1U2HA

X-ray structure of the n-terminally truncated human apep-1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
KAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aortic preferentially expressed protein 1
publication title X-ray structure of engineered human Aortic Preferentially Expressed Protein-1 (APEG-1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 19
structure length 96
sequence length 96
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u2hA00
3GBLA 3WEXB 5CGYC 2R9HD 3K4DA 4JGMA 4X0KB 1U8HA 4YHZH 1IRAY 1DQMH 2QBWA 2UWEB 5FEBA 4WNQB 1I1RA 3IETA 3HZKA 2VDKH 4R0LA 2X7LA 4QHUB 2VL4A 1KUMA 1FN4A 4I8DA 4MD0B 1WEJL 5DMIL 4EDXA 1KIRB 5BV7H 1GGCL 1XIWC 3PNWB 1WZ1H 5D1XA 1VGKA 1U8NB 4N0CC 4Z6AT 4LAQH 3VXSA 4HC1A 4WHDA 4MJ6B 4WWKA 5DJYB 4WI4A 2V5MA 4G6AC 2NY6B 3QUMB 1NCWL 4RIRA 2Z35B 4XBPA 5TDPA 1NBVH 2PW1B 4KH2A 4AH2A 2C7UA 2ICCA 2MWCA 4MQ7B 3TBSA 4XPGL 3VFPA 4HKXB 2KDGA 5D2LF 2NY7H 5C6WH 3DVFA 3PF2A 4HWNA 4JPKL 3DGCR 2PO6D 2FDBP 4Q0XL 4NQDA 3SHSA 3QO0A 5IWLC 3U0PA 5IV2A 2F19H 2VC2L 5D7LA 4KI1A 3D39B 3CMGA 1QSFD 4DZ8B 1XF3A 4IIQC 1DBKL 1RVFL 4MZ2A 1MIEL 3IF1A 4PJGF 2DM3A 4IDLA 1VB9A 1XF3B 2CPCA 3RZCA 1RHFA 2P24A 5HYSA 3WL9B 1HHJB 1JIBA 3PV7A 2EYSA 3U1SL 4PJDF 3G04A 1DBML 4JHBA 5C0IA 4WTWA 3CVHB 4BFIB 2FYYA 2X1WL 1T2XA 3MXVL 5BS0A 4Q97A 5I1LA 4H8WH 1DFBL 1KTKE 5DUPL 1JYXA 4I0PD 5GZNC 3B9KD 3SBWA 4E5XB 2MNUA 4IMKC 5DD1H 5BS0B 2ZCKL 1F8TL 1U8OA 3MLZL 3MUGB 2LTQC 1Q9OB 3DIFB 4PRHA 4ZFOA 2CDGA 4X98A 4GRLA 1HYSC 2H32A 4QWWC 3IJHB 4ZFOB 4LCWD 4ODTL 1OM3H 2H8PB 3OZ9H 4M8VA 4WCYH 3EHBD 4MXVE 1Y18B 3RBGA 1HILB 2H32B 3D2UA 4WW1A 1IFHH 2VXSH 4OZGF 1UH2A 3O6FB 3HUJA 4YFDB 5HHNB 2X1XR 3D2UB 5IBUG 1C16A 4OT1H 4PJ9C 4QGTA 3FO2A 5KOMC 3MZTA 1S3KH 2DQGL 4LPCA 5T3XD 1S9WA 4Y4KD 1N64L 3ARFA 5J1AB 2ADJB 3EAKA 1FBIL 4OLYL 1MFNA 1A2YA 2EDJA 2E7BA 3MV9A 3HAEB 4L4TB 3QB7C 3D9AH 4P3CH 1BZ7B 5FDYA 3MV9B 3DSFL 1UKSA 1S7VB 4XB8A 2JJUA 3BEVA 4POUB 3UDWC 4NQEB 3HC4H 4K8RC 4JVUA 5F7MC 3LSOA 4PRDA 1SEBA 3HE7B 1T4KA 2EDBA 2ZSVA 5FA4A 3B8SA 3LD8C 2DQTL 4NQCD 2A6DB 4BFEA 2DKMA 1BAFH 4M6ML 1X5JA 4NQXA 5E8PA 2D7PA 2IWGA 3Q0HA 2C4XA 5E24E 3QUXB 1JK8B 4YDKL 3OF6A 4PR5B 3L5HA 2V6HA 5C0FB 2H6PA 3GM8A 3IVKA 4XX1G 1TQBB 1NGXB 1JPGA 3OF6D 3SQOH 3S3SA 3BP4A 4HS6B 1Q9WA 1BZ9B 4J3TA 3MLRH 3B43A 2QTEA 2A1WH 4MZ3A 4GG6F 2HJLA 3QG6B 4U1GC 1F11A 2XIDA 5I1GH 2J7LA 4K3GA 4BSVB 1B88A 3T4AA 5C6TL 43CAA 4Y4HA 2NX5D 5INDB 1JYVA 2QR0B 2IBBA 2VXTL 2VOTA 1NGPH 1ZMYA 4OZIE 2YR3A 4OZHA 4X99B 3JSSA 1QR1A 1F2XK 1X5FA 3KXFA 2DWEB 4XNMA 1F4WL 4WW2C 5DRNB 1I7TB 1QR1B 2O26U 3H42L 2HAZA 4MA8H 3ULVE 4UNVA 4G9FE 1DUZA 1MAMH 1JPST 1NMCC 4QHLB 4EXPX 2AJYL 4L5FL 3WS6C 3QG7H 1U6AH 4MWFA 3DMMC 3EDDA 4G8IA 1NEZA 3QDMD 3GMPB 3PWPA 1T1WA 1Q0XH 1L7IH 5TQ2L 3V5HA 3HR5B 3L5WB 1QZ1A 1T1WB 2VL5A 5DRXA 3TIEB 4JN1L 2VLJA 3TZVB 5F7HA 3JZ7A 3QA3A 3MRBB 4J4PA 5HY9B 2D0HA 2VL5B 1LO2H 3CC5A 1CDJA 1UA6L 4LHUB 1BD2B 3S35H 4I5BB 1MCOH 4JPWH 5F7KC 1YYLH 4AMKL 4MJID 2BX5A 3ARDD 5K59E 1GOGA 4E0RA 2BOCA 3LIZL 3PQYB 4P2RB 4LSVL 5F3BB 4WUKH 2NNAA 3LQAL 5LVEA 5IB5A 1R6VA 3VG0L 1VFMA 4B41A 4CUCA 5FV2A 5EFIB 1U92B 3W82A 3Q3GB 4RRPG 1A0QH 1LE9B 3TBTA 5F1OB 1HKLL 4YIQB 1ZEAH 2NTSP 4PRIB 5ACZA 5EOTA 4DEPC 3MOBH 4LCIH 3D3VA 5EU5B 2ID5A 1G7PA 3H9SA 3OBAA 1F90H 1ZVSB 2AXFB 4ZFFA 1OSZB 2WINB 1FFQA 4ZFGL 4CVWA 3G6AA 2A9ML 4W6YB 5A43C 3SKOA 4X6CA 4WFED 3ZSTA 1A9EB 5GS1C 3IJYA 1BFOA 5MERA 1S78C 4KGLA 3LHPH 4E41B 3UTTA 3MRNA 5HJ3B 1YMHA 3UTTB 3F5WA 4UI2A 1AP2B 4GBXD 1FSKB 4PP1D 4ZPTA 1XR8A 5T5NF 3MRNB 4MS8C 4NO0B 3HPLB 4RNRA 4UB0H 3TV3H 4PJGE 2EDEA 3BN9D 5EBLB 3MFFA 5D7IF 5KSAD 4XNQB 3ZHDA 1GCFA 4NBYB 4G6KH 3RHWK 4X6FA 4YWGL 3QCTL 3MFFB 4OI8A 4QRPB 3HKFA 3HNVH 4ODXB 2B8OT 4JAMA 3RJDA 1NBYA 4JN2A 3PWVA 5GRJH 5T33H 1WC7A 5D93B 4GH7B 4LSRH 3WXVH 3DV6A 3M8OH 1OF2B 1RZ8A 3MRDB 4JN2B 3HNSH 4LSTL 1A7QH 3CPLB 3BHBA 7CGTA 1CFNB 2H41A 1EAJA 1GOHA 3DV6B 5GJSL 3DETC 2WMPA 3K2UH 4FNLL 4JY6A 1S7RA 1P84J 1U3JA 5FAAA 4KAQH 1OB1A 3ZE2F 4JY5H 4PJHA 3ME0A 1KPVB 4CADA 1FJ1A 5JLZB 3MX0A 4GAGH 4W4OC 1E4WL 2V5TA 4QRQB 5I16A 3GUTA 5F1IB 4CADB 2WK2A 3DUHA 1RULH 1QO3B 1K8DA 3RWDB 4XNUL 1JNLH 4GLRH 5T3ZL 4Y5VC 3L1OH 1K8DB 3CVIH 4JY4B 2HT3C 4ONFL 1SJEB 4QCIB 1RJCA 4NZDA 4JR9L 3BGAA 2IALA 1UT9A 1DANT 4G7YL 2OK0L 2F53E 1N8ZA 5SWSB 3PGDB 1LD9B 2DLEA 4DFIA 2IQ9L 4LOUD 1H3PL 2J8OA 2ESVE 1Z5LB 2E9BA 5GZOD 5SX4H 1A7RL 4YBLB 4PV9B 5A16A 4FTVA 3G6JA 2W9EL 1KJMA 3LQMA 2IH1B 1MJUH 2DQEL 2EKSA 4JFDB 3MCG1 4ZUTA 1GPOL 2P7TA 5FF6A 2ZOKA 3UTSE 2CIIB 2FATL 3VXQA 1EXUB 3JTTA 4FZ8L 4PB9H 1B0GA 4NKOA 1WBYA 4OLWH 1P4LB 1G7JB 4NJAH 5F6HJ 4UU9B 4P5MA 5B39G 3NIDF 2Q7YB 1OAYL 3RX5A 3VXNB 2XG5A 2BC4A 1X5KA 2NTFB 1CU4L 5HYQB 3MREB 1KOAA 2Y5TA 3OKOB 1AXIB 4PLKC 3P3YA 2GIYA 1ZS8B 2LAAA 3PP4H 5HGHA 2OL3A 5DEGB 3C9NA 1J18A 4K07A 2UWEE 1XIWA 3AREA 5LXGH 1K2DA 1FPTH 3V0AC 5CS7A 4FG6C 4TRPL 1BM3L 1TJHH 5JORA 4YGVA 3WLBA 4HDIA 3O2DH 1S9XA 1K2DB 4I77H 4JZOB 1QR4A 4Z7QF 5IHUH 3L5XH 4C56D 1BQLL 5JORB 3WFCH 1VGEL 3NGBB 1HWGB 2BVEA 25C8L 2J88L 2Z93B 4HDIB 3HTLX 3FQXA 4HFWA 4HGWB 3EFDH 1JRHL 3KYNA 3T2NL 3VH8G 2VH5L 3FQXB 2A0LC 3VXSE 5GRWA 4M03A 4HPOH 3S88H 5JIHA 2Q6WA 1MEXH 2CKBL 4Y5XB 4YDLC 1EEZA 3G5XA 3FT3A 3FOMB 5IOPB 1KCSL 5AG8A 3Q5OA 4H26B 4HXBL 5F97E 4MNQD 2E9WA 4ZOCA 1S7SA 3MJ7A 5D1ZD 1T1ZA 1AGDA 1WISA 4UQ2B 3QULB 1XGPB 1E0OB 3JUZA 4IIQB 2X4RA 3DO7A 3AB0C 2CK0H 1VFBA 5EC1B 3BSZH 1QFOA 1A7NH 1M7IB 2VZSA 1JPSH 5ILTH 1I75A 1LEKA 4X7DC 3TYGH 1IBGL 3AU1A 3PABA 1X5GA 1FGVL 3E8UL 4U0RB 2Q8AL 4XTRD 1FL6A 4OCWH 3PABB 1R3KB 3W39A 2VR5A 4D3CH 2GJ6B 1A6TA 3ULVH 1FL6B 2BHYA 5E2WH 4YO0B 4BJLA 3OXRB 3PUCA 3STLB 1BJ1J 1W0WA 1YDPB 1T2QH 2ORBH 3RJQB 3KGRA 3U79A 2XWTB 2WANA 5BS0E 4CDGC 2X05A 1QFUL 4M43H 3LS4H 1M7DA 5A2KH 2VLRB 4L4VD 2BMKA 4MDIB 2EIZA 3NN8B 4M1DH 3R0NA 1HIML 1M7DB 3U4AA 5JO5B 5ICYB 4PJ9A 4PRHE 4YFEA 1RK0A 1A47A 1U91B 4YHOH 3OX8B 5CKAA 1KT2A 3K80A 1XR9B 5FK9A 3TJHC 4AEIH 1KJ2A 1MFDH 3VFWB 3DLQR 3OPZH 4GMSH 2GY7B 2NY5H 4L8CA 1PGRB 1CDGA 3KPSB 2O61A 1ZV5A 3TNNA 4HJ0D 5CIPA 5JZ7C 4KQ4L 1P6FA 1I7RB 3UDWA 2Z91A 4GW4A 3GSOA 1CE6A 4M9PA 4L4TE 2WWMC 1X5HA 2AJZB 1UB5A 5I1CL 3FN9A 3KPQB 4OCRL 3MV9E 2D0FA 1NGYA 4P49A 2WIMA 3VMPA 4QF1B 5IR1A 1IAOA 4JB9H 2P5WB 3N06B 4DVRL 2FB4H 1FYTD 1IAOB 2HTKD 1JCKA 2MKWA 3DX8B 1MFAH 4MX7B 3LKOB 2DTMH 4U1KA 1KIPA 1S5IL 2WP3O 1T21B 3S3PA 5HPMA 3OQ3B 1OP5H 4RZCB 1AGFB 5DJCB 4G42A 4YH6A 1EV2E 4B53A 1DBAL 4HW6A 1YUHB 4QXUL 2CO6B 4YZFE 3MLYH 1MHCA 3NH7H 1JZ7A 5HVWA 1IM3A 3UO1L 1M4KA 3ZKSD 1WLHA 4W68A 3PDGA 1CF8H 3T65A 2G2RB 4WW2A 2XRAL 3TBWB 4OFYD 4YHZL 1DQML 3VFGH 3HNTH 2QSCL 3ZE0F 3WS6A 2VDKL 4KKNA 3DMMA 1MI5A 1FZJA 1NMCB 4M5ZH 4AG4L 3PDOA 1J0JA 3P4OA 5I8CB 4UNTA 3ARBD 2UZIH 1JVKA 1I8IA 2XNAA 1MI5B 3EOYG 1WZ1L 4UOW1 2AQ2A 4BQ8A 4LAQL 3UZEA 2G9HA 3M17B 3W9EA 3QXAA 3CD4A 1HHHB 2JB5H 2I9TA 1WZMA 3MOQA 1ZHBA 3MV01 5A3IC 3HMWH 3UZQA 1F45A 1SVCP 3AC0A 3W9EB 1RZKC 3QXAB 1NCAL 4QKXB 3PWPE 5H35B 3NZHH 4F3FA 3ECBA 3FB7B 5CD3A 2NY7L 1FNEA 3LB6D 3BPOB 1OAUH 3QUZB 4NC1E 5A2JH 4WO4B 4B50A 5CD3B 3DVNA 1QQDA 4U3XA 3S5LA 1BD2E 1PDKA 2WP3T 5IB3A 1RZFH 1LO5A 2PTTB 3WXWH 1KJ3H 1G6RA 3O3BB 2QADD 3IGAA 3PQYE 4P2RE 2YC1A 4J6RH 1INEH 2P48B 4NRYA 1FV1A 4FQ1L 3HZVA 3FO1A 5EU6D 3V5DB 2QSVA 1OGAB 4JM2B 4RISH 4PJIA 2YEZA 4IRZH 5E6ZA 3TO4D 2VLKA 2BY1A 4RQQA 4HK0B 2A83A 3GGWA 4EDWH 1IGTA 4H8WL 1KCLA 2BVYA 4PJIB 5EU4B 4Z7QE 1UH3A 5JUEL 3CXHK 3EYSH 4YDIH 4UV4L 2ED7A 5DD1L 4PRIE 4MD5B 4PRAA 4MJ5B 1T66D 2HLAA 4JZJC 1F3JA 2WBJD 4D0CA 2DQCH 3FT2A 1NGWB 3VWJD 3IDNB 2XPGB 4PGCB 4Y4FC 3GKWH 5GS1B 3QWRD 1G7LB 3L7FA 1OM3L 5JA9A 4P2QA 5EBMB 3OZ9L 4HK3J 2CLRB 4WCYL 3FKUS 1CLOH 1IFHL 1A6WH 1NBZA 2WBKA 4DKAA 2XFXB 1DLFH 3GMQB 4LHJB 4E41E 4ISVB 4XZUA 1QLEH 3MCLH 1L7TH 4LRNH 1QLFA 4N0FA 1J11A 1S9KC 3MLXH 3UTTE 1L0YA 3I6GB 4L3CA 1W8NA 3AXLB 1CTOA 3KPLB 4HMDA 5HHXL 4ELMA 3DECA 1VESA 4IJ3C 4P3CL 2GKIA 4L3CB 1D6VH 3MROB 5E5MA 3ETBF 2J8UB 4G43A 5FO9A 3MRPB 1ZGLM 5K9KA 4G9DB 1JWMA 2AK4A 4ENEC 4QRPE 5MEPA 2W0KA 5KTEH 2PXYC 4OI9A 1J10A 5F7DB 2FX7L 4F33B 5I30H 2W0PA 4UZGA 4ZO8A 1HI6A 3EYUH 4QRRB 3SKNB 3DX7B 1CXHA 5DD5H 1UJ3C 4R26H 5SX5H 5DMKB 3AUVA 5CP3A 4HC1H 1AY1H 4W4OA 1TITA 3FRUB 5TE7H 1FG9C 1ZLVK 1VFUA 4OGYH 5TQ0H 4WRLA 4Z7WB 2VDQH 1DTUA 2N7AA 1KB5B 4Y5VA 4Z0XA 3D18B 3QDJB 4OM0H 2L0DA 5FGSA 3SQOL 4D94A 3S8WA 1IQDA 4F7MA 3LV3A 4P23C 4X9BA 2APWA 3ULVD 3RNQA 2A1WL 5ESVB 3STZB 5I1GL 3VRJB 2V2TB 2C3GA 3RNQB 3C6LD 4MQXC 5KSBA 3KDMB 3HG1A 1AO7B 3L3GA 3EJZD 1E6OL 2FEDC 3G9VA 2ADGB 4WJ5A 5IF0A 1CN4A 1TENA 3JV5A 3KYOB 3T0AA 2Q1EA 3QEUA 3SDXF 2VLLA 4F58H 2Y4SA 1RQ5A 4LVOC 5SWSE 5FECA 5EN2A 5AYQA 3VD4A 3GHEH 1RAMA 1IGYB 3I9GH 4N9OB 3T4YB 3Q6FA 1AGCA 1HH6A 1MAML 3VWKC 3RI5F 3QG7L 1U6AL 2D4DA 5D7SH 2NXZD 4JFDE 4G8GA 1MHEA 1Q0XL 4ACPA 1YZZA 1L7IL 1SY6A 3ILPA 4EVNA 3VGHA 3MBED 2EZ0C 2FJFA 3KG5A 3SGKC 1OD7A 4WU5A 4JFEB 5D70H 1SQ2N 3B83A 1JHKL 3NCYP 4CVXA 1A6PA 4XHJD 2HLFC 4WU5B 1R3JB 2H32H 3IU4H 1LO2L 2Y7QB 1BGXH 1VKXB 3I6LD 5KSUB 1AXSB 4O58H 4JHWH 4JANA 5A2FA 1VEOA 1MCOL 3AS0A 4JPWL 1YYLL 1DVFC 1CD8A 5FOJA 1JWUA 1DBJH 2XWBA 1ZLUK 1CGUA 4WUKL 3DRQB 2BP3A 3TN0B 1KCUH 3TEUA 1A1OA 5E2TL 4R2GB 5C09A 2XT1B 3T1FB 4I48B 5HHOD 3O11A 1A0QL 1PD6A 3TCLA 3F12B 1ZEAL 1P1ZB 2XN9A 4Q6YA 2GTWA 4BSWA 5IHZA 1S7WA 3MOBL 4LCIL 5FO7B 2XN9B 3IXAB 1F90L 4PLOB 3CFDB 4BSWB 4DZBB 5E7BA 1S7WB 2BNQD 1UM6H 2BJMH 5F8RC 4PJDA 2D9CA 4NN6B 3C60D 2JIXA 4BUHA 1H8OA 3MRCA 3WFHA 2D7MA 2UUDK 2WSKA 1TCMA 3KPPB 3QIWB 5DFWH 4YJZL 4HBCH 1U8KB 1LNUB 2BVOB 3GSVA 1U2HA 3IYLW 3UJIL 1TNNA 4BFGA 5L2KA 1XZ0B 4O4YH 3GSVB 3LN5A 2BSSB 1CWVA 3TV3L 1UQSA 1UXWB 3GBNH 15C8H 5L2KB 2E5EA 2R2BA 3BQUC 1U95B 1QRNA 2J8UF 3GEWB 4UTAH 3MRFA 1HEZB 2DN7A 1QKZH 4G6KL 3ZKQD 1EFXA 2X10A 2GJ6E 3HNVL 1K3IA 5BVPL 1HXMB 1UH4A 2O5XH 5GRJL 5T33L 1S5HA 4LSRL 5DVOA 3WXVL 3M8OL 4P46B 1OARH 1ZSDB 1ZA3B 1ULVA 1JPFB 2CQVA 1CBVH 1I3VA 1S5HB 4H5SB 1NUNB 1RZJH 2EC9U 1TVBA 5DEFA 1KIUA 3JWOC 2VLRE 5KS9A 4KAQL 1K6QH 4OIIH 3ARTA 2A6IA 2PETA 4JY5L 1ITBB 2VE6B 3TH2T 1U93A 5IJVA 1IKNC 2AJ3A 2F53D 5KVMC 4CW1B 2ARJA 2RHEA 2BY0A 3V0VA 1NDMB 1XF5B 2ESVD 1RULL 4LEOA 4V1DA 1JNLL 1TVHA 4AEFA 4D0DB 2V2WB 1ONQA 2KZ1B 3KPSE 1MFCL 3RVUC 4PUBH 4YFLI 1HDMA 3CVIL 1WWBX 3BESR 4Y7MA 3UTSD 3UMTA 1R5IA 5FKPB 1ONQB 2X44D 4LU5H 5AUMA 2ZG3A 2KBGA 5ALCH 2RCSH 4KUCF 1JZ3A 3DV4A 4CU6A 4XAKE 1FFRA 1MRFH 4HUVA 4LLQA 3IDXL 1MCNA 4OAWA 2X4SA 4X4XB 1DSFH 3DV4B 2EE9A 1NC4A 5EA0H 4K3DH 2YPKA 4HUVB 4U1IA 3QPQD 1MRDL 1CG9A 4GS7B 3LPWA 5DD6B 2GUOA 4XCEA 4GG6A 1MJUL 5E1AA 2P5WE 2YPKB 4U1IB 4NNXA 1J5OH 4KRMB 4POYA 3U36A 2B4CH 3OGCB 4DUVA 5HGAB 3O81A 4LSQH 3MRJA 4OLWL 1SYVA 3GMRA 4LLMA 3QUYB 3P0VH 2XXMB 2DQIH 5JA8B 2IEPA 3QHFH 1MCRA 1OGTB 1N0XL 4LLMB 1LK3H 1WK0A 1X4YA 3LN9A 1DUYA 3CX2A 2DD8H 1MCJA 3QQ3A 5JDSA 2X9YA 2P42B 2IADA 5INCA 1F02I 4PJ8C 4FXGA 2IBZX 5JPMB 5D1QB 5I15H 1LK2A 4OSUL 4AM0B 1NFDA 4FXGB 2YOCA 2R0KH 3M07A 2QEJA 4IDJH 3E1F1 4WU7A 4F7PA 2YUZA 5LXGL 2X9XA 4IHOB 5IMLA 4PD4J 4HX1A 1TJHL 4MMXC 4PV8A 1QA9A 3O2DL 4I77L 3NBNA 3ZYOA 5IHUL 3L5XL 3WFCL 1JRHI 3WFBH 3IS1X 1MI5E 4IEFB 3PP3K 3U30C 2ZSWA 5TE6H 3EFDL 1AR2A 1TZGH 3CLEH 5L8LB 5GS0C 3D39D 5DYOB 3WLWC 2CLZB 2ZSWB 3SCMB 1ZAGA 4HHAB 1AQDA 1KIQB 4OF7A 1BJ8A 4NHCH 3S88L 4HPOL 1MNUL 5DR5H 5L7XL 3CU1A 3LPGA 5EC2B 4LLWA 2R23A 3CH1B 1GGUA 1NCUA 3ARRA 2GQHA 4UDTA 5CLTA 3I3DA 4FFZH 2V7HB 2ITDB 2D9QB 2OI9C 4FFWC 4MCZB 3SJVA 4OB5H 3BYYA 5GGVY 2GSGA 3O3UN 1JZ6A 4Z7UA 2CK0L 5DUBB 3BSZL 4HH9B 3Q48A 4JQVC 1F00I 1ZTXH 1HOCB 3TYGL 1FL5A 3GB7A 5T5NG 3KPMA 4NC0B 1S7XA 2X70B 4U1JB 3HAEG 3GSNA 4OCWL 4Q9CA 4A6YA 5EPMA 2YPVH 2F54B 3BIAX 4OZFA 2WQRA 4D3CL 3KNBA 1ND0A 1P4BH 3OTTA 5E2WL 4S1QH 3B9VA 1OGAE 4QOKD 4HIEA 2OQJB 3U7AA 5FGCB 4JZJA 5F3HB 2F8VA 2H3NA 1T2QL 2ORBL 4NZTH 4PJIE 3SE4C 1DQDH 4Y4FA 3O6FD 4O51A 4NZUL 1AR1C 1H8SA 3FFCA 5FOBA 4DCQA 4DWHA 3C09B 4M43L 4YLQT 3LS4L 1J1XH 5D7IA 5E2VH 4J1UA 5C0DB 3T0WA 1U3HC 1U58A 2Y25A 3X13A 4HULB 3CXDH 1RPQA 4KUZH 3NIGF 4L4TD 5HDQH 4D0BA 3Q5YA 2NY2B 3D1MC 4YHOL 3GIVA 1CFQA 4QRTB 3EOBB 3FFDA 4NO3A 3O2WH 4AEIL 3UAJC 1PBYA 1MFDL 1CICB 3OPZL 4GMSL 4P2QE 4NQED 3SDAB 4KRPC 4XCNA 4ZXBB 2NY5L 1YQ2A 4K3HA 3BZFA 2FZ3B 4J8RA 5IQ9A 3HE7D 5IGXL 1CR9H 3N85L 3RVXD 2P8LA 4PRNB 2E7HA 5GGRA 1WTGT 1C5BL 2PXYA 2E7MA 4Y2DA 5GGRY 1JP5A 5TDNA 2Y07H 4TPRH 3B6SB 1ED3B 4TSBH 3LEXA 3QUXD 2OL3H 5L9DH 2J8UE 4OLUH 1AGBA 4R7DB 3PE9A 3FO0H 3ROOA 1UJ3A 4PJAB 4Y2DD 3UTZA 1JI1A 3L3IB 2IFFH 1N2RA 1JZ2A 2OTUB 3ROOB 4JB9L 4U1MA 2QSTA 3DBXA 3GMLA 5DWUH 3I75A 2FB4L 2JJWA 4QRRE 1ZT7A 4U1MB 4OM1H 1A1NB 4YHPB 4K7FB 1MFAL 1R3IH 5EO0B 2PYEB 3HB3D 2DBJA 1KB9K 1CI5A 2GK0B 4P23A 3CFKA 2GITA 4JKPH 5ITFA 3WE6B 4Z7WE 4UIKH 2CJUH 4PG9B 5EBWA 3QT2A 3TC9A 4OFVA 5TGBA 4S11A 1P2CA 3QDJE 1ZHNA 3MLYL 4LHUG 4M7JH 3NH7L 4NDMB 1OT1A 5AEAA 2H2SC 4QGYA 1CF8L 4U3HA 3O2VH 2EDYA 5TDOB 4KZDH 4WUUA 4PJEF 3GRWA 1MQKH 1AO7E 2R56H 1SJHB 3VFGL 4JZNA 3BPLC 1N3NB 3HNTL 5ABDE 3VWKA 2K9UA 1ZT4B 3V7AE 1WFNA 3GSWA 3TZVD 2YKLL 1L6ZA 4NZJA 4RFEB 2EYTA 3GSWB 2VAJA 2UZIL 3H9YA 4RMSA 3EYVB 3SGKA 4LHUD 4RMQA 1TCRA 1BD2D 1H3TA 3BKCH 3LRSB 2FX8L 1K4DA 2C1OA 5J8OA 2GTZA 2JB5L 1BWWA 3RWFA 2VN4A 3FCTB 3HMWL 1QLRA 4HKJA 3TP4A 3V5KA 3PQYD 3VRLF 2H26B 3VFMB 4P2RD 3DWTA 1K4CA 1DEEB 3QNXA 3NZHL 4JFEE 3X12B 5FUCC 3U2SB 4PGBB 5E00B 3S35X 1DVFA 5FHBH 5IW6B 1OAUL 5D5MB 3BWAB 3C8KB 3MLTA 4CGTA 1YYMH 4IRSB 2GJZB 2EEAA 4BSJA 1KJ2H 3Q5TA 1RZFL 4H1LB 4X5LA 5I1IH 4LNRA 2Q3AA 4NHUB 5AYUH 3FZUD 3WXWL 1H15A 3G5ZB 4PRID 2JJTA 5LQBL 4J6RL 1A3LH 2XKNA 2M1KA 1INEL 1YQVH 4RFNB 3K3QA 1JV5A 4P3WA 4X7TB 1EVUA 1F3DH 4K8RH 2E8ZA 2VERN 4HGKC 1EH9A 4RISL 3BZDA 4HS8H 4JLRA 5T1KA 4IRZL 5EO1A 2F74B 5H2BB 5C09E 4EDWL 4PP2B 5IFHH 3E3QC 3KPNA 5T1KB 5ID0B 3EYSL 4YDIL 4ZQKB 4E41D 4LVNC 1F6AB 3F7RA 1F6FB 4L9DA 4RMUA 3S98A 1FAKT 5C0EA 1P7QA 2XN9E 4NQSB 1JFQL 4NT6A 4XMKH 1WFOA 4NO0D 5C0EB 5T1MB 3GKWL 4IOFC 1YEFH 1MUJA 2WIIB 2AEWA 4FQ2H 1CLOL 4YHNB 5EUOB 4NO5A 1A6WL 4L8BA 1DLFL 4X80H 4QRPD 4Z9KB 5T5FH 5K9JL 4PJXA 3MCLL 4LRNL 3BQUA 2VKWA 1N6QH 1LHZA 3C5JB 4KHTL 4G80B 4EUPB 3C08L 3O4LB 3BQUB 5BO1H 4J3VA 1TLKA 2DJUA 4EI5A 2FECL 3O41A 4U2ZA 1KACB 4LKXA 5L2KE 2R2HB 1D6VL 5HI4D 1ZOXA 2E27H 3JXAA 5KG9B 4JVPA 1JNHB 4GRWH 4DKEH 4P5KA 4MB5A 4F37F 3VE0A 3WMSA 4R7NB 2ZP0T 3BH9B 1FH5H 3IU3A 5KTEL 5MENA 4ZAKC 4N1HB 4WI8A 3T09A 5I30L 2HN7A 2EE3A 3QEQA 5DA4A 4P4RB 1Y6NR 3W81A 4WIQA 1NFIA 1U8IB 5DD5L 3BP6A 4M61B 4R26L 3VGFA 1ZWIB 4JHAH 4HC1L 1AY1L 1PFCA 5ADOH 5I1AB 1WV7T 2D2OA 3DARA 5TE7L 2VDLH 4OGYL 5TQ0L 2AKRB 2WM0A 1J87A 3VGDA 2Z92A 3MYJB 1RUMH 4MSWB 4F2MB 5LBSL 3BO8B 5C0BB 5DFVC 1T22A 4OM0L 3U4BH 2Z92B 5SWSD 4CAGA 2YSSA 5C9JA 4OF5A 4HUUA 1N6VA 3MC0A 1U8LB 3P4NB 4XB7A 5C9JB 4K55A 1H3GA 1EVTC 1PSKH 3MMEA 2ICEA 3EDJA 2ZG1A 4JFDD 3QAZC 5IBLD 2J1KA 3ULUC 5T1LA 3TVMC 5GISH 3PWLB 2CRIA 2FIKA 1VFAA 1BQHA 1OTTD 3BXNB 1EBPA 5EZOH 3GHEL 3ZE1F 3UBXI 1Q1JH 3V2AR 2FIRT 3I9GL 3VXRB 5HI5C 3QIBB 4FFVC 4ZDHB 5D7SL 3ARUA 3CJJA 3VRIA 3VXMB 2R8SH 4FN0A 1X7QB 1MWAA 5D70L 3FHAA 4OF3A 1LVEA 1VERA 7FABH 4ZFOL 3HLAB 4HPYH 3O9WB 2P1YA 5E99L 4OCXH 4PY7B 4XVJH 2CK2A 3IU4L 4QHMA 1B9ZA 5D5MF 4XP4H 5E94B 1BGXL 2W92A 2IJ0C 4PJ8B 3WSQH 3X11A 3VFNB 4JHWL 1AD9A 1J8HA 3GSRA 35C8H 3T2OA 3RX7A 3R8BB 2YD1A 4AQOA 3BJ91 2X4OA 4LQFH 2IPKB 3QH3B 4C58B 2H1PL 5EZJB 1J8HD 1AE6H 3KLHD 4TTGA 5DMGC 3WIHA 4LCYA 1XGRB 1KCUL 1IZJA 4XPHH 3T04D 2DM4A 1D5XA 1NUDA 4LCYB 1NGZB 3NACH 2XTJC 1FDLH 1YNTA 5HGBB 1IGJA 1BMGA 4CKVX 4PJ7B 4X9IA 1TNMA 2Y1VA 5IB1A 1OAZH 1PYWA 1SBSH 2K7QA 3MOAH 4G7VL 2BRRH 1UM6L 2BJML 5CZXC 4P4KB 5CP3H 4TYUA 2PUQT 4S1SH 1HQ4B 2G5BB 5F9OH 3FOLA 5ICZB 4P5TC 1W72A 3ULSA 3TBVA 3G08A 5DQ9B 1F5WA 4Z18A 1T1YB 3DTXA 4JQVA 1PQZB 5L2JB 4P2OB 3FB8B 2GJ6D 3K4ZA 1PKQA 4BQBA 5K9OB 4HIJB 1MPAH 4HBCL 3DRTB 3SDCC 4JDTH 4PJ5B 3W0WA 1ACYH 2GT9A 4LARL 4DAGH 4O4YL 3SJVE 2MFNA 2GFBB 4NJ9H 3GBNL 4MHHG 4XWOC 4WHTB 3WNKA 2HRPH 1F4AA 2QQNH 3QXUA 2AP2A 4W6XB 4UTAL 2DLTA 1QKZL 2VLRD 4JQIH 3AM8C 3SE4A 3T8XA 5LGJA 2FNBA 5E1HB 5DC0A 3A6OA 3BVNA 2P44B 3D0LB 4M48L 4ORGA 3TFKC 4OD2A 3LDBB 3T8XB 2O5XL 5D4QA 5FGCE 2KZWA 3FQWA 4ODUB 4HG4J 4HIIB 1U3HA 1CLYH 1SM3H 4M5YL 4OD2B 3BKYH 1A4JA 1OARL 2UVEA 4K7PY 1FNGA 2Q86A 4KKLD 1CBVL 3BZEA 3EYOA 3KPSD 4OUOA 1RZJL 4Y5YC 4JDZB 3VFOA 3DUUA 1SY6H 3CGTA 2O93L 2FEEI 1L0XA 3FB5B 4NOBA 4QEGA 1K6QL 4OIIL 4KK6D 1Z9SA 3DUUB 1BBJA 4HUWB 3FRPA 3H6JA 3W9DB 3M1BB 2ZUYA 3DVGA 2LU4A 1YJDL 4HKBA 4M7LL 4GLRI 4K8RD 3BPCB 4L9LC 1NANH 5FUOH 2AJSL 4GKSB 4NM4H 4XPAH 2P5WD 4PUBL 1HSAA 4Z7NF 3BGMA 2OTWA 1SYSA 1D5IL 3EOTL 1FO0A 3VXUA 4PBVC 4PTUA 3F7VA 9CGTA 1CVRA 5ALCL 2RCSL 3X3GL 4JO3H 3VFVB 5IVNA 3VGEA 4OKVB 4ETQA 4G8FB 3VD9A 1MRFL 1FO0B 1UVQB 2FL5A 5SX4I 4FRWA 4LDLB 4N5UA 5I8KL 1J05B 4HZAA 1DSFL 1AKJA 5JIKA 5EA0L 4K3DL 4JFFB 4KK9D 5E4EB 4PJAE 3CFEB 5DJ6B 3X14A 1CK0L 2JCCF 3RQ3A 3DHJA 4A2LA 5DO2D 5EUKB 4CU7A 4PJBB 4Z7VF 5I1JH 5IEHA 3MUJA 1J5OL 2HFGH 2B4CL 3C87A 5E8OA 1A7PH 2YA2A 4LSQL 3U82B 4Z7OF 2Q76A 5JHDB 3DXAA 5GGUB 4X4YA 2PYEE 4TSAH 3P0VL 2RAMA 3SDXA 5DXWA 5CHNB 1L9NA 1I7UA 2DQIL 3QHFL 1P6AB 2CUMA 2HVKA 1CFVH 3MO1A 1LK3L 2ITCB 1Q38A 4Y19B 2DD8L 4PRPB 3QDAA 1EEYA 3NPSC 3EJYD 2C3HA 3SE9L 2BNRB 4POZC 5I15L 1JI2A 3LMJH 4RDQF 3RUGF 2R0KL 4GKNA 3BPLB 4IDJL 1KELL 3OHXA 2R4RH 1T6VN 5GXBB 2GI7A 1D5BA 1R3HA 5C6PB 2IGFH 2HG5A 1JNNH 3CDGB 2AI0L 5FYLD 3PIQA 4EKXA 1G0DA 4N0YL 4UMGA 2P4AB 3T77B 2BSRB 4LLYB 2VUYA 1AI1H 2J6EA 3HI1B 4YK4B 3ARGC 3ZE1E 2VAAB 2JJSC 3VGAB 3QUZD 4WO4D 3WFBL 1EFQA 5IW3A 5TE6L 3HRZB 1U3ZA 3TA3C 3CLEL 4MLIA 3L3OA 4YC2B 3MV7B 5I0ZA 2NLJA 3N1MC 4K94C 2DQJH 1CE1H 1T0MB 1AGEA 5DR5L 1G7QA 1RZ7H 3ZSSA 4CN6A 2VLME 2CKBB 5B3JE 1T7VA 5EU7C 1T0NB 4IRJA 3T08A 2R0LH 4ZUVB 3LEYH 3BP5B 1OGAD 5D5ME 4JM2D 4FFZL 1BEYL 3SGJC 3ZYIA 4X6DB 4OB5L 3NABH 5DJ8B 5C2BH 2GYSA 3H9HA 3BUTA 3I6KB 1I85C 1UWGH 3F62A 5ID1B 2X6MA 3QDGB 1ZTXL 4UT6H 2MCG1 3FQUA 1KTRL 1ZHKB 1J0KA 1TFHA 1K85A 3A6CH 3FT4A 2MHAA 3MJ8A 2YPVL 3FQUB 2DWDB 1OTUD 1QSEA 4MNGB 3VW3H 5DDHB 5HXMA 3HZYA 4S1QL 4WI5A 5C0RH 1S78D 4R96B 4WGVB 3B4NA 4LVNB 3OJMB 3OAYK 5DZLA 4NZTL 2Y6SC 3ARXA 4CVZB 5CUSH 4HCRA 1EAPA 4FXLA 4R3SB 1KTDB 4YHLH 3MUZ1 3V7MA 5GSRA 1NLBL 4LSUH 1J1XL 3KJ6H 5E2VL 2DYPA 5E4IA 1OAKH 1H3XA 3CXDL 4KUZL 4NSKA 5HDQL 1MCLA 5E2UH 2DYPB 2A74B 4ZYKA 5EOCJ 4N1EA 5EUOE 3MLSH 3OKMB 1IC7L 3O2WL 1T1XA 3WFEH 5HGDB 1QVOB 2ZG2A 4XGZB 2F15A 4PG2C 5HD8C 4XNYL 5J7CC 1O7VA 5JXAH 1CR9L 1OHQA 3G5YA 3RVWC 2PYFA 4PJXE 1C5CL 3O4LE 2EEBA 1IAIH 3FTGB 1QHPA 3G5YB 1UKQA 4M1GH 1XGYH 4RBPK 4YFLF 4ZAKA 5LAXA 2Y07L 3V7AG 5I18L 4TSBL 4DQOH 2OL3L 5L9DL 2GSIA 3GJFK 2YA0A 5LAXB 3FO0L 5DJDA 3ARZA 4N8CH 1XF1A 2GSIB 2IFFL 3QDJD 1ZLVH 2VXQL 5DWUL 1RZKH 1EGJA 3BD5A 3S37H 2VDRH 5EBGA 5FDWA 2HT3D 2HKHH 1MJ8H 3IFPB 5CZKA 1YY9C 3MRLB 3THMH 1AO7D 4CMHC 4EN3D 2VITB 1TZIB 3K8KA 4JKPL 3H3PH 4UIKL 2YN5A 3RTQD 2CJUL 5IM7A 4KUCD 3T0EC 5C0BE 4D9LL 5A1AA 1NSNH 4QXTA 4EBQL 4NRXB 4M7JL 3KYKH 3QQNA 2GHWB 1GZPA 1KYOK 3OKEA 5MEOA 3O3AA 3TVMA 1C08A 5GGVH 4YXKH 1YC7A 3CNKA 4HWBH 2RQ8A 3O2VL 5AZ2L 4KZDL 3B2UC 3MJ9A 2AV1B 4RGNC 2HMID 2X89A 3RRQA 2D4FA 2R56L 4XP1H 3GSXB 4N90D 3GSNH 4JFED 2H9GB 4Z0BH 4A6YH 3V6FB 4OZFH 5SWZA 4U1HB 1T04B 4L1DA 4WV1A 1HYRC 1HNFA 3VXRE 4YAQA 2CLVA 5KANI 1FHGA 5HPOA 3EGSA 3ZDYE 1I1AC 4PGDB 3VXME 4YBQD 1CDIA 3ZTNH 3MRMA 4IOIB 3HE6C 3GI9H 5I8EA 5C07A 1OCWH 4LCCC 4YHKH 3MRGA 3NCCB 3PWUB 4M02A 4M1CC 4RMRA 5ISZA 3LCYA 2XICA 2E8YA 3TN0D 3U48A 5FHBL 1ZLUH 3T1WA 4R2GD 4N1CA 5ADPH 1YYML 4JRYA 5BRZA 4U31A 4X8JB 1KJ2L 1E4KC 4MVBD 3H7LA 4WI6A 5I1IL 1D3CA 5AYUL 1G7HA 4YQXH 4MA3B 4MDJA 2N4IA 4I18C 3LKRA 2BCKA 1A3LL 2A0LD 1WFUA 4NPYA 5DC4B 4CDHA 1YQVL 5CEYA 4NP4H 5CSBA 3B9DA 2HT2D 1I1CA 4K8RL 4Z8FH 3VG9C 2AJXL 4PJFB 2ENYA 4HJGA 4GFTB 3EUUA 4FQXB 4HS8L 3RY6C 5IHBA 4HJGB 2PCPA 3VFSA 4PJ7E 2VQ1A 3HRPA 4YEEA 1G9NC 4LBEB 5IFHL 1CIUA 1FFOB 3QIWD 4O2FA 4P5TA 4G8EA 2UUDH 5EOQH 2OMBA 4Y16C 4XMKL 1NAMA 2FJGA 3KS0J 2ICWA 4ODVH 3VXPB 3V4UH 1YEFL 5KW9H 2YD7A 2Z31B 1MCPH 4FQ2L 1RJLB 4RX4D 1ZKAA 5IMMA 3SDCB 3O6LH 2JELH 3DJ9A 4MXQC 4N5EC 4V2BA 5CILH 5IMMB 3G6DH 3RDTC 5D96C 1N6QL 1BIHA 2FECI 4PJ5E 4ONHA 1PEZA 2Y72A 3AM8A 4KU1A 1H5BB 5C8JA 3O3EB 4HEPG 3QJFB 4P46D 5BO1L 1N6UA 1KEMH 3GRWH 4ODSL 2P8MA 1MLCA 2ZUTA 4APQC 2XQYK 2DDQH 1I9RL 4OV5B 4DKEL 1U9KA 3RGVB 1DQQB 1G0XA 3EFFB 1C5DB 5ETUB 4F8QA 4OCYH 2KQNA 3I02A 1FH5L 3REWB 1Q72H 2VXUH 4XMPH 3P9LA 3PL6C 1PZ5B 1XGUB 4QT5A 2PR4H 4Y5YB 4DJMA 3KHOA 3OJVC 1S7UB 1XGTB 3QIUB 1WQVT 3ZT7A 4JHAL 1KLGA 5ADOL 1XCTB 1CZ8L 2UYLB 3WUWB 2XZZA 1AC0A 2VDLL 1E27A 4L9LA 3PG2A 2BFVL 1IVLA 4CU8A 1CGVA 4PRBA 4QTHA 1HWHB 1RUML 1X6LA 1WICA 2CDFB 4ODHH 3O3DB 1AHWC 4NQVA 1T20A 3QI9B 3U4BL 4PRBB 4YDVA 2Z4QB 1RZIA 4U05A 1YPZB 1TJGH 2NW3B 1PSKL 4Y89A 5DMJB 5HYIA 5T3ZE 1NCCH 1GYAA 1U8PB 4RGMB 4N8VA 4ZFZA 2NYYD 1G6RL 5GISL 1R5WA 4Q2ZA 5FIEA 4LDOB 3FO9B 4YR6B 3QUYD 5EZOL 5D2NC 5B38A 3FONB 5JXEA 4OLXH 1I8KA 2YMXL 5I75C 4JFFE 5D6DA 2BVPB 1DFBH 2CH8A 5DUPH 1HSBB 5DJ2A 5AD0B 3UBXB 1NCDH 4LGRB 5GGSA 4PJBE 4G6FB 3S9DB 3N9GH 4XNXL 2R8SL 2BVQA 3MLZH 5GGSY 5IVXB 5D1QD 5DT1H 1TTFA 2QJDA 4ZD3L 5JHDE 2BVQB 4JFQA 7FABL 2OP4H 1X5YA 4PTTB 5D7JA 1FG2B 5DTFB 4HPYL 1IM9A 1FVCB 4OCXL 4XVJL 3S34L 3NPSB 5ERWB 4XP4L 3V8CA 2W59A 3WSQL 3QXDB 1IM9B 1CS6A 1LMKA 5I73C 4Y19E 4PRPE 3L7EB 3GJFA 5HYJB 4URTB 3SDDB 35C8L 2QLVB 5IVZB 4PBXA 3V4PH 4LQFL 2R2CA 2BNRE 1BOGB 3KLAB 1B90A 1RZGB 3RVVD 4OLYH 4K3EH 3S4SB 3UYPA 1G9EA 5ENWA 3CFJA 5CJ8A 1D6EB 3ARGA 3AGVA 2JJSA 3SCMD 1YY8B 3PP3H 3F58H 5CJQH 4FHBD 2XA8H 3NACL 5ENWB 1CFSA 3ARGB 1FDLL 3MXWH 2UZXB 2OSLB 4UDUB 1EZVX 5F7EH 3U4EB 3ZHKA 1Q94B 1FVDB 3TA3B 2EIBA 4LLVB 4LASH 2O5ZH 2J4WH 3WNOA 3ZKXC 1OAQL 1B0RB 1OAZL 4IS6A 1MY7A 1GZQA 5IUSA 3ABZA 4M6MH 4NRZA 3MOAL 3MV7E 2PF6A 2BRRL 3EO1A 3QNYB 4S1SL 2FBOJ 4GRMB 1P7KA 5F9OL 3SGJA 1LP9F 2X40A 4HLZG 5IIEB 5E6IB 4CBPA 3L3KB 1C12A 4MYWB 2CMRH 2F54D 4MD4A 4BH8A 4HIHB 3DROB 4X7SH 3GMNA 1YN7A 3GMMB 4FMFA 4ZNEA 1MPAL 3V52L 5CBAB 1U42A 3RWJA 4X6DE 3R4DA 2N7BA 1YN6A 3RKDD 3LKSA 4JRXA 2AEPH 5C6TH 3QDGE 4NJ9L 4OCSH 3REVB 2VXTH 2HRPL 2GCYA 2QQNL 2R0ZH 5H8DA 2R9HC 3H9ZA 1FLRH 4Y1AA 1JZ8A 5JPNA 4JQIL 4WEMB 4Z77B 5EO9A 4PY8I 4LSSH 4U6XA 4MNGE 3PGCA 4H0HB 3H42H 1M7XA 5E9DB 2D31B 2NY2D 3E3QE 3TYFB 5DHYA 3CMOL 3FQTA 2NY1B 3VI4E 3KPRA 3CCHB 1CLYL 1SM3L 3BKYL 4M7ZC 1CICD 3SDAD 4ZXBD 3CFBB 1RJYB 1F4YH 4XHQA 5JTWA 2MCPH 3KPRB 4MQTB 3W2DH 1M1SA 1SY6L 5CEZE 1J1PL 5EIIA 5DJXB 2X4NB 2B7DT 5I76B 3ZKMD 5JW4Q 2GJJA 4ZS6D 1BVLB 1S7TA 4AT6B 3TCXA 1IEHA 1I8MA 4WI2A 4OJFL 2FJHA 1JBJA 3RGHA 4Z78B 4M93C 4IMLB 3WIFB 5FUOL 1M6OB 1XH3A 3OKKA 2A6JB 1D5ZB 2PO6C 1FNFA 4J23A 4NUJA 2Y5EA 1WBXB 4U3CA 5HVGB 4WWID 4XPAL 4HV8A 3B2VH 4X5WB 4OF8A 2R4SH 5BQ7A 5FM5O 1A9BB 3CX5K 1EHAA 1P9MC 2AXGA 3MNWB 3U9UB 3FQNA 4JO3L 4TNWF 5I1KH 1X5XA 2PYED 4S2SB 2IAND 1KPUA 2QQKH 3BW9B 4XNZB 1CDCA 2IF7A 5IK3A 1HHKB 4WTZA 4BUGA 5FCUH 5BXFA 2XWJB 1HKLH 5GS0H 4XH2A 4QNPF 5I1JL 2AVGA 4I0PC 1E4XH 2HFGL 3B9KC 1HNGA 1A7PL 5IVXF 4JKWA 3T0EA 5IKCB 1X4XA 3W5MA 4TSAL 3P9MB 4YE4H 5J12B 5BZWB 1BIIA 3HC0B 1F2QA 1QHOA 4AK1A 1CFVL 1YEGH 1O0VA 1XF2A 2R39A 4Q6IB 3BGFB 3R0MA 4RMWA 3C5ZA 3EHBC 4U1SB 2EEDA 1TTUA 1OOAA 2VN7A 5I6XC 1IC5L 4H1LG 5I66B 3VDCA 1MJJB 4UQ3A 1BBDH 43C9B 2PN5A 1A3RH 4DGVH 2B1AL 2R4RL 4Y4KC 3OR7A 3KYMB 2WZPD 3ZHLA 1EO8L 5C08B 2IGFL 4ONGH 1JNNL 4F7EA 4O2EB 1S9VA 5KVEH 4GJTB 4LDEB 3RIAF 2D3VA 2VLMD 1JHTA 4GAJH 3C5SA 1EHNA 4F7EB 5HHQA 4R9HA 2QV2A 1FVEA 3MODL 5DK3A 3UJTH 2IMMA 2X4PB 3WHE0 1F42A 1I1AB 3BPNB 3D85A 3NIFF 4IRSD 3HE6B 4K7PH 4LCCB 2YZ8A 4LVEA 2LVEA 4HKZB 2V2XB 5C3LD 2DQJL 1NEUA 2WUBH 1CE1L 4DVBA 1KBGH 2J3SA 5BVJA 5L8JB 4FQPA 3IAQA 1H3VA 3MRIB 4I0KA 5HDOA 3VXOA 2APTA 1UZ6E 1LE5A 4I18A 3MV8B 5C2BL 3NABL 4WY7H 4XNUH 3VXOB 4MNHA 4LIQE 5T3ZH 2EXYD 1UWGL 5ESQB 2D7NA 2NXYB 4JPIA 4TVSa 4UT6L 2FO4A 4EUPG 5I1DA 4JRYE 3RY6A 3L3JB 4NNYB 1CFTA 1UB6B 4JFHE 5J56B 2VSDA 1FO0H 3P4LA 4G6JH 1X9QA 2QL1A 1RK1B 3VW3L 4PJFE 3IRPX 3OV6A 3I3EA 1IGFH 3HCVA 5C0RL 1FAIH 3HS0B 4G9FB 5LCVH 1A7RH 3WD5H 5TJWK 4H0GA 3HCVB 4Y16A 2W0FA 5FO8B 1M71A 4MAYB 4D9RD 2EXWD 5CUSL 1GPOH 4ZUSB 1ORSB 1I1YA 4YHLL 3FN0H 4LSUL 3KJ6L 3MGTA 3IDIB 2CDEA 3O4LD 4UV7H 1V3LA 1INQA 2P5EB 3QFJA 3DGGA 2MTPA 1MHHA 5E2UL 3MGTB 3RDTA 4F15B 3AS1A 2GAZB 4XRCB 5F1KC 3MLSL 3P4MA 2R2EB 4P9HC 5JOEA 5J9PB 2IQAA 1CU4H 5HYEA 4NFBA 2OR9H 4DK6A 5JXAL 4APQA 1G1CA 3ARDC 1BZQK 2UY6A 3T2PA 1IEAB 4R4BB 1IAIL 4APQB 3S36L 4UIMB 3TBYA 3OSKA 4CL7A 4DQOL 1UZ8B 3IJSA 3O45B 2B0SL 3PL6A 4I3RH 4RAVB 3WS3A 2HJKB 4LLUB 4GUPA 1SJVA 3VI3E 4N8CL 5B8CC 5C0CA 5E6YA 4U1NB 4X6EB 5C0BD 4WHYH 4NQTA 1SMAA 3T0DA 3LQZA 1VGEH 1T03H 1R3LB 1BVZA 1RZKL 5I17B 2V5RA 3NZ8B 2K1MA 3BP7A 3VXTB 2VDRL 1TVDA 1GSMA 3V6ZA 2HKHL 4P3DA 2VH5H 2I9LA 5GHWH 1A6ZA 3D69A 3THML 1AHWB 4BQ6A 1IAIM 3AAZB 2CKBH 4TQEH 4P3DB 4KMLB 2DIAA 3H3PL 1KCSH 4MXVF 2SEBA 4LSPL 1DN0A 4HXBH 5BZDA 2AV7B 5DK0B 1ETZB 4KKBD 2NY3B 1NSNL 2JCCA 5GRYA 3KYKL 3MYZA 4NQUA 4Z7VA 1JTPA 4OZ4A 5GGVL 4YXKL 3VXRD 3OR6B 1NL0H 1MFBH 1YPZE 3QIBD 1N5AA 5I19L 1ZT1B 4U6YB 3O8XB 1H3UA 4HD9A 1G84A 4PP1C 5BV7C 1NC2B 1MHPH 5D2NA 1FGVH 3VXMD 2Q8AH 1N5AB 5FB8A 1FFNB 3IDJB 3BN3B 4XP1L 3BN9C 3GSNL 3BZ4A 1MCCA 5KSAC 4Z0BL 4A6YL 1K8IA 4W4NA 1IT9H 1JF1B 3O9WD 3PWNA 4HXAH 4R4FH 3G5VA 4QRUB 4RGOH 1OQOA 4BFBD 2QSQA 4PJ8D 4U0QB 3WYRA 1QEWA 1PG7L 3STBA 5GS2H 1GHFL 3BRDA 3RUGA 5KOVC 3WN5B 4HWZB 4U2YA 2NPLX 4KV5F 5CEZH 3QCUH 5IVXE 2I27N 1NPUA 4YHKL 3GSUA 4KROB 3TO2A 1XGQA 3NFNA 3FL7A 3GSUB 2B5IB 3TO2B 1XGQB 3DUSB 2VWEE 5ADPL 4DFHA 5IT2H 3UTOA 4D8PA 3FB6A 3PGFH 4U6VH 5HYJE 2OJEB 4YNYA 1CTNA 1LGVA 4KKCD 4YQXL 4GG8A 4H25A 3HI6H 4NZRH 3QZWB 5C0AA 1A4KB 4NP4L 1NQBA 2DI8A 3O0RL 4L3EA 1FCCA 1JYNA 4P4KD 2DLFL 2YD4A 3IDMB 4NM8H 1FRGL 3B5HA 1ES0B 2YD5A 4XCFH 3ULVF 5F89A 3L3HA 4KTYA 4F7TB 5KJRH 4CN1A 4UBDD 4LOUC 2YPLB 3TIDB 2IAMD 4O2CB 5GZOC 3QO1A 4P2OD 3NCJH 2HYMA 5GSVA 5DRWB 5KBNC 4HWUA 3BRGC 1CD1A 2OXHA 4PJ5D 4CJ1A 2VJXA 3WIIH 5EOQL 3P11H 1P53A 2E9JA 4OCNC 1ZHLA 4L8DA 3ZDXE 3T0BA 5EU7E 1JNJA 5CJ5A 3HZMA 3V4UL 5KW9L 1MCPL 1HXYB 4YHIA 1FFPA 3GSQA 5C0JA 3FQRB 3NA4A 3OKDB 4UUJB 1S7QB 3O6LL 2JELL 1FFPB 5CILL 3G6DL 5K59F 2YWYA 2HWZL 1SBBA 3ULUH 3VJ6A 3RL2B 5TH2A 4PGJA 1YMMB 1RUQH 5F7LB 5IMOB 3QNZB 3BKJH 3MJ9H 5FYJH 3QCVH 3IDUA 1OLLA 4PJCA 1DBBH 1KEML 2CR6A 3GRWL 4I9WE 4JRXE 5CEXA 3ARYA 4JREC 1RIUL 2DTSA 2QSCH 3DPBA 3GO1L 5E95B 3VMNA 5CJXC 2DDQL 1U8HB 4PJCB 5JOFA 3HPJA 3IETB 4OCYL 4Z76A 4AG4H 1Q72L 3HZKB 5E9DE 4D9QE 4OQ1A 4M7ZB 4R0LB 2VXUL 2X7LB 4XMPL 1MOEA 1EERB 3AREC 5JOFB 1FN4B 3HPJB 1CT8A 5HVHC 3MGOA 4Y88A 2PR4L 4TNVF 4EDXB 5J1SC 3QEHA 3O6ML 1AIFA 1CXLA 2F5AH 5F88A 3MGOB 1VGKB 5D1XB 3KPRE 4J3SA 4FQIH 5T3ZD 4LPXA 1I9IH 3VXSB 1DANU 4WWKB 1NCAH 3E2HB 3QQ9C 2NZ9D 4KHXH 2XZAH 4M8QA 2PO6A 4OFIA 4ODHL 1E28A 2J8HA 4RIRB 4TVPE 4XBPB 5TDPB 1K5NA 2CUHA 4KJYA 2YA1A 4FZEL 4AH2B 2C7UB 3TBSB 1QSFA 2IBGA 3VFPB 3D48R 4LIQH 5D1ZC 1NKRA 1OWWA 1P9MA 3LKQA 4JFFD 4HAGA 2XZCL 1QSFB 2APVA 1TJGL 2YD2A 4XPTH 4NQDB 3LKQB 2VIRA 3KAAA 1JWSA 1NCCL 3QO0B 3U0PB 5IV2B 5D7LB 2ZUXA 1P4IH 5DJ0A 1A6AA 4MA1B 3R1GH 4XTRC 3IF1B 5JHDD 1BECA 3BFOA 4EOWH 4BH7A 4FQ1H 3RZCB 2P24B 4I0PA 5HYSB 1Z0MA 2I26N 3B9KA 4C4KO 2EYSB 4OLXL 3G04B 1T2JA 1UWXK 5C0IB 3DX6A 3ROLA 5BW7C 2DICA 4Y19D 3QWOA 4PRPD 5JUEH 2FYYB 1CDBA 1W0YT 1W0VA 4UV4H 1NCDL 2W60A 4Q9RH 3N9GL 5I1LB 2EO9A 4XXDA 2BNRD 5C0GA 4LCWA 5DT1L 5ESAA 4JE4B 5E8NA 1ZANH 5KN5A 1U8OB 2OP4L 3TM6A 3QHZH 2HRLA 3RIFF 2L7JA 1B6DA 1NAMH 4PRHB 3T0EE 3TJEH 5FM8A 1XF4A 2ATPA 3VMOA 2CDGB 4X98B 4GRLB 2E3VA 4LRIC 4M4PA 4YPGA 5A2LH 1E6JH 1K9TA 4G3YL 1FIGH 2RR3A 5IB2A 5C0ND 1XF4B 4KZEH 4Y4KA 1MAKA 3RWCA 2AQ3A 4MJ4A 4WW1B 3PHQA 4OGZA 4OFDA 5IQ7L 3V4PL 1GXEA 3HUJB 5JIIA 5FGBC 2YRPA 2Z8VC 1C16B 4HJ0C 4K3EL 4YXLH 4XP5L 5J06A 3FO2B 1EO5A 3K4AA 1JGEA 5TPWH 2HJFA 5HHXH 1S9WB 3MV7D 1LEIA 3ARFB 4U1LA 4BK5A 5C08E 2HFFA 1D9KD 3F58L 3IDYC 1A2YB 5CJQL 2XA8L 4RMVA 3MXWL 3KPOA 1I8LC 2V9TA 5K9QI 1BLNA 3UC0H 3N0PB 4NQCA 5F7EL 2E6PA 3L95A 3KPOB 2FX7H 3BEVB 3L6FA 4KQ3H 2DLGA 6FABL 2FR4A 4LASL 3AY4C 2O5ZL 2J4WL 3LRGA 2BOBA 3JWOL 2XYCA 3LSOB 4PRDB 1SEBB 3OXSA 1T4KB 2D7QA 2B39A 2ZSVB 4C4KT 5FA4B 1QACA 1VHPA 1V3MA 3ZKND 2HTKC 3QDGD 4KV5E 3VU2A 3EYQD 2EDLA 4NQXB 5E8PB 5IW1A 2CIKA 3DHMA 3GM0A 1RHHA 4LK4A 4KJQD 1IGML 2CMRL 3T3PE 4M6OH 4X7SL 1RHHB 2MMXA 4KKAD 2H6PB 2NX5A 3IVKB 1VCAA 3PJSA 4P48A 2FO1A 3MV8E 2X4QA 1JPGB 3ISWA 1V8HA 5M95B 2R1XA 1TJIL 3BP4B 1Q9WB 3VFRA 3RX8A 2AEPL 3E6FA 4OCSL 2HJLB 3HR6A 2XI9A 5FKAA 2P8PA 1E6OH 1F11B 5GS2D 3OKNA 2R0ZL 3OAYH 2UWEF 3T4AB 3UZVB 5CLWA 43CAB 1FLRL 4Y4HB 3E6FB 1NCBH 3FAWA 3WHXA 4XMLL 3U46A 3CSGA 1GGYA 4LSSL 2O5YL 4OZHB 2C1PA 3KXFB 1MSPA 4XNMB 2EE2A 1FZOA 3QDMA 3QRGH 3ARBC 4Q58C 1LILA 1DUZB 5TE4H 1F4YL 4JO2L 2MCPL 4MWFB 3W2DL 1J12A 4G8IB 4UT9H 5DQJA 5IEKA 1NEZB 3IB4A 3PWPB 1MWAL 1JHKH 2P5EE 3V5HB 4UT7H 4NWTH 1PZUB 5DURB 4GW1A 5DRXB 1NANI 2VLJB 4MJIA 3LB6C 3QA3B 3ARDA 1UXSA 5DJAA 4ESKA 4JGUA 4RBPH 5CSGA 3MRQA 1UXSB 3CC5B 3QFDA 4HEME 4MLSA 4W70A 3GJFH 2FSEA 1JZ4A 3B2VL 2R4SL 4L1HA 3RP1A 5DI8A 3QFDB 1ADQA 1WZKA 5F9DC 5E0QA 5B8CA 4E0RB 2QADC 2BOCB 2OXGA 4R97B 5I1KL 3V6OA 3NFSH 2NNAB 5IB5B 5E2TH 2QQKL 3VD7A 4PLJD 1QOKA 5DD3H 2A38A 4FQQA 5FCUL 3ZDZE 1JJUA 4IOSD 2BSTA 3TO4C 3QXWA 5GS0L 1NMAH 3S37X 4KY1H 3FN3A 3TBTB 1E4XL 1OQXA 3S96A 3CUPA 3JUYA 2IBZY 5ACZB 5EOTB 3BD3A 1T66C 1B6UA 2WBJC 4YE4L 3D3VB 1CD9B 2R15A 1G7PB 3H9SB 3TT3H 2EC8A 4KK5D 3KJ4B 3NCBB 4RRPA 3ZTJH 4ZFFB 3RNKA 1YEGL 1FE8H 1H3WM 1W72L 3G6AB 2G5RA 1OAXH 4U6HA 3SKOB 1UGNA 4GBXA 4X6CB 2DQDH 1A14H 3IJYB 1BFOB 1LO0L 5MERB 4FFVD 3UJIH 1BBDL 1A3RL 2YS4A 4DGVL 5KSAA 4PGEA 2AXJA 1YMHB 3F5WB 5KSAB 3LVEA 4ZPTB 5CBEA 2F8XC 1XR8B 4ONGL 1QPPA 3BI9X 4PGEB 2GK2A 4RNRB 5KVEL 3ZL4H 3H0TA 5CBEB 3MR9A 4GAJL 3AS2A 3BE1H 5BVPH 5GPRA 4HJJH 4X6FB 4EJ1C 3UJTL 1DQTA 3MR9B 4OLZH 3D0VA 1LWRA 4JM4H 3WNLA 5EULV 4JAMB 2DQFA 2Q20A 3RA7H 1NBYB 3P77A 3PWVB 4K7PL 2R0WL 2WLYA 1WC7B 3ILQD 3EW3B 1RZ8B 2WUBL 5IHLB 4TVPH 3BHBB 3IXTA 4JFHD 4PLNC 1KBGL 2ENSA 2M8XA 4JY6B 1BP3B 1S7RB 5MI0C 5C1MB 4YZFF 1EEQA 1OB1B 4BA8A 1LO4H 4PJHB 5DF0A 3IFLH 4FQXD 1FJ1B 4CMMA 4WY7L 3ULVC 4KVCH 1JGDA 5I16B 3GUTB 1WAAA 1MFCH 2ZUQC 3UTPD 4ELKA 2ARWA 3BDXA 3C6LC 4YEFA 3GJEA 5CZXD 1LP9A 1ZGLA 5CZVH 4PYGA 1FO0L 4G6JL 5DJZA 2Y06H 3SKMA 1PX4A 3IDXH 1DE4A 2IALB 4LPVA 5C0AE 1IGFL 1FAIL 4TSCL 5HHPA 5LCVL 2BHUA 2Z31D 3MCKA 1J88A 1N8ZB 4JDVA 4L3EE 1KG0A 1MRDH 3WD5L 3U0WH 2DKUA 1DQJA 2YPLE 4JDVB 5A16B 4XCYA 3K46A 4FTVB 5IG7A 3G6JB 5C70A 4LPYA 1KJMB 3FN0L 2NXZC 1X44A 2VZUA 2EKSB 2Z8RA 4ZUTB 2P7TB 5FF6B 3WUWG 2ZOKB 3MBEC 4UV7L 3VFTA 3VXQB 3JTTB 5HGGS 1B0GB 4NKOB 3CLFH 1N0XH 1WBYB 1MREH 4XHJC 1A8JH 5HI3D 4P5MB 3RGVD 1ORQA 4KRNA 2EDNA 3X3FH 1MH5A 2BC4B 2WUCH 4JFYA 3K8LA 1ORQB 2OR9L 1IAII 5CJXA 4OSUH 5L0QC 1YMME 3L9RA 4ODBD 1MH5B 2C3VA 4I2XA 5I71C 4JFYB 2Y5TB 1DEDA 3QIUD 3NCYS 4FMKA 5B39A 5ECJE 1QD0A 1NGQH 3GMOA 4QLRA 4C56A 1S8DA 5MEQA 1TQCC 4I3RL 5HGHB 5L6YL 2OL3B 3C9NB 5K93A 1XFPA 4PJCE 4NOFA 2D0GA 1XIWB 3AREB 1RSFA 5DHVA 1S8DB 3QI9D 2ZOLA 5DSCA 2J6EL 4YGVB 3WLBB 1S9XB 1T03L 5J6HA 3FMGH 3UBXG 2Z8SA 1KCRH 4DUWA 2ZOLB 3OKLA 4ZS7H 1G6VK 2KL6A 1FZMA 2DAVA 4KI5E 5J6HB 5GHWL 2B1HH 4HFWB 1NJ9A 4MNQA 3ZO0A 2IC2A 3KYNB 4YGAB 3WO4C 1MNUH 5D1ZA 4TQEL 4NKDA 5L7XH 1FZKA 3LZFL 2HTLD 3CSYA 4CVUA 3C60C 4BKLA 2Q6WB 5D1ZB 1LO3H 1EEZB 3G5XB 3FT3B 4OQTA 4X6CF 5IFAH 4NGHH 2IG2H 3ELAT 1S7SB 3MJ7B 1T1ZB 5L8KB 1AGDB 1MFBL 1NL0L 1QSFE 3VH8A 3RWIA 1GGIH 3IKCA 4ZMAT 2X4RB 4NQDE 2FWOA 1MHPL 3DO7B 2V5SA 1VFBB 5D7LE 2X1OA 4G6FD 4ZSOA 3S4SG 3RWIB 3A6BH 1X3DA 3MRRA 1LEKB 1QFWH 4LGSB 3AU1B 4FQJL 1KFAH 5BW7A 2PTUA 4ZSOB 2FLBT 1G9NH 5BJTA 1IT9L 3NCEB 3W39B 1WIPA 4HXAL 4R4FL 1A6TB 3NAAH 3L3DA 4NN5C 4RGOL 5EIVA 1AJ7H 5AG9A 5IJKC 2LTQB 4L4VA 1X5ZA 3MLVH 5HYJD 5DFTA 4NZUH 3SDDD 1W0WB 4ZPVA 5CEZL 3QCUL 4LRIA 1P84K 4J3OC 4OD1H 4XVTH 4OUUA 3MSPA 3LKPA 1CGWA 2IFGA 4JO1H 1MF2L 3QJHA 2BMKB 2EIZB 4QTIL 1MAJA 5FGBA 3N1FC 3TPUA 3DX9A 4PJ9B 5IT2L 1RK0B 2W65A 3FJTA 4UNUA 3S6CA 3PGFL 4U6VL 1JGUH 1KT2B 1WBZA 5FK9B 1KJ2B 3IT8D 3TA3D 4JRWA 5T3XE 4CN4A 3HUJE 5IGXH 3HI6L 3N85H 4X4ZA 4L8CB 1I8LA 4TOYH 2O61B 2CR3A 4NZRL 3MNZA 3RWHA 3TNNB 1C5BH 5CIPB 1GIGL 4CNIA 3O4OC 4NIKB 1EHXA 1N59A 1HHIA 2Z91B 3AY4A 4NM8L 3BDBA 4GW4B 3GSOB 2FHBA 1INDH 1CE6B 4XCFL 4NKMA 3HFMH 5E6ID 5KJRL 1T5XA 3EOAA 1FYTA 3MLUH 1UB5B 5ANMA 5IB4A 4KJWD 3LD8B 3QPQC 4KJPC 3NCJL 1NGYB 2VUOA 1T5XB 3EOAB 2RFXA 4TUJA 3GDBA 5IR1B 5T1DH 3ARVA 3WIIL 4NCDA 3P11L 1TMCB 4HGMA 3CZFA 2LAGB 2CRZA 4RAUA 4BYHA 2HT4D 4I9WD 2DQHH 3EIFA 4U1KB 1KIPB 5EDXA 4LSDA 3N1GC 1DCLA 5HPMB 2CRMA 4U1GB 5I1EL 4G42B 4JG0H 1XAUA 5E9DD 4JKKA 4D9QD 4RA3A 4OFYA 3ULUL 4Z5RA 2NY1D 3NA9H 1MHCB 2JB6A 4BK4A 1IM3B 4X7CC 1RUQL 5DGQA 1R0AH 3BKJL 3MJ9L 5FYJL 3MRKA 3QCVL 1DBBL 3T65B 2MSPA 4WW2B 4QRSA 2QQQA 1KXTB 4FABH 1IEBA 3ARBA 1AQKH 2YKLH 4TVPD 4GRWB 2FRGP 4OZHE 2QKIA 3KXFE 5B21A 4XBGA 4XX1E 2NY0D 3H7BA 3DMMB 2W1NA 1FZJB 3PDOB 3P4OB 1OTSD 2AJVL 3EDEA 2XG4A 4LVHC 5FM5M 3ALXA 2XNAB 1I8IB 2FX8H 5CINL 4ZUUA 2D03H 2F5AL 3JWDC 2KH2B 4XVUD 5B4MD 4FQIL 5DRZA 2XKSA 1I9IL 3ZZ1A 4PREA 1VFOA 2G9HB 4R8WH 1DLHA 4KDTC 5ICXA 4KHXL 1GC1C 2XZAL 5EZLA 2I9TB 2EDWA 1BWMA 1ZHBB 3P73A 4QY8A 3ALWA 3PHOA 2ZUVA 2MKLC 4F3FB 2VLJE 4JFXA 3ECBB 5MHSE 1FNEB 4LIQL 1HHGA 3DVNB 3RVTD 1MELA 5FYKH 1QQDB 4XPTL 1YEJH 3NVQA 3S5LB 2ATKA 5IB3B 4W6WB 5EU6A 1P4IL 5LQBH 1UACH 1LO5B 4K3JL 5EIQA 5GJTH 3R1GL 1W2KT 3TO4A 2OS7A 1G6RB 5EU6B 4QYOA 2X9WA 3IGAB 3LN4A 4EOWL 4M7LT 3WHE1 2YC1B 3CSPA 4NRYB 4QYOB 2Z9TA 1FV1B 5DQDL 3FO1B 3HZVB 4WDIA 1BX2A 1I1FA 3DNKA 1WITA 4DEPB 2WBJA 2YEZB 4FA8A 2XTLA 2VLKB 2OBGA 4RQQB 4Q9RL 4WDIB 3QR2A 3VWJA 2A83B 3GGWB 1IGTB 3O6FC 4Z95L 3QWRA 1KN2H 3P40A 5DK2A 1FL3A 3JTSA 4L4JA 1T7YA 1JFQH 4C59B 1ZANL 4PRAB 4JFPA 5IMKA 4EEEA 5CSZA 3QHZL 2HLAB 3D3VE 5DK2B 1F3JB 3H9SE 1NAML 5C08D 1L4IA 3TJEL 4D0CB 3FT2B 4WFEE 5F71A 4LLDA 1AD0A 1E6JL 2LU3A 4LL9A 1FIGL 1T3FA 3L7FB 4KZEL 2VZTA 4P2QB 4X6CE 5K9JH 4FP8H 1NBZB 4JFZH 1I9JH 4LHQB 3MTRA 1I1AD 4KHTH 4XZUB 1QLFB 3CFCH 3C08H 3HE7C 4N0FB 4P59L 4YXLL 3HE6D 3RVXC 5TPWL 1G0YR 1RURH 4M1CD 4YX2H 1FGNL 4XC3H 1D5MA 4ELMB 4MCYA 4PY8J 4QHNA 3QUXC 4I4WA 4BM7A 3MPCA 1M05A 5E5MB 1JGLH 2CD0A 4G43B 5HHMB 3SE3C 3UC0L 1VACA 5FO9B 1B4RA 4MCYB 4Y2DC 2PNDA 5ALBH 4KQ3L 4LMQE 5K9KB 1JWMB 2AK4B 4HUMB 1KTLA 1U8JA 1CGTA 1TQBC 5MEPB 5LGHH 2IH3A 5KZCB 3QXVA 4JQXC 3EZ8A 4P57A 3MRHA 5C2UB 4OZIA 5ACMA 1KTLB 1U41A 3BD4A 1HI6B 1SHMA 2NXYD 1SJXA 2J5LC 5FHAH 3HB3C 2FH6A 2BSED 2FHCA 4JFOA 2MQ0A 2VISA 1KF9B 4HBQA 5LBSH 5D7KE 4M6OL 4X6BA 3CZJA 3C6LA 4PJHE 2OX5A 4Y5VB 4Z0XB 4G9FD 5SWQA 3D25A 2AQ1A 1RUPL 1IQDB 4F7MB 3LV3B 4YUEH 3RHWF 4MAYD 1KJVA 3WFDL 1X5IA 3MV11 4MXWH 4WW2F 1AC6A 1WAAE 5KSBB 1NCBL 3HG1B 3L3GB 5EORH 4BQ9A 4WJ5B 2P5ED 5IF0B 4ZOEA 4X5XA 3TZVC 3QEUB 4XVSL 4XI5D 3QUKA 2EDTA 1I3UA 2VLLB 1F58H 2BDNL 2IPTH 1EUUA 4NO2A 5FECB 5EN2B 2EYRA 2CKNA 2R29H 3MBEA 3QRGL 4NC1C 1VDGA 5GRXG 3Q6FB 1AGCB 1HH6B 2PW2A 5TE4L 3MBEB 4FTVE 3G6JE 3IDGA 3JV0A 1PLGH 4WHCA 5DA0B 4UT9L 5DVKA 4G8GB 1MHEB 3SDYH 4J2XA 1HE7A 2VR4A 3ILPB 4EVNB 1KLFA 4HUXA 4NUGH 2FJFB 3Q1SH 4UT7L 4NWTL 4S10A 5E99H 5DVLA 3RU8L 2XACC 2K3TA 4RWHA 4CVXB 3BH8A 1B2WH 1MVUA 5T3XH 5L0QB 1F3RB 4JANB 3KWWA 1MVUB 2H1PH 2XOTA 2XZQH 4HFUH 8FABA 3FZUC 2H2PD 1J7VR 5HHOA 4H20H 1JWUB 1FNAA 3UROR 2XWBB 4L29A 4HMCA 5D2LA 5EU3A 3NFSL 3E0GA 1BFVH 5HHOB 2I07A 2R1YA 4JM2F 2UVFA 2JJTC 5DD3L 4DN3L 1A1OB 2OMNA 1KULA 5C09B 4KK8D 1E4XI 1IGCH 2P43B 4PJIF 1NMAL 1UJTA 2RGSA 3O11B 2NY3D 3GI8H 2YWZA 4KY1L 2HVJA 2BNQA 5J57B 1LEGA 4K94L 3IKKA 3TCLB 4PJGA 2V9QA 3QWQB 1HINL 3C60A 2GTWB 2BNQB 1KSRA 4YDLB 5IHZB 5KANG 4G7VH 3JV6A 3O8XD 1FSKC 1NC2D 5GIRA 1EIBA 4LKCA 2E7LC 3TT3L 3U7YH 5JHLH 1FE8L 4JJ5A 3RL1A 4PJDB 1J0HA 5GRVK 2X1PA 1OAXL 2JIXB 1WFTA 2LU7A 3AB0B 3MRCB 1T5WA 4HF5H 2DQDL 3WFHB 1KXVC 4KMQA 1A14L 3PV6A 3SGDH 1UFUA 4TTDD 3CU7A 1Y6MR 4LARH 3C8DA 1QBMH 5D93C 2WNGA 3QZWG 2CGRH 1EHLH 3LN5B 1UQSB 4ELMF 3ZL4L 5IJKA 4KROD 4ZSOE 5HI4C 4PB0H 2R2BB 3BE1L 4NN5B 1QRNB 4EI5C 3MRFB 4OZGA 1B3JA 4M48H 4HJJL 1EFXB 4AENA 4OLZL 2VDMH 1PAMA 3QEGH 4JM4L 4OZGB 4OFPA 4UTBH 2VDPL 4M5YH 2W0LA 1Q9LA 3RA7L 1RJZA 2VXVH 1KPRA 1PW3A 1NBQA 2KUTA 4B0MM 3TT1H 1GJIA 5CWSA 1Q9LB 2F53A 1V5JA 1KPRB 1R24A 1F4HA 4TVPL 1I7ZA 4Z7WF 5JW5A 5D6CA 5DS8A 1I3RA 4TUOA 2ESVA 1TVBB 2JJVA 5DEFB 1Q9KA 2X1QA 5KS9B 1F13A 3MNVA 1YEKL 4OI7A 1LO4L 1YJDH 2L4OA 2A6IB 4M7LH 1L9MA 1NDGA 1U93B 3IFLL 5IJVB 2AJ3B 1IAMA 4KWUA 3UTSA 2AJSH 3S3JA 2ARJB 3MLWH 4KVCL 1U8MA 1NDGB 2YPLD 5F1NA 3V0VB 4YBLC 4LEOB 2VYRE 4V1DB 1TVHB 4C83A 4DUXA 3BIKA 5F1NB 3EOTH 1D5IH 5CZVL 1HDMB 2ZCLH 3X3GH 5E7FA 4F7CA 2IMNA 2Y06L 3SPVA 1ZLSH 1R5IB 2RIKA 2EIDA 3BKML 5E8EA 5AUMB 5I8KH 4F7CB 1OTTC 3ES6A 1HH9A 1RI8A 1AH1A 1P5VA 4LLQB 3U0WL 3U0TA 4OAWB 1CK0H 2X4SB 2X4TA 1NC4B 2BERA 1IL1A 1XCQA 3LKNA 1CG9B 3TH3T 4XT1C 3WEXA 1A1MA 2GUOB 4XCEB 4X0KA 4GG6B 1Y6KR 5E1AB 2UWEA 4NNXB 1YMMD 4QO1A 1SEQH 4WNQA 3U36B 1A1MB 5KVFH 1CQYA 5KSVA 2Z0BA 1MQ8A 4QHUA 3MRJB 3CLFL 1SYVB 3GMRB 2DL2A 1MREL 5KSVB 4MD0A 2OTPA 1KIRA 5L88H 2DOCA 2OLDA 3PNWA 2VMFA 1JUFA 1U8NA 4TN9A 3X3FL 1DUYB 2QQLH 2WUCL 4MJ6A 5DJYA 1JUFB 3QQ3B 3SE9H 5JDSB 3QDHA 1J0YA 2IADB 5INCB 3QUMA 2Z35A 4JO4H 2PW1A 3NGBC 1KELH 1QFPA 4RMTA 3KLHC 5C71A 2OJZH 1OP9A 4KI5D 4MQ7A 1LK2B 4OGXH 5D1XD 1NFDB 3AMLA 4HH8A 4HKXA 1FQ9C 3VXSD 2NY6D 1NGQL 2AI0H 4WU7B 4FQCH 4WWKD 3IFOA 4F7PB 4N0YH 5HYSG 2Q7NA 4XPFH 3WDJA 4Y5XC 4GRWE 5IMLB 3IFOB 4HX1B 4DGIH 3D39A 4LVHB 4NYLA 1VPOL 4PV8B 1QA9B 4DZ8A 4KDTA 3QQ4A 4ERSH 3FMGL 1KCRL 4ZS7L 4NYLB 4PS4H 4CJ0A 3QQ4B 5GGTA 2B1HL 3TWCH 4NQDD 3WL9A 1HHJA 1RY7B 2OZ4A 5D7LD 3F7QA 2DLHA 5IROC 4KPHL 3CVHA 4BFIA 1AQDB 4U0RC 4OBSA 5TF0A 1A6UL 5E70A 1MRCH 1LO3L 3OL2A 5IFAL 2DBLH 3RZCD 4LLWB 4NGHL 2IG2L 1BFTA 4ZOAA 4E5XA 1BEYH 3UX9B 2R23B 1FC1A 1CDUA 4OKDA 4UDTB 3MUGA 1RIVH 1GGIL 1Q9OA 3SJVB 3DIFA 2P49B 2W38A 3I50H 2GSGB 4Z7UB 5BS0D 1UWXH 1F3DJ 3A6BL 1Z9OA 4QOKA 1QFWL 3IJHA 2X2YA 1FL5B 6CGTA 3GB7B 3KPMB 1KFAL 2H8PA 1S7XB 5EU6E 1Y18A 1HILA 1QYGH 3RWGA 3GSNB 1G9NL 2NR6D 4QOKB 1RFDH 5D71H 4A6YB 1B0WA 5EPMB 3O6FA 4LP5A 4PRHD 1CL7H 5HHNA 4GRLD 4OZFB 3RWGB 3KNBB 1ND0B 3NAAL 1JTOA 1AJ7L 4HIEB 5J1AA 4HUKB 2ADJA 4JZJB 3MLVL 2VLKE 2YD3A 1IARB 3D2UD 2H3NB 4X83A 3BRFA 3HAEA 4L4TA 4KKLC 3ARWA 4OD1L 4O51B 4Y4FB 1NLBH 4XVTL 3FFCB 5GS3A 2HKFL 4DCQB 1BZ7A 3PWJA 5FOBB 1S7VA 4JO1L 1A5FH 1QFWM 4ZTOH 3VDAA 5D7IB 2F5BH 3ARFD 4NQEA 4J1UB 4KK6C 5KS9F 3PWJB 4NCC2 1U58B 3X13B 2C4FU 4HAFA 1YNLH 3MV9D 1KCVH 3HE7A 4D0BB 1Z9LA 1IC7H 3BX7C 3GIVB 1CFQB 5I1HL 4FQLH 1JGUL 2A6DA 3FFDB 4NO3B 2BHZA 4XNYH 2IPUG 4XCNB 3QUXA 1JK8A 4IJ3B 5E8DL 2M2DA 4TOYL 1C5CH 1P5UA 3BZFB 4PR5A 4J8RB 5IQ9B 3SE3A 1DQLL 2P8LB 4FOMA 5C0FA 2VO5A 1HQRA 4MAUH 5I18H 5GGRB 1TETH 4QXGH 4S1DD 1NGXA 1INDL 5F9AC 2PXYB 4ELME 3HFML 4JQXA 4Y2DB 5TDNB 1DR9A 2VDOH 5EZIL 4HS6A 1BZ9A 1RUAL 1HQRB 1G9ML 3MLUL 3LEXB 3P0GB 2WQ8A 1H9VA 5HHME 1AGBB 3QG6A 4KK9C 5DHVH 1RIHL 2VXQH 1UJ3B 4BSVA 2AK4E 3MQIA 3UTZB 4EI6A 4ZO9A 3R06A 1N2RB 5INDA 1NLDH 5DO2C 2J5LB 2QR0A 5T1DL 3BAEL 1XMWA 3DBXB 4EI6B 3GMLB 3I75B 4X99A 3R06B 5CD5D 1ZT7B 1NEZG 2DWEA 4NFDA 5DRNA 1FYHB 1I7TA 2DQHL 5F7YC 4Y4HD 1QG3A 3CIQA 4P23B 3CFKB 2GITB 4D9LH 5ITFB 4QHLA 4EBQH 2K7PA 4JG0L 5EBWB 3KXFD 4OQTH 5TGBB 1P2CB 1UADC 3GMPA 1ZHNB 2DLIA 3EJYC 3NA9L 5AZ2H 4U49A 2NMSA 3BIBX 3HR5A 3IRZA 3L5WA 1R0AL 3TIEA 3TZVA 1JHLH 5M7QA 1NFDF 4WUUB 4PD4K 4JCMA 3MRBA 4LVOB 5HY9A 5KSBE 3HG1E 4FABL 3PWPD 1AQKL 5HBBA 4JZNB 5HSFA 4LHUA 1QFHA 1BD2A 2BVUA 3VWKB 4I5BA 4HMEA 5DURD 2VLJD 4U7MA 5MHSD 4DN4H 3BPOC 3QUZC 4J4PD 4WO4C 2EYTB 3PQYA 4P2RA 1PKOA 5F3BA 2D03L 5CCKH 1TCRB 4JHZA 1QTYT 4R8WL 3MJ6A 4UOJA 5EFIA 4G8GE 1ERNA 1K4DB 2C1OB 1U92A 2GTZB 3RWFB 3Q3GA 4DGYH 4X7EC 3OAZK 1QLRB 4HKJB 3V5KB 1LE9A 4NN7C 1K4CB 3QNXB 3JWNC 1MCEA 5LWYH 3I6LE 1XEDA 4OCMC 4YIQA 3ZYZA 5BCAA 4PRIA 1N4XH 1LDPH 1DVFB 4JM2C 3GFUA 5EU5A 3MLTB 4IRJC 5FYKL 1YEJL 1ZVSA 2AXFA 4Z7UF 1OSZA 2WINA 1UACL 5CIPH 4LNRB 5GJTL 1H15B 1GAFH 4R4ND 1A9EA 2XKNB 2AJXH 2FGZA 3D3VD 3H9SD 1JV5B 3MACH 5HHOE 1OTUC 4E41A 4KDWA 5D2LE 5HJ3A 4J3XA 1TTGA 4JLRB 1AP2A 3WCYA 5EO1B 4M3JA 4OTXL 4UAOC 2E7LA 4NO0A 3HPLA 2OR8A 3KPNB 1KN2L 5EBLA 3UTTD 1GH7A 2BNQE 4XNQA 3HC3H 3UYRL 1TZHA 1JGVH 2EH8H 2ICWI 5HDLA 4M4RA 1P7QB 4QRPA 3RPKA 2DIJA 4ODXA 4NT6B 1I3GH 1TZHB 3SO3C 4PJDE 2AAVA 1MUJB 1OW0C 2XY2A 4FP8L 1OF2A 1JF5A 3MRDA 4NO5B 4JFZL 4L8BB 1I9JL 3CPLA 1EZVY 4GMTH 1CFNA 4PJXB 5KVDH 3CFCL 1T6WA 1YNKL 3ZMRA 4G5ZL 1RURL 4ODSH 1KPVA 4YX2L 3F7YA 5JLZA 1WVZA 3EDKA 3HA0A 4EI5B 3TF7C 2JK5A 4XC3L 3RI5K 1I9RH 3O41B 3GHBH 2ZWLT 3SO5A 3SQBA 4LKXB 4QRQA 4ZO6A 5F1IA 1JGLL 4PJAF 4XWGH 3F7YB 5HYFA 4WENB 1QRNE 1QO3A 2JK5B 5D7KD 3RWDA 5ALBL 4P5KB 3NFPA 3VE0B 3S7GA 4OZGE 3IU3B 5LGHL 5MENB 1U36A 4JY4A 1SJEA 2HN7B 4QCIA 3QEQB 3NFPB 1NFIB 1UEMA 3ORJA 1CZ8H 3BP6B 4PGZA 5DC9B 5FHAL 4O9HH 5SWSA 1FCGA 3LOWA 3F6IA 4A2MA 2BFVH 3PGDA 1LD9A 4TULL 1J0ZA 4EN3C