1U2FA

Solution structure of the first rna-binding domain of hu2af65
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SPLICING FACTOR U2AF 65 KD SUBUNIT)
publication title Solution structures of the first and second RNA-binding domains of human U2 small nuclear ribonucleoprotein particle auxiliary factor (U2AF(65)).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u2fA00
1VQOS 1X4HA 4Y00A 2HGMA 4WFNQ 1FHTA 2MKHA 5LSLA 4TU7A 3G71S 2QA4S 2JVRA 4F26A 3BS9A 2LEAA 3MI7X 2KVIA 2EVZA 4WFBQ 1HA1A 3U1LA 4WCEQ 3CXCR 2VOOA 1M5KC 1UW4A 2DGUA 4W92B 3CULA 2CQ0A 1H2TZ 1O0PA 2M4MA 1Q81T 2MQQA 2ERRA 2HYIB 2KG1A 4FXWA 2F3JA 2MSTA 2VONA 3UD4P 2PE8A 3CTRA 3MD3A 2RT3A 2G4BA 3EX7B 5LXYA 3VAFA 1WEZA 3THPA 4LIRA 5DDRC 2CPHA 2LKZA 3CCQS 1D8ZA 1H2UX 2QEXS 2K8GA 1X4GA 2DH7A 3NNAA 2MMYA 4FXVA 3U1MA 2KXHA 2DB1A 2GHPA 2MZSA 4PRFA 2XNQA 2M8HA 2M0GB 3BO3A 2RVJA 3R1LA 2DNLA 1P27B 3G6ES 2DGXA 2DNQA 2KRRA 4QPTA 3UWTA 2FC9A 1FJEB 3G4SS 2KXFA 3ZZYA 2CQBA 3BO2A 1VQ5S 3VF0B 4IOCQ 2OIHA 1U1PA 5CYJA 1K8AT 1WG1A 3N9UC 4Z2XA 2CQ1A 2LMIA 1U1KA 4TU9A 4P6QA 4QQBA 2DNRA 3VALA 3PIPQ 2MQNA 2J8AA 3EGZA 2DNPA 4YUDA 2RQCA 1N8RT 3CUNA 3CPWR 2E5GA 3UCGA 3P3DA 2AYEA 2MZQA 2MXYA 2X1AA 2MZ1A 2L41A 2MKCA 2QFJA 4IOAQ 1X5OA 2F9JA 5GVQA 2AYBA 3MDFA 2OTLS 1PO6A 3RW6A 1WEXA 2AD9A 1VBZA 1S72S 1AUDA 1VQ7S 1SJ4P 2M7SA 4OZ0A 3MURP 1VQ8S 4J5OA 1KOHA 3SMZA 5GAHU 1UAWA 2MJUA 2RQ4A 3ZZZA 4ZKAA 3MUTP 2G1DA 3CF5Q 1NU4A 2X1FA 1UFWA 3MD1A 2DO4A 2DGOA 5HO4A 2MGZA 1B7FA 3S8SA 1JJHA 2UP1A 1Q82T 1X5SA 3UE2A 1YIJS 1VQ6S 3B4DA 3CCVS 2XS7A 1FJCA 2DNOA 1OIAA 5JVGQ 5IM0A 3K0JA 3S01A 1RKJA 2KU7A 2DHGA 3SXLA 4CH0S 2DNKA 4CH1A 3H2VE 5DDQC 2CPZA 2HGLA 1U6FA 3Q2SC 2D9OA 1NJIT 4QU6A 2X1BA 2X1GA 1L3KA 1NO8A 4UQTA 1HL6A 3NNCA 2MZTA 5D77A 3CCES 3UCZP 3R1HA 2N3OA 1WHVA 2KN4A 4CIOA 2LCWA 4YB1P 4IUFA 2KXNB 2KG0A 2MB0B 2MQLA 1H6KX 3CMES 1K73T 3LPYA 2OTJS 2CPIA 2LQ5A 3NNHA 1WHWA 1YTYA 2DISA 1XN9A 2N3LA 3JB9k 2M8DB 2LA4A 3L3CA 2DIUA 3NS5A 2DGQA 2DNHA 2MKSA 5EN1A 3BO4A 3CCRS 1X4EA 2KHCA 2LA6A 2BOPA 3HHNB 5DDPC 5DM6Q 2AYGA 3NS6A 1S79A 4PKDB 1VC5A 2CPFA 1DBDA 4RU2A 3V4MA 1KQSR 1G2EA 2J0SD 5MLCV 4EGLA 1X4BA 5H1SV 4U67Q 1U1RA 1M5PC 3P49B 2M9KA 2CPYA 2DHXA 2MGZB 2ADCA 1U6BA 3CCJS 2CQPA 1IQTA 2JVOA 4W90B 2LEBA 5CA5A 4LMZA 3B4MA 3G8SA 2DNNA 2E5IA 3S6EA 2RRAA 1DZ5A 5LSOA 5IM0B 1SJFA 2CQ3A 1U1NA 1M5OC 1DRZA 2E5HA 3G9CA 3Q2TC 1SXLA 1H2VZ 2N82B 2CPXA 1YJ9S 2K3KA 1FO1A 1DHMA 2D3OR 2U2FA 1FXLA 3MUMP 3P5TL 1VQNS 1WI6A 3IWNC 2RS8A 1YWXA 2DNYA 4WF9Q 5FJ4A 2KH9A 5GADU 1M1KT 3CCSS 2MKKA 1QVGR 2SXLA 2VOPA 2DGWA 3FEYB 2A3JA 2KT5A 4C0OC 1JJ2R 2U1AA 3R27A 1VBXA 3P6YC 1YI2S 4WFAQ 1JMTA 2OJ3A 3PIOQ 1YITS 1ZH5A 1SJRA 2DO0A 3OW2R 1SJ3P 3LQVA 4YOEA 4ED5A 2CQDA 2NLWA 2FY1A 4TU8A 4OZ1A 2I2YA 2V94A 3S7RA 1UP1A 2DH8A 1K9MT 2HVZA 1X5PA 4ERDA 2KM8B 4WIIA 4A8XA 2OSRA 1X0FA 1R8PA 2NZ4A 2DGSA 2E5JA 3NMRA 2MHNA 3UD3P 1WI8A 2XB2D 1VC0A 3VAGA 2M52A 1PGZA 2MY7A 1FNXH 1JJ4A 2XSFA 2CQGA 5DM7Q 4TLQA 1ZZFA 1WEYA 2AYMA 2DHAA 4BS2A 1VQPS 2J0QD 2B0GA 2BZ2A 2YWKA 5DDOC 1FJ7A 1VC6A 2RU3A 2DITA 2Q79A 1M90T 2XS2A 2KFYA 4IO9Q 3I55S 1FT8A 3TYTA 5LJ5Y 2D9PA 2DIVA 2MSSA 2KM8C 1YJWS 2JWNA 4V19X 5GAEU 2DNZA 2J76E 3J7ZT 1WF0A 2EK6A 1Q7YT 2HGNA 2MZRA 3BEGB 2FHOB 4PR6A 2MKJA 1N88A 3TO8A 3CC4S 4M5DB 2MZJA 3G8TA 3I56S 1N52B 2CPJA 3ULHA 1X4CA 1KC8T 4F02A 1A7GE 2GO9A 2YH1A 3FEXB 2RUGA 1U1OA 2HZCA 2PEHA 1M5VC 3TP2A 5D78A 1F9FA 2G0CA 3SDEA 3THTA 4QU7A 5GAGU 2DGTA 3VAJA 1QVFR 1WG5A 1X4FA 2XNRA 1WTBA 2MQMA 3D2WA 3CMAS 3CCMS 5JVHQ 2ADBA 4CQ1A 5BJRA 1HD1A 1WHYA 3VAMA 1YJNS 1WHXA 1X4AA 1D9AA 1W2BR 2XS5A 1VQLS 3H2UB 2MJNA 4F25A 2YKAA 3CC2S 1OPIA 2DNMA 2LXUA 2MQPA 1BY9A 2KI2A 1P1TA 2LXIA 2DH9A 1WF2A 2I38A 2CQ2A 4LJMA 1WELA 1ZZNA 1VQ4S 1HD0A 3CCLS 1URNA 2WBRA 5GMKa 1KOOA 1N54B 2DK2A 1WG4A 2CQCA 4Y0FA 2DGVA 2CQIA 2DNGA 1OWXA 3MOJB 1WF1A 2YTCA 3IRWP 3G96A 1KD1T 2N7CA 1Q86T 3VAHA 2VODA 2O3DA 2CQ4A 3MXHP 5ITHA 2M88A 1A9NB 1VQKS 2YH0A 2MYFA 5IQQA 2L9WA 5HL7Q 5CXTA 3J7YU 3VAKA 2CPDA 2KRBA 1VQ9S 1U1LA 2JX2A 2CPEA 1VBYA 2MPUA 2OSQA 2E44A 2MY8A 2MKIA 1R8HA 3MUVP 3CCUS 2LYVA 2MQOA 5LJ3Y 1U2FA 2M2BA 4UY8T 2RS2A 3SDEB 2F9DA 2FC8A 3UCUP 3CD6S 3EGNA 1X5TA 2L08A 2ZJRQ 2FPHX 1QM9A 2JRSA 1WWHA 2LECA 2RRBA 3RW7A 2RNEA 2CQHA 5DETA 1VQMS 4C4WA 1X4DA 5IFMA 2CJKA 2M70A 2DHSA 1OO0B 2EK1A 3DLLQ 3HI9A 1CVJA 2ZJQQ 4WKRA 1RK8A 3US5A 3DXBA 4C7QA 2ZJPQ 1U1MA 1SJQA 3VAIA 2KYXA 3CC7S 1U1QA 5LXRA 1YHQS
chains in the Genus database with same CATH superfamily
1WC3A 5CHCB 2ZOGA 2PMHA 2LDYA 3NEKA 4EU0A 3KLVA 4ED6A 4DR6F 2HHUA 1IWGA 3AD9C 2A1BA 4RW6A 2VL1A 1R0AA 2BM1A 2IDLA 2PEBA 2YPYA 2W7AA 4DV1F 1G6BA 4DL5A 2HWIA 1ZM4A 2VG6A 4DQQA 2KT3A 4DL2A 4CO2A 2GHPA 4NYZA 3CO9A 3WIVA 3T1AA 1P27B 5A6WA 3UWTA 3HHLA 2IAJA 2KXFA 2UUCJ 5E3PA 5CYJA 4ED0A 1K8AT 3GE9A 4K2XA 2V8DA 1XJWB 4MYUA 4ELTA 2D1CA 4QQBA 2G2ZA 2H4YB 2ZVIA 2UUTA 4ED4A 3BZQA 3NGDA 4DBQA 3A8EA 2Z30B 1BGXT 3J81j 1T05A 4AL5A 3BQ1A 2YNIB 4KGMA 4GRSA 3MURP 4DR1J 3KXDA 5KFIA 3J7AN 2LXFA 3DRXA 1JLQA 1VFJA 3ILLA 4O44A 4ELUA 1HIYA 4NPOA 2XHCA 2XS7A 4DV3J 3ZZRA 3K0JA 2HPUA 3SXLA 2ZBPA 2DXEA 4CH1A 1S1VA 1F60B 3Q2SC 1UA0A 3UN5A 1XR7A 4RW7A 4DV6J 2MZTA 4JI7F 3W9JA 1RI7A 4ID5A 2OTJS 4ZLPA 1NK4A 2LQ5A 1YTYA 1NMEB 2WOMA 2R2RA 4X2BA 5J2MA 1S6OA 2YNGA 1X8DA 5HJXA 2PC6A 2FD2A 3W1YC 4Q44A 1KWMA 2CNKB 2FJBB 4X65J 4E0DA 4J9NA 1S1WB 1Y3KA 1QJHA 1N5QA 3ZXWA 2R8JA 4B9SA 3M1VA 4CP5A 4C8LA 1LK5A 4DSEA 2VBXA 5D0GA 3ZFVA 4WXOA 1C0UA 3QPIA 1B0VA 2NXNA 1RDRA 4G1QB 3GIIA 2W9AA 1S57A 5L38A 1RHUB 2KJVA 5I42B 4EZ9A 3AY0A 4WF9Q 2IJFA 1RTHB 1MROB 5AXKA 4WBFA 3RRGA 1EAYC 2OELA 1NKCA 1GX5A 1ZAWA 3C66A 3Q8YA 1U47A 4X4OA 4ERDA 2GIFA 4H54A 2JJ4D 1RKIA 4QIGA 4ECYA 1JLBA 2XSFA 3KTQA 1K44A 4NL5A 3IM9A 5HMZA 5KFGA 5K8NA 2W01A 1VQPS 4DL4A 2XMWA 4HYKA 4USKA 1HBMA 4ZP9A 1TKXB 3AOAA 1HNWJ 1RBAA 1HPZA 2HLTA 4XPCA 1BQMA 3QGPA 2AP6A 1YRXA 3I56S 3ULHA 5KFZA 3ITHB 1IR2A 3GIKA 2ZDPA 1QVFR 2ZD1A 4IH7A 4NLOA 3CCMS 4DPOA 4MMOA 5BR8J 1D9AA 1MLAA 2GIQA 2MQ8A 5KG4A 3DGVA 1MNEA 3GYXB 1P1TA 4DS4A 1BUXA 1R0BG 1IBMF 2OUGA 1LOUA 1WELA 3T9NA 4PEOA 1NK0A 5DRKA 3D6FB 5F9LA 4OX9F 3GYNA 5ITHA 5I3PA 1S48A 2UVWA 1PYSB 5CXTA 4RW8A 2YWGA 2JL9A 3QYYA 4TY8B 3QJLA 3MM6A 5IQ6A 1I94F 1WOOA 1XIQA 1X0PA 2NQPA 4USTA 1GNKA 3JSMA 1IKWA 2UUAF 5CCLA 4UT4A 2V4JB 1JKHA 3TX0A 3ETOA 3IAM9 2VJUA 3V6HA 1EP4B 2IM3A 3MGJA 2QJ3A 2ZJPQ 1UL3A 4ER8A 1GAOA 2BXJA 4R8UA 4DR6J 1W26A 5IS2A 4RNFA 4KE5A 3PTWA 3W7BA 2VOOA 2XULA 5THWA 4NI2B 5J2PB 5D3GB 1Q81T 4F3OA 1TV6B 2FJWA 4MJKA 4DV1J 5KG7A 4B9LA 3R3TA 4ZPDA 3ETMA 3F41A 2ROPA 3GTYX 3DLGA 4FXVA 2Y1IA 3NRBA 3CJ2A 4Y65A 2XNQA 3I96A 1FRKA 3LOUA 4EYHB 2HHTA 2J6SA 2DGXA 2VASA 3C6TA 1GXTA 4X4PA 2Z2ZA 3M2RA 2CQBA 4PABA 4MFBB 5BYSA 2R8HA 1U1PA 2BR0A 5K9FA 2CDQA 2FYXA 4XTTA 4DSJA 1FX4A 2HHQA 2ZZMA 4O23A 2VUGA 3CWJA 2HVHA 1AUDA 3HP6A 2K1RA 2BKPA 2M7SA 1YBTA 4EWTA 1N36J 1WOSA 2W4DA 4N7TA 5C25A 1AFJA 2DO4A 2OD4A 1ACMB 4I67A 3DLEA 2PMZD 5LMUF 1YIJS 3B4DA 3HM9A 3LF0A 1FJCA 1CJTA 3EGVA 2DHGA 4JI7J 4DR2F 4ZVGA 1NEEA 1UEVA 2LQJA 1FK9A 4K4UA 3NNCA 3IS9B 4N41A 1HNVB 3TNVA 3SQOP 4QJVA 4R5PB 4IH5A 2IPOB 1U7LA 4F4KA 1WHWA 1VJQA 1RB0A 1FX2A 1QY7A 2MKYA 2LA4A 3PYEA 2EFNA 3W9HA 3IN5A 4KFBA 4FN5A 4H4KA 3NGUA 4JI4F 2YNFA 2J0SD 1CJUB 2R3VA 3QSYB 1FFSB 1JLEB 1VRUA 1F2HA 3C6UA 2LEBA 1Z2ZA 1RHJB 3B4MA 3ZNJ1 5KFCA 1DLOA 1RTJA 1TL3B 1DZ5A 3HVRA 2IC3A 5IM0B 4ECQA 2CQ3A 1ZM3A 1IKVA 3PACA 4TXSA 3SFUA 2K3KA 4F0MA 3GCWP 1WI6A 1RU1A 4K7QA 3JYTA 3WC0A 3OSPA 2DKOB 3D54A 3FC9A 4X66J 3PIOQ 4EBCA 3NOGA 1YJUA 2J9CA 2FY1A 2NSBA 4IDKB 3Q8VA 3GV8B 3OR2A 2FHJA 3C2PA 4XK8C 2VQEF 4A8XA 2OSRA 2YKOA 2XY6A 3RYLA 3GV7B 3OFGA 5CABA 1RWVB 1CQNA 2LVWA 1HMVA 3KJVB 3JAMY 1HNIA 2BBEA 2M52A 2MY7A 2BE7D 4M5JA 3QO9B 4NCGB 4L72B 4YFUA 4ZHRB 4AFFA 1M90T 2KFYA 2HAFA 3UVJB 2KZMA 2BV3A 3M6VA 4V19X 5DGBA 2ZEJA 2HGNA 2IM0A 2FVRA 3PR5B 5J2NB 4RPFA 2PEHA 3NG8A 4OFZA 3TP2A 4K4WA 4PZVA 2DEJA 3IG1B 3BSNA 1X4FA 1V3RA 3CCWA 1E6VB 4OI4A 4J9PA 1IBMJ 3H2UB 3CD5A 3EMTA 4KC5A 4J9LA 2C2ZB 1TK0A 3QRPA 4DUTA 2I6WA 2VHGA 4ECWA 3MMCB 1FKOA 1AZSA 1WF2A 5C24A 3W5ZA 1FDNA 3HHEA 3UDCA 4OX9J 2RHQB 1OY9A 4PWUA 2GCFA 1FCAA 5HROB 4NMXA 2VB6A 2Q1LA 3LP1A 1Q79A 4ANDA 1UCNA 1Y4ZB 5D8HB 1Q78A 4MKVA 4O3RA 1I94J 4DOZA 3H59A 1D1UA 3M8RA 2MQOA 2M2BA 1N56A 3SDEB 3CCZA 2UUAJ 1X5TA 2V8GA 4LSNA 3N6LA 1DTQA 2RNEA 3KWMA 1L5UA 4LRAA 5IFMA 1A0OB 4EK2A 2ZH5A 4O4GB 1RK8A 2QE5A 2AJ1A 4GC7A 2KJWA 2CWKA 1U1QA 1N5SA 1QAXA 5MAOA 2HGMA 1WUUA 2ILYA 2UU9F 4HACA 3R5CA 1V5VA 1NK7A 3BH7B 1KEKA 2PSZA 5ETPA 2ZC3A 1H2TZ 3NL0A 5HANA 2VFRA 3A8JA 2RF2A 4UOHA 1FDBA 2ZH3A 2DH7A 1CULB 4Q8EA 4FF1A 3RB6A 3FCHA 3UNGC 2DB1A 4JUZA 4LFAF 3FCWA 1VLOA 1XR5A 1FD2A 1I5OB 3IRXA 2FZKB 3EUNA 2GVZA 1K0TA 3D1OA 4AXIA 2BKOA 5FLXU 2Z2MA 1KFSA 4HEA9 4B3TJ 5KFBA 1RA7A 1N8RT 1RHRB 4JI5F 2GNKA 1SV5B 2X1AA 4X4TA 2ALZA 2W9BA 2QFJA 1O51A 2PI4A 2XYGB 5DZ6A 4HT5A 5A76A 4TN2A 3K5LA 2ZBRA 3KLEB 1PIEA 1UWBB 3W65A 1KP6A 4DL3A 4A8WA 4YB6A 2MJUA 3W61A 3MUTP 5LMUJ 1B7FA 4FYYB 2BQUA 1IVZA 1T8EA 2BE2B 1NSQA 4DR2J 1EKRA 2KU7A 4YR3A 1R7IA 2OPSB 3CDBA 3G82B 4ZJQA 2CXEA 1YZ7A 3AXMA 4S0MA 3KLIB 4NCAA 3MEDB 3W8PA 4UTGA 4JI4J 5KFWA 2GX8A 3TI0A 4XDDA 2D69A 3D6HB 2CZ4A 2DR6A 5ETKA 1AYEA 4NCBA 1NJXA 5J2QB 3HFVA 2UZAA 4U67Q 2IRYA 4FKYA 2XQCA 5LL6d 2JEJA 2CNLB 4DSLA 5D4NA 2VICA 1KQKA 4ETXA 1ZAXA 1JJCB 1SJFA 3M2UB 4NLTA 1SH3A 2ATCB 3Q2TC 3QJPA 3SSSA 4WFZA 3JQKA 3NXZA 1FO1A 1YDLA 2D3OR 1NZAA 2YKMA 4FPRA 3NGSA 2P5VA 4X4QA 2GZOA 3PO5A 1YSJA 1SKUB 2DNYA 5FJ4A 4CLFA 4L74A 2VOPA 2AX1A 2KT5A 3BKUA 1B0PA 2Y0BB 1T7PA 3HF5A 5GMEA 1LWCB 4IH6A 5KFMA 3OW2R 3LQVA 4USHA 1DAXA 4JV2A 2VQEJ 5BYQA 2R7OA 3S7RA 3R8YA 3GG1A 3M8PB 1X0FA 1XMQF 2E5JA 3NAHA 4U9RA 4U96A 3MR7A 4DX6A 1W25A 1FNXH 4DV0J 5DM7Q 3PYFA 2DPIA 3MM9A 2KTQA 5D0RA 4C11B 3M30A 1JLGA 1M5HA 2ASJA 4JI0J 2IYIA 1RAAB 5DG9A 2W4PA 4K59A 4CM2A 2XMUA 2DNZA 2E9TA 2WK4A 5FDLA 3BEGB 5J1PA 5B09A 4UZBA 2QMWA 3CO0P 1RYRA 3LP0B 1QDUB 3BF4A 3O6QA 1WTBA 4DG1B 2EW9A 4DV2F 4MIAA 4XO0A 2CVIA 5H9FJ 4C3LA 3DI6B 2LXUA 2OPPB 1GMWD 5KFTA 1R8BA 2XCPA 1EX8A 4ANCA 3CCLS 2VPXB 1D9FA 2D3ZA 1NHUA 3RB3A 4U8VA 1KQFB 5HVGA 2YH0A 2IVYA 2JOQA 4DLEA 2JX2A 2CPEA 3CSKA 4HDGA 4F2RA 2E44A 5E41A 3VV2B 1RBLA 3M8YA 1T9WA 3QT8A 2LYVA 3O8WA 3QT5A 4AE5A 1NDLA 3PYGA 1Q53A 4OQJA 4JI1F 3KK2B 4LF1A 2ZJRQ 1GTHA 5AE1A 3RW7A 4O0NA 3MR3A 1VQMS 1VGYA 7AT1B 2DHSA 1N6QA 1NJZA 5LSRA 1SBRA 1RT4A 1SUQA 4P74A 2ZJQQ 3US5A 3FZ2A 5HLFB 2DRDA 3V5RA 4ZS6A 2GC8A 2G4BA 1RT2B 5KOWA 2NCKL 4B3OA 1QSSA 1UVLA 3OR1A 2KVIA 3TZYA 2CJBA 5HQ8A 2HRTA 3FK4A 3RBDA 2HLUA 4FNHA 2CIMA 4NMLA 4PCQA 2OMLA 2GA7A 3NCRA 4N56A 3TQEA 4LFAJ 3HFZB 2H5JB 2KB2A 2FVQA 2ZUAA 2WRMA 3AODA 2POKA 1NDPA 4QPXA 4A47A 4ZCLA 3TVZA 4YR0A 4C98A 1TUGB 3T5LA 3K5NA 1TK8A 4G3IA 2FIUA 1WC4A 2W24A 1VBKA 4JI5J 3PZPA 3VALA 2J8AA 4L75A 2RQCA 2XMAA 2E5GA 2XGPA 3OJSA 4USVA 4RW6B 5E3RA 2MZQA 2I5JA 1RCXB 2V6AA 2MZ1A 2VC1A 2AV5A 4IOBA 4PPDA 2BKNA 3A13A 1W2IA 3X3UA 3C46A 3BPDA 3VQTA 2BQRA 1SJ4P 4NA3A 3MM5A 1NBEB 3RB4A 3ELHA 2VG6B 2G1DA 4GMKA 3OL8A 5HO4A 1SKSA 1PBAA 3POTA 2EKNA 2XYHB 4GKKF 1JLCA 3QGHA 2HS0A 4CDIA 4FZVA 3KUHA 4TYAA 1OYEA 3OTDA 2ALYB 3HHLB 2IAJB 3M6WA 3AFGA 3D6MB 1PJ5A 1TL4A 4RNHA 3CCES 4DLGA 3UCZP 2N3OA 2LCWA 3T3FA 3HVAA 4PG4A 3O5TB 3R7NB 3NCPA 1K47A 1RT1B 5ETVA 4CO4A 5CD4H 3BO4A 2BOPA 1KVJA 4M5HA 3PW7A 1T05B 4ZVTB 2QG9B 4DV4J 1R6YA 4PKDB 2J7WA 2FVPA 3A3PB 1X4BA 3FCVA 2BM0A 2M9KA 2VBWA 3H90A 2AF6A 1JLQB 1TUWA 1EZZB 4O44B 1ZPWX 2HHXA 3GZ7A 1SCJB 1IR0A 3LGHA 1LXNA 1KKHA 1Q8KA 4ILMA 5F0UA 1HR0F 1S1VB 4CTAB 7FD1A 4RW7B 2PFFB 3IWNC 1UW9A 4ID5B 2D41A 2KH9A 1M1KT 4Y34A 3EDRB 2WOMB 4M5DA 5J2MB 3H2LA 2YX7A 2CVEA 4CM0A 4ZPAA 2YNGB 1Q95G 2NLWA 2YQ0A 1ELOA 3DMJA 3IBCB 2V94A 3MM8A 3GR0A 2A0FB 1F5BA 1HW9A 1WJ9A 5HSPA 2XGQA 3M1VB 3IBFB 1S99A 3CIMA 2Z2LA 3UD3P 4GC6A 3GP9A 4KO0B 4A8OA 5F8LA 1RTDA 3RR8A 4MK7A 3QRQA 2E1RA 5CD4A 1FTRA 1C0UB 2B7BB 1YKWA 1RGVA 4LF2A 3JS9A 1VLYA 3J7ZT 5KFUA 3G8QA 4EMDA 3TO8A 2UUBJ 1N52B 3O1LA 2LQBA 1KC8T 2GO9A 4HVZA 4OYAA 3NS7B 4IR9A 1S9FA 2G0JA 4DV2J 2LU1A 1N5YA 5DGAA 1GQEA 1FWLA 3D2WA 5JVHQ 5KFAA 4J9RA 5DJBA 1S97A 5D4PA 3JTNA 1K1SA 2DNMA 2ZH2A 1JLBB 2GGPA 1RP5A 2I38A 2QLXA 3JTOA 5H9EJ 1R43A 4NLPA 4P71A 1RXOB 4YP3A 4JI2J 4X62F 3I9ZA 1NSPA 5KG3A 3M8SA 1GMUA 3PX0A 1TL1A 1NK5A 1HBMB 3MXHP 1S1UA 3MAHA 1SL0A 1HPZB 2AJ4A 2GMJA 1VQ9S 2KRBA 1TKZB 2EG2A 3GJTB 1FRMA 3FQKA 3PM9A 3CJ4A 2ZD1B 5HK4A 1X9MA 2V68A 4OYOA 2L08A 2E5LF 2BJ7A 4ES1A 2B4UA 2HVEA 1C4AA 3ISZA 1ZOTA 1ZM2A 2F63A 2DEIA 3QBCA 2FVCA 3FVYA 2AZ3A 5EX3A 3IAS9 1ICEB 4CO3A 2FZCB 3V2UC 3MMBA 4B3RF 2QRRA 1TP7A 4TU7A 4WU2A 4DMZA 4WFBQ 2ACMA 4RW8B 4QOTA 4JV5F 3M7VA 4DI6A 1FRHA 2CQ0A 2MQQA 2FLNA 4RL1A 3H8YA 2LKZA 2CUYA 2VG7A 3QIDA 1R27B 2VA3A 2J9DA 3JSMB 1IKWB 4IQMA 2ZE2A 2W2NP 4NZ7A 2VQFF 2MMYA 1JKHB 1MMNA 2MZSA 2HIQA 5CZVA 1FEEA 1B70B 2HKEA 4OYXA 3PY8A 2ZH7A 1NK9A 4I6WA 2QIFA 1UZDA 3VWSA 1TAQA 3N9UC 1U1KA 3OPKA 2NXCA 2XI3A 4P6QA 5DZ7A 3M32A 2B43A 3CPWR 3D28A 4M95A 5A0YA 1LEOA 1TL7A 2EFQA 5F9NA 4ED8A 1T03A 3N5BA 4HL9A 2QL5B 3DN9A 5E2QA 3TX8A 4FBTA 3DLGB 3J81U 1JJHA 3LPEA 1FVQA 4GVLA 2AW0A 2XZDB 4LVNP 4ZPTR 2W2PP 3C6TB 3M2RB 4I6YA 2CPZA 2C42A 5CYMA 2Y1JA 1RAFB 4QU6A 4PG6A 1HL6A 4HH0A 4YB1P 3MPDA 4ECSA 2W7PA 1B3TA 5H9FK 3HKWA 4F67A 3KOAA 1HWLA 4IFVA 2K1RB 1Q7LB 1DBDA 2OPQA 5A2QY 5E3AA 3V4MA 2VH7A 2X51A 5C25B 1AB8A 1YRTA 2C2MB 1H7XA 2HNYA 1Y5LB 4OYBA 3X1LB 3BBFA 2QZ8A 3TQ1A 1HR0J 2IBOA 1CJTB 2GW8A 1M5OC 2NR0A 4ATNA 3RAMA 1C0TA 3KG0A 1YJ9S 1FK9B 3VGUA 4BHQA 1KLMA 4MTPA 2HFSA 4DR4F 3LTOA 1DQAA 1S1XA 3T1YJ 3N28A 4KHMA 1QUVA 4C97A 2ZFHA 4CNYA 2Q3PA 5KT3A 1SJRA 4KFBB 4TU8A 2OI2A 2HIYA 1APSA 4IRKA 2YNFB 5KT7A 2KM8B 1OPZA 3CJSA 4KSEB 1FKPA 2XZWA 2ZH6A 1VRUB 4OLPA 1VC0A 3DRRA 3VAGA 3C6UB 4IG3A 1DLOB 4OHVA 1RTJB 2HBYB 2IC3B 1IKVB 2JNJA 5DDOC 2HFOA 3ZZOA 3W64A 3KG1A 4I7FA 2J0XA 2DIVA 2Z0GA 4AUKA 4DWIA 1IUJA 4FDFA 1R0CB 3TRGA 5LM7E 3JYTB 1PKUA 5GMDA 5C5JA 5K8PA 1JXLA 2JC0A 3AA8A 3Q8PB 3EZOA 1DQ9A 2ZUGA 3C14A 1M5VC 1F9FA 2ZC4A 4W4MA 1QAIA 3OR2B 3OJUA 4Y3CA 2RKIA 2ZWPA 2ZH8A 2B4VA 1HMVB 1VOMA 1HNIB 4YHHF 1Q0NA 4X62J 4DSIA 3H40A 2BEFA 4ZCIA 4LFBF 4I68A 3VZIA 2WONA 1XMBA 5EWEA 2N7CA 5M2UA 3DU5A 4FBUA 1TVRA 4DQSA 1UMJA 1NH8A 2KO1A 2ZWOA 4FYDA 5HN0A 3J7YU 1Y0HA 3G2XA 4AQYJ 2MPUA 1PC4A 2JHEA 1R8AA 4DCPB 2BUNA 4FYWB 3CW2C 4ZN1A 2QC3A 2RS2A 2E5LJ 1K1QA 2MTLA 4K4SA 3HKZD 3SIPB 4X4UA 3CD6S 2ZHBA 2HVDA 5M2PA 5IT4A 1QM9A 4K4TA 2RRBA 5HQMA 3DRPA 2DRBA 1AZSB 5C24B 1AFIA 4TY9A 1DTTA 4B3RJ 4DZDA 1SJQA 3ENAA 3W66A 3LP1B 1KTVA 3G71S 2DR8A 1QTNB 5A8KA 3N0VA 4JV5J 2Y3YA 3MPYA 5C42A 2VPZB 4MT1A 2B4OA 1ZAVA 4KGVB 2KFZA 4B9TA 4DFMA 5C7PA 2YPZA 4N8OA 1IXKA 5F8HA 3VQSA 3OFHA 1CSJA 1UPPA 1EJ7L 4QIVA 1XC9A 3VAFA 1J5EJ 4LSNB 3PYDA 5IT9Y 1WC5A 2VQFJ 1DTQB 2ATLA 5AT1B 2KVQE 2Z4PA 2EG1A 1RT5A 2WVDA 3TUJC 3T6JA 4ZJLA 1HKAA 2DNQA 1WSRA 5IV4A 5EWGA 4Q0BA 1Z1ZA 1FRLA 3JSYA 3L09A 4HACB 5F8MA 3NWGA 2DY9A 3PIPQ 1J5OA 3UI3A 3UCGA 5GAHI 2E66A 3L7UA 1WACA 2RF2B 2OPRA 4J5OA 5FLXY 1FFWB 5KFNA 1GMWA 3AAWB 4IO1A 1UFWA 1U6ZA 4P7VA 4ZDNA 2MGZA 3Q86A 4ED2A 5C2GA 1IJEB 4AYBD 3MAQA 4ZVQB 3PEJA 3OQ2A 4FPIA 3T5KA 1UFKA 3IRXB 2C2DA 2DNKA 2Y1RI 4BWJA 2GVZB 2WCXA 1L3KA 4PXEA 1WHVA 4CIOA 3AB2B 4PYDA 4C8NA 5G4DA 4DR3F 3NNHA 5F41A 2D3O1 4UY85 2M8DB 2BACA 1ULRA 5H9EK 5EN1A 4URGA 1X4EA 2KHCA 2W9BB 4YMEA 2R7VA 2H9ZA 3D5MA 2W2MP 5ETMA 3NS6A 2VKZG 5KG1A 1S59A 2R7QA 4LF7F 3MEKA 3DLHA 3W9IA 2NYIA 3GG0A 2H4WB 1UVMA 3E01A 4ZK7M 1V9OA 2W7OA 4DR4J 2HS4A 3TAMA 2RMLA 4LR8A 2FZGB 3VCDA 3WZ0A 3H4DA 2Y8WA 4EO8A 2VJVA 5ETTA 3FKBA 1T0TV 4QWAA 3CCSS 2VPYB 1T11A 2W25A 3QATA 2XYPB 1JJ2R 3HT3A 4I0WA 3RB0A 4OJGA 3QGIA 4M8LA 1EETA 2HBRB 4HDHA 4LF4J 1R8PA 3GCXP 2RQKA 3I4PA 4GKJJ 1HYSA 1NK8A 3FBBA 3LWLA 4DV5J 4CLYA 3OXLA 5EDWA 1FJ7A 1VC6A 2XY5A 2XS2A 4DPXA 2R2TA 2YKMB 3SCJE 4PYAA 2R7UA 2D9PA 1S5ZA 1TFWA 3KMSA 5GAEU 1SQFA 1HBNA 1R8CA 2DJWA 4ZCMA 1YBAA 1HNZF 2HHVA 4Y2CA 4O4RA 4N76A 4YHHJ 1HD1A 2B8PA 2MJNA 4Y2KA 3GIJA 2KI2A 4KKOA 2FHJD 3SQGB 4LFBJ 4ZLLA 4Q45A 2ASYA 3QMQA 4RX6A 3MM9B 2CA9A 2BOAA 1N54B 3P4UB 3KDOA 1L3SA 1OWXA 2C3PA 3M30B 2P8IA 1XQIA 1FF2A 1JLGB 3G96A 4I2PA 3K5OA 4MK9A 1VQKS 2GVDA 3SV4A 1JIHA 3ZNUA 4WE1A 3CDAA 5FDLB 4M5IA 1U1LA 1NH7A 3DYAA 3IMQJ 1U2FA 2V8HA 4ES2A 2FLPA 4DPWA 4J9QA 3BPSP 1Z4UA 3CE8A 3UCUP 2HNDA 4NEZA 3WX4A 1WD6A 4OJ3A 3I9V9 2G9OA 5ETRA 4NEYA 4Y2IA 5DETA 2CJKA 4K50A 1R6VA 5KFDA 1YJRA 3TJ9A 1N32J 1S9EA 3M2VA 4DSKA 2MKHA 4I64A 2QA4S 4IR1A 4F26A 2LEAA 3HXMA 1UVIA 4LRCA 2WVEA 1XWLA 3L7PA 3U1LA 4NE9C 2W9CA 2IM2A 2HHPA 5IXUA 3HHDA 1BWEA 4NA2A 4DUYF 3NLCA 3OTOF 3FDSA 3BBCA 2HQ3A 3H0PA 1F6TA 2OHDA 4FF3A 2PO4A 4RUAA 1S9GA 4A4JA 4RJVA 3ZZ0A 3FRYA 4F7VA 3NNAA 2Y8YA 4M5GA 1N6QB 1S0NA 2R7WA 1H38A 4PRFA 1RT4B 3JXOA 1SUQB 1YRUA 1P6TA 1RAGB 2RUSA 4PXBA 3G6ES 4HKQA 4DU7A 1CS4A 2C3OA 4B3OB 1VQSA 3QQCD 3BGLA 3OR1B 3J80U 2AJ2A 2WVCA 2MKCA 4JB8B 4RUCA 3AA9A 2QV6A 3MDFA 2QN6B 4JI8F 3E3XA 4DR5F 2DR7A 1YLXA 1NU4A 4F4XA 4L3KA 5DO2A 2DGOA 2NSCA 4URQU 1RQ0A 3IC1A 2G2YA 4OZ2A 1ZETA 5KG6A 1NSKL 3PKMA 4WXWA 3DC2A 3CDWA 1RWNB 1RSCA 3GSDA 5DDQC 1VS3A 4XIUA 2BYCA 4DR3J 4JI6F 4RNNA 2R8IA 2MB0B 2K2PA 3JQMA 2PN6A 3KLHA 1MSWD 2I5JB 4I1TA 2AMCB 1SC3B 4LF7J 4NLXA 5DM6Q 1NAQA 5HVHA 4TQRA 4F0HA 3MM5B 4M1KA 3FSIA 5MLCV 2QLJB 1WDDA 1NLKL 2B9XA 3POTB 3CDUA 1JLCB 2DNNA 3S6EA 3F0NA 2FHKA 1N0UA 4USIA 1HWIA 5HMYA 3PFOA 4FS1A 1SPBP 1WTFA 2CJAA 5DG8A 1Q8LA 2KT2A 2JLEA 3JQJA 4ZPBA 3OT9A 2RIJA 1Y00A 4ZVUB 2J9EA 2DHHA 1CEZA 4ECXA 3P6YC 3MPVA 1UWAA 4GVBA 2CQDA 4H4OA 3NOCA 1S6UA 3HMJG 5L1KA 1L3UA 4WIIA 4ZP6A 3NMRA 2JC1A 3FFIA 1HI0P 1GK8A 1RT3A 2LQ9A 4EEYA 3OL7A 1U25A 1I51B 2DHAA 1L3VA 5CYQA 1FJGJ 4NXMF 3GFXA 3V6KA 3BYRA 3D67A 1FT8A 2WVFA 4Z37A 1HLWA 1Y3JA 2PD1A 1NDCA 2B5JB 2BJ1A 2CWXA 3DXSX 1MROA 3FEZA 3CJ8A 3T5JA 1V5IB 4M5DB 1HNZJ 1C1CA 1FRXA 3DMJB 2AEMA 3B82A 4QU7A 4B3MF 3MM8B 2HHHF 1BQXA 3TANA 1Q5YA 1IBLJ 4LF6J 2C2OB 4YQWA 3HZEA 1UZHA 5J1EA 3TOQA 2XS5A 1BY9A 1RTDB 2ILZA 2C3YA 5KFFA 4EZ6A 3D0IE 2VBYA 3A8IA 2HZVA 3UR3C 4QWEA 2CQCA 2QLFB 3P96A 2OEMA 4QWCA 1NB2A 2Z58B 3R5DA 1NRKA 3M8QA 1SQEA 1CJKA 3C8YA 3UQSA 3TZZA 5B0FA 2BABA 1A9NB 3EM1A 1N34F 4PPZA 3QAUA 5IZHA 3NBPA 2I1RA 3AJ1A 2IHR1 1VBYA 1U8WA 2OSQA 1RAJA 3D66A 3NGKA 1TMJA 5HVFA 1P8GA 3GLJA 8AT1B 2VDHA 4PAAA 4OJ1A 4ECUA 2DR9A 5E33A 1N5YB 1LWEA 5L1LA 2NUHA 1MN9A 3OVBA 3QZ8A 5BYRA 1F5AA 4ALZA 1ROFA 2M70A 2QMUB 4U7UD 2UXDF 3KJFB 3N6MA 3QT6A 1HNXJ 3LUYA 2AHOB 3PJXA 2QA1A 4NXNJ 4QWBA 2KYXA 2V2ZA 4L76A 1TL1B 1FHTA 1S7HA 3BS9A 3MI7X 3R5AA 1WC0A 2WHOA 3GFZA 2NREA 1MWZA 4ELVA 2FDNA 2C2NA 3OTOJ 3CULA 1IN0A 1XMOF 3T1HF 2E1AA 5B0GA 3E2EA 1B7YB 1KHWA 2MSTA 1RTIA 2AGOA 2OEKA 5HP1A 4QYZJ 4QYRA 1D8ZA 1H2UX 2QEXS 2F40A 4ICLA 1N5VA 3OFFA 2BRKA 2OAUA 5AXLA 2OFHX 2ZM6F 1SJ1A 2ZNZA 4QPTA 2CYYA 1VIXA 3PX6A 4C3MA 3VF0B 2E9ZA 1QD1A 3PEHA 4CLSA 4A8QA 2OFGX 2NZCA 4WP3A 4NI2A 2GAHC 1L3TA 4NZ6A 2RHSB 3Q8SB 3GQCA 1RISA 4YUDA 4B02A 3FSYA 2P9EA 1KR4A 1Q4RA 4DR5J 1FKAF 1X5OA 2L3MA 4ECRA 2WW8A 1UTAA 1S1TA 1SC1B 2VG7B 1Y10A 2ZE2B 2ZOFA 4ZKAA 4ZITA 1HBOA 3RBXA 1MW7A 4IFYA 2A10A 5JUMA 1WNEA 1GXUA 3RAQA 2GJFA 2FQQB 3IM8A 1RKJA 5GAEI 2HGLA 3BQ2A 2X1GA 1NO8A 1UVJA 1DFDA 4X4NA 1Y7PA 3G6VA 3R1HA 1JQGA 2ZH1A 5HMWA 3M32B 3CMES 2MLZA 4ECTA 3PO4A 3WC2A 4K4YA 3NS5A 2KYZA 2DGQA 1NB7A 5A0YB 2V2KA 2BANB 2ZBQA 3HVWA 5F8NA 1TL7B 1LWFA 3MTKA 1S7IA 1T03B 3HCXA 1NDKA 4NWBA 2CPYA 4RNMA 1BQNA 1U6BA 2CQPA 4LF9J 4P2FA 1PILA 4LMZA 3RJMB 2IMWP 5LT5A 2HVIA 1OYDA 3TJAA 2P6TA 1RLCL 1H2VZ 5FD1A 3KJNB 4CLWA 3MUMP 4R5PA 1RAHB 2V69A 3D4JA 4Q7AA 2OGUA 2CDRB 1RBOB 2Y1LB 3SFGA 1VRQC 1U0HB 1YI2S 4WFAQ 3TAQA 1ZH5A 4KHPF 3DNCA 1M1GA 3UDVA 3CVKA 3KDNA 1H7WA 4OZ1A 4IFVB 1FNOA 2G2OA 3RBZA 1KBRA 3TZWA 2HVZA 2OPQB 2VF3A 1RJJA 2HNZA 2HNYB 2A2CA 4DL0C 3MR5A 4ZVEA 3V4IA 1WEYA 1S49A 2HW3A 2FB0A 4IYQA 1C0TB 3B54A 1NSAA 4EYIB 1IWAA 1KLMB 2ROEA 2MSSA 1S1XB 5IOLA 2FHOB 2MKJA 4B3MJ 1S10A 3GJRB 4AL7A 5I4MA 3EVMA 2ADBA 5BJRA 1FKPB 1X4AA 3FGVA 4KAIA 2WAQD 4KB7A 2LU2A 2XZTB 4IG3B 2VFSA 1S6QA 9RUBA 2WBRA 4Q2MA 3BKFA 5L9NA 1WG4A 4Y0FA 1N34J 5B0BA 5F3TA 4I7FB 2X3GA 3KK3A 4KBIA 3JAMU 2LEPA 5HL7Q 3T5HA 4Z7CA 4YDDB 5AJ3F 3K7RA 4UQGA 1R8HA 3Q83A 3IG1A 3C14B 4KH0B 2AEJA 3RZAA 5IV3A 2FC8A 1XNQF 2RKIB 2V2QA 3KNGA 2K3IA 3D68A 1T3OA 2CQHA 2UXDJ 2DBBA 2IFXA 2HMIA 3EVWA 1T9YA 1CPZA 4IQXA 1I1GA 4D3GA 4C7QA 1RACB 2WONB 3ZTOA 1LW2A 5RUBA 2YX1A 1X4HA 3BGUA 1TVRB 2I8EA 3V81A 3P8BB 2LQ8A 4LSLB 3TA1A 1X9WA 4LBIA 1XMOJ 4RW9A 3T1HJ 5CQGA 4W92B 4X4VA 3PJWA 1GT8A 1VI7A 4MIWA 4FXWA 3MD3A 3UD5A 4BCAA 2RT3A 1TZ0A 3FMBA 5LXYA 2MEWA 2JLFA 2ZM6J 3I82A 2UVVA 2CJ9A 4O4GA 2EFPA 4DL7A 1PAUB 3DRPB 2G13A 4C8OA 2ZVSA 1J27A 3MECA 4LR7A 4ZLJA 1DTTB 3WX8A 2Q43A 1RTZA 1RABB 5KAKA 4Y6IA 4USUA 2EC2A 6FD1A 3P45B 4FF4A 3IGVA 2RRNA 2FC9A 2EPIA 1MMLA 2B9EA 3B6BA 4X64F 1WG1A 3ZO7A 1SKWA 5A8KB 5C42B 4WJBA 3BJYA 2DNRA 3QFWA 3TEGA 4FP9A 3CUNA 2GQ2A 3W8GA 1G1XA 1P9YA 2QL9B 4EBEA 4J9MA 2COLA 3DHWC 3FBEA 1BC6A 4OYPA 3QJJA 4Q43A 3HSZA 3OV7A 5B0AA 4RNOA 4RU9A 3MM7A 1Q82T 1RT5B 3UE2A 3UPFA 2L9NA 3HJVA 5FIIA 1ZYQA 2XHWA 3BSAA 1OSCA 3RUBL 2I0XA 3CJ3A 4PQAA 1EKSA 4HHHA 4IUFA 3M9OB 1Y9OA 4L73A 1J5OB 5F8JA 3IBWA 3I6PA 3CCRS 1H0HB 3M9MB 2OPRB 2IDEA 1XEZA 1VC5A 3JSBA 4OMFG 3F56A 2X7IA 1VDHA 2MGZB 4TKTA 3CCJS 1AW0A 2JVOA 2P9GA 5I3QA 4OI6A 3G8SA 3PRVA 3H5XA 1LQ9A 4RBTA 2CFXA 5GADI 4ECZA 1REGX 3TUIC 1DRZA 3I87A 2XLJA 2CADA 2UUCF 4OHYA 3KLIA 2WSFC 2JH3A 1UKUA 2UV8G 1GEHA 3E51A 1N4LA 1UA1A 2MKKA 1JXVA 4MKYA 4KHPJ 2U1AA 2OJ3A 1YITS 5ETOA 3EPIA 4NX9A 2BJ3A 2MHEA 3DOKA 4C0HA 2YNHA 4LBPA 5G0RA 4CLPA 4OI3A 1VHFA 2W8KA 2R2UA 1E6YA 2L9DA 1FVSA 1NJWA 3MF5A 2VD3A 1C1BB 1U4BA 4DQRA 3MPWA 3E01B 4LRDA 3EDQB 4CNZA 4B9MA 5L8RC 3FBCA 1TTHB 2DITA 3TAMB 1RYSA 1RU2A 2EXUA 4NYOA 2J7KA 4QYZK 4WYLA 4QCLA 1WF0A 4P2XA 3Q8UA 1N88A 2VBZA 4PQUA 3QAEA 3NCQA 2KFNA 1FNMA 5JJBA 1CC8A 4WP9A 3PHTA 4C8KA 1RHKB 1V3SA 1EETB 4X65F 4A48A 1EB0A 2ASDA 4Y2MA 1WHYA 3FQLA 1WHXA 3MEGA 4U95A 4KR0B 2IRUA 2AX0A 3GJQB 1HYSB 1XNRF 2V50A 5DG7A 3SSQA 1VQ4S 5SUHA 2GAGC 3K5PA 2HQCA 3HO1A 2ZBCA 1WF1A 4ILLA 4DV7F 5AJ3J 4DL6A 3EZ5A 2L9WA 1GTEA 3HLUA 1HBNB 2AJ0A 4O3QA 4BC9A 3PX4A 1C2PA 3AQPA 3HHKA 3LP0A 3H5YA 1XNQJ 5DQIA 1VK3A 3EGNA 3LAMA 3OTBA 2JFKA 4JOUA 1PBUA 3SV3A 1OO0B 3R6GB 2IYGA 2BQ3A 4XDCA 4KKOB 1RT7B 5SZTA 3HI9A 3H5SA 4RBVA 4OIXA 4WKRA 1U1MA 3TUZC 2LDIA 4I2PB 4OZLA 1MG7A 2H3EB 3Q0AA 2PI5A 1R3NA 2PA8D 2GVDB 3M8ZA 4WE1B 1HNWF 3D7SB 4NOHA 1S6PA 2C1EB 5ADZA 1XBWA 3DYAB 1ZBTA 3W60A 5EHHA 3CMQA 1SH2A 1SL1A 3EJMA 4LIRA 2EEYA 2HNDB 1QSYA 2K8GA 2C3MA 1NNDA 4PWDA 1SIWB 3RG6A 2ROGA 2KXHA 3DRSA 5DQGA 3PJ9A 5KFEA 3G4SS 3DGPA 2V9KA 3ZZYA 1S0OA 4F50A 1S9EB 5B0DA 4I6AA 2QT7A 3LP2A 3M2VB 1T94A 2C28A 2W9CB 4PG8A 1P9QC 2AYEA 4JI3F 4N47A 3OTCA 2L41A 2VFVA 3LALA 2E1CA 1U2RA 3PV8A 2OTLS 1WEXA 2AD9A 4ID8A 4PWWA 1S9GB 4J90A 1HI1A 4I56A 1DARA 3OXGA 1KOHA 1UAWA 3JTPA 2B56A 2HQDA 3TEHB 1S0VA 3BGRA 1X5SA 1FWKA 3TVYA 4K4XA 1H3DA 3S01A 1PYOB 2BA9A 5K14A 1WORA 1F9HA 2HBQB 1CS4B 1CLFA 2HHSA 3DOMA 2QFIA 3F44A 3Q89A 2WSCC 4P10A 2VPWB 1F5CA 2M3DA 2XWXA 2ZH9A 1P1LA 1XN9A 3W2WA 2N7YA 5KFLA 2FJAB 2RU9A 4KV8B 4PUOA 2GMLA 1S79A 4M5NA 1JK9B 4RU2A 2XY7A 3BR9A 2BJ9A 2PA3A 4H4MA 4X4RA 5EUHA 4ED3A 2IIHA 4ZJOA 2JZ5A 2Z56B 4M5LA 4W90B 5I3UA 5CA5A 4KPCA 2RJZA 2B51A 1H98A 3AD8C 1OJ4A 4RBUA 2EKYA 3L4BC 5LSOA 1FDDA 1U1NA 4HR2A 2FJEB 1W7WA 2N82B 1HQEB 4I4BA 4F4YA 4I69A 2B9YA 3P5TL 1UEUA 4K5SA 3OSNA 1RT1A 3K5MA 1QVGR 2ASLA 2DGWA 3A1YG 4C0OC 1SC6A 3KLHB 2AU0A 1LFPA 4YB5A 3SCIE 2R42A 3FZBA 1K9MT 2V4QA 1N36F 1PG5B 2VZ9A 1VRTA 2XB2D 5KG2A 2R2SA 2H5EA 2AJFE 4TLQA 1Q5VA 4WKYA 2JLGA 3AD7C 3N4WA 3ZTRA 4CTAA 4F3QA 3ZTPA 3T41A 3MOZA 5M2RA 3GR1A 2UU9J 2UVUA 1YJWS 3C16A 3DDNA 1FEHA 4PR6A 1VR6A 1SKRA 4DX8H 2IBKA 1U1OA 3M8WA 2HZCA 2OKQA 4GVBB 4H4OB 5D78A 1TUVA 1T9VA 4RKUC 2YKNA 3U1NA 5DQHA 4FVMA 1Q16B 1XNRJ 1GH8A 3Q23A 3PG9A 4KO0A 3FFIB 1RT3B 2IM1A 1T9TA 2Y9HA 1HD0A 3M4XA 5GMKa 4OZ5A 5CYQB 4DFJA 4DV7J 2F8EX 2OH2A 3VAHA 2EI5A 2Y0SD 5T14A 2CQ4A 4J9OA 1FE0A 3ET6A 4V1Ak 2J5AA 4YY3F 3TJ8A 3KUEA 5IWAF 1C1CB 4X66F 5LJ3Y 1XK8A 3GWCA 1R0AB 2XMJA 5B0EA 3QSIA 4WWSA 4ZPWR 3IWLA 1RA6A 2FPHX 1IR1A 3W5YA 1Z2LA 5J1EB 4P7TA 3L95X 1X4DA 5D4LA 3M6UA 1CQMA 2R7XA 3LAKA 2FY8A 2W1BA 2XMKA 5IT0A 3VAIA 3CJQA 1NPPA 1JLFA 3HULA 3M8QB 1CJKB 1OQ3A 2JVRA 4YN3B 3VVTA 5HQLA 3GV5B 1TKZA 1MU2A 4XPEA 3NBPB 2HFUA 1UW4A 1U48A 1YK9A 5AXNA 4KGKA 2VC0A 2V5HG 3K89A 3OFEA 1N48A 1S4EA 2H1YA 3BM7A 1PYTA 3KLGA 1TU0B 1LWEB 3PHEA 2CPHA 2RE1A 3U02A 1KRPA 6AT1B 1U45A 2YQ3A 2XBPA 1OMSA 1LKZA 2OLWA 4WK3A 3A12A 4LT6A 5J1NA 5LOQA 1RAIB 3BGFA 3RAXA 3CJ0A 1VCTA 3TWZA 2FJVA 4EFAC 4LBHA 2QLBB 1KHVA 3ICLA 3HVTA 2W2OP 4QWDA 5F8IA 4JI3J 3U27A 4LQ3A 2VDIA 3KK1A 5A8WA 1FI4A 1RTIB 1S72S 5HP1B 4DCOB 5T41A 1XMQJ 5GAHU 1VQYA 4ICLB 2K7JA 2J8SA 3FNNA 3W2VA 3RRHA 2O66A 2HK2A 1YQHA 5BXIA 4ZCKA 3EPGA 1HQUA 2RAQA 3LANA 2FJDB 1KTQA 1XTZA 2X1BA 2OEJA 5D77A 5KOXA 4ZP7A 1TELA 1LK7A 2KXNB 2EBGA 5E5NA 2CPIA 4CLKA 2DISA 2DNHA 5KFKA 3HHNB 5DDPC 1VIOA 3MZIA 3NY0A 2DVIA 1S1TB 3OLBA 2CPFA 1VK8A 1YX2A 5H1SV 1HBOB 4IFYB 1RUSA 4YDXA 4J9KA 2ZNYA 4OX7A 1IQTA 2DT9A 3DLBA 1SC4B 2ZBIA 1EARA 1QSLA 1NCLA 2ACYA 2Q6BA 2E5HA 3PW4A 1N5TA 5HMXA 3ENVA 4RZRA 2CAJA 1TK5A 1TQLA 4WP8A 5LMNF 4B3TF 1JMTA 1BQMB 1ZPVA 3GSIA 3MEEA 1JWWA 1SVDA 3BSCA 4WIQA 2ZKTA 3KG4A 4K0KF 2FJXA 1LWFB 4JI1J 1X5PA 2A6MA 1QTMA 5KT6A 1BQNB 5DLFA 1RCOB 2C2RA 2AYMA 2YWKA 1Y11A 3UN3A 5ETNA 3TARA 2F7VA 2Q79A 5A2QU 3CGIA 4KGXB 2NS1B 2H54B 5GAGI 1O8BA 5F8GA 1Q7YT 4CH7A 1A7GE 2QO3A 2YH1A 3MM6B 2J0WA 3UW1A 3MFHA 3BSOA 2VIHA 4CQ1A 5ETSA 2GQCA 1YJNS 2HNZB 5T7LA 3OUYA 2YKAA 3MMAA 1RWWB 2DH9A 4URSA 2VV5A 2CQ2A 3V4IB 4LJMA 2CG8A 3FSXA 1VHIA 1DJ0A 3NGRA 2QYCA 2CQIA 5B0CA 2DYAA 3B78A 3M9NB 1LFWA 4YY3J 4RWWA 4R8UB 5IWAJ 1UJ6A 4CZCA 4DX7A 4HI1A 2BW2A 3K8WA 2GFFA 4CRJA 2UVRA 4P73A 5ETQA 5D0EA 2MKIA 2VFUA 2J7UA 4HTIA 4UY8T 4K2JA 4ECVA 1Y5IB 2IY5B 2Z2YB 3WIUA 1V6HA 1O5JA 3CJ5A 1WWHA 2HQFA 1GX6A 3DM2A 4ZLNA 1ZM9A 3KKFA 1YJ7A 4ZVHA 4GKKJ 3TW0A 4TVAB 3AH6A 4DV0F 4R0JA 1S6QB 1DQ8A 4CYUA 4WU3A 1BE4A 3VGTA 2O01C 1YHQS 1VQOS 1BMQB 1OY6A 4JI0F 5LSLA 4ZP8A 1TKTA 1VISA 4DN9A 3W62A 3RTVA 5AXMA 3KK3B 3R97A 3CXCR 4OYZA 3PRDA 1M5KC 3QIPA 3I0SA 3B8HA 1WOPA 2CJYB 4Y28C 2V63A 2ERRA 1KN6A 1F0XA 4DPUA 4HI2A 2HBZB 1IKYA 1HBUA 5DDRC 3TVKA 4LFCF 3VTIA 2N4CA 2GJ2A 2Q6CA 3FMWA 2HMIB 1X60A 3U1MA 2KKHA 2D7SA 2M0GB 3BO3A 3C15A 4B3SF 4C6AA 4E2FB 3DLEB 4WFXA 1FXDA 1LW2B 3THVA 3CJRA 3V81B 1RAEB 2CQ1A 4YR2A 4LVOP 4TU9A 5B7WA 2HEKA 1KVKA 4RW9B 3EGZA 2GIRA 1RWXB 2H51B 2V67A 2MXYA 2GMHA 3BQ0A 1NM2A 3AXKA 4I2QA 5GVQA 3N01A 2HFZA 2CJXB 1RT6A 2AZ1A 3IP0A 4A8SA 4ED7A 3ZC4A 2RQ4A 3MR6A 5A8RA 1QE1A 3EE3A 3VHQA 4KTQA 3MECB 2BJDA 4KGZB 2WB4A 4ZVRB 2HQGA 1UPMB 3PNIA 2HS3A 4N5SA 5KG0A 1JXEA 4NRTA 2ZKUA 4P72A 1QUPA 3ENQA 1U6FA 4M94A 3DKDA 3BKTA 5IT9U 2YKPA 3UR0A 3R7BB 2LLZA 3ZTQA 3SCLE 4KHRA 1K73T 4CCHA 2HG4A 3G6YA 3L3CA 2XO7A 1RAOA 4FNIA 2MKSA 3DU6A 4LUBA 2B6AA 4X4SA 4PXCA 4BDPA 1KS2A 2J9DE 2A18A 3SEOA 1KQSR 4NYPA 4AD6A 3I0RA 1REVA 4UOFA 3CJTA 2DHXA 1NKBA 3DLKA 2D3UA 3G86A 5KT4A 3MM7B 2JEGA 4GO5X 2E5IA 4FS2A 3DCAA 3TR5A 4E98A 4HT7A 3DDKA 1HWJA 2OP5A 4ZA1A 1SXLA 3HDSA 5E0OA 1N0VC 2Z57B 1YG0A 5HBMA 3BGOP 5LMNJ 1VQNS 3GU0A 2RS8A 2XMMA 4JP8A 3UNYA 1HHQA 2SXLA 1UVKA 1VBXA 3GFYA 5F0WA 2E1PA 1EHWA 2B3TB 4K0KJ 2CNNB 3MAAA 4ED5A 2GQQA 3IGNA 4OYWA 3F73A 2DD8S 3HSDA 4RUBA 1SIZA 1EIYB 3QZ7A 1EQ0A 5EWFA 2VG5A 1K0VA 2MHNA 3M05A 4G6VB 1JJ4A 2B7CB 1FKOB 3PXGa 3VR1A 2UV8A 4NRUA 1YJVA 2XWYA 3I55S 3TYTA 4P2MA 4UOCA 2HRYA 2JWNA 3V6DA 1H72C 2X3DA 3I4HX 3K58A 3KHLA 5K8MA 3FEXB 2RUGA 4O3PA 1N33F 3PRBA 4QR0A 4U6PA 4LSZB 3DOKB 3IR7B 2CKWA 4DV4F 5L46A 3CMAS 2YNHB 2CRLA 5G0RB 4DR7F 3VAMA 1E6YB 4YEAA 4AL6A 4C8MA 3HK2A 4NASA 1CJVA 4HHJA 1OPIA 2APOA 1NUEA 5CZXA 2XSJA 2XLIA 4QZVB 2M5YA 3EGWB 1FTCA 1S12A 3JSRA 1KOOA 3H98A 1G4CA 3H25A 3MOJB 5CAAA 3C3LA 2PFDA 4C48A 3IRWP 5HJYA 1Q86T 2VODA 3QNWB 2EFOA 1PAEX 1RWUA 2MYFA 4IG0A 1F3FA 4GO7X 5DS7A 2RDDA 3QLHA 4LR9A 2EFVA 3MUVP 3CCUS 4PQUB 3GIRA 5E3CA 2HHWA 3L7OA 2IMOA 2YX4A 1UEKA 2PDAA 3AOCA 4A8FA 2NUUG 3DRYA 1S4FA 3MEGB 1BLUA 4ZPVR 4FYVB 2DPJA 3SQGA 2W8LA 2EC0A 5KFRA 2AWZA 4RW4A 3NWRA 1U49A 3QFHA 1QLNA 2MLXA 3G6XA 2RILA 4OZ3A 3EWGA 2LFVA 1HARA 4WCEQ 3KLFA 3UDLA 7FDRA 2DGUA 5U47A 2UUBF 3O3LA 4JV0A 3KYLA 3N6NA 1ZTTA 2DCUB 4LFCJ 2PGCA 2F8MA 2PE8A 4CT8A 3OL9A 3OHAA 2RQMA 1WDTA 4D3HA 3PKYA 3OTEA 3BR8A 3W63A 3H42A 1RZMA 2QYGA 4B3SJ 4LRBA 1PJ6A 2AKWB 3BREA 1IKXA 2DNLA 3I32A 4NLDA 1U09A 1FFGB 4JI2F 1BWVA 2VFTA 2F65A 3LGMA 3PW5A 4IOCQ 1LNQA 1CG2A 5KG5A 2J6TA 4Z2XA 2AIRB 1YJTA 4KH1B 4MKAA 4OYIA 1S6PB 2QA4G 2ZITA 3ILOA 3EYZA 4DQPA 4WPAA 4IOAQ 4YS2A 4ZIWA 4DX5A 2AYBA 2IA0A 4KRWA 5KFYA 2UXCF 1LXJA 3S1TA 4EUVA 1LV5A 3GJSB 3OL6A 4P75A 2F5GA 4PWDB 3MD1A 5D6GA 3S8SA 2ZZTA 2YXLA 3DRSB 3LH2S 2UP1A 2FTRA 3H7HB 2DNOA 4LF8F 3KJQB 1WKKA 3DGPB 1Q8BA 3H2VE 2P2CB 1NJIT 3LP2B 2MQLA 3EICA 3BBBA 3LPYA 1NHVA 1NK6A 3CNQP 5L1JA 2FGOA 3JB9k 2PMWA 4F36A 1WC1A 1G2EA 4MK8A 4NLRA 2NYHA 3HJFA 1R89A 4OZNA 1JLAA 4O3OA 2BDPA 4C3KA 2DY1A 3BGRB 4CI0B 2RRAA 3LGNA 4DCJB 1JNRB 1ZA2B 2B4PA 5K14B 1RWPB 3WDOA 3DOMB 2Z8QA 3E8OA 5ETLA 1GMVA 3FEYB 4V19J 3W2WB 2K06A 2KZZA 2DO0A 3P5BP 2I2YA 4PUOB 1FDAA 1S77D 1H73A 2JFDA 1VYAA 1KVIA 3CIZA 4H4MB 2B9WA 3DFEA 4M5MA 1WI8A 2DXDA 5I3UB 3W3SA 3ISNC 1PGZA 3GIMA 4DQIA 1BXNA 2NXUA 5D15A 3I5CA 4BS2A 5HI7A 3CJKA 4DDFA 3TAPA 2GHWA 2B0GA 2BZ2A 2RU3A 4LIWA 8ATCB 2WBMA 2V8VA 2R8GA 4B08A 1NPRA 5E7OB 2C3UA 2DRAA 2R8KA 2CJQA 3M6XA 2R7RA 1V3ZA 1Y5NB 4QIWD 3MTJA 1N33J 3G8TA 4A8KA 3A4TA 3H5UA 1YZ6A 1KSPA 1VMBA 4OJHA 3GMGA 4DR7J 2BVZA 4QR1A 3DOLA 1MN7A 3CC2S 1VRTB 4OLOA 4TNOA 2LXIA 3BV8A 1LW0A 4B9VA 1URNA 1AXQA 4F0KA 2DGVA 2V4RA 3PFEA 3RGIA 2E7XA 2B5JA 1HQ2A 1B99A 5AE2A 4OYMA 3C16B 5IQQA 1RWOB 3T1YF 3U7JA 3G87A 3K2YA 2IJNA 5L39A 3ISND 3I31A 4A8YA 3BYPA 3BH6B 2ZHOA 4N8NA 4OHWA 2YKNB 4IRCA 2F9DA 2FUG9 1HHTP 4F2SA 3RR7A 2JRSA 9ATCB 2QSFA 3MCSA 4CLZA 4C4WA 2QSWA 4NLGA 4AXJA 2EK1A 1OQ6A 4C0BA 1URRA 4UUWA 4NLWA 4DUZF 4R0EA 2JDJA 4Q5VA 4BLGA 2AQ4A 2CNOB 3N5FA 3R2CJ 1BHNA 5EX0A 4BBYA 4JBCA 3ET6B 2E9RX 4BWMA 3OBIA 1T9XA 2QX0A 2BRLA 2EBEA 2FVSA 3HX9A 2OD6A 2M4MA 2KG1A 1GXLA 2QA2A 4KJIA 2F3JA 1F3VA 3A3OB 2YKQA 3CTRA 2KHDA 1D09B 4TYBA 2YNIA 2JEIA 4KIAA 3ZZPA 4DN0A 3MCNA 3CCQS 3W5XA 2V2VA 1PCAA 3C19A 3EVOA 3IFEA 4ZIVA 4F04B 3QRRA 4O0IA 3EXCX 3R1LA 3SYZA 1RLDA 4RO0A 2R9LA 3LO3A 5F3ZA 3VZHA 1X9SA 3QGGA 1JLFB 5HAOA 2KDOA 1HWUA 1MU2B 1QAYA 2WZ1A 3R6LB 4AQYF 4ANEA 2HURA 2LP4A 5KFOA 5EGYA 2UXCJ 2F9JA 3RU0A 2YWHA 5KFQA 1PO6A 5KTQA 3RW6A 1VQ7S 3KLGB 4DU8A 1VQ8S 1S1WA 3R5BA 2ZHAA 4JV1A 3SCKE 4P9SA 5IC6B 2AEFA 4WTOB 3D1QA 3GPAA 4WFYA 4LF8J 5C2CA 3PW2A 1VQ6S 3CCVS 5JVGQ 3WQPA 1RADB 4KQZA 4DZ6A 4CH0S 2HWTA 2QGFB 3A8KA 3MWBA 2IVFB 4G1QA 2GS8A 4NLUA 5I42A 4ENOA 3HVTB 5KFPA 4XAKA 1RTHA 3KK1B 5A8WB 2DIUA 1IBCB 4ZVPB 1F9EB 1IJFB 2AYGA 3HHLC 4WK1A 4ZOSA 2C2KB 3KHRA 4KT0C 1GFWB 5CCMA 2YWWA 2YVSA 4LRFA 1J5EF 2E1MC 1M5PC 3P49B 1AUSL 3R7SB 3D3CJ 3W2VB 2ADCA 4DSFA 2F4VF 3SBMA 5KFJA 4U8YA 1HQUB 5B08A 2F8HA 1DHMA 1FXLA 4DF4A 2P9CA 4CO1A 3IR5B 1TKXA 4OX6A 1FESA 5GADU 2BANA 1X7VA 1ZA1B 2EWHA 3FBFA 4B9NA 3ITHA 1IM4A 1MWYA 4M5KA 1D3WA 5K5MA 2PIIA 3ZTSA 3HPOA 2HFVA 4F3MA 3GB0A 3TA2A 4ILRA 4U7CA 1IBKF 1U8SA 8RUCA 3HZGA 3CD7A 3J7A1 4PG7A 4K4ZA 2GGPB 2J0QD 2F4FA 3H20A 2OO4A 1B4SA 3HHLD 3CEDA 3QT7A 4NZ0A 4MAKA 1U0HA 1S1UB 2MZJA 2GV1A 3KHGA 4F02A 4TY8A 3MEEB 4DUYJ 1U02A 2FLLA 2G0CA 2R4FA 1OY8A 2UUWA 1WG5A 2XNRA 1XR6A 4OI2A 5K20B 2DR5A 4HH1A 4J9VA 2ZDOA 2MQPA 2V4JA 1FRIA 4B17A 4FVCA 4DJBA 1ZZNA 1U24A 1EP4A 1R31A 2DK2A 3PW0A 2DNGA 3NP5A 1M1HA 1FRJA 1KD1T 2N4DA 2XM3A 3UFCX 3D3BJ 3MMBB 3R5GA 4HLBA 1F1BB 1DY3A 1KQGB 5J2PA 1CC7A 5D3GA 2XO6A 2H48B 4LQ9A 4Z7YA 3A3NB 2OMOA 1PJ7A 1TV6A 1UJ5A 4JI8J 2O5DA 4K8RA 4O3SA 1KNZA 4LF4F 2V9WA 5KFHA 1D0EA 1FWPA 5T7LB 3OUYB 3FUYA 3OVSA 4GKJF 3MMAB 4OV6A 3DLLQ 4DUZJ 2BJEA 3IR6B 3FRZA 1CVJA 2UXBF 4DV5F 4UW2A 3DXBA 2H5IB 3ZZTA 1UJ4A 4MFBA 1I3OB 5KFXA 2MDAA 4Y00A 3D0HE 3BDPA 4Q8FA 1T9UA 5E3QA 4DPYA 4QBUA 4JI6J 2NPFA 3BDEA 3HFKA 3KNAA 2XI2A 2ZOMA 3J81Y 1BD6A 3UO0A 2P6SA 3UD4P 4RLEA 3EX7B 1AT1B 3SI8A 1WEZA 4LF5F 3THPA 4RR5A 1OS5A 2ABYA 4UUXA 1NKEA 3DM2B 1X4GA 2DXFA 2XMVA 2RB7A 3D6TB 1RE1B 1CBKA 2M8HA 3ENWA 2RVJA 2DTJA 2XEXA 4CYUB 2KRRA 3LWMA 5JXSA 1O6XA 3Q24A 4LSLA 3IS9A 2E29A 1TKTB 5CYMB 3J7Z5 1HNVA 3NGTA 2R7SA 3AJ2A 4DEZA 3QIPB 1U2CA 2DNPA 3I0SB 1S76D 2JSXA 3PCOB 2GO8A 3P3DA 2HSEB 1IKYB 5KT2A 2W2QP 1HBUB 3SMZA 4Y2AA 3QWUA 3ZZZA 1CJUA 3KUGA 1D9DA 2HK3A 4OX8A 1JLEA 2HWHA 4UOGA 4F4AA 1WKLA 2BW7A 3C15B 2A6OA 1TL3A 1OIAA 5IM0A 4NXMJ 3OXFA 3L9ZA 2AT1B 4C9DA 1N32F 3VGSA 3VVUA 4A46A 4UQTA 2A2DA 5KT5A 3KFWX 4P52A 2D74B 1HFEL 1H6KX 2VU5A 1WSVA 1FD8A 4JYAF 2N3LA 3O2IA 3PVXA 2LA6A 3Q22A 4I2QB 1FA0A 4IDKA 2HHHJ 1RT6B 2IJRA 1IM6A 1ITPA 4AT1B 3CB4A 1U1RA 5A8RB 2VKRA 1QE1B 3HSGA 2F4VJ 3KJVA 1YGYA 4BC7A 1M5SA 3DRRB 1KFDA 3QO9A 4NCGA 3K17A 3KHHA 4ZHRA 3G9CA 3EZUA 3GILA 3UVJA 4A8MP 2J6UA 3R2DJ 3ZZUA 3T6BA 3HD2A 4OL8A 4OV1A 4IKAA 4F4WA 4TLRA 1JNZB 3R27A 4OHXA 1LWXA 5J2NA 2R7TA 1TR0A 4YOEA 1SJ3P 3ILJA 2B6AB 3K8VA 1EQMA 1QAJA 3LA0A 2G0IA 1SI9A 4C8YA 2DH8A 2PT0A 2ZH4A 1IBKJ 1E6VA 1TKDA 3I0RB 4NA1A 2DGSA 3D0GE 1REVB 2HFNA 4ETZA 1U0SA 2H65B 3ADAC 3DLKB 4PG5A 3T9ZA 2F1FA 3MMCA 4B9UA 4MH8A 4OZJA 2CG4A 4O3NA 1H74A 1ZZFA 2FLOA 2V8PA 4MYTA 4EO6A 1J2VA 4DHVA 4OI0A 4H4KC 5HROA 1TAUA 4N77A 2WVBA 5HBMB 2BE9B 5LJ5Y 2KM8C 3EXYA 3K57A 1NHKL 2J76E 3NMAA 2EK6A 2MZRA 1G7CB 4DF8A 3CC4S 2K7KA 2CZ9A 3MAAB 1TFYA 1VJWA 3SDEA 3THTA 5DLGA 4NLQA 4C2MA 2DGTA 3VAJA 2FHMA 2HRUA 1NXIA 3CDEA 2KL8A 2YWEA 4J9UE 2VG5B 1ZTWA 3KMQA 1W2BR 1C1BA 4F25A 1FERA 1T02A 2E7WA 1OSDA 4NLYA 2HZAA 1HI8A 2FGCA 1I6JA 1YVFA 5L9XA 2HAIA 3AQOA 5CH7B 4EBDA 3UN2A 4L3NA 4L6V3 3ONQA 5K8OA 3GYGA 4CT9A 2RDIA 3CCTA 2O67A 4USWA 5KFVA 4J37A 3R5JB 3V6DB 4USMA 4USJC 2CPDA 2E7VA 3TUPA 1HWKA 4CO0A 2C22A 1MWQA 4C8ZA 1A6LA 4ZN3A 4QW9A 1RHQB 3TZXA 4WZMA 4NLVA 1CULA 2XLKA 2GHVC 3K59A 1CJVB 3WBZA 2UXBJ 5L1IA 2MLYA 2XSJB 1SL2A 4FXDA 3CD0A 1DURA 3MPUB 4J91A 1S0MA 1FJGF 3CC7S 5LXRA 4WTYA 3AJDA 4WFNQ 4Q0BB 3AHPA 3BN4A 4FYXB 4CLLA 2EVZA 1HA1A 4IG0B 3D1HA 4FF2A 3QLHB 3MR2A 1O0PA 2HYIB 1SV5A 2NXJA 4DS5A 3O44A 3PR4A 4LF5J 1KLNA 1T95A 3OVAA 2VONA 4M63A 1AROP 3OD2A 4W98A 4QIFA 3OHBA 3KLEA 1UWBA 1ZS6A 1IBLF 4LF6F 2W4CA 1RT7A 3H4BA 4X84A 1XERA 1HW8A 2BE2A 2RH3A 3MFIA 3I5BA 4RW4B 2WSEC 3FJ2A 4MKBA 1FJEB 3BO2A 1VQ5S 4UZCA 4U7UK 2OPSA 2OIHA 1T3NA 2XC9A 3G82A 4CWBA 3MCMA 3UDEA 3SSRA 1RHMB 2LMIA 3AOBA 6FDRA 3KLFB 2MQNA 2WW4A 5IC4B 3MEDA 2RDJA 1JX4A 1B0TA 3TA0A 2ZZNA 1Q1KA 4K4VA 4UF4A 1VBZA 4OZ0A 4QIEA 5J2QA 4R25A 4F8RA 3PDNA 3GFHA 3Q8RB 2X1FA 3CF5Q 4OI1A 4DR1F 2XG8A 3NAIA 4G65A 1UVNA 4HTJA 4FKXA 3SZ2A 2BJ8A 4ES3A 1IKXB 1HNXF 3M2UA 3MMJA 4NXNF 1KDNA 4DV3F 3DLJA 2D9OA 4G1IA 4LREA 1UETA 1UFLA 2XTJP 2KN4A 4JYAJ 4HHUA 2XMTA 2KG0A 2YBVA 3LW5C 4DV6F 2GJIA 3VGVA 2L48A 3T19A 1RWKB 1LWCA 4ZPCA 2CZVC 1SH0A 1NZ8A 5JMNA 4CLUA 4ZMMA 3M8PA 2HQIA 4CO5A 4EGLA 2Q66A 4RWXA 3I5AA 2YQ1A 1RWMB 4YB7A 3RBEA 4WYWA 4C11A 1YBUA 2CPXA 3CT9A 2U2FA 2DCLA 2IVMA 2RD5C 2XCAA 4ITSA 1PC5A 1YWXA 2JEFA 1NJYA 2A3JA 4Q2LA 5D0HA 5AE3A 4KV8A 4ED1A 1M0SA 2IRXA 2G1HA 1UP1A 3AT1B 1FXRA 4DG1A 1D8YA 3AB4B 2NZ4A 1F2GA 4DFKA 3BB5A 4DPTA 1JLAB 1X31C 3DI6A 3QWPA 2OPPA 3NKYA 1KONA 2CQGA 4J9SA 5A6PA 3DHXA 4QR2A 1HQEA 4KYZA 3MCOA 4E8UA 2VA2A 4IO9Q 2AJQA 4ZVFA 2I9SA 3GONA 2V34A 3IXQA 1WKJA 4TQSA 2IA6A 2CPJA 4ZVOB 1X4CA 3R9LA 1C4CA 2NPIA 2QLWA 2YY3A 2YWFA 5GAGU 1G3OA 1FE4A 1U26A 2MQMA 1HHSA 5HATA 3N79A 3KK2A 3WHIA 4PXDA 1VQLS 4RUHA 1Q8IA 3HD1A 1IQZA 5BR8F 2AGPA 3V6JA 4LF9F 4CLTA 2WTFA 4WZQA 4F4ZA 2NXEA 2AGQA 3OLAA 1TMMA 3CJKB 4QW8A 5HLFA 5KFSA 3J7YI 3HT0A 1NPKA 3IO1A 4MIBA 4DXLA 2WB1D 1PSDA 2B8QA 2YTCA 4P2SA 1RT2A 4J7CA 2QL7B 4X64J 2O1PA 2O3DA 3IWXA 2M88A 2BMBA 5D4OA 3VAKA 2QMXA 3MHYA 3ILIA 3D9BA 2MY8A 1JB0C 1AA1B 4ZVSB 3IA0A 1SQGA 3Q8QB 4K5RA 2BX6A 2V0NA 1B64A 3BN7A 3DOLB 2LECA 4NLSA 2EFGA 4KPYA 2C2EA 3J80Y 1LW0B 4OHZA 4EI2A 1TL5A 4IRDA 2RSQA 4G1PA 2QTWA 3RRKA 1MMDA 3HSJA 1SB6A 1WC6A 4KY3A 4DFPA 3DDIA
chains in the Genus database with same CATH topology
2QRRA 5CHCB 1LW2A 2YX1A 1X4HA 3BGUA 1TP7A 2ZOGA 1QLNA 1TVRB 3G6XA 4TU7A 2I8EA 2LDYA 2PMHA 2RILA 4WU2A 3V81A 4EU0A 3KLVA 4DMZA 4LSLB 4ED6A 4WFBQ 4DR6F 3TA1A 1X9WA 2HHUA 1HARA 4WCEQ 4RW8B 3KLFA 2A1BA 3UDLA 4QOTA 7FDRA 4RW9A 2DGUA 5CQGA 5U47A 4W92B 4JV5F 4X4VA 2UUBF 3PJWA 1FRHA 1GT8A 1VI7A 2CQ0A 4RW6A 2MQQA 2VL1A 1R0AA 2FLNA 3O3LA 4JV0A 2BM1A 3N6NA 3KYLA 1ZTTA 3H8YA 4MIWA 4FXWA 2DCUB 2PGCA 2F8MA 2PE8A 3MD3A 4BCAA 2RT3A 1TZ0A 4CT8A 3FMBA 5LXYA 3OL9A 2W7AA 3OHAA 2VG7A 2LKZA 3QIDA 4DV1F 1R27B 1G6BA 2RQMA 2VA3A 4DL5A 2HWIA 2J9DA 1ZM4A 1IKWB 2JLFA 4D3HA 3PKYA 2VG6A 3JSMB 3I82A 4IQMA 2ZE2A 2UVVA 4DQQA 3OTEA 3BR8A 2CJ9A 2KT3A 4O4GA 2EFPA 4DL7A 4DL2A 3DRPB 2G13A 4NZ7A 4C8OA 2VQFF 2MMYA 2ZVSA 4CO2A 1JKHB 2GHPA 1MMNA 2MZSA 3MECA 4NYZA 1DTTB 3BREA 1IKXA 2Q43A 3CO9A 2DNLA 2HIQA 3I32A 4NLDA 5KAKA 1U09A 4Y6IA 5CZVA 1FEEA 6FD1A 3T1AA 1P27B 4FF4A 3IGVA 2RRNA 5A6WA 3UWTA 3HHLA 4JI2F 2FC9A 2IAJA 3PY8A 2EPIA 2KXFA 1MMLA 2ZH7A 1NK9A 2VFTA 5E3PA 3LGMA 4I6WA 2QIFA 3PW5A 4IOCQ 3VWSA 1TAQA 4X64F 5CYJA 4ED0A 1K8AT 1WG1A 3GE9A 3N9UC 4K2XA 1CG2A 5KG5A 2V8DA 2J6TA 4Z2XA 1SKWA 5A8KB 1U1KA 3OPKA 4MYUA 4ELTA 2D1CA 5C42B 2XI3A 4P6QA 1YJTA 4WJBA 4QQBA 3BJYA 2DNRA 3M32A 4MKAA 1S6PB 2QA4G 4FP9A 2B43A 3CUNA 3CPWR 3D28A 4M95A 2GQ2A 2UUTA 2ZITA 3BZQA 3EYZA 3NGDA 4DQPA 1G1XA 5A0YA 4DBQA 3A8EA 4EBEA 4J9MA 1BGXT 4IOAQ 2AYBA 2IA0A 2COLA 3DHWC 1T05A 4AL5A 4KRWA 3BQ1A 2YNIB 2EFQA 4KGMA 1BC6A 5KFYA 5F9NA 4ED8A 2UXCF 3MURP 1LXJA 3S1TA 4EUVA 1T03A 1LV5A 3QJJA 3OL6A 5KFIA 4Q43A 2LXFA 3N5BA 3OV7A 4PWDB 3MD1A 4HL9A 3DRXA 5D6GA 1JLQA 1VFJA 3DN9A 5E2QA 3TX8A 3S8SA 4FBTA 3DLGB 5B0AA 4O44A 4RNOA 4RU9A 3DRSB 4ELUA 1JJHA 3LH2S 3MM7A 2UP1A 1Q82T 2FTRA 1FVQA 1RT5B 3UE2A 3UPFA 4NPOA 2AW0A 4LVNP 2XS7A 4ZPTR 2L9NA 2DNOA 4LF8F 3ZZRA 3K0JA 3C6TB 5FIIA 2HPUA 3M2RB 3SXLA 1ZYQA 4I6YA 2XHWA 4CH1A 1Q8BA 3H2VE 1S1VA 1F60B 1OSCA 2CPZA 2C42A 3BSAA 3Q2SC 5CYMA 2Y1JA 1NJIT 4QU6A 3LP2B 1UA0A 4PG6A 1XR7A 1HL6A 2I0XA 4RW7A 2MZTA 3CJ3A 4JI7F 4PQAA 1RI7A 4HH0A 4ID5A 4YB1P 4IUFA 4ECSA 3M9OB 1Y9OA 2MQLA 2W7PA 3LPYA 3HKWA 4ZLPA 1NK4A 1J5OB 2OTJS 2LQ5A 1NHVA 4F67A 1YTYA 5F8JA 2WOMA 1NK6A 2R2RA 4X2BA 5L1JA 5J2MA 1S6OA 2FGOA 3JB9k 3KOAA 1HWLA 3IBWA 3I6PA 3CCRS 2YNGA 1X8DA 1H0HB 2PC6A 2FD2A 4IFVA 4Q44A 2K1RB 2FJBB 3M9MB 1Q7LB 4E0DA 4J9NA 2OPRB 1VC5A 1XEZA 1DBDA 1S1WB 2OPQA 3JSBA 4OMFG 2VH7A 2X51A 5E3AA 3V4MA 5C25B 5A2QY 1G2EA 3F56A 1Y3KA 1QJHA 1N5QA 1YRTA 4MK8A 4NLRA 2R8JA 1H7XA 4B9SA 3M1VA 3HJFA 1R89A 4OZNA 2HNYA 1JLAA 4O3OA 2BDPA 4C3KA 2MGZB 4TKTA 1Y5LB 3CCJS 1AW0A 2JVOA 2P9GA 3X1LB 5I3QA 4OI6A 3G8SA 3BGRB 4CI0B 1LK5A 4DSEA 2QZ8A 4C8LA 3TQ1A 3H5XA 1LQ9A 2VBXA 2RRAA 3LGNA 2IBOA 4RBTA 2CFXA 3ZFVA 4WXOA 5GADI 4ECZA 2GW8A 1JNRB 2B4PA 1M5OC 3TUIC 2NR0A 5K14B 4ATNA 1DRZA 3RAMA 3I87A 1C0TA 1C0UA 3KG0A 3QPIA 1YJ9S 2XLJA 1B0VA 1RDRA 1FK9B 2UUCF 4G1QB 3GIIA 2W9AA 4BHQA 3WDOA 1KLMA 4OHYA 4MTPA 5L38A 2Z8QA 4DR4F 3KLIA 2WSFC 2JH3A 2KJVA 1UKUA 5I42B 3E8OA 2UV8G 3AY0A 3E51A 1N4LA 4EZ9A 4WF9Q 1DQAA 1S1XA 1UA1A 2MKKA 3FEYB 3N28A 4MKYA 2IJFA 4KHMA 1QUVA 4V19J 2U1AA 4C97A 2ZFHA 3W2WB 2KZZA 1RTHB 4CNYA 2Q3PA 1MROB 2OJ3A 1YITS 5AXKA 3RRGA 5KT3A 1SJRA 2DO0A 4KFBB 1NKCA 4TU8A 3EPIA 2I2YA 1APSA 1GX5A 4NX9A 1ZAWA 3C66A 4IRKA 4PUOB 2MHEA 2YNFB 3DOKA 1FDAA 1S77D 1U47A 4X4OA 4C0HA 5KT7A 4ERDA 2KM8B 2YNHA 2JFDA 4H54A 5G0RA 1KVIA 4OI3A 1OPZA 3CIZA 1VHFA 4H4MB 4KSEB 2W8KA 2R2UA 1E6YA 1FKPA 2B9WA 2JJ4D 2XZWA 2L9DA 3DFEA 1FVSA 1WI8A 2ZH6A 1VRUB 4OLPA 1VC0A 3DRRA 1RKIA 3C6UB 4QIGA 3VAGA 5I3UB 4ECYA 3ISNC 1NJWA 3MF5A 3W3SA 2VD3A 1JLBA 1PGZA 1C1BB 4IG3A 1U4BA 2XSFA 3KTQA 3GIMA 1DLOB 4DQRA 4DQIA 4OHVA 4NL5A 1RTJB 3MPWA 2NXUA 5HMZA 3E01B 5KFGA 5K8NA 2IC3B 3I5CA 5HI7A 3CJKA 4BS2A 4DDFA 3TAPA 4CNZA 1VQPS 2GHWA 4B9MA 5L8RC 1IKVB 2B0GA 4DL4A 2BZ2A 5DDOC 2RU3A 2XMWA 4HYKA 2HFOA 2DITA 3TAMB 4LIWA 3ZZOA 2WBMA 2V8VA 1RYSA 2R8GA 3KG1A 4NYOA 2J7KA 4I7FA 2J0XA 4B08A 1HBMA 2DIVA 4WYLA 4ZP9A 1TKXB 2Z0GA 4AUKA 5E7OB 4DWIA 1IUJA 2C3UA 2R8KA 2DRAA 2CJQA 4QCLA 1HPZA 3M6XA 2HLTA 1WF0A 3TRGA 2R7RA 1V3ZA 3JYTB 4XPCA 1Y5NB 1BQMA 4QIWD 3QGPA 1N88A 2AP6A 3MTJA 1YRXA 3G8TA 3I56S 5C5JA 4A8KA 2VBZA 5K8PA 1JXLA 3ULHA 2JC0A 3AA8A 5KFZA 3Q8PB 4PQUA 1DQ9A 3QAEA 3NCQA 3H5UA 2KFNA 2ZUGA 1KSPA 1FNMA 3ITHB 1CC8A 5JJBA 1VMBA 4OJHA 1M5VC 1F9FA 2ZC4A 3GMGA 3GIKA 2ZDPA 1QVFR 4C8KA 2ZD1A 1V3SA 1QAIA 1EETB 2BVZA 3OR2B 4IH7A 4NLOA 3OJUA 4QR1A 4X65F 4A48A 3CCMS 4Y3CA 3DOLA 2RKIA 4DPOA 2ASDA 4Y2MA 4MMOA 1WHYA 3FQLA 1WHXA 3MEGA 2ZH8A 1D9AA 2B4VA 4KR0B 1HMVB 2IRUA 1VOMA 2AX0A 2GIQA 1VRTB 4OLOA 5KG4A 3CC2S 1HYSB 4TNOA 1XNRF 1HNIB 4YHHF 5DG7A 1MNEA 3GYXB 1P1TA 2LXIA 4DS4A 1IBMF 1LOUA 1LW0A 1WELA 3SSQA 4B9VA 3T9NA 1VQ4S 5SUHA 1URNA 1AXQA