1U2DC

Structre of transhydrogenaes (di.nadh)2(diii.nadph)1 asymmetric complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active-site conformational changes associated with hydride transfer in proton-translocating transhydrogenase.
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
molecule keywords NAD(P) transhydrogenase subunit alpha part 1
total genus 48
structure length 174
sequence length 174
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2004-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1u2dC00
4TWIA 1U2DC 2OD2A 2UZ1A 2VK1A 3LQ1A 3PDHA 4BUZA 3CLSD 3FSJX 5MF6A 3E9YA 3F6EX 4UTXA 4C78A 2IHVA 4JUAA 4UUBA 1S7GA 1OVMA 1T9BA 2FSVC 2VBIA 4TWJA 1V5GA 1EFPA 2H2FA 4Y6OA 2FN3A 5EJAA 2B4YA 4UTRA 1PO7A 3K35A 4GG1A 2A1TR 4JT8A 1BFDA 2BRUC 2EZ9A 2OD9A 4GPEA 3GLRA 4BVBA 2Q29A 3F6BX 4KXQA 3PKJA 1POWA 1NM5C 4L2IA 4RMIA 4F4UA 1M2NA 2NXWA 2PGOA 4IF6A 4MZXA 1MA3A 4MQ5A 2JLCA 5FYQA 4UU7A 5K2OA 5FEMA 5EJ8A 1YC2A 4J16C 1V5FA 2EZTA 1DJLA 4JSRA 4JU9A 2FR8C 2Q5OA 4X3PA 4MPRA 1U31A 5DGTA 1HZZC 5EJ5A 4GP9A 2Q28A 3JWPA 4Y6QA 3D81A 4MPJA 1OZHA 4K9PA 4QPZA 3GLSA 1D4OA 2VK4A 2VK8A 1M2HA 4JT9A 4BV2A 3CLRD 4COKA 1S5PA 5EJ9A 1YNOA 1PVDA 1ICIA 1Z8NA 2H4FA 4JU8A 3GLUA 5EJ6A 4UUAA 3RIGA 3U3DA 2JIBA 1N0HA 1YBHA 5BWOA 2H2HA 4ZP1A 1M2JA 4BN5A 3ZGOA 2FWNA 3IAEA 1Q1AA 5K6RA 2PGNA 4K9KA 4JUBA 2H2GA 3D4BA 4RJIA 1V5EA 1YTLA 2DJIA 2OD7A 2JLAA 4JUFA 3CLTD 4UU8A 5MGNA 1U2GC 5IMSA 1Q17A 2H4HA 4UTNA 4KPUA 5DGDA 1YHYA 1O97D 1E3TA 4JUCA 1SZCA 3GLTA 2WVHA 4GM0A 3ZG6A 1T9DA 3PKIA 4R8MA 2UZ1B 2JI9A 4BVGA 4KGDA 1PI3A 2JI8A 1M2GA 1PTJC 4BVEA 2OORC 2VBFA 3ZGVA 1YI0A 3HWWA 4D5EA 4C7BA 4HDAA 3EA4A 5K6TA 4K9MA 3CF4G 1U28C 3CLUD 2H2IA 2FRDC 4QQ8A 1J8FA 4Y6LA 4BV3A 1PYDA 3EY9A 3JR3A 4RMJA 4JUDX 2IHUA 2V3WA 3IAFA 4V1CI 1OZGA 1MCZA 1JSCA 2WVAA 4V1CA 1SZDA 5EJ7A 1T9CA 4K9LA 2AG0A 4UTZA 5D7NA 2JI6A 2C31A 2QQFA 2Q5JA 3EYAA 4JD5A 5AHKA 4IAOA 4BN4A 4BVHA 2VBGA 3OE1A 3RIYA 2Q5LA 1PT9A 2W93A 4HD8A 5MFZA 4K9QA 1PNOA 5MFPA 3FZNA 4I5IA 1UPBA 4G1CA 5EJMA 4D5GA 4RMGA 4RMHA 4FEGA 4ZZIA 3U31A 3HWX1 4K9OA 1O96B 1XLTC 4O8ZA 2QQGA 1Y9DA 2A1UA 2X7JA 2H2DA 2H4JA 2Q5QA 2VJYA 5BWNA 4L3OA 2EZ8A 5BWLA 1POXA 1UPAA 4K9NA 4RJKA 1PNQA 1EFVA 1QPBA 2EZ4A 2PANA 4MPPA 4Q9DA 4X3OA 4F56A 4V1CB 4QELA 5EJ4A 1Q6ZA 1Q14A 5K3SA 1T9AA 5DEIA 3FLMA 4FVTA 4GM1A 4RJJA 4UTVA 1OZFA 2Q27A 2AG1A 2WVGA 1ZPDA 1YHZA 1UPCA 2NYRA 2OO5C 4FEEA 4GM4A 2EZUA 4FZ3A 4IG9A 1YC5A 1M2KA 2IHTA 2JI7A 3D7KA 4BVFA 4J1TC 2HJHA 2H59A 1YI1A
chains in the Genus database with same CATH superfamily
2HW8A 1G2PA 5BR7A 1DKRA 1LJLA 2OCAA 4NULA 5D86A 5ALOA 3RS2A 1K5HA 4GDFA 4D4MA 1DG9A 1OBFO 1FSSA 3KLPX 1H2EA 3AINA 1CY1A 2NADA 4HGOA 4XQCA 5DYWA 1GG2A 5EEGA 5TE9A 1YI8A 1JHYA 1G291 2WG1A 3LV8A 1EP1B 3NKLA 4N12A 4RWEA 4X85A 5A6SA 5LLDA 2NO5A 1HQKA 1CUAA 3DSRA 5JDCC 4WKNA 4ZEVA 5DXJA 1FP4B 5JXIA 4LZAA 1T2FA 4CIBA 3TEFA 3THWA 4JMPA 3BE6A 1SBCA 3IEIA 4DSNA 1QOPB 1N5RA 2DFKB 2ZWMA 2ZM6B 1NV9A 4AY6A 4LTDA 2D1YA 3L8HA 3EGVA 1YVPA 4EF5A 2YYZA 3JWPA 1YL5A 4AJKA 2I4LA 3MJVA 5AR1A 2D5LA 2HF7A 1PL7A 5BSKA 3G7SA 4Q21A 1TAHA 3D8BA 1TVKB 3EOZA 1E6UA 4IIUA 3FB1A 4EH1A 4ZARA 4EAQA 3Q2IA 2XXAB 3LCVB 4KQWA 3R9WA 4C87A 4WRRA 1IB6A 1R1DA 1W5BA 1KK0A 4KGVA 3STYA 3BG5A 1TCVA 3DVQX 3DGEC 1DCTA 1ISSA 5HRAA 1G3UA 4OY3A 1CJVC 1LLDA 2BE9A 1QF6A 2JFGA 1MENA 4HLUC 3LE8A 5BR4A 5K6RA 4L76A 3S8EA 4O5OA 2A35A 1TJ5A 2DM6A 3IURA 3AG6A 4U2CA 2X0DA 4ZHQB 2R7LA 2FA9A 4OGWA 3C43A 5BSHA 1WZNA 3FOFC 1Q3TA 3RODA 1Y6ZA 4WJLA 1IZ0A 2C2YA 1R10A 2QTGA 4XJSA 4ZCRA 4M0LA 1AZLA 3ZH2A 3W6NA 1WUIS 4KO3S 3GJTA 5LBTA 3JASB 4ZOLF 1P2GA 2AIRA 3DHYA 2JI8A 4URXR 3JARA 4JDUA 3QV2A 1O6GA 4OI2A 4TL8A 4JLVA 4UNIA 1MLDA 1MFZA 2BW0A 1FDSA 3JCZA 3L3BA 3OCCA 3WWDA 2A0UA 3LA6A 1ZSNA 3KB2A 4BWVA 2C77A 1MQ8B 2H2WA 4D82A 1DQRA 2NU9B 2L42A 3MINB 2F43A 1CQWA 5EJ7A 1T6XA 2J7PD 5AM5A 1KZ7B 4ZVPA 3ZBQA 4C6SA 4A16A 4X92A 3CH7A 5ADHA 2YVLA 4LNHA 5EJEA 4GE3A 4RHFA 5FLYA 3OIUA 2XUAA 3W79A 3HFRA 1ZH0A 2O2YA 3DF7A 4QAQA 1E5QA 3PQ4A 5F4ZA 4LFCB 1Y4AE 3F74A 1MH1A 2WTMA 4W5TA 1NQXA 2PMBA 2ZZKA 3IPLA 1H4QA 4URZR 4R2XA 3NNNA 3O8NA 3ROPA 1LW7A 4ZIRB 1F8UA 4OQPA 3VYUB 1Y7IA 1RJGA 4FX2A 3NOQA 1GUDA 3BB1A 2OBFA 4JJKA 1H2AS 1FQOA 3UAVA 2XIQA 2W6JD 4PC3A 5IMSA 1FJHA 3KJHA 5JECA 3G8YA 1NUHA 1MPTA 3IBFA 1KZ9A 4BLRA 5KYUB 5CUQA 2V59A 3AP2A 2W6NA 3NC4A 3H6KA 1FBTA 2UV8A 2FR1A 1J00A 3JZFA 4Y7DA 4CKEA 2HLHA 3KL2A 3LL4A 4RO0A 3D8HA 4CI9A 5IANA 5IUNC 1H1LA 4QC2A 4HWOA 3K0AB 4RMJA 3L4JA 3IAM6 3P5SA 4DM3A 5IPFA 1U2DC 2Q62A 3NBQA 4NBKA 1W48A 1MTZA 2FZGA 3MCTA 1O1YA 2QZZA 3K9CA 2A30A 2H00A 3RK0A 4C01A 1JLHA 1IWOA 3LPMA 4TYYA 4FC6A 4RDHA 1TKBA 4ZOLA 5LKAA 2P9GA 3PHIA 2C3PA 2PXAA 1JQJC 2WKSA 2IL1A 3BB4A 3DYIA 4JT8A 4MI9A 2PZLA 3GF4A 4NYMR 3H86A 4PLGA 3SM9A 4AMYA 4B2PA 1OIVA 3I09A 1AKYA 1YKGA 3KJNA 2XLCA 4RVDA 1RQNA 2G06A 2FPMA 4LRUA 2O3UA 3CX3A 5K8IA 1BRMA 3HM9A 3QY0A 5DNAA 1T6BY 3AGQA 1J39A 1WNFA 1G17A 3ESQA 4NHEA 1E94E 1QP7A 1SC9A 3S2YA 2A9OA 2G71A 3IELA 5M7EA 3GLFB 1K6EA 4KITB 1A2KC 1IOWA 1M2HA 3DO5A 1KQ3A 4UHDA 2WF5A 1QCCA 4WXEA 1ZVKA 5DULA 5G4KA 4LMRA 4NCIA 4U63A 3W2HA 1DAHA 1WZCA 4RKEA 4ZCLA 1VRCA 2HR1A 2XGGA 4AJ2A 3FOEC 1EESA 2FKNA 4Y1RA 4KR7A 4OTZA 2AKEA 3EZXA 1DAOA 2H2HA 4KQ1A 3PQ5A 1RQRA 4CQMB 4P3KA 5DKFA 2E4YA 5ADVA 1RWVA 3T7DA 4HFNA 3D4BA 4FW9A 2DHCA 1E9AA 4BQQA 3QKWA 1UR5A 3KWFA 1VCOA 4GW3A 2E21A 2JAPA 2XYGA 3G5LA 2OZLA 1JQEA 1FA9A 2I1WA 3OPXA 5C7YA 5LPNA 1K9VF 4LE0A 1DUSA 2Q3BA 4N7MA 4OA8A 5TPWA 4B2YA 1GT91 1QX4A 3HJHA 4DEYA 4F3CA 4U2BA 1KP3A 1TXGA 1DIOB 2HMAA 3JQ7B 1BGWA 4PSDA 1NMXA 1V7PC 5CX4A 1M0WA 3IP1A 5KHLB 3H9UA 2NGRA 1DPGA 1VPDA 1GUZA 2BM9A 1GPMA 1Z0FA 2IDKA 3WS7A 3O3NB 5EHIA 3EXG1 1RIIA 3RSQA 4YMUA 1ZAYA 1KYVA 4LDAA 3K4PA 3NWOA 3OQIB 2ZANA 1JQLB 3O74A 3OLYA 4P33A 5EZYB 2H08A 1NRIA 3A3PA 2HQBA 2X1LA 2VSOA 4QQFA 2G9VA 2PYIA 2VPYA 3ZU4A 1MDBA 4LYEA 5EIOA 1BX0A 1ONPA 3G2JA 4JV5B 1ID8A 3N7TA 1YFLA 3OY2A 2Z08A 3OA2A 3TTYA 2B9VA 1RQGA 1G18A 1PJ3A 3RIYA 2V0NA 5F1PA 2C96A 1VSTA 3MCAA 1MAHA 4NYMQ 3T41A 3CH5A 1XPUA 1J5PA 5AK3A 2FFAA 3U31A 5LYJA 2A8YA 5CP8A 1VIVA 1OTYA 3RS8A 121PA 1VG8A 3N3AC 5FUMA 1NONA 5BVGB 2BFDA 3LQQA 2F1KA 4NCHA 3EEFA 2X76A 3KKQA 4P3NA 1G9XA 1M8GA 5ALGA 2P91A 1T8SA 1KOFA 3STTA 2EZ4A 1EJBA 3NPMA 2JBAB 4G4SO 2V9CA 5C1DA 1IQUA 3UWSA 4A6PA 5MDHA 4Q15A 4YV1A 4ITUA 3O3MB 1A71A 1KO8A 4MI1A 5K1ZA 1A8SA 3C3DA 3VYRB 1RBZA 3WFJA 5A9RA 1VFPA 5IVKA 2HDNB 5AUPB 4LF9B 1BVHA 3ZCSA 2ZBUA 4HPWA 5DSXA 4ZVOA 4A91A 1TYZA 3ZUGA 1N8KA 1X15A 3T7AA 5JAIA 4RW0A 3KXIA 4WEOA 3LI2A 4CLHA 3BGWA 5ESRA 4C78A 3QYPA 1V16B 3KLMX 1E1KA 5GM2A 1THGA 1V5GA 1O9GA 1R0LA 5KQSA 1YOVA 3LOPA 3DOCA 2B4YA 4HEQA 4B33A 2RHOA 1C3OA 2FUG6 1N1MA 2DHEA 5SZKB 1D8TA 1JR4A 1RZRA 2BTEA 1NMSA 4N5IX 2CBXA 1UBRS 2JARA 3GNQA 4ZKEA 3DNPA 5DBOA 2XMRA 5EKTA 4CKXA 1SKMA 1W44A 4RETA 2ZSBA 4NJEA 2O3QA 3LLUA 4NE7A 4WK0B 4CCYA 1W30A 2DU8A 1WQ3A 3NDRA 1P7ZA 1YHNA 2RHHA 1BD3A 1ZU4A 3JQPA 4UAUA 1M6YA 2AR0A 4LY3A 2BISA 1KDYA 4JR1A 3NX4A 4ZFNA 1XYYA 1DO0A 3PYXA 2E4XA 1HQDA 1NX6A 1WUKS 4Q4AA 5GPBA 4BV2A 5FBVB 4TKLA 2Y1KA 2VTVA 3E27A 4AY5A 5LWQA 3OJEA 1RSZA 5ANRB 2ALJA 2HQRA 4JLUA 1Z5OA 2XOKD 4LJ8A 4DR5B 1G7CA 2OPBA 1WBDA 1WIWA 2XQIA 3U3DA 2XBUA 4E32A 2AFHE 4XFKA 4Z9BA 4BO1A 1KYYA 5EXEA 2B78A 5CLJA 1JG3A 3WLRA 1YS4A 3IAEA 4FZVA 2B36A 2XF2A 4I1VA 1YQGA 4U8HA 3RSOA 4BP9A 4DSUA 1MABA 1XF9A 2YJ4A 4H6PA 2W2XA 4RAQA 2FHSA 1Z5PA 4NYIQ 1QIIA 4MKXA 4BFXA 2ONYA 2D3WA 5JFGA 2EATA 1GJRA 3FY4A 1H9BA 3HXPA 4KGXA 4ZVNA 1F0YA 2E89A 4CV0A 1IVNA 1J8VA 1B8NA 1BE6A 5HKBA 1U90A 4ZDIA 4J0QA 3N3BC 4RESA 1M67A 2FMTA 3TN7A 4JS0A 3GQVA 1FU7A 4EKGA 1Y8RA 5J1SB 4OX9B 2N42A 5F73A 1PDOA 1E0DA 3HBNA 1QOZA 5BWCA 5E95A 1YDHA 5C5CA 3VR5D 2A9VA 2FVYA 4RFSB 5LBUA 2VJLA 5LUAA 4CF6A 4Z1OA 4GFDA 2DWQA 1ZUWA 2FFRA 4WESA 5CNKA 1JEYA 1YR2A 1VA4A 3CPEA 5KVCA 3GFSA 4KK3A 4R81A 2CJPA 3WRYA 5LMZA 2ZUWA 4M0DA 1G8HA 1ZOOA 2GAFA 3WBBA 1DOAA 4H7FA 1I4TD 2ZVDA 4R6WA 4PCLA 1ZGAA 4Q6BA 5J2UA 5HIIA 3ZX5A 3ICCA 3CVYA 2LCQA 3MAAC 2D2EA 1TLLA 2QTVB 3AFNA 4RSGA 5JCJA 3DDCA 1VSVA 4O29A 1QVAA 2BV3A 4OSPA 2QJWA 4TWRA 3PQ8A 3Q8MA 3SZLA 4NCNA 4NBWA 4XLTA 2CB9A 3QBDA 3WGKA 2YICA 2JG3A 1XVAA 4FCTA 1WF3A 2I66A 4O1MA 2ADFA 3IP9A 4JI5B 2CDBA 2QGZA 3QKUA 4FN5A 4HDRB 4E6PA 8ATCA 3RU7A 2D4HA 4U7FA 2QN7A 3EEIA 3DTVB 2WNIA 3F5DA 3CXUA 2R7AA 1LDYA 4WN9B 5BWBA 4LHEA 4WUTA 4KW7A 3LKVA 4HL6A 4I5GA 1ZO8A 3H83A 4QGFA 3HVKA 5DCLA 1AS3A 2W2NA 5DW3A 4RX1A 3UB3A 1SU8A 4MV7A 2RJ3A 4N0PA 3O5AA 1VE3A 3SC2A 3AUYA 3M5CA 4QJ3A 4XX0B 3SEQA 4D45A 1U81A 2TSYB 2HWXA 3COPA 3HACA 1VBFA 4GSYA 3PWZA 1SUDA 4LYHA 1TM2A 1PR6A 1YRQA 1XL1A 3Q12A 1JR3D 2Z8YA 3DEJA 1T2EA 3UJHA 1UFQA 3F2IA 4ZO9A 1OBCA 2VS1A 2VJBA 1LX7A 3ICWA 4G9EA 2OB2A 2UDPA 3AU9A 2X8LA 1NVVQ 2ZIGA 2HJWA 3L77A 4X60A 3G0OA 2A7QA 1E60A 2EBFX 4P82A 5A02A 2XQJA 1JV2B 1LFDB 2QRVA 2PBLA 3ND8A 4M0CA 3QOWA 4D3DA 3OU6A 3IT1A 1ZL2A 4ZT6A 3A6KA 2HXGA 2XYVA 1HTBA 4TLBA 3FWYA 4BGVA 3VO1A 1SU4A 1X1EA 3GUZA 1RYFA 3OF5A 2WIKA 2ZS9A 3KS9A 4CM9A 4W7HA 1PBTA 3S27A 2CXRA 1OGIA 2V4ZA 3LOUA 2AKYA 1PQUA 3SR3A 3VHLB 5JXGA 3WAGA 2H1OA 5JMPA 3JQQA 2P6NA 1MX9A 3ZPXA 2NSLA 4KR2A 3R3YA 1GFZA 1KFKB 1P19A 4WK2B 1U3GA 1LDEA 1M72A 5C1PA 5KYKA 1FC0A 5HTKA 1Y8CA 3ER6A 5JARA 3S1SA 2P2NA 1NNEA 4WOCA 4KQ6A 3W8EA 4NI5A 3RKRA 5TGTA 3O8CA 3VSDA 3CEHA 4V39A 3AB7A 1LLQA 1Z4NA 1RRFA 4EY7A 5LU8A 2XOEA 1QGOA 2XNHA 1I2DA 3R41A 1JR3E 1EG7A 1FTSA 2YH2A 2PG3A 2X13A 3A4VA 3BM5A 3KVNA 1PNTA 4IH4A 4JHLA 4II2A 4YJGB 1XNRB 2ZUEA 3DDHA 1CDZA 3LDUA 3LGSA 4ZQIA 1L7PA 1FFHA 2PVSA 3E1GA 2YQZA 3O21A 4EKNB 1ZA2A 3EZFA 4GWGA 4YUVA 4KVGA 3BGDA 2CL0X 1DPFA 4MCAA 1ZWLA 1V7ZA 4OXYA 1KC1A 2Y2UA 1GVHA 3WMGA 5KTOA 2WA1A 3E3AA 1RKVA 5DJ5A 3ZQUA 3LWBA 5BQXA 3IV9A 2QD4A 3KT6A 3DGFC 4X20B 5JMOA 4YYZA 5DM60 4LXIA 4IDHA 3LCJA 5D7NA 4AN0A 3U6KA 4CIAA 3FZEA 1JYEA 3TL6A 2A94A 5JT1A 2GFHA 2JLZA 4MKIA 2GILA 4QTXA 1IZ8A 4LF7B 2VJCA 3GRAA 1VL1A 3BSWA 4EJSA 5EWLB 4EHJA 2EF1A 1QIKA 1EGHA 3ESAA 1BXGB 1JHAA 2GPWA 3JYNA 3MD9A 3KUKA 4FOSA 4G4SP 3A9UA 5EYPA 4IHJB 3KOMA 4OFZA 3KXDA 4R2JA 4S12A 5FOTA 3CX8A 1Z5NA 1JIXA 4XAQA 3Q11A 3BE8A 3HY3A 1NYRA 4MYHA 5DH9A 2NUPB 3GYBA 3NIWA 3MFYA 2IOYA 2VDMB 3KDAA 2GX6A 3DBRB 1MJGM 1VFNA 3ZE6A 4B7UA 1C3EA 2MINB 1K88A 1BCRB 1NJ1A 3E82A 1XQVA 3O03A 1UF9A 4GI7A 3BYZA 4RACA 5GVRA 3L05A 1P5FA 2WYOA 1U3UA 5WRFA 1T0BA 3L9WA 4CG0A 5EMNA 5I4IA 4N82A 1Z4MA 5TMDA 4DY4A 3DNFA 4EJSC 4RTQA 4Q5IA 3R5SA 4XX0A 4LX0A 3CSSA 1G0NA 4L8GA 4LA4A 4P7FA 1J56A 3MVEA 1YDEA 1KU0A 4K3VA 2BGGA 1KU6A 3ANYB 4KRXA 4DQVA 3T0FA 1YQQA 3LCRA 4CMCA 3H9QA 4IV8A 5LQRA 5HF6A 1KRHA 1XTVA 2ZT6A 4C9BA 3AXSA 1POWA 2FPXA 2QN3A 3OZIA 4H1VA 3VR4A 3UW3A 5IWAB 1NBEA 3HXQA 3GZNA 2JJ2A 1GEEA 5M3BA 4KV7A 1NZDA 4L74A 5L51A 1CG6A 1RCUA 3Q7EA 4OKIA 2BGKA 3DBIA 4DMHA 4LF4B 2Q0QA 3HJRA 3VAZA 4E5KA 1JVBA 1P91A 4BO6A 5HQ3A 2FK8A 3C85A 2WJ6A 1V11B 3EVAA 1ENZA 3AHHA 4KLRA 4DAOA 4NJMA 2PWBA 2J5QA 4TZKA 3DFIA 1CQJA 1FVOA 3U0BA 4NY1A 3GB9A 3IKVA 3W04A 3HBFA 3ER9A 4MI6A 5GWXA 3LY9A 1DQSA 1CWUA 2YIVX 5CW2A 5CCEA 1UZUA 5TMBA 1EXVA 2PUCA 2IV3A 5LN1A 3BEOA 2DPHA 3PFIA 3JZMA 4RJIA 1E7MA 1FDRA 4REMA 4KDFA 4Y2TA 1QFXA 4CFYA 4I9HA 4OQXA 4TV9A 3QXGA 5MGNA 3M5DA 2J3QA 3RVQA 4MVJG 4PV7A 8AT1A 1T4BA 2IEYA 4OHCA 5FTKA 4B0OA 1FFSA 4IIFA 3ILXA 2V97A 4GLOA 5FV4A 2PX6A 1SHUX 1VYHA 3RUCA 1GILA 2F8TA 2IP2A 1PTJC 1RXIA 1RPJA 2R6CA 1G8GA 4M88A 1CUIA 3RRMA 2J3HA 1JDNA 1W94A 4KIJA 4J7UA 4F9TA 1JA0A 3FMGA 2VDOB 3K1AB 4GMGA 4TN5A 2IYRA 1PYDA 2K5UA 1K4MA 4L6IA 5TVGA 1XTPA 1XU9A 3MJEA 3PHHA 3AKZA 2OHOA 3WRXC 3VOSA 5K8UA 1B8PA 3RSGA 4EEKA 4TLDA 1GTMA 1X9IA 4FYWA 4OJQA 2RDMA 4N4AA 2OMEA 3GLHE 4WOJA 2C7OA 1MEEA 4F71A 1FTNA 2VCEA 1KOJA 4Q4DA 1D6MA 1QH0A 3BSSA 1A1SA 5DNWA 3WZLA 2DR2A 1LH0A 3QVWA 5CNIA 2ZR7A 3UKOA 3WLSA 2C5EA 1OFUX 4OQNA 1RWXA 1LVGA 4P9NA 4PG4A 4QUHA 2XR1A 4B4OA 1FY2A 2ZROA 3ONNA 4X1YB 5E3HA 1F14A 2W43A 3U37A 2C1ZA 2H29A 2QQGA 3KEGA 4H59A 4I3GA 2QNIA 3IC5A 4C0SA 3K73O 2OM6A 2R5WA 3EWIA 3P0IA 3IUYA 1I5RA 2XNCA 3R8XA 3VAYA 1LZKA 1GPUA 3DWEX 3KWMA 3QVMA 4NK4A 3VKVA 2W0MA 4J9VA 4DV4B 1MB2A 2UVDA 1E2KA 2OP1A 3FVWA 4LDZA 2Q4TA 4JHXA 3P32A 2YFHA 1NMEA 2R87A 3DB1A 5J63A 3RAEC 1XZDA 2SBTA 4UHJA 5K7SA 4ZAVA 5HUQA 1Z37A 1EUQA 2Y1LA 4Q3DA 2GFQA 2HA5A 2I22A 2W2LD 3CNBA 3D7NA 1FP2A 3SMQA 3FFXA 2ZVQX 2EFEB 1QGDA 4DB4A 5C31A 2R8PA 2HIAA 2I4NA 2TMDA 4BQEA 2ZJ5A 5DN6D 1UEXC 2BH2A 5FUVA 3F47A 2A67A 2I1QA 1VL6A 1XRLA 2Q6TA 4OFXA 1YRWA 2HY7A 2JGMA 2KMLA 1SEVA 1FYFA 3PHJA 2GNAA 1T5DX 4EI8A 3PITA 1ADJA 3O94A 2ORIA 3QRWA 2VQ6A 4HDKB 3D5EA 3QU5A 4DM7A 2FOLA 3E22A 1U8TA 4LDQA 5DU2A 3W1EA 1QZUA 1QWSA 1RRKA 4BQRA 4CIYA 2EJBA 3D6VA 4DLKA 1XQYA 3A9RA 3AVUA 1M75A 3LO8A 2ZZMA 2JBAA 4A10A 3QNMA 2PMFA 2YV5A 5TGZA 2DYKA 1IDN1 1I1NA 1MC1A 2HK9A 2ZJ1A 4PICA 4V0QA 4BRWA 4YRAA 2FOIA 2ZRAA 1W5EA 1C7JA 5LUBA 4P32A 1ADGA 1I6KA 3W8RA 1KI6A 5D51S 1G3MA 4N7BA 3S1AB 4HB4A 5LDGA 4EEZA 2MMGA 5A5VA 1TEVA 1TO2E 4M89A 3T1VA 1DDIA 1BKDR 2BHNA 4A0QA 5KIAA 1UXOA 1IOZA 4KDEA 2N75A 2P9TA 1Z4JA 3IAUA 4BX2A 3SU8A 1XPOA 2PL1A 4LY9A 2W2PA 1CERA 1SD1A 2XUFA 3STWA 4ASUD 4A4DA 3FMOB 1C3JA 3OFNA 4ENSA 1QU2A 4ZD6A 4D25A 3DLCA 1P9RA 3HR8A 2VAVA 1XP8A 4Q4LA 4XGKA 4QUJA 1BX1A 4GRDA 3ZGNA 4HVCA 1JU4A 3SLKA 3G2MA 4OG2A 4BLOA 4PZCA 2PX5A 3IBSA 2IYTA 4HBZA 1WY7A 4FE4A 2HU2A 3LCMA 1L4GA 5HIJA 3WGYA 4Z6KA 4LYDA 3DB2A 5AT1A 5IZCC 4CIWA 2I62A 5ALXA 3A1NA 4BU1A 2FPIA 5KAMA 3T12A 1B2LA 1Y5NA 4MAMA 4CETA 5JSKA 3BRQA 2HSJA 1SIOA 3KV1A 5F3RA 3BB3A 4EG7A 1PEDA 2WWRA 4RHUA 4RTKA 1P0MA 1YU6A 4MUJA 2O4UX 5D6NA 3ZY3A 2EWVA 4QGSA 2YHAA 5LQCA 2CMDA 5KWJA 4F7WA 3GJ3A 2GAAA 1U1CA 4GP7A 2PRZA 1DCKA 3KDPA 1DXQA 3VSEA 2CUZA 1GV1A 3VI4B 3QLVC 5DHAA 3QOYA 1TLTA 3EVDA 2GD2A 2NZVG 4IRMA 1GN8A 5F7JA 2VYNA 3T7TA 5CA1A 5KMGA 2WQ6A 4M1SA 3ZU3A 3ZHRA 3NALA 2W6ID 5F2OA 3IL2A 1FW6A 3HA5A 4ND1A 2D0OB 4LXYA 3CZCA 3GCZA 2P4SA 2QQFA 3BF7A 3R5TA 2Q3CA 4ZN6A 5LM3A 2D13A 5E6RA 4KX5A 4H0NA 2NUAA 1RC1A 2JAHA 2ZI5A 2QEQA 2ZTVA 3H04A 4YJ2A 3WMXA 3Q0TA 4BWYA 1MVOA 4FHDA 4Z2YA 2YS7A 2JFVA 2Q1WA 2VKTA 1DINA 1PWHA 2HL6A 3B9BA 2KLBA 3EF1A 3KKOA 5EKUA 5F76A 2ZJFA 3TQRA 5IU6A 4TWBA 3OE7A 4MR8A 4X6YA 2AC7A 4NEQA 1M1ZA 3O0DA 1NAHA 1PD1A 4I0WB 4L57A 5A7FA 2WI8A 2ORYA 1X1TA 3WL4A 2FWRA 2AMJA 4HFJA 2J6BA 1AIPA 2HF9A 1PNQA 4MGHA 4X8OA 1TB4A 1KQNA 1EBBA 2RHWA 3QLTA 3THYB 3JWHA 5EXPA 4EG0A 5K3SA 4YCDA 2VHCA 1KZHA 1ZAKA 1LVUA 1ZOSA 4H7JA 4KXYA 5DYYA 3DUWA 2A0KA 3RSLA 5BWOA 4YBZA 2EJWA 1R66A 1BG6A 3CBGA 4NG5A 4A8PA 5AUOB 4V02A 4RKRA 5KQRA 1F0PA 5LC1A 1F1JA 5AXAA 2O8BA 3G9ZA 5CDSA 1A4IA 2O1SA 3G6WA 3SEAA 1P4SA 5KC8A 1CR2A 4UE3S 3ZGLA 2B7CA 2O7NA 4WNAA 5J2UF 1HK7A 1U7UA 3LLMA 1FRZA 1SOAA 2CNNA 1JYSA 1PT5A 2W37A 2YV4A 3HDQA 4Q00A 4KUHA 1BA2A 2FMFA 3DDZX 5DEOA 3CONA 2QUIA 3BA1A 4RLSA 3UWPA 3D2BA 1L5QA 3HUUA 2PDAA 4HDKA 4ALNA 3OCYA 2IYXA 5KYXB 3KLOA 1D1TA 3LUJA 1X2BA 2Y0PA 3SI7A 5CA1F 1ZITA 3H5NA 2NU8A 4I1IA 2ANCA 1W2WB 2QSZA 4O63O 5JWHA 4EA8A 1JIKA 1Z7GA 4AZWA 3HKEA 4JN6B 3IMKA 3GVIA 3UPTA 3M82A 5AKZA 3W2FA 2ZAMA 3Q3HA 1PZGA 1ZXXA 4RENA 4JLDA 5BR1A 1NMYA 3F46A 3KQVA 4XW2A 1DADA 1HYGA 3BWDD 4YGYA 4W6QA 4M8LA 1JPJA 1R4MB 3MOGA 3X2SA 3N0VA 2GMWA 3AV3A 4ABTA 5DW0A 2WHPB 5CDFA 4CFZA 2G28A 4UE2A 2IKQA 5AVYA 2PFSA 1E5TA 1KYWA 1KSGA 2JA2A 3V4PB 3E6AA 3KALA 1IPHA 4N3GA 3DEIA 2H9YA 4GUAA 2I6TA 3FGNA 4D44A 1Q0LA 1GQQA 1WPXA 3NWJA 3NHFA 3L8ZA 1FSFA 5DM1A 1GHTA 2DFTA 2C04A 1CUSA 2I2BA 3QELB 3AL2A 3OOEA 5IVIA 2PS9A 2Y1XA 1KRWA 2PUHA 5FTLA 4BO9A 1F2UA 1PK7A 1S2MA 2HZBA 2XMZA 1LKZA 4WKGA 1SXJD 1Z2OX 2Q41A 3Q7TA 3GQBA 3QQ5A 1FXUA 2G1UA 3HKBB 3IQZA 1E2FA 2W4QA 3EDMA 4HY3A 3O90A 5ELLA 3UVEA 1A5BB 3ZS9A 4C4ZA 1NVGA 3NWBA 1U3FA 4ALKA 4QT4A 1PZFA 2FZ4A 3PPVA 1BKYA 3D8SA 1JT9A 3EVTA 4XPIB 3BGSA 2HU5A 3GUUA 3DPSA 1QS0B 1L7EA 3JR3A 4MW2A 3AETA 1ZIXA 3ZE7A 1JSCA 5ERGB 3PHGA 4A0RA 1DBWA 4CMBA 1OFTA 2JRLA 2YBDA 4L8LA 4M0UA 1WEKA 2VDPB 5ADWA 1T35A 1EKXA 2OWEA 2CFOA 1K86A 4Z0HO 1YJBA 3JVUA 1KJIA 2FN9A 2QTMA 2VAWA 3HFGA 4PX2A 5FTJA 3IUNA 4D98A 5AI8A 5C18A 1EFAA 3R9XA 3R3ZA 1JSRA 1Q7RA 3DAGA 3EFHA 3QLVA 1SNYA 3HJCA 5FO1A 3RS9A 1TTTA 1DQZA 2Q3DA 1GR0A 1T0PA 3AI3A 1JR2A 3GJ7A 4PGMA 2O8EA 3FNFA 2IYWA 3HYRA 2EG5A 5T8KA 4A2QA 3LWDA 4DRYA 1G41A 2WF8A 3FKSD 1G5HA 4IUBS 2GVNA 4DNFA 2R44A 4K40A 1GPH1 2AG1A 3BE4A 4XIGS 4XPZA 3TG2A 1R6TA 4FZ3A 1YR1A 5L7TA 3NAZA 3K71B 1Q84A 2JI7A 1Y8AA 3IRVA 1B00A 1SVKA 4WNIA 3GCGA 3I42A 3CHYA 1RLJA 4FGSA 1Z06A 3RARA 1OLSA 3NIDB 4IDQA 3KZKA 4K5QA 4OKNA 4UNQA 5SICE 4JVNA 2WT9A 3VR1A 1W1IA 2HC9A 2R5NA 3AIMA 4EJ6A 3T0GA 1CETA 4X45A 1CY8A 5CIWA 4DG5A 3GA5A 4C76A 5ISMA 3IQIX 4IRUB 2QUHA 4QO8A 1CY2A 1TYDE 2VA9A 1LV8A 1K0UA 2F3UA 4N6OA 4N8EA 5DOVA 4XCQA 4MHSA 4PVCA 1XCBA 2F1JA 4CIXA 1RXUA 4K9DA 1GXSB 4EA7A 1XXHA 3DT8A 3HDVA 1WV1A 4WZAA 5CLHA 2ZRKA 3HDTA 5NULA 3I01A 3QHQA 3FLAA 3CRQA 3ZU5A 1E4YA 4Y6QA 5D6OA 2WD7A 5CFQA 1CXZA 4HSGA 4OD0A 4I5DA 4BFLA 1SKBA 3GRKA 2IS1A 3P9SA 3BJZA 1GT6A 1ECPA 4LI3X 1DVRA 2X6RA 4Y2UA 4AI6A 1E2QA 2B99A 3EVCA 5D00A 2M1ZA 3KKZA 4WMLA 3LGAA 2PKYX 5DHRA 5LP6A 4YBRA 3ZGZA 4L5IA 3RIGA 1RRCA 1E6EA 1VYVA 5KBYA 4GU5A 1BSVA 5HKKA 5IK2D 1V6SA 2Y1FA 3I01M 4MUXA 4PSUA 3OQMA 3U4QB 5EQTA 2VOJA 2YBEA 5SY6A 2O23A 1HPLA 1ZIOA 2G80A 3EIWA 1OT3A 4AK9A 4HLUA 3PXGA 4EB0A 5GY7A 3L06A 4HWKA 2GJ4A 3PJFA 4OKSA 4A5OA 2NZJA 2X6QA 2HNAA 2QT1A 3A37A 3N8HA 4OIFA 1MX5A 1JE0A 1RCTE 1GLGA 3N5CA 5FULA 2FSHA 5IBRA 1WOYA 1MR3F 1JHMA 5EL0A 4JI2B 5HCIA 1EUCA 1X80B 5EQFA 1MEOA 1XR3A 4IJ6A 3IH5A 3TCNA 4GAEA 4G5OA 2ZDHA 1ZRSA 5KKCA 3CRMA 2ZBVA 2BR5A 4PLVA 4A03A 4J3JA 2G9UA 4KN8A 2B83A 1S8FA 3R75A 3REQB 1X38A 2CL6X 2PCJA 3N0WA 2P4UA 1BC5A 5CK4A 3G88A 2K7ZA 4I99A 4F9GA 1Y5RA 2H1RA 4MROA 1PJCA 3IAAA 2ZRCA 3PVCA 3D1VA 3W3AA 1GCGA 1Z68A 3PJEA 3OE1A 1TT5A 3NV7A 1BQ3A 3H4IA 2LGJA 1JEOA 1CR6A 5SZIA 1I3MA 4Z0PA 5K6AA 4UXJA 2JLVA 1KIAA 2HPAA 1LK7A 4WBSA 1T2UA 2EXXA 3CRRA 3I8SA 3PP8A 2W6IA 4TTAA 1L5ZA 4LIPD 3RRYA 2IOFK 3H2BA 3OETA 3TUZC 2ZCJA 3LRPA 2PR7A 2X7JA 2H2DA 1LTKA 4BJ3A 1KPGA 4PTLA 1KK2A 3GUVA 4AJNA 2IE8A 2P0AA 2AFIA 1H0SA 3USZA 1W0JA 4MA4A 1JFRA 3AF1A 4CDRA 1FS5A 1K8RA 4IIYA 4EW6A 3QVJA 2BM1A 4J0GA 1JDBB 4LXUA 1AQNA 1NSFA 3RBZA 3GIDA 1SD5A 2AYXA 3A32A 5A05A 1Z56C 3RVSA 4C7KA 2Z30A 3D43A 3ZCXA 3ADBA 3FETA 2NPFA 4AM8A 3O75A 3EZ7A 5DP2A 8OHMA 1BWRA 1QIFA 1BXRB 2A9JA 2AEFA 2GK4A 2QYTA 3U19A 3R6TA 1H05A 1GPDG 4ZYWA 2Z2KA 4RD4A 4B3MB 2JJ1D 1JI0A 1QGUA 3NTVA 4P58A 2R96A 3NVMB 4QOGA 5F9HA 1CV2A 3G82C 5HK8A 4NJEB 4RZUA 4BQIA 2TYSB 1P61B 1N77A 3J7TA 1GQYA 2BGRA 2CNOA 4D9MA 3KQLA 1QX3A 2I8AA 1EDBA 5KJEA 3KXKA 1H2ZA 1XALA 3GY0A 4GIBA 2LNDA 4QYWA 5BT8A 3SQWA 3LC0A 5I5GA 1DX6A 1ZLXA 2BUAA 4MJ7A 3IVAA 1AV7A 1NNLA 4YJFA 3LPCA 4PXAA 2I3AA 4YXWD 3JYQA 3FJ1A 5J4KA 2ZRHA 3UB4A 4D9GA 2ZRNA 1I1HA 2ZAIA 3MMXA 1J0XO 3NWEA 2ZB4A 1CS4C 2A9RA 3CNNA 3OAAA 4YDRA 4D9EA 1NW8A 3BD9A 2OOKA 2QRLA 3P27A 4AQDA 5I3CA 2PNJA 1MJ5A 4P93A 1FSZA 1DKOA 3W9BA 5LJIA 1IJKA 1F20A 1T2DA 2B1GA 1TJNA 4AQYB 3AHEA 1SK8A 1JLKA 1NUUA 3ZDXB 3UENA 1S2DA 4QUBA 3VC2A 3E05A 4D6PA 4MLDA 5JZ9A 3ABZA 3NDJA 2XPCA 2UUBB 1JVNA 3L6DA 2QTCA 3C3AA 1OWOA 2NSJA 3EXFA 5EMLA 1RIFA 2BL4A 1SVIA 1FOEB 2DBZA 1L7QA 1ZESA 3HP7A 4J76A 3DMTA 3BMCA 1SUWA 4XASA 3T1QA 3GWGA 3FNBA 1RM5A 1GPJA 4EX6A 3OMWA 2GYVA 5DYIA 5FBQB 3RC2A 5EHQA 4LPKA 5FCDA 4BO8A 2C00A 2GEJA 4HQNA 5DGCA 4WY2A 4BZZA 3RG2A 2FF5A 4O3MA 1N1EA 5AK0A 1GL3A 3R23A 3C48A 5DNVA 2FEAA 4EY6A 3AZOA 4ZCSA 2YYSA 1AH2A 4NENB 4MUMA 2B2NA 4GD3Q 4NOMA 2X1HA 1Q7EA 3LP6A 4DCNA 4YMTA 1IYZA 2PSDA 4AQ7A 1GAQA 5DXFA 3D54D 1AF7A 2ZSJA 2R8RA 4WZAE 3EVGA 4F5YA 3HDGA 1ABEA 5I7AA 4TMXA 3IESA 1SVWA 2B34A 3P2JA 2ODQA 3E70C 4EEXA 1T2AA 2NM0A 1G5PA 1CUFA 4CU2A 4B45A 2Q5LA 5JNLA 1HTTA 1M34B 4A73A 1K7EB 4OK5A 3N53A 1ULTA 1WHSB 1Z6AA 4JC0A 4LMAA 1HT1E 4ZCPA 5CA0A 2BY4A 1Z3CA 3TIFA 4C14A 2ZS7A 1HE4A 1E2DA 2AYYA 5ILGA 1F2VA 3ODPA 1JILA 4NPAA 5TQ2A 5E6SB 3THXA 1JSLA 4Q93A 3ZR4B 5K0BA 2L69A 5JTTA 1HRDA 5FOSA 1SWWA 1E1QA 2QMEA 2VHXA 1ID1A 1WV0A 2XA9A 4P80A 3TNJA 1EEXB 3QX9A 4QEKA 3E8MA 5KCZA 1VG9B 3Q2KA 2C42A 4TXNA 3WV5A 1UJMA 2PXHA 4JJIA 4Y7CA 5P21A 4EY4A 1SBHA 3ETLA 5J2TF 2HIGA 5HRCA 5A7GA 1UJ5A 4ETNA 1JZQA 1PJLA 1W6UA 1YC5A 3D6FA 3W34A 4TKVA 3ZYCA 4PHHA 5CVUA 1VJCA 1NUSA 2PH3A 4C4RA 2XXJA 3VKUA 3I2GA 3JQEA 1YMVA 2PTHA 3RF6A 3M3PA 2WWFA 3DBHA 4R31A 4J03A 3UJNA 3TD6A 2BUBA 4Q3CA 2VL7A 3UAXA 1Q0TA 3U1BA 2FP4B 4OOFA 1DL5A 2JFPA 2MTBA 2YXLA 4V3CA 2H65A 3K92A 4DMLA 1I32A 4QX6A 2AUMA 3O38A 4X8LA 3RJMA 3VKWA 4RVFA 4C20A 2QZ4A 3BZBA 3SR0A 4WOPA 5EJ8A 4DM4A 5BQ5A 1CD5A 1X8LA 1NRWA 1UXIA 2J3LA 5EE9A 4WZBE 2YKGA 1MG5A 2NVBA 3B6KA 3BMOB 1QTNA 4J2OA 2OQVA 1H3FA 2F55A 4RIEA 2NTNA 2Y0BA 4LZJA 5KZMB 3HKBA 3CKMA 4X9XA 3ZTTA 1WLSA 1ZY2A 3RIEA 1SJ9A 2W6OA 1FSPA 4WK4B 1ONBA 1ONNA 2R6DA 3GELA 3T06B 5EMHA 1EXMA 4LSMA 3ELBA 2VT2A 3DMPA 4IZ6A 2WB4A 1Q11A 4D02A 4F3NA 3OP1A 5HE9A 1V4VA 2X4LA 4FZ5A 2YFQA 4LZZA 1QHYA 1NVEA 4BN5A 1WWKA 1EB9A 2I1LA 5ALDA 3FKJA 3I53A 3IBTA 3HA7A 1IOVA 2QVZX 1RVDA 2XVYA 1IN8A 1JLSA 3ML1A 3P2MA 2IKSA 1TADA 4ABYA 3QVVA 3N8IA 2P5SA 3V9PA 2I87A 4NECA 4O08A 1ZD1A 1N4AA 1EJ6A 4B3IA 4LVOA 2QRKA 3AT1A 1YK0A 4NZYA 1G16A 2XZPA 4CIVA 2C54A 3B1KA 3IPRA 5BSMA 1M6NA 2F62A 2BD0A 2UAGA 3GA0A 4WCFB 3KKEA 4PQGA 1ZW1A 4JLSA 4G97A 2A5GA 2Y1WA 3S29A 3DBLA 3GUCA 5BPFA 3B3QA 2PKWA 3JZIA 4MGIR 3K6KA 2YYYA 2QF7A 3RSFA 2VA8A 3TQFA 1RHRA 2IHZA 1P9NA 3KZVA 4XD7D 1E2GA 3NUZA 4Y2GA 2DBQA 4YWHA 1IY9A 2WJJA 4JX9A 3COZA 3CYFA 1FUYB 2HRQA 3RYHA 1XTZA 5HDQA 4YV0A 4L51A 4ZGWA 2YMPA 4CKYA 5AW1A 1N6LA 1QIHA 4TZ6A 3WAJA 2O20A 5EJMA 3UPDA 2LCIA 3RJ5A 1QQTA 4HQ6A 5E2BA 4HHEA 4MW0A 1N34B 4K7JA 1VKZA 1SCQA 1XD8A 1RYZA 5I6DA 3ET4A 3R3HA 4WKBA 4H2DA 1V9LA 4EK9A 2FZKA 1XZHA 4Y2QA 4PHCA 4BO3A 2ODNA 4OBXA 5EP2A 1OFHA 4MQLA 4ILKA 5SZJA 3T7JA 2EFGA 2XGJA 2TMYA 4N3AA 2DUMA 2BMVA 2YN4A 4KG7A 3LFHA 2VNAA 4JR2A 3M4JA 2JVKA 3H17A 3LNTA 3IBGA 2UUCB 1G1MA 4I46A 2XVMA 1ML3A 3VA7A 2ZRFA 4BMNA 3HBJA 4JJAA 4YRPA 4H60A 4RL6A 3NRCA 4NU8X 2EGGA 2GPSA 3LM8A 4DFDA 1I3NA 3SQNA 2WKWA 2MJLA 3U7QB 2NN3C 2R6AA 4JY7A 4IHJA 3UJ8A 4YRSA 5DZSA 4TV9B 3R0JA 1EVIA 5FOXA 2RBEA 2QT9A 1UJBA 3KKMA 3OEED 3KOXA 2XH8A 4DS3A 4ZHSA 3VVLA 3H87A 4B3HA 4BTLA 2N46A 3PBKA 4N9WA 4QTYA 1C3VA 1DUVG 5K8VA 4FYVA 2O0LA 2NXWA 1OB2A 1JHDA 1M6HA 4MQ5A 3ZE1B 1S2OA 3A9SA 2GESA 3LTNC 4GI1A 4DLYA 2H1IA 5K3CA 3GT0A 1B23P 2EFCB 2JZNA 2ZPUA 4GP9A 4M9UA 3IUSA 1U8ZA 1JW9B 2GT1A 2RG1A 1IJBA 3RRFA 2YUTA 4Z9XA 2A86A 4J3FA 3VDRA 3GDHA 2FUNB 5DX8A 1K0FA 3OZFA 1K2VN 4HATA 2BEJA 2O4CA 3Q2OA 3M6WA 4MWBA 4W5HA 4YJDA 4PPYA 1J2RA 1JAIA 1PGOA 1XO1A 1GNSA 1ZNWA 2ZKLA 3H99A 1B42A 2PV0A 1KMMA 1UBFA 1U1DA 2RGEA 3LW7A 1GCIA 2VJMA 4JP2A 4YFYA 5IH7A 1L5YA 1G60A 4YJGA 4ZA2A 1XTRA 3CT4A 1G20E 3O9VA 4QGBA 4XWYA 5CU7A 1GGEA 2EJVA 3EG9A 2GTHA 5CT6A 5FT9A 3WYAA 2PJRA 2XUQA 1I7LA 1O94A 3FUWA 4ZJZA 1E2PA 2I76A 5JFOA 4AF8A 2BMDA 1Z2DA 1WZEA 2WD9A 5DLPA 1BJKA 3ZZ0A 2WUDA 2I2XB 5ALUA 1WQ1R 1KE2A 4DCVA 3K16A 3A05A 5JIBA 3EMKA 1E98A 3AUTA 2FFJA 4U2FA 2ZSUA 3D64A 4ALLA 5KNDD 1WR8A 1EQAA 4TS4A 4YLGA 1K27A 4IS3A 4HQ0A 4V1CI 1OZGA 1XAIA 4ZPXA 5DHUA 3GPBA 4FPXA 1SEPA 4K0KB 1QFYA 2H3EA 3LPNA 3HU1A 5CT8A 2XUIA 4ZVKA 4PZDA 3ND7A 5AHKA 1XDSA 4D0GA 4QO7A 3GNSA 5LL6P 5EXTA 3B1ZA 4GS5A 1H4SA 1JHXA 3EBOA 4WFKA 4L78A 1GXSA 1UC4B 2Y4OA 5EWLA 3WA7A 1A8UA 1NHWA 2PU7A 4HXFB 4IKOA 1VHDA 4WVFA 3MPUA 1L4LA 3L0BA 2XGMA 1U5CA 3KVVA 3B3FA 4IYRA 4XWTA 1TZ2A 4BL5A 2FI1A 4BKOA 1AXEA 3K9QO 4BDSA 2Z4RA 2AJCA 4QAJA 4ER0A 2A0FA 2JFUA 4GBGA 5ADUS 1W9MA 1KZYC 5DGHA 5KVAA 3KOYA 2G67A 3RTEA 2QUBA 1M6VB 4FBLA 4WK6A 1CY4A 1GQRA 1KWGA 3WKAA 3F3MA 4X1KA 2DFVA 1U63A 4WFJA 4W4TA 3DAFA 2LIVA 5AKIA 4GICA 2NXJA 2IHTA 1E4EB 1X7ZB 4LYAA 3WK8A 1NJ5A 1PVVA 3X44A 4L5AA 5LQDA 2YWBA 2VK1A 1E2BA 4OFWA 4L2IB 5I47A 2UUOA 1H8HA 3E9YA 3GMTA 4F86A 2IOQA 1TUEA 3ICEA 2PQ0A 4ZT5A 3FUTA 1VA5A 2BJHA 4M7RA 1E9BA 1GDDA 5G0SA 3OKAA 1LBSA 1XLTA 3QFTA 4DRXA 1JYFA 5LP6C 1QRAA 3IIMA 4KODA 3ZW9A 1TRHA 2O2SA 1TZMA 2OFFA 1JUDA 3UGKA 3KOZA 1CJSA 1BKSB 3GD7A 3AWIA 1YUBA 2JIOA 1DTWA 1V45E 4WI1A 4DADA 3SZRA 3WLNA 2IQ5A 4LC1A 3TNDA 1M8FA 3ER8A 3JQFC 3IP7A 1BJTA 4ZOQI 2C7QA 2TECE 2IYAA 1V2HE 3Q6NA 1OROA 3VFDA 3K94A 1NJ2A 4D0LB 4WLOA 4RD3A 2QUKA 4QPZA 4XEUA 3HFSA 2GRJA 2HK7A 4WFQA 4XE5A 3CLRC 1M6VA 2ZIZA 4PXSA 1MV8A 3TI7A 3URKA 3VSBA 3L82B 1D09A 3HLTA 3KB8A 4HI0E 1ICIA 3VZDA 5LKRA 1MRSA 2BCEA 4MQMA 5A7HA 1P5JA 3BMNB 3EEOA 1U0FA 1PJSA 3TRFA 1H5UA 3BCUA 2P78A 1NIPA 3GH3A 3QBJA 4WASA 4DNOA 4A0HA 4UPDA 3DC2A 1P33A 3EGXB 3O8OB 4RSRA 2XMGA 2JHAA 1X1QA 2BVNA 1Z0UA 1IE3A 4WOBA 2QN8A 2R68A 1Z4OA 4Z3DA 1F5SA 3S68A 1ADBA 5KOJB 2CBZA 2Y9PB 3R8FA 3EBLA 2PLNA 4KP7A 1GAXA 2ZYVX 3HEBA 3WFZA 1IHPA 2Z6VA 2O1WA 3AERB 4HWPA 4IP0A 3UATA 1G1AA 4G0QA 4ZU3A 4EJ0A 1N6KA 5G3ZA 1J99A 1Y7HA 2VYQA 4A2WA 2ONCA 5T8KC 2VP4A 5JD6A 3OTIA 1H9AA 1Z16A 3C5HA 3R77A 4MB6A 4IXNA 4YO7A 4ZTZB 2I1VB 2BDUA 1IN4A 1OXTA 4PYOA 4R1OA 3BJEA 2YHUA 2XLBA 4JJGA 3AHJA 3H2SA 1OI2A 1XV5A 3AOEC 3KX2A 4HTFA 2PIDA 4WACA 5CFOA 2XZLA 1QHNA 1EGAA 2JS7A 2RSLA 3ZXXA 5IBCA 3PL5A 3QK7A 2YXEA 3S2GA 1FMCA 1E32A 4LNUA 5JLAA 3CUUA 4R68A 1CDDA 1QHHA 3AFHA 2ATXA 3FBGA 4IQ8A 1DG3A 1LY1A 1XE3A 4YGXB 3L04A 3LO5A 1SFRA 1GKKA 1R6XA 4KGZA 4ZQEA 2ZE6A 3EGOA 3MXTA 5ALRA 5EJ2A 2GF0A 1MAAA 2G07A 4GC9A 5LZ7A 1U4NA 3GNLA 3ZDFA 4E4YA 3EQ2A 4M7WA 3OPQA 5TQVA 3MBIA 3OQ1A 2O07A 1R5OA 2I2CA 1Y33E 2PS3A 4KH0A 1MFPA 4FUQA 1T4GA 1XZNA 3QJYA 4QVKA 3RUAA 3T3GA 2R8BA 2P65A 4AWAA 2FUCA 3GJXC 2HHCA 1VMEA 1ZRMA 1SBIA 1W59A 4R98A 3UUGA 3V55A 1H23A 5JTUA 4ZPJA 2CK3A 1QH8B 3FR7A 4AZ3A 2OTCA 2QVBA 4EKYA 1LF5A 4MYDA 3COJA 4ARUA 4F4DA 1DWQA 1Y6JA 2GN4A 2XBLA 3ZHOA 2OO5C 4RHTA 1EP2B 3K2BA 2P6OA 5IDYA 1YVUA 4N65A 2AL7A 4POAA 2IQIA 4Z4GA 2FOXA 4M98A 3U5TA 3LYAA 3G8CA 4BBZA 3PR2B 1JZTA 3ONDA 4KRGA 5I9TA 4Q4JA 1RBMA 1XDWA 5FLXA 4ZMRA 1GPYA 3EXHC 3EZYA 5JWOA 1ZP6A 3FZQA 3O84A 2GI4A 5FKJA 4EJSB 4CTJA 2QMUA 2ECKA 4HS9A 1E3EA 3ELYA 4Y6OA 3BIFA 5IF9A 1CS0B 2O7SA 3AMVA 5AKKA 1GGHA 3PC3A 4P4SA 2YYAA 3LD9A 1J8YF 1LC0A 1C0LA 5AJHA 3RFVA 3TUIC 4YMLA 4DC1A 3I2HA 4EPYA 5IHXA 4OQMA 5FL7A 5CDYA 4RV9A 1A9RA 2OG1A 3NEPX 5ECWA 2DKNA 1DQYA 2NAFA 1EA7A 2PGOA 3I2IA 1KKUA 3IDSA 5DX1A 1G5FA 1U98A 4FDLA 4H77A 3Q3CA 2IY8A 1VHTA 2EZTA 3K1ZA 1QKIA 5DBFA 1QPGA 3AJAA 1ZUNA 3AVOA 1U31A 3QOXA 3V8EA 1PFKA 3D1LA 1PS9A 3FVRA 4UZFA 4LRWA 3BPSA 1UBOS 1ZVVA 4DR4B 3EDQA 4PLZA 4PWYA 3K9BA 3JZDA 5HF9A 4RVCA 3RNOA 2WJ4A 2CZQA 5EKXA 4EF6A 2G0TA 3M70A 4QRHA 4EHAA 4FQ7A 3GLUA 1Z0DA 2WHXA 3EFBA 4RORA 3U3KA 3KSBC 1S4MA 1ZEMA 1JH8A 1UMBB 3EZ2A 4UVDA 5BQOA 1DC3A 1KTVA 4JIMA 5BPHA 1N0HA 3STXA 5BYKA 2X9VA 1NVVR 2FWNA 4RK5A 3OEYA 3NGLA 3FUCA 4CF7A 1PWXA 1U4SA 2EJTA 3JQRA 4WA8A 5NLLA 5T4EA 4OQQA 4CYMA 3RSSA 3SJAA 2YASA 2EKZA 3EE6A 2O2HA 4U7DA 2WMNB 2B4AA 1WL8A 2HK6A 1R8SA 2QA5A 1WTAA 3HP4A 3T5BA 3AEKB 4H1WA 3W77A 3EXIA 1J8MF 1UKZA 2P67A 5JADA 5GINE 4LJLA 3HDJA 3T5CA 5HMLA 1BDJA 2CFIA 4IDAA 4J4TA 1WKVA 4R54A 4ZI7F 3CB4A 5CA1B 2V7BA 1WW2A 4OHRA 3BGOS 3T9DA 2BKEA 2VNSA 3KL4A 2D7JA 1L6RA 1IN7A 2AZXA 4LN1A 2GCIA 3CVJA 5TPWB 1WZIA 3SBEA 3QX3A 4IHKA 4DCCA 2ZFUA 4YP9A 4B81A 1IPEA 1QCZA 1CUEA 2V3WA 2J0UB 4KE7A 1JKJB 3UC9A 2DFDA 4F8YA 3OZEA 1RLIA 3UM9A 4JR0A 3JW8A 4BASA 2HSEA 3GRYA 2OV3A 1WDMA 3RHZA 3TTWA 3X1ZA 1P3DA 5GZ3A 2FY8A 2H7CA 1JHRA 4DJTA 3V8MA 1RTTA 2CSUA 2DKOA 5K8LA 2Q4RA 4CG2A 4MZDA 5DI9A 1GAJA 2QB5A 2GS9A 4F60A 1H2YA 1TAUA 4E15A 2XDQA 1VIDA 4WBXC 3LVBA 3EG9B 5K0LA 1QC5B 1ODTC 1J23A 3C39A 3FAKA 1ZGZA 3HR4A 2GEFA 3DNMA 1KK1A 4AJ1A 4RJKA 4KRFA 1FNDA 2PANA 3R5JA 3ZLUA 2E87A 3AESA 5DK4A 3OQ6A 1LNSA 5ALWA 2XJ4A 2DCUA 3W7AA 4UKDA 5INTA 3ZKAA 5HHTA 1FU4A 5FEUA 3ZHZA 4BNDB 3PGVA 4UM5A 7GPBA 4BVKA 4LYGA 4J91A 3Q3JB 2OG2A 1YS6A 2WJAA 2H59A 3D6JA 2JFYA 3DDNA 4HXEB 1NF3A 3H7AA 1UCFA 1RWBA 3L7KA 2QL5A 2CEAA 2X8WA 5LQSA 5IYZA 4QWWA 4MMZB 4IX9A 2PT6A 4F0JA 2HPHA 1I36A 1UWLA 4Y6GB 1LBHA 2PLAA 2RG7A 3K30A 3D3WA 5EJIA 1EU1A 1KI3A 1A5TA 4XQGA 5TB5A 2NVUB 1U7OA 4HGNA 4CMEA 1HX7A 1UK8A 3SR4A 4YDQA 2OM2A 4EFDA 3W9UA 1RD4A 3PJRA 3JPWA 4BKQA 3GLKA 4R9VA 2XYHA 5FHQA 5KYUA 2C95A 1F3OA 5D1NA 1KYTA 2PRKA 3R6LA 3I12A 1SMKA 4QDOA 1DJLA 3SQLA 4ER3A 4ESVA 2G5CA 4FFBA 4IJVA 2BFNA 1CJCA 4ZT7A 4CU5A 1F9EA 1FX0B 1W34A 2BKUA 4EG1A 1YZFA 4IHAA 4Q4CA 3GLSA 4HGPA 5JDIA 4IDFA 2Y0EA 4MW5A 4MKHA 3FNQA 4ERNA 1K8XB 1GQSA 1NQUA 3DZIA 4GKAA 4TRJA 3NANA 2PL9A 3ONVA 1V1MA 1CP3A 2O3JA 4XM0A 4GEKA 1CFJA 1Q19A 1SCIA 1F2TB 4R51A 1VP9A 1Z0ZA 3N70A 2H4WA 1EEHA 4MV0A 1T9GR 2QR5A 3MJSA 1ZRNA 4MR9A 2OQRA 2IUYA 2Q3JA 2Z5FA 3FUXA 3K1JA 4OXKA 5ALJA 3ZWAA 5KO2A 1E20A 4BFTA 1XEWY 1XHEA 3I9JA 2GHRA 4FXPA 2F67A 4K46A 3ULKA 3QEJA 3N6RA 1A9OA 1Z62A 2F43B 4MYTA 3ZI4A 3LHFA 2HQ1A 5K0FA 2QN2A 4JBXA 5E4JA 4LZLA 4MR7B 4HC4A 1RQ2A 1FUIA 3SNKA 1JF8A 1KDTA 2IT1A 3J80A 2V9PA 5AOBA 2GHQA 2HBQA 1YE8A 5I7RA 4JI7B 2HFJA 3WYFA 2BKLA 2ZKIA 3PDUA 1A9QA 2ZJ4A 3LX4A 1QVWA 1I4WA 1JQDA 4BWFB 3O2NA 4I9NA 4NENA 2X58A 3NYIA 3BWYA 3OPVA 3R3WA 4NZZA 4LJAA 2CD7A 3HYLA 5HS6A 4S04A 2OECA 2GRUA 2G1KA 4RHYA 3AR4A 3WQRA 3I61A 2OA0A 2C29D 2PKQO 3IVRA 5M5BA 2C9DA 3U56A 1A5ZA 1IBLB 4G25A 3VTAA 5LU9A 1FFBA 5DISB 2IXEA 3VO9A 1KAMA 3SXJA 5KB3A 4FFDA 4KLAA 2VJQA 3B51X 4P34A 2Q7DA 3TDKA 3WDKA 3WL6A 1FMLA 5JCOA 4JOSA 4Z9FA 1HNZB 2AN1A 5HYVA 2PZFA 3KR0A 2AE2A 2VUSA 2VLBA 3DS8A 3KTOA 3MWDA 3IAM1 1FZQA 1ZVJA 2ZRIA 3HRHA 3K3PA 4XUEA 4ZAWA 4C5CA 3OLCX 2FW9A 4I7EA 4RIFA 4CCAA 3R0XA 3H4MA 3O93A 4FHZA 1FNMA 2POQX 5L3SA 1J2UA 3E4CA 3SF8B 2WTBA 5CEFA 1K6JA 1E3SA 1NATA 2M6SA 3MGKA 3NM4A 1JEQB 3GV0A 5B3AA 3MMPA 1CRQA 1M2WA 1A9SA 3TEJA 2EF0A 4BBAA 3GGJA 1FLNA 1QCYA 3B3AA 4FFOA 1AS2A 2O5VA 4LTNA 4BYGA 1X7HA 1O0SA 5BV2P 2ZBRA 1TDJA 5TDHA 4ZVVA 2WKRA 3AB8A 4N0EA 3JARB 3MA0A 3DFMA 4E22A 2H0AA 2ZUFA 1IB0A 2Y1GA 1U99A 1XRPA 3NO4A 5T67A 5C7LO 4B2IA 4L4ZA 1ENYA 1Q83A 2XZDA 2QMHA 5JCZA 1ZCBA 2NSYA 3IQDB 1U2GA 3ZY2A 4WDRA 4F46A 3EZ6A 1KEKA 8MHTA 4O33A 4UW9A 1E2EA 5J2TA 4M1EA 2AZMA 3Q72A 4ENWA 1DIHA 4L4YA 3L7IA 1ZC4A 2IXDA 4M4SA 3CG4A 3PD0A 1YZTA 1NIJA 3FBWA 4XOUA 4CKEB 4M3NA 2RH9B 1P3Y1 1APBA 1LB1B 4DA8A 2FPGB 5HJ7A 4YMVA 2Q99A 2CVQA 2J5XA 3KHSA 3MOIA 4U6NA 3WWEA 5L4NA 2P4QA 4PX9A 3PGLA 3BMOA 3PNKA 2XT9A 1KNQA 3L4SO 1QQ7A 4Q1FA 5ICGA 1AHIA 5AVOA 3QI2A 3HABA 1US8A 5A5GA 4PLHA 3SBOA 1IUOA 3GEDA 2G1PA 4JLMA 1DUIA 1H66A 1L4NA 1VSQA 1XROA 3GX1A 1S5PA 4FP9A 4FYKA 4MUIA 4R41A 4RLHA 4ZXPA 1T0UA 3VOAA 4ZV4A 4F93B 5FWNA 1VKNA 1PCXA 1NW6A 2GGSA 2DH5A 2I7DA 3N86A 4HAXA 4PAGA 4W1SA 5ED0A 3RV3A 4YPOA 4U0JA 1RWQA 1ELOA 4MKRA 4XLZA 3EPLA 4LNUB 1ITZA 1ZX1A 5HIKA 4GKVA 2BMEA 3R7BA 4WN3A 2ZRPA 1U2EA 1AUQA 4P53A 3G5MA 1I10A 2Q8NA 1X8XA 1E9FA 2IZ6A 2NPIA 1F06A 2K2QB 3Q1LA 4FNAA 4DIFA 5C8XA 5TS2A 5HKOA 2HT1A 1XU4A 1U0NA 2F4VB 5HKAA 4DNQA 4HYYA 5KS2A 3IDQA 5EC8A 2OGZA 1HNWB 1KI6B 1FMJA 2HUNA 3HV0A 1CEEA 1FK8A 1OE0A 3HCBA 3TGWA 5C80A 3QUBA 3D3EA 4KI7A 2Q2QA 2WUGA 4FKBA 4TVBA 3ZVRA 3S81A 1USVA 3OZRA 1MVNA 3NOXA 4HDSB 1GRQA 4KVFA 1MB0A 4R8VA 4LZNA 2WJVA 4Q66C 2HGZA 4LRQA 2DXIA 4X6XA 2JI4A 1U2TA 3FWPA 4MDFA 3EC2A 4DIUA 2OCGA 2O06A 2PRJA 3RNLA 1U8YA 2FFQA 4DR7B 1JA9A 5AIAA 1XEFA 2EWMA 2I3ZA 1B0AA 2DULA 2ANBA 2XYPA 3WGZA 4ATNA 2DBRA 2VWPA 3CO5A 3LZDA 2O2IA 2EERA 1SHLA 2G7ZA 3JAKB 4FEGA 3GEMA 1EGQA 1ZXLA 4GLFA 4YEDA 4YAEA 2WPDD 4QHYA 2BDTA 4CL3A 4QTTB 3RVPA 4NBLA 4YT2A 4AIRA 5B58C 3IERA 3GR6A 1FDTA 1GZ5A 2AD1A 1B74A 1CJBA 1JG6A 2R25B 2WDZA 4AWXA 3MK31 4UDXX 4UBIA 4QL3A 1ZK3A 3SC2B 1Z5UA 1ZVMA 5CBKA 3UTDA 2XVZA 1SCUA 1YCDA 2J6HA 5FFNA 4K28A 4LC0A 4M86A 3NMUF 1MHTA 3U7IA 3SFTA 2QDXA 2QD3A 4U6SA 1A9YA 3RC7A 3BULA 4BV9A 2C8LA 1O5IA 3IEMA 2DOKA 4MVJD 2BKXA 3NZEA 3U9LA 2ZRLA 4BP3A 3F6EX 2FH5B 4BCDA 1TMYA 4PX3A 1WG8A 3M1IA 1PGNA 3UIEA 2W4IA 3A9WA 1PJQA 1E3JA 1LX6A 4H27A 3NBYC 2W5UA 2P9ZA 4O3FA 4OK3A 3SX2A 4D99A 2QAIA 2O0JA 4M21A 1UM9A 4QDTA 2NV0A 2C3YA 4OU5A 3FPAA 4KXQA 4CDNA 1KWKA 4F3KA 5G1OA 4G0MA 1U5BA 4X1KB 2PMWB 1X0XA 3GEPA 5KNDH 3AR8A 4HQKA 3TTXA 4KLCA 3RVJA 1B1AA 2JAXA 1EDOA 2OCDA 2ZVJA 3MJTA 5AVVA 3FTCA 3MTGA 5K0SA 5A0VA 4WZ6A 4DMMA 5F7XA 5AVUA 2CYBA 1T29A 3O4HA 2DG2A 2BI4A 4ZVSA 3RIMA 1E1RA 2FPPB 1UDBA 4XEHA 2GZ1A 3FVTA 1T8PA 3BZUA 5GJWC 1PUXA 3NHJA 2NUBA 4QPPA 4HPXB 3WLOA 4XZ3A 4TMKA 1B6TA 2AEJA 4PWZA 3RYIA 3IIJA 4B3RB 3NQ41 3V8BA 1LJ8A 4DCSA 2CY0A 3FHLA 3AJDA 3GBVA 4Y6PA 2C3OA 5F1KA 3VPSA 5BN4A 1UXGA 2JZOA 1JBKA 4P4NA 3BCRA 3OKFA 3TVTA 3O8DA 3U09A 3LQKA 2BHSA 4CMHA 1V1RB 1GRNA 3IPXA 2GN8A 1P29A 1J0AA 1JQ3A 4HAYA 2H1WA 1FW8A 1S9HA 5FNVA 3VH4A 5EZQA 5JY1A 3MCUA 4GI5A 2FE4A 5LOVA 2RGXA 3Q4GA 1VL0A 4RL4A 1QLHA 5SYNA 4C0QC 3ETNA 4EG4A 4IMIB 1PG0A 1V9SA 1X87A 5MGBA 5FUWA 4ZMBA 4QUDA 4IQGA 2IS2A 4FGLA 1R8JA 4PE5B 3K0FB 1Q7CA 3MCZA 1E2HA 4LGVA 2QX4A 5C53B 3L6UA 1PT6A 3DOEA 4BVGA 1C9YA 1XP5A 3HR7A 4C4OA 4EO7A 5JQWA 2G6TA 3OWOA 1YI0A 4DR6B 1DV1A 3MTJA 3UJPA 1RYDA 4ZYLA 3OLZA 5J9FA 4KREA 2SICE 2X7XA 3QITA 3GW8A 2D7DA 4BY9E 3C1AA 2GBIA 5FRDA 3WQHA 2VQSA 2A5JA 3K8YA 2W6ZA 2BGLA 4LFBB 2QYHA 4K9RA 5A3VA 4RJLA 2NUTA 4EGJA 2OK7A 4GPAA 1ESNA 2QPLA 1CK4A 3BORA 4RFVA 1JECA 2QPOA 4DJEC 5KWEA 3CG0A 4UDOA 2PBRA 4W5JA 3HK2A 5A3RA 1VB3A 3ODGA 3K9WA 4YJ3F 1X80A 3VSCA 4NNPA 1MG0A 3DMHA 2LUOA 3KHKA 4DDVA 2H48A 1PW7A 4MW7A 3OAAD 5C32A 4DSAA 2QV7A 3Q7RA 4CKWA 1GP2A 1KI8A 2JNWA 2ISQA 3A4IA 2XT0A 1B41A 4BNJA 1HDRA 3SF0A 2QLJA 3KCQA 4H0CA 2I99A 4HV4A 4YY3B 2Z3WA 3R9IA 3ZLBA 2QDKA 3IMFA 3FMFA 3P96A 3QE3A 4I4IA 1VLLA 3DFFA 2X6TA 3E3MA 1UPAA 3PZRA 4MDYA 3REQA 4AP9A 4D8XA 5IBPA 1E2IA 3BMQB 4U6QA 4ZI5A 3A06A 1VMAA 2QLNA 1WDWB 1RHKA 3I3SR 5GJVC 2ZPTX 2YY5A 2H7YA 1C29B 2Q46A 2BZSA 1KNXA 2I5PO 3EF3A 3G17A 3GFQA 2ZSFA 2IV7A 4PTZA 1YBMA 4M1QA 2C4KA 1ZI6A 3EQZA 4DN6A 4FZRA 3LWZA 1T24A 1K8ZB 1YR3A 4JB0A 1E0SA 4NCJA 4OMFG 4PBTA 3FWNA 1L5HB 4O4JB 4CF5A 3I04M 2FN3A 1UM9B 2NSDA 4UTRA 1DIAA 1TZBA 1XJ5A 2KI5A 2WT4A 1RRMA 2XHEA 1B6RA 4WKPA 2CE7A 2KPOA 4I36A 3RC1A 1V37A 2I7CA 5JSZB 1RHUA 2AEMA 2XRFA 1C4KA 4K2HA 4W1PA 4JOBA 4EVIA 3QVGB 5K09A 4RVHA 1I9GA 5GQSA 4AW9A 3OT5A 1MA3A 1W1UA 3LUHA 4OK6A 4XD2A 1A7UA 5G1NA 3ZU2A 3L8EA 2Q5OA 2J45A 3G68A 2C07A 1ODKA 3FI9A 3FOAA 1KE1A 3UKJA 5KVVA 4L3VA 3TLMA 1Z74A 2P8JA 4DJ5X 1ZJJA 4FGWA 2R6FA 4HNRA 1ANKA 1U8FO 2HH9A 1KEEA 2INGX 5C5DA 4ZEMA 2HPVA 3K1YA 3MEQA 4PR0A 3RT9A 1L4FA 5HJEA 2GPTA 4BVLA 3JXEA 1H1TA 1PTKA 3VH3A 3U4AA 2D5BA 2GXSA 1KORA 2ZUDA 4BBPA 3STHA 1NI4A 2ZB2A 5JZOA 2HUPA 2I91A 1HLPA 5EVJA 3MYRA 4REQA 1P7WA 3HEAA 4OBWA 3EXHB 4RVNA 3ZS8A 1I14A 2WINI 3ISJA 5T3UA 2CWDA 2EOAA 1KO1A 4JUIA 3U3OA 5ITZB 2AG6A 3AR3A 5ALSA 3W3AH 2BKVA 4DDKA 3N0XA 3DQQA 3CNQS 1E3DA 2XE7A 3G23A 4ZOEA 4EMBA 2GTIA 1SELA 4JSYA 3R7NA 5CEEA 2XDWA 7REQA 4X41A 2BFPA 3TX2A 2C9YA 4B6JA 1N0IA 4A15A 3RT7A 4IMRA 5IT5A 1F0KA 1FP7A 4JQOA 2DE0X 4Z1MD 4FI3F 3DQZA 4IJMA 2YJTD 4JLNA 1VM6A 4MDHA 4OVKA 1G5IA 1UBSB 3HCOA 4WXHA 1EZ4A 5ALKA 3A25A 4P92A 3UFXB 3ZJTA 2O19A 1OI7A 1UZLA 2YC2C 2JJ1A 4FOOA 5FFFA 2AJDA 5D1HA 1Z17A 4UE6A 3WSTA 1XAGA 5J4HA 1FRNA 5I7WA 3ST7A 1YQDA 4CV1A 2XE6A 2ZSAA 4QVIA 4JI0B 4Z7OB 4LJSA 5LZ2A 1BAPA 2D8MA 3OT4A 4F4JA 1YS1X 4N5HX 1TJ3A 3IULA 4DT1A 4IW3B 1V3UA 2PX3A 5KPDA 1HFJA 4LDPA 4UPVA 3AHCA 4ZU6X 4RANA 4E31A 2Z8ZA 4FIZA 4MI3A 1FFWA 1TA4A 3H11B 2CV2A 3F1LA 1WHTB 1WX1A 1JJFA 2O2ZA 1XL0A 3MPOA 1CEXA 5AW0A 2JW5A 2ZWPA 4ML3A 3U4DA 5J2TB 3DJFA 3F9RA 1Y82A 2JD1A 3HE3A 3OTGA 1NJ6A 4YROA 4B3DA 5KSZA 1R4ZA 2PD4A 5AUQA 3D8NA 1V4BA 1P2SA 1DBVO 1FYVA 4CRWB 2QJFA 3ZOZA 2IV2X 2Y0DA 4G85A 1WVMA 3BGIA 4FBGA 5D5PA 2QD2A 3S1AA 1DOZA 2WSLA 3SYNA 5AVSA 4OX9Y 4UBNA 1LRJA 1NBWB 2VJNA 1IN6A 1S89A 2EX0A 4XSHA 1PL0A 1X7DA 3FWKA 2DPXA 4DJJA 1JR3A 4BKMA 3KEOA 4LZWA 5C1BA 4AMUA 1QU3A 3GI1A 3O8QB 2POCA 3DEFA 3MJCA 3QVUA 1LFAA 2C5LA 3ZI0A 5F35A 1EX1A 2R60A 3FIUA 3IJEB 4OUKX 1TNDA 4PGGA 5H59A 3ZBTA 1OVMA 3TW8A 4S1OA 2WFZA 1GGNA 1L7XA 4B31A 4XGQA 2AC2A 2FDXA 2YV3A 3DW3X 4JJEA 4M1OA 5HCNA 4DBLC 1WQ4A 3E5HA 1C3XA 1ODFA 4XIIA 1NPYA 1IFXA 2HWWA 5H3LA 5HCUA 5JAHA 3SYLA 4ZKDA 5JZSA 2EKPA 1A9XA 2ID7A 4PO8A 2VP9A 1XZAA 1AA9A 1KS2A 4R1MA 3SS8A 2FPSA 1SQ0A 5CNJA 2GUWA 3ZJUA 1KEPA 2HA7A 4Y2HA 3L6CA 5SY4A 2GHTA 3ZE8A 4MPJA 4YXWA 2F9FA 2HSWA 1T3ZA 2ZGVA 4C5BA 3ZWKA 1JIIA 1SXGA 3PUYA 3IT3A 1KY4A 2WRZA 1WXFA 5K2MA 1ZJWA 3U2QA 1J0BA 2D54A 3VU1A 1Z12A 2FLVA 4ASUA 2IY7A 1JP7A 1L4KA 2GDZA 5FNVF 1KMCA 2WFLB 3ZE9A 4DUYB 1T43A 1WTCA 3H5AA 3IV7A 3KAQA 4PC7A 3V2IA 5BVHA 1LNZA 4G4JA 2E5LB 3L0SA 4L85A 5JSZA 1U2DA 1ZBQA 2A0YA 2QE6A 3T9AA 5KJ6A 1FUEA 1ATIA 3EWNA 1ZG3A 4CM6A 3E2PA 2ACEA 1BH6A 4PRZA 2FGJA 3F3SA 3LK6A 4HNGA 2CD9A 2IE0A 2E85A 2W22A 3MMNA 5EE5B 4L9RA 3ZCTA 3SVLA 5BN3A 4N5LA 1DLJA 2D2IA 1C7IA 3VJMA 2CLEB 3DDWA 1P8JA 3FDIA 3OX2A 3WXBA 3O47A 4G41A 1QMPA 4XIYA 3OU2A 1UMDB 2FPKA 3RF7A 4EMUA 1Q92A 3MTDA 2ZBGA 3AUUA 2V98A 3C5EA 4Y6LA 3GJZA 2AQ8A 2AZDA 3TL3A 1C0IA 1YD7A 3A6GA 1UJ6A 4DW8A 5FX2A 3JASA 5HMMA 4NOJA 3QY9A 4C0WA 4CM8A 2ZU0C 1BW9B 3SXUA 3KWJA 3OIWA 3VNQA 1TYBE 1ZD8A 4YRFA 3SS7X 4BDTA 4I2VA 3CO0S 4FYMA 4IAOA 3SZUA 4GSKA 1H3EA 3QKRA 3E81A 4RLQA 4QYIB 5CXQA 1BXGA 4RTRA 3CE9A 3E15A 5DHFA 3RFUA 3IA7A 1Y5LA 5BQPA 3FZNA 4I5IA 4TRRA 3QYAA 5DLDA 4CV2A 1AZWA 1HSZA 4NZ9A 4KPFC 4I8XA 1GZHB 3HNRA 1UBCA 3PUWA 3MWFA 3ZWWA 1LS1A 2OCYC 3KQOA 3N2NA 1YZKA 2W6CX 4EM6A 3RVNA 2PR2A 4RVGA 3IV6A 4D92A 4QSHA 5I7OA 3FYUA 3SS9X 4A7PA 4FT4A 1KAOA 4EOGA 2RGCA 4YP6A 1UAAA 1EVJA 1DKNA 1XTUA 2ZR0A 2YUIA 4LISA 1J0CA 5BN3B 1ND6A 2PT9A 3QPBA 4LCEA 1ODJA 1NC1A 4N5DA 1HYQA 5AVKA 4LSZA 1MNQA 2YJ6A 1L1EA 1JDBC 3SPXA 1RXEA 1XKLA 1SQ6A 4HK4A 1GNQA 3GGSA 1W4CA 2J3JA 1XNJA 4MW6A 4Q19A 5BUSA 3T1TA 2R4UA 2OAQ1 4BMSA 5JSQA 3S2ZA 4KMOA 2P2YA 2QUAA 1T36A 3OM0A 1CRWG 3DR3A 2GAJA 3OPMA 4XKJA 2IBTA 1NLYA 2FPRA 4RD2A 3UUWA 4J6FA 4P7GA 1CJMA 2C98A 3B9PA 1JE1A 1H1DA 3I5UA 3BKXA 4WCDA 5IAAA 4UAJA 3FVVA 3GDFA 1BFDA 4QUAA 5CFNA 3AY7A 1C7QA 2N1BA 4E09A 2HNBA 4NC9A 3F6BX 5H7XA 1EX9A 1L5KA 5BSEA 1R0RE 5JMTA 2P3OA 1YA8A 1ILWA 1X92A 4K05A 5IXYA 4QRDA 2Q4BA 3G85A 4MQFA 5FP0A 1IEXA 2BP7B 3U3RA 5HQ3B 1RJ9B 2ZJYA 1TF2A 1EGMB 1T4MA 1QHHB 5EJ5A 1C50A 3F7MA 4DLXA 1KEWA 3H2IA 1A72A 1KAGA 1RM4A 3T3PB 2R1TA 1L8LA 3V4FA 1P39A 4B4UA 2VPIA 2FPOA 4HH0A 4OHWA 1H6DA 3AF5A 1A96A 4YB8A 2QVGA 1AM4D 1Z8DA 4IR7A 2G9NA 1MB9A 3E5MA 4LXTA 3A70A 1LLUA 2QJOA 3FA2A 3D3QA 4G5GA 4UHCA 3UYKA 3UMYA 4PZYA 4YUXA 5JZVA 3PQDA 5KYGA 4BMOB 2LXNA 3TM5A 4D9FA 2A5LA 4QUIA 4TLCA 4ZRDA 4C30A 1I24A 2I6UA 1E3WB 1O77A 1DC6A 4Y1FA 3NORA 1Q1GA 2G9RA 1IMJA 1YUMA 3JY6A 1OXSC 2F59A 5KOJA 4Z8XA 3B12A 2A7XA 1ECLA 1YVEI 1F5NA 1V8ZA 2YTZA 3P9YA 1RI5A 4Q34A 4R9RA 5AJXA 3V4OA 5B36A 1A3CA 4MAFA 3OTHA 2B98A 4EUEA 5CDGA 1QYXA 1GZ4A 3WKEA 4EBBA 2O05A 4QOSA 1KY3A 1T8RA 3DT6A 4KPYA 1H9CA 3IRUA 2OR3A 4XVHA 3UT5B 4YALA 1TT7A 4RKWA 2JIDA 3D31A 3ORYA 3LU1A 2C7RA 5AXBA 1ZGGA 3KD3A 2I9KA 1R0XA 2JH8A 1KL7A 4OI0A 4E5MA 4PNEA 5EHXA 3AFGA 4EO9A 2ZI9A 1UK9A 2IPXA 3TH5A 3TW4A 1E89A 3B5EA 1W5FA 4LHYA 5LOVB 3G2QA 4OAOA 1W87A 1Q0ZA 2HREA 2QU7A 2OBYA 1PS8A 1IQPA 3JWEA 1QGZA 5ICFA 5LNK1 4DSTA 4OGLA 4XFJA 1SXIA 4JLWA 3NFYA 4HPJB 5CDFE 4GECA 3GUHA 1OPRA 1RBQA 2N0SA 1Q15A 3OCXA 4KBGA 1Q3HA 1ECGA 1YGPA 4I1YA 4NKRA 1TO6A 4PZZA 1I80A 1VCMA 3GT3A 3NC1C 1J8DA 3KZOA 5DFAA 2GN9A 1T9AA 2ACKA 1IMOA 3RJTA 4IINA 2WLSA 4CM7A 3KCNA 1ISIA 3C8ZA 5ABPA 3RI3A 4HAZA 1NBHA 1MBZA 5DWDA 3PYMA 4B74A 9ABPA 1O6ZA 4INJA 3T34A 2P9FA 4MKZA 2RGBA 3PWSA 3KYDB 4KQ9A 2VDJA 3UG7A 1M0EA 1AKTA 2UXDB 2EHDA 2AJLI 2HJSA 3C7TA 2B3TA 3H9GA 3PPIA 4YJFB 4FM9A 1OLUA 2DWUA 3IE0A 1UJNA 5DK6A 5JASA 4NCBA 3TTSA 4G0WA 5J47A 1CS0A 3DL0A 1G21E 2GVDC 1TQ6A 1WM1A 1FTGA 1HEIA 2Q29A 1M1YB 2AHRA 1S3IA 2Q0XA 4C7VA 1AJEA 5HOQA 1NP3A 2JJ8A 5DXAA 2WJYA 1A98A 1Z82A 2IXFA 4LMPA 1Z6QA 3KTFA 1V5FA 3TJRA 1XMVA 3QPWA 2IYUA 4IJQA 2QSUA 4Z7QB 5CVJA 3KQNA 3AV0B 3NBUA 3WQQA 3T3OA 1VXRA 1QGAA 4F6RA 5AO9A 3RTGA 4RS4A 5HE8A 1LRKA 2Z9BA 5FD8A 3SICE 3E7DA 2VF4X 2ZE5A 2J0EA 1N1DA 2VYVD 2YN2A 1OY1A 3R6WA 4QARA 2FW1A 3ASZA 3EUEA 1WUTA 1SCKA 3R9XB 1WKCA 1G6HA 2FWPA 5IXJA 1Y1SA 4YYEA 2XTMA 5L45A 1I4EB 2PEZA 1HZZA 4FHFA 4MUFA 5U4XA 2CLHB 4DWJA 4NH4A 3SG0A 1XZ8A 2QX8A 4WJKB 4HLCA 1EFKA 5CDTA 4US2R 2P69A 1EQUA 3HB9A 2D1TA 3N2LA 4EPTA 3ELWA 1YRBA 4G01B 4XJXA 5D3KA 1IY8A 3GAFA 2LWIA 2X0RA 2Z2YA 4ZTBA 2PZKA 1W0KA 4PYQA 4IEIA 2QTVA 3JWGA 1CEYA 2VP0A 1VC2A 3AETB 4M83A 2ZYTX 2OXFA 1WXQA 3A2MA 3FWHA 5DYTA 6REQB 2I6QA 3OCVA 1ECJA 1YIOA 1MB4A 2HN9A 3KTAA 4MWGA 2GB4A 1T3TA 5KNCD 3GOQA 4WLNA 1SVOA 1RC0A 1SZCA 3GLTA 1K97A 3NHUA 3F4BA 1PI3A 3IR6A 2WSMA 2CN1A 2ZRBA 1VI5A 1AKUA 1JA1A 4C88A 4B4KA 4UQLA 3V3TA 3CF4G 2E5FA 4DNPA 1IUNA 2MDTA 3CGGA 5TIIA 1YF3A 5B7GA 4KWEA 1Q16A 1WCXA 1WRBA 1MH9A 2FQXA 3I6MA 4PFJA 4WINA 3T61A 3ZH9B 2BSQA 4YJ2F 1HTWA 3VOTA 2AG0A 2GSWA 3KOOA 4P5PA 2ZWIA 4OOEA 4ER6A 3H9JA 1AGPA 1QYRA 1SUSA 3I2JA 4TUYF 5A4IS 1OH7A 2IHKA 2D1QA 2VIIA 4WZBA 4MB0A 1DNPA 5CX1B 5JI3E 2Z5LA 2JGAA 3OD5A 4JT4A 3U17A 2OLEA 3IUJA 5FB3A 2MR6A 5DGIA 3E2MA 4ARZA 2C92A 2ZB7A 2Y93A 5F1YA 1KKLA 4JCOA 1JLLB 4INZA 3WBKA 5JYDA 1JJBA 2F6RA 4FFLA 2WYWA 4BIIA 2Z3VA 5M34A 3U49A 4INPA 2W48A 3K0HA 1Z4KA 1BW9A 2GNPA 2GZAA 3A6FA 2WWVD 2JH9A 1SU7A 1ZNQO 3G13A 4DKXA 1R7RA 5LP6F 5LQKA 2EL7A 5ULLA 1EYZA 4OATA 4B5LA 2Q9AA