1U2EA

Crystal structure of the c-c bond hydrolase mhpc
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
286
structure length
286
Chain Sequence
YQPQTEAATSRFLNVEEAGKTLRIHFNDCGQGDETVVLLHGSGPGATGWANFSRNIDPLVEAGYRVILLDCPGWGKSDSVVNSGSRSDLNARILKSVVDQLDIAKIHLLGNSMGGHSSVAFTLKWPERVGKLVLMGGGTGGMSLFTPMPTEGIKRLNQLYRQPTIENLKLMMDIFVFDTSDLTDALFEARLNNMLSRRDHLENFVKSLEANPKQFPDFGPRLAEIKAQTLIVWGRNDRFVPMDAGLRLLSGIAGSELHIFRDCGHWAQWEHADAFNQLVLNFLARP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the C-C Bond Hydrolase MhpC Provides Insights into its Catalytic Mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase
total genus 107
structure length 286
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 3.7.1.14: 2-hydroxy-6-oxonona-2,4-dienedioate hydrolase.
pdb deposition date 2004-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u2eA00
4WCVA 2XMSA 4W1PA 2D0DA 4Z49A 4HRYA 2C4HA 4AZ0A 4MEBA 4W1RA 1JKMA 1CFJA 1UOQA 2Q0XA 2OXEA 1MPXA 4Q05A 3JWEA 4G4IA 1T2NA 2CMFA 4KACA 3GELA 2JIDA 4OSEA 2WFMA 5ALUA 2ES4A 1J07A 1PJAA 3UUFA 4B81A 3DQZA 4DLNA 3G0DA 5AO9A 4J0GA 1ZD4A 3IVMA 2Z3WA 2AJBA 3WK5A 2RHWA 4WJLA 2V97A 1QIKA 5K3FA 2WQZA 2HM7A 5AKKA 5HFAA 4X91A 3NWOA 1LPOA 4OYLA 1ETHA 3W2TA 3QYJA 4CCYB 2ZYSA 3NGMA 2WJ3A 3G0GA 2QVBA 2XUDA 1JMKC 4ARBA 1TAHA 3I2JA 1ZD3A 3C45A 1EB8A 1XZCA 2HA4A 1VJ5A 2ZSIA 4OYYA 5AK4A 4BCCA 4HS9A 1MX9A 3BF8A 1TKRA 2OCIA 1XQXA 1K5PA 3WWEA 4X85A 1MX5A 5SYNA 5DTJA 2JGIA 2O2HA 4CG2A 2WLSA 2VT6A 5EIAA 1A8UA 1TRHA 1CUCA 3G7NA 2PSDA 1E8NA 5JAUA 4U2DA 3AFIA 3BWXA 2YYSA 5CRIA 5JD6A 2VTVA 4Y2VA 1MAHA 3I1YA 4JH0A 5JIBA 2YH2A 3CXUA 5ALSA 2WTMA 4H77A 2WILA 4B85A 3ANSA 4OB7A 5C81A 4RPCA 1P0IA 1G42A 4DMHA 5CMLA 1GKKA 1TCBA 2QKYA 3WI7A 4MYSA 4BDTA 5ALLA 2CEKA 2PM8A 5K5EA 3LCRA 3WKDA 2PBLA 2X5XA 4AX4A 1EDEA 4Y2SA 4MYDA 4C6HA 4BAZA 1LPSA 3B12A 3I2HA 5ALEA 5AHXA 1ODCA 4E15A 1EXWA 1ZIXA 3WKAA 1UKAA 3H2IA 4AXBA 4AO8A 1J2EA 3GBSA 4DM7A 5KWIA 3KWFA 4HXEB 2RI6A 1D07A 5ISMA 5HF9A 1GT6A 2CB9A 1JI3A 2ACEA 5AH0A 4ETWA 5T4BA 1IUPA 5AICA 3KWJA 1UK6A 4L3WA 3KSRA 3I2FA 2HDWA 1MTZA 3ESDA 1AZWA 1XZKA 2JGFA 1CUUA 3FOBA 1MNAA 3DL4A 2RAUA 3AZQA 4C4ZA 2YASA 3G9ZA 5JD5A 2XUHA 4BRSA 3L1IA 3D2BA 5LP1A 1WOMA 4N5IX 5D3ZA 4ZRDA 2XUFA 1JJIA 3VKFA 3C6XA 4LXIA 1SCQA 3B3QA 1QONA 4G1FA 2PSFA 5FXMA 4P92A 2WKWA 4WFKA 1FFCA 4BP9A 4FKBA 3R3VA 5FPPA 4GWLA 5EI5A 2QUBA 5ALPA 3RARA 3ICVA 2HU8A 4Y2XA 4PSCA 1YAHA 5CW2A 1UK9A 3C70A 1XRNA 1QTIA 3WJ1A 5LZ4A 2WG1A 3I2IA 5ALKA 2ZJ7A 1ZGCA 2GBGA 2JEZA 2DHEA 2OCGA 3X3HA 1GQSA 1UT6A 5DNUA 5EFZA 2VF2A 3DD5A 3LP5A 1CUDA 1W76A 4GEGA 3TEJA 4DIUA 2DCMA 3G9TA 4DNPA 2AJLI 1C4XA 1ZIYA 5JAOA 1VOTA 3H1BA 1A88A 2B61A 4BDSA 5DWDA 1SC9A 4TGLA 4DNQA 3KD2A 3QMWA 2AJ8A 2JGKA 4QWWA 3A2MA 3KOOA 4OU5A 4A5SA 1BN7A 3TGLA 1F0PA 4J0IA 4FLFA 4DNOA 2HU7A 2VQ6A 4OU4A 3AIMA 2HFKA 1AUOA 1YA8A 3NUZA 1U65A 2C5GA 2WU4A 4K6KA 4S0XA 4QDXA 1DTEA 1T4MA 3B5EA 1A8SA 5E4TA 5K3CA 4NS4A 1XRQA 3CCCA 1XKLA 5AOBA 1WHSA 1ZOIA 4ZI5A 4BP8A 1USWA 2HA2A 3QMMA 4RNCA 2Y6VA 1VA5A 5D3KA 5HF8A 2FJPA 4ZV7A 5FRDA 4QEKA 2ZJFA 4WDRA 5CT8A 2DR0A 3W04A 4CG3A 3SK0A 5IVHA 1UXOA 6YASA 1Q84A 3VISA 3DOIA 2QS9A 1CUWA 2WIKA 1EINA 3ZWQA 4C88A 1CVLA 5D7BA 3G0IA 3G0BA 4ARAA 5ALJA 4AN0A 2GZRA 3EF3A 4IO0A 3I2GA 1XKTA 4RE6A 2GYVA 5IKXA 4GBGA 3V1NA 5FKJA 2HA7A 3P2MA 1XZLA 2PU7A 2PUHA 1EHYA 4B9AA 3OTQA 2V9ZA 3LLCA 1DX4A 4HVTA 2XUKA 5AP9A 1IMJA 2ONCA 3PDCA 5AI8A 5AM0A 2RONA 2WHPB 4B0OA 1HDEA 3HSSA 1LLFA 2XMBA 1KEZA 3FLBA 2C7BA 1GGVA 3H2GA 1VA4A 3FSGA 3WWPA 5I8PA 4LYEA 2BFNA 3STYA 5CH8A 2DQZA 2GBCA 5K3AA 3WIBA 4CFSA 5AK6A 2ZSHA 2JGMA 3BF7A 2EEPA 1X2EA 3N0TA 1UZAA 1XZMA 1XFDA 3BL8A 1QIHA 3SC2A 4BC0A 5A6VA 4H7DA 3QPCA 1MNQA 4X71A 5DNVA 1DU4A 2RGUA 5LZ2A 5LLSA 4W9RA 4Y2PA 5ALIA 4BRZA 1R9MA 3O95A 1VE6A 4YASA 2VT7A 1H23A 2VAXA 5AM4A 2X8BA 1YCDA 1WB6A 1QO9A 1SOMA 2PSEA 3K2IA 3HC7A 4X94A 1XLWA 3Q8WA 5ALQA 5AOAA 3DCNA 1YR2A 4B0PA 1IZ8A 4HAIA 4FNGA 3MUOA 4GHWA 4O08A 3QITA 2QOEA 3F96A 1Q0RA 2XE4A 4J0HA 2OCLA 4G4JA 3CN9A 4X6UA 3HABA 3UUEA 2VAVA 3M81A 3SX4A 3F98A 1H2XA 4LYDA 1FFBA 3ANTA 5DYWA 4N8EA 1XZDA 4BAGA 4BTVA 1AC5A 5H3HA 3DS8A 5FDFA 1EX9A 1U4NA 5FPQA 4UBKA 3V1LA 1EVEA 5AKYA 2XB6A 3DYIA 2HFJA 1CV2A 2Y6UA 2WG0A 4PNZA 2PVSA 2WFZA 2FX5A 3FYUA 1L7RA 4DMCA 1FFEA 1VKHA 1HQDA 1ODTC 4J7AA 1LNSA 5C8VA 1EDBA 3WMRA 2WUFA 2XQFA 1XROA 1ORWA 4GI1A 2XUOA 4OUKX 2DHCA 4G8BA 3BDVA 2H1IA 2PL5A 4QE3A 3NOXA 5AK5A 4N8SA 5HCUA 1R1DA 4KE9A 4KR0A 3PE6A 4DYHA 1DQYA 2GYUA 5I7UA 1UKCA 3I6MA 2RHTA 1E66A 1O6FA 4LKOA 3D7RA 1ZI8A 3WL7A 2O7RA 4LXHA 3A70A 3D59A 5F4ZA 3DLTA 3WIOA 5DTIA 4EZIA 1A8QA 2XMZA 3IURA 4INZA 4X6XA 5AOCA 5AIBA 1QIJA 4EY5A 3VJKA 4AZ3A 1L7QA 1EA5A 1ZJ5A 2C0PA 3BDIA 1VLQA 4QLAA 1N5MA 5ALMA 4PO3X 1G5FA 5ALTA 1CUAA 5ALFA 3RLIA 1H2ZA 5AKXA 5CTAA 3R3UA 2B20A 1QIIA 4Q82A 5LZ9A 3H04A 4YK7A 4FLEA 3JYHA 4X93A 3G9UA 1XZBA 4WFJA 3DJYA 1XQWA 2VJCA 1LBSA 3OOSA 5AI5A 1THGA 4BC1A 1QIDA 4EY7A 3EBLA 2WIDA 1CUGA 5FUMA 4XX1A 1XZIA 3F8SA 1AURA 1F8UA 4B9EA 4Y2UA 4UBIA 3D0KA 1QIMA 4H7JA 2JEYA 5ALHA 1YS2X 3AZPA 4AO7A 4U2GA 4J03A 4Y2TA 1ZGBA 4X7BA 4F60A 2VJDA 1E89A 1DQZA 1ISPA 3FYTA 4N8DA 4BAUA 3WA6A 2XMQA 4H7FA 4UBLA 1CUVA 4UFPA 4LXGA 4CCWA 2QM0A 4MQMA 4NMWA 1L7AA 3N2ZB 4XIIA 5LZ8A 2JGEA 4L0CA 3TRDA 2WIFA 4HTAA 4M0FA 3JW8A 5HF5A 5K3FB 1E8MA 4J0KA 2BAGA 3R3YA 1H2WA 2R8BA 3YASA 1EK2A 3QPAA 4Q34A 3V9AA 1FFDA 1F6WA 3STXA 3GZJA 1SFRA 3FYUC 4C01A 1LZLA 3FBWA 2V98A 2XUAA 3ESAA 3MUNA 4GDMA 1VXOA 4WY5A 1K6EA 4PW0A 2XMGA 1CUSA 2BUBA 2WIGA 3H17A 5ALXA 2ZYIA 2XQIA 3QH4A 3WKBA 5HKBA 4KYVA 2PUJA 5AKLA 5CURA 1CUHA 2B4KA 3R3XA 1GZ7A 4KE7A 1P0PA 3IA2A 2HA0A 1YA4A 3WK7A 4MWTA 1CUJA 1N8SA 3AZOA 4OPMA 5D6OA 3WWDA 5CXUA 4FBLA 3IBTA 4H7IA 1YAJA 4UUQA 5SYMA 2OQVA 2CUTA 3HI4A 3O9MA 3AJAA 3O4GA 1O6GA 4X95A 1XZEA 3A2LA 3EQ8A 2JGJA 1W4LA 3I1IA 4E14A 5ALOA 4FLMA 4CCYA 2PU5A 4I3FA 2QMQA 4LIPD 4I19A 3FWHA 1W75A 4Q1VA 4KAAA 2QRUA 2LIPA 2JBWA 5T4FA 4MWSA 1DT5A 3K9BA 4EUSA 3VJMA 4BB0A 5JAHA 3ILSA 1IVYA 4K5QA 4AN1A 5JALA 5EGNA 3D2AA 3WWCA 1CEXA 4M0EA 2OGZA 3G8YA 3I2KA 3FSGD 5ALYA 3PFBA 2BCEA 1ZI6A 4L72A 4C4XA 1WCYA 2P8SA 2BJHA 3V1MA 4DSZA 3ZLUA 5FP0A 3WL5A 1RP1A 3IB3A 3LIPA 4QZVA 2VEOA 4QDTA 1QFMA 4A23A 5JZ9A 3DOHA 3VVLA 5AKEA 5FOQA 3HEAA 1P0MA 2VA9A 2BGNA 2QXUA 1UOOA 4Q3LA 3R3ZA 2V96A 4W63A 4G5XA 4N5HX 5JANA 4TPKA 4JYPA 4X3CA 3QBJA 2XI4A 4G8DA 4DGQA 1BN6A 3IUQA 5LZ5A 5JD4A 2ZJ6A 5CT9A 3GUUA 1OCEA 4Y2QA 1IUNA 1XLVA 2PKYX 1CQZA 5ALWA 1QGED 4NZZA 2OG1A 4K2AA 4LHEA 2NW6A 5EHNA 4EA6A 1U2EA 1JT2A 3RK4A 3MGAA 1YB7A 3FCYA 1R88A 1NU8A 1AMNA 1R3DA 5J3JA 3STVA 5IVKA 2H7YA 2Y2VA 2QTBA 5T4HA 1KU0A 3WL6A 4P08A 2VATA 3GA7A 4G8CA 5DLPA 3H0CA 2XMRA 3I6ZA 5FLKA 3U1TA 3E3AA 2XLCA 1X70A 1Z68A 4B83A 2G5TA 5AM1A 1QTRA 3F9CA 1XQVA 1UWCA 4KJXA 4G9GA 1NX9A 4ZGBA 1JJBA 1BEZA 1BROA 3H19A 1BU8A 5HFNA 1E8DA 2EDAA 2HL6A 4ITVA 5AI6A 2C0QA 3V48A 4B82A 5JYCA 1P0QA 4UFNA 5C7YA 3C43A 1ZI9A 3OURA 3PI6A 5HZGA 5HKAA 1PFQA 4Q3KA 4IH1A 2GBFA 2C58A 5FV4A 3WYDA 1BCSA 1GXSA 1UK7A 4HZGA 2OAEA 2WJ6A 1N5RA 1WPRA 3ESBA 2CZQA 5DYYA 1SCIA 4EB0A 4H7EA 1BEEA 1CQWA 5ALVA 4B7ZA 3T4UA 4ZREA 2DQYA 4X92A 4JYMA 5AI4A 5ALZA 4KRYA 4KE6A 4EBBA 4H7HA 5EHXA 1B41A 2J3QA 3BJMA 3C8HA 4U2BA 4UFOA 3H2JA 1KU6A 2WU3A 2CJPA 4W1SA 5BOVA 3C5WP 2G63A 3FVTA 5KREA 2XT0A 2XUIA 1MJ5A 3ZPXA 2CKMA 1EVQA 5HQ3B 2WJ4A 3DKKA 3HLKA 3O4JA 5A7FA 3PUIA 2XLBA 3LIIA 2O2GA 3VVMA 4D9JA 1YB6A 1DX6A 1QFSA 1HLGA 2IIVA 4UHEA 3H2HA 2QXTA 2OAGA 1QOZA 5CT4A 4FBMA 2WUGA 2J4FA 4OB8A 3PF8A 2WUDA 3R0VA 1M33A 1TCCA 1TCAA 2R11A 4PF1A 3SWWA 3WYNA 4DTCA 2XUGA 2C5FA 4W1QA 4CI9A 5AK3A 1XRPA 1CR6A 1XRMA 3C5VA 3U0VA 4CIAA 4BCBA 2JF0A 1YS1X 4KEAA 4X6YA 1H2YA 5AKGA 2B9VA 1DWOA 3T52A 4G9EA 4DMKA 3A2NA 2H7CA 4NVRA 3ESCA 5E4YA 3CCBA 1WHTA 1Q83A 1AX9A 2OLEA 3I28A 1XRRA 5C8ZA 4K6GA 1VE7A 3C87A 2G5PA 5A2GA 7YASA 1N1MA 1IZ7A 2Z3ZA 3STWA 2WFLA 1TK3A 5KWJA 4BATA 4K6HA 1IUOA 2BUCA 3WQHA 3AIOA 2I03A 3WJ2A 4BBZA 5ALNA 2Y1KA 2XDWA 3VDXA 1CUYA 4FDMA 1C7JA 4EY6A 1XZHA 5EHZA 5JZSA 1QZ3A 2ORYA 4OD0A 3E1GA 4HXGA 4FTWA 2J4CA 2YXPX 4UHBA 4BE4A 1Y37A 4FFVA 4KAJA 3HYSA 4Q3OA 3DEAA 3BIWA 5CH3A 1RWQA 3S2ZA 3L1HA 1I6WA 1CUEA 1EH5A 4BZWA 3QZUA 4Y2JA 1WB4A 1UFOA 5IVDA 2FUKA 2OGSA 3C6YA 4U2EA 1K4YA 4MXDA 1QIGA 1G4HA 1QIEA 2XUPA 5ALRA 3AILA 3WZLA 2XQKA 4KE8A 3WWOA 4AB1A 2UZ0A 2HRQA 2PSJA 3GROA 2QUAA 4JEIA 1EK1A 1MAAA 4DSAA 2BKLA 3F67A 3E4DA 1AQLA 1F0NA 4IH9A 4BVJA 4MEAA 5JATA 4U2FA 2HRRA 1W52X 4H35A 2AJDA 4GLBA 3S8YA 2ROQA 1K8QA 4J3JA 1ACLA 1HBJA 4FOLA 4ZV9A 1CUBA 3WK4A 1VZ3A 1MU0A 2HU5A 1THTA 3H2KA 3AINA 3HJUA 2EDCA 1DWPA 1S8OA 3DDUA 4AQDA 4WDQA 1U8EA 1JFRA 3OG9A 3QVMA 2WIJA 2AJCA 4B80A 3O9VA 4QA9A 1OILA 5HQ3A 2I78A 2I3ZA 4F0JA 5CXXA 5JARA 1PV1A 2O7VA 4BTLA 3FCXA 5LYYA 5LIPA 1CUXA 1ZD2P 4B84A 1LPNA 3C6ZA 1ZD5A 2W6CX 2WFLB 1GPLA 3QPDA 1Y7HA 4L9AA 1YASA 4QWMA 2HA3A 1HKHA 4UHDA 5EIHA 2XMCA 3D3NA 2Y2UA 3F97A 4J0JA 3WKCA 4XWGA 4UBJA 4KRXA 3BE8A 3W05A 1C7IA 4AMYA 4UHCA 5CT5A 2QJWA 4E11A 4C4YA 4ZXFA 4ZWNA 3UMJA 4BCDA 1JU4A 3EQ7A 2K2QB 1ACJA 3BIXA 4QDZA 4QLOA 1UOPA 5A71A 5C8XA 3STUA 1LPAB 4FMPA 3O0DA 3DNMA 4PSDA 4H0CA 4E46A 3FYUB 3HZOA 2PSHA 1VZ2A 4UBMA 4B6GA 2ZYHA 3H18A 5T4EA 2G4LA 3I6YA 3AIKA 1E5TA 1CUIA 5I9IA 2DHDA 4BE9A 1ZICA 2X76A 3BJRA 4PQEA 5YASA 3ICWA 5AM2A 2XUJA 2GYWA 2HADA 4TVKA 5IH7A 3FNBA 5A62A 1MN6A 3L1JA 4A16A 4CG1A 2OGTA 4AMZA 2WHQA 2OCKA 4GW3A 1E3QA 3IDAA 2PX6A 3HRHA 1GPNA 3WK9A 3WKEA 1XQYA 3R40A 5AKHA 1J1IA 3KDAA 1GPKA 1X2BA 1Y7IA 4QDOA 2WUEA 2HIHA 2IITA 3TJMA 2XUQA 3KXPA 4F21A 1QIFA 3OM8A 3C6BA 1ORVA 3D4LA 4C89A 3PUHA 1XZAA 1QO7A 1HL7A 1CLEA 5CBKA 1A7UA 5DJ5A 4PV7A 1XZJA 3ZLTA 3V1KA 3G0CA 4F5ZA 1RYYA 5K3BA 2GZSA 1HPLA 3M83A 2OPHA 4XJVA 4GXNA 4UHFA 3W06A 3K6KA 3R3WA 4UBOA 5BWCA 4X97A 3GFFA 1AGYA 4QNNA 2XQGA 1UK8A 1VXRA 1GQRA 2Z5GA 1BCRA 2VSQA 4PSUA 5AKIA 4ROTA 3BXPA 5AJHA 2ACKA 4IQ4A 2XQJA 4UHHA 3G02A 4BVLA 3PFCA 4OCZA 1TQHA 3O4IA 1AKNA 5K3EA 1LPBB 4M0MA 5JADA 3WL8A 5BV7A 3MVEA 3RM3A 5JAPA 3C8DA 4XVCA 2CBGA 4P93A 1MT3A 3G9XA 4FNMA 4HXFB 4IH4A 3VXKA 1K63A 1LBTA 5LKAA 2RIPA 4UBNA 4EHBA 4OB6A 5AKZA 1OXMA 1CIJA 4H18A 3Q0TA 4DNFA 3D2CA 5ALDA 5AM3A 3W9UA 4EY4A 1LGYA 2GBIA 1CUZA 3CN7A 1WPXA 3E0XA 3FLAA 5EIEA 3M82A 2QT9A 1XLUA 1ODSA 5BWBA 1SCKA 1CRLA 5CT6A 1EB9A 4RGYA 4DMFA 1LPMA 2J3DA 4Y2RA 2WM2A 3FVRA 3ZI7A 3WA7A 4GECA 1EI9A 1MO2A 1GKLA 5KBYA 1BRTA 3EIOA 4FWBA 3M3DA 4V2IA 5DNWA 3DYVA 1JJFA 2W22A 4FHZA 1UKBA 4Y7DA 2DSNA 3EQ9A 4C87A 3IIIA 2WSLA 1R50A 3R41A 2QR5A 1QE3A 2ZVDA 2QZPA 3OC0A 5LKRA 3VJLA 3IUJA 4FFWA 4H7KA 2BUAA 1W6RA 2JGLA 3QM1A 1Q0ZA 2BGRA 1R4ZA 4WY8A 5AI9A 3PF9A 4HRXA 5JZBA 2Z8XA 3WZMA 1XRLA 3QMVA 1W1IA 1LPPA 1ZJ4A 1H22A 1BS9A 2ECFA 1J06A 4BVKA 5HK9A 4BZZA 5AI0A 2OQIA 3W9BA 5JASA 2E3JA 1EDDA 1FSSA 2IX9A 4J0CA 4I4CA 3D5EA 1DWQA 4BYMA 1DT3A 1CUFA 2XMDA 2HA5A 2HA6A 3IUNA 4YX9A 1MX1A 2VJAA 1JU3A 1NU6A 3ZLVA 2QJRA 3FLEA 5AKJA 4JUIA 2AXEA 2WHPA 3A6ZA 1CPYA 3WK6A 3HXKA 5EHQA 3WLAA 4MQLA 3FAKA 4P9NA 4Y2YA 3WK8A 5A7HA 1XZFA 2FJ0A 3STTA 5AM5A 5HF6A 4CIBA 5HK8A 1JMYA 5LZ7A 3HACA 4IHAA 5AIAA 1BE0A 1WM1A 5E2IA 1YSCA 4RE5A 4X00A 1QLWA 4G4GA 4YPVA 5ALGA 1TIBA 2VJBA 4EY8A 1XZGA 3O4HA 1DINA 3ZV7A 5E4JA 5ESRA 3LS2A 2H7XA 3ED1A 2WTNA 1FJ2A 3IUMA 3PICA 5IVIA 5CH5A 4WFIA 1LZKA 4U2CA 4Y9SA 1R9NA 5K3DA 4UPDA 2I3DA 3OPMA 3RKSA 2WG2A 2ZYRA 1WB5A 2Z8ZA 1QJ4A 3AUKA 5DYTA 2H9YA 4QDUA 2O2IA 5A7GA 4KAFA 1FFAA 3DKRA 2PPLA 4JNCA 3DL7A 1B6GA 2HHAA 2WHRA 4X90A 4J0DA 2DFPA 3H1AA 1G66A 4AO6A 3IULA 4MJ3A 2D5LA
chains in the Genus database with same CATH superfamily
1TE2A 2UUPA 2OFXA 1EP3B 2YC2C 1KRWA 1KPGA 4U6SA 5J47A 4BNWA 4L2IA 1OY1A 1NVXQ 1T6ZA 4Z49A 1BFUA 1Q1GA 4GSYA 4MRSA 4HDSA 2VCYA 4MRRA 3PE4A 4AZ0A 1RAGA 4U5QA 4MEBA 1NVVR 3K0AB 1N5JA 2IYTA 2JHAA 2PY6A 3EXHC 1N6OA 3BCHA 1OWMA 4JYCA 2B1RA 1Z4IA 5EJ5A 1CFJA 1LBEA 3K9CA 3AR6A 4NE7A 2K2WA 4MW7A 1F7VA 4TZ6A 4KO4S 2X0EA 5BV1A 2H2GA 4TMWA 3SC6A 4Q05A 3G6KA 5IK2A 3UUWA 2JGDB 3NRCA 5BSMA 2C03A 5JLAA 4D3ZA 1L2TA 4JSYA 4ND3A 4KRFA 2AFHA 1OC4A 3IEPA 3ELYA 2WFMA 4PAWA 4C0KA 2O9JA 4DIFA 5ALUA 1T6XA 3DVAA 4AAYA 3FA2A 1ZK1A 2W2TA 3DW1X 4IDQA 2HNBA 1NRIA 2PBFA 3DQZA 4WKGA 5GGXA 4B81A 1X13A 4FI3F 2YZKA 3G0DA 3GIDA 2P62A 2P4HX 1P2VA 4G97A 3NYWA 1YOBA 4DDUA 3OQ6A 4N03A 1SXPA 1U9CA 3UVEA 1J5PA 2Z3WA 3IVMA 3A1FA 3SG0A 4CKWA 1ZSYA 2XD9A 3ZU4A 3KB1A 5BSKA 1KS9A 1T5TA 3L7JA 4WAUA 1QIKA 2FN8A 2M1XA 2FE1A 4BX2A 4ZAYA 2BM1A 4ZYXA 4RJTA 5HFAA 2IWHA 1Q0QA 1PJSA 4HZUA 3LWDA 4F11A 1N5IA 3FDZA 4NF2A 1EM8A 4EVRA 4M8SA 5AW8A 1SWVA 3DE7X 4CCYB 3ZBTA 2DSTA 3Q7EA 2H2HA 1MDBA 1CY6A 1PWHA 2ZYSA 1SKYB 2ZAGA 4YEDA 1GTRA 4IF6A 1F4PA 4IO1A 1RM0A 3PJGA 2BFMA 2QVBA 1M5TA 1JLMA 4EHDA 4KSBA 5EKXA 2ZS9A 1TAHA 4ARBA 4NJMA 1ZD3A 2X8LA 521PA 1FTGA 1XMOB 1K4KA 4OTZA 2PG3A 3OCCA 5DBEX 2F1JA 1G2PA 3U3JA 2RGRA 1TCVA 3WHPA 4MAAA 1IBKB 4L5IA 3IE1A 3HKBA 3K0EA 2ZSIA 1RKBA 3KAQA 4TL6A 4U9HS 2VUUA 4AKHA 2D0PB 3OX1A 3MELA 3RVJA 1XMVA 2H11A 2OGWA 3P2IA 4HS9A 4KJZA 1MX9A 1SZCA 3BF8A 2R1TB 5F1KA 3H1EA 5HE9A 1FFYA 3KD3A 3X1DA 3GLKA 1XIVA 4KBFA 1TOAA 4DV2B 3FBGA 5LQUA 1SURA 2BFBB 3HY3A 5KTKA 1HYHA 3TIVA 4X85A 2V55B 5FOWA 5K0GA 2ZI9A 2O2HA 2WJGA 1WDKA 5DTJA 3W4KA 5CBPB 1ISIA 2VT6A 1R18A 3LL4A 1A96A 4NIMA 5EIAA 5J59A 4F6RB 3VVBA 3QEKA 1SA0B 2Y4NA 1A8UA 3EFHA 4K05A 5DRTA 1W59A 1V11A 1JXOA 4PZYA 1YB1A 1CUCA 3P0RA 3ZIAA 3G82C 4FU0A 2X3FA 1E8NA 4HR7A 4MWOA 5FBVB 2AZDA 3AFIA 3GRUA 4WHMA 3BWXA 1V1MA 2YYSA 4CKYA 5JD6A 2IPOA 1QYCA 1DC5A 3BOSA 4E13A 4QOHA 4UUOA 1JDPA 3IV6A 2YHIA 1R2QA 2A5YB 1NOJA 1AGRA 2PVCA 4KLAA 5K01A 3A9RA 2VDWB 2YH2A 1SC4A 1M34B 3H5WA 5KKCA 1PZFA 4BS9A 4UDOA 1ECFA 1XTRA 2B94A 2WTMA 4H77A 4PNPA 5EWLB 1SRRA 5BRJA 5KNDA 4FDAA 3EPRA 2P9FA 2DC1A 1N8TA 3O3MB 4DDHA 4NYIR 1NE2A 3KEMA 2P91A 1XMQB 2NNLD 2NGRA 4XLTA 3UICA 3G13A 1DLIA 1VPDA 3IS3A 5MDHA 4RPCA 2J4DA 1T8WA 2P5TB 1BQ3A 2GZ2A 2E48A 3BTOA 4URZR 2DBRA 4EW1A 4JL6A 4UZSA 3D7NA 1DRJA 3VH2A 3GFGA 2EZTA 2ZPAA 4GR5A 3H9EO 4MRPA 2HEGA 4U8HA 4IZ6A 1EUQA 3L8DA 1YZHA 5L7YA 2V3VA 3L06A 4C2TA 3THOA 4DR2B 1JA1A 1JWAB 3LCRA 1HEIA 4Q4DA 3DHEA 4MPPA 3WFIA 3WLIA 2VYFA 3BULA 3KJIA 1X7WA 2ONZA 3DZCA 4UARA 5I9TA 4CDNA 4JLBA 3HCDA 3GYGA 2RI1A 2KB0A 4Y2SA 3CZQA 1ZNZA 1NTOA 2LP4Y 5J40A 4DQKA 1TMYA 2PZKA 2Q28A 3BZBA 3H2BA 2OA0A 3X1WA 4BAZA 1DG9A 3KNZA 1A4RA 3B12A 2A0YA 5E3IA 3I2HA 5H02A 2FWMX 2ZTHA 3KPYA 3Q12A 4F2PA 2GAFA 4PLPA 1BVUA 4M60A 2PPVA 5G0SA 5AXAA 4EB3A 4OREX 3GGDA 4CMAA 3D8NA 4GLOA 4IQ0A 1ODIA 3PUVA 4ALJA 2ZRHA 8ABPA 3EIXA 1UKAA 3GFTA 5FTWA 3U6KA 3QFSA 3IUBA 1WDMA 2Y92A 3HGMA 5KYXB 4WINA 5LQNA 2YJNA 1Z8NA 1B0AA 1A2QA 1Z39A 4PLWA 4AO8A 1NBHA 4X1OA 5D3MA 1J2EA 4D82A 1CC1S 1W0KD 3IDQA 3CVYA 3I62A 4DM7A 3VTAA 1DKPA 4EMTA 2WYHA 3E9EA 5SY9A 1XE3A 3WLLA 3K0CA 3DAYA 4ENRA 2QQFA 1BGXT 1KAEA 5JS8A 2YFKA 5ISMA 5CCXA 4G5OA 1SVUA 4E2FA 2GNAA 4MUXA 3H5LA 4MYTA 1W30A 5A06A 3IIKA 4BP1A 4ENVA 3L7NA 1A9PA 3FNRA 4TM8A 4H16A 4WK4B 4ETWA 4OP2A 5TF0A 1JQJC 3ZJ5A 1IHUA 1N1EA 1VI6A 5KTRA 5KVSA 5JNSA 4Y0AA 3WE7A 5EUQB 4AF7A 2LR0A 1TXGA 4JC4A 1UJ2A 1OT5A 4BLRA 1WXHA 1Y33E 1I5RA 5IABA 1IAQA 2AMLA 2PX3A 4EG0A 3LG2A 5I7EA 2QEQA 3KCQA 5CD1A 1GPWB 4I3GA 1LDYA 1C9NA 1ZUIA 2XIQA 2JCYA 3TL3A 3WGYA 4B4DA 1OYYA 1RMTA 2PJZA 3OM0A 1CDDA 1MRZA 4EUNA 4N0EA 1OVGA 2YOHA 4ALLA 1IQ0A 4HY3A 4RAOA 4M22A 1A8PA 3DL4A 3IMEA 1PK8A 3HU5A 3EH2A 4UMEA 1JEAA 3UJBA 1DMSA 5CX1A 4BLOA 4KVGA 3HXTA 3ZXXA 4LF7B 1A50B 2E4ZA 1Z6GA 2GPTA 1Y42X 1HLDA 1N2EA 2HSEA 3L1IA 1ZQ9A 2COKA 2G04A 2JLWA 4BO6A 3IAXA 1K5HA 4LF8B 4ZRDA 4UEOA 1YIAA 2XUFA 3ASVA 1JJIA 2WTXA 1UMBB 4PSKA 1ZMOA 4DSUA 1XOIA 1SCQA 1F2UA 1Q3TA 5FOXA 3G5UA 3CX3A 4Z9AA 3RRZA 4CM5A 1QONA 4PGMA 1U98A 1V37A 4LEIA 4OIFA 3AOEC 3EA5A 1IEQA 4MKGA 5C52B 1QGAA 1GPJA 4YAFA 1O94C 2YWXA 3MRVA 3DL0A 3FIUA 3DUWA 5JSZA 2FH5B 4JJ7A 5FPPA 3U7QA 1GL6A 4WK2B 3DDWA 4NDAA 1OX5A 1X7GA 1ZZGA 2TMYA 2QAIA 3QFFA 3RARA 1CG6A 2Q5HA 3MGCA 1DAKA 3V7YA 1AUVA 4NS1A 1IN1A 3QWFA 4REMA 1T1IA 3B60A 3IOCA 3C70A 3LWZA 4R2KA 5K0NA 1XRNA 1ZGHA 1F1BA 2HIMA 3E7XA 3KM0A 3PQ7A 2LBPA 3AVQA 3H8WA 1NVDA 3TEMA 1AQUA 2CXOA 4FSXA 1E2FA 4YCJA 3COSA 1OWOA 4EYQA 3S40A 1T9ZA 2PRIA 2AEJA 2Q3MA 2F1RA 3DZ8A 3O9ZA 4J7XA 5GWXA 4E33A 5D00A 1G59A 4DWOA 4LMRA 3TZ6A 2VXYA 1VLHA 3RU7A 2XJ9A 3D4OA 1D4OA 2WNSA 3IR5A 4FZ5A 4BLSA 2GA9A 3CY6A 5DHTA 2ADMA 3FJOA 4LUCA 1Z5NA 3NIBA 4I2NA 4IV5A 3F6YA 1H0SA 2ETXA 3L1UA 4KSCA 1GQSA 1SXJC 1NRWA 5DNUA 4WFQA 1DFIA 1ISFA 3DJFA 3KQTA 4KSYA 4PWZA 4ROSA 2JCSA 1CUDA 2J46A 3LP5A 3QX8A 3DBLA 2D2IA 1MO4A 3UT5A 1PSDA 2HNAA 4O8CA 1T9DA 4OXYA 3UT5B 1BE1A 2C54A 2BFCB 3E7FA 3BCRA 3FNIA 3MHPA 2HV9A 3GD5A 3WRYA 5JBIA 2JA1A 4CNBA 3PSAA 3SU8A 4M89A 1NW6A 1P8AA 2ACVA 3T1OA 4EYSA 4W9MC 1X7XA 2VYVD 4DIOA 4E30A 1TO2E 3QE2A 1N4DA 3S99A 4L3OA 4F4DA 4FS8A 3RHZA 1XV5A 3W1VA 5LD2B 4IF4A 4Q03A 1HORA 5JY1A 4RJKA 4HWOA 2GHQA 5B57C 4DNQA 1NXXA 1Z7EA 2OY0A 2XYVA 3AJDA 3KD2A 2AJ8A 2I3AA 4QWWA 4I5EA 1GLGA 4RWEA 4WGGA 4KQGA 4YJ3F 4JSRA 4MYRA 4D3XA 3TGLA 4FYJA 2GBPA 2XBLA 2IHVA 4M46A 4BWYA 3KLMX 4YP9A 3H86A 4J0IA 1NTRA 3EGOA 4FLFA 1ATIA 2J3JA 3H0EA 5EPUA 5F64A 1JNXX 2IYAA 4K87A 2DCUA 4MZXA 1E9FA 2DHRA 2EJUA 2QTZA 1U65A 1WSDA 4UPVA 4KPEC 4RVHA 2AQIA 4EJMA 4MO2A 4B71A 1BDHA 4LF4B 1ABEA 1E58A 2FU5C 2ODWA 3RGWS 4B47A 2H08A 1PD1A 5G02A 2J9FB 1GUFA 3C6MA 3AXSA 4PFQA 3EXG2 4WXPA 2I87A 3B5EA 4BU1A 1A8SA 2IY9A 3MINB 4L4ZA 4MJLA 5E7QA 5JCPA 1KRXA 1OD6A 2I6QA 1XRQA 2Q1WA 2FPUA 4MULA 4BNFA 1WHSA 1NOKA 3ROEA 3EPLA 1HSOA 5GOTA 2OZLB 4RNCA 4IJKA 1VE5A 3C3AA 1ZD9A 4QSMA 1DKNA 1AF4A 4L0QA 2V7EA 3ITEA 2VJLA 1MC8A 3JQ8A 1HFKA 2JGRA 3M9XA 4DNXA 2V7BA 2B8EA 4FHCA 3LUAA 5D3KA 3KOMA 2B3TA 4DZRA 4CEHA 3IAM6 1CJTC 1NATA 4KR9A 1F6DA 4UCQA 3MD0A 1U5AA 2EGUA 2FJPA 2OO7A 2A9PA 4C5BA 4REOA 1J2RA 4QEKA 5CT8A 1BS1A 2DR0A 4JBXA 2Z08A 2IYFA 1NSYA 3PP8A 2CKDA 4ARZB 3E5HA 3D6FA 4X1IB 3SK0A 4IOMA 4Z1MD 1MGOA 1K8YB 4B33A 3UHAA 4WRRA 3RJ5A 1ZN9A 5DHQA 3RJ9A 4L0DA 4FN5A 3JQQA 4BV2A 1EMDA 5L4NA 2NU8A 5G0UA 1N36B 5DBGA 2A9RA 2FGKA 3OQJA 3UB3A 1I4LD 3L4BC 2BBWA 1MO3A 3MCZA 3VISA 4AULA 3FWPA 1E1NA 2PX2A 1ABBA 4QYTA 4YV2A 5D1NA 1GNPA 3QJYA 4YLYA 2ESRA 2W2PA 3NM4A 4ZAXA 1O87A 1YI0A 3DKVA 4XJXA 3ANXA 3LUBA 3L0SA 2HHLA 2Z09A 3ZWQA 1OKKD 1PZXA 2I2CA 3P9QA 2NYUA 4KIJA 3BVPA 4PG5A 1VG0B 3FUTA 5D7BA 4F71A 4ZV4A 1KJYA 2E49A 4Y2HA 1QF7A 2JFFA 1ZX1A 3DWIA 3UBTA 1XELA 5B4TA 2WHXA 3I2GA 4L5CA 1FIUA 3FWYA 1O5OA 3AKCA 3L4EA 3GGJA 1KI8A 5I6DA 3PEWA 1HTBA 4AQYB 2E4UA 2X7HA 4WZBB 4NE9A 3P2MA 2FA9A 4KK3A 5EEHA 2PUHA 2ZUUA 1CEQA 2BDTA 3LO5A 1DX4A 4HNTA 4CVNA 1ZG3A 2IA5A 1E7RA 3G85A 5LBIA 3FYCA 4BZQA 3NBMA 1NLFA 5KI6A 5AP9A 2G17A 1YZ3A 1J5XA 3URKA 5J4KA 3GBPA 4KRGA 3PDCA 3Q7SA 3HZHA 1MEEA 2Q46A 5LYJF 1EK6A 3B9QA 3G0OA 3PUYA 1JG7A 2YVUA 4JCCA 1MLDA 5DULA 5SZHB 4BMYA 1TRKA 4D43A 2XY4A 1HDGO 1E7WA 2Y9PB 1A9RA 1HDEA 3EEFA 4MK4A 1NYLA 3FLBA 1OZFA 3ADCA 1ES9A 2TMGA 5GPBA 1HI9A 1PT7A 2FYTA 1SXIA 1T0JB 2DVMA 3TKLA 1VA4A 4EB8A 3FSGA 1RQLA 4TMYA 3CRVA 3HFRA 1WCIB 3OIFA 5P21A 1UBJS 1YS4A 2VDQB 3H9GA 4RMGA 4F9FA 4M7WA 5H7XA 5BW4A 4L76A 3DNPA 3A3YA 3AF0A 4GMHA 3LY5A 3JRWA 3N0XA 1BJTA 2X42A 1R5OA 2ZIVB 2O07A 5F52A 4K8RB 3G1WA 2F48A 1AZSC 2C77A 1FL9A 4OHUA 1EXMA 2VPZA 4ZCMA 2BHSA 2CCGA 4M6WB 3OWXA 1ZXBA 1ODFA 4LZWA 1X2EA 1UZAA 1R0KA 5CX1B 4IEIA 1NKSA 4K28A 3Q0IA 4M9QA 3S27A 5BR4A 1G5HA 3BKWA 5C9ZA 2J0UA 3GFSA 1KZ4A 1MKYA 3SC2A 5BQXA 3LTNC 3K09C 1YOVA 2GUGA 2XHEA 5FA8A 3UWDA 4BC0A 2H4WA 4H7DA 2JFBA 3K73O 3QPCA 4X71A 1DXOA 1GZVA 1N1DA 4WWHA 4YJHA 5JEDA 1MFZA 2RGUA 3KZKA 3S8MA 3K6SA 3FJYA 2YV3A 3PLRA 1AOXA 1U7UA 3LQYA 1CYDA 4MQ6A 3LYHA 3E61A 4BLUA 2NXNA 3E2IA 4YRPA 1G38A 2O0HA 4H31A 5ALIA 3UXHA 4O4JA 3V2UA 3CW8X 3RC9A 3TMKA 5DTQA 3KKPA 1F2DA 4BO2A 3RVSA 1ZU4A 5L4SA 2VAXA 4D9FA 3B85A 5AJXA 4NU0A 4FFNA 4WKNA 1CB0A 2L0XA 1W49A 2FZVA 3OO1A 1K7CA 1QO9A 2PN1A 4MICA 1N7GA 1QH8B 3KQMA 1ZUNA 3WLNA 3K2IA 4GNKA 2YC4C 2Z4TA 3HC7A 3H4TA 4X5OA 3ZWOA 2VWQA 1YL5A 3PXEA 4D0GA 4D6YA 3MWKA 1K06A 5K9ZA 4PSVA 4ID3A 3QSGA 4IY1A 1NOIA 2HSJA 2UVDA 2UYOA 1OASA 3Q8WA 3ZR4B 2AS0A 1UBHS 4JKYA 5CW1A 2L2QA 2QTNA 2ZRLA 2QORA 3UTDA 3EXEA 2DAPA 3SAJA 4HAIA 3VR2A 4M37A 3V4PB 2DB3A 1OXUA 4C43A 1RT9A 4ILKA 1TVKB 3AT1A 4GHWA 5CIQA 3EEQA 4MMYB 3AP3A 4X7PA 1Y6JA 4O4IA 1QR2A 4Z4IA 1T10A 2X41A 2X4LA 3IO3A 3K1AB 5E6SA 2JI6A 2XE4A 4J0HA 1AH2A 3GEPA 1Z06A 3T95A 5DNAA 2ZT5A 4INPA 3JVDA 3H5AA 1YKSA 1KQFA 3S1SA 2CV0A 3U4CA 4CLXA 4X6UA 3U3ZA 1U0SY 2JZOA 3HABA 3LXXA 5EHGA 1OBFO 4PC3A 3VAYA 1KJZA 1X39A 4D9IA 4YO7A 5LQAA 4G01B 1CJUC 2R7MA 1KZ6A 4D56A 3D1VA 2EJVA 3F98A 4JYAB 1WUIS 4Z8XA 4JZYA 4LYDA 1KI3A 5BPFA 3DDOA 1S8NA 5CLIA 5FA6A 1HTWA 3MIIA 1DWUA 1RJDA 3HJBA 5DM70 1QDLB 5JXHA 1X9IA 4HLUA 1R0LA 3KZ1E 2AW5A 2IYWA 4NBSA 2WVJA 2Z95A 4Z5XA 1AC5A 4HS4A 4LOKA 2ISCA 3LA6A 4IRXA 3WAGA 1O89A 3GBVA 3GPIA 1BMTA 4PPFA 4GNRA 2POQX 5FBHA 5EP4A 1YZTA 4KHZA 1H5UA 2YL2A 2VHXA 3L9WA 2JHPA 4JASB 3AFHA 2J07A 3TN7A 4QPDA 2HW8A 4X66B 2F1IA 3CEAA 2OBFA 1C3OA 1ZNXA 2XB6A 1DBRA 5CFNA 4EFLA 3ZKWB 3UW3A 1RLJA 1JH8A 1IE3A 2GHTA 1M1YE 2HF7A 3AOGA 3J7TA 4LRTB 5DX0A 4C7MA 1RYNA 5AW0A 1ISMA 1CV2A 4J0EA 3ECCA 2F3TA 2Y6UA 4PYLA 2MR6A 2HJGA 1SQ5A 3DH0A 4PR3A 5K5EA 1JA0A 5ED4A 4J1SA 2FFRA 3GEDA 3PDUA 1MA3A 4QOGA 4PNZA 3HXPA 1A5TA 2KS6A 2PQ6A 5U4XA 3TO5A 3DE0X 1XMIA 3RUPA 1QJCA 3FYUA 3MGGA 4F97A 3ZDDA 4YA6A 4HRVA 4QX6A 4FGKA 1SUWA 3ZKWA 4G4SO 1YXMA 4EHFA 4L73A 3HKEA 4RYDA 4IJVA 4QYIB 2YIJA 5CHYA 3BWMA 2EF0A 1NJ6A 4RESA 5C8VA 4MCAA 4DCSA 4TSFA 3KQLA 4L16A 3GJ3A 2VUIB 2CL6X 5TPWB 1ZA1A 2HXSA 1P9RA 1EHCA 1E69A 1XROA 1AKEA 3E5RA 3RTEA 2C2XA 2FSIA 2XBMA 1IIRA 4MQFB 5B2EA 3FZNA 1ZBDA 2PZGA 2CNWA 1DPGA 1RYDA 2CD9A 3JD3A 3A6HA 4G8BA 2ZI6A 1V4BA 2EWMA 4ARVA 3NOXA 4QFMA 5AK5A 1RIIA 2COUA 3RVRA 3K70C 1AKTA 4PX2A 3W5BA 4IW3B 2YVAA 3A36A 1JGTA 1O57A 4KE9A 1OOEA 4KR0A 2CL5A 4RD3A 5KSYA 5EQDA 5SY4A 1HC7A 3UENA 3SBDA 2KI5A 3FSJX 1IEWA 3QY0A 3TKAA 1IC6A 1UKCA 2ISSD 1ZZEA 3AV3A 4FCVA 3H83A 1DELA 3UJ9A 2IW3A 4YQYA 5JH7F 1G3UA 1O6FA 4R8KA 4Y3UA 2I67A 3C1AA 3NHSA 4UEQA 3WL3A 4P81A 1NP6A 2JIZA 3D7RA 1RRVA 4IRMA 2W8BB 4M3NA 3RVMA 1TEZA 1FUEA 5J5VA 2DTEA 4QARA 3DOCA 1P9LA 2DBVO 3KUCA 3MFQA 4R5HA 1AKUA 5JAQA 5I47A 2ZTSA 3IURA 3PTLA 1D2MA 2C4UA 1U9YA 3E3LA 1PFUA 1ORIA 5C7OO 4WK6A 4OEHA 4ER0A 6REQA 1G291 1ADYA 2OOKA 2H4ZA 4G5RA 4TYMA 1TC1A 1U2SA 3A8TA 2AN5A 4F06A 3CF6R 3ZWVA 1P73A 3LQ1A 1L7QA 1CRZA 3LE8A 4RSGA 4HFMA 3RU2A 2F3UA 2HMYB 4BLVA 1OB5A 3GFVA 3W8EA 1PLJA 5BNZA 1VLQA 2QROA 1T5OA 4M0PA 4LFCB 3RF6A 1ZVVA 1I2AA 3ASZA 3H1TA 1U2QA 5I8ZA 3R8FA 2ZROA 2QN8A 4OQDA 4BY9E 4IIJF 3W0LB 2B4QA 4AG6A 4AS3A 1YTLA 5DMHA 3AI7A 2RAPA 5ALFA 4BKOA 1A4XA 3HLYA 1AM4D 1HDZA 1MH1A 1P2DA 2XJ4A 2JARA 1MABB 4XUCA 4ZGGA 5LLDA 3OE5A 1VL6A 5CTAA 2ORIA 3HZRA 1HE4A 3IEKA 2B20A 2C9MA 1ADBA 1KI1A 2V6IA 1KPIA 5IUNC 3ILYA 1FFSA 1JHAA 1QIIA 3H6HA 4Q82A 4EPRA 3ZWYA 5LZ9A 4YK7A 2BH9A 2P9CA 3I45A 4FYXA 3SIPA 4I55F 4ZYZA 2Q5CA 3X1KA 3LKBA 1LU9A 4LOJA 1TAUA 1XX6A 3V4ZA 1UXHA 2QR3A 1QPBA 5HRCA 1WZ2A 4H7PA 4OL9A 1KE1A 3GJTA 2EBFX 1PG5A 2I1LA 3R5JA 4G67A 4XM0A 1N3IA 3THRA 1I1QB 5I4IA 1CX9B 1RC8A 4YIKA 1T1EA 3OJXA 3HDGA 4RS3A 4BC1A 1QIDA 3WAJA 5EUMA 3OU6A 2ZCVA 3DTVB 4KPUA 4PZLA 5LQDA 4N6OA 3R0IA 1J4AA 3NRJA 3IAS6 3NIFB 2ZIGA 1HFEL 3R5TA 1P1CA 3DVRX 1OZAA 2MYTA 3F8SA 1F8UA 1GPMA 2BY4A 2O3SA 3HO6A 3ON5A 3OVMA 4BO8A 1X9GA 3KR0A 3NTLA 4PHFA 3GQBB 1XU9A 3D0KA 1ECLA 1QIMA 1NBAA 2ODPA 2JEYA 3GLHE 4K3VA 4E5UA 3DFZA 5ALHA 5JBNA 1Q0TA 2BI7A 2CCKA 4HWGA 3RAEC 1FDRA 2I2DA 4LV8B 4AO7A 4KC0A 5FI1B 4J03A 5C0OE 1I4EB 1TJ4A 5ADHA 3PGLA 4FI3C 4BX8A 4YT2A 3DEJA 3GAZA 6Q21A 1PT5A 3G2PA 5JV5A 3VNVA 2P9EA 1E89A 2C8JA 4LI3X 2X0DA 4HX5A 1ZMTA 1PTJA 1U81A 4HDKA 3TAUA 5KPDA 4K26A 2Z9DA 3AIIA 2MYNA 1C50A 3P4UA 1FRVA 1HQCA 2OCDA 3M1AA 3ONNA 4LZLA 4N8DA 5DGDA 2D5CA 3S2UA 5EXSA 4YJ2F 1T4DA 4X0EA 1YJCA 3R7LA 4R2JA 4UBLA 1N33B 2NUPB 1SUBA 4UFPA 1T5IA 4HL6A 4I5DA 3ULKA 4TKVB 3IQIX 4CCWA 1JFFA 5ICEA 4OH1A 5HS4A 1L8LA 1YNOA 2C7PA 1Q57A 3I76A 1QK5A 2J8ZA 3UQYS 2R00A 4LOIA 5G3YA 2CHGA 3EZFA 2D3WA 1SBHA 3AM3A 3N8KA 1XF9A 1AK1A 2DWUA 2JGEA 3F5DA 4GX0A 4R9NA 4TT8A 3DEZA 3UK2A 3LC7O 3TRDA 2BKXA 1KH2A 5FBZA 1UBUS 4ZT4A 4TSKA 5HKLA 3ZUGA 2JLRA 4RDCA 3A9TA 1MAUA 1NI4B 2PZBA 3QTBA 1V7CA 2GXQA 4JP2A 2P3LA 3AU9A 4PZ0A 1FVOA 4RXUA 5EC8A 1JQDA 4OGWA 5HE8A 2EZ8A 4LWZA 4J75A 4XPIA 1G9XA 1JAZA 2Q5OA 5LDGA 4DEXA 1I0IA 5KX5F 5LOVF 2BSAA 3R3YA 3ZC3A 4PWYA 2R8BA 1P3Y1 2QL9A 1ULHA 1EK2A 3L40A 4Q34A 3V9AA 5FUVA 3KHUA 2IHNA 4AYXA 3F3KA 4RLQA 3ZIUA 4YALA 1DKUA 3P45A 1F6WA 4D3SA 5FR2A 1GTJ1 1K0UA 1DC8A 1UJ5A 5AHKA 3STXA 1U0HC 4PIPA 4ARZA 2F1OA 4HWPA 1N4AA 2OHXA 3EG9A 3Q10A 3TIXB 3KQKA 4ZPJA 1L4UA 4FC7A 2DJIA 3CRQA 2WA1A 4FUQA 4DYDA 3E7DA 2XCSB 2RKWA 2V98A 2XZDA 4R9VA 1ZWKA 3TLCA 2VPYA 3BXXA 5FYQA 3ESAA 3HBAA 4J4TA 5A5VA 2DMRA 3AM4A 3P9ZA 1CEEA 1JHVA 3RUFA 2AMYA 1AGXA 4AJOA 3U5ZB 2XMGA 3IELA 1VPVA 3LP6A 4A8HA 5K3OA 1V11B 1IXZA 1YZVA 4L9SA 1EVYA 3V1TC 4GYWA 4L02A 2UVPB 3OQIB 4DWVA 5C5CA 1W96A 3H17A 4BGIA 4QJ3A 5BVHA 5EJ4A 2ZYIA 3WKBA 5A5GA 5JO0A 1JZSA 2FX2A 1ZNQO 2QN1A 2A0XA 2BMAA 3NOQA 4KYVA 5EIBD 1DJLA 5CURA 3AEQB 3R3XA 5KJ6A 3BD9A 2CL0X 4KE7A 1U8TA 4AZWA 4EPWA 2LKDA 3B82A 1P0PA 1PKXA 4GI5A 3AW8A 1JHPA 4MVJF 1GM5A 2H4HA 2RKBA 3I72A 3GHYA 4HDMB 1LFDB 3KQWA 3WBFA 4I2VA 4PU0A 4IIFA 5K6AA 4K0KB 4LY6A 1CUJA 1W48A 2GTHA 2B5OA 2G0AA 1YULA 4URXR 1S2DA 1TQ2A 3EDRA 3UGKA 5KNCD 4H6XA 3H5TA 3N39C 1Y8QA 1WU7A 4J1QA 4WBSA 1XF1A 3A7DA 5BQ5A 3LUJA 4Q7EA 3W5VA 2WJJA 3G2IA 2EBWA 2EL7A 3DZIA 2Z1DA 3SI7A 3SYLA 2X9QA 3E70C 2LW7A 3IBTA 2C7GA 3EY9A 4WT7A 3BN3A 5IBCA 1J70A 1GLNA 5ESXA 3DOOA 3Q88A 3RTCA 2E4YA 3O9MA 5IBQA 3ROTA 1TIPA 3O4GA 1O6GA 1VG9B 1GJRA 2H57A 1UWVA 3UF0A 4TMTA 1NXSA 2NAFA 5EMHA 3UOAB 3B9RA 2ZJZA 1NNI1 1AB5A 3E4CA 1Q17A 1PK7A 1TLTA 4YDSA 1X7XB 1XTJA 2VTEA 4RM2A 3VOSA 5AUQA 1SUIA 1W5TA 3PPIA 1KDYA 2I3GA 3ND8A 2JFYA 4BNDB 2PA3A 4R40A 3ROXA 5E95A 5HZKA 2JD2A 2JIOA 2W4QA 1N6PA 4KPGA 1UKEA 3HZZA 4DIEA 2BSQA 2DGDA 3E9DA 4R7TA 4WX2B 4EG6A 1CDEA 4Q1VA 4JVMA 2LD4A 1O95A 2ZIXB 3KQOA 4R2LA 2WJVA 1GNQA 3ESZA 1L4HA 2K7FA 2R6DA 1JWBB 2NZYA 2JBWA 2YV4A 3Q9NA 4LX0A 5CK5A 5D2CA 2DUWA 3VJMA 4BMPB 1CDOA 3ES9A 4EHHA 2WM8A 2WK1A 1SPXA 2GARA 4QU5A 1F3LA 4NPHA 2ETVA 2UKDA 5AUNB 3IP7A 4G63A 3TQTA 1RQXA 3FOAA 1QX4A 4L15A 1R74A 3FSGD 3V7UA 3PFBA 3ZJUA 3WMXA 4B46A 4CM3A 3IILA 2HK7A 3TI7A 2BCEA 3TZKA 1T4CB 4LK3A 3P26A 1SRQA 4GKBA 4X61A 4Y6RA 1H1LA 4BO1A 3LHKA 2Q3JA 4QVKA 5TV2A 1WCYA 2C5EA 2P8SA 3ZWCA 3P9SA 4KGZA 2SKEA 3JQ8B 1YBMA 3L7DA 3VPXA 5HBGA 2PUCA 2J0QA 3WL5A 4ESOA 3ET5A 4Q4HA 3Q11A 2WWVD 4EJSA 2ZB4A 4MJXA 4R4JA 1NBIA 1L4LA 1QFMA 4QDTA 5FWYB 4G9BA 3D8BA 3EAFA 4RGBA 1UDXA 1C3EA 1JF8A 3C4QA 1MB4A 2GF9A 2C57A 2Y71A 3B9BA 5AKEA 5DTMA 4KODA 3CLVA 2Q45A 3VVLA 5FOQA 2O5RA 4MS4B 1SCNE 3L05A 4LRQA 3D8SA 4HDRA 2VA8A 1NXTA 3KUDA 3OA2A 4XWYA 4XRGA 1NN1A 1ZCAA 1Y4AE 2WWTA 3R3ZA 4TWJA 3RYIB 1KDOA 1HGXA 5HR5A 4G5XA 1E92A 1MEJA 1J42A 1G4AE 2PKEA 6CHYA 2C20A 3ZXYA 4JNKA 1ZINA 1GA6A 2DWQA 3IVGA 1APBA 1C30A 1OB2A 1E60A 3U80A 3GLFE 1QYRA 4QQKA 2II6A 5HYVA 2G83A 2XI4A 3ZV4A 1R6BX 4C6SA 1NG9A 1M76A 1NE7A 4W9NA 2C97A 3PHIA 3IUQA 5EWJB 4L8LA 4KI7A 1OGYA 1DKQA 3AHJA 1XCJA 2RHLA 2VK2A 4C03A 5GZ3A 1TEHA 2PQ0A 3KEFA 4OFBA 2CW5A 5HM8A 4AWXA 1XLVA 3N05A 2GPNA 1W4RA 5IKMA 1CQZA 1DXYA 1HQKA 2OFWA 5ALWA 4PRKA 3PX3A 1U8YA 1QGED 3LNTA 2HK8A 3PRJA 4RHCA 1WMBA 2BFAA 2IVZA 2NPOA 4N7BA 2R6CA 5DSZA 3UOWA 2GXSA 4FIZA 4K2AA 1AV6A 4DDVA 1IFXA 5K99A 1JT2A 2E5FA 2YYYA 3D4PA 2CYBA 3LX8A 4TQGA 3RIXA 5GZ1A 2ZUFA 3DVLA 1Y6FA 2AKEA 2J5QA 1I8TA 5EQJB 4BB9A 4NZ9A 5BV8A 1Z5UA 1JVSA 2P11A 3KKKA 3RNOA 4N5LA 5EJ2A 4PCAA 3S7ZA 1ZXXA 5IVKA 1UJBA 4CRWB 3RBAA 3RC8A 4UZEA 4BGDA 2P2ZA 4R16A 1Q50A 1PJQA 2PFSA 2CLHB 2AXPA 1PX2A 1RJ9A 3GJ6A 4EA7A 1DC7A 5IF3A 4YCNA 3WL6A 3LO8A 3PUZA 1J5EB 4DLBA 2VATA 2VSXA 4FUTA 3UGQA 5K4GA 4WADA 3OPYI 1UQUA 3GJRA 5DX1A 3I6ZA 2FZKA 4D8VA 1PSWA 1EE2A 1H6CA 1X8LA 3N6RA 2Y68A 1LD3A 1C3JA 1L8XA 2CY0A 2ZBRA 2GD2A 2FVXA 1G17A 4GGPA 3BWEA 3K16A 4ITRC 3B89A 1QYWA 4I3HA 2WPDD 3OM9A 1P3DA 5EKDA 2G5TA 1G19A 1ODJA 3L8CA 1RPNA 4JR1A 1U2GA 4TKLA 4LHZA 5AM1A 2LTAA 2R6R1 3FKSA 4YAEA 5HJ5A 1XQVA 5T41A 5MGNA 4NBLA 1UWCA 1BC5A 2CLOB 4KJXA 1A2BA 3BMNA 4M54A 4QOIA 4A1FA 5IJ9A 2NU7B 3FMGA 1P1RA 1XA0A 2NO0A 1JJBA 2ZDHA 1C8LA 2PJUA 1VGVA 3AVOA 2OFOA 1W93A 1PGQA 4P32A 4DDWA 5G40A 1RCUA 2A8YA 1NIJA 2C2YA 2GZDA 3CSDA 3S4YA 3T7AA 2FGJA 3VZCA 4UTVA 4EGAA 2FG6C 2EDAA 1F8XA 3HXQA 3LRPA 4TTPA 1XB2A 1KFEB 3F2VA 4YRCA 1X7YA 1PT9A 3JD4A 1GV0A 1SC6A 4CL0A 7REQB 4MDEA 1WHTB 2IXTA 1KPHA 3IPYA 1JMVA 2FAXA 1JPNA 3THYB 2W2VA 1G7CA 4B3RB 4ONEA 3EGVA 4HKTA 4TL8A 5JYCA 1W29A 2WI8A 3ENNA 1SMKA 4HNHA 2QVGA 3GLQA 5KJEA 5C7YA 1A3CA 4QTZA 2HEIA 3OU7A 4JOBA 3KFVA 3WVNA 1OH5A 3HSYA 5IW8A 4LAFA 1JN0A 5HKAA 4R0NA 4RK0A 2VS1A 5EG5A 4ZK2A 4QGAA 2CC2A 5TJ9A 4EECA 1B23P 1JTEA 3GJYA 1OAOA 2Q6VA 3U7FB 3EWSA 3KX2A 3T7JA 4TTVA 4PZZA 3T3NA 1GXSA 4LWQA 1NLZA 1LQTA 3ODGA 3WBJA 1UK7A 2CFSA 2IGBA 4HZGA 1NNEA 3RSFA 4TWIA 1LJ8A 4BPBA 4OA5A 3I73A 4G2NA 4MX8A 1WPRA 3ZWWA 2EKZA 1PQUA 3JYOA 3M5WA 3IDOA 5EHIA 1EFVA 3UJ7A 1JIUA 4RZIA 3KJEA 2WE7A 1M6YA 1BWSA 5DHRA 3U39A 3GJXC 3OIYA 1C7QA 2P30A 3B7GA 4FBGA 1BEEA 1SBYA 4J2TA 4QUDA 1QHNA 1CQWA 4MR7B 4HFJA 1Y1LA 5ALVA 1B0ZA 1F5SA 4ZREA 3T4UA 1TTPB 3P94A 4LVOA 4NY1A 4OJYA 3NDPA 4PHGA 5T64A 4E5PA 4EVSA 1X7YB 1LSSA 3ISTA 5ICGA 2OYCA 3HM9A 3GLTA 5ALZA 5FPYA 5JY6A 3MJ4A 1IJBA 3JY6A 1EX1A 2ICAA 4EBBA 3S3TA 1N8KA 1IZZA 1EKXA 1XWFA 4AJEA 5CAEA 3AEYA 1MHTA 3NHBA 3IC5A 3TEFA 2QUHA 1XTPA 4JWTA 1ZUD1 4ZJUA 4LJ8A 2J3QA 3C8HA 3BE4A 3L7CA 2XGOA 1BX1A 3VGPA 1HETA 1XZ8A 5FTKA 4C4RA 4G0OA 2Y8EA 2FWNA 2O3RA 3QK7A 3MAAC 1JDBC 5CVEA 3BGWA 5C5IA 2FW0A 2M2IA 4EOGA 3BMNB 3NR2A 2OHJA 3FVTA 1VIVA 5H68A 4ZZ3A 3DGEC 2K6GA 1ISHA 3C2QA 3F7OA 2QBYB 3OPQA 1DXQA 1TL7C 1VL2A 1WEKA 1XA3A 5CM9C 4K6MA 3N0VA 1FJGB 2VXBA 3ZPXA 2RBGA 2D3TA 3WLEA 3JZAA 5IAKA 5A7FA 4YCDA 3ONFA 5CFOA 5KNBA 2AN1A 3G68A 2D0OB 3PX7A 4M7PA 3OIWA 4DEVA 4Q3BA 1N1GA 3ZNOA 4DV6B 5B7PA 3KT3A 3BMCA 4PTLA 2XB2A 1DHRA 3E3NA 3P5SA 4TRMA 4ZOLB 2GK6A 1YZUA 4R69A 5AM3A 5CLLA 1S8AA 2CE2X 3IKJA 4MITA 2R6FA 1YB6A 1N5DA 2BMWA 1S7GA 3JASB 3MLEA 1FP4B 2RJOA 2IIVA 2ODNA 4FD3A 3H2HA 5GJVC 5E1MA 5AW9A 1NZFA 2X1HA 1QOZA 1JKJA 5CVUA 4ZAWA 1PDWA 2WUGA 3K0CC 1Y9AA 4J1NA 4NCBA 4ND2A 3KUXA 5LUAA 2UAGA 3SDZA 1XAIA 1K2WA 4RHXA 4MJ7A 4TS9A 4BJ1A 1YFJA 4URUR 3F3MA 1XTTA 2R11A 2R60A 1X3SA 1WKCA 1LDEA 1OYVA 2A0KA 2H5JA 2Z5FA 3LX6A 3M1IA 4DTCA 5F9HA 4Q9NA 2XUGA 3PR2B 4K9OA 5KYGA 4ER6A 1D3AA 4V0MA 2C5FA 2IXDA 3KOWA 4K1LA 2D62A 2VXOA 4YUYA 4YMVA 4N48A 1JG2A 1PZMA 2O8VA 1LVGA 1XN1A 3GFBA 2P77A 3C5VA 7AT1A 3U0VA 1KAHA 2Y93A 2HHJA 4LQLA 4BQIA 1CR0A 1Y5LA 2DX7A 4P4UA 3PC4A 2OYRA 3P0HA 4GEKA 1T2FA 2JF0A 2XAUA 3DE6X 3PI7A 2Q50A 2ZRJA 3R75A 3E9QA 4Q4AB 1IM2A 1IMOA 5AKGA 3VQTA 1DWOA 2Q7OE 5CBPA 2VF8A 2H8KA 4V24A 1SXJB 5FWXB 3F7MA 1PO7A 3BB3A 3QVGB 4GO1A 2RHOA 2W37A 3B6IA 4BFLA 3BMCB 3G7UA 1AX9A 1F3OA 1P0CA 3C3PA 4RH1A 2G09A 1P2BA 1B2RA 3IV9A 3MA0A 4DM3A 5HKKA 4ID9A 3U5TA 1JLKA 5FBQB 3RHFA 1YE8A 2KSQA 3KFLA 1U0JA 1XRRA 3ADOA 3HKBB 4GR4A 1HDOA 5AXBA 3EA4A 1NLUA 1VE7A 4QTYA 4OV6B 1JSXA 3KE9A 1EESA 1EIWA 1LSUA 1M2FA 1BDIA 3DTVD 1LC3A 4NKRA 4UTZA 5A4DA 1VCIA 3R0ZA 1UIRA 2OWDA 1OKKA 1IZ7A 5AJTA 3TAHA 4H1VA 3IB6A 1G60A 3DZFA 5ELMA 5FYDA 3SHQA 3GWZA 1PUJA 2YYZA 5C18A 5DTEA 3OHMA 3TH5A 4BP3A 2PYDA 3KAKA 4UM9B 2ZWPA 2QU8A 3AEKB 1L5VA 1Y5IA 4QTUB 3TCXB 3ABRB 4JKIA 4ZICA 3O2SB 3PC6A 4U4AA 1BNCA 2FPXA 1RAFA 1ELOA 1ZGGA 5GIOE 1E32A 1W87A 5ALNA 4ZEOA 5BN3A 2Y1KA 4X1KA 5B53A 4KQFA 1OV6A 4HEA1 4O2RA 4F04A 4UU7A 3VHLB 3DMFA 1JEDA 2ODBA 3CUEF 3NDIA 4TLEA 4A92A 5JZSA 1S7CA 3K0SA 1KSJA 1PU2A 1Z62A 3EXHA 4UREA 1P4RA 3V8PA 1G0OA 4MVJE 2WP0A 5J63A 1ZUNB 2VHJA 2Z2YA 1S0UA 4BO5A 2R8XA 3AJ9A 2QRNA 4FYHA 3L01A 4EGSA 5DB4A 5LR6A 1EUDA 4AVYA 1Y1RA 5REQA 3ZCXA 4D8WA 2H1CA 3BAZA 5IBPA 3T9DA 1EFLA 4JJ6A 5T6MA 2FW6A 2HJVA 3LC1O 4UUMA 5EMKA 3BXHA 2J3MA 1A72A 1NURA 1YF3A 1IRXA 3FHLA 3PIIA 1U8FO 1W2GA 1JAYA 3UV3A 4DWJA 3HYSA 4Q3OA 5CM8B 4KR2A 4HN9A 1RAHA 3ZWBA 1C4KA 1Y8ZA 3QFHA 3PJRA 4KUHA 3GUHA 2DFDA 2AC7A 4BU0A 4DMMA 5LOVB 3AUSA 3T7TA 5JC1A 1C7RA 4P22A 4BZWA 5A02A 1XP5A 4S24A 3MMSA 2BEJA 1KQPA 2ZXEA 4DZTA 3CLRC 1FDWA 1KVRA 2I0FA 1XNRB 4WERA 1YOVB 1ZM3A 1WB4A 1R9JA 1TFRA 3H4IA 3L6DA 2C95A 4GZLA 5IVDA 5KTNA 4RZHA 5EZSA 5A4KA 1RHUA 3ZDCA 1EGVB 3IP5A 2HBQA 2HPAA 1BD4A 5JSZB 1WBBA 1G4HA 3BRCA 1MVLA 3TL6A 1U7DA 2JCVA 2O3QA 3T15A 2DOKA 1W94A 3FCOA 1PHRA 2Q5LA 2PS9A 3OOJA 2XTZA 3DXZA 3OZWA 2F3SA 3FPBA 3WZLA 5J4YA 2XQKA 2WAAA 5JG7A 4KE8A 5JE8A 2IYZA 4HN4B 2YNMD 4KH0A 4BN4A 4JXZA 4XM1A 2UZ0A 3B7WA 4Y2GA 4GRAA 3WL4A 1E64A 3EMKA 4BMVA 2C84A 2PKQO 4MRNA 4IG9A 4F85A 4GPAA 3EYAA 3W3ZB 1MAAA 4DSAA 2OKCA 2A33A 1V8ZA 3BXOA 4JYZA 2VAMA 3E4DA 3EE6A 1AQLA 3C3XA 1W36D 4BVJA 4MEAA 3WS7A 1ULTA 1PW5A 2XKJE 2PMDA 1W52X 2GPYA 4IHJB 2ALJA 1V1JA 2JJ2D 2KBEA 5F5LA 3TZLA 1ULSA 1OPXA 3OOEA 1OSNA 3UUGA 2I2WA 1XTUA 2QE7D 3G2KA 3IH5A 4Q01A 3SS9X 4P7JA 3TE7A 4GE0A 4LE2A 3WAKA 3S8YA 3O7WA 1MOPA 2ROQA 5DVZA 3AG6A 3AVWA 2TRSB 4MP6A 5C3UA 1HYGA 4D42A 4JLOA 1FDSA 4MW0A 4AP9A 2QPAA 2POCA 2ZSJA 4HGOA 5E6SB 1PI3A 1YDEA 4M4SA 1E18A 3E2PA 4NU8X 1VZ3A 3LJKA 3R6LA 1ONPA 1SHJA 3V8BA 3UG6A 4ZO7A 3UCFA 1H4VB 1G5QA 2QW8A 4QUKA 2GRAA 2IUUA 1THMA 2EDCA 3VU8A 1F4VA 1OH6A 1ZUHA 4WDQA 1ZMXA 3G3EA 4WV3A 2ZYTX 4CQLB 3OPXA 3BIFA 3OP1A 4OIMA 2W0SA 1Z6XA 4OQPA 3I04M 2W2QA 5ALOA 4YYEA 4ND8A 3EC7A 3KELA 5ILQA 1HDRA 5AHRA 4QA9A 2XH8A 5TQVA 3E9YA 1E2GA 2LRHA 2HX1A 4JVLA 4JI2B 4P3PA 4XQCA 3KEOA 4BKMA 1T4GA 3VR5D 2Z1MA 5CXXA 2NU8B 1Z74A 2DTXA 4M1WA 1HKUA 4HDQB 4BTLA 3N2EA 4WOPA 5LYYA 1P9NA 2J5KA 1ZD2P 2EJTA 4H4EA 1RSZA 5DYGA 4MQ5A 3TG2A 5TEWA 5ELLA 2H8GA 4KFSA 4POOA 3SS7X 1TLFA 2WFLB 2EC5A 3AI1A 4RLSA 1GPLA 3QPDA 4QLBA 3A1TA 3KHTA 2CLCX 2O05A 5KVAA 4JV5B 1E2NA 2V6BA 1M6HA 2C0CA 3SXJA 3SYRA 2C3UA 4BXOA 1UL1X 4HX9A 5JISA 4OK6A 2HA3A 3Q8LA 3MBOA 4DT1A 3D2LA 3D81A 3JARB 2HCJB 3L49A 5KPJA 1RU3A 2AOUB 4N9WA 4UHDA 3W6NA 3ZE7A 2QVLA 3D3NA 1C0PA 5JMWA 3IMFA 3F97A 1DBVO 2JL1A 4XWGA 5JUWA 3D7LA 3GP8A 3PTZA 4I50F 4TWRA 2YQZA 4PFKA 2BT4A 4AMYA 4AX8A 1JEQA 3ESYA 3A6EA 1D0VA 1TUBB 2QJWA 3CS3A 4E11A 3MINA 3IA7A 5CK4A 2XX3A 2XRZA 1TF7A 5J2TF 3INNA 5KZMB 1IM8A 3UMJA 3PRHA 4BCDA 1JU4A 2K2QB 1ACJA 4MUMA 5GM2A 2RGBA 1ZO8A 1F8GA 3CO5A 4X60A 2FRVA 2UU9B 1BXZA 1UOPA 4FT2A 1NV8A 2C4KA 2PWAA 1YZKA 1TNDA 3BTSA 2FF5A 1LPAB 2ZRAA 1KTIA 4W7SA 3FI0A 2YWJA 5TMDA 3DNMA 2IOYA 4Q4HB 4UVHA 3L8GA 3O03A 2NZ2A 2PSHA 1DZ3A 4IDBA 2DPHA 4QQNA 3KVNA 4R84A 2QUJA 3HV2A 5LXTF 4RTSA 1VQ1A 4KO2S 2E4XA 4LYGA 2ZYHA 3H18A 3HUEA 4UE2A 3E22A 3FDJA 1HDCA 2WE8A 3ELUA 1CZUA 5EYPA 1ZVMA 1J33A 1Y6QA 4E2ZA 3RIYA 2FN7A 3QLJA 1KFCB 4R2XA 2O50A 5I9IA 1UWKA 3GY0A 1H2FA 3UHFA 3V3TA 1MV8A 3NYQA 2DHDA 3BICA 1ZICA 1E1QD 4CF4A 1U1IA 2IK8A 3IV7A 1C7ZA 1JIIA 3BXZA 3OLVA 4COKA 4GP6A 4PAMA 2V1UA 1IBRA 2AGVA 5EMJA 3BXEA 5IMBA 4C7OA 3KQHA 1GU1A 3LFHA 2JD0A 2J6CA 4PZDA 3T3EA 4NOKA 3AEUA 4IIGA 5JSFA 4TVKA 3ORSA 2G1PA 2JDID 3W6OA 2V7QA 2X5KO 2OPBA 2X0RA 4OXKA 1MX3A 1XGKA 3KLBA 3WRXC 4BMNA 5IH7A 2GEKA 1UPCA 4MOWA 4TTQA 1W5AA 4R6XA 3AYXB 3Q2KA 4QFBA 3L1JA 4BQPA 4G25A 3DZGA 2OGTA 3NAZA 2MMCA 3AY7A 1R8QA 1UQRA 2EKDA 2OV3A 3MF4A 2WV9A 1FC0A 1ICEA 1E3QA 2JJYA 2M32A 4CLDA 4TL9A 2UXDB 2YZMA 4IGEA 3MTQA 2QRZA 3EA0A 3UT0A 4BMCA 2RBKA 2D8MA 2VDOB 1BHQ1 4R1TA 3JAMA 2PLAA 3KBBA 4CE6A 1XT6A 3QXCA 2HQRA 4JMLA 4DCMA 4EENA 4HVLA 4LWOA 4R1NA 4CZ2A 1HURA 5I7AA 2QTGA 1FSPA 5CA0A 3CYFA 3B2NA 3WKEA 4EMBA 2BF4A 1DO2A 2FG5A 2R7NA 4TMKA 4MHSA 3QU9A 3PZBA 2QSJA 3A05A 3U3KA 3BYZA 3IDZA 4JENA 2DBQA 1KYXA 1CZKA 3PR3A 2JANA 4I5FA 1T9KA 4DC1A 3KP1A 4PZPA 2JBAA 5G1NA 1JEOA 1KEKA 5IVPA 1KMHB 1QCYA 2BE7A 2EHDA 3T0FA 4WLOA 4IJUA 4C05A 4Z4QA 2B0JA 3A3PA 2LGJA 3T7CA 5JTTA 3FPEA 1FQJA 3BA1A 4CMGA 3AG5A 3IVCA 4F21A 4HDMA 4KFRA 3OM8A 4GM0A 5K2MA 4YXWD 4JBGA 4EWLA 1DARA 1TU3A 1T8PA 3OCVA 2WABA 3PQDA 5CA1B 5TR9A 1P6XA 1Z2EA 3DVQX 1D1PA 4NEQA 4C06A 5KU1A 5KYNA 2G9RA 1HL7A 1CLEA 4N12A 3PGJA 1ZH6A 1P72A 4PPYA 4AYTA 1VE3A 4DRXA 4CDRA 1GRQA 3FTNA 5GADl 2CCJA 2QIPA 4JJAA 4WL0A 3ZLTA 2UXCB 3K7EA 3V1KA 4C4TA 2BFEB 2X2PA 4MI1A 1H8EA 2D2FA 1RYYA 1V6CA 5AXDA 5K3BA 2GZSA 2QUKA 3M83A 3QVXA 2NO1A 5HIMA 1ADFA 1YMQA 3H7AA 3NORA 3EFEA 4GXNA 4MW2A 3N28A 4YV7A 2VJMB 1GKYA 3EPJA 2WP8J 3ZQ6A 1JA9A 3UWPA 4YRFA 1I10A 2O20A 2Y1XA 3PHHA 3R3WA 4DS3A 5BWCA 2ABWA 3M6WA 5C3MA 2Q49A 5KMGB 4QNNA 2XQGA 1J8MF 2G88A 1JBQA 3K4HA 3QEAZ 1VXRA 1YVDA 3GOQA 1WR8A 3PQ6A 4JHXA 2J9YB 1Z6TA 3I5AA 4NQRA 4OYHA 3INRA 4R81A 1GQRA 2VNIA 4S1NA 1U3FA 1BCRA 1YBVA 4O2BB 4XJTA 5DCLA 4MKRA 5KO2A 2VSQA 2H17A 2ZPUA 3LVFO 4GUAA 1KOGA 2H1RA 4HB2A 3NBXX 2XT6A 3B9PA 4FNOA 4IDOA 1QCCA 3BHNA 1WS6A 4P4TA 4PZAA 4X1YB 3VYUB 4CMIA 3I52A 1N0WA 2F8MA 3QTTA 4I4TA 2REBA 2PR2A 3H3JA 1P1HA 1GY8A 3NRBA 1XJWA 3L7AA 2PX8A 4Q9JA 4ND4A 3ABIA 4BUCA 1ENZA 2C2HA 3FRHA 3V8NA 4PYNA 5JDCC 1UMKA 1LJLA 2O4UX 5CB8A 1U0OC 2WAYA 3ICOA 4XASA 4H59A 5KC8A 4TMVA 1O6CA 4IIVA 5B4UA 1NR5A 1XUOA 3KWLA 8ATCA 3WL8A 1PL0A 4TLBA 5JWRA 2PWBA 4TLCA 2PLRA 1WUJS 1ARZA 2H1VA 3DWEX 3PHLA 1WDWB 5D3QA 5DTRA 3QV2A 3EVTA 3RM3A 2Q5QA 1NXVA 2QGNA 2O52A 3EVAA 1N9GA 3C8DA 2BM9A 4G3XA 3E18A 3G9XA 4HXFB 3LH5A 2P2SA 3C4JA 4HGQA 4XSVA 4QTXA 4TUYA 2HZBA 3HPQA 2AZ4A 3VPGA 3HG7A 3VXKA 1H2HA 1LBTA 5LKAA 1DAEA 5CAEB 4GOLD 2FEOA 4N7MA 1YKFA 5H80A 4RTJA 4Q15A 2ONJA 1GVNB 2KPOA 5DBOA 4P4NA 3ANLA 5L3SB 3B2QA 3O31A 4UM5A 4YJGA 3CJRA 4CUJA 4KZPA 2FPLA 4KITB 3CURA 4ZCLA 1RWOA 3RODA 1YJBA 1GZ6A 1E3TA 3BCSA 1QH8A 2ZYWX 1CIJA 3T1TA 2R751 2O0MA 1V4NA 4M76B 2Z5VA 3IKVA 4RH0A 4GAEA 3ONDA 3KYDA 3LUDA 4NMHA 4MW9A 2RHJA 2R6JA 2XA2A 4KQ6A 2EFJA 3O0TA 3PNBA 4WZAA 5A05A 3ZHRA 4BNJA 1K0FA 1XYGA 1E4YA 3C24A 3D2CA 4GL4A 4JI6B 3DFMA 3ROMA 3W9UA 1D03A 4HFNA 1AJEA 1YU9A 3DAPA 4AS2A 5KC9A 2NU9B 2OP1A 3W4IA 4B6PA 4H0FA 2ZIZA 3IX7A 1EFVB 4YR9A 3U4QA 5BN1A 2DFNA 2OORA 1CUZA 3FSEA 1NF8A 5TDHA 4RORA 4PLVA 4TM7A 4Z9FA 2PT6A 3O94A 5F78A 5HOQA 1QYIA 3WNQA 2R5WA 1IXKA 2O8CA 4C7VA 2QT9A 1AHHA 1ZC3A 1U7ZA 1XLUA 1C8VB 2YW9A 2QZZA 2ZR9A 4JIMA 3T3IA 1WUYA 2JLSA 3FYDA 4QBGB 2JG3A 3MCTA 3TLXA 3VSAA 4RY8A 5IU6A 1V1MB 2CNNA 3DCYA 4JBLA 2I22A 2O48X 3FE2A 5EXEA 1E9RA 2CN1A 1BHSA 1CRWG 2A1UB 4ZQBA 1ENYA 3VI3B 3S0JA 4C30A 2J3DA 4Y2RA 2E55A 1KDVA 4EK9A 4TZ0A 2WM2A 4EUHA 1JHQA 1USKA 1W88A 2BLNA 2QRPA 3C6QA 1XDSA 3PDIA 4JBIA 2A9VA 4GECA 3RKRA 5G0TA 4DY4A 4KREA 4YUWA 4XPZA 3EZXA 5KQGA 1ONBA 3VC7A 2JB9A 2QZJA 1Y0BA 4ZHQF 1HWYA 1ZDMA 4JSTA 4G5FA 4TTAA 3K30A 3FNGA 1A27A 4EKYA 3AESA 4Q4JA 4YJGB 5GJCA 5IJZA 5EE9A 2ZREA 3TOVA 4NEHB 1TJYA 2O6HA 4H2DA 4X7RA 1B8UA 1DNPA 3K05A 2EARA 4P5PA 5TGTA 1M6VA 3DYVA 1JJFA 1LS6A 2W22A 2BR4A 4EFKA 1RYHA 4F45A 3K9HA 3STHA 3B5JA 1NJFA 1SVNA 1F2VA 2CF6A 4IVRA 3HVUA 2DSNA 2NG1A 2O7NA 4YT8A 5I7WA 4L4XA 2ZVJA 3GJ4A 1XU4A 3AF2A 4QPJC 5BV2P 1WSAA 2Q7XA 5E0OA 3IIIA 2HMTA 4FE4A 4MVJD 4M1MA 5GIPE 1DSSG 1D6MA 5C7LO 3RVLA 3JQAB 4FCCA 1R15A 1T1GA 4FR5A 4XWWA 2C98A 1K7EB 4JVNA 4R7ZA 2I71A 1NZDA 4PR0A 1GPDG 2H2AA 3MS2A 3OC0A 2PUTA 2GKOA 5KU7A 1KS2A 1E7MA 2WNHA 3K2BA 4QBFA 1I2BA 2GAIA 3VRHA 3GDHA 1BEUB 1OFTA 2ZYGA 3DLAA 4P83A 4UU1A 4KV7A 2I3BA 3HU1A 4Z4GA 2E5LB 1Q0ZA 2BGRA 1Y1SA 4ANFA 3L8MA 1YQXA 1PX0A 1UWLA 3TNDA 3QYFA 5JZBA 1A1SA 1VIMA 4LBZA 4KZKA 4R9SA 1X74A 2VBCA 2AUMA 3CV3A 3PJEA 3I4CA 4YH1A 3WZMA 4YRAA 5JXIA 4WCDA 4LDJA 1D6JA 4X1KB 3C97A 2OAP1 3QMVA 1W1IA 1ZN8A 3DP9A 1LPPA 3KSUA 3PXCX 4CKWB 4EQ6B 1XAHA 5CXQA 3QU5A 5I01A 1ZJ4A 2FPGA 4HDNA 5F3DA 3VO1A 1BS9A 1UP7A 2QMOA 3TRFA 5HUQA 2ECFA 4YAJA 1JVBA 3EMBA 2W11A 1J06A 3AHGA 5A4MS 4C4AA 2OUIA 2DZDA 4CL2A 2F00A 4TMZA 2Y76A 1V96A 3QRWA 5FOVA 3IALA 3CTPA 4L5JA 1R7RA 2YJTD 2ZRDA 4UU0A 3WGHA 3W9BA 3C4VA 3K5HA 1SJ9A 1QBKC 4P54A 3OHSX 1HE5A 1J97A 2QV0A 5B6IA 4BWVA 3DZKA 1DIOB 3JSAA 4DR6B 4MPRA 1KNQA 2VG8A 3D5EA 3WLHA 5DK4A 2EIXA 4AF6A 3M70A 3L2OB 3SJBA 1DWQA 2YS7A 4LQ4A 2RHGB 2RJ3A 4MUYA 1RQ2A 4OLJA 2FKNA 1FP2A 2DJ5A 5K0LA 5T8KA 4ETIA 4F2DA 4RCZA 5TXGA 1XCLA 3QKSA 4I9FA 3FNEA 1JT9A 1ULAA 2HA5A 3O8BA 2FWRA 2WLTA 2QLNA 2BFPA 4EO4A 2WIBA 4RU1A 2C9CA 1HG1A 3ROKA 3Q5GA 1UXJA 4NG5A 5EESA 1UOEA 1XBTA 3OQOA 4AJNA 4MGYR 4WSOA 5DKFA 2VJAA 2UYHA 4QYXA 4UNQA 3HWSA 2QI9C 4WBXC 1JILA 1YFKA 1JX6A 4ZIRB 3U4QB 3KB6A 3V1YA 3K31A 4B3FX 4C2BA 4GPTA 1A9TA 4P4GA 5ELXA 4JUIA 1QZZA 3NIWA 3HKDB 3OZIA 1WQ1R 3IPAA 4GYJA 1AQYA 3EB9A 4J4BA 4XCVA 2AFVA 3H3XA 4J94A 1XCPA 1CPYA 3ZVLA 2IS6A 2SKCA 3GN2A 4DKJA 1RHMA 1Z26A 4BMSA 1M0EA 4BO0A 4FOSA 4ZVUA 3I61A 2Q9UA 3DMHA 4LTMA 2BBOA 2O54A 4RENA 4ACBA 1ABFA 2AE2A 2H1OA 1UC5B 1Z35A 2FJ0A 1S1MA 3GRPA 3V2IA 1XKXA 1GA4A 4NJMB 5CNIA 4C4PA 3ZE6A 4HLCA 4LKRA 2VH5R 1T3LA 1UP4A 2R62A 3A4NA 3ZDFA 4YMIA 4XYGA 1JMYA 4L8WB 1QHYA 2E18A 5CA1A 2ZJYA 5IKOA 4B5LA 1WUTA 2Z5LA 1Z4LA 3PWZA 1UAYA 4K0RA 4XIJA 3JSXA 1PSZA 1BE0A 1TVKA 3MSCA 3QWBA 1YSCA 4QVGA 3O8QB 4CTOA 1CKEA 1U9IA 1XJ5A 3GJZA 4RGQA 4DOMA 5JFGA 5B7QA 1OLSA 5JZVA 2C9OA 1ZP6A 5FOSA 1FTNA 3EVFA 3H9JA 3ZJYA 2EEZA 1HYBA 2E89A 4MV6A 4ZDKA 4AU1A 4XQEA 3ZDAA 5ESRA 2CXQA 1NBMA 2OLJA 3GAMA 3LS2A 1L5HA 4XW2A 1V7ZA 4FT4A 3F8WA 4D3YA 5IVIA 4UQLA 1HR0B 2JCBA 4CW7A 3KUUA 2PZ8A 4JP5A 4M36A 5CH5A 3DFIA 4BUJA 1LZKA 4FGSA 4Q1BA 5E1DA 1CJSA 1ICIA 4Y9SA 3CLTD 4O4HB 3ZHYA 4F91B 2QNIA 4M8NE 2ZZNA 1FLVA 5ERYA 3QUBA 3BREA 1ZCZA 4FHDA 3LDUA 3S68A 2I91A 3H6GA 1VBNA 2JJ8A 4HQ6A 3BPSA 3HB1A 3I6IA 4ZTBA 1LXCA 1P1BA