1U2FA

Solution structure of the first rna-binding domain of hu2af65
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
b'ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SPLICING FACTOR U2AF 65 KD SUBUNIT)
publication title Solution structures of the first and second RNA-binding domains of human U2 small nuclear ribonucleoprotein particle auxiliary factor (U2AF(65)).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u2fA00
1JJ4A 5D77A 3MURP 2G0CA 2G1DA 2M9KA 3S8SA 1JJHA 1NU4A 2X1AA 1U1KA 1PGZA 2RQCA 1QVGR 5JVHQ 3J7YU 5LJ3Y 2DO0A 1M5KC 1WTBA 2MJUA 3EGZA 1H6KX 2LXIA 2DHXA 1JMTA 1YTYA 1WF1A 4YUDA 2RQ4A 2KRRA 1HD0A 2OSQA 2I2YA 2SXLA 1VBXA 1X4BA 2AYEA 2DH7A 2DGOA 3H2UB 3R1HA 3CCSS 2KT5A 3BS9A 5LJ5Y 3G8SA 1WI6A 1VQ5S 2J8AA 1S72S 5MLCV 3VAHA 2CPJA 2KXNB 2O3DA 1X4HA 2BZ2A 2QFJA 1F9FA 2XB2D 3FEYB 3RW7A 2MXYA 2XS7A 1UP1A 3HI9A 2HGMA 3UCGA 2RU3A 5GAEU 2J0QD 3CD6S 2RRAA 2F9JA 1Q81T 2FY1A 2MKHA 4PRFA 3R27A 1U1RA 1KOOA 1K73T 2KH9A 2CQIA 2DNLA 5GMKa 3CPWR 3CCVS 1M5VC 1FJEB 1QVFR 1VQOS 1WEZA 2N82B 2AD9A 3CCUS 2E5JA 2XSFA 3LQVA 4EGLA 1K8AT 2DNRA 2CPHA 2MZ1A 3L3CA 4YOEA 4LIRA 3BO3A 4BS2A 5JVGQ 2LMIA 5IFMA 1DRZA 1X4CA 2KI2A 3CULA 1FHTA 4RU2A 2OTLS 1L3KA 2LYVA 3CC2S 1U1LA 1WEYA 3TP2A 1OO0B 4W90B 2CQ4A 1N88A 2KM8C 1OWXA 2AYGA 2KFYA 3VAMA 4QU7A 5H1SV 2MYFA 1WG5A 2X1GA 1OIAA 3G96A 3BO4A 1B7FA 2LEBA 3NNAA 3IWNC 4CIOA 5HL7Q 3US5A 1H2UX 2JX2A 1IQTA 2VOOA 5LSLA 3VAIA 2DIUA 4TU9A 2DNOA 1DBDA 2MHNA 1U1OA 1KOHA 4W92B 2DIVA 3PIOQ 1SJ4P 1YHQS 3V4MA 5LXYA 2N3OA 2VODA 1HL6A 2EK1A 2OSRA 1XN9A 2JWNA 3CCJS 1M5PC 3CC4S 2KG0A 1N52B 4M5DB 2ERRA 2DH8A 1O0PA 2XNQA 2ADCA 1DZ5A 2NLWA 1X4EA 1FO1A 1ZZNA 2CQ0A 2FC9A 2XS5A 1G2EA 2CQ1A 5GAHU 2ADBA 5DM7Q 2DGXA 2KM8B 1U6BA 3G71S 2DITA 3MUVP 1YITS 2JVOA 1U2FA 2DISA 3CXCR 2HGLA 2AYBA 1WELA 2L08A 1X5SA 2MZRA 2M70A 1X0FA 3H2VE 5LXRA 2DGUA 5LSOA 2M2BA 3NMRA 1URNA 2G4BA 5D78A 4CH1A 4IOCQ 3P49B 2VONA 2KXFA 2CPFA 2DNNA 1D9AA 2E5GA 2N7CA 2YH1A 1HD1A 3ULHA 1VQMS 2FPHX 4J5OA 2MJNA 4OZ0A 4WF9Q 3MDFA 2F9DA 2MB0B 1SJRA 2HVZA 1U1QA 3MXHP 3MD3A 1X4FA 4PR6A 2FHOB 1VC5A 4IO9Q 2CQ3A 1VQ7S 3VAGA 1WEXA 5CYJA 2RS2A 2M8HA 2RNEA 1U1MA 2MKIA 2WBRA 2OJ3A 1KC8T 2MQLA 1VC0A 3CCES 1WWHA 2RT3A 3FEXB 4ZKAA 3I55S 1VQKS 2HZCA 1U1PA 1PO6A 1UW4A 1A9NB 3BEGB 1FJCA 1X4AA 3JB9k 3VAKA 3VF0B 1X5TA 2RVJA 3Q2TC 3UE2A 4LJMA 1M90T 3NNHA 1SXLA 3CTRA 1QM9A 2CPDA 4WFBQ 1Q82T 3IRWP 4Z2XA 2D9PA 1M5OC 2MGZA 3D2WA 2DGQA 2XNRA 1N54B 2KHCA 2LCWA 2M52A 4OZ1A 1VBYA 4ERDA 2RUGA 2KN4A 4C4WA 2LKZA 3SDEB 2OTJS 3B4MA 1UAWA 2MSTA 4P6QA 2L9WA 2LEAA 4Y0FA 2MGZB 3Q2SC 2DO4A 4TU7A 2MZQA 5GADU 3UCZP 1WI8A 3MUTP 2DB1A 1DHMA 1YWXA 4F02A 1H2VZ 2LA4A 2F3JA 1RKJA 1NJIT 1R8PA 3PIPQ 3CC7S 1WHYA 2MKSA 5CXTA 1SJ3P 2EK6A 2I38A 3CF5Q 2KU7A 1Q86T 2NZ4A 2K3KA 5DDPC 5HO4A 3OW2R 2DGSA 4U67Q 4WCEQ 2X1BA 2YTCA 3BO2A 2MQNA 3P6YC 3CUNA 3I56S 3HHNB 2RS8A 5IQQA 2YH0A 3G4SS 4PKDB 3CCMS 1WHWA 2MKKA 2DNGA 1WG1A 3VALA 4WFNQ 3SMZA 5IM0A 4CH0S 1WHVA 2L41A 1X4DA 1ZH5A 1D8ZA 2XS2A 1YI2S 1SJFA 2CPXA 2DGTA 2CPEA 2LECA 2CQPA 1WHXA 3R1LA 1FT8A 2MQMA 1FNXH 4ED5A 1YJ9S 2E44A 1UFWA 1SJQA 1FJ7A 1VQ8S 3DLLQ 2DH9A 5IM0B 2DNYA 2E5HA 2KRBA 2UP1A 4QQBA 2AYMA 2DK2A 3ZZYA 2GO9A 4C0OC 4LMZA 3TO8A 3NS6A 1VQPS 2LXUA 3SXLA 3G9CA 4FXVA 2MZJA 1P27B 2MZTA 2PE8A 3S6EA 2E5IA 1P1TA 1X4GA 2DNHA 2MQOA 2D3OR 3VAJA 1M1KT 5GVQA 2DNPA 1WF0A 3S7RA 4V19X 2V94A 2B0GA 2MY7A 2M88A 2MKCA 3UD4P 1Q7YT 2QEXS 1VQLS 1CVJA 5DDOC 1RK8A 3N9UC 2YKAA 2M4MA 3THPA 2U2FA 1WG4A 2GHPA 1ZZFA 3ZZZA 3EGNA 2CQHA 1K9MT 1VQ9S 3S01A 3CMAS 4CQ1A 3EX7B 1VQNS 2CQ2A 4QU6A 3CCQS 2J0SD 3TYTA 4IOAQ 2LQ5A 1YJWS 1KQSR 3SDEA 4F25A 2Q79A 2JVRA 2MY8A 2D9OA 2CQBA 2DHGA 3UD3P 3UCUP 2KG1A 3VAFA 3CCRS 1R8HA 2FC8A 1KD1T 2DNQA 2MZSA 1U1NA 3CCLS 4WIIA 2LA6A 3RW6A 1YJNS 2CPYA 5BJRA 4YB1P 2EVZA 3P5TL 5GAGU 1VC6A 2MSSA 1HA1A 3NNCA 2YWKA 5ITHA 2DNMA 3UWTA 4C7QA 4IUFA 2A3JA 1S79A 2DGVA 2MQQA 1VQ6S 4WKRA 2M8DB 1AUDA 2HGNA 1H2TZ 1VQ4S 2DNKA 1WF2A 2BOPA 3P3DA 3CMES 2M0GB 3MUMP 2ZJRQ 2J76E 3LPYA 1VBZA 3G8TA 2ZJPQ 3NS5A 3J7ZT 2RRBA 2KXHA 2PEHA 1X5PA 2KVIA 5CA5A 2MQPA 2CQGA 2DHAA 2CJKA 4UQTA 2KYXA 2JRSA 1A7GE 3U1LA 2CPZA 3THTA 4FXWA 2QA4S 3MOJB 3MI7X 2DHSA 3U1MA 2MMYA 5DETA 1OPIA 2HYIB 3DXBA 4F26A 4UY8T 1BY9A 2CQDA 3K0JA 3MD1A 5DDQC 5EN1A 2M7SA 2CPIA 5DDRC 2DNZA 4WFAQ 2VOPA 5DM6Q 1U6FA 4TU8A 2K8GA 4A8XA 1NO8A 1FXLA 5FJ4A 1YIJS 2OIHA 3B4DA 2CQCA 2DGWA 4QPTA 2MKJA 2N3LA 2MPUA 1N8RT 2U1AA 3G6ES 1JJ2R 1X5OA 2X1FA 2ZJQQ 4Y00A 1W2BR 4TLQA
chains in the Genus database with same CATH superfamily
3RUBL 2Z4PA 5JXSA 3BBCA 3E01A 2ROGA 3B78A 1LWFB 3W63A 2CJAA 1EX8A 4NI2B 2WONB 1U0SA 1R43A 1RWPB 2HAFA 3H2UB 4B9MA 2WW8A 2YKNA 4AXIA 2KT5A 3RB4A 1MN9A 5T41A 2B4PA 4O3PA 4F0HA 1FKPA 3AQOA 1RHQB 2MXYA 2XMJA 1EQ0A 2OPRA 2EFNA 4P2FA 1IJFB 2DNLA 1S9FA 2WHOA 4DV5J 4QYZK 2N82B 1C0TA 5JUMA 3L3CA 3SV3A 2VKRA 2LU1A 1RA7A 3PYDA 3D3CJ 2ZC4A 3QT6A 1KFSA 5HBMB 5FDLA 3HHDA 2AYGA 3QT5A 1XNQJ 4FP9A 3KMSA 1EKSA 2JX2A 5KT4A 3V5RA 1GMUA 4LT6A 1FEHA 2XI2A 5LXYA 3KHRA 5D4NA 3M30A 1M5PC 4X66J 2KT3A 1HW9A 2Q43A 2UXDF 2YQ1A 3M30B 3E2EA 5GAHU 1K0TA 3CB4A 5D4OA 3F0NA 2QMWA 1KEKA 5B08A 2R7RA 4RNNA 3I9V9 1S77D 1JLEA 4LF7F 3PR5B 1NKCA 5D78A 2EKNA 4DCPB 3W61A 3H59A 4J9PA 2VJUA 3QZ8A 4OZ0A 4OLOA 2W9CB 4RBVA 4GKKJ 1CSJA 1FE4A 2RS2A 3TANA 3DLBA 3CCES 1S1XB 3W62A 4EU0A 1B70B 1NDLA 3VAKA 5AXMA 1X5TA 3UE2A 4K5RA 1SH0A 1QAIA 3IR5B 3H0PA 2XNRA 4OZ1A 1VBYA 2IVYA 4FPIA 4YN3B 1SQFA 2WK4A 1QAXA 2IVFB 3BR8A 3BBFA 2V34A 2YKMA 4F02A 3LP2A 1RKJA 1REVA 3M2RA 1M5HA 1TTHB 2BABA 2QTWA 2G2YA 1TL1A 2F4VJ 3CDUA 4CH7A 4DQPA 4QR1A 1VMBA 3D5MA 4B9NA 4ED4A 3T1AA 3QRRA 4I69A 4YS2A 2DNGA 3N79A 3D6TB 3MTJA 2ZC3A 1TL1B 3HULA 2F65A 5KFZA 1D8ZA 1U02A 1IM4A 4N41A 2CPEA 5JMNA 1C1BA 1NEEA 2HEKA 2BKPA 1WKKA 1JLAB 3MMBA 2PGCA 2C2RA 1VIOA 3MMCA 1CJKB 2AP6A 1C1BB 3HFVA 1R0BG 1ZA1B 1P27B 3O1LA 2E5IA 2VC1A 3MMCB 5GVQA 1T9VA 3DRRB 4QW9A 2XCPA 3MM8B 2E7XA 4UOFA 2KFZA 4LFCF 3TW0A 1HNVA 4PG4A 3CMAS 1XNRJ 5J1PA 4IOAQ 1S49A 4ENOA 1YJWS 2BJ8A 4EBDA 4OQJA 1SC1B 1SB6A 1WD6A 1RYSA 4LFBJ 4WXWA 3QJLA 2DNQA 1H72C 1RWXB 1Y3JA 1UVJA 4I0WA 2CPYA 4KYZA 3B54A 1Q7LB 3P5TL 2YWEA 3NNCA 4URSA 3UWTA 1IWGA 3JTNA 2FZCB 3GJRB 1FJGF 3HHLC 3H7HB 1KNZA 1HBUA 4B02A 4A46A 3P3DA 1D9DA 2CADA 3G8TA 4DV4F 2UZAA 4LF9F 3J7ZT 5KFRA 3DYAA 3VWSA 4ZVSB 3LGMA 2Z57B 5IV4A 4FF1A 3MOJB 2HK2A 3DYAB 2XI3A 2CG8A 3ET6A 4EUVA 1RISA 3IBCB 4WE1A 1LOUA 3ENQA 2BANB 3ISNC 1S4FA 2QE5A 2X1FA 1S48A 3ET6B 4KT0C 1U4BA 1DLOB 3W2WA 2A10A 4PUOB 2M9KA 4KIAA 4CLLA 3MECA 4WE1B 2Y1LB 4YR3A 2ZOMA 3GIIA 2LXIA 4HI2A 1RQ0A 3QGGA 4TY8A 3MM6A 1FDDA 1SQGA 5A76A 5MLCV 1ZM9A 4TY8B 2GIQA 1LXNA 5F8GA 5DGAA 1RE1B 3MOZA 4DUYJ 1HQEA 4DL0C 2HAIA 4DS4A 4ECZA 2YNFA 1ZAVA 4LUBA 2OKQA 4OHVA 4M5JA 3CULA 3CVKA 1L3KA 1IBKF 5DQIA 3L7OA 4TY9A 4MK7A 5E3CA 3GMGA 1V3ZA 1H3DA 3R9LA 3QIDA 1TZ0A 4QR0A 1D09B 5J2MA 1J5EJ 1XMOF 2DNOA 2MHNA 3PJ9A 2AIRB 1KOHA 2DIVA 2BMBA 2N3OA 4P72A 3PO4A 5J2MB 4C2MA 2LEPA 2HWTA 1T9YA 3TQEA 3QT7A 2YWFA 1U6ZA 2ZD1B 4KSEB 1JNZB 3JQMA 1F5CA 1RAOA 1RT1B 3A4TA 4JI1F 4NA2A 2XM3A 3RRHA 2UU9J 2QLFB 2DISA 1X9MA 3I32A 5HROA 1OSCA 2OO4A 3DDIA 4ZN3A 3GCWP 2PMZD 4DL6A 2QMUB 4IOCQ 2BX6A 1NH8A 1NSAA 2E1PA 1SBRA 3EMTA 3JTOA 1ZM2A 2HVZA 5CYJA 2MDAA 4IFYB 3MCOA 1U1MA 2OJ3A 3MR5A 3CJTA 4DV5F 4JP8A 3OJUA 2ASYA 3MPYA 3H40A 1A9NB 2UXBJ 3W5YA 2V6AA 1M90T 5KFUA 5KFMA 1VDHA 4ZJQA 4NLPA 2W1BA 2C2EA 1EAYC 3TUPA 2NS1B 1XNQF 5J1EA 4ZOSA 4K4WA 1NH7A 5KG7A 3DOMA 1UVLA 4TU7A 3C6TB 1RACB 1WI8A 1R0AA 1P9YA 3IC1A 4O0NA 4JB8B 2H4WB 4FYXB 1RT2A 4JI6J 1ZM3A 3DOMB 5D8HB 4JI8F 1KTQA 4X66F 3IGNA 5IWAJ 4U67Q 3ETOA 1TVRB 4C3MA 2C2DA 4MKYA 3M32A 5KT3A 4XPCA 2MLZA 4DV1J 3G4SS 1WG1A 3RB6A 3VALA 2DR9A 3QJJA 4OHWA 1IJEB 4CH0S 2L41A 2MEWA 2YNGB 5H9EJ 4HH1A 1VISA 2DR5A 2OP5A 4J9MA 2C3OA 3M32B 3KJFB 2DGTA 4JYAF 3CGIA 2FDNA 1F0XA 3GIJA 3DLLQ 3Q8UA 1NHUA 5E0OA 4UUWA 1UKUA 2RIJA 4LF5J 4I2QB 1AZSA 1Q4RA 2MZTA 2PE8A 1BWEA 2JFKA 2HIQA 4GKKF 4LSZB 2DNPA 4OI4A 3VVUA 2V94A 5J2NA 2M88A 1AZSB 1GNKA 2BM1A 4HT5A 3KJQB 4USIA 4IG3A 4ECTA 4XDDA 4KY3A 1KQSR 2Q6BA 3LWMA 3UD3P 4WJBA 5HJXA 1HYSB 2VB6A 4WPAA 1U1NA 4PYAA 2LA6A 4DPYA 5BJRA 3ELHA 4YB1P 4ER8A 4DBQA 2HNDA 2I1RA 3ENWA 3M6UA 1S1WA 2ZBQA 3NGSA 2B9EA 4P74A 2F8EX 3DLGA 2Y8WA 4OX8A 4DR4F 1KBRA 2JRSA 2CPZA 3NCRA 3MI7X 5D3GB 3PHTA 3DXBA 1BY9A 2BDPA 3MD1A 4DZDA 2R7QA 1S76D 2EFOA 5DGBA 2F5GA 1P9QC 4NASA 2HFVA 3W7BA 2JSXA 1LWCB 3T41A 3K2YA 1U24A 3LGHA 3R7NB 2ZH2A 2VDHA 1RU1A 2OEKA 2CVEA 3BQ2A 1WTBA 2ATCB 1KQFB 4I1TA 4LSLB 2IRXA 2IM3A 1ZAWA 2W25A 1XNRF 1YRTA 5DQHA 2QL9B 2BKOA 2NSBA 4IR9A 1ULRA 1D8YA 2V4JA 1UEKA 2JC1A 5KFXA 4LFBF 3M8RA 3HVWA 4RWWA 4O4RA 2F9JA 3W8GA 4F67A 2VH7A 3RB0A 1HR0J 2XMAA 2ZZTA 1FFWB 4RU9A 4TLRA 4IKAA 2CVIA 4Z37A 4DS5A 3ETMA 2ZNYA 2MKYA 3FNNA 4MFBB 4G6VB 2R2RA 3BR9A 1OWXA 1RAFB 4QU7A 3J81Y 4C98A 2QO3A 2LEBA 3BV8A 4CIOA 2E9ZA 3U1NA 3I0SA 2LQJA 2XZWA 1SJ4P 3LP1A 3W65A 1O0PA 2XNQA 5CCMA 1KVKA 3UN2A 1UTAA 2GGPA 3I0SB 1SKRA 3C14B 5DM7Q 5G0RA 1TKZB 3PDNA 4ZVRB 4PCQA 5CD4A 4NEZA 2ASJA 1KHWA 1T02A 2ZWPA 1CBKA 3AD8C 3R6LB 2HS4A 3VCDA 3MEDB 5LXRA 1NJZA 5C42A 2VG6A 4NLQA 5A2QY 1OY9A 3QO9B 3U7JA 2VICA 1DURA 1S1VA 1PJ5A 2VKZG 2BJ1A 1UL3A 4AQYF 1SC3B 1NMEB 4DUYF 2NXUA 3BDEA 3ITHA 3BKFA 4ZVFA 4KKOA 4A4JA 2DD8S 1OQ6A 2C3YA 4KH1B 5KFWA 2D3O1 3N6MA 2F63A 4KKOB 2VJVA 1HNWF 4DI6A 3MEKA 1I94J 4JV2A 3SV4A 1P8GA 2WCXA 5A8WB 4WBFA 4NL5A 2YNHB 1U48A 3HMJG 1JLFA 3UCZP 1KVJA 1DHMA 4JI0J 5E7OB 4U6PA 4LFAJ 2GJIA 2V63A 2E29A 3PKMA 5L38A 3T5JA 3OW2R 2F8HA 3EZOA 4M5KA 2XZTB 4DR6F 2YTCA 1M1HA 2ROPA 3KLEB 3N0VA 6FDRA 3PVXA 1J27A 1WHWA 2UU9F 3FFIB 3PYGA 4ECUA 1Q5YA 1TAUA 2DBBA 4BLGA 2RU9A 1HWJA 4Y6IA 1FNXH 5EHHA 1XIQA 2GIRA 1TKXB 5EX0A 3DRYA 1KLMA 4Y34A 1HQUB 1VI7A 2C2OB 1VQPS 4I7FA 1N5YA 1T05A 1Y5NB 5D0EA 4A8KA 3CNQP 5A6WA 1YBUA 4DEZA 3C6UA 3SYZA 4ZCMA 2JH3A 3KYLA 2HNZB 4R25A 3FVYA 3N9UC 4ZS6A 1ICEB 3EGNA 2UXBF 1UWBA 4E2FB 2QJ3A 4WYWA 4LF4J 5AJ3F 4RW7A 1MSWD 1RBLA 2LQ5A 1RB0A 3R5CA 4Y2AA 3L7PA 5KAKA 2FJVA 3G87A 4L75A 1ACMB 5KFFA 4W4MA 5KFDA 3MM7A 1N34F 4ED7A 4ZN1A 2HQDA 1FCAA 3HF5A 3TUIC 1HNXJ 4JI6F 1UEUA 5KT6A 4Q8FA 3BDPA 3DMJA 4RW4A 5IWAF 4X84A 3CD7A 4AD6A 1S0VA 1XMQF 2GX8A 4I2PA 2M0GB 2B51A 4BWMA 1C4CA 3OHAA 4DV1F 3T3FA 3DMJB 2Y3YA 2N7YA 2KZMA 2KXHA 2CWKA 4NLUA 2QL7B 3GFZA 2QA4S 2OEMA 2XHCA 3SQOP 3HHEA 2K1RA 2JNJA 5DDQC 5D0GA 5I42B 3DGPB 2VIHA 4LF5F 5KFCA 3BH6B 3EVMA 1T03B 1UVKA 2ZJQQ 3I87A 1GMVA 3GYXB 2O01C 3ILLA 3K8VA 1M5KC 4AL5A 5A2QU 1Q16B 1SV5A 1YJRA 4X4OA 3QLHA 2RQ4A 3CCTA 1IXKA 1Y7PA 3KKFA 3ZTQA 2FTRA 5IT0A 3G8SA 1SV5B 2YBVA 3UR3C 4M5LA 1RAEB 4U7UD 4ZPDA 3HM9A 1YZ6A 3HI9A 1OSDA 2JEFA 2JLEA 2A1BA 3OBIA 4B08A 4G65A 4ZCIA 5F8LA 4I67A 3G6YA 4KR0B 4PG8A 1MMDA 1WEZA 4CYUB 2DNRA 4LIRA 2ATLA 1R27B 5K8PA 3EJMA 4DMZA 2FIUA 1OO0B 4W90B 3ILJA 2DVIA 2IJRA 1TV6A 3MAAA 2RQKA 4ZCLA 3KMQA 2PD1A 2ZHBA 3CJQA 2QA4G 2DIUA 4TU9A 3Q8QB 4DLGA 4YP3A 2VODA 4OX6A 3DOKA 1WC1A 2ZH3A 2BJ7A 2C3MA 3PX6A 1DZ5A 1X4EA 1FO1A 3VQTA 2V8DA 3DCAA 2XEXA 1HBMA 1G7CB 1HMVA 4LR7A 2JVOA 3VGTA 3CXCR 4M94A 1GK8A 3HD2A 3V6DA 1RHRB 3NMRA 2EFQA 2VONA 3FSXA 1JLCB 1RT7A 2MJNA 4WF9Q 3LH2S 3AOBA 3N6LA 2EPIA 4NLOA 1HR0F 1E6VB 4YEAA 2WBRA 1FFSB 3HJFA 1JJCB 1WWHA 4ZKAA 3NWGA 3OR1B 1FA0A 4CM2A 2LCWA 2KHCA 1NRKA 1F2HA 4Y2IA 2OAUA 4Q2LA 2WVBA 2DO4A 4C11A 3P4UB 2BW7A 3BSOA 1WSRA 4Q5VA 2NZ4A 1KLNA 3KK1A 3H5YA 3HLUA 1F6TA 3TVKA 4EMDA 3P6YC 1CC8A 1YJUA 2R8IA 2MKKA 4USJC 4Q44A 2CIMA 2EWHA 3KK1B 3PG9A 1GTHA 4A8FA 1BGXT 4O0IA 4RW8B 1YJ9S 3PX4A 4CCHA 3WX4A 4J9LA 2GO9A 2AMCB 4Y3CA 3M9NB 2AEJA 3OTBA 4TXSA 4ETZA 3JTPA 2BA9A 3L4BC 1IVZA 2NUUG 1GXTA 2B9XA 2B4UA 2U2FA 3FUYA 3OXFA 3W1YC 1YRUA 3PJWA 1ZAXA 1VQ9S 3BSNA 4ZDNA 4OX9J 5KFLA 2XSJA 4N8OA 2GC8A 1S7IA 1RTHB 1UJ6A 4HLBA 1KD1T 5HVHA 5KFHA 2KJWA 3LPEA 4B3MF 4JI0F 2UUAF 5KOWA 4M5IA 4LFAF 1FD8A 2GIFA 1S79A 1VQ6S 1XQIA 2HGNA 4U7CA 4HVZA 3HK2A 2QMXA 3JYTB 3M2VA 1PAEX 1YRXA 4B9TA 3VGUA 1W25A 4HL9A 2Z58B 3TAMA 5IZHA 4B3OB 2M3DA 2WW4A 1LWEA 1MU2A 1FRLA 2HMIB 2VQFJ 4DJBA 3NL0A 1IBCB 4UY8T 1S1TA 2F7VA 1B3TA 3ZZUA 1LWEB 5DM6Q 1MU2B 1U7LA 2K8GA 1RI7A 4KGVB 1JWWA 2MKJA 3VR1A 1S1TB 1R0CB 1RWKB 3MCMA 5D77A 2VFSA 1PGZA 2RQCA 2Z2MA 1N6QA 4LF8J 4LR8A 4QWAA 3GV5B 2I5JB 2B7BB 3AB2B 4P2SA 1Q5VA 2I9SA 4F04B 1GX6A 2QT7A 1S72S 1NHVA 3ENVA 3FZBA 1X4HA 3RW7A 1WUUA 3QYYA 2JEJA 2RU3A 1YX2A 1DTQA 3I9ZA 3NGUA 1Q81T 2APOA 2B5JB 5DZ7A 5CH7B 2J0WA 1K73T 2LDYA 3HZEA 3CCVS 1FJEB 1APSA 1HNXF 4WP9A 1AT1B 5DQGA 5BR8J 1WTFA 4PYDA 5HP1B 3JAMU 3KTQA 2Y8YA 4FS1A 5IFMA 1JLQA 3LW5C 4RU2A 2HHHJ 2D1CA 2UXCJ 3EZUA 4GMKA 1TK5A 4TQRA 4UUXA 1ZTWA 4OHZA 3D68A 5HVFA 5T7LB 4ALZA 1Q0NA 2FYXA 2ZH8A 2E1CA 3UR0A 4ED0A 4KPCA 4OZJA 1BLUA 1KVIA 3QFWA 3HHLA 3M9OB 2RQMA 3OFEA 4QIVA 4PAAA 1S0OA 4ATNA 1CEZA 5K14B 1IR0A 1G2EA 2AKWB 1A6LA 1U6BA 3WIUA 3PYFA 4DF8A 3NMAA 1FDAA 1N0UA 2CG4A 1W2IA 3WC0A 5H9FK 2NYHA 4I6WA 3V6KA 3I5CA 2HQGA 4M1KA 1RAHB 1FNMA 1SJRA 4DUZF 1G4CA 3MD3A 4PR6A 1GXLA 2QLWA 1VC0A 4ZPWR 5KFQA 2FLPA 4U8YA 2EBEA 3PCOB 3P96A 2DGQA 3FEZA 3HKWA 2XG8A 3TX8A 5KG4A 3HT3A 1HPZB 4ITSA 3OUYB 1VLOA 3BSCA 5GADI 1PJ6A 4ED2A 3OSNA 2X1BA 4FYDA 1TKTA 4Y2MA 3KLFB 4OV1A 4EBCA 3PEJA 1MROA 3ICLA 1TKTB 5LM7E 2VPWB 3GQCA 4BBYA 1MROB 4NRTA 3KLIA 1YK9A 2DK2A 2QV6A 1RTDA 1PIEA 3OFFA 1P1TA 5LMNF 3V81B 4HDGA 4DN9A 1M1KT 2R8HA 3LF0A 1O6XA 3AY0A 1ZTTA 4DL5A 1SL0A 4OHYA 2D41A 4HHHA 2HZVA 4NA3A 1DTTB 4R5PB 1T11A 1B0PA 3M2UB 1XR7A 4K5SA 1X31C 3JS9A 4RKUC 3KLVA 4DR2J 2WB4A 4WU3A 2AT1B 4Q43A 3M4XA 2FHMA 1ZBTA 2GVZA 1HA1A 4OYBA 4IG0A 2YWKA 2FB0A 2MQQA 2G2ZA 2M8DB 1ITPA 1U25A 1H2TZ 3QGPA 1X60A 5F8JA 4JI4J 3EWGA 2GVZB 4IDKA 2QYGA 1VBZA 1TR0A 3CWJA 2MTLA 2BJ9A 4FVCA 2RKIB 3MMAB 1ZOTA 2MQPA 4IDKB 3LAKA 4LRCA 4NPOA 1NKEA 1G3OA 2DHSA 2V8HA 5CYQB 4UQGA 3ZFVA 4USTA 2CPIA 4WFAQ 2PI5A 1JIHA 1FDNA 2DGWA 2N3LA 3VZIA 4ZITA 3SEOA 3BO3A 1JJ4A 5K20B 3PTWA 4ANDA 1TKDA 4CDIA 1Z2LA 3K5LA 1D3WA 4P10A 4NZ7A 4CO4A 1QD1A 1NK8A 4OX7A 2P9EA 3TWZA 1GMWA 1EHWA 4OX9F 4FN5A 1ROFA 3M8ZA 1AW0A 1RA6A 3M8SA 1F9FA 4ECYA 2HFOA 3AXKA 5C25B 4PRFA 4H4OA 5ETPA 2XYGB 4NZ0A 3R2CJ 3CW2C 2WAQD 4OYXA 3CCUS 3DLKB 3QIPA 3LQVA 2R7VA 4RLEA 4RW6A 5JVGQ 4H4OB 2PI4A 1DQAA 4MIWA 1YQHA 1FHTA 3K57A 3DOLA 3DRSA 7AT1B 3MR3A 4N76A 3G82B 5C24B 2MYFA 3GV7B 4AYBD 4EO6A 2OUGA 3DN9A 3CSKA 1PJ7A 5HL7Q 5AE2A 2VQFF 3A1YG 4YB7A 4EYHB 5LSLA 4M5DA 1T95A 1U1OA 3LP0A 4CWBA 5SUHA 3PIOQ 4EBEA 2OSRA 1Q95G 3UI3A 5A8RA 4M5DB 1UJ4A 3QFHA 1S7HA 1F3FA 3LALA 1QUVA 3NP5A 2RSQA 3Q8YA 4ZIVA 1TL5A 3NLCA 1U2FA 4OI3A 2AYBA 4TQSA 1YBTA 3DKDA 2H1YA 5ADZA 4F2RA 4KGMA 1KSPA 4GO7X 4PXCA 2JDJA 4LREA 2Y1IA 3ZTRA 4KV8A 3MFHA 2EC2A 2G4BA 4KC5A 4ZLNA 4LF6J 3EPIA 1S9GB 2FLOA 1LQ9A 4O3RA 4F3MA 1HD1A 4ZVHA 4KV8B 1K47A 1U1QA 3PRDA 2QLJB 4DR3J 1X4FA 3EE3A 3R8YA 4X4VA 1GX5A 3GP9A 4ECWA 1TMMA 3PFOA 2XMUA 3FEXB 1P1LA 1U1PA 5BR8F 2WVDA 5KT5A 1A0OB 1X4AA 1KQKA 3BGRA 2OFGX 2GMLA 4J9OA 4G1QB 2HNYA 1IQZA 1HNIA 4Z2XA 2MGZA 4W98A 2UXCF 2HVDA 3JQKA 2M52A 3HVTB 2PDAA 3MPDA 2WOMA 3CE8A 1VBKA 2MSTA 1HNIB 2PA8D 2V50A 2MGZB 2QIFA 2WOMB 4PWDA 1NJIT 1OS5A 4X64J 3OLAA 3H98A 2MKSA 3RRKA 4RUBA 2EK6A 1Q86T 3CF5Q 4ES3A 1RKIA 2XO7A 1RTJA 3FBFA 5A0YA 2ALYB 4Q2MA 5EWFA 5IQQA 2YH0A 2XY5A 4WFNQ 1RBAA 4NLVA 5AXKA 3NAIA 3A13A 2RF2A 2HHPA 4K4XA 4FZVA 3GSDA 3L9ZA 2DEIA 2V8VA 2UP1A 2RF2B 4FVMA 2VFRA 3D6MB 4DSIA 1NB7A 3HSDA 3Q89A 2OPQA 5E5NA 2QL5B 4TYBA 1U8WA 3FMBA 1WF0A 4LF1A 2OPQB 2VFUA 4C0BA 4OMFG 5J1NA 2JJ4D 2LQ8A 4UF4A 4IOBA 3CJKA 4X4UA 1AFJA 2CQ2A 4Q7AA 4QU6A 3CCQS 3NCPA 3G6VA 2H9ZA 1LW2A 3RBDA 2CXEA 3NAHA 2H51B 1VOMA 3VAFA 1NZAA 3IXQA 2QZ8A 1HBOB 1LW2B 4KBIA 2BE7D 2LVWA 1UPMB 3DHXA 1Y5LB 4CLTA 5KFBA 1VC6A 1NHKL 2R7SA 1JXEA 2VA3A 1NBEB 4N77A 1WF2A 4LBHA 4G1PA 2K3IA 1T94A 2X7IA 2OH2A 3FZ2A 2PEHA 3SI8A 4DX8H 1NCLA 2CQGA 3C16B 3RBXA 3KDOA 3U1LA 4ZP9A 2OD6A 4NYPA 2HYIB 3FKBA 4OYZA 2WB1D 4C6AA 1JLGB 1UVMA 1YGYA 2W4PA 2EEYA 3TA1A 2YX1A 1T9XA 4MK9A 3RBZA 1RTZA 3X3UA 4TLQA 1JJHA 4QIGA 3TARA 3PEHA 4M63A 3QWUA 3R7SB 3Q8PB 2V8PA 2BR0A 5K8NA 1FESA 4L6V3 3V4IA 4F3QA 4QOTA 1FF2A 5LJ5Y 1VQ5S 3EVWA 5E2QA 2A6OA 1SKWA 2GAHC 2FVCA 3MAHA 3VAHA 2BZ2A 4X4TA 3KK3A 1UP1A 3UCGA 1RWWB 5LSRA 2EG1A 4B9SA 4DR2F 5DRKA 5GMKa 4ES2A 4LFCJ 1FE0A 1RWMB 4TNOA 2LMIA 2UVUA 2JEIA 3T6BA 4GO5X 3MM5B 4WP8A 3THVA 1Z1ZA 3GYNA 2FVSA 2J6UA 3VAMA 1WOSA 3IR7B 3HD1A 2IA6A 5BYQA 4LRFA 3FSIA 4FYVB 3IG1A 3KUHA 4PXBA 2XO6A 3NGRA 4PPZA 1M0SA 4M95A 2EK1A 3MMJA 3H8YA 3IG1B 5F9LA 4O3OA 1YLXA 1JLBA 1FEEA 3ZTSA 2IBOA 2CJQA 1HKAA 4MIAA 1HI1A 1VGYA 2GVDA 3I96A 4M8LA 5KFNA 5F8HA 1S6OA 1JLBB 1R8CA 4KO0A 1X5SA 3CCZA 1K1SA 1V3SA 2GVDB 2YWGA 1TFWA 3PNIA 3F73A 3FGVA 1X0FA 3H2VE 1RHMB 3EGVA 4ZJLA 1JKHA 4KE5A 3GJSB 4ZHRA 1XERA 3PKYA 2VBYA 2J6TA 2RDIA 2N7CA 2YH1A 4J5OA 3SQGA 3N28A 1FRMA 4ZHRB 3RG6A 2K7JA 2Z2ZA 4DSLA 1D9FA 2IDEA 3HHLD 3W66A 1NZ8A 4NYZA 3HHKA 1FVQA 3HP6A 2QSWA 3IRWP 1LFPA 2R2SA 3UD5A 4F0MA 1KR4A 4RZRA 2UUWA 3K5NA 4WP3A 2KN4A 1FD2A 1VRQC 2YPYA 1RAGB 4JI3F 4GC7A 1TP7A 5KFEA 3Q2SC 1NK4A 2K06A 2FJEB 1U0HA 4EO8A 5GADU 1W7WA 1G1XA 5D0RA 3OVBA 5J2PA 2XLKA 5D4LA 3GJQB 2UV8G 3ISND 1PC5A 4JBCA 2IMWP 2HSEB 2GS8A 3KFWX 5ETVA 2RS8A 2ZFHA 3W64A 5HN0A 4CT9A 1FK9B 3BGOP 5JJBA 5I3UB 3UPFA 1VHFA 3QAUA 4IRDA 1SJQA 2E5HA 2G2OA 4MKBA 5K9FA 2AYMA 4LF6F 3O44A 4FBUA 2NPFA 7FDRA 1WKJA 4DR3F 4FKXA 4JI1J 3T9NA 3MGJA 2O1PA 4DX6A 4DV6J 2R8GA 4QWBA 2JC0A 3Q0AA 7FD1A 1N5QA 3AOAA 3E01B 1NSQA 2R4FA 5CZVA 3HFZB 3EX7B 3J7AN 2YKNB 1CJUA 4LSNA 2ZH9A 1U45A 3TEGA 2BE9B 1RT6A 2KB2A 4OI6A 2CA9A 2MZSA 1FKPB 2VPYB 1CJUB 2LFVA 4LSNB 4O23A 5L9XA 1RT6B 1QDUB 2NR0A 4OZ5A 2PEBA 2OPRB 3IWXA 4X64F 1QSLA 1WACA 1XR6A 4YB6A 4IUFA 4NLSA 3W5XA 3C15A 1C0TB 1RADB 4CM0A 4C8MA 2P8IA 5SZTA 3FCVA 1JB0C 1QTNB 2L3MA 5AXLA 2XWYA 5IC6B 1V9OA 2GMHA 2HFSA 2W2QP 4NLDA 5CA5A 3PZPA 5FDLB 2WSFC 1EZZB 1RAIB 1OQ3A 2J0XA 3EYZA 5IT9Y 2CAJA 3DM2A 3GFYA 3KUGA 4JI8J 1RWUA 2H5JB 1KFDA 5EN1A 3MEGA 5KFAA 2ZDPA 4CLSA 2BXJA 1N0VC 1YIJS 2OIHA 3C19A 2EC0A 1XR5A 3G6XA 2P2CB 4C48A 1JJ2R 4K4TA 2FLNA 2DCLA 3S8SA 1SH2A 3FC9A 3GB0A 3P45B 5HVGA 4ILMA 4O3SA 4JYAJ 2DO0A 4KHRA 4C8OA 2AJ0A 2CYYA 5KFPA 4QWEA 3WHIA 4CLKA 1CJTA 1X4BA 1VBXA 2ZBPA 4J9NA 1JLEB 4DPUA 2F4FA 4X4PA 1RSCA 2XB2D 3FEYB 4WFXA 4B3TF 2KL8A 4QZVB 1EETA 2B7CB 2ZE2A 2YKOA 4DSEA 2DJWA 3TVYA 3L09A 2CPHA 4IO1A 4ANEA 2DRDA 4DSJA 1EETB 4OYPA 5HANA 4KRWA 2RMLA 2ZE2B 2KZZA 2KJVA 1RAJA 3KG1A 3UDVA 5H1SV 1R8BA 4FKYA 5IS2A 1T3NA 2J8SA 2GJFA 2CJBA 4QCLA 3HXMA 2VOOA 1BMQB 3GTYX 2WZ1A 2VA2A 4K4VA 2UVRA 4W92B 1TUWA 1IWAA 2VPXB 2YKMB 3OPKA 3LP2B 1REVB 3M2RB 4I4BA 1S0MA 4OYWA 3OLBA 2C2KB 2R42A 1ZZNA 4DR4J 2MHEA 3MUVP 2Z2YB 4H4MA 1UCNA 1SH3A 2Y0BB 2IPOB 4ECRA 2M70A 4L73A 2QFIA 4ZP7A 2OHDA 2DGUA 2JHEA 4LRAA 3P49B 5BYSA 2RD5C 1YJVA 4ECXA 3MMBB 1TELA 1D9AA 3BZQA 4KH0B 3HX9A 1L3TA 2MB0B 3MXHP 1U2CA 1SCJB 1REGX 2RNEA 3BGFA 2Z56B 3QATA 2Z30B 3I55S 2C42A 2O5DA 3VF0B 4Y2CA 2YQ3A 2RUSA 1X0PA 2LDIA 1AB8A 2CPDA 1HNVB 3CD0A 1N54B 2CUYA 4EWTA 4ERDA 2IVMA 1VJQA 3RRGA 4J9UE 1W26A 4RNOA 4B9LA 3PRVA 4HHJA 2WVCA 1H73A 4R8UA 4RPFA 4OJHA 4RR5A 4XPEA 2HQ3A 3C2PA 3W9IA 1TFYA 2NCKL 4OI2A 3WC2A 3CDEA 1UVIA 1HBUB 2L9NA 1MLAA 2XCAA 4NCAA 2QC3A 1FXDA 3CJ5A 3UNYA 1ZH5A 4WZQA 3MF5A 1SJFA 3SSQA 1TL7A 2CPXA 5EGYA 1S9EA 1VRTA 5F8IA 2JL9A 2JFDA 1H74A 2DR8A 4CO0A 2NXCA 5L1LA 1S9EB 4N7TA 2RILA 3N6NA 4ZVPB 1FRXA 4HHUA 3GFXA 2B8PA 1C1CA 1AYEA 1YKWA 4DPTA 2D3OR 5KFIA 1BQXA 3VVTA 1VR6A 1CVJA 3W2WB 5DDOC 1RK8A 3MECB 4F4XA 3MR7A 2W7OA 5M2UA 1ZZFA 3U27A 3R5AA 3KLHA 5E3QA 3HCXA 4PZVA 3MM6B 1JX4A 3TJ8A 3M7VA 4AQYJ 1FXRA 3UCUP 5KG0A 4USWA 3BKTA 4M5GA 2FHJA 1J2VA 4AT1B 1VFJA 1N32F 1HQEB 1HNWJ 1FTRA 2DGVA 4PXDA 4IH6A 5GAGI 3TJ9A 2ZKUA 2YNFB 3EDRB 4IRKA 3I5BA 3R5GA 1TUGB 2DNKA 2HRYA 4OI0A 2C28A 3M8QA 3MEEA 4X4NA 2NPIA 2CZVC 4L72B 3LPYA 2Q66A 1I51B 4Q0BA 4DCOB 4XAKA 4D3HA 5HQ8A 1NJWA 2VZ9A 1LNQA 3MEEB 2P6SA 3B82A 1RWOB 2KYXA 4RO0A 3ILOA 3H4DA 5DETA 4L3KA 3PW7A 1Q53A 2KFNA 4GVLA 2PA3A 1PKUA 4PQAA 2L9DA 2VOPA 2W2MP 4DR6J 1FXLA 4CLZA 2HVEA 3OTEA 3NXZA 3M8YA 3QGHA 2YKPA 3M1VA 2FUG9 5I3QA 3MURP 1Y5IB 4JV5J 4DV6F 4IRCA 2X1AA 3J7YU 2RB7A 2QYCA 1GEHA 4WK1A 3D1HA 1YTYA 5E3AA 3GIKA 1HD0A 2I2YA 2RH3A 2SXLA 5KFKA 1FI4A 5HROB 1AFIA 3R1HA 2B43A 2V68A 2IFXA 3S1TA 1RT4A 5E33A 4XDCA 5KT2A 1RT4B 2BEFA 1U8SA 2ACMA 4FF3A 1QSSA 4NA1A 3LGNA 4ZLLA 2CQIA 2VL1A 1FX4A 1M5VC 4UZCA 1XWLA 2IYGA 3I31A 4EGLA 3IRXA 4WFYA 5AJ3J 3P8BB 4YOEA 2AEMA 1DRZA 4A8OA 2KI2A 4C8NA 3KNAA 1YJTA 4MH8A 3PW4A 1KDNA 2GMJA 2VUGA 1N34J 2GQQA 1HNZJ 2GV1A 3RAQA 2ZH4A 2OD4A 3GU0A 4GVBA 1RT5A 5J1EB 2BRKA 4UOGA 2HHTA 2YQ0A 1FRJA 1ZA2B 1R0AB 2FVQA 3RB3A 4PEOA 4GVBB 1NDPA 3JSMA 1XMQJ 1RT2B 5F3ZA 5E3RA 1S1UA 3R2DJ 1RBOB 2NLWA 4X65F 5KG6A 4Q45A 4FS2A 1GXUA 4U9RA 4ZPTR 1S1UB 1GT8A 2IJFA 1AA1B 1WELA 3DDKA 4BC9A 1XK8A 3A8KA 4ID8A 1IKVA 3A8IA 1QUPA 4L3NA 4DQRA 2B56A 5CQGA 2NXJA 4J90A 3K17A 1RZMA 2VG7A 3ZC4A 3UVJA 1RHKB 1WDTA 2FGOA 4H4KC 3J80Y 1VQ7S 2LP4A 4IH5A 3BB5A 4CRJA 1P6TA 2VG7B 4DV3J 2I8EA 3UVJB 1VQKS 5J2NB 1PO6A 4X4SA 3JB9k 1UVNA 2QLBB 5F8MA 5T14A 1CC7A 2BRLA 2GCFA 2RVJA 3NNHA 4IG3B 4M5NA 5A8KA 1QM9A 2HQFA 2EI5A 1F5BA 4RL1A 5H9EK 1IKXA 2J5AA 1M5OC 3Q83A 2YVSA 4CLPA 4ELTA 2VBZA 1ZETA 1N48A 2UVWA 4Z7CA 2WTFA 1O5JA 5C7PA 1SI9A 1YG0A 1DY3A 2D3ZA 3I0RA 3PIPQ 2DCUB 2DR7A 1NKBA 2KU7A 4XTTA 4ICLA 2HNDB 3H90A 1BQNA 2VQEF 4DV2F 3UDLA 1S1WB 4P7VA 5B0EA 3DU5A 3H20A 3BJYA 2G0IA 5B0FA 3GJTB 1RLCL 4QIFA 5HATA 3DLGB 2LECA 3R1LA 1FT8A 5DG7A 2JEGA 4ED5A 3GONA 3GCXP 2GZOA 3TRGA 3C8YA 4FXVA 2LLZA 1SUQA 2FZKB 1TQLA 3TEHB 1NDKA 4FXDA 1LV5A 2G0JA 5KFTA 1VQLS 1SUQB 2GHPA 2GFFA 2ZHOA 3IS9A 1HW8A 3CDBA 4E98A 1YSJA 4K50A 4J9KA 1SVDA 3SDEA 5EUHA 3PW0A 1Y9OA 2V4JB 5FD1A 3K5OA 4AE5A 3IO1A 2AJFE 3EPGA 3GYGA 3QSIA 2PO4A 3FMWA 3PYEA 3RR8A 3OD2A 1NAQA 4JI7J 3A8JA 4NCBA 3O5TB 3K7RA 3POTA 2K7KA 2FJDB 1NJXA 1GH8A 2RRBA 3MCSA 5HMYA 4CP5A 2HPUA 1A7GE 3PO5A 3D6FB 3QAEA 4FXWA 2P6TA 2QN6B 2KHDA 4CZCA 1V5VA 3K0JA 3CJ8A 2QX0A 3U02A 3LP1B 3KJVA 4NLWA 1X5OA 2Y1RI 1FWPA 2GGPB 3H5UA 3OL8A 5JVHQ 5LJ3Y 3BYPA 1Y0HA 2AV5A 3F44A 3L7UA 2MJUA 2XMTA 5G0RB 4QIEA 2OPSA 1WF1A 2GHWA 4YUDA 5HMWA 3W8PA 1S57A 4BHQA 1NSKL 5F8NA 3WDOA 3BS9A 2VDIA 3J80U 1WI6A 4RWXA 3TZXA 4KFBA 3T1HJ 5C42B 2VG6B 2O3DA 5LMUJ 4O44A 3Q22A 3JXOA 1J5OA 1HI0P 5BXIA 1S1VB 4NCGA 1U1RA 4OYMA 2BE2A 4O44B 4USHA 3CPWR 4PG7A 3GR1A 1YDLA 3D67A 4CLYA 3ZZPA 3ITHB 3AJ2A 3WQPA 4JOUA 2BE2B 2FZGB 2UUBJ 3ZZOA 2IAJA 1X4CA 3M8PA 1XMBA 2YNIA 2FJAB 3H5SA 5L9NA 3CC2S 1Q8IA 3M8PB 3SZ2A 1OIAA 4B3MJ 1B7FA 2UUAJ 1H38A 3FK4A 4E8UA 3KG4A 1L3SA 1X9WA 4CO5A 1JLFB 4NYOA 4IFVA 3TZZA 1F3VA 2BQ3A 4DQIA 1VRUA 4K4YA 3GSIA 5D4PA 2NYIA 4MAKA 1O51A 1VCTA 3CC4S 4QYZJ 4YR0A 2OMLA 5EWEA 4X4RA 1VRUB 2ZUAA 2CQ0A 4JV5F 2BJ3A 5KTQA 3M05A 1LWFA 4AUKA 4WYLA 4NI2A 2KM8B 3C66A 2WONA 4I64A 1KRPA 3ZZTA 1K44A 4I56A 1S6UA 1BHNA 4XIUA 2BW2A 4UW2A 4FF2A 1MG7A 3OTOJ 2FJBB 3SSRA 3UFCX 4ZVOB 3RR7A 2Z2LA 3BBBA 2HVHA 1XBWA 2R9LA 1KLMB 3ULHA 5B0AA 3K89A 4I7FB 1HARA 4RBTA 4NXNJ 1N5YB 4MKVA 1T05B 1NLKL 3BPSP 2FVPA 2BV3A 1KC8T 2MQLA 1NK5A 3C6UB 2VBXA 4MYTA 4Y28C 3M9MB 1FJCA 1R31A 3TJAA 1Q8KA 4ZPAA 3Q2TC 1RDRA 1SXLA 1UWBB 3UO0A 5HBMA 1EJ7L 3D2WA 4RW7B 2ZZNA 1HNZF 4N8NA 4P6QA 4DDFA 2LEAA 1CS4A 3TI0A 2ZBIA 1Y4ZB 3MM7B 4B9VA 3J81U 4AL7A 1I5OB 2HLUA 1CS4B 5DDPC 2UV8A 3FBBA 2A0FB 1SC6A 4NRUA 4RW4B 5DG8A 4DPOA 4UY85 3DHWC 4DQQA 3IBWA 3CUNA 3SSSA 4I2PB 4HTJA 1K1QA 1PAUB 1H0HB 9ATCB 3MPVA 2XYHB 1WC4A 4NE9C 3CIMA 1HI8A 2E44A 2I6WA 1FX2A 2HQCA 3GFHA 2K1RB 1WOPA 2W9CA 4DV0J 4OYIA 3RBEA 4USKA 1Y3KA 4C8YA 2RHQB 3T1YJ 5FIIA 1S1XA 4DV3F 1Q7YT 3BM7A 5M2PA 2WVFA 3DRXA 4RUAA 5I3PA 2CQHA 1RGVA 2YX4A 2Q1LA 3PV8A 3QLHB 3TNVA 3RU0A 3QMQA 2VFVA 3TYTA 2AW0A 4OJGA 3EICA 4DU7A 4DUZJ 1V3RA 2W7AA 3N5BA 2HBYB 4NLGA 2HURA 1PBUA 3EM1A 2Z8QA 4ZLPA 2BACA 3KOAA 2XY7A 5DJBA 2KDOA 5GAGU 1N5TA 3NGKA 1QAYA 2IMOA 1FKAF 3F56A 3G86A 3IWLA 1HWUA 2Y9HA 5DZ6A 1GTEA 4A8MP 2HHSA 3Q86A 3SCIE 2OPPA 2ZKTA 2AGPA 4PG6A 2BYCA 2B9WA 3WZ0A 4UQTA 2OPPB 1UMJA 1UFKA 1TV6B 3MAAB 3T6JA 5DG9A 1JLAA 1DQ8A 3HFKA 3JSYA 1SKSA 1CJKA 2GA7A 1AUSL 2DXFA 3A3NB 1KP6A 1R7IA 5DDRC 2D69A 1OMSA 3ISZA 2RJZA 3B8HA 1NO8A 4ZLJA 3DRRA 4RX6A 3MM8A 2E7VA 3DOKB 4K0KJ 4D3GA 1W2BR 2G0CA 2FHJD 1N36J 1M5SA 3DLJA 1HBMB 4DN0A 3CJ4A 1QE1A 4J9RA 1HMVB 1URRA 4DHVA 4EZ6A 4PWUA 2DHXA 1JMTA 1QSYA 2C2ZB 4R0EA 1JNRB 2AYEA 1QE1B 1FVSA 3V6DB 4WTOB 1TMJA 5AE1A 5IV3A 5LMNJ 2DPJA 1F5AA 4JUZA 2HFUA 2NQPA 3IM9A 2UUTA 3C46A 3LAMA 5IC4B 1RT7B 2MKHA 2IYIA 2EFPA 2HHUA 4QWDA 2AD9A 2HBZB 3CDAA 4DSKA 1RYRA 4BS2A 4F7VA 4EFAC 2AGQA 2DXEA 4JI7F 2CJXB 1B64A 1FERA 2LYVA 3OFHA 2CQ4A 2ZWOA 1RAAB 3JSRA 4U7UK 3CO0P 4DR1J 3GR0A 8RUCA 2G1HA 4C11B 3T5KA 3DI6A 1F60B 1TL3A 2R8KA 3ZNUA 1XN9A 1TK8A 2BANA 1N52B 1DLOA 2DH8A 3D1QA 2ADCA 4PUOA 3ZTOA 3IAS9 3DI6B 3EUNA 1TL3B 1DQ9A 5CAAA 1TAQA 2Z0GA 3PW2A 1ZYQA 5B0CA 4USVA 2J7UA 2OGUA 3D4JA 2ASLA 3GIRA 2AX1A 3BF4A 2CPFA 1Y00A 4DR5J 3OV7A 3T1HF 5LMUF 4RBUA 3RGIA 1LXJA 3PW5A 3CEDA 5ETKA 2O67A 2XQCA 4ELVA 2MKIA 2EXUA 4KGKA 3DGVA 1FNOA 2XLJA 3T19A 4ZPBA 2AHOB 2UUBF 5HJYA 1YVFA 4WFBQ 2A2DA 1R8AA 3OT9A 5RUBA 1RP5A 2E9TA 2XSJB 5B0BA 1HHSA 2GQCA 1Q8LA 1UW9A 3T5HA 2MZQA 4HACA 3QRQA 3VTIA 4CO3A 2ZNZA 2XC9A 4K7QA 4DL2A 5CXTA 2IIHA 3OL9A 4C3KA 4HACB 3AD9C 4NLTA 1L3UA 4WCEQ 2ZD1A 2ZVSA 1RT1A 1L5UA 3BO2A 2MQNA 1VLYA 4MJKA 4YHHJ 2AWZA 3I56S 3HHNB 3M2VB 4YR2A 1HHQA 4GRSA 4Z7YA 3TAPA 2HW3A 2JOQA 3TAMB 1RU2A 3PRBA 1IKWA 3NY0A 3MZIA 3OTOF 1VQ8S 2J6SA 2GNKA 4C0OC 1IKWB 1WC3A 4PQUA 2MZJA 2YY3A 1KQGB 3BQ1A 4NXNF 2JZ5A 3JQJA 4IFYA 2D7SA 1Q78A 2L48A 3S7RA 2W01A 1FRIA 4PQUB 2H54B 2B0GA 4V1Ak 2MKCA 4DX5A 1IR2A 2BQRA 4MIBA 1VK3A 4RUCA 2OLWA 4DOZA 1N6QB 4EI2A 4BCAA 3S01A 1PSDA 1S12A 2NXNA 2QG9B 2ZITA 1VQYA 4ETXA 2XHWA 1R89A 1XTZA 2D74B 4ECQA 2K2PA 2XMVA 4UOCA 5ETNA 5HLFA 2JLFA 2KG1A 3C6TA 3CCLS 4X4QA 1DTQB 1Q1KA 2DEJA 5HLFB 2E1RA 3LOUA 3R5JB 1KTVA 1TVRA 2MLXA 5HMZA 3KK2A 4YQWA 1S97A 1HWLA 3CJSA 5ETRA 3TQ1A 1SIZA 1JLQB 2XY6A 2YNGA 3OVSA 1CQMA 3KK2B 1IR1A 3D54A 2KKHA 4WKYA 4BDPA 3PXGa 2HHVA 3U1MA 3CMQA 4QJVA 2KTQA 3K59A 2H65B 3PJXA 4I2QA 1GFWB 2QLXA 2DT9A 2PT0A 3HHLB 4DV0F 4LVNP 4NX9A 3IGVA 1OYEA 1N8RT 4Y00A 3MWBA 4KHMA 4RNHA 3UQSA 3OR2A 3K5PA 2R7WA 9RUBA 3T1YF 3D1OA 1WC5A 3B6BA 3NRBA 2LU2A 2QA1A 3RAMA 3OR2B 2FJWA 2ZOFA 1LFWA 2DGOA 1FFGB 3DFEA 2NSCA 3K8WA 3LWLA 4DF4A 1HYSA 1FKOA 2HGMA 2AZ1A 2IY5B 1MWZA 2RRAA 2FY1A 3E3XA 4U96A 3ADAC 2KH9A 3NEKA 4P73A 1FKOB 4ANCA 2QSFA 2EFVA 1K8AT 2BQUA 3J81j 2MZ1A 2HRUA 4ED3A 4F2SA 3R5BA 2VC0A 1R6YA 2XZDB 4KPYA 4Y2KA 2F4VF 4P2XA 3IR6B 5MAOA 3IAM9 4PG5A 2IC3A 2C3PA 5D3GA 3BO4A 4EK2A 1LK7A 2FQQB 3OXLA 1DAXA 3UDEA 1CG2A 2V9KA 3IWNC 4HYKA 2HBRB 2PIIA 2IC3B 1DBDA 3N4WA 3GZ7A 1S0NA 3CCJS 1LWCA 1DFDA 2ERRA 3JSBA 3MR6A 3FRZA 4K0KF 1FTCA 2IRUA 2ROEA 4NOHA 2ILYA 3QRPA 5F0WA 1N36F 1WJ9A 2BJDA 2DGXA 2HGLA 3NOGA 4LSLA 2W9AA 4OFZA 4I6YA 4FPRA 1T9TA 2H5EA 1GAOA 1OY8A 5L1KA 5K8OA 5KG5A 2WVEA 1QY7A 4CO2A 4IQXA 3KLIB 4NEYA 2FPHX 1S5ZA 2NZCA 1RTDB 4JV1A 1IBMJ 2CQ3A 3GWCA 3VAGA 4HDHA 4ED8A 3AQPA 2H3EB 2ZOGA 4DFKA 4F4WA 3W2VA 1UW4A 3GLJA 4RW9A 4MFBA 4OYOA 1HLWA 4WZMA 1RTIA 1Q82T 1MMLA 3W2VB 3EGWB 2WSEC 4RW9B 1UZHA 2GJ2A 4TVAB 1XJWB 3AB4B 5KFGA 4L76A 1RTIB 2H48B 2B4VA 3AODA 4DR1F 3CDWA 2BM0A 1EKRA 2HLTA 1V5IB 4NMLA 3DXSX 1VK8A 2K3KA 4FDFA 1ELOA 1SPBP 2C3UA 4IG0B 3C14A 3I6PA 1UA1A 3R3TA 5CABA 5KFYA 2V5HG 4JI2J 1TKZA 3G8QA 1Y10A 4UZBA 3DC2A 5C2CA 1WHVA 4ZA1A 3MEDA 2ZH7A 3UNGC 2CQPA 3FCWA 2XGQA 2FVRA 5EX3A 3W9JA 1NDCA 4DXLA 3QO9A 1S6PA 2V2VA 4DR5F 3NS6A 1WSVA 2LXUA 3NGDA 2ZHAA 4ED6A 3GG1A 2CZ4A 1MNEA 3S6EA 3AHPA 1S6PB 4P7TA 3PACA 4V19X 4HI1A 5FLXY 1EQMA 3D28A 1S4EA 4DCJB 3AD7C 2BJEA 2HQIA 1K9MT 4ED1A 3KHHA 3IMQJ 3O3LA 5KOXA 4J9SA 5LL6d 4WU2A 5A8WA 2J9EA 2V4RA 2DRAA 3IM8A 2V9WA 2XULA 2JVRA 4ZP8A 2MY8A 1PYTA 2YNHA 4H4KA 1C0UA 3Q24A 1R8HA 2FC8A 2CJYB 4U8VA 3M8WA 3NOCA 3EZ5A 5F41A 4A47A 1C0UB 3KWMA 3TUJC 1J5EF 2IBKA 2HFZA 4QR2A 1RCXB 4WKRA 3QIPB 2HHQA 4LBIA 1YJ7A 3KLEA 2BOPA 4YDXA 4RW6B 4YHHF 3MUMP 1NK0A 4FNHA 2G9OA 3FFIA 1X9SA 1H7WA 5KG2A 4YMEA 4JI3J 1EB0A 3DOLB 3DRSB 1BE4A 4K2XA 2AJQA 3MHYA 1TKXA 2B9YA 3O6QA 3AJ1A 1OPIA 2FLLA 1HQUA 2CQDA 3BN4A 1UJ5A 1FRHA 1U09A 2VD3A 1TL4A 2E9RX 1VYAA 4EZ9A 3LP0B 2ACYA 3LANA 5A8RB 4OIXA 2IM0A 4UOHA 2HNZA 3RJMB 2W8LA 3EGZA 1H6KX 1U26A 5BYRA 2KT2A 5K8MA 2R2TA 1BWVA 2XMKA 4KGZB 1PILA 2QFJA 6FD1A 4DFJA 1BD6A 1F9HA 4CO1A 2VASA 3FQLA 5D0HA 3VV2B 3R27A 2GHVC 2W9BA 5DLGA 5GAEI 3QT8A 1IUJA 5DLFA 2XSFA 3BREA 2W9BB 2V0NA 4B3RJ 1YZ7A 2W24A 3TA0A 1HHTP 3AA8A 3BGRB 1WEYA 3D7SB 2HNYB 4ZVEA 4GKJJ 1JXVA 4CNZA 1WG5A 2P5VA 1PC4A 4OV6A 2LXFA 1C2PA 2YXLA 3T9ZA 1L3VA 5I42A 3DGPA 4A8SA 2E5LJ 2RAQA 1YHQS 2AJ1A 1T03A 3Q8VA 3L95X 4PWDB 1HL6A 3RYLA 4F50A 1MW7A 4HR2A 4CI0B 2QRRA 4U95A 2NUHA 3AJDA 5KFJA 2J9DE 1RTJB 1B0TA 3HZGA 5A0YB 2POKA 2L08A 5CHCB 2OEJA 4F4AA 2P9CA 4RNFA 4ZVUB 3BGUA 4F3OA 3Q8SB 4F4YA 4YDDB 5FLXU 2E5GA 5CCLA 5C2GA 4B17A 2F9DA 3G2XA 3NG8A 4IO9Q 2J9DA 4CYUA 5KFVA 3D0GE 5AT1B 4GC6A 1PYOB 4OI1A 2W2OP 4F4ZA 1VJWA 1M1GA 1T3OA 4WWSA 2EW9A 3CTRA 4XO0A 4QIWD 3BSAA 3CJKB 4DL7A 1C4AA 4B3TJ 3BYRA 4CLUA 4TKTA 4G3IA 3GILA 5D15A 2L9WA 3TVZA 4P52A 3SCKE 1Q8BA 2C2NA 3A12A 3AA9A 3N5FA 2DB1A 3GG0A 2LA4A 1VHIA 2EKYA 1SJ3P 2I38A 3HDSA 1RT3A 2DGSA 4MMOA 1CPZA 8AT1B 4KAIA 3QPIA 2CJ9A 1FWLA 3I4HX 1RT3B 3CCMS 4XK8C 3SMZA 3KHGA 2V2KA 2VF3A 4S0MA 1UFWA 1XEZA 1FJ7A 1JLCA 2DNYA 4B3SJ 5I4MA 3UN3A 4ECVA 1MMNA 4LMZA 3QQCD 4USUA 2X51A 4LVOP 3G9CA 1RWVB 1E6VA 2OMOA 2DNHA 2ZVIA 2HWIA 1IKYA 1IBMF 2IHR1 5LT5A 3R97A 4KHPJ 5HI7A 3OR1A 3J7YI 1CQNA 3UD4P 4P71A 4NMXA 3OSPA 1IKYB 4ILRA 4I6AA 5L8RC 3O2IA 3VZHA 8ATCB 2BKNA 3V4IB 3DNCA 2CNKB 2CWXA 2O66A 2YWWA 4KTQA 3CCRS 1B4SA 5HSPA 3NBPA 3JAMY 3KK3B 2NREA 5GMEA 4ZK7M 3RW6A 1YJNS 1AXQA 3KDNA 2R8JA 2H5IB 1T8EA 2HFNA 3QNWB 2MSSA 2DY1A 1MWQA 5ITHA 1SC4B 3NBPB 3SCJE 1OJ4A 4CLWA 1G6BA 1KS2A 4HTIA 3CMES 4JI2F 2RE1A 2J76E 3OL7A 4J9VA 2CNNB 1PG5B 4JI5J 2W2NP 4RW8A 3NCQA 4QYRA 2VV5A 4R0JA 2AGOA 4F26A 2COLA 3OVAA 2M7SA 2MQ8A 2CNLB 4TU8A 1SL1A 1UFLA 4MYUA 3B4DA 2N4CA 2R7TA 2WRMA 4LQ9A 4K4UA 3GIMA 1NU4A 4OZ2A 1U1KA 1QVGR 3PX0A 2VFTA 1WNEA 2ZM6J 5ETTA 2KRRA 1KONA 4KO0B 2I0XA 3QJPA 3AH6A 2J8AA 1S10A 4B9UA 1RTHA 2DY9A 5K5MA 1D1UA 2CPJA 1JKHB 1LEOA 2IJNA 2KXNB 3FSYA 2BBEA 2R2UA 3H5XA 4FYWB 1I94F 5J2QA 2WBMA 2DYAA 3R7BB 2R7OA 3R6GB 4QWCA 3CD6S 4X62J 3SQGB 3OJSA 2OI2A 2XMMA 1QVFR 2B3TB 5J2QB 4FF4A 4DFPA 4P9SA 4FNIA 3C3LA 4IR1A 3GV8B 1RUSA 3JYTA 4E0DA 3Q23A 4LR9A 3IBFB 3W3SA 1RCOB 3KHLA 2UUCJ 3HSJA 4F36A 3TX0A 5IT4A 3MPWA 4IYQA 4B3OA 5M2RA 3OFGA 2HHXA 2X1GA 2HMIA 1N32J 1IQTA 4ZIWA 2C22A 3VAIA 1U0HB 3CT9A 1VS3A 1LKZA 5J2PB 1Z4UA 4IH7A 1O8BA 2A18A 4ID5A 3OTCA 2FC9A 2CQ1A 4NLXA 1I3OB 2DITA 1YITS 4KB7A 4ID5B 2I5JA 1YBAA 1HBNA 1N56A 1NUEA 2LQBA 1QAJA 3K58A 2IA0A 1WDDA 2W4CA 3DLEA 4USMA 5LSOA 2M2BA 2B8QA 4I68A 3I5AA 2P9GA 1HBNB 2KXFA 4C8KA 3RTVA 4LF4F 2IM1A 2DNNA 4MT1A 1N33J 3AAWB 1VQMS 3DLEB 4PWWA 3CJRA 2B5JA 2YPZA 4OL8A 3A3PB 1UZDA 4URQU 4ZVGA 1WEXA 2AQ4A 1B99A 1NM2A 3LUYA 5HP1A 2PMHA 2HZCA 2YWHA 3TOQA 1N5VA 4B3RF 3I4PA 4OZLA 1BQMA 1EP4A 4KGXB 2ZH1A 4MKAA 5EDWA 2D9PA 2G13A 5T7LA 1BQMB 1EP4B 1NK9A 4GKJF 2E66A 2MLYA 2LKZA 4C4WA 2D3UA 4DLEA 5H9FJ 4Y0FA 1TU0B 6AT1B 3K5MA 1VIXA 3HT0A 3MUTP 2R7XA 4NXMJ 1CULA 5IXUA 4NLRA 2DKOB 1R8PA 2E5LF 4WTYA 4O4GA 5E3PA 5E41A 4YY3J 1E6YA 1CULB 5K14A 3RZAA 3C15B 4O4GB 3HVAA 1E6YB 2JLGA 2NXEA 5B7WA 5IM0A 4DX7A 1D0EA 2KVQE 3DLHA 1PCAA 3LTOA 2AU0A 3DDNA 3H2LA 4WK3A 2XMWA 5IM0B 3MM9A 3CJ0A 3DM2B 3ENAA 4LRDA 3I82A 4KQZA 3MEGB 3SXLA 4X65J 3MM9B 3VAJA 2ASDA 1WC6A 5L1JA 3SBMA 2PMWA 2MY7A 3M6XA 3EVOA 2M4MA 1IM6A 3ILIA 5CZXA 4CQ1A 1VQNS 2J0SD 1CJTB 3P5BP 3A3OB 2J7WA 1RJJA 2ZZMA 1RABB 5DS7A 1IBLJ 4F25A 2Q79A 5G4DA 1HPZA 2D9OA 1FDBA 2YKQA 2X3DA 2CQBA 3OUYA 4DZ6A 4DR7J 3PFEA 1UA0A 2KO1A 4RJVA 1CLFA 4HT7A 3QWPA 1HFEL 4DV7J 2DNMA 1VQSA 4C7QA 1T7PA 3GPAA 1MN7A 2AJ2A 2XTJP 2AF6A 4J9QA 3H25A 1NPRA 3KLFA 2W2PP 5U47A 4NZ6A 3RAXA 2B6AA 3AOCA 1KKHA 2F1FA 2KVIA 4DL4A 2RHSB 2DHAA 2B6AB 3THTA 3H4BA 1GMWD 2ZBCA 2MMYA 4C0HA 1N5SA 4HKQA 1HWIA 4B3SF 4UT4A 2DNZA 2Q3PA 3LO3A 1U6FA 2VQEJ 4DV2J 4A8XA 3V81A 3E51A 4HH0A 5KG3A 2U1AA 3G6ES 4KHPF 3BN7A 2V2QA 2DXDA 3IP0A 1S99A 1AROP 4NLYA 4H4MB 1DTTA 3KNGA 3AT1B 2ABYA 4OYAA 4BC7A 4DSFA 4DWIA 4K2JA 4C97A 4R5PA 1WOOA 1CJVA 3FJ2A 1TUVA 3M2UA 2RDJA 3D0IE 1EIYB 4MTPA 1OYDA 5GAEU 2J0QD 2HBQB 3F41A 1CJVB 3GE9A 4ZJOA 4RUHA 2XGPA 1VQOS 4HEA9 1NSPA 3KUEA 1DJ0A 3HO1A 2DPIA 2BOAA 2PC6A 2V8GA 1X7VA 2ILZA 3KLGA 2RKIA 3MMAA 2HK3A 1RHUB 3BPDA 4CT8A 1U49A 4JI5F 1NXIA 3KLGB 5F0UA 3FBEA 3G96A 4DL3A 5CYQA 1WC0A 1SQEA 3NNAA 4TN2A 2AJ4A 5F3TA 4OJ3A 1U2RA 2E1MC 4R8UB 3N01A 2KG0A 3FDSA 2DRBA 5IT9U 1GQEA 4WXOA 3TZYA 2A6MA 5DO2A 4DFMA 2ADBA 1UEVA 4ELUA 3BQ0A 3G71S 3NWRA 4WFZA 5L46A 2W4DA 2ZM6F 5GAHI 2PN6A 3CO9A 3VGVA 4A8YA 2MZRA 4J91A 2ZH5A 1TL7B 3CJ2A 1R6VA 1URNA 4CH1A 1NB2A 1VRTB 5GMDA 1UWAA 1HQ2A 5C25A 3MDFA 4C8ZA 3KXDA 1TK0A 4N47A 4RNMA 4ES1A 4X62F 2V4QA 2WSCC 1C1CB 4C9DA 4K59A 1T9UA 4OLPA 2M8HA 3DLKA 1F1BB 1SKUB 1JXLA 1ZPWX 5THWA 2RT3A 5D6GA 3D9BA 2HRTA 1K0VA 1KHVA 4LJMA 3UDCA 4AL6A 4AFFA 2CZ9A 3MAQA 3DU6A 3KLHB 2AZ3A 2UUCF 3G82A 5C24A 2VU5A 4OZNA 4H54A 2RUGA 2QGFB 1KWMA 4L74A 3T5LA 3IN5A 1JK9B 2XWXA 1Z2ZA 2E7WA 1YWXA 1NPKA 1H2VZ 4ZVTB 2F3JA 3CC7S 1OPZA 1JQGA 1H98A 1WHYA 2HS0A 2C2MB 4FBTA 5EWGA 5HO4A 4LIWA 4QPXA 2FHKA 2V67A 1LK5A 3SFGA 2DTJA 3M8QB 3TUZC 4PKDB 5KG1A 3TA2A 3AXMA 1NPPA 4F8RA 3UW1A 4Q0BB 4ZVQB 1YI2S 3QSYB 1NK6A 1WHXA 4LF8F 4N5SA 1S9GA 3PY8A 2DH9A 2BVZA 2KRBA 2HIYA 5HQLA 3ZZYA 2F8MA 3TO8A 1N33F 4K4ZA 4ZP6A 3WIVA 4JV0A 4LQ3A 4LRBA 2MQOA 3MTKA 2Y1JA 4ZPVR 3BKUA 3X1LB 5ETMA 1Y11A 3SCLE 1N4LA 3M1VB 3QBCA 2QEXS 4OHXA 1OY6A 2ZH6A 4G1QA 5KT7A 3HVTA 3J7A1 1V6HA 1KN6A 3H42A 2HHHF 3HJVA 3ZO7A 2CNOB 5HK4A 2W7PA 3VHQA 2EG2A 4J37A 2CDRB 1I6JA 4C3LA 3V6JA 5AE3A 4NXMF 4EYIB 2R3VA 4YY3F 2A3JA 4EEYA 1AUDA 5LOQA 2PSZA 3IRXB 1VQ4S 2IDLA 2CFXA 3ZZ0A 2ALZA 4PPDA 2ZJRQ 2CKWA 2FD2A 3LA0A 2ZJPQ 3WX8A 2ZBRA 2OELA 1T9WA 2QA2A 4A48A 4YB5A 3D3BJ 5AXNA 1S59A 1RT5B 2RRNA 1QLNA 4CLFA 3KG0A 4BWJA 1UETA 1RLDA 1QTMA 4OJ1A 1S6QA 4CNYA 5FJ4A 3OL6A 4QPTA 3W9HA 3JSMB 2MPUA 5ETSA 4TYAA 3D6HB 2RDDA 3TR5A 3HVRA 4V19J 2UXDJ 2G1DA 5IOLA 4P75A 1S6QB 3NKYA 1WKLA 5ETOA 1HWKA 2HG4A 4O3QA 2OSQA 4LF7J 2GQ2A 2DH7A 3ZZRA 3CCSS 3DRPA 3CD5A 2FJXA 4A8QA 3ZXWA 1IBLF 4MK8A 2DR6A 1IKVB 1HBOA 4PXEA 3SIPB 2GO8A 3Q8RB 2XS7A 3BGLA 3DRPB 3MFIA 3PHEA 5HQMA 1XC9A 4DQSA 4DR7F 5A6PA 1LW0A 3TAQA 1KOOA 4ILLA 2V2ZA 5B0DA 2A2CA 4DV7F 2E5JA 2HZAA 1LW0B 3QZ7A 3EDQB 1EARA 1R3NA 3O8WA 2Q6CA 1ZS6A 2OTLS 5A8KB 1U1LA 3D0HE 3TP2A 1N88A 1IKXB 2KM8C 2KFYA 3C16A 5L39A 1NK7A 3PR4A 1SIWB 5KFSA 4AXJA 3WBZA 3W5ZA 4LBPA 3US5A 1H2UX 2AEFA 1JLGA 5CYMA 1PYSB 3FQKA 3V4MA 2E1AA 4QW8A 3I0RB 2JWNA 4CTAA 4PABA 4ICLB 5CYMB 2DHHA 1BQNB 3OQ2A 2J9CA 3HSGA 2XS5A 3OTDA 2HKEA 4CTAB 2GAGC 3HKZD 3NGTA 3OXGA 1SL2A 3MPUB 3MCNA 1BC6A 1WORA 3UN5A 3IFEA 1T0TV 4G1IA 3R5DA 3OHBA 2XBPA 3AFGA 2HS3A 2ZEJA 3HPOA 3FCHA 2FHOB 1VC5A 1LWXA 1F2GA 4F0KA 2ZDOA 1RHJB 2FGCA 2F40A 1H7XA 4Q8EA 3BEGB 3IA0A 1ZPVA 5C5JA 2XYPB 3NS7B 4URGA 4DPXA 1NJYA 1F9EB 3MM5A 1DARA 2ZUGA 3IS9B 1B0VA 4P2MA 3ONQA 4JI4F 3D66A 2HWHA 5B0GA 3SDEB 2OTJS 3B4MA 1UAWA 3CIZA 2UVVA 4UTGA 2C1EB 1FRKA 1PBAA 3SFUA 4Y65A 4QBUA 5HAOA 4OZ3A 1FJGJ 3FRYA 3M6WA 3E8OA 2XLIA 1QJHA 2V69A 2N4DA 2BUNA 2EFGA 4DV4J 2AX0A 2LQ9A 4LF9J 4K8RA 3POTB 1MWYA 2Y0SD 1X8DA 1X4DA 1ZM4A 2VHGA 2XS2A 3W60A 4C8LA 3PM9A 3QGIA 5ETLA 2MQMA 4A8WA 4F4KA 4DU8A 3FBCA 5CD4H 4N56A 2IRYA 4QQBA 2PFDA 4K4SA 4DUTA 4WIQA 1BXNA 2M5YA 3VQSA 3V6HA 1B7YB 1X4GA 4NWBA 4ZMMA 3KJVB 2H4YB 4X2BA 2CRLA 4ECSA 2EBGA 1U47A 3V2UC 2HVIA 2YKAA 4M5HA 5F9NA 3THPA 4FYYB 1WG4A 2W8KA 5ETQA 3ZZZA 4M5MA 2VBWA 5L1IA 1UPPA 2OPSB 5HMXA 2GW8A 1RXOB 2B4OA 1SJ1A 4ZCKA 2R7UA 3CJ3A 5B09A 2DHGA 4KFBB 4LF2A 4YFUA 3HSZA 3CCWA 4IQMA 4J7CA 4WIIA 1J5OB 2J7KA 1RWNB 1NNDA 4NCGB 2EVZA 3VGSA 5KFOA 2FY8A 3BH7B 2CDQA 3J7Z5 4KJIA 4DPWA 2VPZB 3EXYA 3M6VA 2IAJB 2KYZA 1FK9A 2YNIB 2IM2A 3NS5A 1IBKJ 3MR2A 5I3UA 2PFFB 1X5PA 1BUXA 2X3GA 1I1GA 2HHWA 2CJKA 4ZPCA 4O3NA 1Q79A 3A8EA 3EXCX 1XMOJ 4DG1A 3TZWA 2VG5A 3KJNB 5IQ6A 4IFVB 3ZNJ1 3ZTPA 2CQCA 2YX7A 1FWKA 4DG1B 2OFHX 1HIYA 1IN0A 2VG5B
chains in the Genus database with same CATH topology
5I3QA 5D77A 2HNZA 1Y5IB 3MURP 4DV6F 4IRCA 2VFSA 2Z4PA 2X1AA 1PGZA 2RQCA 3J7YU 5JXSA 2RB7A 3E01A 2W8LA 2Z2MA 2ROGA 3B78A 2QYCA 1LWFB 4WK1A 1N6QA 2CJAA 3EGZA 1H6KX 3D1HA 1U26A 4QWAA 2WONB 3GV5B 5BYRA 1YTYA 5E3AA 3GIKA 2KT2A 1HD0A 2I2YA 2RH3A 2SXLA 5KFKA 1R43A 2I5JB 2B7BB 5HROB 3H2UB 4B9MA 2WW8A 2YKNA 3AB2B 1AFIA 5K8MA 3R1HA 2B43A 4P2SA 2IFXA 3S1TA 2KT5A 2I9SA 1RT4A 4AXIA 3RB4A 1GX6A 2R2TA 2QT7A 5E33A 1S72S 4XDCA 5T41A 2B4PA 4O3PA 5KT2A 1NHVA 3ENVA 3FZBA 1X4HA 2XMKA 1PILA 2QFJA 1FKPA 3AQOA 6FD1A 4DFJA 3RW7A 2MXYA 1BD6A 1RT4B 3QYYA 4CO1A 2RU3A 2JEJA 1DTQA 3I9ZA 2VASA 3FQLA 1Q81T 1U8SA 2XMJA 2APOA 2OPRA 2EFNA 1QSSA 4FF3A 4NA1A 2B5JB 3R27A 3LGNA 2GHVC 2W9BA 5CH7B 2J0WA 5DLGA 1K73T 1IJFB 2CQIA 2LDYA 5GAEI 2DNLA 2VL1A 3HZEA 3CCVS 1S9FA 1M5VC 1FJEB 1APSA 1HNXF 2WHOA 1IUJA 5DLFA 1XWLA 2N82B 1C0TA 2XSFA 5DQGA 5JUMA 2IYGA 1WTFA 3I31A 4EGLA 3BREA 3IRXA 4WFYA 5HP1B 3L3CA 2V0NA 2W9BB 3KTQA 4YOEA 4FS1A 2W24A 2VKRA 2LU1A 3TA0A 5IFMA 3SV3A 1HHTP 1DRZA 4A8OA 1JLQA 2KI2A 3AA8A 3LW5C 4C8NA 3KNAA 3BGRB 1YJTA 4MH8A 3PW4A 1RA7A 4RU2A 2GMJA 2D1CA 2ZC4A 1WEYA 2VUGA 3EZUA 4GMKA 2HNYB 1KFSA 4ZVEA 5HBMB 5FDLA 3HHDA 2AYGA 1TK5A 4TQRA 2GQQA 4UUXA 4OHZA 4CNZA 1ZTWA 1WG5A 2GV1A 1PC4A 2P5VA 5T7LB 3RAQA 4ALZA 2LXFA 2ZH4A 2ZH8A 2E1CA 2OD4A 4FP9A 1RT5A 1C2PA 5J1EB 3T9ZA 3KMSA 1L3VA 3UR0A 2BRKA 5I42A 2JX2A 3DGPA 2HHTA 4ED0A 4OZJA 5KT4A 1BLUA 4A8SA 1FRJA 3V5RA 1KVIA 4LT6A 3HHLA 1R0AB 2FVQA 3RB3A 1FEHA 2XI2A 1YHQS 2AJ1A 5LXYA 3M9OB 1T03A 3L95X 3KHRA 4PWDB 2RQMA 1HL6A 5D4NA 3M30A 3JSMA 3OFEA 3RYLA 1M5PC 1RT2B 4QIVA 5F3ZA 4F50A 1MW7A 5E3RA 2KT3A 1HW9A 1S1UA 4CI0B 2QRRA 2NUHA 2Q43A 1S0OA 4ATNA 2NLWA 4X65F 1CEZA 5KFJA 2J9DE 2UXDF 5K14B 1RTJB 1B0TA 3HZGA 1IR0A 3M30B 5KG6A 3E2EA 4Q45A 5GAHU 4FS2A 1G2EA 1K0TA 3CB4A 5D4OA 1GXUA 5A0YB 1A6LA 4U9RA 1U6BA 4ZPTR 1S1UB 1GT8A 2IJFA 2POKA 1WELA 2L08A 2QMWA 3DDKA 5CHCB 4BC9A 1XK8A 5B08A 1KEKA 2R7RA 4RNNA 3I9V9 2P9CA 1S77D 4RNFA 4DF8A 1JLEA 4LF7F 3BGUA 3NMAA 1FDAA 3PR5B 1NKCA 4ID8A 1N0UA 1IKVA 1W2IA 2CG4A 5D78A 4F3OA 3WC0A 1QUPA 3Q8SB 4L3NA 4F4YA 4DQRA 2B56A 4YDDB 4I6WA 3V6KA 3H59A 3I5CA 5CQGA 2E5GA 4J9PA 5CCLA 2VG7A 4M1KA 3QZ8A 4OZ0A 4OLOA 3ZC4A 1FNMA 2F9DA 4B17A 1SJRA 2W9CB 4DUZF 4RBVA 3MD3A 3NG8A 4PR6A 1CSJA 1FE4A 2FGOA 4H4KC 4IO9Q 2J9DA 3J80Y 1VQ7S 4IH5A 3BB5A 2RS2A 5KFVA 1GXLA 1P6TA 2VG7B 3TANA 2I8EA 2QLWA 3D0GE 1VC0A 3DLBA 3CCES 4GC6A 1VQKS 1S1XB 4ZPWR 4OI1A 5J2NB 5KFQA 4EU0A 1PO6A 4X4SA 4F4ZA 3JB9k 1VJWA 2FLPA 1UVNA 5F8MA 3VAKA 2EBEA 5AXMA 1CC7A 1X5TA 2BRLA 1T3OA 2GCFA 5T14A 2RVJA 3UE2A 4K5RA 2EW9A 3NNHA 3CTRA 4IG3B 5A8KA 1QM9A 4XO0A 3P96A 4QIWD 1SH0A 3BSAA 3CJKB 4DL7A 1QAIA 1C4AA 3IR5B 2EI5A 1F5BA 1IKXA 2J5AA 1M5OC 2DGQA 2XNRA 2YVSA 4OZ1A 4ELTA 1VBYA 2IVYA 2VBZA 1ZETA 1N48A 4TKTA 3FEZA 4G3IA 2UVWA 3HKWA 3GILA 2WK4A 2XG8A 3TX8A 5KG4A 3HT3A 1HPZB 2L9WA 3TVZA 1QAXA 2WTFA 1O5JA 3SCKE 2IVFB 1Q8BA 4ITSA 3BR8A 3AA9A 1SI9A 3N5FA 3OUYB 1YG0A 2DB1A 3GG0A 2YKMA 4F02A 2LA4A 3LP2A 1RKJA 1REVA 3M2RA 3BSCA 2D3ZA 5GADI 2EKYA 3I0RA 3PIPQ 1M5HA 2DCUB 1SJ3P 2DR7A 1NKBA 2I38A 2KU7A 2BABA 3HDSA 1RT3A 4ICLA 4ED2A 2HNDB 2DGSA 1BQNA 4MMOA 3OSNA 2X1BA 1TL1A 4FYDA 1CPZA 2VQEF 3CDUA 4DV2F 1TKTA 4CH7A 4DQPA 4QR1A 3UDLA 4KAIA 3QPIA 1VMBA 3D5MA 1S1WB 4P7VA 2CJ9A 5B0EA 4B9NA 3DU5A 3T1AA 4Y2MA 3KLFB 4I69A 3I4HX 1RT3B 3H20A 3BJYA 3CCMS 4OV1A 4XK8C 2DNGA 3N79A 4EBCA 3MTJA 3PEJA 3SMZA 1MROA 2ZC3A 1TL1B 3KHGA 3ICLA 1TKTB 5B0FA 5KFZA 2V2KA 1D8ZA 4QIFA 1IM4A 3DLGB 4N41A 2CPEA 2LECA 2VPWB 3R1LA 1C1BA 1FT8A 1NEEA 5DG7A 2JEGA 4ED5A 3GQCA 4BBYA 1UFWA 1XEZA 1FJ7A 1MROB 4NRTA 1JLCA 3KLIA 1JLAB 3MMBA 2DNYA 2PGCA 2C2RA 1VIOA 5I4MA 2DK2A 3MMCA 4ECVA 1MMNA 2QV6A 2AP6A 4LMZA 1C1BB 2X51A 4LVOP 3TRGA 1RTDA 3C8YA 3G9CA 3OFFA 4FXVA 1P27B 2LLZA 1SUQA 1E6VA 2E5IA 1P1TA 1TQLA 2DNHA 2OMOA 3O1LA 5LMNF 3V81B 4FXDA 2VC1A 4HDGA 4DN9A 3MMCB 2HWIA 5GVQA 1IKYA 1LV5A 1M1KT 1IBMF 2R8HA 2IHR1 5LT5A 3DRRB 4QW9A 2XCPA 3LF0A 3MM8B 5HI7A 3OR1A 5KFTA 3J7YI 1CQNA 3UD4P 1VQLS 1SUQB 2E7XA 3AY0A 3OSPA 1ZTTA 1IKYB 2GHPA 2GFFA 4DL5A 2KFZA 4ILRA 1SL0A 4LFCF 2D41A 4I6AA 2ZHOA 5L8RC 3IS9A 3O2IA 4OHYA 3TW0A 1HNVA 1HW8A 4PG4A 3CMAS 3CDBA 3VZHA 4NA3A 1DTTB 5J1PA 4E98A 3V4IB 1YSJA 4IOAQ 4K50A 1S49A 1YJWS 4J9KA 3DNCA 4EBDA 3SDEA 5EUHA 4OQJA 2O66A 1SB6A 4R5PB 3PW0A 1WD6A 1Y9OA 1RYSA 4KTQA 2V4JB 5FD1A 3CCRS 4WXWA 3QJLA 1B0PA 3M2UB 3K5OA 1XR7A 2DNQA 4AE5A 3IO1A 4K5SA 2AJFE 3NBPA 1Y3JA 4RKUC 3JAMY 3KK3B 2NREA 3KLVA 1UVJA 4ZK7M 3RW6A 4I0WA 1YJNS 3EPGA 1AXQA 2CPYA 2R8JA 2WB4A 1T8EA 2PO4A 4WU3A 2HFNA 3P5TL 1Q7LB 3FMWA 4Q43A 3M4XA 2MSSA 2FHMA 1ZBTA 1HA1A 2YWEA 3NNCA 4IG0A 2YWKA 4URSA 3UWTA 5ITHA 2FB0A 3NBPB 3RR8A 3JTNA 1FJGF 2MQQA 3HHLC 3SCJE 1NAQA 2M8DB 1U25A