1U2HA

X-ray structure of the n-terminally truncated human apep-1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
KAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of engineered human Aortic Preferentially Expressed Protein-1 (APEG-1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords Aortic preferentially expressed protein 1
total genus 19
structure length 96
sequence length 96
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u2hA00
4R2GB 4I9WE 5HYIA 1IC7H 1SM3H 4Q2ZB 4R2GD 4X6DB 2A6IB 5JOPD 3DBXA 3BPLB 1DSFH 4M7LT 4XZUB 1BM3L 2D9CA 5CSZB 1ODAA 4XMPL 2BVQA 1TTUA 2W65A 3IFPA 4MA8H 2XXMB 3IRZA 3Q3GA 2D7PA 3D25A 1WWBX 4JGMA 3WHXA 1PQZB 1T7XA 4PS4L 1YEEH 2XYCA 4OV5B 5TDOB 2FO4B 4HV8B 3WFZA 3MBEB 5CSGA 2XRAL 4ACPA 2VDOL 3HLAA 4N0CD 5DURD 2X4TB 5FYKU 5TFSL 4L4TA 5BV7B 4YH6A 4ZXBD 4HEPG 3HNSL 5E00B 2X89D 3B2VL 1AD9B 4CKVX 2A6JB 4WFGE 3ECBB 3PP4L 3ZT5A 1MIML 4OT1L 3FN0H 3TO2A 4UB0H 3FRUA 3O4LD 1ORQB 3CK0H 4I77H 4JFEB 3SBWA 5DFTA 2J12B 3K2MC 5ITFB 2AQ2A 5GSVB 4OZHA 3WIFB 4EJ1C 5ENWB 1YMME 3RWCA 1ZGLM 1QRNE 2Y6SC 2B0SH 3P0YH 4UV7L 4G6KH 4GAGL 5BV7C 2IQAA 4XXDA 3F12B 2VDKL 2B7DT 1RAMA 4O02H 4S11A 2M8XA 1AE6H 3TWCL 4HXBH 4FQLL 4Z77A 3B3IB 1G9MH 3QUZC 5FYJD 2V17H 4XNXL 4J1UA 1HH6B 3ILQD 2AEPH 2Q8AL 1INEH 4QTIH 4X9BA 1Z9SA 4GKOA 2VLRB 4HQQH 5CEYB 3ULSB 1NBZB 4MAYB 3MRPA 4AENB 3OTTA 2B1AL 1FJ1A 3TPKA 5DJ8B 5EUOA 4I0PC 2VAAB 3R0MA 4M6NL 1EAJA 4XC1H 1T6VN 3MV9A 5L2JB 3O0RL 5C0AE 5IGXH 3NCYP 3W9EA 1A9BA 3MV7D 4KTEH 3G5XB 5FB8A 5BS0E 2OJZL 4WO4A 1N6UA 4WEBL 5GRWA 5E6YA 3CSYA 3KPRB 3TCLA 3HC4L 4O51B 1IAOA 3VFMB 3GIVA 4Q9CA 1WFNA 5CILH 4QRPD 3AREA 1GGBL 4KI5C 5K9JH 1U3HA 2VKXA 2XN9B 2PO6C 2X4RA 3I6KB 4G7YH 1J88A 4JKPH 2JJUA 4W4NA 3VI3E 2GFBB 2G5BB 3MV8A 1VKXA 4JJ5A 4P23B 4WI4A 1Z3GH 3NACL 4ISVB 5DLMH 1JPGA 4LOUD 3GSWA 3O4LA 2GJZB 4WV1A 3QCTH 2PW1A 3BISA 2UWEB 1FGNL 3GBNL 2C7UB 5IW1B 2XT1B 5GS2D 4K23H 3PHOB 3IFNH 3SQOH 2VISA 2CUIA 3K8KA 4HCRL 2WWMC 2XV6B 4UU9A 3W0WE 4M61A 4NJ9H 5EZLA 4GMSL 5DJ0B 1NLDH 1JHTA 4NKOB 3QFJD 2J1KA 4DGIL 2QEJA 4G9FA 5B38A 2CKNA 5L88L 4IOIA 5AZ2H 4QRQB 4OCYL 4O2EB 1XCQA 5J1SC 4JANA 4YE4H 4YFLF 1GGCL 2G5BA 1DZBA 3MV8B 1UVQA 3IETB 3OBAA 2Z31A 3P4MA 5L9DH 5DF0A 5DC9B 1LDPL 5IROC 5JR1L 4LCWD 1YN7B 2Q7YA 1WAAF 3QBTB 2ADGB 4MNQD 4RIRB 4RBPK 3BMWA 1QRNB 4OZFB 4EI6A 1X6NA 3QQ3B 4J6RL 4C56A 5F71A 4EVNA 2WBJD 3G6AB 3B9KC 3T0XA 2ZUWA 1LGVA 4OLXH 4NHCL 1BQLH 3KWWA 4JFEE 4KRPD 4EXKA 3O2VL 2VDPH 2WINB 1I3RA 3D85A 1MI5B 1Z9MA 2X44D 1TQCC 1KNOA 4M03A 4UILL 1U8JA 4M61B 4KK9D 2RAMA 3K74B 1FFPA 2VXQH 1RU9H 3KDMB 1E27A 4TVPE 1DLFL 1NMBL 2E9WA 3W9DB 5GRJH 5DQDL 3FRPA 1Q0XL 3BSZH 4X6EA 1G6VK 2H9GB 1EGJA 5D7IF 5E4EB 2NY4B 3P0GB 5GGSB 5IOPA 4F9PA 3CXHJ 5ABDE 4PJDE 1UA6L 4YWGH 1K3ZA 2ATKA 4UINH 4FTVA 3QDGD 2Y07L 1TLKA 3S3JA 1FGVH 1OF2B 3INUL 3T0AA 1JYWA 3T0EC 3FHAA 4P46A 2EEBA 3SDDB 2HTKD 3BESR 3C60C 2P24A 3MRLB 5HSFA 2JE8A 3NPZB 3GKWL 4Z18A 1MAJA 4N8CL 4V1DA 3SDDD 1U2CA 3PHOA 3RDTC 2GSGB 4XAKE 4XXCC 4YBQD 4M1CD 4PYGA 5CIPA 3UTSA 1Y0LB 1K85A 2Y1VA 4RNRB 2VH5L 5HXMA 4YXHL 1Q94A 2BP3A 1MCNA 1F90L 3MYJB 4WTZA 3BO8A 1UADC 4XCYA 1CZ8H 1FVCA 1SVZA 4HKZA 1S78D 5DRZB 4IDJH 4M5ZL 5KANI 3VXPA 4NN5B 2PXYA 4U1IA 3REWA 3ARSA 1AQDB 4ODWA 3WUWG 4EVNB 4L4VE 2IADB 4PRPB 5DQ9B 3R8QA 1X7QA 3JVGA 2PW2B 4HW6A 1BWMA 2CRYA 3BEVA 2E8ZA 4NQVA 2DKMA 2Y9RT 2D3VA 1V5JA 3ARPA 2IANE 2GUOA 2XQYK 4HIHB 5EO9B 3EOTH 4HT1H 4KI1A 4NZTL 1JZ3A 3TZVD 3ZHDA 2A0LC 5JW3H 5ICXA 3V0VA 5KZCB 1YQVH 1LK2A 4MCZA 4P9HH 3WEXA 4L5FL 4KGJA 4X6EB 4OCSH 1F42A 4BZ2L 1YYMH 4LEOB 1FL6A 5GGSA 4D9RE 5HD8C 1B4JH 1G7LB 4W4OC 4LSQH 2DQFB 5E8EB 4K3DL 1KLGA 4LHUG 4EN3A 5EBWA 1W8NA 5EO0A 1EAPB 1NMCC 3MJ9H 3MBXH 1KOAA 5KSBA 1J0KA 5E8NB 4JM2C 3VFSB 1WC7B 1MVFA 3TIEB 3F7YA 3MJ6A 4OI8A 4XTRC 5E99H 4V1DB 3G5ZB 1OPGH 3LAFA 4FFYL 4OQTH 4GW4B 4G3YH 4YDKL 3DV6A 4JKMA 1IQDB 5CIPB 4GXUM 5FV2A 4LCWB 4NC1E 2OMNA 3O81A 1QSEE 2BJMH 1IEHA 4AEIL 3BIKA 3LIZH 1E6JH 2FJHB 3VXME 4OZHE 4XCFL 5D5MB 4UTBL 4OFVA 2PF6A 5DK3A 2FX7L 4XNYL 5SWQB 3J8F7 3OF6A 3MLSL 4LSVL 3BVNB 4F58L 3U1SH 1JPTL 3DNKA 4ZFOA 3N0PB 2NY3C 3BH9A 4U6HA 1UH2A 2F58H 3WSQH 4OGXH 1WAAE 4WWKA 4EXPX 5I73B 1R3IL 5HYQA 3QQNA 3KYKH 1XF1A 1KTLB 3MREB 3BO8B 4J8RB 4JO4L 2LAAA 2W0FB 4B41A 3RWJA 4F33A 4AH2A 2RB8A 2V2TB 4G43B 4X98A 1J8HA 1DQMH 5J13C 1OB1A 2FRGP 1M4KA 4MJIA 5I8CB 1EA9C 1MCSA 3GMRA 3A67H 4K94C 4U0RC 2V5RA 2KKQA 5IBTH 4DGVH 3UCRA 5BVPL 2AEWA 1CXKA 5JORA 4L3EA 3I85A 5E2VH 1ADQL 4BFIA 3DHMA 1HINH 3FCTA 1AQKL 5KS9A 2BC4B 2VLKD 1KB9J 1UM6L 3BE1L 4OM1L 2C3WA 1ZKAA 3RZWA 2Z0BA 3HR6A 1C5CH 1WWAX 3P11H 4FG6D 1NFIA 1UCTA 2XTLA 1A6WH 1JCKA 3V2AR 1S7SA 3EYSL 3NIDE 1FL6B 1OD7A 3AS1A 1RSFA 1SHMA 1GRWA 2BNQA 5INCA 1U9KA 2F54B 4QOKE 4ZQKB 4NQCB 3QQ4A 1GC1L 2F54D 3VGGA 4NFBA 5SWQA 3LS4L 1GPOH 2MJWA 5F9OH 3MNVB 5MP6H 1KEMH 5IVZB 4RQQA 3RIAF 5D5MF 5FUZL 1U8HB 4XVTL 2XWTA 5FYKL 1BVLB 6FABH 3NFNA 3FQTB 3MTRA 4YEEA 1CGVA 2A9MH 4ZG1A 1LEKB 3T0BA 2JF1A 1X4XA 4DJMA 2UYLB 5JHLL 1CGSL 4PB9L 2QSQA 1UWGH 1FHGA 3RU8H 3O41A 3T65B 1BECA 1D5IH 5HI5D 1I7ZB 4MA1B 1QVOB 4HJGA 3QUXC 1K4CA 1NBYA 1TTGA 1X5YA 1IAKA 2HVJB 1I1FA 4BA8A 1I8IA 2WAHA 3O6LH 3LEYL 3ZMRA 5C1MB 4EDXB 1NDMA 4OZ4B 4J7RA 1KIRA 3KAAA 4MAYC 4RGOH 4LHQB 3TO2B 2CLRB 2ATPB 4HPOL 3PQYA 1UJTA 1CFTB 1RHHB 2X9YA 43CAB 3RWJB 4F33B 3GMQA 1MUJA 3VGFA 3O3BB 3V0WL 4HHAA 3EYQD 2VDML 1FPTL 2JJVA 2EDJA 5TDNB 4DOHB 5IUSA 1F3JB 1I9EA 4TSAL 4OD1H 1ED3B 3C60A 5FM4A 3BIBX 4E0RA 1QUNA 1RZIA 3VXMD 3DI2B 1VSCA 4HWUA 5IB3A 1KB5L 4YK4C 1Z3GL 3NACH 4PGZA 4CVUA 5DA0B 1N0LA 2F54E 4QOKB 4WU5A 4X7SH 3P2TA 4N68A 5EOQL 5T1DH 4W70A 5HYJE 1JN6B 1A5FL 2IPUK 1FC1A 1A9BB 3M8OL 4OQ1A 3G5XA 5FB8B 4YBQC 3BWUC 3BDYH 4HJ0D 4NQDE 1MHHB 5DJXA 1QPXA 1J1PL 3T8XB 3GSNA 4ZO9A 3TJEL 1H0DB 4D0BA 3ARFA 1QHOA 2JLLA 1ZA3B 4CMHB 1NANI 4MDJA 4HZAA 3ZHLA 2VXTH 4DGIH 2OTUB 3QR2A 2EE6A 5INCB 1NCBL 4PJ8B 4JHAL 1D6VH 5SX4H 3IF1B 3OB0H 2P1YA 4XPGH 4ZUTB 4APQC 4O00A 1Q1JH 5CWSB 1VERA 3N1MC 4IOFC 4CNIA 4Z7OF 1VPOH 1G7MA 3T2PA 4B5EA 5FGCB 3MLPA 2YD4A 3JTTB 4D9RD 5FO8B 3KYMB 2APTA 2HTLC 4Y7MA 3L3KB 1G9MC 5JTWA 1IAOB 2J8UF 4ELMF 1WZLA 4NJAH 3IDXL 3S98A 4O58L 3CFCH 1ZK9A 4J6RH 5GRUL 4G9DA 3TBYA 1W72L 3EYVA 1JWMA 1AKJB 2XWJB 4UIMA 3MUZ1 4CADB 4OCRH 1PDKA 4Y4FB 1IILE 3IDUA 5D6CB 5IQ9A 5DJYA 1I7TA 4NQUA 4P2QE 1ZLSH 5EZLB 1ZMYA 2GSIA 3V4PH 3KHQA 1BLNA 4F57L 4ENEC 4BSJA 4KRNA 2N56A 5IW6B 4QXGH 2OR8A 5BS0D 2D7OA 1XCQB 5H35A 2YMXL 5F88A 1WK0A 2NX5A 5F1NB 2QR0B 2YRZA 1JNHA 2C3VA 4Z7UE 4AIXA 3PWVA 3WL9B 5ILTH 3ALPA 1U3ZA 4S0SD 3VXQA 5J6GA 4UINL 4HMDA 4R0LA 1FV1A 4H0IA 1NGWA 1S5HA 3U48A 4L1DA 4I0CC 1LQSR 4F9LC 2IWGA 5B22A 4NO5B 4PJ7F 1C16B 4JRXB 2DN7A 4HWEH 3H9SE 1QBLH 1H15B 2IANA 4KKAC 4DN3H 4HK3N 3EJJX 4H1LG 4FP8L 4MWFB 1XR9A 1A7QL 2R9HC 4Z7WF 2I9TA 5I71C 4U1SA 3V9FA 4GS7C 3HI5L 3P4OA 4WU5B 4XHJD 2ERJB 1QEWA 2X70B 3WE6A 4QYOA 2KQMA 5IBLC 1DN2A 4WHDA 3HE7D 5C6TH 4NM8L 2IEPA 1QLEL 5I1KH 3D85B 2FL5A 2NX5B 4AL8L 5SV4A 4JZJC 5D9SB 4MXVF 3U7WH 5CD5C 1I8LA 1A64A 3S35L 2IFFH 5BOZG 1CD8A 3HB3D 4ZOEA 5GZND 2EICA 4TNVF 1NDGA 5IHLB 1ZT4B 4GQ9H 4IS6B 4GS7B 3HC3L 4MAUL 3MV9E 5IHZA 3RNKA 4QTHB 1FBIL 4WENB 1CR9L 3QIBC 4LHUA 5KJRL 2G60L 4TSCL 3HCVA 4XCEB 3T3ME 1E4WH 3FQXB 3HMXA 3ZKXC 3RWFB 3TT3L 1YQVL 3GMMA 2P4AB 4Y5XA 1WJ3A 1DLHB 4LPCA 4LPWA 1RZ7H 5D96C 4LCWE 4M9PA 3HG1E 4ZFOL 5HI3C 4M7LH 2K7QA 4NZUL 2V5YA 4JPIB 4NZJA 3WFDL 3C5ZB 3HE6B 4JDTH 1PG7W 3O2WL 3WNPA 3EW3B 4PJDF 4ZDHB 1QYGH 3VXUD 4DVRH 2F8OA 4RFOL 4UQ3B 3W81A 3Q5TA 2XQBH 5ITBL 3C6LA 5ADOH 1UG9A 3UTTD 1EEZB 5DEZA 1JPFB 4X6CA 3OKKA 4ZODA 4QYOB 3F7VA 1FDLH 3H0TB 1KCVL 4WHTB 3QCVL 3EYQC 1N64L 2B8OT 2WLYA 3QDJB 1T1XB 2VQ1B 3EYUL 2GK0B 4AT6A 1DBBL 5D93C 1KIQA 2AGJL 5EORH 4HMEA 4X8JB 1AGEA 4ZUUA 4LCYB 3VFPB 1OT1A 3DTXA 1NPUA 4KXZH 1FAKT 4UIKL 2XWBB 1U3YA 1UFUA 4QT5A 2E6JA 4PJIE 4F80A 3LKRA 3VRJA 3SDCA 4WO4D 4YX2L 1CWVA 4WFHE 1LVEA 3S88H 2CLVA 4H88H 5BMFL 4FA8A 1A3RH 1KLGB 2ITCB 4ZUVA 5IMOA 3QUXA 1JPFA 3B8YA 1UGNA 4NUJB 5MENB 3U6RB 1U8KA 4OQTA 2VIRA 2XN9D 4IBLT 4WIQA 3MMEA 1BBDH 1CYGA 4Y5XB 3CFEB 3O6FB 1NCTA 4ZS7H 3RAJL 5CBAA 1YECH 4IMKA 3MUHL 4JO1L 1AD0B 3N85H 3X12B 1K3IA 3MJ9A 3WKMH 1KG0B 5CUSH 1RJZB 3HZKB 5DD6B 1WCQA 4N90E 1WITA 3MLUL 1TDQA 2X1OA 1ZLUK 1QPPA 2R1WB 5ANMA 1WTGT 4PRHE 2DS4A 1OGAD 5EOTA 2A6IA 1WCBA 3GSQA 1NFIB 5DJDA 3ARFC 3MUGB 1OAQH 1ZTXH 1PFCA 5F97E 3TZVC 4KUCF 3KPOB 5C0GA 2CMRH 5LGJA 2ATKB 4Z7WE 1S7UB 4YO0B 5F1SA 5JNYB 2NTSP 3C5ZA 3HE6A 4YAQB 5C9KA 4QHUA 3FT2B 3QUMA 2YXMA 4PTUB 1I3GL 3K0WA 2VN7A 3E8UL 1F3DJ 4Z8FH 4NUGL 4YHIA 3VMPA 1KEML 4XNZB 4PP2A 1IVLA 3C6LB 1T03L 2I9LB 2JB5H 5ALBH 3AAZA 5D72L 4LVHC 1VEMA 3L3IA 2R0WL 4G6AD 4A6YL 5D1XC 4MX7A 1QFUH 2DIAA 1OAKL 4Q9RH 4LSUH 2XZAH 4JKWA 3TN0C 5A1AA 5A3ID 1BIIB 3LZFL 3E6FB 1KCLA 5F8RC 3Q48A 1NC2D 3ARDA 4ORGB 1U2HA 4DW2H 1EHLH 3M17A 5JNYA 5FKPA 4DN4H 1HYSC 1CDHA 5BZWA 3ARUA 2D03H 2OZ4L 5KW9H 1N59B 2DQHL 4ZFGL 2H3NB 3ARDC 3GJFA 3I3EA 1OP3H 4IDLA 4FQ1H 3SE9H 2DYPD 3I9GL 1IC5L 4XB8A 2W9DL 2BNQB 5ERWB 4D2NA 4U0QB 2X5PA 4XP1H 5IJVB 3IDGB 3DVNA 4YHMH 3GHBH 3KPNA 43C9A 5HDBF 4RFNB 3H7LA 1DE4B 3RFZC 5F21B 5EB9A 5GGUB 2DKSA 2BFVH 3ULVF 4U6VH 4XVSH 1QLRB 1IGFH 1AD0A 5K33A 4GUPB 3V7AE 4ZS6D 3U9UB 1Q38A 4YUEH 3ELAT 3UBXA 4M7ZB 5I6XB 4OZ4A 3WO4C 3KYNA 1ZT1B 3QUMB 5D6DC 3VXRB 4WUUE 4D9LH 3TBWB 1WIOA 4I3SH 3UPAA 5A40E 2BY2A 1VACB 1J5OL 3T1WA 3ES6A 4LMQI 4GRMB 1B88A 1CXIA 1ZA3A 1RZJC 4JY4A 3RDTB 2W65B 3IKCA 4FZEL 1HSBB 1ZA6A 1NDMB 5DR5L 3G08B 3QUMH 5HDLA 5D5MA 4HV8A 5D5ME 1K2DB 4Z7VA 1WBXB 2ZCLL 3NAAH 1OTSC 4POZC 4Y5VB 1OAUL 1U3HD 5FYKD 2YZ8A 1KPVB 2NQCA 4ZOAA 3G6DL 1PD6A 4DWHA 3O4LB 2FB4H 5DC0A 5EOCJ 2I25N 3MUJA 1ZVSA 4M7KH 2CDEB 3QIUA 3QJFB 5F3HA 4DQOH 1JWMB 1E4XH 1QFWM 1UWEH 4YDIL 4E41A 1A2YA 2HT3D 3MRDA 4XBPB 5E08H 5TQ0L 1ZLSL 3BP6A 1K8DA 2DLFH 5DJ6B 1YMMB 3IXTA 3RUGB 2QLVB 2R0LH 4ZD3H 3NCMA 1KENL 4JY4B 4QRQA 3LH2L 4PGCA 4M6AA 5EZIH 3RJQB 2XZCH 2D7TH 4XXDB 3X13A 1A3QA 1MPAL 2ARJA 3WLBB 5FO8A 1CBVL 3DX8B 4S0TD 4JPKH 1R3JA 3RI5F 2UZYB 3QYCA 3UROR 1PKOA 1XGRB 4P2RB 3QG7H 4G8EA 5CILL 4YZFE 4HWNA 5FGBA 3AVEA 3ULUF 2WW8A 4S1SL 4Z5RA 4LLDA 4MNQA 3TO4D 3OGOE 4DN3L 3BKYL 3B9DA 5F7EL 1MQ8A 3OKNA 2BSSB 1T66C 1F02I 3DURB 2CR6A 3MGAA 3TIDB 3LS5H 3QXWA 2XZQL 2YC1A 4F7TA 2IMNA 3KPQB 4WUKL 5I66B 4L8DB 1RUMH 4ODXB 3D3VA 4ZAKD 3UBXB 4ZYKA 2Y06H 1RVFL 2Y5TA 1CDCA 4GBXD 4R4BA 12E8L 2ZG2A 1KIUA 1WWCA 1XF4B 2DJSA 1KPVA 4U6XB 3QPXH 4PUBH 4IIQB 3QZWG 2DM7A 4JM2F 3TZVA 1U3JA 4OSUL 4P23D 5HPMB 1II4E 5E94B 3TM6A 2DIBA 3CPLA 4MXWH 4EUPH 1SJEA 4OLUH 1HQRA 2DJ4A 1A3LH 4LSSL 4D0DA 4ELME 4B0MM 3L95A 5DD5H 3RL1B 2OK0L 3KXFD 4KHXL 3CD4A 3CUPA 3PQYE 4QNPE 2V2WA 1MFNA 3U82B 4JFQB 3GRWL 1WSST 4YGAB 3K8MA 1CIDA 5D2LF 3SPVB 3PWNA 3P4NA 5EBLB 4M4RA 2HKHL 3MJ8A 5CEZH 5D71L 1CTNA 3QEQE 2R0ZH 1A0QL 1CFVL 3HMXH 3SHSA 1C08A 3QFJB 2JK5B 3H7BA 5DQJB 4HXAL 5I1IL 4JM4H 1MUJB 15C8L 2VXUH 3JWDH 4PJBA 3QUZD 2J2ZA 5K9OA 4GLRI 5GGVH 4M43L 4ALAL 3BKMH 3TF7C 1NMBH 1YA5A 1SVCP 3OKLB 4TYUA 5AD0A 5EO9A 4PJ7A 5E9DE 3PJSB 2FR4A 1AJ7H 4KJQC 1FE8L 3QEHA 1JVKA 2ZUVA 1KCVH 4JHBA 3GMMB 4FQXA 4H20H 4PRIA 3PGCB 5L0QC 1XGYL 1MNUH 3SE3C 2CXGA 4JFED 1QR4A 3K81A 4M6OH 5IWLA 4NNYB 2YK1L 3MXVH 3OKOA 1X5XA 5BW7C 1DBKH 1J8HD 1NH6A 3SE3A 1P4IL 1ZHBB 1HKLL 3VRIB 2ADIB 2EDWA 3EUUA 2R69L 4P0DA 3DX7A 3TVMB 1CF8H 2CXKA 4TUOA 3I6GB 3ZTJG 5T5NG 3MGTB 5LBSL 1J1XH 3QEUB 1MREL 3TVMD 2B5IC 5F8QC 3M07A 1RZJL 2E7LC 1JUFB 1MLCB 4JKKA 5CSBA 5C3TA 2IBZY 3OG6B 4YNYB 1AGDB 4X0KA 2FDBP 4HS8L 4UT6H 4K3EH 1FAIL 4KK8C 5SV3A 4XXCA 3ROOB 1P1ZB 2GAZB 3MRMB 1G7JB 3UP1A 5CJQH 4ZFOB 2CK0L 3FT3A 1CDYA 2YD1A 3UTZA 4I2XB 5HYSB 2ICWB 3UZEA 2PO6D 1RIUH 1LEIB 4RMRA 3OKEA 3T0EA 2WIMA 1YY8B 2P5ED 4ZTOL 4Y19E 3RVVC 3SGEI 5IG7B 3PWNB 3GNMH 5FGRA 2ENSA 3BGFC 3QAZC 4GRWB 1QFWI 2VR4A 4QY8A 3U4AA 5J8OA 1FNSL 4OCSL 4C59B 3H3PH 3WFEL 2C3VB 4DKEL 2JJTA 3Q6GH 3RBGA 2OJEB 3VXOB 1CIUA 2EDKA 2OZ4A 2AI0H 4FG6C 4DKFL 2O5YH 3BXNB 1VESA 3SDCB 1XAUA 3LQAH 4X6CF 3DI3B 1CE1H 1KFAL 3CVHB 3THML 1EFXA 1T2QH 2W0LA 2AXJA 3IFOB 5ELIA 4UOW1 3QDHA 1JGVL 1IBGL 2BC4A 2MMXA 1TCMA 2EIBA 1D9KB 5IEHB 4I8DA 4JRYD 4U3HA 4AEIH 1INDH 1RUKL 3BT2L 4JFZH 3CFEA 3O6FA 4PJFA 4UQ2A 1RZ8B 3IDYC 5BRZE 5FYJE 5T3ZL 4R6UA 1PY4A 5EN2B 1MCOL 4A2LA 1CGWA 1RZKH 2CJUH 1KN2L 1MLCA 4LOUC 1FL5A 4G8GD 5ESAA 3ARRA 3GJEB 4M02A 4DZBB 4HWZA 5IVXA 5DUML 3C60D 3GMNA 5DTFA 5BZWB 2DBLL 2V2XA 5ICZB 2AJSH 5FUCC 1AFVH 2VWEE 5MERA 4JO4H 3STZA 4QCIB 3VI4E 2ESVE 3I84A 2ESVA 4PJXA 4PJXE 5DFWH 4FHBD 4EBQH 4KHTL 1CK0H 5KTEL 3DETD 5L6YH 2DQCH 3C6SB 1XT5A 1JUFA 1XZ0A 3AS3A 3H42L 3MRHA 3SE8H 2EYSB 5HJ3A 2JIXA 1CG9A 3MACH 3PWPB 5FA3A 1MRFL 4PJ9C 1TNMA 4NDMA 5CJOH 4L29A 5JDSB 1F2QA 1H5BC 2IAND 2A1WH 4NQDD 1H3WM 3LB6C 3MRCB 2EH7H 2BFVL 4XVUC 3S36H 1VADB 4ORGA 1IAIH 3TFKD 3L1OL 2XZZA 2GEEA 3ZSSA 2NY4D 3W0WD 2XKNB 5J11C 5JQHC 2ZUQC 4K3GA 4JN1L 4YHKL 2VZTA 3V4VL 2XY1A 4M3KB 1RIVL 1PGRB 4X7CC 2LAGB 3QIBA 2C9AA 1NGPH 5EOCL 1JTPA 1OARH 4R97B 4D3CL 1DANU 2ZNXA 2JKXA 1R24A 2FO4A 3P0VL 4M62H 4ZXBA 3L3DB 4I13B 2YZ1A 3Q3GB 2VWEC 4FFWC 3HHRB 5FF6B 3ARQA 1U8QA 2DD8L 3RWIB 2V7HB 3G6DH 1AO7B 4G6JH 4DUXA 2C1PA 3FQRB 5H94B 2VERN 2V7NA 3T77B 3ARBD 3U83A 3LKQB 5B8CC 3S3PA 3TJHC 4WI5A 3L5JA 1A6AA 3N06B 1KYOK 4FRWA 2DAVA 5T1KA 2EIEA 3TNMB 2PTVA 1S7QB 4UQ2B 4LAQH 3KPSE 3UXFA 3B5GA 1KT2B 5GS1C 3K3QA 4X5XA 5IB1A 4R26H 5GHWL 2UWEE 2J4WL 2NZIA 1MHEA 1UJ3B 1CG9B 1RFDL 3QQ4B 1JHKL 3ARFD 3GMNB 5DTFB 3BGMB 4LLWB 4YQXL 2FWOA 3BD3A 5HGAA 3MA7A 5F7YC 4HGWB 3UTTA 3STZB 2VAAA 3FO1B 1U8HA 4RGNB 4PGBA 1P7KB 4JFXA 4JREC 1I4FB 1UB5B 2KL6A 2F8VA 4NQTA 2AJVL 4PRAA 4X80H 5KN5A 2XICA 4UIMB 3N9GH 3W0WA 3VD7A 1R5WB 4PGDA 1S7QA 1SBSL 4KWUA 2VLKE 4WFFE 4W68A 4OLVL 3LS5L 1GOFA 3VG9C 2E6PA 5AYUH 1F58H 1CLOL 4JFPB 3TBSB 4BYHA 1KULA 2VNCA 5D7JC 1RVFH 2R4RH 5F7NC 5D6DA 2LABA 4WO4B 2VJXA 2EDLA 1JFQH 5DMIL 3DRTA 3D9AH 3B8SA 7FABH 2GJZA 3BI9X 3QIWA 1EV2E 3DSNA 5C7XH 3RHWF 3PABB 5GIRA 4NO5A 1HHKB 1UT9A 4U6YA 5DC4B 1RZFL 3LKQA 1ZHLA 3QA3B 1C1EL 5GRVK 5JO5A 2X4UA 3CU7A 3EZ8A 4JHAH 4KDVA 5FHBL 2VXVH 3V4UH 3IB4A 5I0ZA 3MLXH 4JQVA 1FN4A 4NT6A 3TLRA 4S2SA 3HG1D 4MQ7A 4Y5YC 4BSVA 5D96B 1EXUB 2DQIH 4YHYC 1PYWA 5C0CD 3VFGH 4MD0A 1EBPA 1CFQB 3ZDXE 2VDLH 1A6AB 4AY0A 2DQDL 1QSFD 3JV0A 5JDJA 4KI5D 2FWOB 3Q6FB 2O61A 1RI8A 4X7TB 5D1QB 4C57C 3DO7B 3IU4L 5HVFB 4HXAH 4HUKB 4GG6F 1NJ9A 3L3HB 5FGCE 1OP9A 4KJWD 1C8PA 1A47A 5AEAA 5DRXB 4K55A 3RNKB 3T2QA 2X4QA 1XF5B 3RPIA 3PNWA 2CRMA 2OL3L 5J57B 3EAKA 3BFOA 3S34H 2V9TA 5TGBA 3MJ7B 3DMMD 3KPPA 1RD6A 4Z7QF 3LV3A 5I1HL 1FIEA 4K3HA 5CJ5A 3VXSE 5KVGH 2CRZA 1MCPH 4ZFZB 5C70A 3DMMB 4P2YA 5DMYA 3FB5A 4XWOC 2VLLA 1TZGH 3L6FA 4NIKB 4CVZB 1ONQA 4FMFA 3UPCA 4M5YL 4GAJL 3VXRE 3C08H 1ZLWH 1BD2B 4L8BB 1D9KC 4B7LA 1HKFA 5GISH 1GZQB 4LVOB 2ADFH 2IALB 3IJYB 3W9DA 1OM3L 2ICWI 3QQ9C 1K2DA 3MFGB 1QA9B 1EEZA 1B0RA 1OAZH 1DP0A 1LD9A 4ODVL 1X4YA 1I8MB 1NCDH 4FTVB 4XBEH 5M94B 3VGEA 1AHWA 5IJKA 3RWDA 4OLZH 3UYPA 3FQNB 4PRHD 1NANH 5HHOB 5EIIB 4I0KA 2Z91B 4KRLB 3MRDB 3MRGA 3EJZC 4LCCA 4XBPA 4U1IB 3NIGE 2FHCA 5I1AA 3TP4A 3EFFA 1WLHA 1IE5A 2RCSL 4L8CB 3HUJB 3TBTB 1IGYA 1LO3L 3ZDYE 5ID0A 4MMXC 1YZZA 3ROLB 2CKBL 5EU7C 3MV9D 4PJBF 5SX5H 3H3PL 2EH8L 4Y8DC 3U46B 4DKEH 4Z6AT 5F6IC 2NMSA 5BO1L 2K9UA 3FFCB 5A2IH 4CU6A 1YN6A 4N0FA 4JDTL 3BRGC 4MGXA 5DQ9A 2BVTA 2IQ9L 4RISL 5K93A 1QYGL 3E2HB 2DB8A 4MQSB 4QOKD 1QZ1A 5SWZA 1NBQA 1QTYT 3PGFH 2X42A 1HXMA 1LHZA 5E2UH 3P4LA 3ZO0A 5EPMA 5E8NA 3TEUA 1FVEB 3GJFK 2YC1B 3BT2H 1H3GA 1R0AH 1IGYB 4LLYB 4PG2A 5IB2B 5L8LB 1TJIH 1U8NB 1Z2KA 4D0CB 4KY1H 1G7LA 3O9WB 1MWAL 5DRNB 1T5XA 2Q76A 4WHCA 3SDAB 5TE6H 3UTZB 5GS1A 3D25B 3QFDB 1ROWA 2WBWB 5E03A 3UMTA 4QHLA 5C0AA 1PJ9A 4PRNA 1IGIH 1ZSDB 2L4OA 2HJFB 5CEXA 1HQRB 4F7CA 3DV6B 4UBDD 3BH9B 4C56D 2R29H 4R8WL 3EFFB 4FFWD 4FN0A 4LRIA 3UTPD 3V6ZB 1PLGL 1ZHNB 4NQSB 1PAMA 1B2WH 4L1HA 4M7ZC 3BSZL 1HI6A 5ISZA 2V2TA 3O11A 4APQD 5DRWB 1CFNB 1JNNL 1ND0B 4WI9A 3QNYB 4IOFD 4KV5E 2WUCH 3WKML 3H7BB 1G84A 3L7EA 4XPTL 1XGQA 2D4DA 5CSZA 2WUBH 1JF1A 4Y4KA 1EHNA 2QKIA 3LQMA 4ZAKB 2EDHA 2BDNL 4PJCB 4C58B 4ODSH 1B4RA 1J8HE 1G9NH 2A38A 2F5BL 4RMQA 1V7MH 4XPFH 1E4XI 2W9LA 1JGDB 1T1YB 2ZOKA 1OAQL 1ZTXL 4MCYB 4P46D 4FS0A 5DVOA 5FKAA 4XP9H 3PJSA 2AK1L 5IFAL 1FRGL 2JIXB 4P2OC 4QHKI 2KH2B 1JBJA 5E8PA 2ZUQB 4FTVD 3MCLL 1EPFA 4EQ3A 3QIUD 3MMEB 4LCCC 3F8UB 1X44A 1SEBA 4LSPL 5MERB 4XB7A 5E8DL 4IRZL 3KLSA 4HUVA 2Q76B 5GS1B 1IC4L 4WI6A 2EDXA 1A6ZB 2F53B 5FECB 3HUJE 1EJOH 3PXHA 4Y5XC 3MRHB 5GGRB 1YYLL 5T5FH 3VFRA 4WDIB 5FCUH 3L3OB 1WFUA 1D5BB 5I76B 2W0PA 5D7KD 3E6HA 4MJ6A 4IRJA 1IGML 4B53A 5LJYH 3TGXA 3QUZA 5F70A 4ZTPH 1LEKA 5C9JA 4JJ5B 4K8RC 3FMGH 2Z8WC 2LU4A 3FO9A 4IJ3C 4OFPA 2ZWLT 4ZUWA 3KLAB 4LLVB 4HMCA 5DD0L 1CU4H 4DGYL 5M95B 4M93C 2Z92B 2DQUL 5ISZB 1CLYL 5FYKE 3T2NL 5DD3L 2BOCB 4ZFGH 1OCWH 3L3GA 5ISZD 2HFFA 3SDXB 4M1DL 3UYOD 4U1KB 3VXNA 4WTXA 5CD5D 3MBXL 5JW4Q 2X4OA 3ULVH 1AY1H 2IPKB 1O7VA 3BKCL 3T1FB 4X8XA 5JUEL 1BX2B 3BP6B 3OAZH 3RZCB 1IGJA 4K7PY 1PBYA 3U7AA 1YMMA 2IGFL 1F45A 3I50H 5I1JH 2AABH 4MD5B 5IBUG 4PGEA 4UV4H 3Q0HA 1VGEH 5I19L 4CMMA 4HS3B 2AXGA 1EK3A 2HT3C 2Q86B 2ZCKL 4OJFH 1LE9B 1HCFX 1N5YL 1OSPH 2I27N 4JEGB 3OGCB 3CH8A 4XVJL 3ARWA 3GMOB 3NFSL 1BVKB 2XI9A 4NN6B 5C07A 1VFOA 5I75C 1ULVA 4ISVA 3P30L 5C7XL 3F5WA 2CDFB 4Z7OE 1F4HA 2YD8A 3DX8A 4P9ML 3B83A 3WSQL 3QH3B 1I3RB 3K46A 4JG1L 3O3BA 3OKNB 4PJCE 4YHOH 2C7UA 3DETC 4LNRB 4J12A 3UO1L 3TYFA 1WQVT 3JV6B 5ITFA 2QADC 2AERT 5LWYH 2VE6B 3OF6D 1KELH 1OSZB 1S7WA 4LF3A 5JPMA 3FZUD 3IJSB 1F4WH 3VXRA 3C2AH 2YA0A 2MHAA 2XKSA 2NW3A 2DQDH 5C0EB 1J05A 4IOIB 4WW2A 3B6SB 4U05A 2ZUXA 1G6RH 4KKNA 4OI9A 4DUWA 3VW3L 5I1EH 1YEGL 3ARFB 4PTTB 4J1UB 5HYJA 3NCCB 3IDJB 5BV7L 3TZVB 1IAII 1QLFA 4JFEA 4LCIH 4PJHE 2Y5EA 3SDDC 2J5LB 3GSNL 4P23C 3CX5J 2V2WB 4PB0H 3TT1H 1JMZA 2UWEF 3T0VA 4S1RL 2DWDA 1HHGB 1N4XL 5AWNH 1IKFH 4E5XB 1LO4L 5T33H 5D2LE 4PBXA 4F37F 1MRCL 3HNVL 4OB5H 3VH8G 4K7FB 3WIHL 3E3QC 4H5SA 4UILH 1HIML 2NXZD 4KRMB 3VRLE 1BD2A 1FIGL 5LGHH 1EXUA 1HE7A 3IJHA 4TVPH 2P42B 3CAFA 5DVMA 2W9EH 3VFMA 1ACZA 5K9OB 2GI7A 3DVGB 1C16A 4JRXA 4K8RL 3ZT6A 4LHJB 4Z7VE 3LPWA 3QH3A 2AXGB 3O3DB 1NCCH 3IDJA 4HIJB 1BBJA 4X6FB 2V5MA 3PGDA 1G9NC 4HIHA 1XCTB 4NRXB 1IT9H 4JDVB 1F3RB 3KYAA 1FNEB 1L7TH 2EDQA 1TENA 1DQDH 4XRCB 4CN4A 4UDUA 2CQVA 3CCHA 2JJWA 1IL1B 1Q9WA 1KPRB 1JIBA 5KS9F 4I3GA 4YXLL 4NRYB 4Z76B 3IAPA 2B1HL 1I7RA 1PSKL 3EJYD 1J86A 1UXWA 4H0HB 4IM8A 1A3LL 3FQUB 2ZG1A 4HAFA 2AK4A 4RMTA 4G42A 1FVCB 1FG9C 5DDHB 2QHRH 1A4KB 3H9ZA 4EI5B 2YWYA 5E4EC 1EO8L 4YHPB 4JPVL 3WUWB 4N0UE 5ALCL 2H32B 1U42A 2W1NA 4ONHA 5C71A 4GG6E 3NCYS 1FSKC 1BM3H 2H26B 3S36X 4MA8L 3HI6H 2XRAH 1I85A 4ZNCD 3FB6B 3PQYD 5D7JD 3GBML 1YEEL 4M6ML 2ADGA 4DFIA 2HKFH 2PTTB 5BCAA 3AGVA 3PDOA 1V3LA 1FNGB 3G9AB 4MCZB 4GKZA 3VXMA 4WFED 3RL1A 1UXSA 2F5AL 3VFTB 5E2UL 1NAKH 1Q72L 2UZIL 1JHTB 1D5ZB 4JN2B 3PIQB 5DJZB 2VOTA 1I8MA 5EU4B 5LQBL 3KDMA 4XH2B 2HJLB 3PE9A 4H20L 1U8OB 5FYJU 3FFCE 1UZ8B 3NABH 2YSSB 5HHOA 5GXBB 4EDWL 1T5XB 3D69B 1VFAA 1QR1B 5FHAH 1CN4A 2X7LB 3TPUA 4Q9BA 5K59F 2VDNL 2P24B 1YNLH 2BK8A 3TWCH 2YPKA 2H6PA 2VL4A 2WSKA 1P4BH 3MRJA 4I5BA 3MOAH 5FFLA 4HQQL 2X4TA 3QPQD 3DGGA 3G5VA 3BPNC 1SMOA 2C4FT 1DFBL 5EZOL 1X5HA 5JOEA 5I71B 1TVBB 2YRLA 4PD4J 3FFCA 2ZUTA 3GFUA 2GIYA 3R8BB 1L6XA 1ZHNA 4NQSA 3WUWA 4J3SA 1JHLL 3FONA 4JFFA 4HS6B 4NO2B 5JHDD 3HRZA 4GRWE 1P5VA 5TF1L 4R4NC 3UTQB 2DQEH 1LK3L 5DEFB 1JNLH 3U6RA 4YC2C 3OPZL 4G7VH 3REWB 1BQUA 1JWUA 3W11D 2FYYA 3SEPA 3HC4H 2WP3T 3V79C 2BVPB 1A9EB 3PDOB 3EBAA 4WEBH 5L8JB 1NCNA 1BJMA 5DJAA 4YXKH 3EJZD 3VXMB 2QQLL 1JZ2A 1QNZH 4XNQB 3LKRB 3ZL4L 4AM0A 5HI4C 4CU8A 4Z77B 3DROB 4N8VG 3MYJA 3QCTL 5E5MA 2VZVA 1C5BL 5C0AB 5C8JA 1JYVA 4X4YB 1QACA 4CGTA 1LP9A 4PD4K 3BUYB 1RUPL 1AQKH 5HI5C 3FT3B 4GLRH 3RWGB 2RGSA 5C0CA 4EN3B 2ZJSH 4DAGL 3OZ9H 5IHUL 2XKNA 4X4ME 3DRQA 1S78C 3Q1SH 3BEVB 3LPFA 3IJYA 1UB6B 4XP6H 1PG7L 5DYOA 2F74B 5FK9B 4HHAB 2X4NA 3MRFB 4MJ4A 5AZ2L 1YEDA 1XGQB 1G6RA 1TJHH 4YE4L 3RUGE 1MJUL 1Y18B 2FX9L 1ZLUH 2C3XA 3HLAB 4LHUD 4JFFB 2I60L 3QWQB 3VXSB 2W92A 1RURL 1T1YA 1X9QA 3E2HC 4JFFD 3T3PE 1EAPA 2A6DB 4HJGB 3QNZA 4KHTH 4F7MB 5HHPA 1T7VA 4V2CB 2JELH 2J88H 1WIPA 4KDTA 3GO1L 5D2LA 3F7YB 4P3WA 3WKNA 1H8NA 1Z0MA 4KZDH 1G7QA 5CJOL 1T89A 1DUYB 5HVWA 3B9AA 1LEGB 2EZ0C 4I48A 4P2QB 4G8GE 1UJ3A 4MNQE 2VR5A 5DMJB 1E28A 1A1NB 4FQPA 3QWRD 1FDLL 2Q86A 2FYYB 2H45A 4X4YA 5D1XD 1NGXB 3RY6A 3BZ4A 5C07B 3SGKC 4RCAA 1FG2B 5EFIA 3T3MF 4TQEH 2AV1B 4N8CH 4KVCL 5EOCH 1H5BA 3JUYA 4N9OB 1EX0A 1I9IH 3T08A 1YQ2A 4B50A 5TFSH 3UJJL 1DANT 2Z4QA 1T1ZB 4PJIF 4KI5E 2DQGH 1CT8A 4NO3A 3MV01 5ADPH 2VE6A 1A3RL 3JWOH 4FNLH 4XP5L 1CQYA 3N1QC 3R0NA 2EKSA 3F65A 4M5ZH 1H3UA 3EGSA 5J1AA 3RTQB 2AQ3A 3VXQB 3EO9L 3WDIA 5J6GB 1JRHL 4X9HA 1MHPL 3EHBD 4P3CH 3LKOB 4N5ED 2OX5A 3H3KA 1NGXA 5IMLA 4LAQL 5A16B 4LASL 1JZ6A 2XWTB 3LEXA 4Y2DB 3O45B 5CINH 1S9VA 4J4PA 4Z95H 4BFGA 4NNXB 3GK8H 4JLRB 2XA8H 1W0YT 3MRLA 3ESVF 4ZNEA 3BQUA 1MCWM 2D9QB 4FQLH 3S96B 4JVWA 4WFGD 2ADJB 3RVVD 5JW3L 2KDGA 5GGQL 4NQCA 1RUAL 1U58A 2O5XL 1X5JA 4YFEA 3DYOA 5EIQA 1ZLVK 1XH3A 3LD8C 1YEKH 4R4FH 3TBVB 4C54A 1R3JB 4X4ZA 4JCMA 1NLDL 5BW7A 3C5ZD 3HE6D 4UDTA 4QHMB 1T03H 4JFFE 4PFEA 3DIFA 3MNZB 1MFBL 1F11B 4HIEB 3BEWA 1H5BB 4HKXA 4WTZG 3DVIA 1XGUA 5C0JA 4TPRL 1UVQB 1UKSA 3IETA 4XCFH 5CZVH 3SKOA 2PR4L 3I6KA 5DSCA 4LRNL 2P8MB 4NQVB 1FNEA 5BRZA 4KTYA 2UVFA 4TTDD 1V3KA 4KDTC 1GGBH 1UJ3C 2JB6B 3U79A 3V7AG 2PO6A 1XR9B 2I9TB 3NN8A 3PG2A 4JFXB 1S8DB 3LV3B 3KPTA 4R4BB 3RUGF 4G8FA 2DOCA 3B9KD 5FHBH 4G8EB 3ZDYF 3WN5B 1OD9A 4I3RL 1JZ5A 5IW1A 3BZFA 5EC1B 4XWOD 1ZXQA 1QSED 1ED3A 3C60B 2XN9E 1DL7L 1CVRA 1MELA 4WW2F 5KSVA 1T04A 3SOBL 2E27H 5FIEA 3C5SA 3IFNL 3T4AA 2BNRD 3BQUB 4HPYH 1IARB 5EBMA 4WW1A 1E4JA 3CDGA 3BQUD 2BNRB 1WIUA 4XRCA 4Z0BL 4M6MH 2W07A 3TO4C 1GGUA 4JHWL 1XGTA 2NY4C 4DGVL 5F7LB 2HT2C 1RK1A 4IHOB 1S7RA 3T0WA 3QXUA 1FYTA 3HG1B 3JUZA 3FQXA 2R8SH 5CJ8A 4GT7A 3BE1H 3KXFA 4KKCD 2OP4L 4XPAL 3WV0A 1Q0YH 1A7NH 4OZIB 3G6AA 1TCRA 2UY7A 3VG0H 5D1ZC 4NFDA 4YHLL 2BHYA 4O9HL 3RWCB 1KEGH 1NC4D 4HKBA 3SGDH 4UU9B 4PRHA 5J11B 3HZVB 4HUUA 3V0AC 1R5IB 3SN6N 2NX5D 5E7BA 3TNNA 1YJDL 2AXFB 5I1CL 5HHVL 2P5EE 4WWKC 1JNHB 1OGTB 4RAUB 3ZYIA 3SCMA 5T3XH 2DM3A 5CD3A 4LKXA 1WZKA 2JB6A 3IRPX 2GITA 3TBYB 1VENA 4PBWD 2CDFA 5JMRA 4WEMB 5CMAB 2PNDA 2Z31D 5DQJA 4Y19B 1XGTB 5DEGA 4RIRA 4HKXB 3V6OA 3A6OA 1ZVHA 1X5KA 3GMRB 1K8IB 2Y07H 5C0IB 3INUH 1BZ9B 2FX8H 1J0YA 1M7DB 1X4ZA 4PP1D 1G1CA 5EIVA 1ORSB 4GW1A 4PLJC 1KXVC 1T4KB 1TVBA 2EE9A 1BEYH 1MY5A 4O5LH 4PJ5B 1W8OA 2VZSA 2NY5L 2IPTH 2V5SA 3SDXE 2NLJA 5CCKL 4HUUB 2FECL 3W9EB 4JO3H 4XGZB 3U4EB 4HC1H 3DVFA 4K3DH 1UXSB 1S5HB 1VEOA 2DIJA 5D93B 3BN3B 1DEEA 5KSBB 5DK0B 2ITCA 2DYPB 1MH5B 1S7RB 4LPVA 4M7JH 4OKVA 1KXTB 3TVMA 2R2HA 4KK6C 3RTQC 3BHBA 4OIIL 3CC5A 5D7IB 3FN3A 1OPGL 2D31B 4M1GH 3SE4A 4Z7VF 4KU1A 5D70L 2L0DA 4I2XA 5HYSA 4WW1B 3CXHK 4L9LB 1KCRL 3BDXA 4QGTA 2GTZA 2NY0D 1KXQE 2HTLD 1LD9B 1S3KL 1YEHH 2GCYA 3DWTA 1ZEAH 4GRWH 3MNWA 5E6IB 1NAMA 1IQWL 2P7TA 1X3DA 4MHHI 4PRBB 4Z7WB 2UYLA 5FYLH 4KVNH 4NNPL 3K2UH 3BVNA 4F58H 3G6JB 12E8H 4LVEA 3RGVC 2J7LA 3KS0J 4PY7B 1JZ7A 3IKKA 5HY9A 5DRWA 2IJ0C 3AB0B 5TH2A 3R1GL 1V7NL 2BVPA 4APQA 3VXRD 3KPSD 3RVXC 1YNKL 1I1CA 5I8EB 2D2OA 1AHWC 3KPSB 1NCAL 3GSOB 4LSSH 4EN3C 5LAXB 2J6EH 1FFOB 2P8LB 5IW3A 3UTQA 4PRDA 1NBVL 1WC7A 2B0SL 4HCRA 4YHIB 3VFUA 1QRNA 1DE4A 5HYJD 3FAXA 3IDXH 2XG5A 4UAOB 4AT6B 2C1OA 3IU3B 4HXBL 1KJ3L 2ED8A 4P2OD 4HUVB 3VWJA 4MSWA 4NCC1 1W72H 3BAEL 4KGLA 3TESA 1D9KA 2B4CH 1GH7A 1F97A 4XHJC 1KJVB 2J8UB 15C8H 2VXUL 3P11L 4X6BB 5D1QD 3SO3C 3EYSH 5GGRA 3U1SL 2OTWB 3CFKB 2B1AH 2E3VA 1RMFL 2JCCE 1UEMA 2PKDA 4BZ1L 3MLWH 2APVA 2DDQL 2OZ4H 5KW9L 4TUKH 4LIQH 2YUWA 4LSRL 1AGBA 2DQTH 2FGZA 1T21B 5T1LB 3CFBB 4HZLA 3L5WA 1MFAH 4RGMB 3S4SA 2QSTA 4NSKA 3UX9B 3ILPA 3GI8L 1WV7T 1AGEB 1U3HC 4GKSB 2IBBA 1BFVH 5F3HB 1UKTA 1LP9F 5CHNB 3MROA 4XPBL 5JORB 1BJ8A 4K94L 4LLMB 2XACC 3TN0B 4NN7C 1WT5A 4X5WB 1U8OA 4MNHB 1LEGA 1ERNA 1NC2B 4NN7B 2KZWA 3REVA 5BVJB 1BX2A 3W39B 3C5JB 2HLFD 3N50A 4N1EA 2FJGB 5KVDH 4X98B 3ZKND 4XNZC 2EE2A 3GEWB 3IGAA 3SE4C 4FABL 1NCWH 3OV6A 2DKUA 3OWEA 4S1DD 3H9SD 1R6VA 1CFTA 1RHHA 1ZAGA 5EBGA 1IGTB 1WBXA 1P2CB 4PJEA 4ODUA 4DZ8B 3JV5A 4ZPVA 3G5VB 2C5DC 5IV2B 3P73B 5E6ID 3E1F1 4K3JH 3GGWA 4LLDB 3MODL 5KJRH 2G60H 4TSCH 1JTOA 4XVUD 4NWTL 5LCVH 3WEXB 5AAWA 5JW4R 3O2DH 2VDOH 4X7SL 2VLKA 4HAGA 5LGJB 2QQKL 1PX4A 1UCBL 3QHFL 5EU3B 4LPTA 5I15H 5GGQH 4GRLB 3PHQA 1UM4H 4R7DB 1UWGL 4NHCH 3MV9B 4OFYD 5L2JA 4P5MB 5E08L 3OX8B 2VXSL 5C86A 2HFGL 4U1GB 3RDTD 4Z0XA 4CL7A 3RL2B 3BKCH 1T89C 2OTWA 4PV9A 4X7EC 5ISZE 4YPGB 1P7KA 4NP4L 4IRSC 3B6SA 1DLFH 1G7HA 4RQQB 3RX5A 3AXLA 1FZOB 5GZOC 3MRIB 3EOAB 1BWWA 4IS6A 2VLJE 2P47B 3A6BH 4TOYL 4U1LB 4HGWA 3TJHD 2FLBT 4FMKA 5TE4L 4TUJA 5MEPA 1AP2B 4JFDE 3CDCA 2CR3A 5C0BA 5DVLA 1OP3K 1KSRA 3SGEH 1AI1H 3F7RA 4QTIL 4NCC2 3U7YL 3UC0H 3HC0A 2F53E 4HD9A 4U1MA 5EO1A 4I3RH 1IGJB 3V4PL 5F9WC 2VH5H 5FDYA 3K7UA 5ACLA 1A5FH 4KDWA 5KN5B 1TFHA 5KVFH 3H42H 1CICB 2YMXH 1J9CT 3RTQD 1T04B 1TZIB 4BQCA 3WIIH 1LE5A 4X6DE 5EG6C 2NY3D 4MDJB 2A74A 2P8MA 3S9DB 3WFCL 3MV8E 2VL5B 4NZRH 1IGCL 1H3PH 1MF2L 5I8OH 1ORQA 5EU3A 1YECL 2GT9A 4HH8A 3PWLA 8CGTA 4JHWH 2FGWH 2EC9T 1FQ9C 1E6OL 3OKOB 1C12A 1B6DA 1JN6A 2FIRT 2NY1D 1GIGH 1KC5H 4FZ8L 2YRPA 2IQAB 2OP4H 3I3DA 4XPAH 4U2YA 4Z0XB 1A7NL 4JQXC 4PJFF 2FBJL 4P46C 4U1MB 3GKZA 1Z0NA 2EDRA 3MV7B 2OR9L 4ZSOA 4O58H 4U6TA 1PYWB 4KJYB 4PS4H 1B0WA 3OJMB 4GRLA 3VDAA 1NAMH 1E28B 4QEGA 3IDMB 3HKFA 1DQTA 4PRPA 4LSQL 4U1LA 4RAUA 4AEEA 5D1QC 4PJXF 5CD3B 3O6MH 4FFVC 5IB5A 4MZ3A 4KTDH 4JM2D 1FL3A 3PWLB 1U8PA 3QI9D 2BRRL 2VC2L 5L88H 5D72H 4NUGH 3VD5A 5AYQA 4PRIB 5DUBA 2JB5L 1GGCH 4FQJH 1XF3A 5ACMA 4R3SB 1OAKH 2F53D 4AZ8A 5KANG 3GSUB 4WY7H 3F6LA 3CZFA 4OFDA 2AEIT 4ZS6C 4PJ7E 4CRPA 3QZWA 4GBXA 3GDBA 3D3VB 3QUYA 3DUSB 4JAMB 5IW6A 3FO0H 5B21A 2X4RB 4HC1L 4NKQB 5JQ6H 3W2DL 3LN5A 5IKCB 2FJFB 4CJ0A 1FNAA 1NGYB 5FUOH 2EYRA 3ESUF 2QHRL 3QWRA 4JPWH 1R5IA 5CS7A 5D9SA 4NOFA 3CFDA 3GB7B 1D5XA 1X7QB 2B39A 5DFVC 4NM4H 2Z8RA 4HGKC 3CUPB 4MB4A 2AV7B 4Z78B 5C09D 4LLQA 2YPLA 4ODHL 5E5RB 1X5ZA 5GJSH 3MXWL 4Z7NE 1AR1C 1U95A 5LXGL 2GK0A 4C56E 4PJEE 3GI9H 4G6MH 1SBBA 3TV3L 4NRYA 4HFUL 5MENE 3GRWA 3QULB 3J7HA 4XT1C 3T8XA 5SWSD 4D9LL 5B3JF 2JJTC 5GPRA 1DLHA 2XTJE 3QISA 1BIIA 1ADQA 1S9YB 1YEJH 5EA0L 3DUUB 5ETUB 1U0QA 3UZVB 3VRJB 2YA2A 1YNKH 4WI3A 1CLCA 4CN1A 3LN4A 4GG6B 3L95B 4F37K 2UY6A 2QADD 3QUXD 5DK2B 1GOHA 3MLXL 4GSDH 5IBUB 4KXZI 2HWZL 3P9MA 4E42A 4RAVA 3FQWA 5IB5B 5I74B 2I5YH 4TNWF 1A6VL 3PDDA 1GVIA 4M7KL 2K7PA 3H0TA 1IKNA 4PY8J 1RY7B 1AXTH 2XPGA 1BQHG 3VWJB 3ABZA 2IH1B 3LRGA 3KJ6H 4L9LA 2VLME 3QCVH 1LO0L 3HTLX 3DRQB 4GH7B 4ZSOE 4TVSa 1L6ZA 2ADIA 4A6YB 4R90H 5ANMB 5MHSD 2R0LL 1SEQH 3F58L 1DDHA 5I1GL 2CLZB 4FQCL 4Q58C 4XMKL 4N8PA 2FEDD 1OW0C 2VLJD 5JR1H 3FOLA 2NX5E 3KXFE 4G43A 4QRUA 1OAXH 1CBVH 2AEQH 3SDXF 4M00A 5KVGL 1LDSA 4N5UA 1AGDA 4QRRA 1ACYL 4X0KB 4PTUA 5C09E 5HVGB 3UTTE 4H26B 5DHVB 5IMOB 5ID1A 4OFIA 3C08L 3QNXA 3QNZB 2A6DA 5E8OA 4F7MA 4ESKA 2Y7QA 1I1AB 1SQ2N 3CX2A 4Y4HD 1QD0A 3OKDA 1UWXK 2FEEL 5SWZE 3A6CH 3V6ZA 3BWAA 1BVLA 4U7KA 4PRHB 5F7EH 1SY6H 2YBRB 2V9QA 2DTML 2NXZB 3CFKA 4XI5C 3MRRA 5JLZA 4NQEB 4LFHD 3U36A 2KUTA 1KLUA 1S7SB 1G7IA 3DXAB 5CIPH 1I7ZA 3MLUH 3NCJL 5CLTA 1GZPA 3MV11 2BXYA 4JFOB 4OBSA 2DQJL 4LLAA 2ZSWB 5F7KC 1CD0A 3OG4B 2FHBA 4EI5C 2GTWA 1JZ4A 1U8LB 4Q9QH 2SEBA 1KIRB 4ONGH 3SY0A 5F89A 3RX7A 4BZYA 1UACL 3WLBA 4ODUB 5FECA 4M4PA 1LEIA 1YEIH 3CXDH 3P0VH 2HN7B 4GXVH 4L4VB 4UNVA 4P4RA 1SY6A 4ODTH 1AGBB 4JB9L 2RCSH 1Q1JL 3BP7A 1SYSA 5JW4N 4Z9KB 3O3AB 4EN3D 2HKHH 3I6LE 5K9QG 1P7QA 3S4SB 5J7CC 3PWJA 5ALBL 3W39A 3C5JA 4K71B 2XTJD 3CSBA 4GO6B 1FNLA 3TIDA 3R06A 4LBEB 4PR5A 3HMXL 4R7NA 4F7TB 4F8QA 3B9VA 1FYHB 3MLYH 2Z92A 5GGTL 3DRTB 3RWEA 3ULUC 4PJ8A 5IQ7L 2IAMA 2Q20A 2AJXL 3PQYB 3QRGL 5J3HC 3F12A 3MGOA 3MRFA 1MEXL 5BRZD 2DF3A 5HGAB 2NY6B 4WFHD 3QDME 5GS3A 2HFTA 2YOCA 4OUUA 3QT2A 4QXUL 4S1QL 4Y19D 2R15A 1AKJA 2XWJA 5GJTH 3U4BH 3QEQD 4XCNB 4ERSH 5C0NC 1FO0B 3LN9A 5F1IA 3VXSA 3V5KB 4FFZH 4XP4H 5CEYA 3ULSA 2W9DH 5MEPB 2EIDA 3QNXB 4QOKA 4U1NB 1N7ML 3VWKB 3SDYH 3HMWH 2BVOA 1CTOA 5DT1L 4E41D 5EC2B 2VDRH 2QTEA 1U58B 4APQB 4ORZC 3OKYA 4U6VL 3SKMB 1MJ8H 3QIBD 3P9WB 1MHHA 4NQCD 5DJXB 3WXWL 5DJCB 3PWVB 3WL9A 4HKJA 2ORBL 2GY5A 5HI4D 1P4LA 4WRLA 4JCLA 2HN7A 2R1XA 1S7XA 1I85C 2XFXB 1C5DB 3RBSA 4AG4L 3V8OA 1YC7A 4PJEF 3RVUC 4WVRA 2Q6WA 4R4ND 1MPAH 3GSXB 4RGNE 3V6FA 3PHSA 2DLHA 3JV6A 4Y5YA 5DD1H 4Z7VB 1MHPH 4P3CL 4D9QE 4LP4A 2E7HA 1FPTH 2VXVL 3D5OF 4GQ9L 3ZZ1A 1HILB 3GUTB 1A14H 1SJXA 4N0YL 3MBEC 4Z95L 3RVWD 2MPAL 3FO2B 3V52H 4ZO8A 5EUOE 5JHDB 3MRIA 3WHE1 5F9AC 2R0KH 1OT2A 1FVDB 1L7IH 1L9MA 2YWZA 3DXAD 4ZMAT 3SGKA 3C09B 4ONFH 1MIEH 4PTTA 3SKJL 4HDIA 4PREA 1MHCA 3RY4A 3U0WH 4QHUB 3TFKC 4OLYH 1RJLA 3NFPA 3ZTNL 4ZQKA 4XCNA 4KAQH 4QHKJ 4WW2B 3IJSA 2WIIB 4RMUA 3QDAA 4WO4C 5D7SL 1IRAY 4MS8D 4Y5VA 2YN3A 4GAFB 2BNRA 1P84J 5C6WH 3CPLB 4RFOH 5C07E 1ETZB 4Q6IA 1HEZB 5EIIA 4GAYB 5BZDA 5IMMB 4HFWB 1BPVA 5E2JA 3HPJA 3OXRA 5JHDA 4AIOA 3FQTA 4JPKL 3ROOA 5GS2H 1T0NB 4KHXH 5F6HI 4KQ3H 3QG7L 4IEFB 1DN0B 1JPGB 5HHME 3O9WD 4YHYB 3CFCL 5GRUH 3M17B 4LCUA 3QDMD 4KKLD 3SDAD 1DBBH 3P9LA 3QXDB 1PZUB 3PGDB 3K80A 4NPYB 5L9DL 3SCMB 2AJSL 5J9PA 4B7IA 4N9GA 3KPLA 4LNVA 2CO6B 4MMZC 3HS0B 2CGRH 3IJHB 2WK2A 4YBHA 4DCQB 1CICD 4HX1A 1OP5K 3NIFF 4L9LC 3P40A 5I1DA 5C0JB 1PZ5B 4F2MA 3S88L 1KTKE 3LMJH 4WGWB 3WIHA 1R5WA 4PGDB 1GC1C 4UQ3A 1RIHH 1T0NA 1GJIA 1NLBL 4D0BB 2Z91A 3L9RB 5A2LH 4DK6A 2XNAA 3DJ9A 3CCHB 3UTSB 1IEBA 6CGTA 1YN7A 4P57A 1CFQA 4ODBD 2Q7YB 1D5MB 3RA7H 1EZVY 3TV3H 2NY5C 1MFCL 3MRNB 1NMCB 4UDUB 3ULUH 3QULA 4QRRE 1B90A 4YDLC 1AE6L 4XC3H 2B4CC 3MJ8B 4LPUA 2NY0C 1RJYB 5EC1A 3PWUB 5AZEL 4TSAH 3EFDL 4N0UA 5IMKA 1NJ9B 3L3HA 2HVKB 3HS0A 5GSRA 1U92B 1KB5H 3V4VH 1HHIB 4PREB 1A4KA 3WO4B 4D3CH 5C07D 1QHPA 3BPOB 3IAQA 4JRXE 2FJFA 2DLIA 5CBAB 4GKNA 2CIIB 1YY9C 3B2VH 3OKLA 1DN0A 5CWSA 5EU4A 3S35X 3QHTC 2G2RA 1R3LB 5LWYL 2A83B 3RVXD 5E7FA 2CDEA 3QIUB 2Q7NA 4KK5C 4OZGF 3PWPA 2GAZA 3MRMA 4MAUH 2P7TB 3RZCC 3KXFB 2O5ZL 3DYMA 5D1QA 4FQXB 1DQQA 1MIMH 4OT1H 4Q74A 1XF2B 3D69A 1QR1A 4OTXL 4Z7UF 1VB9A 1TVHA 2MNUA 4X8JA 5DHXB 4DCQA 2NY1C 1RPQA 4MNGE 4DUVA 4A6YA 4YGVA 1MAML 5GZNC 3TT3H 3ORJA 5EULV 1XF5A 1DVFD 1CICA 3GSOA 4P5TC 3F7QA 3VE0A 4LGSB 5E9DB 2ZCHH 2OJEA 3VXOA 3O6KL 5ESVB 3WFDH 4WJ5A 1HDMB 2WM0A 2GT9B 2X9WA 4J3XA 3GHEL 3TPUB 1IGIL 1N3NB 1VFBB 4QRRB 2WBJB 1EFXD 4NUJA 3IDYB 1B4JL 3MRNA 4IRSA 4MNQB 2N7BA 4OB5L 2R29L 2ZUSA 4R8WH 4LARL 1QRND 3IFOA 3CH1A 4E9LA 5E1HB 1T83A 2VSDA 1M7DA 3X3GL 1CXEA 4XP1L 4XC1L 5F7DA 2IANB 2A9NL 4AEHH 1U36A 4RAVB 4W81A 3O0RH 2W9EL 4HS8H 4UT6L 4UTAL 4P2OA 2OM5A 4CDGC 2DLTA 1IEBB 1CGXA 3QG6A 5I1LB 4HK0B 1REIA 3AREC 2DJUA 4EKXA 5KVMC 5GS0D 4K9EC 1UH3A 4AMKH 1MCBA 2HFEB 4QWWD 3ZKMD 1N6VA 3HCVB 4UUJB 2NNAA 4N0UB 4BFBD 3EIFA 2LVCA 1HQ4A 5KAQG 4QRPA 1PVHA 5E94A 2MSPA 2NXYC 2NTFB 1JWUB 2AKRA 1ZT4A 2HLFC 2DQCL 3ARGA 4OF3A 4BKLA 1TPXC 3DXAE 1OY3B 5J12C 2X4OB 5DWUL 2A83A 2R4SL 4OFYA 5KAQF 5HDQL 5DYOB 1KJ2L 1FZJA 3QB7C 4CW1A 5D7LE 2Q87A 2FIKB 4YWGL 1KJ3H 3TH4T 3DBXB 3BP5B 1FFRA 1HHJA 5A2JH 5IOPB 3LY6A 4QXTA 3BKJH 5HHXL 3FAWA 5F6IB 4KQ4H 4YGVB 5TQ2H 5HYFA 1CR9H 4WHTA 3WUZA 2FATL 1H3VA 5E2VL 3U36B 3WFBH 4EZMA 1RMFH 4ZOCA 5C2BL 4NWUL 2G9HA 5GS0H 3L5HA 4NC0B 4KRPC 5IESH 4S1DC 2L7JA 5FM8A 5C0CE 2RBLA 1TETH 4DZ8A 5GIRB 4P2OB 3PGCA 2VZ1A 4LQFH 1Y6MR 1A8JH 1Y0LA 3IKCB 1F8TL 3CFIC 1T7WA 3M1BA 3O2VH 4PRIE 1G6RB 3E8UH 2DD8H 4OLXL 3V5KA 1F4YL 1CGYA 1I1AD 5F1KC 2VDPL 4LKCB 4R7DA 2EYTA 2VYRE 1KJVA 3IYLW 2MHAB 2R0WH 4X6CE 3A0OA 1AIFB 2K3TA 4PJAB 1FLTX 2E7MA 1EO7A 2ZZUT 5CFHA 4XWGL 3QHZH 3D6GA 2UUDH 3MV8D 2Z93B 5J6HB 2Y36H 3ZE1E 2ZPKH 3F62A 5TE7L 4XVJH 4L3CA 5IB4A 1JV5B 4NZDA 4LBEA 4PR5B 4R7NB 4P2RA 1XZ0B 5DZNA 5JXAL 3QWOA 5DVKA 4F3FB 5T1LA 1AGFA 4HH9A 2GW5A 1U8KB 2MQCA 5J0BA 4MDIB 5F44A 1HHGA 1PG7X 3LEYH 3O3UN 3RI5K 3RWHA 2WP3O 2H1PL 2OLDA 1IM9B 4FQHA 1CDBA 5F96L 5F7UA 4NQDA 1JNLL 1MCQA 1F13A 3KPOA 1T0MB 4QXTB 1WEJL 1IM9D 3VI4F 4EI5D 1XGRA 3VFRB 1FZKB 1EDQA 1F90H 4QNPF 4WWID 3QUKA 1NFDA 1Z5LB 2CKBH 3X14A 2R1WA 1CLOH 2R1XB 3VFNA 2EH8H 5J6HA 2IH3B 1K4CB 1NBYB 2WZPD 1BBJB 1N5AB 1ZVYA 4XI5D 5BO1H 4HWBH 3L3IB 4K9EH 4L4JA 1KB5B 1FCCA 1A6UL 1GAFL 1WT5C 4LSVH 5HGBB 2BY3A 3L3DA 3BPNB 1JPTH 3AFLA 1QSZA 5GHWH 2X1XR 3MZGB 43CAA 1BGXL 5GGVL 4ZNEE 4EUPG 1I1AA 3BKML 3FO2A 4OD3L 3WCYA 3ULUD 3TA3D 1JI1A 2C1PB 4Q6IB 5TDNA 3CMGA 4DEPB 2H2PC 4E5XA 2EXYD 4PB0L 3ECBA 2YKLH 3S96A 25C8L 3ARDD 3OHXB 1G0YR 5EN2A 5AWNL 4WTWA 1IKFL 4X83A 2J5LC 3MLZL 3UAJD 3X3FH 1MJ7H 5HYSG 1Q8MA 4L3CB 4OZHB 5IB4B 4TRPH 2GYSA 4NGHH 3HNTL 4DVBB 2F9BT 1XGPA 1RK0B 3ROLA 2ZSWA 1TMCB 4JANB 3VJ6A 1NEUA 2BOCA 4LVOC 4P2QD 1HH9B 4RWYH 1T5WA 3RWHB 5F89B 2CGRL 3BZEA 2PYEA 5BQ7B 2EYSA 1FNGA 2X40A 1XGUB 3JTSB 1UEYA 5MEOA 1WFTA 4WFFD 4CADA 1SYSB 1A7RH 3N1FC 5E0QA 1I8LC 1K4DB 5SWZB 4RFNC 4HIXL 4AK1A 5IT2L 5SWSE 4OFKA 1NBZA 1TPXB 2GY7B 4OCXL 4OCWL 2PYFA 1BLNB 5GGUA 4U1HA 3QXDA 3KYMA 3KYKL 4WV1C 1HHHB 1E27B 2CDGB 3WS3B 3FTGA 1CL7H 3P77B 3DO3A 2WWKO 1JL8A 1MLBA 5IFHL 4QXWA 3KLDA 5FUZH 2WQRA 5IMKB 4OD2B 5F7MC 3QXAA 4G7YL 3TCLB 1CD1B 5HDBE 5D1XA 3RU8L 2YD3A 3FKUS 4FP8H 2A74B 3VH8A 1ZA6B 1J1OH 3WDJA 1TTFA 5I6XC 4BH7B 4JQIH 1MQKH 5I18H 5EDXA 3TO4B 4MQ7B 4BSVB 4HX1B 3VWJC 3T77A 1KCUH 3RIAK 2PW1B 3I75A 5GGVY 3HG1A 1I9RH 1J5OH 1C5CL 5F3BA 2QSCL 4PGCB 2O5ZH 1URLA 3ZYOA 3O11B 2VLJA 2EDOA 1GGTA 5E24E 3D87B 1A6WL 4MQXC 2FD6H 4K7PL 5FOBB 2ZKHH 1MCRA 1A1MB 2ITDA 1INDL 3DVGA 2AJYH 4PJ9D 3EDDA 1IGMH 3NAAL 2IMMA 4PJ8D 1DBAL 1ZANH 4ZTPL 5T3ZH 2EE3A 2QKIB 4XMPH 1EGJL 1CFVH 4GMTH 1NMAH 1MFDH 4RMSA 1RZIB 1HSAB 2APXA 4LHUB 4ELMB 1YEFL 4JR9L 2HRPH 3T2NH 5IB3B 1CU4L 2G5RA 4OGAC 4BUHA 4DGYH 3BP4A 1GGYA 1MCLA 1RUAH 3EO1A 1LNUA 2CDGA 1AFVL 3WS3A 3L5IA 3FRPG 3P3YA 4PRAB 4C56B 3U2SB 1IFHL 3VXSD 1BP3B 2VLRD 1DBJL 3QDJA 3G9VA 3CK0L 4I77L 4J3UA 5DO2C 4KI5F 1LO5B 3FN0L 3MLRL 3G04B 2BSRB 3D39D 4DVRL 5CBEA 1H0DA 2D7TL 1NGZB 3G5YB 5JUEH 4N90D 2AJZB 4G6KL 1WVZA 1TNNA 4BK5A 4KMQA 1GCFA 4BJLA 3VGDA 4M6OL 5ICZA 5ADOL 5E9DA 2D7MA 4GG8A 2A77L 1VPOL 4RGOL 4MJID 5C0FA 4LEXH 3CLEH 3HAEG 4MJ6B 3MNWB 5E6IA 2X1PA 1NKOA 2BVQB 5CKGA 4FFYH 2EC9U 5IM7B 4L3ED 4EUPB 3NFSH 3F7VB 3I3BA 1MCDA 4OF7A 2JCCB 5TDOA 2V17L 3BKYH 4P46B 4Q97A 5LBSH 3NIFE 1LP9E 3KLHD 2H41A 1QKZL 3I6LD 2WWKT 4XNXH 2R2HB 4LK4A 5EOQH 3JBG7 4ENED 4PLKC 5KOMC 3EJYC 1B2WL 3RVTD 2NY7H 4Z7UA 5T1DL 3WNNA 5HHOD 4ZUSB 3ZKQD 3WXVH 2LTQC 1DUZB 5DHYA 3SOBH 1NKRA 1NSNH 1CFNA 2FIKA 4KUZL 1RZ8A 3FB6A 1F4XL 3OZ9L 5FDWA 1XFPA 3B9KA 1VFAB 3F7PC 4KJQD 4MB3A 3C2AL 2EDTA 2VZ3A 2NY3B 9CGTA 5D7LA 3EYOA 3NOIA 1GZPB 2DL2A 5I73C 3BZ4B 3NGBB 5FYJH 3QG6B 5HTSA 4KY1L 3UZQA 5FAAA 5I1LA 2Q8BH 3U2SA 1IEAA 1XIWB 3TYGL 3QEQA 1L0XA 1INQA 3FFCD 3MR9A 4JN2A 5DJZA 5FKAB 5IFAH 3VI3F 5JZ7D 4NNYA 1CGUA 5HPOA 2V7HA 3FT4A 2NZ9C 4RFEB 5IK3B 4BQBA 3TA3C 2Z8SA 1EEUA 2DLGA 3L3JB 5B8CB 3QO1A 3I2CL 4NDMB 4H25A 1UC6A 1FGNH 4WHYH 5HHMB 3KPMB 4JFDB 3X11B 5FOJA 4MXQC 4PV8A 4X99B 4MXVE 5T1MB 4F57H 3VXUB 4U7MA 2IAMB 3GMPB 1KN4H 4QXGL 2MKLC 3EYOB 1I8KA 2MCPL 5ILTL 1RZKC 3RWEB 3FOLB 1QBMH 5IFJB 2QHLA 1NUDA 2CJUL 4NNXA 4AM0B 3QI9B 4OI7A 4D94A 4PP2B 2OJZH 2FH6A 5CP7B 1NCCL 1GPOL 5FO9A 4LCWA 1EMTH 4HG4J 5J06A 1WBYB 3FHQA 4LAJH 1QFWL 1BREA 6FABL 3NTCL 3QDGE 3ARYA 1A7QH 4MDIA 4GKSA 5DEFA 1FRGH 4M3JA 5J4MA 3B9KB 2IC2A 2LTQB 4M93B 2R69H 2F58L 4KJWC 4NO3B 1PKQA 3V4UL 4ODTL 1QSEB 1KYOJ 4Z7UB 1P69B 3KGRA 3IT8D 3SE9L 1IEAB 3I9GH 1P2CA 3MRRB 1RU9L 3ZE0F 3U30B 4XP5H 2VQUA 3CMOL 1HK6A 5JIHA 3S35H 2Y25A 1JGEB 4W6WB 5CGMA 5ESQB 1UYWL 1CS6A 2IH3A 4X5XB 7CGTA 5IJVA 1HN1A 1NUGA 2HKFL 3VGBA 4JLRA 4FXLA 5IWLC 4PJFB 1S7VB 1ZS8B 1INQB 3K8LA 3PHQB 3GKWH 5FUCE 3O6FD 1T0MA 1VA9A 2WANA 4DTGL 4UT9L 3T09A 1W72B 3GNML 4HLZH 4P59H 3FB8B 3S37L 1LDPH 3KR3H 4NYLB 3CLFH 1UQSB 3BN9D 3DTXB 5IEHA 3QEGL 4RMVA 4M7LL 4WDIA 3GSNB 3W0WB 4FQXC 4G8IA 2R2CA 4KKBD 3NZHL 5EUKA 1NC4B 1YUHA 1VGKB 3U9PH 5DR5H 1TZGL 4DEPC 4UB0L 5DHVH 5GSVA 2CSPA 4UDTB 2ICEA 3IFLL 1OAUH 4EDWH 1DVFB 2FLRT 4ZS7L 5FA3B 5F9OL 1T66D 4JO1H 3AC0A 2H8PB 4F8TA 2AABL 3BPCB 4RWYL 2B2XH 4H1LH 1MWAA 2ICWJ 4ZFFB 3SDAC 2ESVB 1HYRC 5CP7A 1FFNB 1FH5L 3AXLB 1N5AA 5JHLH 2CK2A 1ZVSB 3MCKA 4HT1L 2VLLB 3HZMA 4WU7B 1R3KB 2NYYD 3LQZA 3VWJD 1HEZA 3D1MC 2PETA 5F1IB 4ZD3L 4Z5RB 4H8WC 4J3OC 4U7SA 3TN0D 5DD1L 3UJTH 3P9LB 1YNTA 4MD5A 4L3AA 3ZDXF 3HNVH 4LIQL 4Z7QE 5BXFA 4A2MA 2EZ0D 2OCFD 2DQTL 4UIKH 1CL7L 2VL5A 3CU1A 4Q0XL 4PJDB 3QDGB 5KTEH 3OGCA 3X13B 5DJCA 3GI8H 2W91A 4OLVH 4CMHC 4ZPTB 4MD4A 4YPJA 1F58L 2VABA 2APWA 3RY5A 2COQA 4XTRD 4N1HB 2XN9A 4RGND 1YMHA 5HHOE 1FC2D 3D9AL 5JPNA 3LQZB 1DQDL 1FO0L 4OZIA 3AU1B 2FBOJ 1CLZH 3QCUL 4WV1B 4EEEA 1H9VA 5J12B 1JF5A 1W72A 5EU6D 3TBTA 5ID0B 1J1PH 5F7HA 1VEPA 3FONB 4RZCB 2OMBA 4K7FA 3MA7B 1N59A 4U6XA 1IZJA 4RA0C 3RRQA 5IJKC 2AP2A 2FSEB 3BHBB 2PYFB 4FQ2H 3DYPA 5I1CH 1NCBH 3LKSB 1GZQA 2R2BB 3OMZA 3O8XB 3NIGF 4HCRH 4NKOA 4OZIE 5T3XE 5D7JA 5FCSH 4ODXA 4WGVB 2XG4A 1I7UA 1M05A 4Z8FL 5A43C 3DV4A 4HH9B 2XTJC 4NFCA 1OTSD 1KPUA 3O3DA 5JPNB 1B0RB 4K07A 2DBJA 2FH8A 1U8PB 4G3YL 5B39B 1CD1A 3G6JA 3H6JA 4GUPA 3P4NB 1RURH 4YJZL 4HFWA 5KSAD 3O4LE 1R3KA 3CSGA 5HY9B 1RULL 4D9QD 3Q2CA 5IQ9B 5IF0B 5LQBH 4OUOA 1OF2A 5CBEB 4NP4H 4WWKB 4Y1AD 3T0EE 4MVBD 3LSOB 1GGIL 4HG4K 3BW9B 1MFCH 4OGXL 3CVHL 2NY6D 4H1LA 1JF6A 3NCBB 2EIZB 3OAYK 1ZLWK 1FN4B 3VFOA 5GRJL 5HHNB 1KBGL 2JK5A 2ESVD 3GIZH 4OM0L 4JZNA 4P5TD 4YHML 4MA7L 4LU5H 4ZPTA 2APBA 3ETBF 3QJHA 2EO9A 2VABB 4K71C 5E2WL 5T1LD 1DQJB 1K6QL 3QO0B 4CVXA 4MSWB 3KWWB 4HC1A 1LO5A 5K9QI 5C0BD 4QRTA 4Z78A 4HUWA 4X7TA 2FSEA 5CEZE 3G5YA 3HRPA 4HUXB 3BD5A 4LF3B 4BH8B 3HR5A 5JPMB 1LNUB 3MQIA 5TH2B 3JWOL 1JFQL 1EZVX 3LOWA 4HS6A 4NO2A 5L2KA 5DK2A 4OM1H 1KIPB 3PV7A 3BYYA 4NZRL 4Y8AA 1MF2H 5I8OL 4N0RA 4PRDB 5ETUA 2BXZA 1NUNB 1V05A 4F7EA 3HFMH 3QXVA 1DQJA 5D7JB 1AR1D 4XNQA 3BH8B 4EOWH 5EWIL 2NTFA 5IHZB 4GKNB 5DZOA 4C4KT 5F9DC 2DQFA 1P84K 5E6ZA 4K2UL 1A7PL 5I74C 1OTUC 2X1WL 5L7XH 1BFOB 1RUQH 4XCCL 1P4BL 4R0LC 3I2CH 5DD3H 1T3FB 2XKUA 4H5SB 4Y1AE 3T0ED 2VB5A 3KPQA 5I66A 4Y4FD 4QY8B 5TQ0H 5DJDB 4RRPA 1XF2A 4HKZB 2BHUA 4LARH 1FZJB 4CW1B 3PP4H 4OF0A 5D2NE 1QA9A 1U6AL 3V7MA 1I1RA 1M6OA 3BN9C 2O5YL 1F6AA 2DYPA 3WHXB 3FB7B 1YPZA 1KFAH 2EKSB 3GJFH 3O6LL 3LH2H 4FQQB 4MQXD 1AHWB 1LK3H 3SGJA 1Q9OB 4P49A 1DDHB 2H2SD 3OJDB 4MCYA 5CZKA 4YFLI 4HUXA 2IG2H 5J13B 1TQBC 4OQTL 4PRBA 3U4EA 4QRUB 3I75B 4MX7B 2WNGA 1MFEH 4OD1L 4A6YH 1MVUB 3CDYA 5IIEB 4Y4HA 2Y7QB 3HA0A 4J23A 1QBAA 1Q9KA 3QDMB 1KB9K 4Q9RL 2XOTA 2QQQA 5FUOL 5FOBA 1JPSL 1A6ZA 2F53A 1Z6JT 1S9WA 3WLWC 3RWGA 4LCYA 3VFPA 4YHOL 3EOBB 3NVQA 3HE7B 4JDZA 3H2WA 5FM5O 2HJKB 3ET9F 4H8WH 1JGLL 5LAXA 4Q6YA 3MLVL 1TQBB 4JGUA 2HFEA 2WUCL 4FQIH 4R96A 5ICYB 3MACL 3LRHA 4LFHG 5DXWA 1HH6A 2PTTA 2WUBL 3P73A 3LD8B 5DMGC 5M7QA 4KQ4L 4WEUD 5JW4M 5D1ZA 3BMVA 1GHFH 5IFJA 2BVEA 2YPLD 2NY1B 4RBPH 1IC7L 5CUSL 4PJXB 1D5ZA 1P4IH 3ARVA 1MJUH 3O9WA 2FX9H 4NWUH 2PO6B 2GQHA 4O9HH 5FGSA 3BUTA 3C6SA 1P7QD 3BP7B 2HMID 4L8SA 5DI8A 1T80A 2AJZA 4X6BA 3RNQA 1Z5LA 3IDIB 2J8HA 4CVWA 4HUNB 3T3PF 2XIDA 4OAWB 1Q9OA 4UBDC 2HAZA 1UM6H 2WLZA 3MRPB 3ZTJH 4AENA 4OCRL 4GSDL 5I1IH 3MCG1 3GIVB 1OB1B 2PXYD 2BY0A 3C6LC 4PV9B 5DZLA 4ETQA 3WIHH 1O5DT 2P8PB 1JRHH 4LLUA 3IU3A 1PY9A 3SDCD 4UOW0 1FZOA 1HWHB 1XR8A 2RR3A 4M43H 4ALAH 1FLRL 2X05A 1JJUA 1GC1H 3PV6B 4ZFFA 2DM2A 5EC2A 1PX3A 1U91A 5TE7H 1EHXA 2DTSA 1BEYL 4PRID 3NA9H 3NZ8B 4LSUL 3P0YL 4UV7H 2CIKB 1FO0A 5B4MD 3D3VD 4ZAKA 1TVDA 1QLFB 1A2YB 2NR6C 5T1KD 4Q2ZA 3D39A 3EO0B 2F8XC 2P44B 4O02L 1UWEL 4U1GC 4YDIH 1BQLL 1OWRM 1BFTA 2X4SA 3ZKSD 1I1FB 4MVBC 3HI5H 1WEJH 5E9DD 1UQSA 4LLUB 2BVOB 2NW3B 3UAJC 5C0EA 5CP3H 4Y2DC 2C3GA 2XY2A 1MY7A 1WZ1H 2VISB 4HBCL 1U8MB 4FNLL 3D0LA 4QF1B 3V6BR 1VGKA 2MTPA 4QRRD 5DQDH 5FYLE 3B5TA 4HPOH 4JG0H 1TZHB 3UBXG 4JHZA 1C5DA 3LRSB 4MA3A 2WWMD 2BVYA 1UA6H 3O45A 4X9IA 4BQ6A 1UB5A 2Y72A 1F6FB 3HPLA 3O41B 3T65A 5MEOB 4KVNL 4NNPH 2PUQT 5IVXE 4TULH 4XMLL 4NT6B 1E0OB 1S8DA 2EDNA 4JAMA 2UUDK 2ADJA 2BDNH 4Y0GA 2F5BH 5KBNC 4KJYA 1V7ML 4JG1H 2ILLA 1BOGA 3MO1A 4PRPE 4UNUA 3KJ4C 4ZUTA 1E4WL 2LU7A 3D85D 1IGTA 4YHZH 3WFEH 3MX0A 3ZKNC 4MD4B 5L6YL 5BMFH 2YPLE 4GRMA 1P53A 3LKOA 5KSVB 5MI0C 2HFFB 3LKSA 5TJWK 3SDXA 3ULUE 2EDBA 1F4WL 4TRPL 2C4FU 3VXNB 3QA3A 32C2B 4XPHL 1BBDL 1JE6A 3GMLB 4RWHA 1PKQE 4YDJA 2UZXB 5TDPB 3RIFK 3C8KB 3LPGA 2FZ3A 3U0PA 1JGVH 1RJLB 4PY8I 3MRCA 3SQOL 3OXSB 3QUYC 1IBGH 2VUYA 4NPYA 1IL1A 1Q9WB 1SJHA 4GMSH 4CMMB 4Z7WA 4G9DB 4OGYL 4JN1H 2N4IA 4NZTH 1BOGB 1RUKH 4KKCC 5I16A 1OTUD 5CEZL 4OLWL 4FOMA 3ZT7A 4L4TE 1FV1B 3MJGX 1A0QH 4W6XB 4S2SB 3AUVA 1JGEA 3O8XA 1XMWA 1Q94B 5D8JH 3QIBB 2OL3H 4LPYA 4OGZA 3IF1A 5A2KH 4BZ1H 5C92A 4ONHB 4ERSL 1OLLA 1K5NB 1S5IH 3FQWB 3MRBA 1GYAA 2YSSA 3AB0C 4PJ7B 1ES0A 5INDA 1FNHA 3GSWB 3GIZL 3D0LB 4QLRA 4Y19A 4YBLB