 5I6VA 4NWGA 5KABA 1KAKA 3QKPA 5KA3A 2CM2A 3V0HA 3QCFA 3ZMPA 2PQ5A 2C46A 2B49A 4R0SA 2GJTA 3D1HA 2HVLA 4GRZA 3D44A 2I75A 1NWLA 4PVGA 2I3UA 2PBNA 5KA2A 2ZMMA 4GE6A 1XM2A 3QCEA 1J4XA 2C7SA 5IBMA 3RGOA 4QUNA 5BZZA 1WRMA 2NT2A 2CM8A 3QCCA 1NNYA 1LQFA 2I6PA 4ZN5A 2M3VA 4BJOA 1YTSA 1ONYA 2DXPA 1PTTA 2H4GA 1JF7A 1Q6TA 4S0GA 4HRFA 1YWFA 3U96A 1BZHA 3MMJA 2OC3A 2I4HA 3O3LA 1ECVA 5KADA 1G4US 1YZ4A 3RGQA 2PT0A 4GS0A 4RI4A 1XBOA 2QDMA 1U24A 1G1FA 4HJPA 1EENA 3F41A 2QBPA 2VEVA 1I9SA 2P4DA 3EB1A 2OZ5A 1VHRA 3H2XA 3ZM2A 1YTWA 2I5XA 1C84A 1XXPA 5KA9A 4RH9A 5KA0A 5GTJA 5BUGA 1G1HA 1OHDA 1PA9A 1PTYA 2BGEA 1BZCA 3QCMA 3BM8A 3B7OA 2H04A 3O4SA 2JJDA 2J17A 4R0TA 2H02A 1T4JA 2CNGA 3D9CA 1Q6SA 2H4VA 2Q05A 3S3EA 3F99A 4WTYA 4JMKA 3V0FA 5MMZB 3S4OA 2ESBA 3CM3A 1GFYA 3OMHA 4GFUA 3BRHA 4B04A 2YDUA 3M4UA 1PYNA 4JMJA 4IKCA 2F71A 4NNDA 1NZ7A 4OHEA 2MBCA 1OEOX 3A5JA 4D3RA 1OHCA 1R6HA 3ZM0A 2CMBA 3RO1A 1GWZA 1OEUA 3BLUA 3V0DA 3S3KA 4GRYA 3MOWA 2A3KA 3SMEA 2B4PA 1MKPA 4RDDA 1I57A 5J8RA 2PI7A 1PH0A 1XXVA 4GFVA 3S3HA 4WU3A 2P6XA 3OLRA 2F6ZA 3O5XA 2QDCA 2I1YA 4OHLA 4JBCA 2BGDA 2BZLA 2H4KA 3GXGA 1KAVA 1P15A 2F70A 3I80A 3AWGA 4WU2A 1G7GA 4WOHA 1LARA 4H1OA 4NYHA 2F6VA 2HCMA 5KACA 1PTUA 2F6YA 2PSZA 3QCIA 4KI9A 2AZRA 2CMAA 2F46A 2NTAA 3V0IA 1L8GA 2GWOA 1T49A 2QCJA 5EHRA 1A5YA 2B4SA 1ZCLA 4HJQA 4OHDA 2CNIA 4ERCA 2HXPA 5HDEA 5K24A 1D5RA 3ZMQA 1ZZWA 3EU0A 3ZM3A 1ZC0A 5KA1A 3GXHA 1QXKA 5KA8A 1U25A 3SR9A 4YR8B 5K23A 1C83A 1I9TA 4D3PA 2QCTA 4ICZA 4PYHA 3QCLA 1QZ0A 1EEOA 3QCDA 1OEVA 5IBSA 1YGRA 5KA7A 4BPCA 3O4UA 3QCNA 3AWEA 2A8BA 2RF6A 4QUMA 2B07A 2VEYA 1G7FA 2Y96A 3F81A 1Q6PA 1AAXA 3AWFA 3EAXA 4ZI4A 1Q1MA 1ONZA 2J16A 4QAHA 2OUDA 4QBWA 1WCHA 5KA4A
chains in the Genus database with same CATH superfamily
1CSJA 2EC2A 1QAIA 2G59A 2QEPA 1XIQA 5J1NA 3MTKA 4RW4A 2R7UA 4Y34A 2XS5A 3J80U 2ZE2A 2F71A 5KFOA 2QBQA 2OMOA 1X0PA 3CO9A 3G71S 3LOUA 1RT3A 2PEBA 1H0HB 4WFZA 1QUVA 5T7LA 3CJTA 3MPDA 2XO7A 1L5UA 5T41A 4ECVA 3QKQA 5G0RB 3LF0A 2MMYA 5KFUA 2UP1A 4LRBA 1N34J 3PR4A 2I6JA 3VV2B 3ZTRA 2R2RA 2XPCA 1UW9A 3L09A 2AJQA 2YNGA 1NJIT 1N0VC 2RQMA 2B7BB 1HWIA 1DURA 1OSDA 2P9GA 2WAQD 2FTRA 2F8EX 1XBWA 2CWKA 2G9OA 2YKMA 3FGVA 1HQEB 3N28A 4NZ6A 4K5RA 3J80Y 1FJCA 2AM2A 3OVAA 4J51A 1SIWB 3TO8A 1UEVA 3DLEA 4DDFA 5HMXA 4DGPA 5F8GA 2VBWA 1N5QA 3IXQA 3NKYA 3QAEA 6FDRA 4NZ0A 3I5AA 2HBYB 2V0NA 5IM0B 3M6WA 2BJ8A 2F3JA 3M8WA 3UN3A 4NXMJ 3ZZTA 5CYQA 3BGRB 5GAEU 1W7KA 3K7RA 5FJ4A 4JI6F 4O3SA 5LXYA 3F9BA 4KPYA 2L9DA 5K9WA 4J9QA 3HSZA 4DUZJ 5C24B 1S6QA 1X4HA 2GHPA 4DL0C 4K2JA 5F41A 3R1HA 1SUQB 4WBFA 1SIZA 1VQYA 3EGNA 2V2QA 2KFYA 2KG1A 1KC8T 1LXNA 4FPIA 1S7HA 4Y2AA 3EUNA 1KSPA 2CJQA 4DU7A 2UUBF 2I6IA 3DNCA 4X4OA 4C8LA 3D1QA 4YDXA 2HVIA 3BO3A 3BSCA 3BJYA 3MR5A 5AE1A 1VIXA 5H9EJ 3K8WA 1VISA 1NB7A 3SR9A 2CQ2A 2F8MA 1IQZA 3M32B 3EDRB 1WC5A 5CYMB 5EUHA 4X4QA 3HO1A 1S0OA 2B3OA 3F44A 4OX8A 4F0MA 3GV8B 5F9NA 3DDIA 3KJVA 3MPUB 3BO2A 2RAQA 3CNQP 3NGDA 3M1VA 4DV2F 3T1HJ 3HHEA 1S99A 5K8OA 1KVKA 1N5SA 3QGGA 4LF4F 1UVMA 4CH0S 2IHR1 3LTOA 3OBIA 2GVZB 2QA1A 4H4MB 1JLFB 4PG5A 5IXUA 5AXNA 1CEZA 2MZRA 3R3TA 1JMTA 3KYLA 4QR0A 4C8KA 1NSPA 2FHJD 1FGSA 3ZZRA 4WP8A 2RKIA 3CCUS 4A8QA 1IR0A 5HJYA 1FD2A 5ETMA 3WIVA 2OPPA 4ELVA 4I1TA 1EP4A 2LXIA 4UOCA 2JEJA 2FH7A 4OJ1A 3OHBA 4NASA 4H4MA 1RPMA 1VFJA 3D28A 3EJMA 3POTA 1EQMA 5KAKA 2HVZA 2I4GA 2VEUA 3CIZA 4NRTA 3EX7B 1NWEA 4RKKA 2CZVC 5F3ZA 1KQSR 2E5JA 4RO0A 1NZAA 4NEZA 1HNXJ 4I2PA 2IPOB 3QPIA 1D8YA 4ID8A 3MURP 4LRDA 5J2MA 4MKBA 4U67Q 1ZETA 3IP0A 2AP6A 2IRXA 3EE3A 4HHHA 1F9HA 2YWHA 1C0UB 3GTYX 4M5DB 4C0BA 5KFPA 3KLFB 2X5OA 3JQMA 2KKHA 2YKQA 1TU0B 2GW8A 2DXFA 4WP3A 4JI1J 3MUTP 1S0MA 2UUPA 4NLRA 2QT7A 2XI3A 2C22A 4LFCJ 2XNRA 3M2VB 2CNFA 2A18A 2V2VA 1TTHB 3ISND 4FYXB 2G13A 1S97A 2YH0A 1AA1B 2CWXA 2NV5A 4ZS6A 2OSQA 4NLGA 3EZZA 2QIFA 3O1LA 2EBEA 4DR7F 1FJEB 1DLOB 1P6TA 4DL5A 3VALA 1U2RA 2MSTA 4MFBB 2FVQA 3X1LB 4V19J 2YY3A 4QYZJ 3C15A 2J6SA 2YTCA 4URGA 3W60A 3T19A 2HSEB 2N7YA 4LSLA 4XAKA 4CO5A 1NEEA 1GXLA 2W2PP 3TAMA 1J5OB 2R2TA 2IA6A 2HHUA 4NLTA 3RB0A 2A10A 2XLIA 1WC4A 2OPSB 2X3GA 1OIAA 4PABA 2UU9F 4HH1A 3CDUA 2WVBA 5L9NA 1Z4UA 5C2GA 3OLAA 2W7PA 1WKJA 2W8KA 2DHGA 4LVOP 3QCHA 2AT1B 4J9VA 3A1YG 2CM3A 1FEEA 1BUXA 2ZH6A 4DG1A 2R8GA 2GCAA 3G4SS 2CNEA 3D1OA 1RAEB 2V4JA 5BYRA 3QCGA 4USVA 2LQ8A 3NS6A 1NKEA 4LFBJ 4CRJA 1S9GB 3JSMA 2BV3A 2ROPA 1D8ZA 1S1WA 1SKUB 3PTWA 4WJBA 3QIDA 4YN3B 1M5KC 3HI9A 3EPIA 4ZOSA 2VOOA 3OL9A 1C84A 4KT0C 5KFXA 3MFIA 4DN0A 4J90A 2HS0A 4DV4J 1RTZA 2QBSA 5K25A 5IOLA 2ZN7A 3RGIA 2A1BA 3N6LA 1UWBA 5I3UA 2Y2FA 1CJKB 1TL7A 1TKXA 1HNZF 3HLUA 3AA9A 4OHHA 2XC9A 1JBWA 2MKIA 2V34A 5C25A 1XQIA 4QWEA 3N2AA 3BSAA 1HARA 4LR7A 2HNZA 1RQ0A 3N9UC 2B5JA 2E44A 2RDDA 3PKMA 3JTNA 1QVFR 8ATCB 1RWXB 3LGNA 5CH7B 4DZDA 4PG8A 3DI6B 4CLYA 1FFGB 3BBFA 3EVWA 3TI0A 4IR9A 3QKPA 3CO0P 4I56A 2CM2A 1RHQB 3L3CA 2GO9A 3FRZA 3R5CA 1OY6A 4KFBB 4OJ3A 2WVDA 4DV3F 4ELTA 3W3SA 4DR3F 4BWJA 4R0SA 1QAXA 3RRGA 9RUBA 1QY7A 4OHWA 5HVFA 1C4CA 1REVA 2DO0A 2P6TA 3ZZ0A 2BJ3A 5KFNA 4F25A 1QDUB 1RTIA 2OH2A 1TK8A 4O3PA 1FRMA 2ROGA 3TZWA 1EKSA 1Y5LB 5J2NB 4MJKA 1TKTA 3EMUA 2V5HG 4BUCA 3SI8A 3H4DA 3IM9A 3EM1A 3N79A 1GQEA 2RUSA 3OTDA 3U1NA 1EETA 5DQGA 2XY6A 2V4QA 2ATLA 3LAKA 4IOAQ 1OYDA 2QSWA 2OI2A 5KA2A 2HQCA 1PSDA 1F2HA 2NXCA 2ZMMA 2JVOA 3SQOP 1Y4ZB 1WC0A 1H2VZ 5C42A 2LU1A 5HQLA 3UCZP 3QCEA 4YQWA 4R0JA 4TLRA 4LF9J 3WDOA 4RJVA 3VHQA 1E6YA 2GCBA 2PA8D 4OX6A 4QWBA 2DHXA 3D6TB 2ZH9A 2XJAA 4QUNA 3W5ZA 4F4YA 1ZOTA 2PE8A 2Q79A 1VDHA 2NT2A 2QX0A 2WOMB 3Q8QB 2I9SA 3E01B 3QCCA 2GFFA 4YB7A 4O0IA 4FS2A 1WI8A 4ZN5A 1RTJB 3I32A 4L75A 1T02A 4DV1J 2KVQE 2DH9A 2M3VA 4I2QB 7AT1B 2MLZA 3CD0A 4RWXA 1U1LA 4FBUA 2KTQA 3G6YA 2XMWA 3MAHA 1S49A 3IG1B 1UZHA 1JQGA 2LXUA 4NI2B 2AEJA 4RW7B 2DXPA 2Y1RI 2BM0A 1LK7A 5J2PB 4R5PA 1C1BB 1DJ0A 3GCXP 2D9PA 1RTJA 4U7UK 3U1MA 2FLPA 5CABA 1D9AA 4AUKA 3HHLC 5B08A 4S0GA 4HRFA 1K1QA 4RKUC 4UW2A 3DU6A 1VGYA 3QMQA 1TV6B 2LMIA 1YWFA 4WYLA 1RI7A 2VH7A 1TAQA 2GVDB 2PDAA 4Y2MA 1ITPA 3NNHA 1SXLA 3I9ZA 3DM2A 1RXOB 2ASJA 1S7IA 3PW4A 2I4HA 1CBKA 1RT2A 2GC6A 2YNGB 4X4UA 4DUZF 2YNHA 1NLKL 2E1RA 2HQDA 1G4US 4KH0B 3QQCD 2RT3A 3UVJA 4IR1A 2QA4S 1YZ4A 3W65A 1R8CA 2XBPA 4IFYA 5IC6B 4C13A 1Q81T 2NUUG 2H65B 2YWEA 3SFGA 2XNQA 3LP1B 4CLSA 2HFUA 4B9LA 3QRPA 4LSLB 1G1FA 2V69A 3R7SB 4HJPA 3HJVA 4QIGA 4IH7A 3F41A 4DR3J 1SC6A 1W2IA 1DRZA 1I9SA 2GIFA 2JRSA 4OYIA 3EB1A 2VFTA 3FCHA 5BZXA 1FRJA 3D3BJ 3ZZUA 5KFTA 4IOBA 2I5XA 2BRLA 2D7SA 2HRTA 2E9ZA 4PG7A 3K58A 2J7UA 2CRLA 3GYXB 4LUBA 2L41A 1BE4A 5KA9A 3MOJB 5EN1A 2HFSA 1OHDA 1PA9A 3VAJA 3CMAS 2HS3A 1UFKA 3DI6A 4X4RA 1O0PA 1S77D 2HNYA 2O67A 2VPZB 4DR2J 1FRLA 4RW6A 2H04A 1B0PA 3B7OA 3SSRA 1FVSA 4UTGA 3CJ0A 4K4UA 1VHFA 1K73T 2WBRA 2J8SA 2J5AA 2KYXA 4RUBA 1JLBA 2VPXB 2OEKA 1Q8IA 1P1LA 1RA7A 2C42A 3BR8A 3EZOA 4DSJA 3LGHA 2HLUA 5K5MA 3LQVA 4CLWA 1KS2A 1Y0HA 1RB0A 1V5VA 2RQ4A 2AHOB 2CJAA 2Z4PA 4RWWA 4B9TA 3TUPA 2DGTA 3I0RB 2Q05A 3UPFA 2OO4A 2MYFA 4I68A 1S9FA 4JV5J 4L73A 2F1FA 4ZIVA 4NCGB 1HD0A 4C6AA 2W9AA 1T05A 2F4VJ 3V0FA 4LBIA 3K5MA 1O5JA 3CJ3A 4JB8B 2OPPB 4QPXA 2VDHA 1IKYA 2IC3A 3IR7B 2FJXA 2CFXA 1EQ0A 2HEKA 1RJJA 1NH7A 2HRYA 2ZBRA 3U1LA 1IKWB 3CUNA 4W90B 1GFYA 4K2XA 2GGPA 3IRWP 4B04A 1QD1A 2DHSA 1VRQC 3CDAA 3SCLE 5MAOA 1YBUA 4QOTA 3PX4A 1S0NA 4P2SA 3ISZA 3N0VA 3QGHA 5IWAF 3M4UA 3IS9A 3M8QB 3U27A 4DWIA 1FNXH 3THVA 3T5HA 1DQAA 1H72C 3HP6A 2XWXA 3TAQA 3KJVB 1FJGJ 2YKNA 4NLSA 3MGJA 4U9RA 4IKCA 3KMQA 4JOUA 1X5SA 4CYUB 4HYKA 1WKKA 4P73A 3FQKA 4Y6IA 1NSQA 4CDIA 1JJCB 4UUXA 4B08A 4DJBA 5ETLA 1GFWB 1O51A 1ZZFA 4B3TF 4CLLA 1S4FA 5KG5A 2VG7A 1S1UB 3OTBA 3A5JA 3AD8C 4ZPDA 4OI6A 1T9VA 3MEGB 4WTOB 5F0WA 4Q5VA 3VAKA 1TVRA 2ADBA 3ZM6A 4USJC 2DGWA 1RSCA 4WCEQ 3SDEB 2B49A 5IWAJ 1JX4A 3T5LA 2C3YA 2WRMA 2ZEJA 1HPZB 3TA1A 2FB0A 3S3KA 1FI4A 2CJKA 2A3KA 1YI2S 3SMEA 1KKHA 4MIWA 3S6EA 2B4PA 1FF2A 3T9NA 3UN2A 3W5XA 5T14A 1YG0A 5A8WA 3E01A 2CJBA 4UY8T 1MKPA 4TKTA 1O8BA 4F67A 2F4VF 4DS4A 1VQKS 2PI7A 2LA6A 2OGUA 1RT5A 4LSZB 3J7Z5 7FDRA 2BOPA 2V94A 3AQPA 1N5YB 1MN7A 2JLFA 5GADI 3M9NB 2R8JA 1KD1T 1J2VA 4GFVA 2HNDB 4ED0A 1IR1A 3UCGA 1G6BA 1P8GA 1Y7PA 2M4MA 1KQGB 3R27A 3VVTA 5B0BA 2QL7B 4ZP7A 4YR3A 3RAQA 3NY0A 5JUMA 5KFJA 4I67A 4LF5F 2G1DA 4TLQA 3VVUA 2DXEA 5HQMA 4X66F 1VS3A 2EVZA 2QTWA 5C5JA 2I1YA 4I6YA 1RWWB 4BS2A 4PG6A 2U1AA 3T5KA 1HHTP 2HFVA 4Q0BA 2UVWA 5D0RA 2CQCA 2DNGA 1WC1A 4LF1A 2IIHA 4LIRA 5L38A 2IJFA 4PRFA 1T3OA 1U1RA 5KT4A 3AWGA 3R5AA 3BGOP 2GS8A 4JV0A 2DR8A 3QYYA 3MDFA 3SBMA 3KHLA 2JZ5A 2RS8A 4B3SJ 4WOHA 2ZH7A 2XWYA 3A8IA 1LARA 1Z1ZA 2C2NA 3M05A 1YRTA 1F5BA 1S6PB 3ZM5A 5KACA 5GADU 2DGSA 1E6VB 3BGLA 4NA3A 1AXQA 2PSZA 2ACMA 3RRKA 4Y00A 3MD3A 4DPWA 2AYGA 3VAGA 2BE2B 2Y68A 3EPGA 2AZRA 3PW5A 2E5IA 4M94A 2FVSA 3PHEA 3B82A 5HO4A 3ZXWA 3RAXA 2HGMA 1IJFB 3CXCR 2J0XA 4GC6A 1M90T 3GG1A 3ISNC 2DR7A 1U6BA 1T49A 2QCJA 4HLBA 4PYDA 1U0SA 1IBLJ 2JFGA 5ETVA 1A5YA 5L8RC 2DGVA 3WIUA 2AYEA 1Q7YT 1AB8A 3DOLA 1TK5A 2WB4A 4OHDA 4FVMA 1JKHA 2HQGA 2GO8A 4ZVOB 4GKKJ 4WIIA 3H8YA 3PXGa 4JV2A 2LFVA 3H25A 1XMOJ 1FJ7A 2DGQA 2ATCB 2IM0A 1FXRA 1WDDA 1WOOA 1Y9OA 2JOQA 3T5JA 2DVIA 1KFSA 3JSYA 4R8UA 3SSSA 3DYAB 3JS9A 1J5EJ 1ZC0A 5KA1A 1XR5A 1S9GA 1PILA 4KYZA 2J6UA 3KJQB 1U02A 3QT5A 1S6OA 4KH1B 3LP1A 5BYQA 3V6DA 3SIPB 4JI2J 4PEOA 1RWUA 2Y66A 2I5JB 2C3UA 4WE1A 3EYZA 3HSJA 1GX6A 1U25A 4WKYA 3K5LA 2FJWA 2R7VA 3QT6A 1TL3A 2V8GA 3GWCA 5LXRA 2FHJA 3AA8A 3NLCA 3ZNUA 2MPUA 3ET6A 1U1KA 4U6PA 3NP5A 2QL5B 1LWFB 2I5JA 2HZCA 1IQTA 1BQMB 2DRBA 3QCLA 1RK8A 1FKOB 5K8PA 5DG9A 3QCDA 2HWTA 2VC1A 3MPWA 3KG0A 2H48B 2DHHA 2UVRA 1X9WA 1RADB 3BKFA 4R8UB 2R7QA 4KAIA 3KNAA 4YS2A 3OL8A 2IBKA 2NYIA 4CLFA 5ETPA 3QAUA 3PKYA 4AL6A 1N6QA 2A8BA 2YPZA 1I51B 3BPSP 3OV7A 3HFKA 4YR2A 4NI2A 2BE7D 1AROP 2IM3A 1YHQS 1NHUA 1D0EA 1M0SA 3P5TL 5FLXU 2WSCC 3NRBA 1G7FA 1CG2A 5A6WA 1KR4A 1S12A 3F73A 2FVPA 1Q6PA 1VRUA 3IAM9 2EWHA 1Q8KA 4OYBA 4URSA 4OX9J 2HBQB 3EAXA 2FC8A 1Q1MA 5KT3A 4AT1B 1FNOA 2AV5A 3DGVA 4O4RA 3R7BB 3RG6A 4OHZA 2L9NA 3K17A 4ZKAA 4AL7A 4HHUA 2DNNA 3K2YA 2J16A 1U6FA 2F00A 1DQ8A 4ID5A 1MMNA 4WWSA 3HN7A 1HI1A 3J81j 4F4KA 1C0TB 4RBUA 4UZBA 2VHGA 1FVQA 1MROA 4U95A 3POTB 2YNIB 3OTCA 4H4KC 4NA2A 1Y5IB 4IRCA 1QAYA 4Q2MA 1FT8A 5KG6A 2GNKA 4CLTA 2JC1A 2HB1A 4USTA 1TR0A 4DS5A 1N5TA 3CEDA 3PW2A 1AUDA 3V0EA 4JI6J 1NNDA 3MFHA 5E33A 4GO5X 1EIYB 4O3RA 1SPBP 3OTOF 3MAAB 2UAGA 3SV4A 3NBPA 1U0HB 4P52A 1CQMA 1SVDA 2IDLA 3DOKB 3QT7A 1DZ5A 2CNHA 2I4EA 1FKAF 3TZZA 3H5YA 1TL1B 3BBCA 2V63A 3OUYA 5K24A 4QIVA 3V4MA 4EZ9A 4J9PA 2COLA 3W66A 1PTVA 4BC9A 3V0GA 1GTHA 2BJ7A 2DTJA 1WC3A 3SSQA 3I87A 1RT5B 3DXBA 1N36F 3SQGB 5B0CA 2KHCA 4P74A 3MM8A 3VQSA 1NAQA 2LU2A 2BW7A 1VRTA 3I5BA 4DL2A 3JB9k 4K4ZA 1Q4RA 4LJMA 1KONA 1OEMX 1HWLA 1YTYA 4ZLLA 1VYAA 4RHGA 4DR1J 1XNRJ 3LJ8A 5JVGQ 4YAAA 4L6V3 1UAGA 1X7VA 1UJ4A 3RTVA 3NCPA 2F6WA 2XZDB 4DZ6A 2CPIA 4QYRA 2GIRA 3V6KA 2QE5A 2E7VA 1YN9A 2QLXA 5DO2A 3ILOA 1Q1KA 1RBOB 4KB7A 3H5UA 4CM2A 4AXIA 3OQ2A 4NRUA 5L39A 3W62A 4A8FA 4OZLA 2Z2YB 5IM0A 2W8LA 3VAHA 3SV3A 1FRIA 5D4PA 1JJ4A 1VLYA 2D3UA 2L08A 4CNZA 4DI6A 2X1GA 5K14B 4ZLPA 1SKRA 1N36J 2GJ2A 4Y2EA 4XPCA 2HRUA 4OV6A 4J9UE 2H03A 2Q1LA 3V2UC 4GWFA 3FBEA 3WX4A 4DX5A 5DLGA 1URRA 4OHXA 1PA1A 1VK8A 2FHMA 4X4VA 2QMXA 4NYZA 5H1SV 1DARA 1NDCA 1UEKA 4HACA 5ETSA 5DZ6A 4A46A 3FMWA 5ETRA 5C7PA 1X60A 3CCQS 3F56A 4ZVRB 3IN5A 1RAJA 1ZM9A 1GMWA 4Q7AA 4CNYA 5AXKA 1R0AA 2QLJB 3TJ8A 2CM7A 1Q6MA 2CMCA 1RHRB 1RKIA 2BE2A 1X4BA 4USWA 3M2RB 1VC5A 2I6OA 4FYYB 2FZKB 3LA0A 4MK9A 2DIUA 1KEKA 1QSYA 3NL0A 2JEIA 3GR1A 2GIQA 4RLEA 1B7YB 2QLFB 1P31A 2B9YA 5F3TA 4F0HA 2Y1JA 1ZTTA 2Z30B 1TP7A 1URNA 4USHA 2QA2A 2VV5A 3PX0A 3A12A 1OETA 1UP1A 2B56A 2MTLA 1YVFA 3W64A 4DR1F 1XNRF 4KFBA 2JNJA 1I94J 1C88A 1UZDA 2EI5A 1JXLA 4DV3J 4F4AA 4NYPA 2EFGA 3ENQA 3M2RA 4ICLB 3G96A 4RW8B 4I8NA 1Q0NA 1ZA2B 2P9CA 5LMUJ 2BQRA 4UAGA 4UQTA 3FUYA 3R5DA 5B0DA 2V50A 1SC3B 5EGYA 2FLNA 2GMJA 4RI5A 3MXHP 1YKWA 1UA1A 4ECUA 3TAPA 4F4XA 1M1KT 1YGYA 4RW6B 3ZTPA 1FQ1A 2GMLA 1SJQA 1IJEB 2JVRA 4TU9A 4EBDA 4V1Ak 1L3UA 2J0SD 4C98A 2VTEA 2M2BA 1X4CA 2BANB 2RQCA 3PJXA 4KKOB 1F9FA 2NCKL 4Y14A 1RLCL 1UWAA 2KYZA 1R0CB 2RQKA 2HWHA 3G86A 4QQBA 4W92B 5KFFA 3A3OB 1ZZNA 5M43A 4FZVA 2WSEC 5KFYA 4QW8A 1FXLA 5KAAA 4QPTA 4HEA9 3OUYB 1N48A 2Y1LB 4QJVA 4UF4A 4PR6A 1NDKA 3O44A 1YJUA 4OI3A 3MECB 1X24A 3GLJA 4CTAA 2W25A 4KHRA 3M30A 3TZXA 2BKOA 5KFDA 3ITHA 3KK1B 3RBDA 1S79A 5HROB 4CVKA 4PWUA 1TKZA 3HT3A 3MI7X 4DG1B 3UCUP 4DFMA 2JSXA 2GP0A 1JK9B 4G1QB 3VGUA 3W63A 2BJ1A 1HWUA 2YQ3A 3FSXA 3RW6A 2A6OA 3A8KA 2VBXA 2HKEA 3BGFA 5HJXA 5K22A 2Z0GA 1GMWD 3AJ2A 3HHLA 1H6KX 4K4YA 2HBRB 4RNHA 1JBVA 2V68A 4NMLA 3M8PB 4RUAA 1UPMB 4CH7A 4IQXA 3TAMB 4DUYF 4CVMA 2MLXA 3TNVA 3FZ2A 1VQLS 2IVFB 3M7VA 2HFNA 3GFZA 3L95X 4JI0F 4CYUA 2CIMA 2MKYA 3D6FB 3B4DA 4CT8A 4DPUA 2B6AB 2CPFA 1FCAA 3CJRA 4DV6J 2NT7A 3PYEA 4UOHA 2IAJB 1PCAA 3ZZZA 1P9YA 2Y1OA 1WEXA 1RAIB 2GAHC 1EB0A 3QSYB 2OAUA 2C2RA 2ALZA 2QBRA 2RH3A 2NQPA 1P9QC 3HM9A 3KFWX 1JKHB 1OWXA 3HD1A 3PRVA 2C28A 4JI5F 1LYVA 2UVVA 4DR4F 3FK4A 2ILYA 5B0FA 4IQMA 5AE3A 2I8EA 3CCWA 3NAHA 5IQQA 4CLUA 5D6GA 2IAJA 3R2CJ 2XZTB 1L8KA 4IOCQ 1UMJA 4YMEA 3CCVS 2EKNA 2H5EA 2HG4A 2K7JA 2PC6A 3DRPA 3CCES 5J2QA 2X1FA 4JYAF 4GKKF 1E0DA 4NCGA 3GONA 1SI9A 1HIYA 3QWPA 4DV4F 2AZ1A 3L4BC 3N6MA 2DCUB 1G3OA 3GG0A 5KFGA 3VZHA 5A2QY 3KLEA 2IY5B 3OLBA 3GJQB 3HKZD 5KA3A 2RDIA 3T6BA 4GKJJ 3DLGA 3MD1A 3V5RA 2B9EA 2XZWA 1BMQB 3QCFA 3OL6A 5DZ7A 2EC0A 1JIHA 3V0HA 2DGUA 2PFDA 2ZNYA 4C48A 1HWJA 2AEFA 1M5HA 1VBKA 2WTFA 3G82B 2F65A 1D9DA 2C46A 2X7IA 3AXMA 2ZZTA 2M8HA 4W4MA 1UVIA 1QJHA 1WEZA 2YX4A 3GJTB 2GJTA 3IC1A 4OZ0A 1IBCB 2X51A 2RF2B 3D1HA 2OPRA 3IMQJ 3KDNA 3N01A 4C3KA 1U47A 1X9SA 1P27B 2IMOA 4USIA 4F36A 2OFHX 3ICLA 5GAGI 4ERDA 2AKWB 2UU9J 4QDIA 3V81A 3M6XA 1F5CA 4LBPA 2VASA 3MVNA 1EEHA 3DC2A 4CO1A 3FBFA 2XY5A 4G1IA 2DBBA 5LXQB 4X65F 3PRBA 3D67A 1NJYA 1Z2ZA 3RBEA 4LFAJ 4Y65A 1J6UA 2N3LA 4GE6A 4BUBA 2ZVSA 3CJ2A 3BGUA 3DRRA 2VZ9A 4NLXA 2DNLA 4CQ1A 5L1LA 2AMCB 2WW4A 1CS4B 2GZOA 2UUCF 4A8MP 3NNCA 4UZCA 1EZZB 1M5SA 2LA4A 4MIBA 5A0YA 2B0GA 2KB2A 2LCWA 5THWA 3MMCA 3T1YJ 1CJTB 1X5TA 2DITA 2XSJB 1BQMA 1HR0J 4ILLA 5BZZA 3UO0A 1U1QA 1UW4A 3CJ5A 3HHLB 2G1HA 2SHPA 2XTJP 2BKNA 2AJ1A 5DRKA 2HAFA 4DFJA 1NNYA 2CADA 3PO4A 4NLYA 2WZ1A 4RNOA 4DCOB 1TL7B 4M5NA 2ASLA 1UJ5A 5IT9Y 3QJLA 4B3OB 3K89A 3FEXB 2CXEA 1MG7A 1N34F 1N6QB 2W7OA 3MCNA 1WHWA 4IH5A 5KA4A 2W2OP 2OLWA 2A2CA 3OFFA 4CTAB 2VG7B 4UUWA 4V19X 4FKXA 2QFJA 2M52A 4ANCA 3FRYA 4LVNP 3FCWA 1HNXF 4ELUA 4LBHA 2IYIA 3MEDB 1RWMB 1H7XA 1FKOA 1ZS6A 5KOXA 3FZBA 4F8RA 1JF7A 1RHUB 1NH8A 3KDOA 2I2YA 2PO4A 1Q6TA 4QZVB 2MY7A 4CO4A 4CO2A 2RHQB 3QFWA 2DXDA 3MM5B 5SZTA 5F8NA 2B9XA 2LDYA 1VJWA 2YQ0A 3U96A 3PEJA 4JI4J 4IFYB 2KJVA 3AHPA 2KG0A 3IG1A 3BSNA 2LVWA 4OYZA 4DPXA 1BZHA 5B09A 4HV4A 4TY8A 3FJ2A 1SV5B 3NS7B 2VC0A 1AT1B 3ONQA 3TANA 2XI2A 2MB0B 2UUOA 2DNQA 2VDIA 3O5TB 2DJWA 3HHNB 1HMVB 2J9DA 2J8AA 1EKRA 5KADA 3MM5A 2MSSA 4J9SA 3PW0A 3QRQA 3X3UA 2GVDA 3C19A 1MN9A 3JXOA 4OMFG 4PXCA 2VKRA 4RW8A 5E3RA 1NBEB 3PJWA 4J9NA 1EJ7L 2FLOA 5F8JA 1I5OB 1U24A 1FX4A 1QE1A 4RW4B 2XMMA 1BY9A 4M5IA 1C1BA 1B4SA 1BGXT 1ACMB 1S57A 3BV8A 4MTPA 1WTBA 4JI3F 3KWMA 3W1YC 4NXNJ 4YOEA 1SH0A 2BYCA 2YNFA 3GU0A 2P4DA 4O3QA 2OZ5A 2Q3PA 3NXZA 4X4NA 3LANA 1VHRA 3H2XA 1Y10A 4ANDA 2CQ0A 2BJEA 5GAGU 4RH9A 3Q89A 1RHKB 2CDRB 2D9OA 1R8HA 1RYSA 5BUGA 1G1HA 2RF2A 3PYDA 1UVNA 3W9IA 4OL8A 1PTYA 4NZ7A 3BQ1A 1YX2A 2CQ3A 2DGOA 4XIUA 1WF0A 2ZOGA 3R8YA 4QIWD 4RNFA 1B70B 5J2MB 2AYBA 3BM8A 3QCMA 3SQGA 5E2QA 5GMDA 2MXYA 3QZ8A 2HVDA 1JXVA 3TWZA 4X4SA 1CULA 4NEYA 3UDEA 4AYBD 1E6YB 2W4CA 3Q23A 3FSYA 5DM7Q 3ILJA 3RAMA 5H9FK 1SJ1A 2CDQA 2W2MP 5L1IA 1FDBA 4DF8A 1WG4A 2D3OR 2PFFB 2QMUB 2FYXA 3AFGA 1R6VA 2CNGA 3MPVA 2MHNA 3D9CA 4IG0B 1RT6B 3THTA 1UAWA 1WG5A 2CJ9A 3EDQB 3PACA 4EO6A 3OJSA 1S59A 1WDTA 3KJNB 3DRPB 2WGPA 2IJRA 1NXIA 5JJBA 1UVLA 1GQQA 4C9DA 1DY3A 1LW0B 2LKZA 3Q8PB 3RRHA 1VBXA 2YPYA 1G7CB 2C2KB 1OY9A 2B3TB 5ADZA 1OMSA 2RU9A 5A5FA 5DLFA 1AZSB 2L48A 3OXFA 1UWBB 5HSPA 2YNHB 2R8KA 2ZH8A 2WTZA 3J81Y 4OZ1A 4DU8A 4EYIB 1S1TA 1JNZB 4IO1A 4EU0A 2NXNA 3RB4A 2LLZA 1C1CA 3OTEA 2WB1D 1N32F 1PYNA 2FJVA 4ECRA 1GG4A 1K9MT 1NDLA 1KDNA 5KA8A 5KT6A 2BM1A 3AD9C 4K59A 3NS5A 4L74A 4HKQA 2N4CA 1ZAXA 4LF2A 2D41A 1IWGA 1BWEA 4NNDA 1NZ7A 3CWJA 2F7VA 2FC9A 2ZBIA 4LF8F 2BV5A 3QCKA 2MBCA 2I6WA 3KJFB 3T9ZA 4PPZA 2DK2A 2YX1A 2DPJA 1KBRA 4TY8B 5J1PA 5KFBA 2XS7A 1K47A 4ZVGA 2MKKA 3KHHA 3EVOA 3NCRA 4GO7X 2KZZA 1A7GE 1SC1B 1NPPA 2DY1A 3LH2S 2CMBA 4ED6A 3BGRA 1OEUA 3GYNA 3C14A 2F4FA 1HBNA 1U8SA 2VPYB 3H2VE 2VIHA 3VQTA 2BVZA 1PC4A 2KXFA 3HHKA 2M88A 4GRYA 4PYAA 3MM8B 4WXWA 4MFBA 2YNIA 2CG4A 3MCMA 5DS7A 4O23A 1A0OB 4J91A 4CLZA 5EDWA 3NRSA 3MWBA 3TEGA 3R5JB 2XEXA 1HBMA 3D54A 2CNNB 3NEKA 3W61A 4EEYA 3D6HB 1PH0A 1XXVA 1FFSB 4CH1A 2HGNA 1MWQA 3M6UA 4IRDA 2QFIA 3KLIB 5HDEA 4B9SA 5LMNJ 2OFGX 3D68A 1PYSB 1RZMA 2G0CA 3HKWA 4ATNA 4ES1A 5A8RB 3FEZA 4OZ2A 2VQEJ 3W2WB 4NX9A 3OLRA 4LRCA 2AJ4A 2PD1A 3QLHA 2VG5A 3W8PA 2FD2A 3CCZA 1XJWB 4JBCA 1XK8A 3CJ8A 1S6UA 2HS4A 1IKXB 2W4PA 1DLOA 5B0AA 2MGZA 1HNZJ 3A3NB 2WSFC 3C16A 4P2XA 2XM3A 2FUG9 5ETKA 3G8TA 4CM0A 2OSRA 3EGZA 3NGKA 4Y0FA 4ZIYA 2J9EA 1V5IB 2BZ2A 3OFGA 3N6NA 4JV5F 3SZ2A 4I2QA 2VG5B 1YJ7A 1KP6A 2B7CB 2Z2MA 3G8SA 2AQ4A 3W7BA 3VGSA 1WOPA 2DHAA 4B3TJ 4C8OA 2ESBA 2F6YA 1B64A 2W24A 3OD2A 4OYAA 1YRUA 1S1VA 4DPYA 1YJWS 3QCIA 4KI9A 1LFWA 2ALYB 4FNHA 4ETZA 2CMAA 2F46A 2ZHBA 5AE2A 2HIYA 4J9RA 2UXBJ 2KT3A 2EKYA 4OYOA 3V0IA 1L8GA 2EW9A 5KG3A 2GWOA 3GR0A 3OXLA 1JLAB 3DLGB 4X65J 1G2EA 1FHTA 2B4SA 5G4DA 2QV6A 4PQUA 1ZCLA 4CT9A 4ED2A 2YX7A 5DGAA 1N4LA 2CNIA 2ILZA 2C3MA 3PFOA 4YY3F 2GJIA 2KM8C 1YQHA 4F2SA 1Q7LB 1QE1B 2BX6A 1RAAB 4E2FB 4F4WA 3MEDA 1V6HA 1T8EA 2HXPA 1EP4B 3JQKA 3JSBA 4DR2F 2BA9A 2HQ3A 1D5RA 4HDGA 2GQCA 2Z56B 4ID5B 3QBCA 3EU0A 2FIUA 1U8WA 3KUEA 1FRXA 2Q6CA 5KG2A 2VQFF 4LF9F 4JUZA 3RZAA 4LF8J 4DL7A 3CCTA 4KKOA 2F40A 3GJRB 1KLMA 3UDVA 4DV0J 3AAWB 4JI8F 2ZJPQ 1TVRB 1F5AA 3GB0A 1TFYA 3RBZA 5K8MA 2ZH4A 1U1NA 3IRXB 2JL9A 3Q8YA 4ZVHA 2OTLS 3VAMA 1YZ6A 2VA2A 3RJMB 1VRTB 1HLWA 3DOMA 3MMCB 3V6DB 2ZZMA 2CVEA 4USUA 1TZ0A 3B6BA 4O3OA 4ZLNA 2QCTA 4K5SA 1M5PC 4RU2A 4PYHA 5A8WB 2M70A 1ROFA 3CD5A 1GNKA 1W26A 2B5JB 3UFCX 4B02A 2CKWA 1TK0A 2UUTA 1NK6A 3J7AN 2MKHA 4O4GA 4I0WA 2ACYA 4L3NA 3HSGA 2N4DA 4DPOA 1T3NA 5IBSA 2EG1A 4BPCA 1AFJA 2FVCA 3T1YF 2NUHA 3SFUA 1R0BG 5LMNF 4F0KA 2MZQA 1ICEB 4A4JA 1HHQA 4ECYA 3QCNA 3EGVA 3MM6A 4QUMA 3KK1A 2MQLA 1FJGF 1DTTB 3BQ0A 3GILA 3SCIE 1SJRA 3TOQA 4ES2A 2V9WA 5I3PA 1NO8A 4FDFA 2ZE2B 4J37A 3OSNA 1WC6A 1YIJS 3TUIC 2ZC4A 4NLUA 5D77A 1X4GA 1ZPVA 3OVBA 1K0VA 4PUOB 2X1BA 2NXEA 2CPHA 4AXJA 4X64J 1FTCA 4XPEA 1R7IA 2VOSA 1JXEA 3CPWR 2EK1A 5KFIA 4X62F 4OZ5A 1GEHA 4F4ZA 2XLKA 4DBQA 4O44A 2IBOA 4N8OA 1SJ4P 3OL7A 5D3GA 2XY7A 4QYZK 4QAHA 4K7QA 3ILIA 5K14A 2CPYA 4PUOA 1XNQF 5ITHA 4WFBQ 1RWVB 1U0HA 2CPXA 2J9CA 4ED8A 3HXMA 3MAAA 2UXBF 3UDCA 3ILLA 2EPIA 2JHEA 3I4PA 1RT3B 2CQ1A 2KT2A 3EGWB 4OZJA 3GV7B 4IG3A 2AD9A 4LSNB 1N33J 3ZC4A 2ZH2A 1JLNA 3OXGA 4A8YA 2XG8A 3NGSA 2HPUA 1Y11A 4KY3A 2G0IA 2BDPA 4OYPA 4LF6J 2LEPA 1FK9A 3SDEA 1T9XA 5CCMA 6FD1A 1OESA 3CD7A 1FA0A 3F9AA 1LQ9A 4OZNA 2OOQA 1HQUA 2HK3A 1YBAA 4KGKA 2U2FA 4L76A 4OFZA 1Q5VA 4GVLA 1OYEA 3TARA 1NK9A 4OHYA 2VONA 3J7ZT 2VD3A 3PRDA 3BREA 2DR9A 3KLEB 1Q86T 1Y3KA 2ZKTA 4QAPA 2F8HA 3QLHB 2RS2A 2HW3A 1C85A 4QIEA 1AYEA 2H5JB 3GFYA 2FZCB 3H2UB 4KGMA 4M5GA 5EHPA 1IBMF 4ZJLA 2GQ2A 5E3PA 2QG9B 3SYZA 4LRFA 5KFKA 2XGQA 2OKQA 4ZCMA 4TQSA 2ZH3A 3BDEA 4DR7J 4J7CA 3QWUA 2JEFA 3A8EA 4FS1A 3AJ1A 1XEZA 3HT0A 5C24A 1PG5B 3O6QA 1YPTA 3P5BP 1TL3B 2I38A 3KUGA 1HBMB 3L7OA 1MWZA 2XLJA 1UEUA 5E7OB 5KFAA 2W2NP 1HNIB 4HL9A 4KQZA 2E5LF 2ZWOA 1XRIA 3ZZPA 3DCAA 4DV7J 3PZPA 1NO6A 4WFYA 1YITS 3MEKA 3D42A 1EHWA 1T05B 2B4OA 2VODA 3G2XA 1G1GA 3HX9A 3I36A 4K4XA 2RB7A 3S4EA 1NHVA 2LEAA 1P3DA 1BQNB 4GE2A 1HNIA 1OS5A 3C3LA 4TU7A 1LWXA 2Q47A 1WHVA 3AOCA 4F04B 2ZWPA 2QL9B 5HP1A 2HC2A 2AIRB 4C2MA 1CULB 1RWOB 2GVZA 1SKSA 2FJMA 2VEWA 2CQDA 1KRPA 1PJ5A 3DU5A 1WF1A 2P5VA 4ILRA 1UETA 2YKPA 5D15A 1XMBA 3PYGA 4RU9A 5E41A 3QCBA 5HMWA 4PG4A 3CJSA 2JDJA 5DDRC 1X31C 1HBUB 2A0FB 5HBMA 1MSWD 1BHNA 2FJNA 1SH3A 2I0XA 1CVJA 5H9FJ 4BHQA 5AWXA 4N5SA 1QTMA 4FNIA 4M5MA 3BLTA 1HQ2A 1E6VA 1VJQA 4FXWA 2CPJA 5AXLA 3ZTSA 2M8DB 2QC3A 3HK2A 3E8OA 2OMLA 2PMZD 2VU5A 1HI0P 2HNPA 1TL5A 4JI7J 2R7OA 3HVTB 1KTQA 1ZAWA 3HULA 3M6VA 1SUQA 3PV8A 1FPZA 2RIJA 1HBOB 2RDJA 1ZM4A 1JLGA 4DGXA 5RUBA 1C87A 4H34A 3DLLQ 2HK2A 2QEXS 1T48A 3K5NA 3QATA 4CLKA 3W9HA 3JAMU 1QSSA 1YZ7A 4YUDA 1VBYA 2H4YB 5HMYA 1SUGA 3SMZA 1RU2A 3TA2A 2W9CA 1SL2A 1Q6JA 1RTIB 3JQJA 4Q2LA 3DRXA 3GFXA 1IKVA 1X8DA 1RAGB 4O0NA 4FXVA 2Z2ZA 4EBCA 3TRGA 4B3MJ 1X4EA 4R30A 2OD6A 4OHIA 3M8ZA 4WK1A 2W2QP 1OHEA 5HL7Q 4KPCA 2VBZA 4KHPF 1MNEA 1N5YA 1Y5NB 2AJFE 3WC2A 3L9ZA 2E1CA 1BC6A 1XWLA 4P2MA 3GPAA 4U8YA 3Q83A 4Y3CA 2EFQA 3KLGA 3TVKA 1WNEA 4RH5A 1HL6A 1U1MA 3ETOA 1AW0A 5J8RA 4MH8A 1PC5A 5D0HA 1HR0F 4MT1A 2KN4A 2CQPA 4KGVB 5D0EA 1JLEB 2ABYA 2FHKA 4KTQA 4ZVTB 4ZRTA 1HI8A 1Y3JA 1X5PA 2IDEA 2OEJA 3MM7A 8RUCA 1FESA 1LFPA 2OUGA 3ZZOA 4DCPB 4RZRA 2CG8A 4KE5A 1IBMJ 2CZ9A 2HMIA 1JLQB 4OLPA 1H74A 4YFUA 3CSKA 4DV7F 2BXJA 3BB5A 1X0FA 3R2DJ 2VEXA 4KYRA 4JI7F 5D4LA 1FPRA 3H5SA 1RTHA 2GC8A 3EVMA 3BR9A 5CYQB 1FNMA 2BACA 5JVHQ 2EFOA 1YJNS 3P49B 4JP8A 1FRKA 5DG7A 1S76D 2QYGA 5D4OA 3C2PA 3V0JA 3MAQA 2NREA 4GE5A 3OW2R 3CB4A 5L9XA 2R7TA 2HNQA 4Q45A 1R6YA 2HAIA 1RU1A 3ZFVA 1S9EA 4P7VA 3PY8A 4F3MA 4MBBA 3W2VB 2E0TA 1SL0A 3TZYA 4X4TA 3LP2B 3K57A 1XMQF 1PJ6A 2KU7A 3CDWA 3UDLA 3MMBB 1MU2B 3QGPA 3KXDA 2R2SA 2PGCA 3VZIA 5C42B 2OPQA 1RXDA 2PI4A 4B9VA 2CNLB 3PW7A 2J76E 1VQ6S 1CJKA 1CC7A 3NMEA 1L3VA 2CJZA 2P6SA 2NZCA 1TQLA 3CM3A 1K44A 1M1HA 2J9DE 4NA1A 2DD8S 3MEGA 5ETQA 4L72B 3WC0A 1ZPWX 2GCFA 2WBMA 4M1KA 4NLPA 1U49A 1IKYB 2IC3B 2NZ4A 1C86A 1TKTB 3AY0A 3HDSA 1GX5A 2OELA 3DLBA 3S3FA 3PR5B 3CF5Q 3TA0A 3IA0A 3U02A 2ZM6F 4NCBA 3H59A 1B99A 2V2ZA 3WQPA 2FY1A 1BZJA 5KFMA 2AJ2A 5IV3A 4YDDB 5KG4A 4KRWA 5KFLA 3K0JA 2LXFA 3PNIA 3Q2SC 2AF6A 4ZITA 3PDNA 4MMOA 1PBUA 5CZVA 4IRKA 4NWGA 2OP5A 5KABA 1YLXA 3M2VA 4TY9A 5HK4A 5JXSA 1TFWA 4N47A 4EMDA 2FJAB 3QT8A 3HFVA 3TVYA 3DOKA 2IRYA 3FFIA 2CNKB 2PQ5A 4WK3A 2VICA 1N88A 5L46A 2LEBA 4C8ZA 2ZH5A 2UXDF 4M5DA 3KLFA 4ZCLA 2HNZB 5KG7A 3MUVP 3H5XA 2HURA 1LWCA 1OJ4A 3MF5A 2UUCJ 3FDSA 4I2PB 1Q82T 1FO1A 4KV8B 2UUBJ 4YR0A 4CIOA 4USKA 1RCXB 1GT8A 1HBOA 3HD2A 2XYHB 3HHDA 4GRZA 3I0RA 1VQMS 1HQUB 3QO9A 3D44A 4TYAA 1W2BR 3D4JA 5KFRA 2XB2D 4RNNA 2MGZB 4PVGA 1LW2A 2G0JA 2GQQA 1TL4A 2WONB 4CZCA 2AYMA 2HHPA 2KI2A 1YWXA 4KV8A 1RCOB 1S1XB 4BBYA 3V6HA 2I3UA 3DXSX 4PXDA 4LF4J 2L9WA 1ZAVA 3QIPB 3R6GB 1XM2A 1UA0A 1U7LA 1WHXA 3W2WA 2YKOA 2DO4A 1OQ6A 6AT1B 3BN7A 4WFNQ 4C4WA 1VRUB 5E3CA 3ZZYA 4A48A 1ZYQA 2XCAA 3CCSS 1J4XA 1XNQJ 3RGOA 3M8YA 5IBMA 2VG6B 3T1AA 3BYPA 5KFSA 3M8SA 1EX8A 2B4VA 3Q22A 4F2RA 1NPRA 1QTNB 1WJ9A 1D3WA 2ASYA 2HVEA 2SXLA 5HVGA 4O44B 1LQFA 2Y3YA 3DLJA 4J9LA 3OPKA 4J9OA 4KIAA 4OHVA 2KXNB 4LFBF 1F1BB 2IRUA 2VFVA 4DR6F 3PEHA 2RILA 2EXUA 1HHSA 2V9KA 3ENWA 4DSIA 3ETMA 1TV6A 1FXDA 4NL5A 1YTSA 2AGOA 1H98A 2QN6B 5J2QB 2RRAA 2HHHF 2BEFA 4DL4A 2BQUA 1OY8A 2A3JA 3EICA 2XGPA 1ONYA 1RAOA 4LF7J 4Q8FA 2MQ8A 1RA6A 2E66A 2WW8A 4PXBA 2H4GA 1H38A 5GAHI 2O01C 4ZPVR 5LM7E 2VG6A 1UPPA 1YSJA 1KWMA 4DL3A 1X4DA 4ZVSB 2IA0A 2QMWA 1S1UA 1EAYC 1XR6A 4QU7A 4TXSA 5CA5A 2OC3A 4OYMA 3O3LA 2JX2A 8AT1B 1Q8BA 4F3OA 4JYAJ 1WORA 1U4BA 2HHWA 2BE9B 1XERA 3G6VA 2E5LJ 2PT0A 4ITSA 2KVIA 2R4FA 1NK7A 1F2GA 1C1CB 1FEHA 4ZPAA 4ECZA 4GS0A 1VQNS 4RI4A 2QDMA 2CAJA 2L3MA 4B9MA 4G65A 3IS9B 3M8QA 3KK3B 1F0XA 3UNGC 1FK9B 4ECSA 1EENA 1KOHA 2UV8G 3MZIA 2KFNA 1TMJA 2IM1A 1O6XA 1RACB 2FJBB 3TQ1A 3GSDA 2UVUA 5IV4A 3I56S 2R8HA 2VEVA 2H4WB 3Q8UA 1N54B 2HQIA 4HH0A 4XK8C 4Q0BB 3MECA 2KZMA 2HIQA 4DV5J 1XXPA 4DQSA 1Z2LA 4ZJQA 2OTJS 1MMDA 3OT9A 2B43A 2G2YA 5LT5A 2VPWB 4ES3A 4C3MA 2AGPA 2HVHA 1LWEB 1VI7A 3KG4A 3M2UA 1VQ8S 1KQFB 4LF7F 1CLFA 1BZCA 1HQEA 3AD7C 3CULA 3QZ7A 4ZVPB 1JLCA 1TMMA 3AJDA 5BYSA 2JJDA 2C2MB 3OJUA 4H4KA 3DN9A 3IBFB 2BANA 1KNZA 3M32A 1VQ7S 3ULHA 4B17A 4R0TA 3ZL8A 4USMA 2NSCA 1Q5YA 2H02A 1T4JA 4FF3A 2NPFA 3N5BA 1S5ZA 3C6TA 3SCKE 2ZM6J 3PVXA 2XCPA 2NPIA 4ZN1A 2H4VA 3CC7S 5D0GA 4JI8J 5KFEA 1NHKL 3IWNC 1LV5A 3S3EA 3I6PA 2RVJA 1DTQA 2AEMA 1VR6A 2DKOB 2LP4A 4WTYA 3HPOA 3V4IA 1V9OA 4DCJB 1LW2B 2WONA 4KJIA 4NMXA 1HW9A 4P75A 1SB6A 5MMZB 3S4OA 3MHYA 3SCJE 2P2CB 1OSCA 3P45B 1TUGB 2O5DA 3R5GA 4GRSA 4O4GB 1HKAA 2K8GA 4DX7A 3Q24A 3R9LA 4WYWA 3US5A 1N8RT 1L3TA 4GFUA 4YY3J 1VMBA 4PZVA 1HWKA 3V6JA 5CYMA 3BRHA 4C8NA 2KHDA 2YDUA 4OX9F 3D7SB 3F0NA 3HHLD 3HSDA 3BYRA 1JB0C 3NGRA 4N7TA 2BABA 1H2UX 2Y0SD 3C6UB 4ZN3A 1XN9A 2YKAA 2Z8QA 3T3FA 3D6MB 1TKDA 1T03A 1RWKB 1NKCA 1R0AB 1SH2A 1RGVA 2BRKA 1FWPA 3FNNA 3IRXA 5I42B 4J9MA 4JI5J 1NJXA 4NXMF 3B4MA 4YB5A 4EK2A 5M2UA 4B9NA 1QLNA 4FYVB 2VOPA 2C7SA 4OHEA 1VQSA 1UL3A 1J5EF 4KC5A 5E3AA 4DSKA 2ZVIA 3HJFA 3A3PB 3UNYA 1WELA 2KDOA 1WHYA 1ZA1B 2PIIA 4ED1A 4RW9A 2YWKA 4D3RA 4EFAC 2OHDA 1NK8A 3PO5A 3RO1A 1GWZA 3AT1B 3CMQA 3VGVA 2VFRA 3TW0A 4KBIA 3Q8RB 2LECA 2C2DA 3BLUA 4DUYJ 3V0DA 3AQOA 2F9JA 2ZBCA 3K8VA 1IVZA 4FVCA 2CJYB 1W78A 2O1PA 4M5JA 1RAHB 4ECWA 3RB6A 1T11A 1YJRA 3NCQA 3NOGA 3DFEA 3AOAA 3MM9A 1I57A 3DMJA 1IKVB 1H73A 2JFKA 3ZTQA 4X66J 4P10A 5HMZA 4NLDA 2MZJA 2X1AA 3IR5B 5IQ6A 4IO9Q 3GYGA 4MKYA 3D9BA 2OPSA 4PWDA 2QJ3A 3MCOA 4TYBA 1S1VB 4M5KA 2E9RX 3FSIA 2XSJA 1RBLA 3LGMA 3S3HA 3KK2A 1N0UA 1S9EB 2POKA 5CAAA 4HTJA 4PQAA 5LL6d 1A9NB 2R3VA 4KGXB 1XMQJ 1GXUA 4IFVB 4A8SA 1DHMA 1CJVA 1KN6A 5I3UB 3O5XA 3DLKB 5E5NA 2IVYA 1T9WA 3RUBL 5FIIA 1S1TB 4LRAA 3VCDA 3QO9B 4X62J 2ZJRQ 1RWPB 4N41A 2BGDA 2XMJA 4ZP6A 4DOZA 5A76A 2MLYA 1S72S 1KAVA 3GXGA 2HMIB 4FF2A 1P15A 2F70A 2Q6BA 2UUAF 4DV2J 2ZBQA 2EFNA 4IFVA 1PGZA 1B3TA 1OPIA 1GXTA 2KRBA 5I4MA 4YHHJ 1Q53A 4DR4J 5IT4A 3NAIA 2R2UA 2OJ3A 3QJJA 1HBUA 1F3VA 2A2DA 4NLVA 5HBMB 4NYOA 1Q8LA 4D3HA 4H1OA 4P72A 2AU0A 3TJAA 5I3QA 2CUYA 4H4OB 2F6VA 2HCMA 3NGTA 1K1SA 3DLHA 2NXJA 2LQ5A 3NOCA 4FPRA 1TUWA 2UZAA 3FBBA 3RBXA 4DX6A 3M9OB 4FF4A 3AXKA 4PPDA 3DGPB 2MY8A 4GMKA 2NR0A 1T9YA 3EZ5A 2NTAA 2AJ0A 3M1VB 5KFQA 3D3CJ 2DYAA 4ED5A 1NCLA 1RT7B 2VTDA 5J1EA 5FLXY 4MAKA 5LOQA 2CQHA 2E1MC 2H1YA 3SEOA 4GC7A 1RKJA 2DNRA 4MYUA 4HJQA 3IBWA 2CJXB 2PMWA 3H20A 4AQYF 4NLWA 4GVBB 5I42A 1Y00A 2FQQB 3BEGB 2XSFA 2YWFA 1LOUA 1NRKA 1TKXB 3I5CA 2XULA 3NWRA 1GMUA 3R97A 5AJ3J 3J7YU 3K5PA 3ZM3A 1JLFA 1XTZA 3DOLB 5CHCB 4ZIWA 3PX6A 3DHXA 4CWBA 1WSRA 2CQIA 5C2CA 2K1RB 5IT0A 4P7TA 4NE9C 5FD1A 5HANA 3DDNA 5EWFA 4QR1A 5M2RA 3RU0A 1L3KA 3T41A 3L7PA 4A8KA 3RB3A 2K7KA 2V6AA 2XQCA 2DNYA 2FHOB 1AUSL 2F9DA 5B0GA 4NCAA 4F02A 5K23A 2AWZA 3VF0B 4DLGA 3R7NB 2H9ZA 3WX8A 5MLCV 3TX0A 2F63A 2R42A 1D9FA 2P6XA 2E5GA 4D3PA 1YDLA 2E7XA 1S10A 2K2PA 5E0OA 4K0KF 4JMJA 2Y8WA 4ICZA 5KFWA 1V3SA 1NPKA 2KXHA 4R5PB 3LWLA 3CCJS 1MLAA 2DISA 3CJ4A 5J2PA 1VQ9S 2G4BA 1EEOA 3HF5A 1JLQA 3PJ9A 4I6WA 2E5HA 4Y2KA 4DEZA 1OEVA 4QF5A 3V81B 1YGRA 4A8OA 5CD4A 2LQJA 1NM2A 4R25A 4YB1P 3BS9A 2NLWA 1Q95G 4KHMA 3QJPA 1GMVA 1EETB 2GHVC 1CQNA 2YVSA 3O2IA 2XHCA 3VTIA 4E98A 3AWEA 4EYHB 4M63A 2RF6A 4ENOA 4WFXA 1FKPA 1V3RA 2MQMA 1ZM3A 3C15B 2E9TA 2MEWA 1P1TA 3QFHA 1D1UA 1ELOA 2MZSA 1K0TA 3W5YA 4HT5A 4DXLA 4HI1A 4DV6F 2BW2A 1PIEA 1U48A 5EX3A 4QIFA 5D3GB 3CC4S 1C0TA 4RBTA 3GIMA 2Y96A 1AAXA 4RBVA 1JLCB 3CC2S 4IUFA 3AWFA 1UVKA 1KVIA 2Z58B 3UE2A 5DM6Q 2WHOA 3WBZA 3CJQA 2AM1A 4TNOA 1ONZA 2RMLA 1T0TV 2WVEA 5EWEA 2MJUA 1S0VA 2M7SA 3OTOJ 1M5VC 1PBAA 4QWCA 1W25A 1D09B 5HAOA 4DV0F 1DAXA 3P8BB 4FN5A 3P4UB 2OUDA 3ENVA 3DRYA 5HLFB 3Q8SB 2D1CA 1B0TA 2W01A 1HPZA 4RUHA 4RL1A 4YB6A 4B9UA 1J27A 4JI4F 3B8HA 4M8LA 4LQ9A 4PQUB 2WJPA 2HLTA 2MJNA 3IO1A 1N5VA 2K3IA 1C2PA 3PG9A 2HFZA 2GHWA 4ZK7M 1N56A 1M5OC 2VF3A 2QRRA 2W7AA 3TP2A 3KUHA 4PAAA 5F8LA 2MQOA 2YWWA 2GX8A 4S0MA 5HI7A 5IFMA 2KFZA 3EZUA 3ZV2A 3TYTA 1NUEA 5LSOA 5DDPC 3A5KA 2B6AA 2B51A 3KKFA 2UUWA 2G6ZA 4BCAA 3MUMP 2ZHAA 3MR3A 5ETNA 2PA5A 2BMBA 4C0OC 4UOGA 3GP9A 1LKZA 2JLGA 1WF2A 4IG3B 2BKPA 3BBBA 4LIWA 4CP5A 3J7YI 2DY9A 3MOZA 2EFVA 1MWYA 3UD3P 2I42A 2YKNB 3ENAA 4FP9A 1G1XA 4N77A 3H2LA 4O3NA 4MIAA 4ED3A 1VQ4S 1BXNA 2RSQA 2VQFJ 3FCVA 4K4VA 3ZM1A 2UXCF 4MK7A 1N33F 2P8IA 3GSIA 2WCXA 2NLKA 3K59A 4OQJA 1PJ7A 3RR8A 5G0RA 2AHSA 2DH8A 2HNDA 3I7ZA 5CZXA 4JNBA 3NGUA 5IZHA 1NL9A 2DGXA 4ZVQB 5EHHA 3BO4A 2KRRA 4EUVA 2F6TA 2DRDA 1YTNA 2Z57B 5DQHA 2KO1A 4L3KA 3OR1B 1AFIA 2CFVA 3UAGA 1ZCKA 1FWKA 2AZ3A 5BX1A 3DYAA 3JSMB 4N76A 1TAUA 1SC4B 3KMSA 4DLEA 2FZGB 3RZ2A 5CYJA 1HBNB 1U09A 1V3AA 4NWFA 4P2FA 3IBCB 4TVVA 1JJHA 4KR0B 3H42A 5LJ5Y 2I3RA 2R7RA 2B4UA 1A6LA 1SKWA 3IGNA 2MDAA 3PM9A 3VAFA 4Q8EA 1QUPA 3UR0A 1FDDA 2P9EA 4WZMA 2HHTA 1O5ZA 1XR7A 2BIJA 5AT1B 5DDOC 4C8YA 4LMZA 2HY3A 2GV1A 2MZTA 3DRSA 3PYZA 1NSAA 1WAXA 1ZBTA 3R6LB 3W9JA 1UCNA 5A8KB 1BQXA 2AW0A 3C6UA 2M3DA 2IJNA 4ZCIA 5DQIA 2APOA 1VC0A 4ILMA 3DLEB 5AJ3F 4OJGA 1S1XA 3JSRA 4K4SA 4A8WA 2B8PA 3OFEA 3J7A1 3PS5A 3M9MB 4DSLA 3D0GE 3BN4A 3DRRB 2E29A 5J1EB 4X64F 1QSLA 5ETTA 1T9UA 1FE4A 5HN0A 1KTVA 2NZ6A 3ELHA 1VCTA 1VOMA 3I0SA 3B54A 3GQCA 2JEGA 4ETXA 2DRAA 1TL1A 3CWEA 3C16B 1H3DA 3C8YA 4B3MF 1IKXA 1HA1A 3I31A 4G3IA 2VQEF 1IBLF 4BDPA 1YFOA 4KSEB 2RJZA 4WF9Q 2W1BA 1U1OA 1RT4B 2NYHA 4K8RA 1FX2A 1FWLA 2C2ZB 2CQ4A 1Q6NA 1F3FA 2J7KA 1RT1B 3CDBA 3UR3C 1C0UA 4EWTA 1CPZA 1IM4A 2Y0BB 2XMAA 1GAOA 4HI2A 5FDLB 2VFSA 4ZP8A 2FDNA 2Z2LA 3P3DA 3G82A 4P9SA 2WK4A 1F9EB 4G1PA 1RDRA 2IVMA 4QWAA 3RYLA 3KLGB 1NKBA 2F6FA 3N0AA 5IC4B 2LQBA 4KO0B 4NOHA 1RT2B 4ZPCA 2ZJQQ 4JI3J 3QCJA 3R5BA 1U26A 3WZ0A 1SQEA 4C8MA 5A6PA 1LEOA 4TVAB 3G8QA 1HYSB 2J16B 3GCWP 4BWMA 3D5MA 4LREA 3IWXA 4ZHRB 3TEHB 4MKVA 3H90A 5KFHA 1WUUA 4OYWA 1DBDA 3KK2B 2PN6A 1FKPB 3KLVA 2R9LA 1SCJB 1CC8A 2V8VA 2J0QD 4DQIA 2H3EB 2WVFA 2V4RA 1NMEB 1FD8A 5GMKa 4TQRA 2ZUGA 4AE5A 2JWNA 3LPEA 4X84A 3FC9A 5IS2A 4DX8H 5IT9U 1JNRB 3UI3A 1JLGB 5GVQA 2FLLA 3MCSA 2HQFA 2N82B 3H7HB 2ZDPA 2W9BB 1QM9A 2HZAA 1VHIA 1YGUA 2UXCJ 1QAJA 2DNHA 1GTEA 2VB6A 3G87A 4QBEA 2NSBA 4Z6BA 2ZNZA 3E3XA 3FEYB 3R1LA 1KVJA 2QDPA 4RUCA 1VBZA 4AZ1A 4XDDA 2XHWA 2CQGA 1PXHA 2M9KA 4WKRA 1FTRA 2KL8A 4DHVA 5HLFA 1V3ZA 2GJFA 1SL1A 3DOMB 4OIXA 2ZHOA 5AXMA 4J5OA 4IKAA 4E0DA 4D3QA 1LWFA 3DRSB 3D2WA 1U45A 3FQLA 2I6MA 3KLIA 5F0UA 4BLGA 1T9TA 2AX1A 3AODA 3LW5C 4TU8A 4FYDA 4G1QA 4DV5F 3EMTA 4C7QA 1NJZA 4F50A 4I4BA 1HNWF 1M3GA 1AZSA 4LR9A 1U6ZA 5HP1B 2ZKUA 3TQEA 2N3OA 5DETA 1NK5A 4EI2A 2VKZG 4ER8A 1VLOA 4WXOA 5T7LB 1JLEA 3O8WA 1WKLA 3LO3A 2JFHA 2DNKA 4HVZA 4JV1A 3MMAA 4C11A 5A2QU 1I6JA 1RTDA 4AD6A 2DPIA 1WACA 3IGVA 3PHTA 4LT6A 3VWSA 4CO0A 5GAEI 1G4WR 2R0BA 4NX8A 2D69A 4B3RJ 2IMGA 4RW9B 4DQRA 2FGOA 3C14B 3O4TA 2V8DA 3CCRS 4YEAA 4DQQA 3HVAA 5ETOA 2PA3A 2YKMB 4CLPA 5KFZA 5BR8J 4KYQA 4KHPJ 1ZM2A 1L3SA 5K9VA 3H40A 1X4AA 2H51B 5I6VA 1M1GA 2EBGA 4RW7A 4C12A 4LF6F 3GIIA 2XMTA 1T95A 5CCLA 2XMUA 4Z7YA 4ZPWR 3N5FA 2W9CB 4MYTA 1F60B 5DG8A 4FXDA 1KAKA 3LP2A 1WD6A 3I55S 2ZH1A 2RD5C 2YWGA 2C2EA 4MKAA 2VBYA 4QU6A 2IFXA 2CA9A 4DSFA 1T94A 4RPFA 1RE1B 1DQ9A 5LSRA 2ZOFA 1NJWA 2YXLA 4JI2F 3HCXA 3BQ2A 1IBKJ 3CMES 1KFDA 2CPEA 3UD5A 1DFDA 1RTHB 2HVLA 2EG2A 2J7WA 1H2TZ 1LWEA 3D66A 3M2UB 1IXKA 4NWBA 4ANEA 2R8IA 1RHMB 1YJTA 3GIJA 1BWVA 2I75A 3NBPB 5FDLA 4UT4A 1VIOA 2DIVA 3C66A 5HVHA 3M8RA 2VJVA 2ADCA 1NWLA 2LYVA 1FFWB 5GMEA 1LWCB 1SBRA 1HNVB 4ZJOA 3D0IE 3CJKA 5KFCA 4OI0A 2PBNA 2DEJA 2V4JB 5DDQC 4URQU 3GIRA 4ED7A 3S01A 3C6TB 4K4TA 5J2NA 2ROEA 3CDEA 4EZ6A 1WSVA 5A5EA 3Q8VA 4IG0A 5KT7A 5F8HA 2E1AA 4LF5J 2BBEA 2JC0A 1VQPS 3RR7A 9ATCB 1WRMA 3DM2B 5KT2A 1GH8A 1BQNA 1NSKL 2D3ZA 3DGPA 3GJSB 2LDIA 3KNGA 2CM8A 2Q43A 1WEYA 1K8AT 3EXYA 3T6JA 5B7WA 2I6PA 1VK3A 2FPHX 4RR5A 3BKTA 1SJFA 3AOBA 3KLHB 3IM8A 1CJUB 1WG1A 1PYOB 2C3PA 3GZ7A 3QGIA 4BJOA 4I6AA 3BSOA 2ZZNA 1R8BA 2QSFA 1FERA 2IM2A 3UN5A 4DFPA 5C25B 2JFDA 1KHVA 1PYTA 3MPYA 3MM6B 1PTTA 1NZ8A 2WVCA 1NDPA 2ERRA 4DN9A 1JJ2R 2OPQB 3I0SB 3G9CA 1RWNB 3NWGA 4CI0B 3EXCX 1NU4A 2KT5A 2E7WA 3IWLA 1C4AA 3CGIA 3OVSA 1SQFA 3TUJC 3PFEA 3TJ9A 1CJTA 2GMHA 2GA7A 2V8HA 3HZEA 4HTIA 4OYXA 3UW1A 1NK4A 4NXNF 1R8AA 3MMJA 2ZC3A 4ECTA 1T7PA 2Y9HA 2QYCA 3BKUA 3E2EA 5BJRA 3P6YC 4QCLA 2Y8YA 1KHWA 2B9WA 1ECVA 2HGLA 1TUVA 2RRNA 4ZCKA 3UWTA 4PWDB 3AH6A 3GE9A 2VJUA 4X2BA 3RGQA 5L1KA 3ET6B 4CVLA 4HR2A 3I82A 2QZ8A 1W7WA 2ZFHA 4A8XA 3TUZC 2QGFB 4MK8A 1R3NA 4IDKA 2V8PA 4OJHA 1XBOA 2H5IB 3S7RA 3GV5B 4DL6A 1TKZB 2XYGB 3TVZA 2CNOB 5JMNA 4UQGA 4WE1B 2KJWA 1IUJA 1QVGR 2XMKA 3MR2A 2JFFA 2ZBPA 4Z37A 1PKUA 2OPRB 4NLOA 1U1PA 1RT4A 1XMOF 3GFHA 3CW2C 2D3O1 2XS2A 1G4CA 2QBPA 3BM7A 4ZP9A 2MQPA 3LAMA 1SJ3P 3NMAA 1UFWA 3I9V9 3ZM2A 1RP5A 4IDKB 3I4HX 1YTWA 3H98A 4WP9A 1REVB 4ECXA 1HNWJ 5KA0A 2A6MA 3Q2TC 1ULRA 1OPZA 5KTQA 5GTJA 4Y2IA 3RW7A 4EGLA 1PO6A 2ZUAA 3MEEA 4P71A 4OV1A 4AQYJ 1RABB 5CD4H 2AGQA 2O3DA 4FF1A 3DLKA 1ZH5A 4B3OA 2BGEA 1KOOA 1R31A 2EEYA 3LPYA 5M2PA 3O4SA 2BUNA 3ZO7A 1FDNA 1IM6A 3UD4P 3MTJA 4DR5J 1RAFB 3FMBA 4U7UD 4WIQA 4QR2A 4B3RF 4I7FB 4EO8A 4PWWA 3KTQA 1T03B 1B7FA 1I1GA 1BLUA 4G6VB 2JJ4D 1GQYA 2J17A 2C2OB 3B78A 2ZD1B 4WZQA 1DTTA 1VC6A 1RLDA 3QIPA 4PKDB 3CIMA 1LNQA 5K8NA 4HDHA 2HHSA 2J6TA 1Q6SA 1CS4A 2YH1A 2MQQA 2FVRA 2G2OA 1E8CA 5H9EK 1WI6A 2YNFB 2NS1B 2V67A 2K06A 4M5LA 2GAGC 1NK0A 2CYYA 5GAHU 3F99A 4JI0J 2ZOMA 3HVTA 4JMKA 3QCZA 4OZ3A 5KG1A 1PAUB 1S4EA 1LXJA 2MKJA 3HZGA 3DHWC 4DMZA 1CJVB 4ZMMA 2N7CA 3BF4A 2DNPA 2M5YA 3J81U 3S8SA 4ZPBA 4DQPA 2F5GA 1APSA 3ADAC 1DTQB 3BPDA 3K5OA 5B0EA 2QO3A 3CCMS 1KLNA 2HHHJ 3OMHA 1WOSA 2W4DA 2DNMA 3OR2A 5A8KA 3IFEA 2CVIA 2XO6A 5L1JA 4I69A 4ZDNA 4QW9A 2DR5A 3OHAA 3LK7A 2HFOA 2FY8A 4F3QA 1U2FA 2DB1A 2FJDB 2BOAA 4HACB 2MQNA 2MKSA 3MR7A 3TX8A 4C3LA 3DMJB 1SV5A 2PI5A 4C97A 4RNMA 1Q78A 4LQ3A 4WPAA 2DH7A 3G6ES 3LUYA 3ZMPA 2VORA 1RUSA 4RX6A 3MMBA 2QA4G 1ZTWA 1IKWA 1RBAA 2NXUA 1VQOS 3BZQA 2HHQA 2KM8B 3KHGA 1YBTA 1YRXA 3L7UA 3OR2B 5EX0A 2ASDA 5U47A 2VL1A 1OEOX 4GKJF 4LFAF 3WHIA 2ZITA 4W98A 2CPZA 3MR6A 3N4WA 2I1RA 4Y28C 3THPA 3OR1A 4DSEA 4AFFA 3KG1A 4Z7CA 1OHCA 1H7WA 1R6HA 4E8UA 2HHXA 4K0KJ 3ZM0A 2VA3A 3CVKA 1FDAA 2EFPA 3H0PA 2BQ3A 3ZNJ1 1JLAA 4IH6A 2DEIA 1S6QB 3CT9A 4HT7A 3C46A 3MOWA 5K9FA 1JLBB 5F9LA 3LWMA 1JWWA 1I3OB 4OI1A 3KK3A 4R0EA 4UOFA 3GIKA 1YK9A 5CQGA 4Q43A 3CD6S 1MU2A 2ZD1A 4RDDA 4DPTA 4GVBA 1VQ5S 1OO0B 2GC5A 1OQ3A 2QLWA 2RNEA 5LJ3Y 4ZVUB 2R7XA 1CJUA 1I94F 5LSLA 2HHVA 1SQGA 2HNYB 2RHSB 1UVJA 3FBCA 2EK6A 3E51A 5SUHA 1UFLA 2J0WA 4ZHRA 5A0YB 3GMGA 4WFAQ 3G6XA 4H54A 4DF4A 1LK5A 4U96A 1MW7A 3M8PA 4WU3A 1KQKA 2QLBB 4KGZB 4DFKA 1YJ9S 1U2CA 2VFUA 2IMWP 3MEEB 3PIPQ 2DNOA 4F7VA 2XMVA 2F6ZA 4B3SF 2DNZA 2QDCA 3CTRA 3CE8A 4DR5F 2VUGA 2OIHA 4NPOA 2W9BA 3DKDA 4K50A 4OHLA 2Y67A 2GGPB 5BR8F 1HW8A 2ZDOA 3MM7B 2Y1IA 4JI1F 2BZLA 2H4KA 4BC7A 3LALA 1IN0A 3ITHB 1IBKF 4LSNA 3FVYA 4OX7A 3M30B 4ZLJA 1LW0A 2RKIB 3BH7B 3VAIA 4CCHA 4Z2XA 3I80A 4P6QA 5A8RA 4DR6J 4WU2A 2M0GB 5KG0A 1RHJB 5EWGA 4QBUA 5K20B 4J9KA 1RT6A 1S48A 1R89A 2FGCA 4U7CA 4NYHA 1MROB 2V2KA 3CCLS 2RE1A 4ECQA 5KFVA 1PTUA 2DT9A 4FBTA 3SXLA 1B0VA 4OI4A 1WTFA 4KO0A 4PCQA 3A4TA 1X5OA 1WWHA 2D74B 3P96A 2BR0A 1BD6A 4YHHF 2HZVA 2HBZB 1IR2A 4UY85 2BJ9A 4I64A 5BXIA 1TELA 2DR6A 3BDPA 5EHRA 1R8PA 3OSPA 2H54B 5E3QA 3VR1A 2AX0A 4OLOA 1RT1A 3U7JA 2Q66A 5KOWA 3JYTA 1N32J 1J5OA 4ERCA 3JTPA 3HMJG 5D8HB 2DCLA 3IR6B 4ICLA 2CZ4A 3MM9B 1PAEX 1HD1A 2JLEA 1UKUA 4EBEA 2OD4A 5HATA 1ZZWA 3OFHA 3A13A 4OI2A 1REGX 3T1HF 3ZMQA 7FD1A 2R7SA 4M95A 3KHRA 3I96A 2FJEB 4XDCA 3EWGA 3LP0A 5D78A 3GXHA 3Q86A 3S1TA 4FYWB 1S1WB 2G2ZA 2HC1A 1QXKA 2B8QA 1R27B 4XTTA 4ZA1A 3MMAB 2XYPB 5DJBA 3DDKA 4C11B 4Q44A 1RTDB 4YR8B 3IAS9 4K4WA 2BJDA 4FKYA 4ED4A 1XC9A 1HYSA 3NMRA 1RT7A 1MMLA 1YJVA 3NNAA 1HMVA 1C83A 4AL5A 1N52B 3FFIB 1I9TA 2PEHA 2K1RA 3UVJB 4DUTA 2HYIB 2JH3A 1G7GA 2YQ1A 1RISA 3HFZB 4U8VA 1KLMB 1NB2A 3HVRA 3QNWB 1EARA 3UQSA 5HQ8A 2K3KA 4ZVEA 3VGTA 4QWDA 2MKCA 3D0HE 1F6TA 4ALZA 2KH9A 1RYRA 5CXTA 5LMUF 1QZ0A 5HROA 4X4PA 1X4FA 1Q79A 5F8IA 4N8NA 3M4XA 1UTAA 2YBVA 1X9MA 3QRRA 2HWIA 2UV8A 2O66A 3QSIA 2IYGA 2R7WA 5KA7A 2E1PA 4PXEA 4YP3A 3KOAA 3KLHA 3O4UA 3W8GA 2RRBA 2MZ1A 3LP0B 4ZVFA 4F26A 1IWAA 2MHEA 4LFCF 1FRHA 2B07A 3Q0AA 4A47A 2RU3A 3TR5A 2VEYA 2C1EB 4Y2CA 5F8MA 3F81A 1R43A 2UUAJ 4DV1F 2RUGA 3V4IB 2OEMA 3H4BA 4LR8A 2C3OA 4H4OA 3JYTB 4ZI4A 3NG8A 5D4NA 4TN2A 2CQBA 4NLQA 2CPDA 3W2VA 4I7FA 4N56A 1Q16B 3JTOA 1HNVA 2WOMA 3PCOB 3CJKB 3ZTOA 3A8JA 3AB4B 4CO3A 1HFEL 1UJ6A 3AB2B 2PMHA 3PIOQ 5DGBA 4HHJA 2X3DA 1S6PA 1FE0A 3PYFA 4C0HA 4QBWA 3HVWA 4XO0A 1GK8A 3FKBA 4ZPTR 1WCHA 2UXDJ 5KT5A 3BH6B 2LQ9A 4IYQA 4M5HA 4D3GA 3JAMY
chains in the Genus database with same CATH topology
1CSJA 2G59A 1QAIA 2QEPA 5J1NA 3MTKA 4RW4A 2R7UA 4Y34A 2XS5A 2ZE2A 5KFOA 2QBQA 2OMOA 1X0PA 3CO9A 3G71S 3LOUA 1RT3A 4WFZA 1H0HB 5T7LA 1QUVA 2XO7A 1L5UA 5T41A 4ECVA 3QKQA 5G0RB 3LF0A 2MMYA 5KFUA 2UP1A 2I6JA 3PR4A 2R2RA 3L09A 2AJQA 2YNGA 1NJIT 1N0VC 2RQMA 2B7BB 1HWIA 1DURA 1OSDA 2P9GA 2WAQD 2FTRA 2F8EX 1XBWA 2G9OA 2YKMA 3FGVA 4ID5B 1HQEB 3N28A 4NZ6A 4K5RA 3J80Y 1FJCA 3OVAA 4J51A 1SIWB 3TO8A 1UEVA 3DLEA 4DDFA 5HMXA 4DGPA 5F8GA 2VBWA 1N5QA 3IXQA 3NKYA 3QAEA 6FDRA 4NZ0A 3I5AA 2V0NA 5IM0B 3M6WA 2F3JA 3ZZTA 5CYQA 3BGRB 5GAEU 3K7RA 5FJ4A 4JI6F 4O3SA 5LXYA 3F9BA 4KPYA 2L9DA 5K9WA 4J9QA 5C24B 1S6QA 1X4HA 2GHPA 4DL0C 3R1HA 5F41A 1SUQB 1SIZA 1VQYA 3EGNA 2KFYA 2KG1A 1KC8T 1LXNA 1S7HA 4Y2AA 3EUNA 1KSPA 2CJQA 2UUBF 2I6IA 3DNCA 4X4OA 4C8LA 3D1QA 4YDXA 3BO3A 3BSCA 3BJYA 3MR5A 5AE1A 1VIXA 5H9EJ 3K8WA 1NB7A 2CQ2A 2F8MA 1IQZA 3M32B 5CYMB 3HO1A 5EUHA 4X4QA 2B3OA 1S0OA 3F44A 4OX8A 3GV8B 5F9NA 3KJVA 3BO2A 4DV2F 3NGDA 3M1VA 3HHEA 1S99A 5K8OA 1UVMA 1N5SA 3QGGA 4LF4F 4CH0S 2IHR1 3OBIA 4H4MB 2QA1A 4PG5A 5IXUA 1JLFB 5AXNA 1D0EA 4DR4F 1CEZA 2MZRA 3R3TA 1JMTA 3KYLA 4QR0A 4C8KA 2FHJD 3ZZRA 2RKIA 3CCUS 4A8QA 1IR0A 1FD2A 4ELVA 2OPPA 4I1TA 1EP4A 2LXIA 4UOCA 2JEJA 2FH7A 4OJ1A 3OHBA 4H4MA 1RPMA 1VFJA 3D28A 3POTA 2VEUA 5KAKA 2HVZA 2I4GA 3CIZA 4NRTA 3EX7B 1NWEA 4RKKA 2CZVC 5F3ZA 1KQSR 2E5JA 1NZAA 4I2PA 3QPIA 1D8YA 4ID8A 3MURP 5J2MA 4KJIA 4MKBA 4U67Q 1ZETA 3CCMS 2AP6A 2IRXA 5KFPA 2YWHA 4C0BA 1C0UB 4M5DB 3KLFB 2KKHA 2YKQA 2GW8A 3MUTP 1S0MA 4NLRA 2QT7A 2XI3A 2C22A 2XNRA 2CNFA 3M2VB 2A18A 3ISND 1S97A 2G13A 2YH0A 2NV5A 4ZS6A 2OSQA 4NLGA 3EZZA 2QIFA 3O1LA 2EBEA 4DR7F 1FJEB 1DLOB 1P6TA 4DL5A 3VALA 1U2RA 2MSTA 4MFBB 2FVQA 3X1LB 4V19J 2YY3A 4QYZJ 2J6SA 2YTCA 4URGA 3EMUA 3T19A 2N7YA 4XAKA 4LSLA 4CO5A 2IA6A 1NEEA 1GXLA 3TAMA 2HHUA 1J5OB 2R2TA 4NLTA 3RB0A 2A10A 2XLIA 2OPSB 2X3GA 1OIAA 2UU9F 4HH1A 3CDUA 5L9NA 3OLAA 1Z4UA 2W7PA 2W8KA 2DHGA 4LVOP 3QCHA 3A1YG 2CM3A 1FEEA 2ZH6A 2R8GA 4DG1A 3G4SS 2CNEA 3D1OA 2V4JA 5BYRA 3QCGA 3NS6A 1NKEA 1S9GB 3JSMA 2BV3A 2ROPA 1D8ZA 1S1WA 1M5KC 2VOOA 4WJBA 3QIDA 3OL9A 3HI9A 3EPIA 4ZOSA 4KT0C 5KFXA 3MFIA 4DN0A 2QBSA 2HS0A 5K25A 2ZN7A 2A1BA 3N6LA 1UWBA 5I3UA 2Y2FA 1TKXA 1HNZF 3HLUA 3AA9A 4OHHA 2XC9A 2MKIA 5C25A 4QWEA 3BSAA 1HARA 2HNZA 1RQ0A 3N9UC 2B5JA 2E44A 3PKMA 3JTNA 1QVFR 3LGNA 5CH7B 4PG8A 3DI6B 3QKPA 3TI0A 4IR9A 4I56A 2CM2A 3L3CA 2GO9A 3FRZA 3R5CA 4KFBB 4DV3F 4OJ3A 4ELTA 3W3SA 4DR3F 4BWJA 4R0SA 1QAXA 3RRGA 1QY7A 4OHWA 1C4CA 1REVA 2DO0A 2P6TA 3ZZ0A 5KFNA 4F25A 1RTIA 2OH2A 1TK8A 4O3PA 1FRMA 2ROGA 5J2NB 1Y5LB 4MJKA 1TKTA 2V5HG 3SI8A 3H4DA 3N79A 1GQEA 3OTDA 5DQGA 3U1NA 1EETA 2XY6A 2V4QA 2ATLA 3LAKA 4IOAQ 2QSWA