1U2HA

X-ray structure of the n-terminally truncated human apep-1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
b'KAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aortic preferentially expressed protein 1
molecule tags Contractile protein
source organism Homo sapiens
publication title X-ray structure of engineered human Aortic Preferentially Expressed Protein-1 (APEG-1)
pubmed doi rcsb
total genus 19
structure length 96
sequence length 96
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u2hA00
1IM3B 4IHOB 2G5BB 4HWZA 2XKUA 1YEGL 3PQYB 2MCPH 1RIVH 1YYLL 1OGAD 1CE6B 3B5HA 5IESH 2RCSL 4WFHD 3QUMB 4TYUA 1A6AA 1K4DB 4EIGB 3RNKA 3FONB 2E7BA 1NH6A 3DETD 4P57B 4WI6A 1EFQA 1WGOA 1NFIA 3W11C 3OXSB 4IM8A 4YGVB 1E27A 4DN4L 4BH8A 4NHCH 4XX1E 1JHLH 4HWZB 2WINA 1FNFA 3QAZB 4CADB 4XBGA 5F7NC 3FQXB 2BVOA 1VFAA 4BFIA 1N6QL 1EFXB 1T1ZB 2GQHA 2LV4A 4NOFA 1MRFL 1S7RB 1YYML 1G7HB 1RJZA 4PGCB 4OAWB 5DS8B 4A6YL 4MD5A 1BVLB 5C3LD 1AD9B 2DI8A 3LIZH 4L5FH 5DR5H 5CIPH 2ZUQC 1YYMH 1C5DB 3LPWA 3SPVA 5B8CB 1IAIH 3WKMH 2RQ8A 5L0QB 3VXUE 5E8EB 3L6FB 1QYGH 4QEGA 1G7HA 2E9IA 5K9KA 1LE9B 4Y1AE 2BY0A 3QEUA 1PFCA 5IIEB 1JGVL 4PS4L 5C07D 3WIIH 2JCCA 3E1F1 3UTSE 1U93A 4L3ED 3PDGA 1UWEL 3QUYA 4MA8H 5D7LD 1MHEB 3PWPD 4QXWA 5DRNB 1FL5B 4OIIH 2D03L 2J6EA 5GRZA 1UXSA 5EIVA 1MCPH 4GBXC 4NO5B 1RVFH 4OM1L 1ADQL 3IFOA 5HHPA 1T1XB 2GAZB 3IRPX 4NQDD 3VI4F 2QQQA 4O5LH 5KOMC 5EWIH 5FKAA 4BH7A 3QFDB 2GITB 2ZUVA 3KPMA 4NFDA 1X5IA 2YZ1A 4N1EA 4F7MA 3D48R 1BOGA 3ULUE 1O7VA 4NM8H 1MCSA 4HV8A 3EYOA 3EYUH 2LTQB 2BFVH 4HCRA 2VABA 2OTUA 4K23H 1UXSB 2Y23A 3IDGB 1NDMB 1XR9B 4YHPB 1RK1A 4QCIA 1F2QA 4GW1B 1CXLA 3LKRB 4GW5B 2XTLA 5E56A 1HCFX 1G6RA 1Q38A 3ILQD 5JHDD 2MJWA 4PJEF 2D7PA 4FXGA 1V3MA 2DLFL 4MDIA 1NMAL 4HCRH 4HKJB 4UV4L 1UCBL 4ZTPL 3U4AA 5DHVH 3VFSA 1N7ML 4MXQD 4NC2B 3QO1A 3O6ML 1WSST 4UIKL 3BUYA 3CXHJ 5GS1B 2MOVA 5DJ6B 4YC2C 3H42L 4LKXA 3RTQA 3AU1B 3O6KL 1DQJB 5SWZB 1QBAA 4KUCD 3HRZB 1AGDB 3KPSB 1AI1H 4JGJA 5HHMB 3IKCB 5JW4M 5KW9H 3BJLA 1F3DH 1ZGLB 2Y9RT 4QXTA 3TA3D 2AJYL 1MLBA 4OUUB 1NLDL 3VFSB 1F4HA 2GTZB 3DHJA 3WN5C 1W2KT 2IJ0C 5E99H 4JQVC 2ZCKL 4ZFGL 2HG5A 3QB7C 1HH6B 4K8RD 1RIHH 2HVJA 4LIQE 5HTSA 2UUDH 2L0DA 5IB5A 4LIQL 1NKOA 1A6TA 1QA9A 1XFPA 2ZSWB 4NZRL 3HKFA 4JY6B 4PRHB 2ZOKA 1YY9C 4HPOL 1NAKL 2OL3A 2CRYA 2VDOL 1FCCA 1NCWL 2Z31D 4KK5D 4X6CB 4I18A 5C0GA 1FGVH 3NCMA 5I16B 3QHFL 1WAAE 4O2CB 1HH6A 1Z9MA 2Y06H 4ISVA 5L7XH 5IB5B 5FHAL 4ELMF 3S4SA 1CF8L 4PG2A 3SQBA 1AXIB 3P9MB 1HILB 3LS4L 4LGPB 2MMXA 1SBSH 4F37K 1JPGB 1JRHH 4JFHD 4Z7WB 1AC0A 2LFGA 3L1OL 5H8DA 3MGOA 3S3PA 3VFNB 4K3JH 3ZE0E 4HF5H 1RZIA 2HWZL 3VXRB 1GZPA 5HI5D 4PGEA 4ODXA 4R2GB 2XKNB 2A0LC 2HKFH 5F9WB 5D7IA 1CIUA 1SY6A 3OAYK 3VFWB 5CP3A 3GFUA 4D9QE 3W82A 2BOBB 4Z7WA 3CUPA 4R8WH 2E7CA 4GMSH 3MGOB 3C5ZA 3EO9L 4PLOB 2ADIA 5JW5B 4LSRH 1JWSA 4PGBA 4P9HL 3PGCA 2BHZA 2DQJL 3BD3A 3IJSA 3HMXL 1J8KA 4G6JH 1GZPB 5E6ZA 3AAZB 1MVUB 1F8TH 5T1LD 1BFTA 5E8NB 1EEYB 3D25A 3SDDB 5D7LE 2OI9B 4MSWB 3GSVA 2DJSA 3X13A 4GW4A 2VITA 2OI9C 1A6UH 4PRAA 1RZKL 4G7YH 3GMMA 2F74B 4O51A 3QUMH 1UQSA 3QI9C 2I07A 1DFBL 2X1QA 5HHVL 4OFVA 1WFNA 4JGUA 3IU4L 3TBVB 2YSSA 4U2YA 3U9PH 5GGUB 1IGFH 2R0WH 4KMTL 3KXFA 1QHOA 1SY6L 4HPYL 5B3NA 2WQ8A 4UNUA 4JN1H 4L8BB 5IMMA 3GSVB 3BGFC 3BHBB 3X13B 3OSKA 2F8VA 3SKOA 4AY0A 1A6AB 4AIOA 1IGJA 3UC0H 2DWDA 5MEPA 1LO2L 3EYFB 5IT2L 4N0YH 5AD0B 4UV7H 2I07B 5IM7B 1TVHB 3OXSA 5JHDE 2G75B 3AY4A 3S8WA 3IS0X 4L9LA 5IBTL 4LCYB 4WO4B 3V7MA 2VQUA 4ZFFA 2A1WH 1U8JA 3A67H 3ULVL 1NCNA 5TDNB 5DRZB 3T04D 4XPGH 5GSVB 3VDAA 3QHZH 5MEPB 2A9MH 1FO0H 3IDMB 3OXRB 5AD0A 1M1SA 3KYMA 1KF9B 4GSDH 5A2LH 4PJ9A 4KJQD 1NAKH 2R0ZL 5IHBA 4RFNB 3MRQA 1YEEH 1OM3L 3VXMD 1M71B 2DICA 4LCYA 4WI2A 1ZKAA 1R3LA 1ROWA 4IRJC 3QJHA 5HYQA 1YEDB 1K2DA 1U3YA 5E2WH 1EX0A 2X70B 5FYJD 1DL7L 4ZFGH 4DVRL 5DR5L 1XIWA 2B1AL 3SN6N 3WFDL 1OF2B 1F58L 2IPTH 1P1ZA 1QRNA 3W0WA 5T1MA 1LE9A 4NO3A 1JIBA 4NWTL 4AZ8A 3F8UB 5GRJH 1FRGH 4BK5A 1MLCA 4HWNA 3GMQB 3LY6A 4MXWL 1LD9A 1Q0XL 2C3GA 5B4MC 3NFSL 1YMHB 1H3PH 2W92A 4X7SH 2APVA 3FO1B 4WFEE 1RHHA 3MUY1 3ZKMC 3E8UL 4S1RL 3VXOA 2ZP0T 2VLRD 3ARZA 2NQCA 1H5BC 3MXVH 3CIQA 3S4SG 2KBGA 2PTUA 3NBNA 1C7SA 3QWQB 3D9AL 2D7NA 5CIPA 2DQCL 3FQNB 1AQDA 1JRHI 4TOYH 2FB4L 2HWZH 1ZS8A 3O8XC 1WC7A 3CFCH 2Y25A 2DI9A 2Q76A 4PJ5A 3EO1A 3LKRA 4GW5A 5ALCL 5FYKU 1A4KB 3EAKA 1G6RB 4Y4FC 1U8MA 4K94H 1HQRA 3BI9X 4J4PA 2HT4D 4UTBH 5EZOL 2R39A 4JO2H 3H6JA 1EUUA 4S11A 1JHTA 2E5EA 3BZDA 3RI5F 4HKJA 1ES0B 4K9EC 4ZS6C 5LWYH 3DMMB 3SY0B 1BLNB 1HKLH 4EEEA 3KPQB 1OLLA 4GQPH 4QRSA 5DJ6A 4N0CD 4K3DH 4FHBD 1PG7X 2CDFB 1CDCA 3RU8L 1REIA 2IGFH 3LS4H 4HIJA 5IJVB 3DTXB 1DQJA 1UT9A 1VFBB 3WFBH 5DHVB 1KPRB 3BEVB 4AL8L 4NNYB 2BSED 1IKNC 4DKEH 12E8H 4Y2DD 5E7FA 3DARA 1IEBA 3K74B 3DVIA 2FGWL 5GSRA 3D3VA 3MJ9H 3UXFA 4LRIA 4ZXBD 1YEKL 4PJBE 4LAQH 2Z8WC 4QRSB 1ZLVK 3EIFA 4X8XA 1JZ4A 2CO7B 2N4IA 4Q74A 1T2JA 1T0MA 1BD2A 3IRZA 5T5NG 3LAFA 1VFOA 2WQRA 3F7RA 2P8MA 2BSRA 3R06A 3E6FA 2AABL 4I4WA 5FKPB 5IK3A 1EGJA 2Y07L 1I8KB 3CFDB 2ICEB 5C7XL 4DUVA 4YNYB 3FQRA 5DK2B 2JK5B 4YE4H 3IU3A 4AEFA 3HUJE 1F3DJ 3P4LA 4J3VA 1YNLL 4E42B 2D4FA 1U3ZA 3FRPG 4L4VD 4I18B 1T7WA 5L88L 3GSUA 4LHUG 4L29B 1BJ8A 4NDMB 4TUOB 3IFLH 3NPSC 4WI4A 1I7TA 2XICA 3DXAB 1QSEE 4ZUUB 5IB2A 4MNQD 4A2LA 5GGRA 3WUWB 4JKLA 4MDJA 3S4SB 4HT1H 5IK3B 5KS9F 2ERJB 2ICEA 2ZUXA 1RFDL 3RWIA 3T08A 1MI5A 5D6CB 5DFTA 2MPAH 4KY1L 4NT6B 1NGXA 2PYFA 1AGBB 1OT2A 5DUPH 1YQ2A 4TUOA 4X6DE 1XGYL 4PGEB 5EOQL 5BVPL 5JQ6H 1U8HB 4OZGE 5LCVH 3B83A 4I0PA 3QUXA 3RWIB 1MI5B 5D6CA 2MQCA 1HINH 1RULL 2HTLC 5BVPH 2ESVE 5E8PA 2QSCH 5DJYA 5JW5A 4ODSH 4D9RD 2DDQL 4MQTB 5D2NB 5B4MD 3B2VH 3QIBC 3UCRA 4KMQA 3G5ZB 5ICXA 4XVJL 2PXYC 4KGLA 4D0BB 4O2FA 2NX5E 3CZFA 4KAQL 4L3AA 3EJYC 1PZ5A 4GG8A 3ARDC 3VH8A 3HNVL 3GNMH 5E6YA 1NC2D 4ZMAT 3TNMB 4FNLH 3VFPA 1Z0MA 3VRLF 4HIIB 4M1GH 2K7PA 2Q7NA 4MA8L 2WWKT 1ZHBB 4GRLC 2BC4B 5LGJB 4TVPE 2CXGA 4GAGH 4G8IA 3PNWA 4HGWB 4JPKL 5EO0B 1NBZB 3P11L 4L8DB 3U30B 1W8NA 1QSZA 4MA7L 5CZXD 1J0YA 4HUVB 4YXHH 2NY7H 2XNAA 3O6LL 4HIIA 2HJFA 2OTWB 4Z77B 3QEQA 4H88L 3P11H 3IAQA 3CSBA 1U92B 5F9OH 2G75A 4YH6A 4TNWF 3DX8B 1CQYA 4LU5H 2I5YH 4NBZB 3K1KC 3Q6GH 4I3RL 5FUZH 5AWNL 4O2EB 2Z8RA 1Q72H 4P2QE 4QHMA 3ZSTA 5DRZA 2V2TB 3EZ8A 5DJDA 1AO7D 1MJ7H 2HFFB 1WITA 2LABA 5C0RH 2HJFB 5AZEL 4JFDE 3MRFB 2A6JA 1UJ3C 3CVIL 3F7PC 5HYFA 3VWJB 1RQ5A 1Z3GH 4YBQD 1G7IB 3K8MA 4M7ZC 5HHNB 3ZDYE 4RGND 1FC2D 5CSGA 1H3WM 3KDMB 1CTNA 1X5KA 5DHXB 25C8L 2CRZA 2X4RB 3NABL 3D69B 4HZLA 4JAMA 2M2DA 3KYNB 5J1SC 2A6KA 2LU7A 3MRFA 3QIUB 1ZT4B 3WLBA 2Y5TB 2FJGA 3OKDA 4HUUA 4POYA 1G0DA 3P30L 4LLMA 5DF0A 2DOCA 3QP3A 3RWDA 2PTTB 4DK3A 2W38A 3AFLA 1X4ZA 3EOBB 4R26H 5IW3A 3V0WH 4AK1A 4NQXA 4XP5H 1AGFA 5CSZA 4PLKD 4WHTB 1ZTXL 1ED3A 4BELD 4KKBC 1Q9WB 2ZKHH 3QQ9D 4IOFD 1JNNH 3QIUA 2IQAA 2MSPA 5DK3A 3BPNC 1Z9SA 2EDRA 3O9WA 1JFQH 1RAMA 1S7SB 4PJXA 4XVUD 4JFXB 5T1DL 3G5VB 5KSBB 1GGIH 2NLJA 3HHRB 5E6IA 1LO3H 3TCLB 1JF5A 4KUZL 1A3RL 5LJYH 3VXQB 4JVWA 5CJQH 4CJ0A 1LEIB 3EO1B 2FHBA 1IBGL 1RIVL 1YYLH 2ZZUT 3SHSA 2MKLC 4XTRC 4LGRB 2VLLA 5BW7A 1INDH 4PTUA 1ITCA 1NCAL 5BJTB 5FCSH 2H2PC 4OLXL 4PJXB 4F7PB 4JRWA 4A6YH 4UU9B 2ZG1A 1BLNA 3QRGH 3TFKC 5E24E 2VLRE 1HXMA 1JZ8A 1BZ9A 2WBWB 5MHSD 2EKSA 1C08A 1LEIA 4JPKH 4OZGB 2X4UB 3BXNB 4NN5C 5JOFB 3F5WA 1U95A 3T65B 4WUUA 3FHAA 5F1SA 5CKAA 1N8ZB 5D7KD 3IDYC 1UB6A 1ZT7A 3NZ8B 1BP3B 1ZA3B 1FVCA 4M48H 4OSUL 5DD5H 4I5BA 2BY2A 2DLGA 5JUEH 3U7YL 3I6KA 4AM0B 1W8OA 1I3GH 1VESA 5F9WC 4OI9A 3IDUA 4NQTA 1T0MB 5IF0B 5C6TH 1EBPA 3S98A 1U95B 1DQLL 4OZFH 3MO1A 3NZ8A 2R4SH 3BYTA 2IMMA 3TLRA 4FQCL 2DMKA 3BSZH 5C0AB 4ODSL 1ITBB 2CLRA 2GJZA 5F7WC 2WMPA 4E42A 2CDEA 3CH8A 1BWMA 2LE9A 2FX7L 5F44A 5I1KH 3RGVC 3GSUB 4HK3J 3RWGA 3WHE0 1H3VA 4KJWC 1HXYB 3RTQD 5F9JA 4PREB 1AXSB 3MRNA 4ZUUA 4JVPA 3VJ6A 3BISA 1HYRC 2GY5A 3OAYH 3SKNB 1D5MB 2NY0D 3C60A 3EFFB 3MLUL 1BQHB 1JV5A 4PJ8A 3FB8B 4RMSA 5IQ7H 3TA3A 3WCYA 2DI7A 4Z7UF 3MRLB 5BCAA 1F8TL 1K8DA 1CFVL 2PO6A 2AK4E 3FAXA 5FA4A 4PLJC 2NY6D 3B3IA 1FZKA 4JFDD 5FO9B 4YX2L 5DJXA 3JTTA 2BSTB 3O6MH 1J8HB 4JHWH 4KK6D 4FTVA 4NKOB 2R2EA 4L4VE 4HX1B 1X6LA 4DFHA 2ZCHH 3NH7H 2XFXA 4AIZA 3MBEB 4U7MA 3MLWH 2GHWB 3SDYH 3MV9A 1KIPA 5DEFB 5EUKA 2Y07H 3BN9D 5HHQA 5J4MA 3SJVA 1Z2KA 5DUBA 1SM3H 1UG9A 3CSYB 5D2NE 2CGRH 3S36L 1LO0H 4ZQKB 4J7RA 3RGVB 5T1KB 5C0NC 4NKOA 1EV2E 4GAFB 4ODBD 5F89A 3VMNA 5A2FA 3QWOA 1G7PA 3BP4B 2Y6SD 5DI8B 3QCVH 4F7EA 3WD5H 4YDLC 1A4JB 1AI1L 1YN7A 4ENED 1DN2A 5F7UA 4P5MB 3SDAD 5EB9A 1JPFA 3HR6A 5I18H 1NEZA 1J87A 5HI3D 1MAJA 3TN0D 6FABL 2O5ZH 3C9NB 2YPVH 3DSNA 2C3VA 1A3LH 1F6FB 4N5EC 4JM2A 5HI5C 4M1GL 4MHHI 4QRTB 2A0LD 1RUPH 4MD4B 2B39A 5DI8A 4F7EB 1BF8A 4Z0BH 1QNZL 5E5MB 1LK3H 3FZUC 4Z5RB 1HSBB 1HN1A 1NEZB 4EUPG 5DMJB 1CICA 3R8BB 3DSFH 5C07E 4Y4KA 4XP5L 1IVLA 2D2OA 3ORJA 4HKXB 4BSWA 4QHLB 3U6RB 1JK8A 4JEGB 4O2EA 1QR1A 5HHOB 4N9GB 5EBLA 4ZAKA 1XZ0A 1A5FH 2DRUA 4X9FA 1RJLA 4KMTH 2YRPA 2IPKB 2VYRE 2A6JB 5K59F 3H3BC 1OVZA 1UB5A 5CEYA 5F7KC 2FR4A 3PWNA 4MLIA 2KQMA 5KSAD 1KFAH 4DAGH 7CGTA 1OWWA 2B4CL 4PJ8C 4HWBL 1UADC 5JHLH 1WBYB 1G6RL 3WHXA 3P0VH 1QLRB 3KYNA 4AEIH 1F4XL 2GJ6E 3G08A 4QGTA 4RMRA 5JOPD 1WF5A 2FSEA 1IAKA 3PV6A 5INDA 2JB5L 3KLDA 4HW6A 1IC7L 1AO7E 4TVPL 5DTFA 4RDQF 3I3BA 3MXWL 3SDCD 4NQSA 3TBSA 4QWWD 2FO1A 1QLEH 4QRPE 1RU9L 5I74B 2X1WL 3EOBA 3RGVD 2QSQA 3I2CH 4LCCC 3SDCB 4LOUD 1G7LA 3VWKD 3UO1H 2HJKB 3BKJH 3H0TB 3MRDB 3DV4B 3OJMB 2FSEB 5CD3B 2IQAB 1IAKB 4NN6B 3VG9B 3WFEL 5I9QB 3VGBA 3DNKA 1Z9LA 1AIFA 3MV9D 4K8RC 4J3XA 4FQIL 4H0HB 3VXMA 5KANI 2ZPKH 4JFYA 3G5VA 4HH9A 2HFGH 3BP7A 4LSUL 3BRDA 5EIIA 2NY6C 4F58L 4OF7A 4G3YL 4KROB 3MPCA 4LLDA 4UOJA 4FQPA 1X7QB 3MUZ1 4Z7VE 1NBQA 3UTQB 1IM9B 3DX7B 3GMOB 4UT7L 5BRZE 5HPMA 1FG9C 1LO3L 5DRWB 5FB8B 4ZOAA 4Q0XL 1TPXB 2AXGA 3MGTA 3S3JA 1H8SA 4JFZH 2NY0B 3X17A 4D0CB 5I18L 2IFFL 1ORSA 3FT3A 1I3VA 1ZHLA 3CVHL 5GJSL 3SE3A 4AH2B 4XPBH 5SWZD 5ISZB 3ILQC 4ALAH 1MIML 2KZ1B 2DQTH 3MLVL 2R0LH 4PJGB 1KT2B 2XWJA 3VW3L 4QOKD 3K80A 2BVQB 3WE6B 1BBDH 3RA7H 3MRKB 3C2AL 4KRPC 1ORSB 1A64A 4FFYH 4NRXA 4BSJA 4Y5XB 3FRUB 4LRNH 3MUHL 5C09A 1H15A 3BN9C 4RGOL 1I3RA 2PXYA 3GBNL 1J86A 2FWOA 4OFIA 4PY7B 3B4NA 4S1SL 3TN0B 4UZGA 4P2QB 3BMVA 2E6JA 4P4KC 3X3GL 5JMOC 5IJKC 3FO0H 2UZXB 3SDXA 2HTKD 2R69H 3VD5A 1BAFH 1JGDA 4LF3A 3RVWD 2J7LA 4RGOH 5CAYB 1YPZF 2Y6SC 1MHHA 1Q0YL 4K7PY 3T3PE 3CGTA 2CLRB 2GJZB 3KPPA 4NNXA 4P59L 3MLTA 1XGUB 5TQ0H 1FFNB 5D7KE 1I3RB 2PXYB 5BO1H 1CL7H 4PY7A 5JPMA 3V7AE 1U0QA 1V3LA 1RUQL 4F3FA 4XMLL 3LHPL 3P4NB 2OCFD 3FFDB 3MRNB 3GJFK 4KRMB 4JHZA 2HVKA 4QGYA 5DK0A 2AI0L 1HHJB 5EOTA 3QDME 2AEPL 4JM4H 1QSFB 3IDJB 2NTFB 4YUEL 1EJOH 3WSQH 4YHML 3WJLC 5IVXB 4KVNH 1UC6A 2COQA 4P9MH 4GAGL 1K8DB 5C07B 4FQJH 3GUTA 3AS1A 3KYKH 3O0RH 4BZYA 5HGDB 3NMEA 3EOAA 5EBWA 4RMWA 1XGQB 3ULUF 2BSTA 1FH5L 2LU4A 5FYLL 1OB1B 5FGSA 4XX1G 2EIZB 1DE4B 4UQ3B 1LK2B 4Y19E 4CNIB 4YDLB 4UQ2B 1P5UA 3MBEA 5C0IA 1HIMH 3DUSA 4HS8L 1B0WA 1T83A 1HZHH 3GKWH 3H9SB 4R97B 4EN3B 4XNYL 5EUKB 1UM5L 2F5AH 3RTQC 3EOAB 2P5WE 4M48L 1DBJL 2VR5A 1VGKA 4PYGA 4WW2B 5EA0L 2EIZA 3DBXA 4CRPA 4YHNB 1CGVA 5LAXB 4ONFL 4M6MH 3UO1L 1OAKL 4HC1H 4JFFA 2VIRA 3DGGB 3CDGA 2ZUYA 1H8OA 1NAMH 2VE6A 2X4QA 1JPFB 1D5IL 3M45A 3T2NL 5IEHB 1NLDH 2ZOLB 1TETL 1ETZB 1MAML 3K46A 4NKIH 3SDCC 4KI5E 1NC2B 1EAPA 2VJXA 4JM2B 5A3ID 5CGTA 3V7AG 2OS7A 4CBPA 4JFFB 1T0PB 5HGBB 3WO4C 3RUGB 1L0YA 1RHFA 1FN4B 1YY8B 5GGVL 3FFCB 2A6DB 1ZXQA 5T33H 4P2CG 2W0LA 5KSBF 4K71C 4XNUH 3CLFH 1C12B 2NR6D 3CVHB 5I1HH 1NUFA 1S9WA 4P2OB 2F5BH 1A7BA 3D6GA 2NXYB 1N64L 4N8PA 1S7TB 1FFPB 1MRCL 1I1FA 1JNNL 3NTCL 1CLZL 4N9GA 4ZPTB 4Z7WE 2XQBH 3RDTC 4MAUH 2JCCE 4LLYA 5AAWA 2FIKA 2F9BT 3LB6D 5GPRA 2DAVA 1GRWA 2CKBB 2QSTA 3GSRB 3SGJC 3U1SL 4KRPD 1IMHC 4Y5YB 2ZCLH 4OKVA 1P4LB 4GRLD 4MMZC 3RX8A 1FFPA 4Y4FD 1I1FB 3MRBA 2X4TB 1PEWA 3TVMD 4HIHA 5DO2D 1RJYA 1DBKL 4ZS6D 3SGDH 4KKCD 4WUUE 4OLYH 4FABH 2JJSA 4MVBD 3BPCA 1QD0A 4HIXH 3QJFB 1KB5B 2SEBA 5F3BA 5TQ2L 4CVZA 2GJ6B 3AROA 3G9AB 2A6IA 4MCYB 4N9OB 4XVTH 1XCTA 2H3NB 3DVNB 1IGMH 3FB5B 3S3SA 5JOPE 1MIEH 4EQ3A 1F11A 3PWJA 1ZAGA 4WWKD 1HHGB 3WV0A 3BPCB 4YZFE 3HE7B 1P7QD 2FLBT 2HTKC 3BPOB 1MFAH 4PJFA 4Y1AB 1I8IB 2OMNA 3SDAB 3QUZD 2VUOA 4Z7VF 1MCEA 3PL6C 1YEFL 5IB4A 4H88H 1TJIH 1EO8H 3TIDA 4JFYB 4N8VA 2K3TA 5EIIB 3SOBH 2HT3D 3ET9F 2WLZA 5BV7H 4WU7B 1OTTC 1WWBX 4M5YL 4E41A 5KN5A 2AQ3A 1RJZB 2WBKA 4L3CA 4KI5C 1Q0YH 4ZSOB 1FL3A 3HPLA 3C09B 5DT1L 1I8IA 3FQWA 4QT5A 3U83A 2H2SC 2HAZA 4P59H 2DQUH 3CMOH 5MERB 5IGXH 1EO7A 5CJXA 4JCLA 4PUBL 4ELKB 1YEGH 3H3KA 3EDKA 3LRSA 3DV6B 3MRGB 2RCSH 1N4XH 1NBVL 4PJGA 1QSED 2EZ0D 3DYOA 3SCMB 3GGWA 2XPGA 3IDYB 3K2UL 4JG1L 2NY3C 2RIKA 2P7TB 5ID1A 2XZAH 5E9DE 2DQTL 2VLKE 5DEZA 1MHEA 2DIJA 4IMLA 1DP0A 1BBJB 4C59B 4YJZL 2ENYA 2UWEF 4NSKB 3NN8A 3VXNB 1LEKB 1TENA 3PXJA 4Q7DA 5D5MA 5HJ3A 4K71B 1CD0A 4I0PC 3RVXD 1OAYL 2JJTC 1UM5H 1FAIH 2VDNL 5I15H 3BRFA 1DBJH 2YD6A 3V4VL 5IFHL 3T0ED 3OAUL 1NC4D 3VI4E 2VABB 2NR6C 5L7XL 4N0UB 5DJAB 4NJAH 4JM2C 3PP4H 4NSKA 4LNRA 5F88A 4W68A 4F3FB 1PQZB 3CFKA 3RIFF 3C5JA 1SYVA 4LGSB 1B0GB 3MJGX 5F7EH 4L4TB 5DUML 1DN0B 2UVFA 3B9KC 3U79A 1K4CA 1SEQH 1SM3L 2OJZH 5EC2A 3VI3F 5C07A 5GS1A 3RPIA 2VXSH 2QBWA 1J8HD 5TDPB 1JWUB 4OZIF 3AU1A 2HKHL 3OQ3B 3LEVL 4K07A 1WLHA 4TOYL 3DHMA 1QFUH 3CFKB 3MACL 1JPTH 1EXUA 1SYVB 5GZND 4KXZI 4L4TA 2FO4A 4KTDH 5DD1H 4NQEA 4TNWK 3GO1H 1RV6X 1NLBL 4RAUA 4PB0L 4GAYB 3LEYL 1BIIA 3O3BB 3P73A 2ZNXA 3C8DA 3NIFE 3RHWF 1D6VH 3VXSE 2XTJD 2NYYC 1GPOH 3TJEL 1MRCH 1EPFA 1JUFA 4GRWF 1XAUA 4KAQH 1VGKB 4PJDE 5TE7H 4O4YH 3OKNA 3A0OA 3LS5H 3WO3B 3QNZB 2Q7YA 4MWFA 5L6YL 3UMTA 1KIQA 3T77B 3P77B 5D1QB 1OCWH 3V2AR 2DQJH 2H26A 4R90H 1P7HL 2OL3B 4IOIB 1LGVA 3O3BA 2HKFL 2F58L 4P3DB 2XN9B 4XVSL 4UDUA 2XACC 3RIAK 4RIRA 5LWYL 3M1BB 5HXMA 1WTLA 3PE9A 4OT1L 1MPAH 4UIMB 2BNQD 5IMLB 4KTYA 4U6YB 3J7HA 4EJ1C 1YEHH 3RL2A 3QNZA 1P6FA 1NAMB 1NSNL 4XNZB 4XCNB 5E2UH 1KIQB 4DGIL 5HGBA 4O58L 5EPMB 3QULB 4GXUN 1WAAF 3FAWA 4XAKE 2O5XH 4M00A 1MCJA 2F53B 4RFOL 4RIRB 4FXKA 3GSNB 2WAHA 3CVHA 4UT9H 3LDBB 5BQ7B 3VXRA 2F19L 3KVQA 3OWEA 2AEWA 4ZPVB 5HHXL 4APQB 3RZCC 1FFOA 3L3HB 2XZZA 1JMZA 1HCVA 3TIEB 3HMXH 1RZ7H 1DUYB 4HT1L 4KI5D 1MHPL 1Z9OA 5JPNA 3OB8A 4MQSB 3SO3C 4OD2B 3RNQB 1E0OB 3QO0A 4TTDC 4ENEC 2A77H 3TT3H 2IH3B 3DRQB 4QRQA 2VWEC 4NN7B 3IJSB 3PGCB 4FFVC 5EH1A 4M7LL 3IDXH 5GXBB 4JQIL 3UPRB 3HE7D 4F15C 5C0CD 1IE5A 4GKSB 3BKJL 3AXLA 5I1CH 4P23A 5H94A 4UNVA 1MCIA 3KLHD 2CGRL 3B2UD 4I48A 2R29H 3ARTA 3O45A 3TA3C 2C4XA 3X3FH 5D7JA 2VSDA 2YRLA 3QO0B 4MNGE 5I1CL 2BERA 2GCYB 1KPVA 4XGZB 3WUZA 1QUNA 2O93L 1H5BA 3M8OL 3E0GA 3OAZK 1CVSC 4GLRH 1FVDB 3R4DA 4CVUA 5CINH 4OLEA 1PD6A 1X5JA 5CJQL 1IFHH 3LB6C 4PJ5E 1VEMA 3KPRA 1CU4L 4I77L 3STBA 5D72H 3T3MF 2V5YA 2XKSA 3U2SB 4HAGA 4ZYKA 2OR9L 2VXUH 1CBVL 3OR7A 3FO9B 1WISA 4MJIE 4HWBA 4PB0H 4HXBL 5L9DH 4HPOH 5HYSB 3QDGA 3SGEH 5F96H 2G5BA 1QVOA 1CD9B 4HWEL 3JWDL 3MLPA 5KSAA 3GSOB 4WJ5B 1SEBA 3L3GB 5C8JB 4RGNB 1VGEH 4JFDA 2V17H 5K93A 3O8XB 1CG9B 3QDJE 5L8KB 1WBZA 1ZT1A 5LKNA 3HPLB 5GS0H 1OQOA 4PRPD 4CUCA 1M7XA 3HS0A 4H0IA 1CT8B 5F71A 3MV7E 4EZMA 1VFAB 1DLFH 1XGPA 4QF1B 4LQ1A 5BMFH 4O4YL 4J3OC 1UZ6E 2RHEA 2NY0C 3CD4A 1G7JB 4ELKA 3VXSD 1S7RA 1T7XA 4MQ7B 5IFAL 1S7XB 1P1ZB 5JO5B 5ENWB 2VNCA 4F9PC 4ZG1A 4PYHA 3TP4A 4XNXL 3U7YH 3V6FB 3SGKC 1FNHA 3IS1X 3GGWB 2KPNA 4YFLF 2AJSH 5F1NB 2J88L 2Q20A 4CDGC 4KFZC 1C5DA 2NXZB 3SPVB 3QCUH 3TVMB 3IGAB 5D1XB 1IQWL 5DSCB 3BFOA 1TVDA 2NNAA 1CFSB 1B9ZA 3MODL 5E08L 2H2SD 3DXAD 3U4BH 4JHBA 1G7MA 2PO6D 1XH3A 3QEUB 2AK4A 4H1LG 5DDHB 2JCCB 4Z7NF 1NCTA 1TZIB 2JJVA 4F8QA 4ONOA 1HDMB 2ESVB 1HE7A 2A77L 4M3KB 3TT3L 5CIPB 4EBQH 4FTVD 3GHEH 4XH2B 2GUOA 4NKDA 1MFAL 5JIHA 3SDDD 2P43B 3ZL4H 3IGAA 1QFHA 1ND0A 1JN6B 2Z93A 1J88A 5E94A 5DJAA 2A73A 2VSCA 4RAHA 4FS0A 3ZHKA 1T1XA 2GAZA 1J9CT 2W0FA 1EAJA 1J1OL 3T0EE 2NY5L 4JRXB 4QRRB 1KJVB 4GKNB 4C55A 3N1MC 3C5JB 3QXVA 5FKAB 4M8QA 3IJYA 1LDPL 1HQ4A 2PYEE 2YD3A 5HDQL 2LVCA 1R3IL 4M9OA 4ZUWB 1WCBB 2EXWC 3ZT6A 1ACZA 1JNJA 1Y0LA 1LO5B 5ANME 5EU6D 4BQBA 3G5YA 3QG6A 5EBMA 3IXAB 3MLZH 1BM3H 3BPLB 2I60H 3PABB 4LSPL 2Z93B 4G6AD 3IDGA 1MF2L 3WNLA 3D0VB 3IFPB 1JHKL 3G04B 4QCIB 5HGAB 5J12C 1CTOA 5DD0L 3OZ9L 2MTPA 1KJVA 3MV8B 8CGTA 1L0QA 1KCVL 2F15A 4KK9C 5ETUB 4YLQT 1MCCA 4JFOB 3CK0H 1T7YA 1HI6A 4JM2D 5IJKA 3ESUF 3P73B 4HWEH 3D0VA 5D1ZB 1C16A 4NQUA 1I3UA 4WV1A 2IAMD 3F58L 3IKCA 5SWSD 4YHLH 1BFSA 3ROLB 2YWYA 1LK3L 2DQDH 1NEUA 1M7IB 1RZKC 2HTLD 1F2XK 3HI6L 4BQCA 2EYTA 2XYCA 1Q9OA 1E6OL 1NCBL 2P24B 4DW2H 4FQ1L 2LQRA 1ZVHA 2NPLX 1GYAA 2P47B 2VDRL 3WUWA 2BVPB 3OKKA 4ZOBA 4KDTA 3WFDH 4HWUA 2Z4QA 3EDJA 1NMBH 1KLUB 3GMRA 4LLUA 1JGUL 3ZYZA 4B50A 4X6CA 1MAKA 4BZ2H 5J1TC 3P0YL 2IBZX 4U7KA 2A74B 3QNXA 1MFCL 5BQ7A 2CD0A 4LAQL 1A7NH 1EJ6A 3INUH 1B0RA 5EDXA 4DK6A 3ULVC 5K9QG 5TQ0L 5E08H 1A6ZA 3WFZA 3T4YA 3BH9A 4IRJB 4P2OC 1FFOB 2FZ3B 1T7ZA 4ZTOH 2X9WA 3HLAB 4XP9H 4ETQA 2V5MA 4JRXE 4KMLB 5HHXH 2FATH 5JPNB 3GI8H 5EOCL 4BZ1H 4KC3B 3VFNA 5DYOB 3LH2L 3MNWA 5D1ZD 1MCLA 2OSLB 3WO4B 3MZGB 1BVZA 2A74A 3QNXB 5D2NA 4EUPA 3NCYS 4Y5YC 3DROB 3QR2A 4N1CA 1WZ1H 4Z7QE 4JQXC 1BJ1H 4XAKD 3QCTH 5JORA 5GQBA 2FZ3A 1KC5L 4YO0B 5I1IH 3HLAA 2EC9U 1C5BL 4WDIB 1QBLL 1IGFL 2R0WL 4HFUL 4NZTH 1YNTA 4F33A 1S7QB 2D4DA 3MNWB 1G9NH 5IR1A 1QLFA 4YEFA 3QWRD 4NKQB 5M95B 1MVUA 4OGAD 5CWSB 4U1JB 2OXGA 4RMVA 2X44D 5EU6B 4Z76B 2MKWA 4NZUH 5DUPL 2W65B 4IRSD 1N4XL 1NBVH 4DOHE 3UDWA 3QUXC 4ERSH 1RZFL 3U2SA 4DEPC 4NQDA 2JJTA 1IEAA 1X3DA 3PP3K 3STLA 4P57A 4PJCA 3HE7C 3DUUB 5DA0B 2W91A 3WS6C 2VDPH 2ZJSH 4D8PB 4LSQL 3U0WL 5IR1B 1A21A 4MD0A 1MJJA 2I60L 2OX5A 1QO3A 4NIKB 1GL4B 3P0GB 1IGYB 2BVOB 3WHE1 4Z76A 4P3WA 1A7PL 1JMXA 5KSAB 5C9JA 4LSQH 4U1NA 4YR6A 3E6HB 1V7MH 3WN5B 2Q8BH 5E8DL 3V6OC 3G6JA 1AQKH 2BMKA 3GO1L 1H3GA 2MCPL 5C7XH 2DIBA 4DVRH 1DQDL 3UBXA 2XOTA 1ZEAL 2ARWA 1DLHB 1G7QA 4PJEE 3RL1A 4FQLL 3FB6B 4U6HB 4XMKH 2NXZC 2YC1B 3DLQR 1ZLUH 3UJTL 5FFLA 4DTGH 1Z5LA 3WBDA 2R0ZH 3PL6B 3G6DL 3HPJA 1INDL 1JZ3A 1T21A 1JI2A 5CILL 1GGIL 4NQEE 4PJ9C 2O61A 2I27N 3GSQB 4P2YA 2P5EE 1EIBA 5HPOA 2X6MA 1A9EB 3ECBA 1RPQA 3KXFD 5JXAL 5C0CB 3TNNB 2X70A 1BFOA 4PRPB 4QNPF 2G9HB 3UEZA 5EO1B 3PL6A 1DZBA 5T3XE 4PJBA 4S0SD 4PJAA 3ARGB 4PJFE 5I8CA 4Z7UB 3MA7A 3BDYL 3I6LD 3RZWA 2GSIB 4JQXA 1CWVA 4G6KH 4NQCA 1HINL 1DBAH 3T09A 3WFHB 1A9EA 3ECBB 5A43C 4HJJH 4F2MB 3RFZC 3RP1A 5I17B 4EOWH 3B9KA 3L3DB 3WNKA 3RRQA 3VRJB 1RZJC 3UP1A 4JG1H 5EO1A 1NDMA 4XCFL 4P4KD 4M02A 5I8CB 1LO4H 1YMMB 1JBJA 1N6QH 2DF3A 2P5WD 25C8H 2DQCH 2N7BA 1NKRA 3CXDH 3RVVC 4NRYA 3KGRA 2FB4H 1ZLSL 3EOYG 4F2MA 5D6DC 4NO0A 1Y0LB 3LZFH 5MENB 1MVFA 4O02L 1AGCB 3ZDZF 3D39D 1KG0B 3CVIH 5ANMB 1QKZH 3T4AB 5F7LB 4JGMA 4E9LA 3MTRA 1RUML 3BXNA 3RTQB 4IDJH 2OYPA 3CC5A 3U82B 4NRYB 3ZL4L 5ITBH 4W6WB 3O2WL 1HI6B 1N0XH 1V3JA 4K3GA 5GJTL 1S5HA 3VWJC 4LCUA 4RGNC 2LAGB 3KPQA 2AV7A 1UA6L 4P9HC 3BWAA 5EU3A 2CXKA 4HC1L 3DTXA 3CVHH 1MWAH 1KEML 1BX2B 3ARVA 2HRPH 3QXAA 4YDVA 2IADA 4S1DD 4GO6B 2VXSL 3BD5A 4Z7QF 1B3JA 2H8PB 1DEDA 2AJVL 4OZHE 5C86A 1ONQB 5IB3B 4MXQC 1J12A 2IF7A 2AJUH 5MI0B 5GSRB 3U30C 1NFDE 4PRHA 3U4BL 5DD0H 4JO4H 4Q9RH 1IKFL 3WEXB 4TPRH 3V5KA 1FNEA 1ZVSA 2IG2L 3PWLB 4WFFE 3UTSB 3MV8E 3L5HA 1JPSH 3TBYA 2BHUA 3W2DL 3ARBC 3C5SA 1ZA6B 3D2UB 3E6FB 4MJIA 4KKBD 4POUB 2OZ4H 1EA9C 4PJHE 1HILA 2GK0A 1UM6L 4L4TD 2VDLL 1BQHG 3ZKQD 5DD3L 4MJ5A 2MHAB 3TA3B 1JPGA 1EVUA 2BNQB 4WUUD 1V8HA 3SBWC 1OAYH 4IJ3C 5KVFH 3PJSB 3TN0C 1MJ8H 1P5VA 1SYSA 3FRPA 1R5WA 4KZDH 1LP9F 4BFEA 4WEUD 4X0KB 1DVFB 4FTVB 5D7IB 2QSCL 1FV1A 4P48A 4KXZH 5IVXF 1GGTA 1I1YA 3RKPA 5I1AB 3VGFA 2ZUWA 4PJ9D 1U2HA 2YD4A 3HAEH 1GH7A 4U6TA 2DLTA 1V7NL 1JYVA 3UYRL 1A14H 4OCXH 8FABA 4ZQKA 3RGVA 4KUZH 1CE1H 2Z8SA 2R1YA 5IG7A 3E8UH 1F4XH 1EEYA 2Q8AH 3KXFE 5ESQB 5FM5M 2YWZA 4WDIA 3CCHA 1ZLSH 4IRZL 2FNBA 4H8WH 3MNVA 4OCXL 4HQQH 2Z0BA 1FVEA 1V5JA 2F74A 4DAGL 3GHEL 4AENB 4YIQB 2KZWA 5DURB 3IKKA 2R2HA 3I6LE 3LEYH 5ALBL 5ID0B 4PJ8D 3TBVA 1M6OB 4PJ7B 1KLFA 1EH9A 1I7ZA 4KKCC 2JJUA 2R8SH 1MCNA 3WKNA 2HN7B 3KWWA 3BVNA 4J3SA 3A6CH 3AS3A 2QSVA 4HDIA 4AG4L 3VH8G 1TIUA 2NY2B 4Y4KC 3K7UA 2BCKB 3STLB 1HSBA 4RX4D 2X4SB 1VACB 3VE0B 3MLWL 4TUKL 1KJMB 3C8KB 1J1XL 1EMTL 4PJBF 4PY8J 5CLWA 2R2HB 4B0MM 2VERN 1JRHL 2VL4A 4OM1H 3GKWL 5CCKL 2EE9A 4HGWA 5TE4L 3SO3B 4UT7H 1NBZA 4NM4L 4I0PD 3RVXC 4B7IA 2M1KA 4ZFFB 4YR6B 3K81A 2PYEA 1QACA 2BP3A 3QXUA 3O4OB 3WL9A 1BPVA 1W0YT 1U8LA 3G6JB 1SVCP 5HDQH 4I0KA 2P48B 3PHOA 4J4PD 1U42A 1VACA 2A1WL 3A67L 3W39A 3VE0A 3QEGH 3FO2A 1AHWC 43C9B 3NOIA 2EH7H 4IRSC 5FO7A 4FQJL 5D5ME 1N2RB 4XBGB 3I75A 3RY6A 3M07A 2YHGA 3MROB 5FV1L 3RZCB 3SE8H 1KV3A 2CSPA 3OJDB 1YEIH 1RIHL 2W07A 1CZ8H 4P5TA 1GGBL 1RZ8B 3QI9D 1NCDH 4LASL 3K2UH 5JLZA 3HPJB 5BZWB 4OAWA 3ARGC 3G08B 4Q97A 1DBBH 4X6FA 4EDXB 5FO7B 3D3VD 1OAQH 5D1XD 3GI9H 3WS6A 3EBAA 4EQ2A 1S5IH 1A1NB 5C2BL 2VC2H 1JI1A 4HGMA 4I13B 4TQEL 4P5TB 3SDCA 3I84A 2QKIB 1BAFL 3MCLL 1J8HE 4Y5VC 4LDEB 3NFPB 4Z7UA 3MV8D 3VWKA 3HMWH 2VC2L 2D0HA 4OFPA 3GDBA 5F3HB 3S35L 4H20L 4L1HA 1AIFB 5ESAB 1KPUA 3MCLH 4OCWH 4S1QL 3HMXA 3FOLA 3M17B 4L4TE 4NWTH 4URTB 4NQED 1VFMA 4M62L 1ZSDA 4WGWB 1P69B 5DMYA 3VRJA 4XPAH 3CK0L 3I6GB 1S7UB 2WANA 3VXSA 1B4RA 3RIAF 4ZUTB 2ZWLT 2NY4C 2L4OA 2CPCA 1A5FL 1MI5D 3KS0H 4F7MB 5D9SB 4NO0B 5SV4A 3ZKMD 4MCZB 2JIXB 2WIIA 3F7VA 1WWCA 3M17A 4F7TA 3S6CA 5HYIA 1QPXA 3OTTA 3TCLA 4DKFL 4ODVL 4G6KL 4AH2A 5AYUH 4U1LA 3MZTA 4BKLB 3JUZA 3MQIA 1CGWA 1SBSL 3QFJB 4G8GB 5DHVA 4UB0H 2VDKH 3MMEA 2W60B 1PY4A 3WE6A 1E6JL 4C56A 4XC1H 2EYSB 1KB9J 1S3KH 5BJTA 1L7IL 1NGPH 4NRXB 2CK0H 4OI7A 4HUXA 3I9GL 2AV7B 1H0DB 1PLGH 2EDYA 3FB7B 2G5RA 3HUJF 5JW3H 1PY9A 1QHPA 1P4BH 3QIBD 1T2XA 2EIEA 4WUUB 2BSRB 1UWGL 1SBBA 1OP3H 2EKJA 4FFWD 4BSVA 3TBTB 5FGBC 3D39A 5ECJE 4N0YL 3OKMA 3C09C 4YNYA 2AS5M 5DK2A 3LHPH 5DXWA 4ZDHA 4AT6A 3D2UD 1Q1JL 1FFNA 4TVPH 1KSRA 4RDQG 1FE8L 2AJSL 3RVTD 1QLEL 4L29A 3LSOB 5J6HA 4NPYB 1ZA6A 5L8JB 4PJXF 4MJIB 2HVJB 4YK4C 3TBTA 3MO1B 4QHUA 5A16A 5L2JA 4YBLC 1RUMH 1U8IA 1XF5A 4P5TD 5D4QA 1L7TH 2VL5A 3BPOC 3UAJD 2QQLH 4OZ4A 5IQ9B 2APWA 4C83B 1WV7T 4ZFZB 1NMAH 3S96A 4MNQB 2VWEE 5IBTH 1SYSB 5EBWB 5A3IC 2V9QA 4Y89A 1R5WB 3HZYA 4X99B 3DETC 5B3JF 4LRNL 4K94C 4QRPB 1RZFH 1NJ9A 5C09D 1FV1B 1XF5B 4MX7A 2C1PA 3FQTB 2EO9A 1VKXA 1CLCA 5DMGD 4NKIL 3DUSB 5FDYA 2CRMA 1AC6A 4KPHL 3T0BA 1INEL 2ED8A 1ZLVH 1N3NA 2KL6A 3B3IB 3FL7A 4NHUA 3ABZA 5A2KH 5GJSH 1UACL 3GIZH 5DD3H 1IL1B 1WZLA 4LSPH 4Y2OA 2R1YB 5IG7B 1MJ8L 1YECH 5HHME 1HHKA 3OZ9H 4Q0XH 4P4RB 1ADQA 3TNMA 2AEIT 1KIPB 1YQVL 3LN5B 2E27L 2EH7L 4G9FD 3QUZA 2VLRB 1IGTA 4FFVD 4M5ZL 3S37L 5ISZD 3GM8A 4PGBB 5T5FL 2V7HB 3GNML 3QEQE 2ILLA 4Q2ZA 3CH1B 4PJIA 5LGJA 2CLVA 2XTJB 1WK0A 1QSFD 3NIGE 4JDTL 2H32H 3QEHA 1T22A 1G7PB 3SDDA 3OB0K 4PJAE 3L5JA 4TRPL 1PKQA 4JANB 3TV3L 5I2IA 4NQCE 2AI0H 3MJ7B 2IWGA 2D31A 5IFJA 1UQSB 3SJVE 4YPGB 4ZNEE 5JIIA 2ADFL 2Z31A 5J0BA 3TYGL 4GUPA 2FX9H 1WIUA 4LDOB 2GIYA 1TNNA 1CFNB 4X7TA 5FYJU 4Z95H 3KXFB 2YD2A 1MCWM 5CZKA 3GHBH 5F9DC 1PZUB 2W59A 4QHMB 4EDWH 4EI6A 1FBIH 4NQVB 5E2VL 4OKDA 4ZUSB 3O2WH 3UJIL 2Z91A 2WWKO 2D31B 4HLZH 5SX4H 1MCHA 2BNRE 4M6OH 3QCUL 4Z78B 5FECA 2OK0L 3ILPB 3GSNH 1G9MC 4UDTA 4OD3H 4GG6A 2GT9B 2D7QA 3P0VL 3H42H 3EJYD 3EO9H 3P9WB 4NYLB 4DQOL 1RJYB 4GRLA 4EI6B 2HP4A 4Q9QH 2BY1A 2R15A 5GGSA 4JAMB 1WFUA 3EJZC 4LSVH 2AXHA 3MUGB 1P53A 3OJ2C 1GGCH 1JVKA 4CU8A 3LZFL 1NSNH 2YD9A 3KYMB 2X1XR 1ORQA 4MXVF 1CDHA 4N5UA 3OKDB 4HUUB 1GC1L 2ITDA 2Z35A 3T0EA 4WTWA 3ZE2F 1M71A 2CIKB 5CZXC 5B39A 2YZ8A 3MOAL 1OTSC 4AIXA 3SEPA 1H3XA 4GRLB 1KB5L 4P46A 3RVTC 3VW3H 3MFFA 2BXYA 3ARXA 5KVDL 1YEEL 3HB3C 4Q6YA 5D7IE 3V52L 5B8CC 2VDMH 1FNAA 1NGZA 5FUCE 1AD0B 5I1GL 1UM6H 5DA4A 5EU7C 1ORQB 4CN4A 1BM3L 5GGTH 1KC5H 4Y1AA 2CMRL 5T3XH 3AREB 1KN2H 5IVZB 5F3HA 5F7DA 4GLRI 4X4XA 2YR3A 2EYRB 2DKSA 4WI9A 1AY1H 1NUNB 5E6IC 2NXYC 4YC2B 3WFBL 1UZ8B 3S35X 2WBJA 4Z7OE 3T2OA 5TPWL 2XY2A 4E41B 3RY6C 3I6GA 1T66C 4L3CB 4I77H 1FL3B 4DOHB 2QTEA 3WD5L 4OQTL 4OF3A 4P5TC 1MJ7L 9CGTA 5L0QC 1UEMA 5L88H 1B4JH 1F45A 3AMLA 1K5NB 3QQ4B 1LP9B 2JIXA 2WIIB 3F7VB 5HYJD 3BP7B 1ZS8B 4OGZA 5F6IB 1CFTA 2EKSB 5TH2B 3LRSB 3QFJA 4G43B 5KSVA 3CX5J 1WEJH 4M1CC 3T8XA 1EGJH 3BP6A 4D9LH 4DZBA 5E5RB 4FQ1H 2CIIA 1AQKL 1K5NA 2WIMA 2XT1B 3CLFL 3AM8C 4WFHE 2V5TA 3I6KB 5C6PB 3L3JB 5F21B 2DLIA 2VMFA 4LPUA 5CEZD 2I24N 4XXCC 1RZGA 3HNVH 1QBBA 1QRND 4RISH 3JV6B 3W0WD 4WFGD 2QQKL 3HZVA 3LOWA 5ADPH 1S9KC 3D18B 1BQSA 4OIBA 1CS6A 1M05A 5C0AA 4OF0A 43CAA 4ZDHB 4AT6B 3VXRE 5BW7C 1MCWW 5CJXC 1YEFH 3TN0A 3KPSD 4AQOA 2R56L 4FN0A 4I4WB 4QHUB 2AGJL 3EDEA 5ALCH 1I8KA 1U8QA 4HXAH 2ARJA 3D18A 1NL0H 3EFFA 3BIBX 1YDPA 2R2CA 4OF5A 3FB8A 15C8L 5JQHC 3MC0A 4OZ4B 2QQNH 5IQ9A 2EE3A 5IBLC 1U8OA 5FOBB 1CDYA 1OPGH 3G6JF 3S37X 5JNYB 2PW2B 3ARFD 4Q9QL 4ZO8A 4JFEA 4P46D 4U33A 4C57C 4PV8B 4WW1A 1FGNL 3FFCD 1OWRM 2VXVL 4S1DC 2GFBB 5HDBF 5T1KD 3LKNB 4YDIH 4HKZB 5ICZB 1FYHB 1Q8MA 2RR3A 4YFLI 1BIIB 3HAEA 4EI5D 3GUTB 4NT6A 4GKZB 3DURA 3OBAA 2I9TA 5AWNH 3CDFA 5KSBE 1GOFA 2PYFB 5I1DA 2NW2B 4QO1A 1Z6JT 5I9QC 4X4YB 4K23L 2H41A 3IVKA 3REVB 5F89B 4JCMA 3LKPA 3V6ZB 1UJ3A 2EZ0C 1HHKB 3R1GL 4DZ8A 4WHYG 1DANT 4IRJD 3HRPA 5KOVC 5TF1L 4X80H 3LN4B 4M6ML 5HHMD 2H1PL 2IANE 4KK6C 2V7HA 4MAYC 4P0DA 5DHYB 1Y6NR 3BZEB 4KQ3L 2C3VB 2HMID 3MBXH 5DMGC 4HBQA 3EO0A 3JUYA 1YEJL 4P5KB 3REVA 5TPWH 4IMKC 4R3SB 5C0BE 4G8GE 1T22B 3MLYL 3WNPA 4MD4A 4GG8B 3VH8B 3F58H 5TDOA 3L5WB 5EU5B 5JTWA 3B5GA 1T20B 3DYMA 4K7PX 1HHHB 3LQAC 2ZOLA 2IQ9L 3EOTH 2UYLB 1EZVX 4JO4L 4UOW1 2DL2A 2VZOA 4F80A 1CGSL 4G9FE 3U6RA 2YA2A 1Q94A 5GS3A 1PSKL 2ZCKH 2NTSP 3HAEG 2HFEA 1YY8A 1XZ0B 4JO2L 1OAZL 4XXDB 1FHGA 2OR8A 5T3XD 1HHIB 1T20A 1TITA 2R8SL 4QRQB 5GRXG 2IAMB 1UB5B 2EC9T 1MELA 3VD4A 4JZJB 3MLZL 1OL0A 3SGKA 4HSQA 4GKSA 3MRIB 2WUCL 2Q86A 3B9DA 3QPQD 5LG1A 3KJ6L 3RI5K 5TE7L 3UTZB 1DQLH 3PQYD 1A0QL 5GS2D 2YD8A 3IJHA 5HI4C 2CO6B 1IZKA 1IFHL 2R0KL 3MRPA 5I66B 1H5BB 1R3KB 3UPAA 4RX4A 1PBYA 2BX5A 5E2VH 1G7IA 2OBGA 1I9RH 4MJ6A 3RUGF 2X4TA 3U36B 2L7JA 4QY8B 5EC1B 5TFSL 3D39E 3LEVH 2K1MA 4GOSA 5DC9B 4JFHE 1WEJL 4JRYD 4XNQB 3VWJD 3PGDA 5F6HJ 1UYWH 1E4WH 1NUGA 3ARFA 3BO8A 2A6KB 4KDVA 3L5IA 2EECA 4OLUL 4GQ9H 5TFSH 2V7NA 2Q6WB 5IVZA 3DVNA 2EYRA 1SMOA 4MJ6B 4X7EC 1E4WL 4KI1A 3BMWA 1YPZE 3V0VB 5K9OA 3QXDB 2W9LA 5IBLD 4Y2DC 3ROOB 2PR4L 3V4UL 5C8JA 2WBJB 3PWJB 3N9GH 4OGXL 3WJLA 1MNUH 1PG7L 3SCMC 5E03A 2F8OA 3HE7A 5IHUH 3KPNB 1CG9A 4RFNC 3GMOA 5HPMB 4JZNB 2Z8VC 3AS2A 3ARGD 3HS0B 5KVEH 5IB1B 1OQXA 3U46B 5C08D 2XZQH 3QPXL 3EYQD 3WDIA 3HB3D 2IPUG 3TIDB 4OZHA 2EIDA 3B6SA 2NLJB 5I75C 4J2XA 3O3UN 5F1IB 3QH3B 1YC7A 4PD4J 1CK0H 4N8VG 3OMZA 3RVVD 4U1MA 1BZ7B 5DWUL 1S9YB 3BZ4B 3MOQA 5FV2A 1K6QL 3SE9L 5CBEB 4PRIB 3ZYJA 4R26L 3DVFA 3V52H 5HYJB 3SDXE 5MERA 1U3HD 5JXEC 3B6SB 3VWKC 1XF4B 3SKJL 1K85A 4JO1L 4U1IB 5L2KA 4JFZL 4P2QA 4ODWA 1RUPL 3T1FA 3UX9B 2P5EB 1IJ9A 1HNGA 1KLGA 1MF2H 1MOEA 5GGVH 1NCBH 5HYJA 2VXQL 1U8NA 5C0BD 5IHZB 3U9UB 4PLNC 4TTGA 4XB8A 2DM2A 5DMIL 2P44B 1JN6A 4YHIA 1H3PL 4HCRL 4M1CD 1MY5A 4ODWB 4Z0XB 2ZUUA 4WI5A 3P4NA 3MFGB 3IAPA 4HUMB 3O6LH 2B1AH 1CR9L 2XZCH 4K3JL 3W9DA 1XF2A 4WW2C 3ZKSD 2R56H 3HZMB 3CSPA 3ALPA 5D8JL 1RUKH 1QRNE 3W0WE 1N59A 4LLQB 2YUVA 5BVJA 1U8OB 5HDBE 3Q5TA 3O3EA 4G9FB 4Z6AT 5F88B 3PIQA 2ZSVB 4MQXD 4YHZL 1X5HA 2NY4B 3PWVB 5ESVA 3T1WA 4JFEB 3VXTA 1GAFH 5C0AD 5EZLB 2B1HH 1ADQH 2R2BB 3MREB 5SWQB 1FYTB 1BQHA 1JV5B 4HKZA 5ICZA 5EZIL 3MRLA 1S9XA 1I1AA 3PQYE 3H9SA 3GB7B 4JDZB 4EN3A 4GKZA 1S3KL 3TCXA 3CX5K 3DPBA 5BVJB 5J12B 1ZK9A 4U7SA 3GK8H 4YHOL 2EDEA 3BPNB 1IKNA 3JTTB 3DO7A 1ACYL 1EXUB 2JE8A 1RURL 1PG7H 2VDML 2XV6B 1CDUA 3VFRB 4X6BA 4XZUB 1M7IA 2X40A 3LKPB 4KZEH 5IV2A 4X4ZA 5CSBA 1UJ3B 5GGTL 1FYTA 4MVBC 4K94L 5IMKA 2AEQL 1AE6L 1KCSL 2UWEA 1A6WL 3MXWH 5GRVL 4FZ8L 1FFQA 2X4QB 5GJTH 1KCLA 5F7FA 5INCB 3SJVB 2AJXL 5GS0C 3CSYA 4KPHH 4JPWH 1EAPB 3MODH 5T1KA 1VPOH 5I6XB 3QUML 2AJ3A 1YN6A 3AS0A 1T3FB 4IDJL 3WJJC 3TBWA 2XQYG 3MX0A 3WXVH 1VADA 3KS0J 1FNGA 2A6DA 4K9EL 3JVGC 4X6EB 2DBJA 2ADJA 3EJJX 5FK9B 2VXVH 2YS4A 1KFAL 5GZOC 2Y36L 4OGAC 5GIRA 3O3DA 1GIGL 1S9WB 1YPZB 4P2OA 4UIMA 2DQGL 2NY6B 2R4RH 4LPWA 4OBRA 3X11B 2R23A 3L7EA 3AGVA 1ZHKA 3MR9A 3ARSA 1I8LC 3D3VE 3WFCH 5KZCB 1IQDA 3BH9B 1J18A 4IRJA 4OQTA 1TZGH 2Y36H 5F7MC 2JELH 5F7YC 5FGRA 1X4YA 1ZLWH 1VADB 4P3CL 3WIHA 3GI9L 2YEZA 5FK9A 2AXFA 3T2QA 4F15B 5GIRB 1H3UA 1WCQA 3HE6D 3EYUL 2DJUA 3A6OA 4YE4L 2ZG2A 1CZ8L 4PFEA 1JNHB 4ZPVA 3NCCB 5JORB 4LASH 1F6AB 5ABDE 4MA1B 3FMGH 3VGAB 2KUTA 4I3GA 5IEKA 2P8LA 4ODTH 1T0NA 1S8DB 5FCUH 4IIQB 5J1AB 3QIWA 1OM3H 1OOAA 2YEZB 3MLRL 3TPKA 5JDJA 2OZ4L 1YNTB 4F33B 1UKQA 5I8EA 2IH3A 2VAAA 5IVXE 1KB5A 1YJDL 3SO5A 5IFHH 1C5CH 2EDLA 3P9LA 2A6IB 4MCYA 4FP8L 3ULSB 3UPRA 1JNHA 3QQ3B 3TO4A 1MHCB 4MS8D 5DVKA 1FGVL 4RAVA 2VDPL 2ZJSL 4RZCB 4L8SB 1S8DA 4HJGA 4I48B 1D6EB 4IIQA 1F42A 1I7RA 2D9QB 1T2QH 4HXAL 4D8PA 4LQFH 4R7NA 1P6AB 4L9LC 4PJ7F 2DIAA 4LHUA 4X98B 1KTKE 2V7NB 2MQ0A 4GJTB 4IJ3B 1QBML 1FIGL 2DBLH 4NQSB 1I9JL 3PQYA 1NC4A 2IH1B 3V0VA 1WAAA 4KRLB 5HI4D 3E6HA 1RUQH 1P9MC 4NRZA 3WUWG 3MRRA 1I8MB 3UTTD 4FQXB 3C6LC 3TWCL 5HD8D 1I7RB 3U7WH 5TGBA 3FO9A 2BOCB 3GSXA 5GRVK 1NMBL 3N1FC 3BW9B 5KVGL 5CD3A 1CLZH 1R3HB 5DMIH 4GXVL 5IW1B 1GXEA 5JHLL 1DLHA 1G7QB 1IILE 4XRCB 3AC0A 3VXPB 3L3KB 5D2LF 4WGVB 1D3CA 3BOVA 4OZHB 1NFKA 5H2BB 3ULVD 1EFXA 2MWCA 4Y7MA 1HH9A 2MNUA 4XNXH 4KQ4L 5E00A 3QH3A 1MCQA 3CMOL 3LS5L 3X12A 2H6PA 2YOCA 5IBUG 4MQXC 1FJ1B 1EEZB 5ADOH 1S9YA 1IM9A 3DX7A 3PDDA 4MA1C 4YQXH 3BZ4A 4DUXA 1Q72L 3CU7A 4U31A 5HGHA 1WFTA 2GW5A 4PLJD 3E2HC 5BMFL 4X7SL 5IW1A 4M7KL 3RWFB 3B9EA 4RFOH 3AUVA 4LSTH 5AG8A 4D0CA 2VN4A 4QF1A 3QXWA 4IMLB 5IHLB 5E9DB 4NUJA 1G0XA 3EDDA 3TM6A 4C4KT 3QISA 5FEBA 4MJ2A 3TYFB 1LNUB 1Q9LA 2MCG1 3X12B 1YEHL 3VFOB 4HJJL 4J3UA 1EEZA 3ARGA 2F54A 3Q3GB 2GYSA 3L95B 4PJHA 3MA7B 4XBPA 3T1FB 5IWLC 4G6FB 4NGHH 3L7FB 1GGBH 1I7UB 2ARJQ 1FO0L 1CK0L 4M43H 1RZJL 3QUYC 3V8OA 3U9UA 2ATPB 1DANU 5E5UB 5DRNA 2YPLD 4NUJB 5AUMB 5D93B 3UPCA 1D9KC 4PRID 2NNAB 3T0DA 2VQ1A 2X4PB 4KQ3H 1YMME 3EHBD 3O2VL 1AY1L 2NY2D 1G7MB 3VFTB 4LSUH 2UZIL 1FG2A 3V6BR 1KJ2B 5JXED 4FQQA 2UY7A 4NJAL 4X80L 1I7UA 3WXWH 5HSFA 1RI8A 1MNUL 3BESR 4G7VH 4TSCL 4YDKH 5I71C 1OSPH 3O4LD 5CEZH 5I1GH 3KPLA 1G1CA 4YBHA 4NNXB 4KROC 1T03L 2D7TL 2V6HA 1XGUA 5DURD 2KH2B 1TQBB 4OCMC 3RPIB 2A73B 3ZE1E 3U9PL 5TDPA 4G9FA 3UJTH 4ODHH 2ZSVA 4BQ8A 3V4PL 3RWHA 3R1GH 5DZLA 5JMRA 4X4MA 3GMNA 3NCYP 1Y6MR 1ZLUK 1WCBA 1RIUL 5EOTB 1CGXA 3THMH 1KJ2L 5HI3C 1QSFA 3IDJA 4YAQA 1PKOA 3C87A 4N5ED 4I9WE 5F7HA 3IFNL 1I1AB 4LCCB 3GB7A 4JDZA 4NQCD 1JUFB 3S97C 1TZGL 5EUOE 5SWZA 1BJ1J 4MAYA 3HRZA 3KPSA 4FZEH 1BX2A 5D72L 1WTGT 1FNSL 1G6RH 3B9KD 1LK2A 4GMSL 1FO0B 3MV01 4M5ZH 5J13C 1N5YL 1MLBB 4RQQA 4JM2F 2B5IB 2OL3H 2XN9A 2FLRT 1C16B 4NN5B 3EJZD 4Y1AD 3MA9L 2PXYD 3M1BA 2BNRD 5CBAB 1XF3B 1NUDA 5IMLA 1DL7H 4L3EE 4KKLD 3KPRD 3L1OH 4FOMA 1OAZH 4RMUA 1NAMA 5FYKL 1XF1A 2QADD 4XC3L 4KK8C 4P2RB 5E95B 4MJ5B 1OTSD 1FNGB 3UTTE 4ONFH 4UILL 2W9EL 4BQ6A 2N56A 2J88H 5BOZG 3VXUA 3MJ9L 1XGTB 1YPZA 1JWMA 2LU3A 1OP3K 3TO4C 1QSVA 4OZFG 1VA9A 5EOCH 4BZ1L 1PGRB 1IQDB 4NCC1 4IEFB 3S5LG 4POZC 1K9TA 5CFHA 3QDJB 3QEGL 3SGDI 5C6TL 1FH5H 5FYLH 1WZ1L 1GC1C 2OP4L 4JO3L 2FX8L 4MB4A 4BK4A 2I9LB 3F12A 2X10A 2QL1A 2RBLA 2IEPA 4HH8A 1L7TL 2I5YL 3GSWA 5H37H 4M6NH 2D9CA 1HKLL 4D0DA 2FL5A 2ITCA 4GRMB 1K8IA 2PR4H 3KLAB 4LPTA 4ODUA 3MRMA 3X14A 3QDAA 3ARUA 2XKNA 1P9MA 4L4VB 3G6AB 2PNDA 4G80A 4IS6A 1FE8H 4M61B 4X9GA 4E0RA 5ESQA 3VFWA 2P8LB 4RA0C 2FH8A 1CIDA 2V9TA 5E2TL 2HRPL 3QBTB 5ICYB 5J1AA 5FGBA 5D7JB 2YBRB 2CKBA 4AENA 2FL5B 2ITCB 5JOEA 4R90L 1FZJA 4R2GC 3G5XB 1F90H 2VXTH 1O0VA 2XY1A 3D25B 4JFQB 3ZZ1A 4M61A 1BFVH 4BFGA 5HYJE 1AP2A 5GISH 2A83B 2YPLE 4JFFD 1UKSA 5ICYA 4U0RC 3MRHB 5J11B 2AK4D 5DZNA 3MYZA 1C1EL 2X4SA 2DN7A 4OCLC 3C8KA 1KJMA 4ELMA 5HYSA 2GJ6A 4YGVA 4MGXA 1J0IA 4AYFA 2E27H 4LVOB 1OHQA 3B2UC 3MV7A 3SDDC 1NC4B 2IH1A 4JFQA 4KJPD 4BFIB 4L8BA 2VRAA 5DRXA 3F6LA 1OT1A 4YHLL 1U8LB 4NQDB 2AJZA 1FIGH 3O9WD 4XXCA 3PHOB 4PGCA 1CICC 1R24B 3HG1D 1GJIA 4M8VA 4L4JA 1VEPA 5CJOL 1R3HA 4HULB 2GTWB 4PJFB 1MJJB 3RX5A 4OD1H 2B20A 2X41A 5E6ID 4RWHA 5IOPB 2WK2A 5D7LB 2IBZY 3MV7B 5IW6B 4LLWA 4XPAL 1OSZB 5BS0A 3DSFL 2P8PB 3EFDH 3RVWC 5LBSH 1G7JA 3L3IB 3IETA 4CMHC 2PCPA 4MQ7A 1RD6A 1NGPL 5DJ2B 2EC8A 1QQDB 3QDHA 4ZSOA 2KKQA 3K2MC 2WUBL 3FQWB 4QT5B 1P7KB 5IOPA 3RU8H 3STZB 3QUYB 5MEND 3UTTA 5HD8C 1JGLL 1A1NA 1EMTH 4XPTH 2OQJA 4D9QD 2WV3A 3TVMA 1QFWI 1KBGL 2V2WB 4GXVH 1MEXL 3DJ9A 3IETB 4RNRA 4WNQA 3S7GA 1UH3A 4KKLC 1T21B 1QEWA 5T1MB 4UT6L 1XH3B 4PB9H 3GSQA 5I8OH 1IAIL 3TWCH 3WKML 1JGUH 3SCMA 3BIKB 1EFXD 1AXTH 3DVGB 3KPRE 5ACZA 4DGYH 1HWHB 1R5VB 3FFCE 1T1YB 3O41A 2D3VA 4HF5L 3FOLB 2XRAL 2OQJB 5B8CA 2E8YA 3E2HB 3EDFA 1ZSDB 1ND0B 4JG0H 1NMCB 1T80A 4FQHB 4HGKC 5KBNC 3VXNA 4FQ2H 5IIEA 1MCFA 5D5MB 5EOCJ 1J11A 1P2CB 4M8QB 1P7QB 2VN7A 4XNYH 3S34L 1R5VA 3BRGC 4K55A 4AEIL 3W81A 5D70L 4HS6B 4LSRL 3FT2B 5JZ7C 1DQQB 4AL8H 4G6ML 1NDGB 4CW1A 1GOGA 3ZHDA 5EU4A 1BGXL 1GHFH 3ES6A 5ERWB 5CEXA 3MLUH 3RWHB 5FCUL 4ERSL 4FA8A 1I9IL 1A8JH 1PYWA 1NANI 2J5LC 2IPTL 2NY1B 4KHXH 1E4XL 1ES0A 1BOGB 4ODHL 1MWAL 4C56D 4P49A 1K4CB 5C0BA 5GHWL 4XPHH 4Y2DA 2IALA 3QT2A 2CDFA 2FDBP 3NAAH 5JA9A 5IBUB 1KTDB 2OJEA 3RWJA 3K4DA 4P46C 1T04B 3BEVA 1GVIA 3K3QA 5J6GA 4XPBL 3DYPA 1W72B 4QTIL 2FO4B 4S1RH 5A2IH 2UZIH 3O6KH 1JPSL 3W2DH 4RAUB 3GM0A 5C0BB 3ZKNC 2EYTB 4IOFC 4M4RA 3PGFH 1A3LL 1Q9OB 5DEGA 3BQUA 2B1HL 5FAAA 1G0YR 5C0GB 3NACH 3O11B 4P4KA 3OGCB 3MLYH 5I16A 5I19H 2P5WA 1JP5A 1ODAA 4O2CA 5AYUL 2IADB 2OMBA 3GBNH 1YNKH 4ESKA 1GPOL 4IRSA 3TJEH 5A16B 5L2JB 2M8XA 1W72L 1OGAA 5IB3A 3OV6A 2RAMA 3ZTNH 4X8JA 3GMLB 3T77A 3V4PH 4P2RA 4K7PH 4GFTB 4JZOA 4WO4D 1DR9A 4PBWD 4P3DA 2GI7A 4MNQE 2WLYA 1BBDL 1KJ3L 4MA3A 4GRWE 1RIUH 4UDUB 3UZVB 3GHBL 4W81A 1NCAH 4WEBL 5SX4I 1B2WL 2AVGA 3QA3A 2HG5B 4K7PL 3ME0A 4HLJA 3EGSA 1KCRL 4UI2A 5GGRY 3T4YB 1R0AH 4D9RE 5AG9A 3J8F7 1FP5A 3V5HB 3FQTA 1DTUA 4PGZA 1CD1B 3F12B 1CICD 2XQYK 3CUPB 3S35H 1I9RL 1E6JH 1VERA 4W4NA 1NPUA 5CZVL 4LPYA 3GSWB 1N3NB 2R9HD 4NFBA 1AGBA 4GRMA 5K9JH 2R1WB 2QADC 1D5XA 3TF7C 3GJEA 5E8NA 3HZKA 3WDHA 4IS6B 3S37H 2EO1A 3QUZC 4NGHL 4PRHD 4RFEB 5CP7B 4P4RA 2MQ3A 1JNLH 3KPOA 3TH3T 3NFNA 4DVBB 4TNVF 1S78D 5FOJA 5SX5K 4DGIH 2VDQL 1WZMA 3VFGL 1WIPA 1A7OL 4LPCA 4YHMH 3WSQL 2B4CC 1KCSH 3I3EA 4UILH 4AG4H 5CWSA 3G5XA 4DN3H 5IMMB 1LQSR 4F9PA 4RSVA 1AP2B 4LDLB 4JKPL 2EE2A 1I85C 4APQC 2BVYA 4C58B 4TVPD 5F6IC 4I3SH 3VFPB 4UOW0 4YDKL 5L6YH 4FQCH 1VEOA 2ADIB 4DQOH 1KPVB 2FECI 1ULVA 3AAZA 1HIML 4GUPB 4PR5A 5KS9A 4KY1H 1DBMH 4OLZH 3QAZC 4HC1A 1C1EH 3O2VH 2DWEB 4MSWA 1U8JB 1GGYA 4PRAB 1U3HA 3GSNL 4ETYA 1KN4H 2ZUTA 4ZYKB 3QDMB 4M43L 1KJ2H 3P2TA 3PUCA 2BMKB 2ERJC 4LEOB 4Z78A 3B9AA 1UJTA 3ILPA 4KV5E 4LVHB 5CP3H 5F1KC 2XRAH 4P2QD 4BH8B 4HJ0C 1KIRB 4Q9BA 2B0SL 5BZDA 1NCDL 4HUNB 4JLRB 1TXKA 5MI0C 2X4OB 4OTXH 1JYXA 4NYLA 1OSZA 3QJHB 1D5IH 1EEQA 3MBED 3ZHLA 1DBBL 2PYEB 1Z5LB 1W0VB 2PCPB 2DWDB 3HN3A 2Q3ZA 3MUGA 1I9JH 1CDIA 2J1KA 2YXFA 5DJ2A 1IGCH 2JJWA 3NTCH 3SGJA 4OTXL 5DQJB 5DQ9B 1OGAE 2JELL 2F8XC 2ITDB 4QHNA 2XWTB 4XPGL 4P2RD 4JLRA 1A6VH 4LVNC 3ZKND 4DKDC 2JCCF 4WO4A 5DD6B 5IROA 2UY6A 3TNNA 5C0CA 2X4RA 3W5MA 4NFCA 4HZLB 2ESVD 2G9HA 3L6FA 2VH5H 2WUCH 4QYOB 4PJBB 2DLFH 3D5OF 5JO5A 5IESL 2NZ9C 3VDBA 4Y16B 3L5XL 3ARDA 4WI7A 4YDJA 1U93B 3S5LA 4NQCB 2BSSA 4EDXA 3MRQB 5IKCA 1MWAB 1SQ2N 1BVKB 4OCSL 2DQEL 3NAAL 4MLSA 4XNMA 3IXTB 4E5XA 1F6LL 1QPPA 3B9KB 1UACH 3GIZL 4TN9A 3N85L 2QKIA 3BZFB 3LMJH 4XWGL 1AGFB 5CSZB 3H7BA 2VO5A 3BN3B 4KJQC 1QRNB 2C7UB 2YA0A 5DJ0B 5FYKH 3W0WB 4AEHH 5DDHA 1U8MB 4YDJB 5MHSE 3TZVC 3UZQA 5I73B 3QFDA 1MWAA 1MLCB 2NXZD 2YMXH 4MNGA 1UWXH 2X9XA 1HK6A 3MRCB 1WUNT 3QQ4A 5KSBA 3FT2A 2GUOB 4NKDB 4OGYH 1KELH 1R5IB 4DUWA 1JYNA 2QQKH 4R4ND 4YHPA 1UWEH 3HE6A 3VXSB 1VFBA 1OAUL 2H45A 4QRRA 3CC5B 4NC1E 4ZUTA 2QQLL 3U4EB 5FO8B 1TDQA 4NNYA 1I3GL 4HMCA 4IDLA 3BP6B 4JG0L 3C08H 1I4FA 3GI8L 2Z92B 4D94A 1S5HB 4P9HH 1NGQL 4QXGL 1WC7B 2M26A 3BWAB 4I3RH 5FUZL 3RJDA 1R0AL 1A4KA 3UTPE 4G8GA 2FJFB 3FOMB 1IGIH 3MV8A 5J6GB 4JPIB 1EBAA 2NY7L 4LSDA 3CFDA 1FVCB 4APQD 2HRLA 4HFUH 4OB5L 1UCTA 3SE9H 1KTLB 3OAZH 4OUUA 5I75B 1K3IA 1A7RH 2HH0H 1DBAL 3BQUB 3WNOA 3A6BL 3O81A 3SE8L 2UUDK 3ZKXC 4JPVH 5IJVA 4NWUH 2QHRL 1NQBA 3UZEA 4HEME 4GT7A 3DXAA 4C56E 4HWBH 2O5YH 1UENA 2D03H 3ROLA 4UMGA 3B43A 2GK0B 5J06A 5T5FH 2BZDA 1JPST 1XIWC 3O4LB 4JZOB 3GBLA 4PRBB 3C2SA 1ZWIB 1SVZA 4Y8DC 4NZUL 4OZFB 3VFUB 2VISA 2VAJA 3EFDL 3QIUD 4NPYA 5BXFB 1NANH 3VJ6B 2Y72A 1CYGA 3EGSB 5JR1H 4I0PB 1UEYA 2YK1L 4OJFL 1TMCB 4NZTL 1CD8A 3KG5A 1I1YB 3OG4B 1KLUA 1ZV5A 1CD1A 1XGYH 2UZYB 4PJAF 5I1AA 5CJOH 4U0QB 4OV6F 5J56B 3DI3B 4NCDA 5GZOD 2VKXA 3B9VA 3IU4H 3ARDD 1OD9A 2DQEH 5ITBL 3ARBD 3S96B 1T4KA 4GBXB 1XT5A 1RK0A 2YUXA 2VISB 4NDMA 4Y5VB 3KYAA 3CDCA 4M62H 5IB2B 4UIKH 3HZKB 4XP1L 4D0BA 2R2EB 2C1PB 4DW2L 1S7VB 3CZFB 1TCMA 3DRTA 4EUPH 5L9DL 1PZ5B 4FZEL 4HAFA 4Y88A 5DJ8A 4NHCL 4RISL 3NFNB 4DVBA 2DD8L 1CE1L 3I02B 1JFQL 1H3TA 1KGCD 3ZE0F 3LN4A 1INQB 2Q8AL 1F13A 1HWGB 5GGVY 2B4CH 4DJMA 2X42A 1RK0B 3OB0H 3JV4A 4UBDC 3QCVL 3BZEA 1F4WL 1SJEA 5EG6C 4MB3A 3PWUA 2PUQT 3VFVA 4F57L 1S7VA 3DRTB 3W5NA 2EDTA 2YD7A 2FX9L 3EKCA 5CHNB 5EU5A 3EYVB 5T1LA 5I1JL 5E8PB 1ZEAH 4DN3L 4Z95L 5L8LB 4KKAC 2CKBL 2VLRA 5AEAA 4O51B 2EXYC 2QHLA 4U1KB 4EOWL 4PJCF 4TRPH 35C8H 3IDNB 3C9NA 5D7SH 2ICWI 4TSAL 3RPKA 4HBCH 3CFBA 4ZOEA 3BP5A 4OZIB 3JVGA 4TSBL 4F8TA 3SKOB 5KZCD 3DX9B 4FG6D 2Y06L 1CGYA 2DLEA 3QDMA 1IEAB 2CQVA 3W39B 5HVFB 1TVHA 4G42A 3N1GC 5JUEL 4Y4KB 1I8LA 3IDNA 2ED7A 3BDBA 1N2RA 4I3SL 1IGYA 4QHLA 5EO0A 2DM4A 3MROA 2Q86B 4ZXBB 3C6LD 3ARWA 4R96A 3CFBB 1VHPA 3BAEH 2LAAA 5EBLB 4GRWB 4HS3B 1W0VA 3TH2T 4ZO9A 1I75A 2I25N 3OXRA 1YMMD 3IDMA 5D6DA 4ZNEA 5E1AB 1IAOA 1Y18A 3E3QE 5DQJA 2E6PA 3GBMH 2FJGB 2BNQE 4Y16C 2E6QA 2VTFA 5KVDH 4GG6B 3SGEI 3PP3H 3BKML 3NCJL 1UYWL 2QR0A 2HLFD 1R3LB 4ZXBA 4M7LH 1N64H 1F00I 4JHAH 3ZDXF 1QSEA 4X5LA 3FTGB 3NFPA 4C4KO 4FFWC 5FYJE 3ARDB 1A22B 3VWJA 3OJVC 1B6UA 2ZUSA 3HG1A 4ONGL 1KN4L 1U3HC 3PV6B 2O61B 3BH8B 3T0EB 2W0PA 1J1PH 3CZJA 4WI8A 1XIWD 4H1LB 4DCQA 1LD9B 3VU2A 1WQVT 5IHUL 5TJWK 4LKCA 1V3KA 2BXZA 4E5XB 3QXDA 3C6LB 5E1HB 2VZVA 3CFIC 1CQKA 5B39G 3D69A 1G7LB 1X5ZA 1U8KA 1SJVA 2HLAA 3VXQA 4P2RE 1QSEB 3NFSH 3MLSH 5E2WL 4XCEA 3LMJL 5C1MB 2VLLB 1E28B 4X4XB 3GRWL 4ALAL 2IAMC 4X9HA 5M94B 3MV11 1KIUA 3MRCA 4UT6H 4MCZA 2BRRL 4HH9B 3FQNA 5BRZD 1HXMB 1R5IA 4L8SC 4OQTH 1W72H 4U1LB 5LCVL 3T0VA 4JDTH 4BKLA 5M7QA 3SKUD 1BZ7A 1KCUH 1Q9WA 4CU7A 4W4OA 2YXMA 5JOFA 3HR5A 3H2WA 1JNLL 3IT8D 4XCEB 4UINL 3C5ZC 5C0JA 4HK0B 4U1GC 4D3CL 4WTXA 1I4FB 1QR4A 3ZT7A 1GZQA 1OPGL 4PLKC 5ANMA 1U6AH 1UH2A 1FAKT 4HUXB 3CLEH 2QEJA 3FB7A 4EXPX 4Q9CA 4UBDD 4TSAH 5L2KB 4WHYH 5TH2A 5GZNC 4RWYL 1DBKH 2CUMA 4G43A 1NLBH 4ODTL 1AFVL 3N9GL 4OGXH 5C0JB 5JIPA 2DQHL 2ICWA 4PTUB 3OX8B 2CKBH 4NUGL 3UTPD 4QTHA 2MFNA 3TC9A 3FRUA 3REWB 1FSKC 4P2OD 5F8RC 5ELIA 4LSTL 3TPUA 3VFMB 4Z7UE 4KHXL 4AQ1B 4MMXC 5E2UL 2X4UA 2GJ6D 4OIAA 3PL6D 4ZS7L 1PEZA 4S1QH 4WWKB 3SKMB 4PRPE 2P8MB 3R06B 5AYQA 5A2JH 3WNNA 3CXHK 5AZ2L 4G7YL 4LF3B 1ONQA 1CL7L 3OX8A 3ZMRA 4MXVE 1MHHB 5ADOL 1M05B 3KPPB 3FQRB 3MCKA 4G6JL 1Z3GL 4U1GB 4BM7A 2JB5H 5KG9A 3MLTB 4DKEL 5ACLA 4W6XB 2CUIA 4HUWB 4O02H 1A47A 3RWEB 3KAAA 2GK2A 1BEYH 3QFJD 1QKZL 3FFDA 3PWVA 5ESVB 1WJ3A 2DTML 4PP2A 3OKLA 4MDJB 4CAGA 5IVOA 4N1HB 4X7CC 4S2SB 2R2BA 1MJUH 4B7LA 1L0XA 3KHOA 4WHCA 1C7TA 2MHAA 5KVGH 5IVXA 4NO0D 3EYQC 3OGOE 3RKDD 1X9QA 3JZ7A 1FL6B 4HUWA 5FYKE 3OHXA 4Y5XC 3H9SD 2H9GB 3O9WC 4EN3D 1AXSA 5I1IL 1YEIL 3H9ZA 1DVFA 2Y7QB 3EW3B 5J3HD 1FORL 4XZUA 4OCRL 3T2PA 4S2SA 4UQ2A 1KEGH 3C60B 1JE6A 3LKNA 1TCRB 5DJ8B 5EOQH 4NBYB 2XN9E 5B38A 5C9KA 1UWGH 3VDCA 5FHAH 1WT5A 3HI1B 3LVEA 1IGTB 4WO4C 3S9DB 1OSPL 5CEZL 5I1DB 3NVQA 4ZNCD 5INCA 1CN4A 2VLKA 5BRZA 2GSGB 3KLHC 4FFZH 4QRTA 2DM3A 3HUJB 3V6ZA 1UKTA 5TQ2H 1U41A 3DGGA 5SWSB 3B8SA 1GAFL 4LIQH 2ZCLL 3NPSB 1FVEB 3RIFK 4J1UB 5FGCE 5E5MA 3FMGL 5IFJB 2YD5A 3QRGL 4R9HA 1CICB 1ETZA 5K59E 5IVNA 5DUBB 5DHYA 4P9ML 4RBPK 4XCYA 1NC2A 5I1JH 3N50A 3CFCL 2GSGA 3QI9B 4XHQA 1UFUA 4JKWA 3PNWB 3TJHC 1KGCE 5CS7A 1ZHNA 1IBGH 5HHOA 3RUGA 3BP5B 2EDNA 5ALBH 5TDOB 3BVNB 1XMWA 1CLOL 4WUKL 1VCAA 2XNAB 1F4YH 1J5OL 2IANA 2IPKA 2OTWA 1N5YH 2VLME 2PETA 3WIHL 3WIFA 2CKNA 4UDTB 3WMSA 2GT9A 5J8OA 3PWNB 1S7TA 4DEPB 3QI9A 5T3ZH 2AKRA 2R0KH 2P1YA 4QRUA 5DT1H 1OAUH 3WIHH 2EXYD 1DBML 3WL9B 1WBYA 1ZMYA 3FKUS 3WHXB 5DJCA 5GGSY 2IANB 1LMKA 4NC1C 5EN2B 1HEZA 1IC4L 4OGYL 2IAMA 1L9MA 43C9A 3JWOH 2X7LB 4Y19D 2YPKB 4R8WL 3DUHA 3SQOH 5C0EA 2FX7H 5I1KL 3MRIA 4BSWB 1MHCA 2E7LC 4FZ8H 3ULUH 3VFGH 1TETH 2BDNH 5DLML 1UM4H 4DGVH 2AJXH 3OJDA 2FJHA 5I8OL 3DWTA 1E4XI 4PBXA 1RJLB 1RMFH 5J7CC 5JLZB 3H0TA 5BZWA 5EN2A 4PJIE 1ZT4A 3JTSB 2Y5TA 1R3KA 1C5BH 4LVOC 5KANG 2X7LA 1MHPH 4TVSa 2A9ML 3TESA 2AW2A 4DCQB 1IEHA 4YHKL 3AB0B 1BEYL 3AB0C 2VDKL 1X4XA 1TZHB 1DDHA 1XEDA 3RJQB 5TE4H 2HLAB 1ED3B 1HYSC 2BOCA 2VDNH 3ARFB 3UTQA 3MSPA 5DD5L 3VWKB 4O9HL 1TJHL 1WZKA 1Z0NA