1U2OA

Crystal structure of the n-domain of grp94 lacking the charged domain in complex with neca
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
236
structure length
226
Chain Sequence
b'GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQESTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Structure of the N-terminal domain of GRP94. Basis for ligand specificity and regulation
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 66
structure length 226
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1u2oA00
3EHHA 3QTFA 4R3AA 4B7PA 4KP4A 4HY6A 3A0WA 4H85A 2WI5A 3B24A 3A0YA 1UYFA 4YKRA 3R4PA 1AM1A 3D0BA 4LWEA 3RKZA 5F3KA 3PEHA 4WUDA 4XTJA 4XE2A 2JKIA 2CH4A 2CCTA 3RLRA 1UYLA 4YKQA 2ZKJA 2AKPA 1I59A 3R92A 3FV5A 5FNFA 2Q8GA 4R3MA 2BTZA 1EI1A 4AWOA 1JM6A 1UY6A 4CWPA 1UY8A 5IN9A 3A0RA 3R4OA 2IOQA 4AWQA 3O0IA 2HG1A 2YKCA 3O2FA 2YE5A 1H7SA 2JJCA 3CGYA 3DGEA 1GKXA 4U93A 1S16A 2YEHA 1YERA 4O0BA 3TZ5A 1Y4UA 2FWYA 2YJXA 3HZ1A 2XDSA 4PU9A 4URLA 2ZDXA 3U2DA 3T0ZA 3OWDA 4O05A 1BXDA 4O04A 2XDXA 1Y8NA 2YI0A 3A0XA 4GGLA 3K99A 3K97A 4JAVA 3VADA 2YEJA 2FXSA 4EMVA 1UYIA 3B25A 2XHTA 4I5SA 3ZKBA 2WI3A 4XIRA 3H4LA 1AMWA 2WEPA 1NHIA 1BKNA 2IOPA 4KSHA 4HYMA 4LWFA 4LWGA 5M4HA 2FWZA 4U7NA 3ZXQA 5IDJA 4XCLA 1I5CA 4P8OA 4ZKIA 2IWXA 2YE8A 3FT8A 4YKTA 3EKOA 3LPSA 2PNRA 4GEEA 4MPCA 4GCZA 1Y8OA 1QYEA 4EFTA 1A4HA 3SL2A 4BXIA 2CGFA 1Y4SA 4U7OA 4CWTA 4GQTA 4LPBA 4CE1A 5M4PA 4GFNA 3INXA 2H8MA 4MP7A 4CWNA 1YT0A 1US7A 1ZXMA 2XJXA 3T10A 3B27A 2WI6A 2VWCA 4K4OA 4E01A 2XX4A 2Q8FA 1ZXNA 5FNDA 3RLQA 2HCHA 5BODA 1MX0A 2E0AA 1NHHA 3K60A 4MOTA 2BU6A 3C11A 2YEAA 4L93A 2WI4A 4AS9A 4NH8A 4O07A 2BU2A 4MPNA 2XJJA 1YESA 3R4MA 1YC4A 3HYYA 1MU5A 5CTUA 2YI7A 4HZ0A 1PVGA 4HXWA 5M4KA 1AH6A 1ZW9A 2YE4A 4NH9A 2XCMA 1BGQA 2VCJA 4R1FA 3C0EA 4PL9A 3TZ2A 4HZ5A 4XIPA 4L91A 2BYHA 2YK9A 2YEDA 1TIDA 2WERA 3D2RA 3B28A 4CWRA 1YSRA 4E02A 2XX5A 2ESAA 4EGIA 3HHUA 3HEKA 4MB9A 4XCJA 3G7BA 4UROA 2CCUA 4EFUA 4GT8A 1TILA 2YKIA 5FNCA 3K98A 4CE2A 5J71A 5CF0A 1BYQA 1UYDA 4I3HA 2YE9A 2YE6A 4CE3A 1YS3A 5M4MA 1UYCA 4L90A 2YECA 2BU8A 2BU7A 4PRVA 4XC0A 3IEDA 5CPHA 4BIUA 3HYZA 2BT0A 3OMUA 3RLPA 2IWUA 1UYHA 3EHGA 3QDDA 2XDKA 4CWQA 3PEJA 1U0ZA 4L8ZA 1EA6A 2K5BA 3BMYA 5FWKA 4LWIA 4MP2A 4HYPA 4XKKA 4H7QA 4DUHA 1UYMA 3VHDA 3T1KA 1OSFA 1Y8PA 1TH8A 4FCPA 4JQLA 2HKJA 3WHAA 3R4NA 3GIGA 4KSGA 2UWDA 4FCQA 2O1UA 2YE7A 5D6PA 1YT2A 2XABA 4XD8A 2YK2A 1GJVA 3CRLA 3JZ3A 4BQGA 4YKWA 3LNUA 2XHRA 4URNA 2YI5A 2H55A 4DZYA 4V25A 2BYIA 3Q5KA 4MBCA 1I58A 3EHJA 2Q2EB 1QZRA 2XDUA 2BRCA 5F5RA 3GIGB 2GFDA 3H80A 1AJ6A 3CWVA 2BZ5A 2O1WA 4QPKA 1UYKA 5J6AA 4XKOA 3TZ4A 2BU5A 2IWSA 1GKZA 2QFOA 2XHXA 5GGZA 4YKZA 2CG9A 2EXLA 3CGZA 3U2KA 5M4NA 1H7UA 1NHJA 4HY1A 4BIZA 2YEFA 1KZNA 2YGFA 3VHAA 4NH7A 5CTYA 2QG0A 1TC6A 3ZM7A 2YKJA 2XX2A 4FPPA 2QF6A 1ZWHA 1Z5BA 4E00A 2YEGA 3B26A 4H81A 1R62A 4EGKA 1TC0A 1AH8A 2C2AA 3O6OA 1YSZA 2CCSA 4AWPA 4EGHA 4FMTA 4CWFA 3R91A 1YETA 1Z59A 2XK2A 2XD6A 4LP0A 5C93A 3U67A 3BM9A 3ZXOA 5L3JA 3KE6A 3OW6A 1UY9A 3TUHA 4KTNA 2O1VA 1ID0A 5D7CA 4ASBA 4P7AA 2XDLA 4KQVA 4ASFA 3MNRP 1B62A 2YGAA 3HZ5A 4Q20A 3T2SA 2FYPA 4CWSA 2YE3A 1KIJA 1S14A 4HXZA 2WEQA 3G75A 4ASGA 4XITA 4QPJA 3NMQA 4CWOA 1L0OA 4WUBA 2WI1A 4BAEA 2Q8IA 2WI2A 3CRKA 4YKYA 4XKAA 2Q8HA 3GIFA 3OPDA 4V26A 1I5BA 2YKBA 1I5DA 1YT1A 4URMA 3EHFA 1TBWA 3TZ0A 2IORA 4BQJA 2GQPA 3G7EA 3D36A 4FCRA 4PRXA 4EM7A 3GIEA 4YKXA 1B3QA 2BREA 2YKEA 4B6CA 2YEIA 5BOCA 5D7RA 4XDMA 4O09A 1QY8A 2YE2A 2YJWA 3Q5JA 1UYGA 3WQ9A 2ZBKB 3EKRA 1THNA 5CTWA 2YEBA 4JASA 4XIQA 1Z5AA 3FT5A 2YEEA 5D6QA 4X9LA 4ASAA 5M4EA 2XJGA 4YKUA 2YI6A 1YC1A 2VCIA 5CTXA 3Q5LA 3ZKDA 5D7DA 4ZVIA 2BSMA 2ZDYA 3T0HA 3TTZA 4JAUA 1Z5CA 1U2OA 2YGEA 4L94A 4EEHA 1B63A 1UYEA 4LWHA 3A0ZA 4MPEA 3A0TA 3INWA 2WI7A 1UY7A 1YC3A 3OWBA 4KFGA 3VHCA 1I5AA 5IDMA 4WUCA 4W7TA 2QG2A 2VW5A
chains in the Genus database with same CATH superfamily
3EHHA 3QTFA 4R3AA 4B7PA 4KP4A 4HY6A 3A0WA 4H85A 2WI5A 3B24A 3A0YA 1UYFA 4YKRA 4E72A 3R4PA 1AM1A 3D0BA 4LWEA 3RKZA 5F3KA 3PEHA 4WUDA 4XTJA 4XE2A 2JKIA 2CH4A 2CCTA 3RLRA 1UYLA 4YKQA 2ZKJA 2AKPA 1I59A 3R92A 3FV5A 5FNFA 2Q8GA 4R3MA 2BTZA 1EI1A 4AWOA 1JM6A 3LMMA 1UY6A 4CWPA 1UY8A 5IN9A 3A0RA 3R4OA 2IOQA 4AWQA 3O0IA 2HG1A 2YKCA 3O2FA 2YE5A 1H7SA 2JJCA 3CGYA 3DGEA 1GKXA 2FTKA 4U93A 1S16A 2YEHA 1YERA 4O0BA 3TZ5A 1Y4UA 3CYGA 2FWYA 2YJXA 3HZ1A 2XDSA 4PU9A 4URLA 2ZDXA 3U2DA 3T0ZA 3OWDA 4O05A 1BXDA 4O04A 2XDXA 1Y8NA 2YI0A 3A0XA 4GGLA 3K99A 3K97A 4JAVA 3VADA 2YEJA 2FXSA 4EMVA 2C1IA 1UYIA 3B25A 2XHTA 4I5SA 3ZKBA 2WI3A 4XIRA 3H4LA 1AMWA 2WEPA 1NHIA 1BKNA 2IOPA 4KSHA 4HYMA 4LWFA 4LWGA 5M4HA 2FWZA 4U7NA 3ZXQA 5IDJA 4XCLA 1I5CA 4P8OA 4ZKIA 2IWXA 2YE8A 3FT8A 4YKTA 3EKOA 3LPSA 2PNRA 4GEEA 4MPCA 4GCZA 1Y8OA 1QYEA 4EFTA 1A4HA 3SL2A 4BXIA 2CGFA 1Y4SA 4U7OA 4CWTA 4GQTA 4LPBA 4CE1A 5M4PA 4GFNA 3INXA 2H8MA 4MP7A 4CWNA 1YT0A 1US7A 1ZXMA 2XJXA 3T10A 3B27A 2WI6A 2VWCA 4K4OA 4E01A 2XX4A 2Q8FA 1ZXNA 5FNDA 3RLQA 2HCHA 5BODA 1MX0A 2E0AA 1NHHA 3K60A 4MOTA 2BU6A 3C11A 2YEAA 4L93A 2C1GA 2WI4A 4AS9A 4NH8A 4O07A 2BU2A 4MPNA 2XJJA 1YESA 3R4MA 1YC4A 3HYYA 1MU5A 5CTUA 2YI7A 4HZ0A 1PVGA 4HXWA 5M4KA 1AH6A 1ZW9A 2YE4A 4NH9A 2XCMA 1BGQA 2VCJA 4R1FA 3C0EA 4PL9A 3TZ2A 4HZ5A 4XIPA 4L91A 2BYHA 2YK9A 2YEDA 1TIDA 2WERA 3D2RA 3B28A 4CWRA 1YSRA 4E02A 2XX5A 2ESAA 4EGIA 3HHUA 3HEKA 4MB9A 4XCJA 3G7BA 4UROA 2CCUA 4EFUA 4GT8A 1TILA 2YKIA 5FNCA 3K98A 4CE2A 5J71A 5CF0A 1BYQA 1UYDA 4I3HA 2YE9A 2YE6A 4CE3A 1YS3A 5M4MA 1UYCA 4L90A 5JENA 2YECA 2BU8A 2BU7A 4PRVA 4XC0A 3IEDA 5CPHA 4BIUA 3HYZA 2BT0A 3OMUA 3RLPA 2IWUA 1UYHA 3EHGA 3QDDA 2XDKA 4CWQA 1F51A 3PEJA 1U0ZA 4L8ZA 1EA6A 2K5BA 3BMYA 5FWKA 4LWIA 4MP2A 4HYPA 4XKKA 4H7QA 4DUHA 1UYMA 3VHDA 3T1KA 1OSFA 1Y8PA 1TH8A 4FCPA 4JQLA 2HKJA 3WHAA 3R4NA 3GIGA 4KSGA 2UWDA 4FCQA 2O1UA 2YE7A 5D6PA 1YT2A 2XABA 4XD8A 2YK2A 1GJVA 3CRLA 3JZ3A 4BQGA 4YKWA 3LNUA 2XHRA 4URNA 2YI5A 2H55A 4DZYA 4V25A 2BYIA 3Q5KA 4MBCA 1I58A 3EHJA 1IXMA 2Q2EB 1QZRA 2XDUA 2BRCA 5F5RA 3GIGB 2GFDA 3H80A 1AJ6A 3CWVA 2BZ5A 2O1WA 4QPKA 1UYKA 5J6AA 4XKOA 3TZ4A 2BU5A 2IWSA 1GKZA 2QFOA 2XHXA 5GGZA 4YKZA 2CG9A 2EXLA 3CGZA 3U2KA 5M4NA 1H7UA 1NHJA 4HY1A 4BIZA 2YEFA 1KZNA 2YGFA 3VHAA 4NH7A 5CTYA 2QG0A 1TC6A 3ZM7A 2YKJA 2XX2A 2QF6A 4FPPA 1ZWHA 1Z5BA 4E00A 2YEGA 3B26A 4H81A 1R62A 4EGKA 1TC0A 1AH8A 2C2AA 3O6OA 1YSZA 2CCSA 4AWPA 4EGHA 4FMTA 4CWFA 3R91A 1YETA 1Z59A 2XK2A 2XD6A 4LP0A 5C93A 3U67A 3BM9A 3ZXOA 5L3JA 3KE6A 3OW6A 2HHIA 1UY9A 3TUHA 4KTNA 2O1VA 1ID0A 5D7CA 4ASBA 4P7AA 2XDLA 4KQVA 4ASFA 3MNRP 1B62A 2YGAA 3HZ5A 4Q20A 3T2SA 2FYPA 4CWSA 2YE3A 1KIJA 1S14A 4HXZA 2WEQA 3G75A 4ASGA 4XITA 4QPJA 3NMQA 4CWOA 1L0OA 4WUBA 2WI1A 4BAEA 2Q8IA 2WI2A 3CRKA 4YKYA 4XKAA 2Q8HA 3GIFA 3OPDA 4V26A 1I5BA 2YKBA 1I5DA 1YT1A 4URMA 3EHFA 1TBWA 3TZ0A 3S5TA 2IORA 4BQJA 2GQPA 3G7EA 3D36A 4FCRA 4PRXA 4EM7A 3GIEA 4YKXA 1B3QA 2BREA 2YKEA 4B6CA 2YEIA 5BOCA 5D7RA 4XDMA 4O09A 1QY8A 2YE2A 2YJWA 3Q5JA 1UYGA 3WQ9A 2ZBKB 3EKRA 1THNA 5CTWA 2YEBA 4JASA 4XIQA 1Z5AA 3FT5A 2YEEA 5D6QA 4X9LA 4ASAA 5M4EA 2XJGA 4YKUA 2YI6A 1YC1A 2VCIA 5CTXA 3Q5LA 3ZKDA 5D7DA 4ZVIA 2BSMA 2ZDYA 3T0HA 3TTZA 4JAUA 1Z5CA 1U2OA 2YGEA 4L94A 4EEHA 1B63A 1UYEA 4LWHA 3A0ZA 4MPEA 3A0TA 3INWA 2WI7A 1UY7A 1YC3A 3OWBA 4KFGA 3VHCA 1I5AA 5IDMA 4WUCA 4W7TA 2QG2A 2VW5A
chains in the Genus database with same CATH topology
3EHHA 3QTFA 4R3AA 4B7PA 4KP4A 4HY6A 3A0WA 4H85A 2WI5A 3B24A 3A0YA 1UYFA 4YKRA 3R4PA 1AM1A 3D0BA 4LWEA 3RKZA 5F3KA 3PEHA 4WUDA 4XTJA 4XE2A 2JKIA 2CH4A 2CCTA 3RLRA 1UYLA 4YKQA 2ZKJA 2AKPA 1I59A 3R92A 3FV5A 5FNFA 2Q8GA 4R3MA 2BTZA 1EI1A 4AWOA 1JM6A 1UY6A 4CWPA 1UY8A 5IN9A 3A0RA 3R4OA 2IOQA 4AWQA 3O0IA 2HG1A 2YKCA 3O2FA 2YE5A 1H7SA 2JJCA 3CGYA 3DGEA 1GKXA 4U93A 1S16A 2YEHA 1YERA 4O0BA 3TZ5A 1Y4UA 2FWYA 2YJXA 3HZ1A 2XDSA 4PU9A 4URLA 2ZDXA 3U2DA 3T0ZA 3OWDA 4O05A 1BXDA 4O04A 2XDXA 1Y8NA 2YI0A 3A0XA 4GGLA 3K99A 3K97A 4JAVA 3VADA 2YEJA 2FXSA 4EMVA 1UYIA 3B25A 2XHTA 4I5SA 3ZKBA 2WI3A 4XIRA 3H4LA 1AMWA 2WEPA 1NHIA 1BKNA 2IOPA 4KSHA 4HYMA 4LWFA 4LWGA 5M4HA 2FWZA 4U7NA 3ZXQA 5IDJA 4XCLA 1I5CA 4P8OA 4ZKIA 2IWXA 2YE8A 3FT8A 4YKTA 3EKOA 3LPSA 2PNRA 4GEEA 4MPCA 4GCZA 1Y8OA 1QYEA 4EFTA 1A4HA 3SL2A 4BXIA 2CGFA 1Y4SA 4U7OA 4CWTA 4GQTA 4LPBA 4CE1A 5M4PA 4GFNA 3INXA 2H8MA 4MP7A 4CWNA 1YT0A 1US7A 1ZXMA 2XJXA 3T10A 3B27A 2WI6A 2VWCA 4K4OA 4E01A 2XX4A 2Q8FA 1ZXNA 5FNDA 3RLQA 2HCHA 5BODA 1MX0A 2E0AA 1NHHA 3K60A 4MOTA 2BU6A 3C11A 2YEAA 4L93A 2WI4A 4AS9A 4NH8A 4O07A 2BU2A 4MPNA 2XJJA 1YESA 3R4MA 1YC4A 3HYYA 1MU5A 5CTUA 2YI7A 4HZ0A 1PVGA 4HXWA 5M4KA 1AH6A 1ZW9A 2YE4A 4NH9A 2XCMA 1BGQA 2VCJA 4R1FA 3C0EA 4PL9A 3TZ2A 4HZ5A 4XIPA 4L91A 2BYHA 2YK9A 2YEDA 1TIDA 2WERA 3D2RA 3B28A 4CWRA 1YSRA 4E02A 2XX5A 2ESAA 4EGIA 3HHUA 3HEKA 4MB9A 4XCJA 3G7BA 4UROA 2CCUA 4EFUA 4GT8A 1TILA 2YKIA 5FNCA 3K98A 4CE2A 5J71A 5CF0A 1BYQA 1UYDA 4I3HA 2YE9A 2YE6A 4CE3A 1YS3A 5M4MA 1UYCA 4L90A 2YECA 2BU8A 2BU7A 4PRVA 4XC0A 3IEDA 5CPHA 4BIUA 3HYZA 2BT0A 3OMUA 3RLPA 2IWUA 1UYHA 3EHGA 3QDDA 2XDKA 4CWQA 3PEJA 1U0ZA 4L8ZA 1EA6A 2K5BA 3BMYA 5FWKA 4LWIA 4MP2A 4HYPA 4XKKA 4H7QA 4DUHA 1UYMA 3VHDA 3T1KA 1OSFA 1Y8PA 1TH8A 4FCPA 4JQLA 2HKJA 3WHAA 3R4NA 3GIGA 4KSGA 2UWDA 4FCQA 2O1UA 2YE7A 5D6PA 1YT2A 2XABA 4XD8A 2YK2A 1GJVA 3CRLA 3JZ3A 4BQGA 4YKWA 3LNUA 2XHRA 4URNA 2YI5A 2H55A 4DZYA 4V25A 2BYIA 3Q5KA 4MBCA 1I58A 3EHJA 2Q2EB 1QZRA 2XDUA 2BRCA 5F5RA 3GIGB 2GFDA 3H80A 1AJ6A 3CWVA 2BZ5A 2O1WA 4QPKA 1UYKA 5J6AA 4XKOA 3TZ4A 2BU5A 2IWSA 1GKZA 2QFOA 2XHXA 5GGZA 4YKZA 2CG9A 2EXLA 3CGZA 3U2KA 5M4NA 1H7UA 1NHJA 4HY1A 4BIZA 2YEFA 1KZNA 2YGFA 3VHAA 4NH7A 5CTYA 2QG0A 1TC6A 3ZM7A 2YKJA 2XX2A 4FPPA 2QF6A 1ZWHA 1Z5BA 4E00A 2YEGA 3B26A 4H81A 1R62A 4EGKA 1TC0A 1AH8A 2C2AA 3O6OA 1YSZA 2CCSA 4AWPA 4EGHA 4FMTA 4CWFA 3R91A 1YETA 1Z59A 2XK2A 2XD6A 4LP0A 5C93A 3U67A 3BM9A 3ZXOA 5L3JA 3KE6A 3OW6A 1UY9A 3TUHA 4KTNA 2O1VA 1ID0A 5D7CA 4ASBA 4P7AA 2XDLA 4KQVA 4ASFA 3MNRP 1B62A 2YGAA 3HZ5A 4Q20A 3T2SA 2FYPA 4CWSA 2YE3A 1KIJA 1S14A 4HXZA 2WEQA 3G75A 4ASGA 4XITA 4QPJA 3NMQA 4CWOA 1L0OA 4WUBA 2WI1A 4BAEA 2Q8IA 2WI2A 3CRKA 4YKYA 4XKAA 2Q8HA 3GIFA 3OPDA 4V26A 1I5BA 2YKBA 1I5DA 1YT1A 4URMA 3EHFA 1TBWA 3TZ0A 2IORA 4BQJA 2GQPA 3G7EA 3D36A 4FCRA 4PRXA 4EM7A 3GIEA 4YKXA 1B3QA 2BREA 2YKEA 4B6CA 2YEIA 5BOCA 5D7RA 4XDMA 4O09A 1QY8A 2YE2A 2YJWA 3Q5JA 1UYGA 3WQ9A 2ZBKB 3EKRA 1THNA 5CTWA 2YEBA 4JASA 4XIQA 1Z5AA 3FT5A 2YEEA 5D6QA 4X9LA 4ASAA 5M4EA 2XJGA 4YKUA 2YI6A 1YC1A 2VCIA 5CTXA 3Q5LA 3ZKDA 5D7DA 4ZVIA 2BSMA 2ZDYA 3T0HA 3TTZA 4JAUA 1Z5CA 1U2OA 2YGEA 4L94A 4EEHA 1B63A 1UYEA 4LWHA 3A0ZA 4MPEA 3A0TA 3INWA 2WI7A 1UY7A 1YC3A 3OWBA 4KFGA 3VHCA 1I5AA 5IDMA 4WUCA 4W7TA 2QG2A 2VW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHH A;  3QTF A;  4R3A A;  4B7P A;  4KP4 A;  4HY6 A;  3A0W A;  4H85 A;  2WI5 A;  3B24 A;  3A0Y A;  1UYF A;  4YKR A;  3R4P A;  1AM1 A;  3D0B A;  4LWE A;  3RKZ A;  5F3K A;  3PEH A;  4WUD A;  4XTJ A;  4XE2 A;  2JKI A;  2CH4 A;  2CCT A;  3RLR A;  1UYL A;  4YKQ A;  2ZKJ A;  2AKP A;  1I59 A;  3R92 A;  3FV5 A;  5FNF A;  2Q8G A;  4R3M A;  2BTZ A;  1EI1 A;  4AWO A;  1JM6 A;  1UY6 A;  4CWP A;  1UY8 A;  5IN9 A;  3A0R A;  3R4O A;  2IOQ A;  4AWQ A;  3O0I A;  2HG1 A;  2YKC A;  3O2F A;  2YE5 A;  1H7S A;  2JJC A;  3CGY A;  3DGE A;  1GKX A;  4U93 A;  1S16 A;  2YEH A;  1YER A;  4O0B A;  3TZ5 A;  1Y4U A;  2FWY A;  2YJX A;  3HZ1 A;  2XDS A;  4PU9 A;  4URL A;  2ZDX A;  3U2D A;  3T0Z A;  3OWD A;  4O05 A;  1BXD A;  4O04 A;  2XDX A;  1Y8N A;  2YI0 A;  3A0X A;  4GGL A;  3K99 A;  3K97 A;  4JAV A;  3VAD A;  2YEJ A;  2FXS A;  4EMV A;  1UYI A;  3B25 A;  2XHT A;  4I5S A;  3ZKB A;  2WI3 A;  4XIR A;  3H4L A;  1AMW A;  2WEP A;  1NHI A;  1BKN A;  2IOP A;  4KSH A;  4HYM A;  4LWF A;  4LWG A;  5M4H A;  2FWZ A;  4U7N A;  3ZXQ A;  5IDJ A;  4XCL A;  1I5C A;  4P8O A;  4ZKI A;  2IWX A;  2YE8 A;  3FT8 A;  4YKT A;  3EKO A;  3LPS A;  2PNR A;  4GEE A;  4MPC A;  4GCZ A;  1Y8O A;  1QYE A;  4EFT A;  1A4H A;  3SL2 A;  4BXI A;  2CGF A;  1Y4S A;  4U7O A;  4CWT A;  4GQT A;  4LPB A;  4CE1 A;  5M4P A;  4GFN A;  3INX A;  2H8M A;  4MP7 A;  4CWN A;  1YT0 A;  1US7 A;  1ZXM A;  2XJX A;  3T10 A;  3B27 A;  2WI6 A;  2VWC A;  4K4O A;  4E01 A;  2XX4 A;  2Q8F A;  1ZXN A;  5FND A;  3RLQ A;  2HCH A;  5BOD A;  1MX0 A;  2E0A A;  1NHH A;  3K60 A;  4MOT A;  2BU6 A;  3C11 A;  2YEA A;  4L93 A;  2WI4 A;  4AS9 A;  4NH8 A;  4O07 A;  2BU2 A;  4MPN A;  2XJJ A;  1YES A;  3R4M A;  1YC4 A;  3HYY A;  1MU5 A;  5CTU A;  2YI7 A;  4HZ0 A;  1PVG A;  4HXW A;  5M4K A;  1AH6 A;  1ZW9 A;  2YE4 A;  4NH9 A;  2XCM A;  1BGQ A;  2VCJ A;  4R1F A;  3C0E A;  4PL9 A;  3TZ2 A;  4HZ5 A;  4XIP A;  4L91 A;  2BYH A;  2YK9 A;  2YED A;  1TID A;  2WER A;  3D2R A;  3B28 A;  4CWR A;  1YSR A;  4E02 A;  2XX5 A;  2ESA A;  4EGI A;  3HHU A;  3HEK A;  4MB9 A;  4XCJ A;  3G7B A;  4URO A;  2CCU A;  4EFU A;  4GT8 A;  1TIL A;  2YKI A;  5FNC A;  3K98 A;  4CE2 A;  5J71 A;  5CF0 A;  1BYQ A;  1UYD A;  4I3H A;  2YE9 A;  2YE6 A;  4CE3 A;  1YS3 A;  5M4M A;  1UYC A;  4L90 A;  2YEC A;  2BU8 A;  2BU7 A;  4PRV A;  4XC0 A;  3IED A;  5CPH A;  4BIU A;  3HYZ A;  2BT0 A;  3OMU A;  3RLP A;  2IWU A;  1UYH A;  3EHG A;  3QDD A;  2XDK A;  4CWQ A;  3PEJ A;  1U0Z A;  4L8Z A;  1EA6 A;  2K5B A;  3BMY A;  5FWK A;  4LWI A;  4MP2 A;  4HYP A;  4XKK A;  4H7Q A;  4DUH A;  1UYM A;  3VHD A;  3T1K A;  1OSF A;  1Y8P A;  1TH8 A;  4FCP A;  4JQL A;  2HKJ A;  3WHA A;  3R4N A;  3GIG A;  4KSG A;  2UWD A;  4FCQ A;  2O1U A;  2YE7 A;  5D6P A;  1YT2 A;  2XAB A;  4XD8 A;  2YK2 A;  1GJV A;  3CRL A;  3JZ3 A;  4BQG A;  4YKW A;  3LNU A;  2XHR A;  4URN A;  2YI5 A;  2H55 A;  4DZY A;  4V25 A;  2BYI A;  3Q5K A;  4MBC A;  1I58 A;  3EHJ A;  2Q2E B;  1QZR A;  2XDU A;  2BRC A;  5F5R A;  3GIG B;  2GFD A;  3H80 A;  1AJ6 A;  3CWV A;  2BZ5 A;  2O1W A;  4QPK A;  1UYK A;  5J6A A;  4XKO A;  3TZ4 A;  2BU5 A;  2IWS A;  1GKZ A;  2QFO A;  2XHX A;  5GGZ A;  4YKZ A;  2CG9 A;  2EXL A;  3CGZ A;  3U2K A;  5M4N A;  1H7U A;  1NHJ A;  4HY1 A;  4BIZ A;  2YEF A;  1KZN A;  2YGF A;  3VHA A;  4NH7 A;  5CTY A;  2QG0 A;  1TC6 A;  3ZM7 A;  2YKJ A;  2XX2 A;  4FPP A;  2QF6 A;  1ZWH A;  1Z5B A;  4E00 A;  2YEG A;  3B26 A;  4H81 A;  1R62 A;  4EGK A;  1TC0 A;  1AH8 A;  2C2A A;  3O6O A;  1YSZ A;  2CCS A;  4AWP A;  4EGH A;  4FMT A;  4CWF A;  3R91 A;  1YET A;  1Z59 A;  2XK2 A;  2XD6 A;  4LP0 A;  5C93 A;  3U67 A;  3BM9 A;  3ZXO A;  5L3J A;  3KE6 A;  3OW6 A;  1UY9 A;  3TUH A;  4KTN A;  2O1V A;  1ID0 A;  5D7C A;  4ASB A;  4P7A A;  2XDL A;  4KQV A;  4ASF A;  3MNR P;  1B62 A;  2YGA A;  3HZ5 A;  4Q20 A;  3T2S A;  2FYP A;  4CWS A;  2YE3 A;  1KIJ A;  1S14 A;  4HXZ A;  2WEQ A;  3G75 A;  4ASG A;  4XIT A;  4QPJ A;  3NMQ A;  4CWO A;  1L0O A;  4WUB A;  2WI1 A;  4BAE A;  2Q8I A;  2WI2 A;  3CRK A;  4YKY A;  4XKA A;  2Q8H A;  3GIF A;  3OPD A;  4V26 A;  1I5B A;  2YKB A;  1I5D A;  1YT1 A;  4URM A;  3EHF A;  1TBW A;  3TZ0 A;  2IOR A;  4BQJ A;  2GQP A;  3G7E A;  3D36 A;  4FCR A;  4PRX A;  4EM7 A;  3GIE A;  4YKX A;  1B3Q A;  2BRE A;  2YKE A;  4B6C A;  2YEI A;  5BOC A;  5D7R A;  4XDM A;  4O09 A;  1QY8 A;  2YE2 A;  2YJW A;  3Q5J A;  1UYG A;  3WQ9 A;  2ZBK B;  3EKR A;  1THN A;  5CTW A;  2YEB A;  4JAS A;  4XIQ A;  1Z5A A;  3FT5 A;  2YEE A;  5D6Q A;  4X9L A;  4ASA A;  5M4E A;  2XJG A;  4YKU A;  2YI6 A;  1YC1 A;  2VCI A;  5CTX A;  3Q5L A;  3ZKD A;  5D7D A;  4ZVI A;  2BSM A;  2ZDY A;  3T0H A;  3TTZ A;  4JAU A;  1Z5C A;  1U2O A;  2YGE A;  4L94 A;  4EEH A;  1B63 A;  1UYE A;  4LWH A;  3A0Z A;  4MPE A;  3A0T A;  3INW A;  2WI7 A;  1UY7 A;  1YC3 A;  3OWB A;  4KFG A;  3VHC A;  1I5A A;  5IDM A;  4WUC A;  4W7T A;  2QG2 A;  2VW5 A; 
#chains in the Genus database with same CATH topology
 3EHH A;  3QTF A;  4R3A A;  4B7P A;  4KP4 A;  4HY6 A;  3A0W A;  4H85 A;  2WI5 A;  3B24 A;  3A0Y A;  1UYF A;  4YKR A;  4E72 A;  3R4P A;  1AM1 A;  3D0B A;  4LWE A;  3RKZ A;  5F3K A;  3PEH A;  4WUD A;  4XTJ A;  4XE2 A;  2JKI A;  2CH4 A;  2CCT A;  3RLR A;  1UYL A;  4YKQ A;  2ZKJ A;  2AKP A;  1I59 A;  3R92 A;  3FV5 A;  5FNF A;  2Q8G A;  4R3M A;  2BTZ A;  1EI1 A;  4AWO A;  1JM6 A;  3LMM A;  1UY6 A;  4CWP A;  1UY8 A;  5IN9 A;  3A0R A;  3R4O A;  2IOQ A;  4AWQ A;  3O0I A;  2HG1 A;  2YKC A;  3O2F A;  2YE5 A;  1H7S A;  2JJC A;  3CGY A;  3DGE A;  1GKX A;  2FTK A;  4U93 A;  1S16 A;  2YEH A;  1YER A;  4O0B A;  3TZ5 A;  1Y4U A;  3CYG A;  2FWY A;  2YJX A;  3HZ1 A;  2XDS A;  4PU9 A;  4URL A;  2ZDX A;  3U2D A;  3T0Z A;  3OWD A;  4O05 A;  1BXD A;  4O04 A;  2XDX A;  1Y8N A;  2YI0 A;  3A0X A;  4GGL A;  3K99 A;  3K97 A;  4JAV A;  3VAD A;  2YEJ A;  2FXS A;  4EMV A;  2C1I A;  1UYI A;  3B25 A;  2XHT A;  4I5S A;  3ZKB A;  2WI3 A;  4XIR A;  3H4L A;  1AMW A;  2WEP A;  1NHI A;  1BKN A;  2IOP A;  4KSH A;  4HYM A;  4LWF A;  4LWG A;  5M4H A;  2FWZ A;  4U7N A;  3ZXQ A;  5IDJ A;  4XCL A;  1I5C A;  4P8O A;  4ZKI A;  2IWX A;  2YE8 A;  3FT8 A;  4YKT A;  3EKO A;  3LPS A;  2PNR A;  4GEE A;  4MPC A;  4GCZ A;  1Y8O A;  1QYE A;  4EFT A;  1A4H A;  3SL2 A;  4BXI A;  2CGF A;  1Y4S A;  4U7O A;  4CWT A;  4GQT A;  4LPB A;  4CE1 A;  5M4P A;  4GFN A;  3INX A;  2H8M A;  4MP7 A;  4CWN A;  1YT0 A;  1US7 A;  1ZXM A;  2XJX A;  3T10 A;  3B27 A;  2WI6 A;  2VWC A;  4K4O A;  4E01 A;  2XX4 A;  2Q8F A;  1ZXN A;  5FND A;  3RLQ A;  2HCH A;  5BOD A;  1MX0 A;  2E0A A;  1NHH A;  3K60 A;  4MOT A;  2BU6 A;  3C11 A;  2YEA A;  4L93 A;  2C1G A;  2WI4 A;  4AS9 A;  4NH8 A;  4O07 A;  2BU2 A;  4MPN A;  2XJJ A;  1YES A;  3R4M A;  1YC4 A;  3HYY A;  1MU5 A;  5CTU A;  2YI7 A;  4HZ0 A;  1PVG A;  4HXW A;  5M4K A;  1AH6 A;  1ZW9 A;  2YE4 A;  4NH9 A;  2XCM A;  1BGQ A;  2VCJ A;  4R1F A;  3C0E A;  4PL9 A;  3TZ2 A;  4HZ5 A;  4XIP A;  4L91 A;  2BYH A;  2YK9 A;  2YED A;  1TID A;  2WER A;  3D2R A;  3B28 A;  4CWR A;  1YSR A;  4E02 A;  2XX5 A;  2ESA A;  4EGI A;  3HHU A;  3HEK A;  4MB9 A;  4XCJ A;  3G7B A;  4URO A;  2CCU A;  4EFU A;  4GT8 A;  1TIL A;  2YKI A;  5FNC A;  3K98 A;  4CE2 A;  5J71 A;  5CF0 A;  1BYQ A;  1UYD A;  4I3H A;  2YE9 A;  2YE6 A;  4CE3 A;  1YS3 A;  5M4M A;  1UYC A;  4L90 A;  5JEN A;  2YEC A;  2BU8 A;  2BU7 A;  4PRV A;  4XC0 A;  3IED A;  5CPH A;  4BIU A;  3HYZ A;  2BT0 A;  3OMU A;  3RLP A;  2IWU A;  1UYH A;  3EHG A;  3QDD A;  2XDK A;  4CWQ A;  1F51 A;  3PEJ A;  1U0Z A;  4L8Z A;  1EA6 A;  2K5B A;  3BMY A;  5FWK A;  4LWI A;  4MP2 A;  4HYP A;  4XKK A;  4H7Q A;  4DUH A;  1UYM A;  3VHD A;  3T1K A;  1OSF A;  1Y8P A;  1TH8 A;  4FCP A;  4JQL A;  2HKJ A;  3WHA A;  3R4N A;  3GIG A;  4KSG A;  2UWD A;  4FCQ A;  2O1U A;  2YE7 A;  5D6P A;  1YT2 A;  2XAB A;  4XD8 A;  2YK2 A;  1GJV A;  3CRL A;  3JZ3 A;  4BQG A;  4YKW A;  3LNU A;  2XHR A;  4URN A;  2YI5 A;  2H55 A;  4DZY A;  4V25 A;  2BYI A;  3Q5K A;  4MBC A;  1I58 A;  3EHJ A;  1IXM A;  2Q2E B;  1QZR A;  2XDU A;  2BRC A;  5F5R A;  3GIG B;  2GFD A;  3H80 A;  1AJ6 A;  3CWV A;  2BZ5 A;  2O1W A;  4QPK A;  1UYK A;  5J6A A;  4XKO A;  3TZ4 A;  2BU5 A;  2IWS A;  1GKZ A;  2QFO A;  2XHX A;  5GGZ A;  4YKZ A;  2CG9 A;  2EXL A;  3CGZ A;  3U2K A;  5M4N A;  1H7U A;  1NHJ A;  4HY1 A;  4BIZ A;  2YEF A;  1KZN A;  2YGF A;  3VHA A;  4NH7 A;  5CTY A;  2QG0 A;  1TC6 A;  3ZM7 A;  2YKJ A;  2XX2 A;  2QF6 A;  4FPP A;  1ZWH A;  1Z5B A;  4E00 A;  2YEG A;  3B26 A;  4H81 A;  1R62 A;  4EGK A;  1TC0 A;  1AH8 A;  2C2A A;  3O6O A;  1YSZ A;  2CCS A;  4AWP A;  4EGH A;  4FMT A;  4CWF A;  3R91 A;  1YET A;  1Z59 A;  2XK2 A;  2XD6 A;  4LP0 A;  5C93 A;  3U67 A;  3BM9 A;  3ZXO A;  5L3J A;  3KE6 A;  3OW6 A;  2HHI A;  1UY9 A;  3TUH A;  4KTN A;  2O1V A;  1ID0 A;  5D7C A;  4ASB A;  4P7A A;  2XDL A;  4KQV A;  4ASF A;  3MNR P;  1B62 A;  2YGA A;  3HZ5 A;  4Q20 A;  3T2S A;  2FYP A;  4CWS A;  2YE3 A;  1KIJ A;  1S14 A;  4HXZ A;  2WEQ A;  3G75 A;  4ASG A;  4XIT A;  4QPJ A;  3NMQ A;  4CWO A;  1L0O A;  4WUB A;  2WI1 A;  4BAE A;  2Q8I A;  2WI2 A;  3CRK A;  4YKY A;  4XKA A;  2Q8H A;  3GIF A;  3OPD A;  4V26 A;  1I5B A;  2YKB A;  1I5D A;  1YT1 A;  4URM A;  3EHF A;  1TBW A;  3TZ0 A;  3S5T A;  2IOR A;  4BQJ A;  2GQP A;  3G7E A;  3D36 A;  4FCR A;  4PRX A;  4EM7 A;  3GIE A;  4YKX A;  1B3Q A;  2BRE A;  2YKE A;  4B6C A;  2YEI A;  5BOC A;  5D7R A;  4XDM A;  4O09 A;  1QY8 A;  2YE2 A;  2YJW A;  3Q5J A;  1UYG A;  3WQ9 A;  2ZBK B;  3EKR A;  1THN A;  5CTW A;  2YEB A;  4JAS A;  4XIQ A;  1Z5A A;  3FT5 A;  2YEE A;  5D6Q A;  4X9L A;  4ASA A;  5M4E A;  2XJG A;  4YKU A;  2YI6 A;  1YC1 A;  2VCI A;  5CTX A;  3Q5L A;  3ZKD A;  5D7D A;  4ZVI A;  2BSM A;  2ZDY A;  3T0H A;  3TTZ A;  4JAU A;  1Z5C A;  1U2O A;  2YGE A;  4L94 A;  4EEH A;  1B63 A;  1UYE A;  4LWH A;  3A0Z A;  4MPE A;  3A0T A;  3INW A;  2WI7 A;  1UY7 A;  1YC3 A;  3OWB A;  4KFG A;  3VHC A;  1I5A A;  5IDM A;  4WUC A;  4W7T A;  2QG2 A;  2VW5 A; 
#chains in the Genus database with same CATH homology
 3EHH A;  3QTF A;  4R3A A;  4B7P A;  4KP4 A;  4HY6 A;  3A0W A;  4H85 A;  2WI5 A;  3B24 A;  3A0Y A;  1UYF A;  4YKR A;  3R4P A;  1AM1 A;  3D0B A;  4LWE A;  3RKZ A;  5F3K A;  3PEH A;  4WUD A;  4XTJ A;  4XE2 A;  2JKI A;  2CH4 A;  2CCT A;  3RLR A;  1UYL A;  4YKQ A;  2ZKJ A;  2AKP A;  1I59 A;  3R92 A;  3FV5 A;  5FNF A;  2Q8G A;  4R3M A;  2BTZ A;  1EI1 A;  4AWO A;  1JM6 A;  1UY6 A;  4CWP A;  1UY8 A;  5IN9 A;  3A0R A;  3R4O A;  2IOQ A;  4AWQ A;  3O0I A;  2HG1 A;  2YKC A;  3O2F A;  2YE5 A;  1H7S A;  2JJC A;  3CGY A;  3DGE A;  1GKX A;  4U93 A;  1S16 A;  2YEH A;  1YER A;  4O0B A;  3TZ5 A;  1Y4U A;  2FWY A;  2YJX A;  3HZ1 A;  2XDS A;  4PU9 A;  4URL A;  2ZDX A;  3U2D A;  3T0Z A;  3OWD A;  4O05 A;  1BXD A;  4O04 A;  2XDX A;  1Y8N A;  2YI0 A;  3A0X A;  4GGL A;  3K99 A;  3K97 A;  4JAV A;  3VAD A;  2YEJ A;  2FXS A;  4EMV A;  1UYI A;  3B25 A;  2XHT A;  4I5S A;  3ZKB A;  2WI3 A;  4XIR A;  3H4L A;  1AMW A;  2WEP A;  1NHI A;  1BKN A;  2IOP A;  4KSH A;  4HYM A;  4LWF A;  4LWG A;  5M4H A;  2FWZ A;  4U7N A;  3ZXQ A;  5IDJ A;  4XCL A;  1I5C A;  4P8O A;  4ZKI A;  2IWX A;  2YE8 A;  3FT8 A;  4YKT A;  3EKO A;  3LPS A;  2PNR A;  4GEE A;  4MPC A;  4GCZ A;  1Y8O A;  1QYE A;  4EFT A;  1A4H A;  3SL2 A;  4BXI A;  2CGF A;  1Y4S A;  4U7O A;  4CWT A;  4GQT A;  4LPB A;  4CE1 A;  5M4P A;  4GFN A;  3INX A;  2H8M A;  4MP7 A;  4CWN A;  1YT0 A;  1US7 A;  1ZXM A;  2XJX A;  3T10 A;  3B27 A;  2WI6 A;  2VWC A;  4K4O A;  4E01 A;  2XX4 A;  2Q8F A;  1ZXN A;  5FND A;  3RLQ A;  2HCH A;  5BOD A;  1MX0 A;  2E0A A;  1NHH A;  3K60 A;  4MOT A;  2BU6 A;  3C11 A;  2YEA A;  4L93 A;  2WI4 A;  4AS9 A;  4NH8 A;  4O07 A;  2BU2 A;  4MPN A;  2XJJ A;  1YES A;  3R4M A;  1YC4 A;  3HYY A;  1MU5 A;  5CTU A;  2YI7 A;  4HZ0 A;  1PVG A;  4HXW A;  5M4K A;  1AH6 A;  1ZW9 A;  2YE4 A;  4NH9 A;  2XCM A;  1BGQ A;  2VCJ A;  4R1F A;  3C0E A;  4PL9 A;  3TZ2 A;  4HZ5 A;  4XIP A;  4L91 A;  2BYH A;  2YK9 A;  2YED A;  1TID A;  2WER A;  3D2R A;  3B28 A;  4CWR A;  1YSR A;  4E02 A;  2XX5 A;  2ESA A;  4EGI A;  3HHU A;  3HEK A;  4MB9 A;  4XCJ A;  3G7B A;  4URO A;  2CCU A;  4EFU A;  4GT8 A;  1TIL A;  2YKI A;  5FNC A;  3K98 A;  4CE2 A;  5J71 A;  5CF0 A;  1BYQ A;  1UYD A;  4I3H A;  2YE9 A;  2YE6 A;  4CE3 A;  1YS3 A;  5M4M A;  1UYC A;  4L90 A;  2YEC A;  2BU8 A;  2BU7 A;  4PRV A;  4XC0 A;  3IED A;  5CPH A;  4BIU A;  3HYZ A;  2BT0 A;  3OMU A;  3RLP A;  2IWU A;  1UYH A;  3EHG A;  3QDD A;  2XDK A;  4CWQ A;  3PEJ A;  1U0Z A;  4L8Z A;  1EA6 A;  2K5B A;  3BMY A;  5FWK A;  4LWI A;  4MP2 A;  4HYP A;  4XKK A;  4H7Q A;  4DUH A;  1UYM A;  3VHD A;  3T1K A;  1OSF A;  1Y8P A;  1TH8 A;  4FCP A;  4JQL A;  2HKJ A;  3WHA A;  3R4N A;  3GIG A;  4KSG A;  2UWD A;  4FCQ A;  2O1U A;  2YE7 A;  5D6P A;  1YT2 A;  2XAB A;  4XD8 A;  2YK2 A;  1GJV A;  3CRL A;  3JZ3 A;  4BQG A;  4YKW A;  3LNU A;  2XHR A;  4URN A;  2YI5 A;  2H55 A;  4DZY A;  4V25 A;  2BYI A;  3Q5K A;  4MBC A;  1I58 A;  3EHJ A;  2Q2E B;  1QZR A;  2XDU A;  2BRC A;  5F5R A;  3GIG B;  2GFD A;  3H80 A;  1AJ6 A;  3CWV A;  2BZ5 A;  2O1W A;  4QPK A;  1UYK A;  5J6A A;  4XKO A;  3TZ4 A;  2BU5 A;  2IWS A;  1GKZ A;  2QFO A;  2XHX A;  5GGZ A;  4YKZ A;  2CG9 A;  2EXL A;  3CGZ A;  3U2K A;  5M4N A;  1H7U A;  1NHJ A;  4HY1 A;  4BIZ A;  2YEF A;  1KZN A;  2YGF A;  3VHA A;  4NH7 A;  5CTY A;  2QG0 A;  1TC6 A;  3ZM7 A;  2YKJ A;  2XX2 A;  4FPP A;  2QF6 A;  1ZWH A;  1Z5B A;  4E00 A;  2YEG A;  3B26 A;  4H81 A;  1R62 A;  4EGK A;  1TC0 A;  1AH8 A;  2C2A A;  3O6O A;  1YSZ A;  2CCS A;  4AWP A;  4EGH A;  4FMT A;  4CWF A;  3R91 A;  1YET A;  1Z59 A;  2XK2 A;  2XD6 A;  4LP0 A;  5C93 A;  3U67 A;  3BM9 A;  3ZXO A;  5L3J A;  3KE6 A;  3OW6 A;  1UY9 A;  3TUH A;  4KTN A;  2O1V A;  1ID0 A;  5D7C A;  4ASB A;  4P7A A;  2XDL A;  4KQV A;  4ASF A;  3MNR P;  1B62 A;  2YGA A;  3HZ5 A;  4Q20 A;  3T2S A;  2FYP A;  4CWS A;  2YE3 A;  1KIJ A;  1S14 A;  4HXZ A;  2WEQ A;  3G75 A;  4ASG A;  4XIT A;  4QPJ A;  3NMQ A;  4CWO A;  1L0O A;  4WUB A;  2WI1 A;  4BAE A;  2Q8I A;  2WI2 A;  3CRK A;  4YKY A;  4XKA A;  2Q8H A;  3GIF A;  3OPD A;  4V26 A;  1I5B A;  2YKB A;  1I5D A;  1YT1 A;  4URM A;  3EHF A;  1TBW A;  3TZ0 A;  2IOR A;  4BQJ A;  2GQP A;  3G7E A;  3D36 A;  4FCR A;  4PRX A;  4EM7 A;  3GIE A;  4YKX A;  1B3Q A;  2BRE A;  2YKE A;  4B6C A;  2YEI A;  5BOC A;  5D7R A;  4XDM A;  4O09 A;  1QY8 A;  2YE2 A;  2YJW A;  3Q5J A;  1UYG A;  3WQ9 A;  2ZBK B;  3EKR A;  1THN A;  5CTW A;  2YEB A;  4JAS A;  4XIQ A;  1Z5A A;  3FT5 A;  2YEE A;  5D6Q A;  4X9L A;  4ASA A;  5M4E A;  2XJG A;  4YKU A;  2YI6 A;  1YC1 A;  2VCI A;  5CTX A;  3Q5L A;  3ZKD A;  5D7D A;  4ZVI A;  2BSM A;  2ZDY A;  3T0H A;  3TTZ A;  4JAU A;  1Z5C A;  1U2O A;  2YGE A;  4L94 A;  4EEH A;  1B63 A;  1UYE A;  4LWH A;  3A0Z A;  4MPE A;  3A0T A;  3INW A;  2WI7 A;  1UY7 A;  1YC3 A;  3OWB A;  4KFG A;  3VHC A;  1I5A A;  5IDM A;  4WUC A;  4W7T A;  2QG2 A;  2VW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...