1U2DC

Structre of transhydrogenaes (di.nadh)2(diii.nadph)1 asymmetric complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P) transhydrogenase subunit alpha part 1
publication title Active-site conformational changes associated with hydride transfer in proton-translocating transhydrogenase.
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
total genus 48
structure length 174
sequence length 174
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2004-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1u2dC00
4BN4A 1OZHA 1T9BA 4GP9A 3PKIA 2H4HA 4K9OA 2UZ1A 1PT9A 1V5GA 1MCZA 4IF6A 2JI9A 4L2IA 4RJIA 1SZCA 4V1CA 1PNQA 5K2OA 2QQGA 4JU8A 3JR3A 4D5GA 1T9CA 4KGDA 2Q5QA 2HJHA 1MA3A 5EJ9A 5D7NA 2Q28A 4X3PA 1PNOA 2NYRA 4R8MA 4Y6OA 4BVFA 1Q6ZA 2FSVC 5EJAA 1M2GA 4O8ZA 4JT9A 2VBFA 1T9DA 3FZNA 2WVHA 4HDAA 2UZ1B 5MGNA 2C31A 4C78A 1E3TA 4JUCA 1ICIA 1M2JA 5BWOA 4V1CB 2Q29A 4JU9A 1M2HA 4UTRA 4MZXA 4FEGA 3K35A 4FVTA 2Q5LA 3CF4G 1YC5A 1YHZA 2H2GA 1PVDA 3RIYA 4BV2A 2H2HA 3FLMA 3F6BX 4JUFA 2W93A 3GLTA 4UTZA 5K3SA 3RIGA 4F4UA 1YNOA 4JUBA 2EZ4A 1PO7A 4HD8A 4FZ3A 5EJ6A 3U3DA 1UPAA 1YI1A 1YTLA 2AG1A 4MPJA 2H2DA 1ZPDA 5EJ8A 4K9LA 2EZ9A 3HWWA 4UTVA 2VBIA 2VK8A 2A1UA 4IAOA 2OD9A 1S5PA 4TWJA 1OVMA 2FRDC 1Z8NA 4J1TC 4MPRA 1Q17A 2Q5JA 4COKA 4BVBA 4RMHA 1T9AA 3EYAA 2JLCA 5BWLA 5EJ7A 4JUDX 4JD5A 3OE1A 2FR8C 4MPPA 2QQFA 1YC2A 4JUAA 1UPCA 4JT8A 4J16C 1V5EA 4IG9A 4MQ5A 2OD2A 2IHUA 4Q9DA 1EFVA 4D5EA 3F6EX 2H4JA 4GM4A 1POXA 4RMIA 1JSCA 5MF6A 4L3OA 4RMGA 3CLSD 1POWA 3ZGOA 1Q14A 3D7KA 2PANA 2X7JA 1OZFA 4G1CA 2H2FA 5K6RA 1O97D 3D81A 2B4YA 1BFDA 1Q1AA 3GLRA 4Y6QA 1SZDA 5DEIA 1M2NA 1PTJC 2JLAA 2VK1A 3D4BA 3EA4A 3PDHA 5EJ5A 2Q5OA 2H2IA 2EZUA 2OORC 4UTXA 2FWNA 5EJMA 3U31A 1J8FA 2BRUC 1S7GA 3CLRD 4RJJA 2VK4A 4UU7A 2NXWA 1QPBA 4QQ8A 4F56A 5DGTA 1DJLA 1YI0A 4TWIA 4GG1A 4C7BA 3E9YA 2JIBA 4BV3A 2PGOA 1O96B 4UTNA 4UUBA 3GLSA 3HWX1 2EZ8A 4V1CI 4K9MA 4BVHA 2VBGA 5IMSA 5K6TA 2OD7A 4ZZIA 5EJ4A 5FEMA 2WVAA 1NM5C 1HZZC 3PKJA 1U2GC 1UPBA 3FSJX 4X3OA 3ZG6A 2Q27A 4BVEA 4K9QA 5DGDA 4BN5A 3EY9A 5FYQA 4Y6LA 5AHKA 1EFPA 1U28C 4BVGA 2IHTA 4K9PA 4KXQA 4QPZA 3IAEA 4FEEA 1U31A 4I5IA 1OZGA 2EZTA 3IAFA 3CLTD 1PYDA 1PI3A 4BUZA 2JI8A 2AG0A 3ZGVA 1D4OA 2VJYA 1YHYA 2JI6A 2WVGA 3LQ1A 1V5FA 4K9KA 3GLUA 4RJKA 2FN3A 2V3WA 4UUAA 2H4FA 3JWPA 4KPUA 4RMJA 2H59A 4JSRA 2A1TR 1U2DC 2IHVA 5MFZA 4GM0A 4UU8A 5MFPA 4QELA 1Y9DA 4ZP1A 1N0HA 4GM1A 1XLTC 2PGNA 5BWNA 2JI7A 3CLUD 1M2KA 4GPEA 2DJIA 2OO5C 1YBHA 4K9NA
chains in the Genus database with same CATH superfamily
1RWKA 3MMNA 4S1OA 5I7VA 1Q50A 3N74A 4HS9A 4GOLD 1Z16A 1ZVKA 4DMCA 3ZWCA 4TYWA 3P2YA 1Z0ZA 1RW4A 3I34X 1TK2A 1YAJA 3AF3A 1ZQ1A 4FW9A 2ZU0C 1J42A 4X7RA 3AKEA 3PDWA 1JWAB 4ZDIA 4B7UA 2ID8A 3LOUA 2Z5LA 1ENZA 1R8XA 5HKKA 4U5XA 4XQCA 1K92A 4HX2A 4IO0A 3HCOA 1DIRA 2B8WA 4DCUA 4EY3A 5HK9A 2O9JA 3ZBTA 3Q11A 4CLRB 1XQYA 3TFWA 1CF2O 4I9GA 3TM4A 1V3UA 4B3JA 5CAEB 2A88A 1CE8B 2FSFA 4Z0NA 3A1SA 4PLTA 3DV0B 3QFCA 3GG2A 4IF6A 1NN5A 4X9XA 5EXTA 2O8EB 5AW2A 2Z56A 1NNLA 1YR2A 4UUPA 2J7PD 3MAAC 4I1VA 1RHUA 4XYEA 1JLLA 3D8UA 3GLHE 1TI7A 3LC2O 3Q9SA 1LS6A 3KLNA 1ZEMA 3WMWA 2DEUA 4A0QA 1JPJA 3X2FA 4ZHSA 3QKWA 4R2KA 3T5DA 1DIBA 4RO0A 4RETA 4BNFA 4W5JA 4YP0A 2ZREA 2D4AA 4NS1A 3HG7A 1MVNA 5EXXA 4EY5A 3DM5A 3H5WA 4KE9A 3KR1A 3NIGB 3FMIA 3GGSA 3PFIA 4P32A 4U2CA 1XO1A 4KGDA 1WKBA 4FBLA 4TYNA 3WHIA 4CDGA 1VM6A 2ZB3A 4TTIA 5KYWB 5LC1A 1FU4A 4AYTA 2QN1A 3ZUPA 2XUIA 3TF5A 1KMHA 2XGSA 4WADA 3ERCA 2BISA 4ENWA 4JDUA 1WHTB 3TG8A 2GKSA 4FGJA 1VG1A 1L5ZA 4JLJA 4Q21A 4DBLE 4EBBA 821PA 5IYZB 2NX2A 5GZ3A 2VDWB 2ZTHA 3D0KA 3Q2OA 5ALIA 4C9BA 2OR3A 2CE2X 3DF7A 3G5TA 4ZVNA 2W6JA 3I5XA 1Z5OA 4YP7A 4DCCA 1TPYA 4REMA 4WNAB 1JR6A 4YRDA 3TO5A 2CYAA 1MH1A 2E2WA 2EW1A 2OV2A 2ZYWX 4G2TA 3UJDA 4ZYVA 1CT9A 1X3LA 1JI0A 4G8JA 8LDHA 2DGDA 1WZNA 3BB4A 3GDWA 4J4TA 5H16A 2DCMA 1KZ7B 3KYDB 4TZTA 3O8BA 2VPQA 2UZ1B 1ZIYA 1T0UA 3G8CA 3HACA 1CEYA 2I6XA 1BXZA 4Y0VA 4ZTZB 3FTFA 3KU1A 1CYDA 2FPLA 3MOIA 3VC7A 1A7UA 3G89A 3QI2A 4MV6A 2SKEA 4UPDA 5AJHA 4TMVA 1Z0UA 3BE8A 4FZVA 1E79A 5GWXA 3MK31 4AG5A 3KYJB 3X1KA 1DC7A 3W8DA 3C8MA 3VC3A 2PVSA 2MOKA 4BECA 2ODBA 5GZ6A 4EEKA 4HUQB 2WI8A 2G25A 3LVRE 4IDCA 1BFKA 1PZGA 1TW3A 4P4GA 4PLVA 4Q3NA 4POOA 1X7XA 2E6KA 2E3JA 2NPFA 4V1CB 4DF3A 1E6KA 3A6EA 1L5MA 3R3UA 2QYSA 2VPZA 3GEEA 3QI7A 4GSKA 4CM6A 2E55A 4DA6A 2VSYA 3RSHA 1M0TA 2CSUA 4RPHA 2OSBA 1G8AA 3KZCA 5ETJA 2PL1A 2Y05A 1VG8A 1ZA2A 2YNMC 3F71A 4EB0A 5FWYA 4K7JA 2Q5LA 4B2IA 4GPZA 1T8SA 2ZEJA 1M6VB 4A23A 4IWYA 2YVLA 5TC4A 3CINA 3PUXA 1TL7C 2H2HA 3SFTA 3W1EA 1BHO1 1EUYA 1NMXA 1IUOA 4PG7A 1MX3A 1QKJA 5A6SA 3S2SA 4KQMA 1GKLA 1K5DA 4G5FA 4IQ0A 3H16A 5FBKA 4DSTA 1PL8A 4A0HA 4D6XA 3Q3HA 1YVUA 3AVOA 1ZL2A 4YLEA 3RIGA 2IOFK 3TB6A 5CNJA 1HQCA 4BLWA 1DZ3A 1JDUA 3QJYA 1M1ZA 1PO7A 1PK8A 3Q9NA 3MJ4A 2G28A 3QU9A 3BBLA 2WWVD 2KBEA 2WE8A 4E70A 5JS7A 1DBPA 2P35A 3B2QA 3GK3A 4YHHB 4PLCA 4L51A 4BO1A 1D07A 2WPNA 3U3MA 1X7GA 4GOND 3ZIDA 3ZY3A 1UPAA 1ABFA 1P45A 3ID6C 4EZBA 5JAHA 1XJQA 3RUEA 1PR2A 3AHDA 5FWXA 2ZI9A 5BP7A 3KSRA 4S2EA 3MOSA 4MPJA 4MKXA 4U7GA 4LZLA 4CR8A 2YDXA 5M7EA 1IN5A 1MEJA 3QUSA 1YIOA 3OPVA 4N8DA 4PC6A 3ZDXB 5C7YA 4F85A 1MF7A 3WE7A 1AMOA 2R1ZA 1LV8A 4CKXA 2JIDA 2JA2A 3ICWA 4DR2B 1QLJA 1GTJ1 1TM5E 2ZE8A 3OY2A 1HDIA 2V6FA 4KL8S 4PFKA 4BRZA 4M9SA 3OZRA 4R01A 5J4YA 2PD4A 4DLUA 1RBQA 4LRWA 1MVLA 4P08A 3V4SA 1Z0SA 3TN7A 3NDJA 4GYYA 3FOFC 1ABEA 2QMZA 3LK7A 2IBSA 1VFPA 1PGJA 5B7PA 1P62B 3VDXA 5FOTA 2V03A 1EWTA 2ZVDA 3VSBA 1F8FA 1XLWA 4RZXA 4AMUA 3OP1A 1GSOA 3WB9A 3GGPA 1T0BA 2LE0A 3D7RA 1Z47A 4LDAA 4YEDA 3ZCXA 1UBMS 3EJWA 4GX5A 1XROA 4JLOA 4MS1A 4EK9A 3PPXA 1KVRA 3HPRA 1Z0IA 1K0FA 1RZUA 1RHRA 2RGXA 3RTDA 3DBHA 3NV9A 5G0TA 5CLFA 2WP8J 3AYZB 1PU2A 1T9AA 5BQOA 3T0IA 2RIPA 3MELA 4O2LA 4LDPA 3UWDA 1AQNA 2K6GA 3U1BA 1TVCA 1KVQA 1QHGA 4B6PA 2NZVG 3V2GA 2C8VA 3OM0A 3UJCA 5CTAA 2JJ2A 1GUYA 1JHXA 3LXUX 5IF9A 4AJ1A 1AA9A 4IH9A 1FP7A 4LXYA 2YCLA 4YO8A 1W85A 3LW8A 4QFDA 3T1VA 4R5HA 4ZOLF 1SAYA 1QC5A 1ABBA 1HH4A 4HWRA 4OQPA 1G9XA 4E5DA 1UPCA 5KYUB 1THMA 2G5TA 3VR6D 4Z51A 4E51A 2B2NA 2FX5A 5AI5A 3OD5A 1H2AS 1R0ZA 2VDJA 4D5EA 3CGWA 3EGVA 4I2NA 3ZDZB 2I4NA 1AVTA 1J0AA 5IKMA 1KC1A 4JV5B 3OY7A 1SWVA 2VNSA 4PHFA 4QEKA 3F6EX 2A1UB 4A2CA 2NPIA 1L1FA 4GGPA 3F8WA 3P9IA 1MJFA 3NHBA 1KR2A 3IMKA 5DRYA 3TEMA 1AU9A 1FTWA 4CT5A 2PXCA 4GE0A 4IZHA 3T5TA 3ZDEA 3QVSA 1UL1X 2XB9A 4BMCA 3VR5A 4C5AA 3SDZA 1WOMA 4DLVA 5MF6A 2N1BA 4KHZA 1UC9A 4B6FA 3PNVA 1NY6A 1I7PA 1UXGA 3ZNQA 1POWA 1TVMA 3KLBA 3PVSA 3R0XA 5D5QA 3BCRA 2FQWA 3AEKB 3UUGA 1QQTA 4OXNA 5DTMA 5BUSA 1A5AB 4R2HA 3U7GA 3RGWS 3SBDA 1Z3IX 1U02A 2AMLA 2C2BA 2DBYA 3OE4A 3O95A 4K3VA 3W4IA 4HEA1 2R6GA 3RTBA 1HM5A 3LD9A 2ZT6A 3KJZA 4EKYA 2YIJA 4Z8YA 5C80A 5JCJD 3U7QB 4EPWA 1QHFA 5CXUA 1M5RA 4P98A 4ZGGA 4FEAA 3UHJA 3GVCA 3ICQB 1V8ZA 1P4JA 3GLQA 1U9CA 5PNTA 3DVAA 2COUA 4KYIB 4UFNA 3SQDA 1E2JA 1WUJS 3DWFA 4BATA 1HFEL 1ORVA 3RLIA 4EECA 3ND9A 3ANNA 2DQZA 3GD5A 3KJHA 4MI1A 4Q18A 5LKRA 5HF8A 3MB8A 1P9LA 3A14A 1HBJA 1R16A 1Y7LA 4FE7A 4Y6QA 1HRDA 3KQSA 1B0UA 3K09C 3LYLA 4GXNA 1OCEA 4MMYB 4OH1A 4WX2B 2WT9A 1AMNA 4ND8A 1BMDA 1J8YF 2DFDA 3K16A 3WYGA 5CR9A 5LWHA 1NF8A 2HGZA 2MR5A 1UWVA 4MQMA 3W4KA 1M10A 5FBQB 4K9RA 1GTL1 1D03A 3RBXA 5JBQA 2HXYA 5HE8A 2YDYA 1V1MA 2H08A 1W4CA 3KKNA 5JQGA 3ONWA 5KSPA 3WDKA 3AB3A 3I5MA 3RVLA 2KI5A 3VR4H 2C4MA 2HH9A 4ZI3A 3KOYA 1Y3CE 2CZCA 1Q3KA 1FFXB 2DOKA 3INRA 1DEAA 2MSLA 3QFSA 1VLJA 2GH1A 2JD0A 4NS4A 1RYEA 3L6EA 3NM6B 3IA7A 3WDSA 4XH9B 2YW9A 4NATA 1F6DA 1USKA 2QRUA 4DCGA 3F49S 4QAJA 1K5HA 3CISA 3G1TA 2KMLA 5G0SA 5A7HA 2B92A 4MQBA 1KH1A 2I3DA 3B82A 4CVNA 1XCLA 1Y81A 3V4PB 4ZI7F 4TS3A 5AJUA 4LF9B 1NBWB 1QHEA 3BQ9A 5KTSA 1T5IA 1E9RA 2VAVA 4TMZA 2WK1A 3V48A 4WCFA 4LNUA 4JEMA 3WFJA 5EQFA 4XQEA 3KFVA 5A0VA 1USGA 2LR0A 2WOOA 2IPXA 4KZKA 1IDN1 4KRYA 1B0ZA 1L5YA 1GPNA 1WXGA 3DTVB 4PX5A 4ZOBA 2O0HA 1SUPA 3PFBA 3S29A 4OXXA 4E4RA 1U0OC 2Z2JA 2DUUA 1QVRA 4LHZA 2VYVD 2GPTA 4YDHB 3OQIA 3E9DA 2VRNA 4Q24A 1JQJC 3HDYA 4FWIB 3AI3A 1QH8A 2NG1A 1V8PA 5L6LB 4P5EA 3TRJA 4ENRA 2Y1EA 2OCAA 4IIFA 4RTSA 5EYPB 4F46A 1LEHA 3E9YA 3Q8WA 3L1VA 4PXYA 4QOGA 4YCBA 4BNYA 1GG8A 3DPIA 4ZQGA 4JT4A 2B98A 2DKNA 3ROKA 2CXRA 3IILA 3RU3A 3GLSA 5H83A 3PEVA 1D7AA 2VHYA 1DKPA 1UUFA 2FMFA 1P80A 1YQDA 2I4IA 2PLNA 4MVJM 3WYCA 3EFOA 4BVHA 5KQLA 4IDPA 4N0QA 1NHGA 2BKAA 4TV9B 1KFJB 4YUXA 3C6QA 2PT7A 5I7RA 2RB4A 1Z74A 5DHAA 2H4WA 1MR3F 3TSOA 4C7JA 5IXYA 1AK1A 1AKQA 3ANMA 2DFPA 1B93A 3T7JA 5JATA 1MFZA 3ZGLA 1QRAA 1RWPA 3EUFA 4JQSA 2FGJA 2TYSB 4BMNA 2LRHA 1DXHA 4XWGA 3NBAA 3OWXA 4D42A 5KB3A 3LIIA 2N42A 1SXJD 1BS1A 1F4LA 2PUVA 3C15C 2W8ZA 1HKUA 8OHMA 3AU9A 2WT4A 2WFLB 3N2LA 4XAQA 1AGXA 3CNNA 3V2UA 3KQNA 4PEVA 3DZ8A 4LKOA 3TRFA 2GZMA 3CWCA 4HEQA 1BS2A 1I13A 1PUIA 1N1GA 1SUDA 2JGJA 5D3QA 1V16B 3FSJX 2AC7A 2PA0A 1U5BB 4P33A 3TPCA 4NL4H 4CFYA 4GMFA 2FSUA 5DWVA 4EWLA 1QCZA 3ZJ4A 2EJVA 3P2OA 5DNAA 2HIMA 3EIUA 3L79A 3B3FA 2CUNA 3B5JA 4FGKA 1RPAA 3BL5A 3I9JA 4JENA 4TLDA 3FIJA 3OIUA 4WPGA 4EP1A 1JFSA 3G13A 4NZ9A 1N75A 2ZYAA 3ZE6A 1FVFA 2ZBFA 1F8YA 1MQ9A 3DEAA 4EJ0A 5BNWA 3K0SA 3TIXB 4E4TA 1SCUA 3MD0A 5JXHA 1ICEA 1MX5A 1NLYA 4KMRA 5H3HA 3FDZB 1GU1A 5TS3A 1YS2X 1KIMA 3C6ZA 2LWIA 2HPVA 2TMKA 4FEEA 2QPTA 3CWZA 3OQOA 3KKKA 3RT9A 3G0BA 1KO8A 1E9EA 1KRWA 5GM1A 3ORQA 4GPIB 2DB3A 3EZ6A 3PNKA 1OZGA 1D2MA 3BFPA 3HK2A 2EZTA 2XXAA 1RNLA 3OZUA 1DLJA 3K9WA 5BPFA 3BSSA 4DMUB 2A5LA 1W49A 1S01A 1UFVA 3PT5A 2YWHA 3RIEA 4IJWA 5E7QA 1U1DA 1XQ1A 1VIAA 5B1DA 1W0KA 4IJUA 1V7PC 2FW8A 1N2JA 4RK7A 4YAUA 4O5AA 4K0RA 3UPTA 1EP1B 2AN3A 2B8EA 1TQ2A 2C5BA 2X4DA 3PA6A 1G0OA 3ON5A 3CX8A 3ROGA 3QEMB 4MVJP 1QFMA 4YQYA 4CDRA 5M5BA 3OKFA 5FPSA 1I0IA 1Q1NA 1Y42X 2RH9B 1D0VA 4N3NA 3FM9A 3MN1A 4UHDA 2IPOA 1F2UB 3CF4A 2FN3A 3K1JA 3MERA 1V6SA 2VHUA 4DOMA 3T5PA 2HLDA 2QIPA 4QDZA 2HCTA 4PAGA 1E2KA 5BYBA 1T2EA 1UT6A 4LYAA 4V0MA 5KOJB 3IBSA 3OE7D 3M6AA 5HDQA 5JJ5A 4XD2A 5CVDA 3IQGX 4RDIA 5AJWA 4F6LA 5IVPA 3U81A 4NWIA 5CG1A 2VWQA 2O14A 4DV1B 5HKLA 1DPFA 1R0YA 2BRUA 1UZUA 2RI1A 3HBMA 1OLXB 1PL6A 3IR6A 4ZK2A 4IEFB 3MTDA 4UAJA 3FVVA 1OH8A 3MWEB 1AKEA 4FFBB 4HN4B 2IEDA 4MA5A 3JZMA 3RRXA 4YRGA 4QGBA 1NU6A 1SC9A 1YDWA 3RT7A 3KT0A 1CV2A 3IOCA 3PQ5A 2PGNA 4EB6B 5C8YA 5AM0A 5BWNA 2QN7A 1VZ2A 4BZXA 2BFDB 4HDSA 1QE3A 2CWWA 4MW2A 5FJJA 4EHJA 2ZG6A 2IVFA 2Q4TA 3PLAE 4KO4S 5A3RA 4N3BA 5EHGA 2C00A 2X0KA 2PX2A 2O8FA 4DARA 3EXIA 3WWZA 1R8SA 3EW9A 1C3OB 4C0QC 3ZZUA 2HPAA 2JGAA 2Y9PB 1ZOLA 5J23A 1L0BA 2D59A 5EE9A 4AD8A 1J49A 4A4DA 5E1OA 4B81A 1KY5A 3MWJA 4ZYLA 3KT3A 1U6KA 2J5QA 1RWXA 1CD5A 1ZIOA 1E2UA 3MA0A 4JAVC 1NIJA 5THKA 2DFLA 1HDEA 3TS1A 4MB2A 1TEZA 4N5IX 2XUZA 3EUWA 1F0YA 4FE3A 1T29A 2I7DA 3OT1A 1V9CA 4QU8A 1E9SA 2OA0A 1IY9A 3TBKA 4BLRA 1E62A 2ES4A 3PKIA 4HGOA 3WLJA 1FUUA 3OG9A 1W4LA 3T9EA 5CBPA 1BDIA 1E3MA 1U1GA 3HFJA 3HKDA 4MROA 3WK7A 4D44A 4LK3A 2VT3A 4NEQA 3GJTA 2TMYA 1EVJA 1TF5A 5KAMA 1Q84A 3FUUA 1QR6A 4HDOB 1OJ7A 1BOFA 5TNXA 2NU9A 3SR3A 3ITDA 4CTOA 4B47A 3HH8A 3SXPA 3W9UA 1O6GA 2E85A 1E2PA 2X1VA 1OFUA 1L5SA 2C7VA 1Y6RA 4IJKA 3BE5A 3ZYZA 1CUIA 3W0LB 2IYVA 3AYXB 3FPAA 3GJ6A 3KKMA 4HQRA 2V96A 3ONDA 1JKIA 3Q10A 1GQOA 2JFFA 3JQ8A 4LMPA 3E03A 5EZYA 3WNVA 5L6MB 2QJFA 2ZP1A 1WKCA 3C7AA 5B5SA 1TIKA 2CK3A 3C39A 4N54A 3VO1A 1E7MA 1N1DA 3AOEA 5DWDA 1OYVA 3SYLA 1KFBB 3HJCA 3GJYA 2RK3A 2VNIA 2DTXA 1LDYA 1CJUC 1EZZA 1KQPA 4J94A 2QYOA 3EGDB 3H8SA 3SEAA 4LVNA 1XVIA 2HU8A 1HURA 1F20A 2ATCA 1GNQA 4LRQA 3MS4A 4CKCB 3T0FA 3FDFA 4FFOA 4RYDA 2H1LA 3M4JA 4FQ5A 1XKTA 5D7NA 1TK3A 3LP6A 3VOTA 3WK6A 5K0GA 1QNLA 5M34A 2HDNB 4BNWA 5H9WA 3TTWA 1NTOA 3OTWA 4IF4A 2PZAA 3VRHA 1PEDA 3IOYA 1ZESA 4WKOA 1PJCA 3K0AA 4RSGA 3AM5A 3NHJA 2JGMA 3TOXA 4BYMA 5F23A 4QPDA 1VI6A 4NHOA 4Q3AA 4ZAVA 1SY7A 2VUUA 3QUTA 1DAIA 3MGCA 3HBAA 3OQJA 4LGCA 4KR0A 4NF2A 4ZC8A 3RFCA 2C94A 4RHCA 2R6R1 3RF6A 3WBBA 1LC3A 2YWEA 2QTWB 3B52X 4XQ0A 5U1PA 2NUAB 3NIWA 1QP8A 4X64B 1IL0A 3IQFA 2Q8NA 5JIBA 2HJRA 4DW8A 1WM1A 4RFLA 4IGIA 3RS2A 4IIGA 8ADHA 5JTTA 4FI3C 1N6HA 3HUEA 3NOOA 1RLTA 2XCLA 3EW7A 5DCLA 3ZDCA 1R0CA 4DANA 3OJ0A 1N7IA 5EHQA 3RH0A 3Q2KA 1NVDA 5BSRA 2R8XA 3CBQA 2WKWA 2BM9A 1HE3A 1JDPA 1Z34A 4X93A 1KZ1A 4YYZA 2JIZD 4IZIA 3DWGA 4AS1A 3NHAA 4V3CA 4FEGA 3SS8A 3N7UA 1RAHA 2JCYA 4G0QA 4JIMA 4NG5A 3HJTA 4B74A 4K05A 2XQJA 3A04A 1XMJA 5T4EA 3GARA 1NT2A 3WGLA 3NB0A 4L50A 5IAAA 1WDLA 3TQFA 3LYAA 3V7WA 1I7DA 4PX3A 3OHMA 3PG5A 4A9AA 4DCOA 3P4YA 3OPMA 1HZJA 3NBMA 1OTXA 5EESA 2NQ2C 2GAAA 4IHQA 2LIPA 1X1QA 4DSZA 3WIUA 1QKIA 4IDEA 3NNDA 3CKMA 4EG0A 3N2GA 3F6BX 3QVJA 1YXMA 4GF5A 5D1HA 1QCDA 4YCJA 3D5EA 4JJIA 4KMOA 1R15A 3VZSA 1Z7EA 3GRCA 2WJGA 3A1CA 2HUNA 1ECGA 4QU0A 2A5DA 2C3PA 2J7PA 4MKIA 3GJ0A 3NWJA 1ZR4A 1QP4A 1L7NA 2X5OA 1MV8A 1H2YA 1H94A 4R1TA 5AK5A 1OYOA 3ILVA 5DBHX 3R74A 4DLZA 2ZWOA 4MUGA 3SM9A 5DMHA 1OXKB 3UUEA 5FI3A 3QVWA 1DSSG 1U1FA 2FSGA 2JGLA 3DR3A 5DP2A 4EY8A 4RVDA 3DLHA 7MHTA 1DLIA 4CDMA 1MO5A 2AG1A 1XF1A 2AYYA 3CX4A 3WRYC 1JEQB 1Z8HA 3KKEA 1IXZA 3BTOA 4NAUA 4QJIA 4UZFA 2NUTA 1JIIA 3IUQA 3PK0A 1X1TA 4W82A 4UZSA 5FUBA 5SV2A 4C3ZA 1EHYA 1C3JA 1XKXA 3HSYA 3QLUA 1GL7A 2ODNA 2QB5A 2YJGA 2YW2A 5E3HA 4H15A 3U7RA 2HB6A 1T36A 1VSQA 4C05A 3U9LA 3BJEA 2N3ZA 4Y9DA 1X86B 3CWQA 3OP4A 1A04A 1T4GA 4HRAA 3U39A 1HQKA 1JU9A 4RTLA 3VAYA 2OD9A 1NF2A 4BFCA 1FFGA 5HKAA 3WYAA 4YV2A 3U48A 5E9WA 1MHPA 1SD1A 1Y63A 3Q98A 2AOUA 4NENB 1DMSA 1KK2A 2CD7A 4RSRA 5F35A 2QRNA 2JK1A 3LQ2A 3C70A 3CR7A 2X41A 1GLNA 2YHBA 2DY0A 1D5CA 3QQPA 1A9XB 2HLPA 3N8GA 1ECPA 5KCMA 5HZGA 1MOZA 1B73A 2RMKA 1MG5A 2JRCA 4IOMA 4KZPA 4F5DA 5CCEA 4OK5A 4RMHA 5B12A 2YWCA 4R16A 4WINA 3D0OA 4DWVA 1QO9A 1PVVA 1X38A 4C87A 3NKVA 4HGYA 2HT1A 1GR0A 1YGYA 4DQXA 2HA3A 2IH2A 2QMYA 1N7GA 1JFFB 2NSDA 1D9XA 1SNYA 2JI4A 1FSFA 4JCCA 1QIGA 1SZPA 1XNHA 2OAEA 4LDNA 4RV4A 5EKUA 2ZUSA 2UYOA 4UCXA 5F78A 3SX0A 3VV2A 5JVDA 1XMQB 4J3JA 4WY5A 3UB3A 3VZCA 1ZD1A 4A92A 1RHQA 2HKIA 3BXFA 5ELLA 3G49A 1KPIA 3OJLA 3V32A 4YV1A 2O6LA 4LTNA 2D7DA 2NV6A 2J9ZB 5TMBA 4J6EA 2FPPB 4HDKB 2EBHX 2FFBA 3E3OA 1U0TA 4K9SA 1JFLA 3H5NA 5AH0A 3TLCA 5J43A 3CW9A 2BGGA 2GJSA 1UK9A 5FBVB 2IGTA 1PS0A 4J16C 3O73A 4MKRA 5DE3A 3TRIA 3UF0A 3V97A 1ZVVA 1G21E 2J59A 3PWZA 2PR7A 1JLHA 1M66A 1EK2A 3EPHA 5F7JA 2M32A 4UCQA 5FTLA 1Y1SA 4UFPA 3E2MA 1FL9A 3MJHA 4E5UA 3KR0A 1NOJA 3HY3A 1A4UA 9ATCA 2H52A 5BSVA 2ZPAA 3MWGA 1GL6A 3PQ2A 1A4RA 2XMPA 4MV1A 3AIKA 4P53A 4PXSA 3RJTA 3KJFA 5LIRA 2F1HA 1EBFA 2IBTA 3NCTA 4GMXA 4UVHA 1UEIA 2ZTVA 1O8BA 4Y9SA 1P2VA 4NYJR 3GRAA 3ZY5A 5C8DA 4GDMA 1ZD2P 1WJGA 2HFJA 3OF2A 4MUEA 3R5XA 1C0IA 4GGOA 2ZRMA 1HL3A 2VI5A 2ZS7A 4UBNA 1IB6A 1Y7HA 3U6KA 3ZGOA 3VR3A 2N75A 3JWIA 1GDTA 3OJWA 4B6RA 2D7JA 3AFGA 2PH1A 3VDMA 1UKAA 1V96A 4FMDF 2Y76A 3TOVA 3RFXA 5ALVA 5L8VA 3A9VA 1JH8A 5G0UA 4FR0A 3T12A 3TD9A 2IU3A 3MJEA 3LHKA 3GDHA 3EWNA 1Z88A 1PT7A 1UC4B 2AKYA 2VXCA 3HCFA 4E7OA 3ODGA 5BN5B 2IY7A 3MNFA 2WOJA 4RS3A 3THYA 4PYJA 3DXFA 3E23A 3BMXA 4B7CA 3M3PA 1JQKA 1LBSA 1FUKA 1H05A 3D6HA 1I4WA 3GMSA 4WL0A 4HRVA 5IJXA 3WISA 3BXOA 3AUJB 3HDHA 4B3CA 2XUJA 3R3YA 1HYEA 2GT1A 2R6FA 1O96A 4JR2A 4WJKB 1GFZA 2NXEA 3MXOA 4W9NC 5B53A 3SF8B 1R12A 4PZAA 2AR7A 3AHJA 1Q0SA 1Y0BA 1XYVA 1NDHA 4YP5A 2VP9A 3QVLA 5EJ5A 3K2BA 1SHLA 3SJCA 1TD1A 3CTMA 2PBFA 2HQSA 2FMXA 1OJLA 5JNUA 2VYND 4UHHA 1RTTA 1TU4A 2WG2A 2PH7A 3RQIA 3L6UA 3T4UA 3DKRA 3HB5X 5AK0A 3QVKA 4JUIA 3GJ4A 5EMKA 4ZALA 1Z2CA 3NCHA 4HPJB 2QXTA 1YMUA 5FEUA 2WLSA 1GV1A 3F6YA 4PZUA 1N3LA 4MVJF 5ALYA 1L7QA 2V7BA 4PSVA 2VPWA 4Q4JA 2C9DA 2CLCX 1ZSVA 3NEJA 5AKGA 3GCZA 1F6BA 3GRFA 1J2JA 4I6JA 5CDSA 3LY7A 1ZSYA 3BX1A 1VG0B 1HMPA 1MO4A 4NNOA 2DQYA 3BHJA 4BJ1A 1X2EA 3VR6A 3O0TA 5LUBA 1J2TA 2X3UA 4ZCTA 2MIIA 2ZJ0A 1ZAKA 4JNCA 1U3VA 2HR1A 4MAFA 1YD7A 1TUGA 1CY6A 1YI0A 2F2TA 2ZSHA 1KIFA 4M76B 1J07A 1I3OA 2XRMA 3HCWA 1W46A 4TWIA 3T4EA 4L5JA 5BV7A 1MD9A 3GLFA 3KQKA 2OZLB 1U0FA 1LDEA 3KRTA 4IV8A 3UFBA 2R47A 1A4XA 1Z37A 1XTIA 1VYUA 2B4RO 2VEOA 1RKUA 2QXYA 4ACAA 3O7WA 3PEYA 4TYYA 4UUBA 4RENA 4K26A 1UFKA 2A30A 1LC0A 2A92A 2OXEA 3AX6A 4YASA 4BJHB 3DAYA 1Z07A 1HDYA 1Y8RB 1ZH4A 4WESA 1YMVA 4M99A 3M1YA 4W1SA 5I9TA 3ZD7A 2GRAA 2XWBF 1Q15A 3M6LA 3OF3A 1SUAA 2GZRA 4FC7A 2R5WA 2YHAA 3AI7A 3AJRA 3EQ2A 3K05A 1XRPA 2FPRA 2ZRKA 4PPQA 1KMCA 1BG6A 5DW0A 2CVPA 4NAHA 2OD7A 5E3IA 3TLJA 2BDUA 1JBQA 2QTGA 2FFHA 2EWWA 5JWHA 4E31A 4NBWA 1TEHA 3ZIUA 3JD0A 4BASA 3N2KA 5EJ4A 2ZAYA 2VZLA 4Q7LA 3TG2A 4D8YA 1KVSA 3OUTA 1SBZA 3G7UA 4L4SA 4OYRA 4WT7A 4X1YB 4ZQBA 1YDFA 3ACCA 1I6LA 1U8YA 1FW8A 1L7VC 2P9GA 2Z5VA 3D7MA 4LBVA 2GZ3A 4OI0A 4OG2A 2HN9A 4X66B 2WTUA 3VA7A 3KSDO 1ZVMA 3H17A 1XAHA 4PAOA 1JEOA 3Q7IA 4XX1A 4LWPA 4FFNA 4OAPA 2QBYB 3EVGA 4D9BA 5GONB 3PHIA 4KBGA 4LPSA 2QI9F 2PXAA 4DR1B 1IK4A 3IQWA 2DKFA 1NWHA 3ITNA 4LE0A 3WGVA 5IT4A 3AVYA 2WJIA 4A6XA 3KZVA 2NZ2A 2WQ6A 1QGZA 2MSCB 4P4TA 5DYIA 3B1WA 1G3UA 1ONOA 1I2BA 1WEKA 1GNPA 3QHAA 4LE2A 4PPYA 3RV4A 1XZCA 1E0DA 4IXMA 3VR1A 1S4QA 3B1FA 4WFJA 3O82A 3EIHA 3VTAA 4DR5B 4QXRA 1UXHA 1NVWQ 1ADJA 1XC7A 3HVIA 4GMGA 1H4QA 4FGZA 4HDRB 3HL4A 4C2UA 1JQAA 2NXNA 4MHOA 3VKVA 2F67A 3ETJA 4CCSA 2EBWA 4L3WA 1M2VA 2IEIA 2ZYVX 1E2GA 4FLFA 4GU5A 3SIRA 5KPJA 4DV7B 1J2YA 2AHRA 5M29A 1J97A 1GQYA 4PZEA 1RJDA 3TXAA 5D3MA 3IHKA 1QH9A 2QTTA 5G41A 4L9RA 4DSAA 3F6CA 4ZAXA 2H2AA 4YRMA 2HQBA 3QOFA 1NI4B 2ENUA 4DIFA 5A7FA 4FWTA 2EJTA 4N6OA 1KORA 1Z7WA 1M33A 2DT8A 4IQGA 1NGSA 4UCFA 3M6IA 2GF9A 5EE1A 3DE3X 4AUEA 4D1YA 3R44A 4D4KA 4DY6A 5E4JA 2B4AA 2CL0X 4I9FA 1IEXA 2J31A 5I9NA 3KD3A 3NH6A 1C9KA 4BBJA 2VYVA 4ZQIA 3U4HA 3HUTA 2C7BA 1Y5IA 4C4RA 1V5IA 3WXMA 1PV2A 3WWCA 3W2GA 4E15A 1KEEA 1V5WA 1IEQA 5E6UB 3QVUA 4M98A 3EG5A 4J0EA 4KUEA 2NW6A 2YWJA 2HZ7A 5FNVA 5KC9A 3H4VA 4HQOA 1JEYB 4UUAA 2YWDA 1TJPB 4I14A 1FC0A 1AB5A 1LFAA 3M5WA 5T8KA 1P7VA 1IXSB 1QBKC 4IUDS 2W90A 3W2EA 4JSRA 1U2DC 2OK8A 4TS4A 5TVGA 3EIFA 5H3LA 5EIHA 2IPMA 3ZDYB 5BN4B 2ZCVA 2O7SA 4DBZA 5KTPA 2UUAB 2OG2A 5FBWB 5U4XA 4C6TA 2K4MA 3CPEA 3KAQA 4WEQA 5E4YA 1QE5A 1F0PA 2IIVA 2VLBA 3FNGA 3DYBA 5JYEA 4IPTA 3IVGA 1RQ7A 2AEMA 4BX3A 2OG1A 3KL2A 2O3SA 1DEXA 4DMHA 1IRIA 5AW1A 1G41A 4EUNA 4F6CA 1SXJA 1DO8A 2OBMA 3O8QB 1CETA 1MGOA 5EWLA 1WB6A 5AJXA 3S1AB 2UYHA 1ML3A 2G9RA 2QG9A 4YCMA 5I4KA 2YH2A 4GPEA 1LA2A 1VMAA 4QX6A 3B3JA 4N0DA 3TOCA 3ZCQA 4WLNA 3M6VA 5BN3B 1C4KA 2PQ6A 4OSOA 1AHHA 3I30X 1NR5A 2GILA 3LY8A 1GXSA 2RH5A 3OKCA 4MW6A 4B17A 1CUHA 2ILVA 1P8AA 3GIWA 2J9XB 1IULA 1NSYA 3BL6A 1GARA 2XBLA 1BE6A 4QNRA 5IJ0B 3HMKA 4OLAA 3LC0A 2ZJAA 1TQ6A 4H0CA 3QF4B 1YRHA 1MHTA 3X3HA 4X95A 2ZWVA 1BH6A 1M1NA 3F5MA 3TNFA 1GCGA 4KIFA 4EI2A 4M8KA 3W7AA 2CEAA 4NR0A 3CXUA 4OIFA 4BWVA 4CQLA 2FR8A 4TVOA 3TSYA 2P9QA 2DPMA 4QUEA 3VAAA 2PKCA 2J0VA 3GEIA 4DJ5X 2GO1A 3ORFA 2I55A 4DFDA 1R88A 4ZRNA 1QK3A 1A7JA 1LSJA 1DIOB 1TIPA 1VIMA 3MINB 4MINA 5F2OA 4IOLA 1J90A 1QGDA 1T1GA 3TKAA 4C7XA 3IIJA 1FNSA 4X20A 1E4EA 3GN1A 3MGGA 4GPAA 2NSJA 4DMRA 3IR5A 2WUFA 3PBKA 3JAMA 1QX4A 2QZZA 2BF7A 1NX6A 2SCUB 2HDOA 2OCKA 4RNDB 1MXHA 1WUTA 4YBRA 4C0HA 4XLZA 1QX3A 5ADUS 3C41J 3DE2X 5MN6A 1ZDMA 4BX8A 5JSQA 3W3ZB 1IBKB 1NF9A 1A9TA 3M82A 3H99A 4M36A 5C8YF 1RR6A 2OQIA 5EZQA 1SKYB 4RUKA 2PS3A 3FHOA 1RXVA 1KETA 3AF2A 2XZLA 2LKCA 3AUXA 3U7FB 2FQ1A 3EPRA 4DIMA 2O05A 1BROA 2ZRPA 3CUVA 3NVMB 4TUYB 3QEJA 1OXVA 1PNOA 3GNQA 1KE2A 1NBOA 1JUDA 2GM5A 3ITKA 3OZEA 3TZLA 1SCAA 1EP9A 2WUWE 2I1WA 1Q6ZA 1EZ1A 3M9XA 3OE7A 4D6PA 1G2PA 3UGJA 1ZRNA 2G09A 2NZ8A 3ISJA 2VCEA 4IMPA 4EHKA 1JG6A 2PUWA 4HBGA 4OHPA 5CA0B 4NYJQ 1FE8A 4AYXA 3Q5GA 2VUIB 3FH0A 5CD9A 3QNMA 3IP8A 1I0ZA 2Z08A 5TMDA 1UJ2A 3BXXA 4I9NA 1LSSA 2VA8A 1DQYA 4AWAA 4ALNA 2ID9A 2C07A 3BGVA 4B32A 1W7AA 4H4CA 2AKAB 1M83A 4FHZA 4XGKA 3K9LA 1CRWG 2W2OA 4PZPA 1K8YB 5E2BA 1MO2A 1M1YB 3A0UA 3UICA 2XGOA 3W6ZA 4DZZA 5A3QA 4AKIA 4OHKA 4LBZA 3UATA 2VG8A 1L7BA 1NVFA 1XPUA 4QM6A 1A2QA 5MFZA 1GIAA 1M67A 5CYOA 3I6BA 1C1DA 4OOEA 1ESMA 3T7IA 4IV0A 4NJMB 2W2VA 4QVIA 4OUDA 2XDQB 4B44A 4E2FA 3JAWA 4NULA 3KVNA 5KAPA 3D6AA 1KO4A 1E6WA 1VLMA 1ACLA 4FFMA 5JNSA 4ZXFA 4YT2A 2P5UA 4Q3KA 1XDDA 1ZRHA 2JFNA 3FSGD 3H2ZA 3CJTA 3F4KA 4WZAB 3AR5A 3G0DA 2IS2A 4UATA 2FN4A 3CF4G 3S2FA 1BDBA 4HZGA 1SKMA 4EG1A 2GJ8A 3N39C 1SXHA 2QSJA 1KPGA 3LPNA 3WB1A 3H4IA 3M6MD 3NRCA 5I7SA 4NV3A 2LKDA 4MCIA 1J2RA 1XRSB 4MR8A 3BKXA 4EO9A 4YQFA 5LBTA 1CR4A 2O23A 2O5VA 4H0FA 4FPXA 3TX6A 3P71T 5IP5A 1V1RB 5IAOA 4F93B 4FTWA 4PO1A 2OYSA 4BFWA 3AEXA 1MJ5A 3BXZA 4M8LA 1N6IA 3BIXA 3A05A 1BRTA 4GOKA 3OSUA 3CPJB 2EAUA 1YT5A 5K4HA 3H5IA 2PT9A 4I4TA 5HZKA 3IV6A 5BNIA 3E18A 5EJ6A 5I9BA 4KPFC 5ARDA 1GZSA 1I2MA 3I04A 3DAHA 4LG1A 5HQTA 3K6SB 2GRJA 2WJ4A 4X45A 3PQ7A 4EY6A 1SCJA 2PRZA 2JGKA 4O4LA 4PZDA 4URXR 1ZICA 5IS2A 3P2IA 1W5FA 1X70A 1TKCA 2C5SA 1ZPDA 5B37A 1IWPB 3JD2A 3W5IA 1YIAA 5JNTA 2CHEA 4EITA 5LR6A 4DLXA 3CT4A 4O2BF 4MS4B 3E1SA 3ZXIA 5J59A 3N0TA 2FSPA 4AJIA 5HJEA 1WKVA 5LP6B 2VSXA 4YMVA 3HYTA 3K5WA 3WZ2A 1VJRA 4EA9A 4YV7A 4MB0A 3BM5A 4ZEVA 4FFVA 5BWCA 1OXXK 2FOLA 1QJCA 2EP8A 3QKRA 4H1HA 4IRUB 3WWPA 5ABPA 3CH6A 5DNUA 3EGXB 2EQBA 4X90A 4N65A 4ZAZA 2X22A 4JZYA 3D1LA 5A1TA 1TC1A 5K0JA 1G4UR 1W1WA 2HMWA 3ZXSA 5DISB 5KSOA 2CCJA 1N78A 2H5JA 2GJAA 3JQ9C 3HDVA 4B6QA 2OK7A 2YBDA 4KXVA 3FYCA 1JNXX 5EWJB 5FFMA 3EXHA 1GLVA 2P0EA 1Q17A 3PI6A 3LO5A 5HMMA 1XU9A 4Y2QA 4AZ3B 2P2NA 4M1OA 1UK7A 4YT5A 3ZHCA 3FWKA 3FUXA 5NULA 4ZDJA 4G67A 4PNHA 1EB9A 2BEUB 3DOIA 2PUAA 1ETHA 1WCWA 2P2ZA 4BU1A 3TQTA 4TV8B 3EA5A 2FPGB 3BXEA 2JIZA 3QUAA 1WXXA 3FB1A 1RADA 1XDZA 1A76A 1H6AA 1YK1A 2B25A 2IGBA 3IVXA 4DMLA 5BV1A 4S04A 4N8EA 4DQVA 3FPGA 5KWVA 4KLZA 1UK8A 3N0XA 4ZT6A 5TDHA 5HX7A 5A71A 4G5XA 2A3NA 1BQ3A 1G6OA 5EMJA 1Y9JA 1DPGA 4JHXA 3WLOA 4B4OA 4OQMA 3RU9A 3QPVA 4AX4A 4CLXA 1D8AA 2O6HA 2AC4A 1P5ZB 3R7NA 4KPGA 3IX7A 4JSTA 4QKQA 4PSCA 4PCLA 4RADA 2Y1LA 3KKOA 1YJ5A 3UNXA 7REQA 3TSCA 1N9KA 3PHJA 4IMIB 4IVQA 4BWYA 3I5UA 4UVIA 3VHXA 1CQZA 2HSJA 3D31A 4EGAA 4MDEA 4GZMA 4NOKA 3M33A 4DR6B 2KBFA 3LHDA 2QG4A 1IXYA 2P9CA 2V74B 3SEQA 2R7LA 3L43A 3EBPA 1V11B 3LOQA 5CPBA 4G0NA 4ZTBA 1SOVA 2O4UX 3WLQA 4ZTUB 4IZ6A 2AEJA 1U94A 4NDZA 4NQZA 5DEOA 3FAKA 1ONNA 3V2IA 5AVWA 3C4QA 3HJAA 4S1NA 2OKCA 1UZMA 5BOSB 5CD1A 3F2VA 3ESQA 5F1KA 2WHQA 4B31A 5HHTA 3HTXA 1SFRA 5A9SA 5LD2B 2A5JA 5IHXA 4JI1B 2Q6OA 4TXHA 1M76A 3GT4A 4FDUA 3ZY6A 4JBLA 4U5QA 4KPEC 1J0DA 1JKFA 3KUUA 3OO1A 4RPIA 4MA0A 4YRTA 5ALLA 3FUWA 3M4NA 3AUKA 4D80A 4JT2A 3W3AD 3AUTA 1C8LA 2C77A 5HUHA 3C8UA 3V8PA 3IP9A 3ZZMA 1RMQA 1CVIA 1PEYA 1ZMXA 3GT7A 4RV9A 3UAOA 4YUYA 4UAGA 2F8TA 5LMUB 1SUEA 1O77A 1QNFA 1QUFA 1TKAA 5E7IA 1YJAA 2ZYRA 5CIYA 5KQGA 5L3RA 2JLAA 1EMDA 2CUKA 2G80A 4CGZA 3K5IA 1RE0A 3OHSX 4FGLA 2X13A 3TPZA 3WGUA 5JS1A 4LHEA 4F3YA 1IUNA 1N8TA 4ZJUA 3OPXA 1TT5A 3AB8A 2XKKA 3GFQA 1KARA 2OO5A 1HG0A 3X1YA 4CT4B 5AJYA 3ZJTA 2G04A 3O94A 4GW3A 1NVUQ 2H51A 1ZN7A 4NZPA 4EQ6A 1N5JA 1KDTA 1GGMA 1FZQA 1IN4A 4OMFG 1TECE 1ILWA 3K5HA 3IEVA 1IONA 4LYDA 1WXHA 2IOHA 4JBIA 1P5RA 1L5HA 2BJWA 4AJOA 4V0ME 4PQRA 1HKHA 4P83A 4YMHA 3VH2A 4DE5A 4HUJA 5JSZB 1P0FA 5C37A 3H87A 3WJ1A 1UMDB 1EDZA 1KFEB 3QFRA 1GUAA 1PD0A 3QMVA 2WM2A 3LQKA 4NNJA 2G4VA 1PZXA 4KR2A 5DCWA 5I8WA 3ZC3A 4ZHQF 4B73A 1FSSA 4KFSA 1JHVA 1UIMA 4H1WA 3ELBA 2GAFA 4OBBA 5K01A 5SYAA 1HORA 1NXPA 4X6LA 4R0VA 3ZBPA 1CY4A 2NXWA 2OZKA 1Q1GA 1DTWB 2Z2IA 3A2LA 3NBFA 3TINA 1TM3E 2VJPA 5D84A 4UPVA 3RARA 1H2WA 1K66A 5C5CA 4KQEA 4B6OA 4GI1A 4KXFB 4TRMA 3TZHA 4MWOA 5LSAA 1JPVA 1H6CA 3B8HA 5FBZA 2JGEA 3VNUA 4WUTA 1E3WA 3IIKA 1MEOA 4CMJA 4RVFA 3I2YX 1FLVA 5KHAA 3MJVA 3HVUA 1WMAA 1TJYA 1Y89A 4KO8A 5HOQA 3QBTA 4FILA 3ER9A 3TLGB 3VTZA 3WRWA 3I73A 3JQBA 5JJLA 1Y1TA 1NW4A 2DQKA 1CBUA 4M2LA 2MSNA 1PX2A 3RF7A 1Q5PA 3W1WA 3EEQA 2OBXA 2CJWA 1YZHA 4RJLA 1SVWA 3FUTA 4GH5A 3U2QA 4CUKA 2QRMA 1GUFA 1YUMA 2PWAA 3WBJA 2O8CA 5DMXA 5DNCA 5KKNB 5HWSA 4IDGA 5T4FA 2R7MA 3RSQA 5GOTA 3H84A 2BGRA 4A0FA 4XW2A 4L72A 5F64A 5FBRB 3G6WA 3G8DA 3P32A 4LUCA 3RR2A 4AKGA 1HYQA 4EG7A 4MR9B 1W25A 1VE9A 1Z82A 5IASA 2IW1A 4J29A 5E4FA 3EF1A 4AXBA 2PUEA 4UBLA 2IIBA 3DVLA 3NYRA 3DXYA 1KZ4A 2CC2A 2XT0A 3D64A 4P36A 4YH1A 3WFIA 3F9RA 3O1IC 1XCJA 4BBZA 2R96A 1HL7A 1QTNA 1U7WA 1KO1A 1K3TA 3DEFA 3K0FA 4J7CA 1ZITA 2BV3A 1X14A 1AKUA 3OIDA 1F8UA 2Q5EA 1Y3BE 1J09A 1R0XA 2AOVA 2DY1A 2V7XA 1HI9A 4QPPA 5HQ3A 2QT0A 4YRSA 1KI3A 3AFNA 4PGHA 5C35A 4U63A 2FW7A 1G8JA 2AB0A 2G63A 1WBJB 2IWHA 1JYEA 2ZVJA 2P4EA 3FRJA 4DDMA 1Y6GA 1NN1A 4YI3A 1JLRA 1ZKDA 2XVXA 1LZKA 4RIEA 2Y8EA 3MSCA 5I47A 3H65A 1DV1A 3W7BA 1RQRA 3U4DA 3UWSA 1L8QA 2B34A 2DFKB 1K06A 3DPUA 2AUMA 3GW8A 3M7IA 1PS9A 3HBFA 4BC0A 5JNVA 2VYNA 3JS5A 2CMDA 4M7OA 1V45E 2XH8A 1KZYC 1MB3A 3EH1A 4XX0A 3MD9A 2FA9A 3R7WB 3W05A 2J08A 5A05A 4MEJA 1VE3A 1KI6B 2WUVA 3AT1A 3I05A 3M5DA 2LCIA 4U8GA 2PWPA 3E1GA 3AV0B 1SHZA 4BN0A 2Q07A 4CR6A 1E20A 4D98A 5JD5A 3SS7X 3A9SA 5CJPA 3VTFA 3QY0A 2V7TA 3EVEA 4B35A 3I5YA 4HXGA 3W34A 2FXVA 2E87A 2H0RA 6ADHA 1I3NA 1TYDE 5CFOA 1VGVA 1XHEA 1FS5A 2JARA 3QUCA 4YJ2B 4Y7DA 5IARA 1A97A 1QS0B 1VSUA 1BXKA 3FCYA 4LSGA 4MYCA 5K1ZA 4GRDA 4QBKA 2BFMA 2NXJA 1OYYA 1YR1A 5COBA 2FWMX 4AFNA 1ATZA 4BMSA 5CH3A 2ZJFA 3IUSA 4NU8X 4ENQA 3OQNA 4LOJA 3ZCUA 1ZNQO 1X7ZB 2VQDA 2RARA 4TLCA 3W77A 4AVYA 2YQ5A 4PQFA 3L0ZA 2OXRA 4WK0B 3HY6A 3NAQA 1AGYA 4IKEA 4FB5A 4P7FA 3SVTA 2OHGA 3LWBA 4H6XA 3GFVA 5HJ7A 1L7RA 3A6GA 4JEIA 5EAIA 4RMJA 5EHZA 3AEUB 1YA6A 2Z6VA 1BX1A 3MQ2A 2JEZA 4XWKA 4XASA 3KAPA 4TT8A 1VLZA 2Z2ZA 3DWIA 3T7SA 5BSHA 4JBHA 1CWUA 2QZ9A 3REQA 2I78A 4O0MA 4QU9A 5BR4A 4C4YA 4QELA 3QPBA 4O3MA 1NDQA 2PZLA 2G4LA 2PU5A 2EJBA 3MWFA 4TLMB 4R54A 1OBOA 1SO8A 3CRMA 3QTLA 4J76A 4PPFA 2NV2B 1MQAA 1L6IA 3BFKA 4UVGA 4MNTA 2QP9X 4L4ZA 1LBTA 1H2HA 1MB2A 1N5RA 2D7CA 3KC2A 4FOPA 3K70C 1FJGB 2PXHA 3VZPA 3FUVA 4Q4CA 5KO2A 1FB5A 4D3FA 1O6FA 1F06A 5KPDA 1G9SA 3Q1KA 4RKRA 3I6IA 4UULA 1NVKA 1GPBA 1JWBB 1T35A 3DL7A 4PQEA 2IXDA 5G02A 5BSTA 4NCAA 3IHLA 2W2MA 3QWAA 2GNAA 2QJOA 4GYKA 1GG2A 4WFKA 2XNJA 2DERA 1ZOOA 4FMPA 4JL6A 3L7OA 5JH7F 3OI7A 1XMIA 2ZE6A 2ZVQX 4YTEA 2B2XA 4DUGD 2BFAA 1HFWA 2D5CA 4HV4A 1TD9A 4CWAA 4HDNA 3HYCA 3EIOA 2NYUA 5DN6A 3DTTA 3KM0A 3PEFA 3PF9A 1IWOA 1QYRA 3BRQA 2OHHA 2RH4A 4QTXA 721PA 2ZM6B 4WCFC 1NLUA 5FNVF 3CNQS 2HCJB 1IUKA 5IH7A 4YACA 2H16A 1J39A 2F17A 4OX9Y 2RHCA 2H1OA 5JNRA 3ZUGA 2WF6A 3LPMA 3SCZA 3L8DA 1I94B 4F8JA 1ZHFA 1ECJA 4GE3A 1CSEE 2EFGA 1UOOA 2HJVA 3CO0S 3OFSA 4MUAA 4B2PA 4DDUA 4ZXPA 2DAPA 4ZDKA 4YJ3B 2BUAA 5FWNA 1N8NA 1UDWA 3JYPA 1XMVA 1U3FA 3OLZA 4LJ7A 4EA7A 2QAGA 1E4OA 1OD6A 2UDPA 3A11A 3M0EA 3RIXA 2YMQA 5HP4A 1S2MA 3E6AA 2RC5A 4JYCA 1EJ0A 1LVGA 5G2OA 3JASB 3N53A 1FXWF 3C8HA 1V37A 4MP6A 2NPOA 3C3JA 1QFXA 4B84A 1IN6A 2BBOA 1T0JB 1JEAA 3BE6A 3T9BA 1EUDA 4W8OA 4UVDA 4W5OA 3M9LA 1RCUA 1W75A 1ZOIA 2WICA 4BFVA 2X8JA 4REQA 4BKUA 4F3KA 1ZNYA 3COPA 2CZQA 1M75A 3EHEA 3GQVA 3HA7A 1C7EA 1QIMA 3R0QA 1CCWA 2AE1A 2NYRA 2PX6A 4ITUA 4RVCA 3EQ8A 2HHLA 4RBNA 2ZTSA 3GHHA 4N48A 3CVVA 1UANA 4D46A 1PV1A 2IP4A 1YJ8A 3K94A 3MPUA 4K6MA 9LDTA 5AESA 4FFBA 3OCVA 2IZ0A 4QYIB 1J20A 4LBWA 4UNNA 4JYAB 1CIJA 1ZM9A 2XEDA 4O8ZA 5EPEA 5F52A 1QVVA 1CY0A 4RVNA 4RXTA 1RTKA 2CCKA 3B89A 1I9GA 1KK0A 2Z3ZA 2DP4E 3HWRA 4PANA 4MPTA 3ZD8A 1C3OA 5AK6A 3AJ8A 2VSQA 1T1IA 2CXSA 2RCNA 4L0DA 3X1ZA 3VX4A 3EMBA 5AVTA 3HVJA 2X2FA 1JVBA 3DEJA 4D99A 3L8GA 2E0IA 4ANFA 1M2JA 1G42A 2QN8A 2D4HA 3E5NA 3SXUB 4E30A 4L0QA 5JYBA 5KNCH 5KX5A 2IEBA 1W36D 3CIOA 1UWCA 3AESB 4W8HA 4FZ5A 3BWDD 4JBYA 4D2IA 2DH6A 4YP1A 2O2XA 1QV6A 1GTG1 1J2EA 2J3DA 3S8MA 4ARZA 2CNKA 1O4WA 1DAHA 3TLKA 2ZRNA 2P1DA 1V1JA 2W6ID 2WG0A 3DYVA 4YREA 3SJZA 4ZOEA 1SVNA 1DAEA 1Z6QA 4PSDA 3B12A 3K8ZA 4RA6B 4PG6A 4A2WA 3P4XA 4EOGA 1JSLA 4UE2A 3QVOA 1QCYA 2EG5A 2J9GA 4WE3A 2XGGA 3LCJA 5AICA 1IVYA 4GPBA 1J6UA 1K97A 4J8PA 2R8EA 3TTYA 5J4KA 1GY8A 3OAAA 2E4WA 3JD3A 4H7IA 3WQQA 1OB5A 2FPWA 4NJOA 3CLVA 3T3HA 1HT0A 4ESHA 2ZM5A 1TYAE 4XEHA 4BCDA 3R1IA 4M1QA 3E05A 4XJTA 2ZBEA 3RBVA 1QG4A 2AMFA 4NZZA 3LUJA 3WHLA 2B8NA 2VJOA 3HLKA 5BOVA 2HCBA 2WB2A 4TTAA 3R41A 4CCYB 5HFAA 1F5NA 1F60A 2Z4TA 2YHUA 4K8RB 2CDNA 1AKWA 4MRMA 4OD0A 2HSZA 4YRKA 3IKLA 4OM7A 4AK9A 1HYGA 5HG0A 4M8SA 3IMFA 1NNEA 4HRYA 3I9NA 4TZ0A 4OQXA 1RI5A 5E8RA 1TFUA 3ESDA 3C48A 2NO6A 2PZ8A 4KO1S 1HYBA 3WWDA 4ENSA 5IN4A 1Y98A 4YCNA 3HZRA 1C41A 1F1BA 3RVRA 1TUBB 1YB7A 3OJCA 2YTZA 4HN9A 5D00A 4X65B 4DQUA 1N3IA 5B1YA 1H0RA 4BWGA 3K4PA 2PSFA 3AERA 1RXUA 3P9XA 1C8KA 1G20A 1CB7A 1BA2A 1NWCA 3DOFA 3RTCA 1T43A 2EFHB 3C1AA 1Q7BA 2AK2A 3CR8A 4P3KA 5ESDA 5F1PA 4DIDA 1ZXLA 5K0LA 1HNXB 4D6YA 3EAFA 4QG7A 4DCJA 1N2EA 1WLYA 1XWFA 3D4OA 1I1OA 1SXIA 4Y6PA 1DJNA 4AJKA 2E21A 3RROA 3ITEA 4LISA 3TLAA 3IP1A 1EUCB 5B6JA 4OI1A 2JFHA 4RTKA 1QVZA 4OREX 2GHQA 3GQBB 5AW8A 3HB4X 2B4QA 5CFZA 3GLFE 3PE3A 3QJ5A 1TLFA 2XB8A 2B1IA 4R31A 1KDOA 2CXOA 3GJZA 2CDCA 3PLRA 3PRYA 1HV8A 4IWNA 2RSLA 4QDJA 4RPGA 2R1UA 4GWLA 1JTVA 5AXDA 4C4OA 4GEGA 1AKNA 4IYRA 2QR2A 4B2YA 2CJFA 1YDGA 1ACMA 1F8XA 1XEXA 1DT5A 3MHTA 2YWRA 3Q4GA 1AIPA 2FEXA 1HG1A 3KXIA 4MS3A 4G85A 1RYNA 1UOQA 4EUFA 5KTRA 4H59A 3ZDRA 3S7TA 2H0AA 4WKPA 1ZUNA 4PLGA 3U37A 1ZA1A 1U0EA 2A33A 2C96A 3DNMA 4DWOA 5LWQA 1MTOA 2RHGB 3W5BA 2RCYA 3JTMA 4R1LA 4YO7A 5TJ9A 4DCVA 5GJBA 4HQ6A 5IYZF 2F4VB 3GB9A 1ONBA 3DB2A 1EQUA 1MPXA 2WC1A 3RCBA 1L5WA 1KZ6A 3E3AA 3GUHA 3O4FA 1WCV1 2P91A 3VAZA 3K9QO 1F0NA 4MTLA 2CUZA 3O8NA 4QODA 2EX4A 4V0LA 1CQPA 3OM8A 2JFWA 2IHKA 2R2AA 3DD5A 2GCIA 4CZ2A 1DOHA 4JI8B 4QOJA 4XKJA 3IAM6 3AOEC 3I76A 2E5WA 4ZPXA 4ZZ2A 1I4LD 1US8B 4EJ6A 1FNNA 1SR8A 1Z5GA 2Y0CA 3R40A 1PUJA 4LXGA 4Z9XA 3C5CA 4NABA 3ER6A 2AQ8A 1VJCA 1MC1A 2NTNA 3B9QA 4ONEA 1PGOA 1CDOA 2IYZA 5IKXA 1NQXA 1S8AA 5BV0A 4B3RB 3E3MA 2VQ6A 1GILA 3HP1A 3IESA 3PYLA 4ZMSA 2C3MA 2QRVB 4XEUA 5HIMA 3GOHA 1O5TA 1LSUA 4II2A 1Q14A 1P9NA 1KI8A 4QBTA 1DI0A 1QG0A 1ZVJA 1W581 4E5YA 4LY9A 3HJFA 3TLZA 5DI9A 3GLIB 1WV1A 4BUJA 1ZL0A 4IS3A 2AZTA 1LTQA 1ZC4A 1YZKA 1JKXA 1ZMTA 2B82A 1F2TA 3G7NA 4GGMX 2C3OA 4LJSA 1YTUA 3OLYA 3UTDA 3K6JA 4D57A 1WSDA 1XRJA 3KWFA 4ARAA 2OLEA 1ULBA 3ZOZA 2JAPA 3RVOA 3GLRA 3QYPA 2BP7B 3TFOA 3VPAA 5A7GA 4QIHA 3LUGA 4C89A 4CDNA 3FOEC 1ZK3A 3ZOKA 2VQ3A 4YCDA 1XALA 2ABWA 4QDTA 3VGJA 2NO1A 2QW1A 2VATA 1P81A 3E7FA 1SUWA 2G0NA 3KZMA 3NASA 2Z4RA 3NWBA 4ZA2A 3U5TA 2FUKA 3C6XA 3B8EA 3ZHOA 2RHOA 1II0A 4N6GA 1BRMA 3REGA 3W78A 1DCTA 2GXQA 1CUBA 3KLPX 4B33A 3HDTA 1FTSA 4LYHA 3S2ZA 1XSEA 3CTPA 3OCYA 3BK2A 3D9QX 4ARVA 1FMLA 1BOOA 3DLIA 3C7KA 3RRFA 2A78A 1VCMA 1GCOA 4I0WB 4F11A 4Y2XA 5BV2P 4RKEA 1XNRB 1W5EA 1ODIA 2FUCA 5ALGA 2ZWAA 2ZTLA 3TUZC 1OGIA 1HNNA 2OORC 1TCVA 4UTXA 2HEIA 4L22A 1O0BA 1CJSA 1X0VA 2FPPA 3E22B 3FZYA 4ZQCB 3P9KA 4F9FA 4DA9A 2C99A 1WXEA 2DSTA 4O1MA 1OX4B 4KDEA 4AP5A 4CKEB 4RVOA 4EHHA 2BEWB 5A4MS 3D3NA 5NLLA 2JLBA 4BPRA 1E5DA 4UEWA 1YRYE 1TTTA 3DOUA 1P5HA 5JCOA 3PPVA 4LNAA 4EX6A 5DW3A 1B4DA 1OV6A 4IHJB 1A5SB 3PQ4A 2OLJA 4MI3A 1S3SA 3KVRA 1D6SA 1GPAA 5BUZA 3U4QA 1GDHA 3W5SA 5BYAA 2H1WA 3H1EA 4CHGA 1SXJE 3KWJA 1GPUA 1QQ6A 2Q1WA 2L18A 4QASA 4AJ2A 1MW8X 1JSZA 2VDLB 2Y6UA 3E9ZA 4R4JA 1MH9A 4UW9A 2WKQA 3R3XA 3L8FA 5FUVA 1D1PA 5EMMA 2IXBA 3AKDA 3TMAA 1E3LA 1ZCZA 3ZQKA 1KY4A 4S35A 1N6KA 1UAGA 1R4ZA 2QW8A 3F96A 2Y0EA 3HU5A 4UHJA 5IDYA 3TZCA 4A8JA 5KINB 5KYNA 3K73O 4BV3A 2XF2A 1G8YA 4XB2A 2AMYA 3BK1A 2QLMA 1JFVA 3S70A 1JALA 3KJGA 2YY7A 4FCCA 5B2ZA 3WVNA 1HE4A 2G70A 3GEGA 1O0CA 3LWNA 3QLUC 1TAUA 2I9PA 4D9GA 2X19A 2BFFA 2NO5A 2BGKA 2XX3A 1JMKC 3JPYA 4S2UA 5F7ZA 4PAMA 2ZSFA 3CT6A 2M6KA 3SC6A 4AUNA 4DL9A 2BH9A 3KOWA 4JR0A 2AL7A 4L08A 2PQMA 4TTJA 1L5QA 1A1SA 2BI7A 4TKVA 1FK8A 3UWMA 1B6RA 4TMWA 1X9IA 3GJ7A 1ZN8A 3NU1A 4QUGA 1U99A 4YXWD 2R00A 3HCAA 2QX7A 3W3AA 3KSBC 1UMBA 1YRLA 1NX9A 3I6ZA 4B0PA 4Z4EA 4LY0A 2C8LA 4OPMA 2VP4A 4ZMRA 2WM9B 5JASA 3GWZA 3VOAA 1P6UA 5EY5B 1S89A 5KNLA 4G4JA 1CS0A 4AROA 4GKBA 1FLNA 5TY0A 4O4HB 3L4EA 5EGNA 2DM6A 3BDIA 2ADFA 4Y0AA 5AIAA 5T4HA 2PNJA 5CITA 1R18A 3TZQA 2I3BA 4Q6BA 1N0WA 1QP7A 3QKTA 4INJA 2AV6A 5EQJB 4KXUA 5D3KA 4GS5A 1OFGA 2PJDA 3JYQA 4WMLA 5I4CA 5GP1A 2W4QA 4Q66C 5K3EA 2ZRJA 1QOQB 5L9AA 3AIIA 4B4WA 1M2WA 3W5CA 3H4MA 1ZNXA 2BTQA 4J07A 4ZOQI 1A9ZA 1DINA 4P8RA 1UKZA 3VU8A 2QV0A 1I9CA 3V8VA 3OT5A 1KNQA 1JQLB 1ZUWA 2ZT5A 3EC1A 3MWYW 1HTWA 1P2FA 2YX1A 1YASA 4IIEA 4OAOA 5LFAA 3IVCA 2H57A 5AW3A 3CNEA 1H8ED 4GICA 3VR5H 1HEUA 4Z7NB 2GEJA 2PKXA 1PGQA 1PYDA 4JELA 4R98A 4OKSA 4JQYA 3U0VA 1C9NA 1YJQA 1TXGA 2OAQ1 3V3KA 2BELA 4YNBA 3VU3A 2C0PA 7AT1A 5IPFA 5KOIA 3PFCA 5CCXA 2UXCB 1NW3A 3C8DA 121PA 2R1VA 1YACA 4FN4A 1XZMA 3GUUA 4IL5A 3NI2A 2HBYA 3T1TA 2HU7A 4KXWA 2HREA 2JBHA 5AW7A 1TUIA 4DXDA 1PYOA 1RE1A 1NUPA 4MLDA 1M2OB 5BRJA 2NOAA 2WB4A 1WPQA 4KQGA 1V5FA 1CUDA 4XGIA 1V95A 2EIXA 1RVV1 1NULA 2EJCA 3PVZA 4K88A 1ZISA 5AKEA 3SQLA 4ZICA 1W5BA 3HS3A 1K6JA 2W5UA 5G3YA 4RWEA 5ALEA 3BF8A 3OH8A 2IS6A 2CLHB 2DBVO 4TZKA 5AYVA 3B9PA 4GT1A 5CX1B 1OX6A 1DUVG 2YMLA 4AZSA 5KNDD 3TQIA 3K2IA 3PD7A 4RY9A 2J3KA 4XPIA 3KK0A 3Q7SA 3T1HB 4FNOA 1Y9AA 1N9GB 1VDZA 1PK9A 3X0DA 4YAIA 1YIDA 5HCIA 1I3CA 4WDQA 1P1IA 4YMSA 3HE3A 4F5WA 5DBEX 3GHYA 2BTEA 1IM8A 3EISA 1CUSA 4N01A 4NCJA 3HB0A 5KNBD 2GBLA 1FFCA 5AQEA 1EVIA 5ADWA 2IRWA 1IEWA 4ZP1A 4MQ6A 4RH0A 4XSHA 1BSVA 2NT3A 2QRJA 1LVUA 2HA2A 2IHBA 2B9VA 3QMPA 1Q22A 3MJFA 4OK6A 4QDOA 4TSRA 2W6CX 4G0WA 3ES9A 5E6RA 1ZIPA 3QPWA 2V7UA 3HB7A 3QUBA 2O1EA 3TCKA 4YR9A 2ZJ3A 1OT3A 1M2KA 1D5WA 2O8DB 1MRSA 2FRDA 4UD6A 1P9OA 4J1TA 1ZBQA 4KCGA 2KSQA 1ZRSA 3CH4B 4GBED 2GSWA 1PFVA 3KPJA 3M83A 3N3BC 1J0CA 1PJ4A 3Q8XB 4YGYA 5E2IA 4HLUA 5LBIA 5TQ0A 2XCUA 1LF5A 4URZR 2NUPB 1E2EA 3R6WA 1CZRA 3DMNA 3DDSA 4FFRA 4I2VA 3UMJA 4D74A 3IIEA 4DC1A 3R9XB 4UZEA 3CSSA 4LWZA 3ABOB 2OFPA 4EF5A 1RIFA 2WYWA 3WGYA 1ZOPA 2W48A 4G07A 4P84A 4CMEA 1IZ0A 1Y6ZA 2HXGA 2IVZA 2ZUUA 1UMCB 3HZHA 3P0IA 2H4HA 4I55A 4NTZA 4C0JA 1HF3A 3GGCA 2F8LA 4Q7KA 2OQVA 1SPBS 4K9OA 4EF4A 2TS1A 1DTEA 1DXQA 1RYYA 1X13A 1KS9A 3NHPA 2Q5FA 4RH3A 4URUR 1TE2A 1Q0RA 1DCMA 3KO8A 2ANBA 3HXOA 4TV9F 3T9FA 2L2QA 4WLVA 1OU0A 4L5YA 3FUCA 4MEBA 1UJ5A 1W47A 1H1TA 1B00A 1TKRA 1ETUA 2E89A 4JKOA 2BEVB 3KHSA 4NP6A 1Z4LA 4ZJYA 3G8AA 4MQEB 2PIAA 1RI3A 2OGWA 4P81A 2PKRA 4AIIA 4RACA 2Z8ZA 4MRRA 4NBLA 1FMTA 3CCBA 4HY3A 4R1NA 2C5AA 4DEXA 4TZ6A 1M73E 2IELA 3N6VA 4IDDA 2GLUA 5K99A 2C3UA 3JR3A 3AHIA 4WV3A 1PGPA 2I5PO 4LX8A 3UKJA 1JYSA 3VU0A 3KYCB 3P0EA 4L6AA 2Z6AA 1XCMA 1YL5A 5ECWA 2C92A 3OZGA 4KVFA 2EJWA 5IZ4A 1A1VA 4LFCB 5IRCD 2NSYA 3ROQA 1WXWA 1IY1A 1ZX1A 3D0QA 4LV6A 4LF7B 1YAHA 2VPYA 4EYKA 2JIRA 5F2NA 2HOQA 3OLVA 4DB2A 3EFHA 4XDYA 4ECAA 3AR3A 4EG5A 4X3PA 5EJFA 4Y6OA 2X0JA 4XWAA 5D5HA 3AM3A 1AUQA 1P1JA 4C30A 4ZU3A 1ES9A 2O7NA 1XF9A 2BGMA 3NEPX 1A8HA 3OX1A 5ULLA 5JXIA 4CQMD 1U8AA 3ANXA 3SAJA 3N2NA 1CUJA 3S8YA 2JDID 1IAVA 4PX2A 4EG8A 4ZO6A 2DYKA 4XM1A 4YUAA 3Q7PA 1CDEA 1E98A 2HEGA 2UU9B 1VB3A 3VDNB 2A35A 4PM4A 4E32A 4BMYA 3EARA 3I2KA 5GGYA 1YOVB 4QA9A 4ZPJA 3GPLA 4EO4A 1EVKA 3FNHA 1VKOA 4DA8A 4TQUS 2IIPA 5DSTA 1KJYA 4JWTA 3Q0EA 4UXIA 4YQZA 3HCRA 2Y67A 2IV2X 4Y2HA 1T15A 3AGQA 1CFZA 1IHOA 3FZEA 3ILYA 3VYRB 3GGJA 2EG9A 4UDOA 3CVOA 3ADBA 1H0KA 3B36A 3G2JA 4GC9A 1IK6A 5IJ0A 1JWLA 4CEJB 3K1AB 2DHEA 5BVHB 2FVXA 1XJ0A 3W8FA 3RAFC 4M0UA 1LI4A 2OBBA 4MGYR 5B7NA 1ZJYA 1IFXA 2J0EA 3D3KA 2RHDA 3NXKA 2FP4B 5DZSA 1SD5A 2XE7A 4Y0NA 4BZZA 2GK7A 4DUGA 1LPAB 4FP9A 3LT4A 1RQ2A 4TXMA 1J99A 4JKIA 3WL4A 4GI5A 2VJNA 1Z28A 3P0HA 1Q44A 3UW1A 2AEEA 2BFOA 4UKDA 1GTZA 1XLTA 2W6PA 4YAFA 4EX7A 4BNLA 4BV2A 3VH4A 1CQIB 1PNVA 3WLFA 5EUBA 5A5DA 3ZKWA 3VPDA 3ZU4A 4DPMA 4MIYA 1P33A 1NBMD 2HC9A 3EG9B 1COZA 3NHZA 3A6FA 4KQJA 3RHTA 5CFMA 4BS9A 1DHTA 4IXNA 2P0YA 4XTRA 1XIVA 4R84A 3FJYA 4Y9UA 4ZAYA 3SBEA 2XOKA 1UP4A 2CNBA 3R0JA 1BTOA 3SSAA 1JAXA 1NW5A 1X15A 2FE4A 2WJPA 1LBQA 3FPSA 2O2HA 1GNVA 3VYWA 1O9HA 2R4QA 1OXSC 3AP2A 4PYOA 4BP8A 2C5LA 1MIOB 2O8BA 3D8TA 1WBBA 1XQWA 5HGXA 1GGVA 3I72A 2QPAA 4QBIA 4XYBA 2V6IA 2PMKA 3L8CA 3QWBA 4ZT3A 1YI1A 2H4ZA 4S1VA 2WHRA 4ZO8A 3SSOA 1NVMB 4J0FA 4RK1A 3D3WB 4LZWA 5EJIA 4EHDA 2YIDA 1FS6A 3LY5A 1CR6A 4HATA 1E63A 5T8KC 1H65A 3E1KA 1XCOA 1YMQA 4UNSA 4BFLA 1H85A 3QZUA 3SC2B 1QQ5A 1SPXA 1XQXA 4DR3B 2YJ4A 4D8VA 1OC4A 1SUSA 5T3UA 3PRKE 5H4GA 3V4VB 5FUQA 1U7ZA 3VU9B 2COKA 1SK9A 5DGIA 5DM60 1M72A 2CF6A 1E7QA 2VK8A 1FLDA 5D1NA 1TMOA 4R68A 3NDRA 3EUAA 3SQNA 4DJFC 5AXAA 1H2ZA 2E4UA 1H69A 1PFQA 4FS3A 2C83A 4I4IA 2F64A 2VAWA 4MLCA 1LCIA 1ESEA 2JLQA 3ZDFA 5GJVC 1SXJC 1M1YA 1SUCA 2G1KA 3BL8A 3GI1A 5AI8A 2YVKA 1AJEA 2R4TA 3KV3O 3PUKA 4ZVLA 5C4GB 4NBKA 4BNGA 4E5SA 2HTEA 1YZYA 1L7MA 4G24A 5AHRA 1I2DA 3QW4B 3IVMA 3INTA 2E4YA 2Y0PA 2FN9A 1NUUA 3S0JA 2ICAA 2P0AA 3R77A 1R9NA 2JEOA 4HAYA 4HP8A 1UCFA 4YFVA 3WGGA 2MINB 4IYJA 4B3SB 4JJ7A 1NPDA 1SH7A 3PX2A 5DVZA 3O0DA 2CLEB 2HRRA 2P9ZA 3B20A 1JZQA 4RK5A 3ZI7A 5AUOB 2QZJA 3RRYA 3W5AA 1U28A 4Q16A 5HRCA 2VS1A 1KK1A 3ZY4A 3LDGA 2WU8A 1KK3A 2FR8C 1DAMA 3I37X 4OHUA 3CPHA 4N5NA 4GNRA 4UHBA 4F92B 3EHDA 3PGJA 4XQ9A 3FMFA 3FPJA 4UMDA 3VI4B 2OUKA 3VV3A 1ZGBA 1YC2A 2W6IA 4B6JA 4L5BA 1VECA 4M0EA 3D4LA 2QDXA 3KXLA 4V39A 1M7GA 2ON6A 3IDOA 2X8AA 3DPSA 1P0MA 2NAPA 4RHXA 4U7HA 3K71B 2H3HA 1V1RA 2PGLA 1S2GA 4FONA 4GXTA 4KC0A 4R9RA 4KYVA 2ZIAA 3GV0A 1TA0A 3L77A 3DLPX 3MWDB 2WIKA 1P31A 3Q72A 2O50A 3H2IA 2AJLI 4Q4DA 2H4JA 2PK3A 5L3ZA 3WSTA 1V41E 4N5MA 1EX6A 3WB2A 1P29A 4QGHA 4RVHA 4GYJA 3QEBZ 3I1JA 1C1XB 3CF6R 1YO6A 3FW1A 3G6KA 4ABYA 2PCLA 1R2QA 2AW5A 1KERA 3VO2A 2IXFA 2BSXA 2CF5A 4TYQA 1ISPA 2D2XA 3ILHA 2QRHA 4MYHA 4CTJA 2R8YA 2I4MA 3N5KA 3OECA 3NRBA 1JBKA 2PY6A 3RVJA 3WNCA 3ZWMA 4WBNA 2FDXA 5DNEA 4M38A 3MCTA 3MGAA 1EINA 1KWKA 1ZN9A 3T06B 4GNKA 2GA9A 3R8CA 1REQB 4BNIA 1JFTA 2D0PB 4QG3A 4KIJA 2NU7A 2XMRA 3Q9LA 4WXEA 3U60B 1N33B 2BM1A 3AVQA 3U19A 5K6RA 1EFCA 1T26A 2I3GA 3TAUA 4F1WA 1Y6FA 1JDBC 5F4BA 1G2QA 4B6GA 4BQIA 4KKVA 4ADSG 2DUNA 2RG1A 2Z09A 3C87A 3DBVO 1FUIA 5H7XA 3EEIA 3S55A 1DAFA 1DE0A 1YVEI 2XB6A 4HWOA 4KWCA 5JCPA 1CP3A 3Q87B 4TKLA 1NJ6A 4LGVA 2V45A 3ZHRA 5LLTA 2VQEB 2ARKA 1H4SA 1DDOA 2CNDA 2XNDD 3QM1A 1M2NA 4ISCA 3FYUB 1PTJC 3ELWA 4R0MA 4RMNA 3R5HA 4S1WA 1KQFA 5F9FA 5KC8A 1VQ1A 2H5IA 2F3TA 3GL9A 4QC2A 5F76A 3S2YA 4DLNA 3FHCB 3OEHD 3TPFA 1Q0TA 1FUEA 3ZQUA 4ER5A 1P1CA 4HB4A 2JCGA 3DTNA 3STTA 2RE8A 3BD7A 2B69A 2H2IA 3G9ZA 4MMXB 4A6EA 2C2HA 1Y7IA 2WRZA 3C4JA 2XCIA 3UWOA 4ERNA 2GHTA 3SE0A 5GIOE 4OLBA 3H05A 4LJ4A 4DNOA 3UMFA 4E14A 2ZUBA 1GHTA 4BE7B 4KR9A 1IJEA 1XXHA 1UDRA 2FPKA 2PL9A 4BQOA 4U7JA 3CZ4A 2R6CA 3TDNA 1JECA 3QPUA 4WCVA 3RU2A 4QFCA 1XL1A 3A2NA 4TWRA 4QT4A 1EESA 2QAIA 2YFHA 4N8SA 3I2GA 4WZ6A 4G36A 4KFCA 2ZIWB 4C03A 5FR1A 2E5FA 3VHRA 2JHAA 1V26A 2YY6A 1XZDA 1XEAA 1JLMA 4MUYA 2JKYA 5EXPA 3GAFA 3Q85A 3TTTA 3OC0A 4NYMR 1NRIA 5LMZA 3OPYB 5DM70 2XJ9A 1XJ5A 1VA5A 2EIHA 3QBVA 3WYEA 4DZTA 1E7RA 2DTEA 3GH3A 2OT3B 3G23A 3RC1A 3H1PA 3KOZA 2QMUA 3U4IA 4LRXA 5AVSA 5BORA 4O4JB 4WUVA 1VI5A 3DBLA 3HGTA 3UM9A 4C7BA 2VQFB 4XFKA 1K4YA 2IZZA 2X5NA 4QU5A 2B1QA 2Z3WA 1LW7A 4ZT2A 3A9RA 2GJ9A 1KKLA 1I01A 2EHDA 4FYWA 4BFZA 4E12A 4YJHA 4CMBA 2O7RA 3H42B 4BLVA 1MB9A 5LPNA 1RJWA 4L95C 5HBRA 1PJ2A 4PX9A 3ONNA 1FDWA 2HRBA 5ENVA 3PXXA 1L4LA 1R3DA 1R6BX 2AWOA 4FSXA 3V7UA 1IHPA 1UBGA 2PNFA 3M5CA 2RI0A 3UT0A 1ZI8A 2OO7A 4AO7A 1MLDA 2AVDA 1MP0A 2V54A 1QYDA 4MQLA 3WA7A 1MRZA 4G3XA 1BDHA 3PS9A 5L3SB 4ZODA 3WL3A 1P4AA 2J1LA 2EC5A 2O0MA 5H9VA 4DDVA 4US2R 5J2TB 1SVOA 5I9IA 3UBTA 3RM3A 3HLTA 4E46A 4QGSA 5AVQA 5K8VA 3H2KA 3P2MA 1L4KA 3N2ZB 1PGNA 3KOXA 5JANA 5JNWA 1O87A 3EXHC 3U13A 1PZEA 3JVDA 3JQ7B 5IJ9B 1YZLA 4K6GA 4OF4A 2R7NA 5MN4A 4XLLA 3GBVA 4QT0A 4HLQB 1O57A 4GOJA 1KAGA 4CMAA 1Q74A 1W5AA 2XZPA 5ERXA 2JCXA 3OTOB 4U7DA 1KJJA 4JNKA 1G4AE 4WOJA 1OPXA 1UQTA 2ODWA 3I9V6 3KP1A 3OZWA 4EMUA 3ZWXA 3NIFB 4UTOA 5JSZA 4IFTA 4UXJA 1J5PA 4RFSA 1E96A 1Z83A 2QX4A 4O2AA 4OFXA 1E1DA 1TM1E 1KJZA 1E6MA 2PGAA 1PLLA 5KOHB 3TNDA 2ZKLA 1IMJA 1RWOA 1WCIB 3NIBA 3DUWA 4WKBA 1QYIA 2JIOA 5AW6A 3AL0C 3IDSA 4MV9A 4KV7A 1SBIA 1GYPA 1ZMBA 4I5IA 1PLKA 4F4CA 1DTWA 3TJRA 3T95A 4F97A 4ER6A 3K0BA 1U2PA 2CXHA 2LIVA 4GX2A 2R97A 2HK6A 4U0JA 3SR4A 1BW9B 1QGUB 3O8DA 4ZEWA 1TMKA 3LU1A 3VYTB 1E3EA 4JP2A 2Y1FA 1R4NB 2C2ZA 3AF1A 4HWGA 4B1FA 4KR6A 3TJMA 5JS8A 3A3KA 3LG2A 4A8HA 1L4FA 5TT1A 3KQVA 4G65A 3UYLA 4M0PA 2PLWA 1JTEA 2HMUA 5HUJA 1Z0KA 2DU8A 2XWSA 5C18A 3QIVA 4JMLA 3BAFA 4IFBA 2J6BA 3GWGA 4I9UA 2PVCA 4LHWA 2ZYSA 3AHFA 3DB1A 4NMWA 4R71A 1YE3A 2EWMA 3PX3A 2GFIA 2FDCA 1WSWA 4YCLA 5CNMA 4M1TA 3MG9A 4NG4A 4ESVA 3D6JA 1C30B 1XWWA 1XAJA 1TYBE 1KA9H 3CV3A 1KQ3A 3P20A 1E69A 3QBEA 4DXHA 3FOZA 2OFXA 3BHIA 4K6FA 1H5NA 1KMMA 3M6WA 1AMUA 1IXKA 2CBZA 3DF9A 1NUHA 4EELA 1WZEA 4EHAA 4URWR 3IHTA 1U7HA 4MSUA 4URFA 1BJKA 1JXOA 2NNLD 3SBXA 1ENYA 2GCNA 2M98A 5DF1A 2R87A 1L7AA 3P2EA 4YT8A 3JYHA 3VKUA 3KTDA 1XVAA 3D7LA 3R7DA 3VFDA 5IT5A 3AR9A 2QLTA 3I45A 3U26A 4DV2B 3ONEA 2JPDA 1QRDA 4RKQA 4ZO9A 5TX7A 3UJPA 4QTTB 2BZGA 2WQ7A 1VL6A 3OMXA 2R8PA 2NZYA 2VWHA 3PIIA 4LC9A 3WYBA 1U8TA 1I3LA 3ME5A 3NYWA 1NKSA 1UJNA 3W90A 1E60A 2DFTA 1ZW6A 4CLOB 1VHTA 3CEMA 4EL5A 2OO5C 1WVMA 3CYFA 2E6UX 4WCDA 3LOPA 1RBMA 5B1SA 1L5KA 1A77A 1FQKA 2FMKA 2GJ4A 3BRWD 3FWZA 2IS4A 1L3IA 4EW2A 4JP8A 2WWGA 2BKLA 2VEDA 1U8CB 4AP6A 2O2DA 1ML4A 4RDHA 4V38A 3GAAA 3PGMA 5BNTA 4NOMA 1WHSA 3VR6H 3NC0C 4C43A 2CSXA 2CEKA 3KWLA 5H59A 3ZNPA 3TL6A 3FMGA 5KI6A 1NMSA