1U2OA

Crystal structure of the n-domain of grp94 lacking the charged domain in complex with neca
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
236
structure length
226
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQESTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Structure of the N-terminal domain of GRP94. Basis for ligand specificity and regulation
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 66
structure length 226
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1u2oA00
2O1UA 4ZVIA 5CF0A 2CCSA 1UYHA 3KE6A 4YKUA 2Q8IA 2XHRA 4H7QA 3D36A 1BXDA 2BRCA 1YT1A 4FCPA 3GIEA 3PEJA 3O6OA 2Q8HA 5FNDA 5CPHA 4LP0A 2VCJA 2JJCA 4BQGA 4CE3A 4GCZA 2H55A 5IDMA 2XJGA 1Y8PA 2VW5A 4XCLA 4QPKA 4K4OA 1Z5AA 2HKJA 2YEAA 4EFUA 3ZKDA 4EGIA 1YS3A 5M4HA 2GFDA 2ESAA 2XHTA 4L8ZA 5CTYA 1NHHA 3T2SA 1TILA 3U2DA 4HY1A 1H7SA 4WUCA 2YEIA 2GQPA 2FXSA 2FYPA 1GKZA 4I5SA 3K60A 3HZ5A 1YC1A 5CTWA 4MOTA 4JAUA 1YESA 1UYEA 2XCMA 4LWGA 1UYCA 2BU6A 1NHJA 1B3QA 4JASA 4NH7A 1Y4UA 3U67A 3OWBA 1ZW9A 2E0AA 3K98A 5D6PA 4WUBA 2WI7A 1YT2A 4GEEA 3VHCA 3WHAA 4BXIA 2YEBA 1Z5BA 4MPEA 5D7RA 1GJVA 2QF6A 5M4EA 3RLQA 4KSHA 2BSMA 1QY8A 4DZYA 2BZ5A 3R4OA 4HY6A 4BAEA 2QFOA 2AKPA 1UYFA 2FWYA 1ZWHA 1YSZA 2YE2A 2YE6A 1S16A 4EGHA 2XX2A 1A4HA 3CGYA 3U2KA 1I5AA 5C93A 3QTFA 2YECA 4LWHA 5CTUA 1Y8NA 5GGZA 2YI0A 1Z5CA 2CG9A 3B27A 1ZXMA 2XABA 4NH9A 3H4LA 4HYMA 1TC0A 4L91A 4QPJA 4PL9A 3O0IA 3CRLA 5J71A 4MP2A 4YKQA 4ASAA 3EHGA 2YEEA 3R92A 4U7OA 3WQ9A 4E01A 2BYHA 4YKWA 3CGZA 2YI6A 1I5DA 4XKAA 3ZXOA 1UYMA 4V25A 4FCRA 4PRVA 2BT0A 2YKEA 1AM1A 2XHXA 1BYQA 2XD6A 3C11A 2IOPA 3PEHA 3T0HA 2XDUA 4XKKA 4UROA 4B7PA 4LPBA 1PVGA 3B25A 2WI1A 4BIZA 2YI7A 2YEFA 4YKXA 4H85A 4CWQA 3OMUA 4U93A 4URLA 1YC3A 3MNRP 2YE5A 4EM7A 3TUHA 2YEJA 3T10A 3FT5A 4XDMA 2IORA 2HCHA 2XX5A 4HXZA 2YKBA 3C0EA 2WI4A 2WEQA 4XC0A 5M4NA 4O04A 5BOCA 1UY9A 2WI3A 3TTZA 1TBWA 2XJJA 3EHJA 3DGEA 4R3MA 1EI1A 3R4PA 3ZKBA 2XK2A 1KIJA 1Y8OA 2CH4A 3A0XA 3H80A 3R4NA 4FMTA 4W7TA 2C2AA 1US7A 4L94A 4ASFA 4X9LA 3CRKA 4BQJA 3FT8A 2XJXA 2Q8GA 2YKCA 2YK2A 2ZKJA 1S14A 1UYIA 3A0RA 5M4PA 1QZRA 1Y4SA 2VWCA 3ZM7A 2YI5A 4KFGA 1UY7A 4HXWA 3D0BA 3CWVA 3GIGA 3INXA 4XITA 2BU8A 3A0TA 2VCIA 4YKZA 5M4MA 3GIFA 2IWXA 4YKTA 3TZ5A 4FPPA 4XTJA 2YGFA 4P7AA 3VADA 1U2OA 3OW6A 4P8OA 1UYGA 4B6CA 4MBCA 1I58A 3B24A 3O2FA 4JQLA 2YJWA 2ZBKB 2IWUA 4AWQA 4KP4A 3A0ZA 4ASGA 4EGKA 1UYDA 1AH6A 2WERA 4XCJA 4KTNA 2CGFA 3T0ZA 2IWSA 2YK9A 1H7UA 1I5CA 2Q8FA 4XIQA 1OSFA 4WUDA 4HZ5A 5J6AA 4CWPA 4E02A 1MX0A 4CWRA 2EXLA 4BIUA 3HZ1A 2IOQA 4CE1A 3ZXQA 4CWNA 4MPCA 4O0BA 4CE2A 5IDJA 2HG1A 4GT8A 2YE8A 1TH8A 3BM9A 4XKOA 1ID0A 4O07A 1UYKA 4JAVA 3GIGB 4O05A 2XDLA 4O09A 4GFNA 3RKZA 4ASBA 4AWPA 3OPDA 4MPNA 1THNA 3HEKA 2BU2A 3LNUA 4LWFA 4GQTA 2QG2A 4MP7A 5L3JA 4KSGA 1B62A 3TZ0A 4R1FA 1KZNA 3BMYA 2JKIA 3A0WA 4KQVA 5D7CA 2XDXA 2XDSA 1GKXA 2YGEA 1JM6A 4XD8A 2H8MA 2WI6A 4ZKIA 4FCQA 4L93A 4E00A 3LPSA 2YGAA 3RLPA 4CWFA 1R62A 1YSRA 2WEPA 3K97A 4DUHA 2YJXA 2PNRA 2O1WA 3EKOA 5FNCA 4CWTA 4URMA 3HYZA 5F5RA 5M4KA 1AH8A 1BKNA 1Z59A 1UYLA 2CCUA 4U7NA 3HHUA 1YT0A 2YEDA 2BYIA 3R91A 4CWOA 3D2RA 2Q2EB 4XIPA 2K5BA 4PRXA 4V26A 4Q20A 4AWOA 2YEHA 4I3HA 4LWIA 5D7DA 4EEHA 1I59A 2BREA 3TZ4A 4GGLA 1AMWA 3NMQA 3SL2A 3Q5JA 3Q5KA 3INWA 1UY8A 2XX4A 3B28A 2XDKA 1I5BA 2YE7A 3R4MA 1UY6A 2YKIA 4R3AA 4YKYA 3VHDA 2BTZA 5F3KA 3IEDA 3QDDA 3T1KA 3RLRA 2ZDYA 2YKJA 1BGQA 2BU5A 3FV5A 3TZ2A 3JZ3A 3EHHA 4URNA 5CTXA 3A0YA 5BODA 1YC4A 3G75A 5FWKA 4LWEA 1YERA 4XE2A 3EKRA 4XIRA 3EHFA 5D6QA 1AJ6A 4H81A 3VHAA 1TIDA 4L90A 3G7BA 1MU5A 1U0ZA 4HZ0A 2WI5A 2YE4A 4CWSA 4NH8A 4PU9A 2BU7A 1YETA 1ZXNA 5IN9A 3HYYA 4HYPA 4AS9A 4EMVA 3Q5LA 3G7EA 1TC6A 1EA6A 3B26A 4MB9A 4YKRA 2YEGA 2YE9A 3OWDA 2FWZA 2CCTA 4EFTA 2UWDA 2QG0A 1L0OA 2WI2A 2YE3A 3K99A 1B63A 5FNFA 1NHIA 1QYEA 2O1VA 2ZDXA
chains in the Genus database with same CATH superfamily
2O1UA 4ZVIA 5CF0A 2CCSA 1UYHA 3KE6A 4YKUA 2Q8IA 2XHRA 4H7QA 3D36A 1BXDA 2BRCA 1YT1A 4FCPA 3GIEA 3PEJA 3O6OA 2Q8HA 5FNDA 5CPHA 4LP0A 2VCJA 2JJCA 4BQGA 4CE3A 4GCZA 2H55A 5IDMA 2XJGA 1Y8PA 2VW5A 4XCLA 4QPKA 4K4OA 1Z5AA 2HKJA 2YEAA 4EFUA 3ZKDA 4EGIA 1YS3A 5M4HA 2GFDA 2ESAA 2XHTA 4L8ZA 5CTYA 1NHHA 3T2SA 1TILA 3U2DA 4HY1A 1H7SA 4WUCA 2YEIA 2GQPA 2FXSA 2FYPA 1GKZA 4I5SA 3K60A 3HZ5A 1YC1A 5CTWA 4MOTA 4JAUA 1YESA 1UYEA 2XCMA 4LWGA 1UYCA 2BU6A 1NHJA 1B3QA 4JASA 4NH7A 1Y4UA 3U67A 3OWBA 1ZW9A 2E0AA 3K98A 5D6PA 4WUBA 2WI7A 1YT2A 4GEEA 3VHCA 3WHAA 4BXIA 2YEBA 1Z5BA 4MPEA 5D7RA 1GJVA 2QF6A 5M4EA 3RLQA 4KSHA 2BSMA 1QY8A 4DZYA 2BZ5A 3R4OA 4HY6A 4BAEA 2QFOA 2AKPA 1UYFA 2FWYA 1ZWHA 1YSZA 2YE2A 2YE6A 5JENA 1S16A 3S5TA 4EGHA 2XX2A 1A4HA 3CGYA 3U2KA 1I5AA 5C93A 3QTFA 2YECA 4LWHA 5CTUA 1Y8NA 5GGZA 2YI0A 1Z5CA 2CG9A 3B27A 1ZXMA 2XABA 4NH9A 3H4LA 4HYMA 1TC0A 4L91A 4QPJA 4PL9A 3O0IA 3CRLA 5J71A 4MP2A 4YKQA 4ASAA 3EHGA 2YEEA 3R92A 4U7OA 3WQ9A 4E01A 2BYHA 4YKWA 3CGZA 2YI6A 1I5DA 4XKAA 3ZXOA 1UYMA 4V25A 4FCRA 4PRVA 2BT0A 2YKEA 1AM1A 2XHXA 1BYQA 2XD6A 3C11A 2IOPA 3PEHA 3T0HA 2XDUA 1F51A 4XKKA 4UROA 4B7PA 4LPBA 1PVGA 3B25A 2WI1A 4BIZA 2YI7A 2YEFA 4YKXA 4H85A 4CWQA 3OMUA 4U93A 4URLA 1YC3A 3MNRP 3CYGA 2YE5A 4EM7A 3TUHA 2YEJA 3T10A 3FT5A 4XDMA 2IORA 2C1IA 2HCHA 2XX5A 4HXZA 2YKBA 3C0EA 2WI4A 2WEQA 4XC0A 5M4NA 4O04A 5BOCA 1UY9A 2WI3A 3TTZA 1TBWA 2XJJA 3EHJA 1IXMA 3DGEA 4R3MA 1EI1A 3R4PA 3ZKBA 2XK2A 1KIJA 1Y8OA 2CH4A 3A0XA 3H80A 3R4NA 4FMTA 4W7TA 2C2AA 1US7A 4L94A 4ASFA 4X9LA 3CRKA 4BQJA 3FT8A 2XJXA 2Q8GA 2YKCA 2YK2A 2ZKJA 1S14A 1UYIA 3A0RA 5M4PA 1QZRA 1Y4SA 2VWCA 3ZM7A 2HHIA 2YI5A 4KFGA 1UY7A 4HXWA 3D0BA 3CWVA 3GIGA 3INXA 4XITA 2BU8A 3A0TA 2VCIA 4YKZA 5M4MA 3GIFA 2IWXA 4YKTA 3TZ5A 2C1GA 4FPPA 4XTJA 2YGFA 4P7AA 3VADA 1U2OA 3OW6A 4P8OA 1UYGA 4B6CA 4MBCA 1I58A 3B24A 3O2FA 4JQLA 2YJWA 2ZBKB 2IWUA 4AWQA 4KP4A 3A0ZA 4ASGA 2FTKA 4EGKA 1UYDA 1AH6A 2WERA 4XCJA 4KTNA 2CGFA 3T0ZA 2IWSA 2YK9A 1H7UA 1I5CA 2Q8FA 4XIQA 1OSFA 4WUDA 4HZ5A 5J6AA 4CWPA 4E02A 1MX0A 4CWRA 2EXLA 4BIUA 3HZ1A 2IOQA 4CE1A 3ZXQA 4CWNA 4MPCA 4O0BA 4CE2A 5IDJA 2HG1A 4GT8A 2YE8A 1TH8A 3BM9A 4XKOA 1ID0A 4O07A 1UYKA 4JAVA 3GIGB 4O05A 2XDLA 4O09A 4GFNA 3RKZA 4ASBA 4AWPA 3OPDA 4MPNA 1THNA 3HEKA 2BU2A 3LNUA 4LWFA 4E72A 4GQTA 2QG2A 4MP7A 5L3JA 4KSGA 1B62A 3TZ0A 4R1FA 1KZNA 3BMYA 2JKIA 3A0WA 4KQVA 5D7CA 2XDXA 2XDSA 1GKXA 2YGEA 1JM6A 4XD8A 2H8MA 2WI6A 4ZKIA 4FCQA 4L93A 4E00A 3LPSA 2YGAA 3RLPA 4CWFA 1R62A 1YSRA 2WEPA 3K97A 4DUHA 2YJXA 2PNRA 2O1WA 3EKOA 5FNCA 4CWTA 4URMA 3HYZA 5F5RA 5M4KA 1AH8A 1BKNA 1Z59A 1UYLA 2CCUA 4U7NA 3HHUA 1YT0A 3LMMA 2YEDA 2BYIA 3R91A 4CWOA 3D2RA 2Q2EB 4XIPA 2K5BA 4PRXA 4V26A 4Q20A 4AWOA 2YEHA 4I3HA 4LWIA 5D7DA 4EEHA 1I59A 2BREA 3TZ4A 4GGLA 1AMWA 3NMQA 3SL2A 3Q5JA 3Q5KA 3INWA 1UY8A 2XX4A 3B28A 2XDKA 1I5BA 2YE7A 3R4MA 1UY6A 2YKIA 4R3AA 4YKYA 3VHDA 2BTZA 5F3KA 3IEDA 3QDDA 3T1KA 3RLRA 2ZDYA 2YKJA 1BGQA 2BU5A 3FV5A 3TZ2A 3JZ3A 3EHHA 4URNA 5CTXA 3A0YA 5BODA 1YC4A 3G75A 5FWKA 4LWEA 1YERA 4XE2A 3EKRA 4XIRA 3EHFA 5D6QA 1AJ6A 4H81A 3VHAA 1TIDA 4L90A 3G7BA 1MU5A 1U0ZA 4HZ0A 2WI5A 2YE4A 4CWSA 4NH8A 4PU9A 2BU7A 1YETA 1ZXNA 5IN9A 3HYYA 4HYPA 4AS9A 4EMVA 3Q5LA 3G7EA 1TC6A 1EA6A 3B26A 4MB9A 4YKRA 2YEGA 2YE9A 3OWDA 2FWZA 2CCTA 4EFTA 2UWDA 2QG0A 1L0OA 2WI2A 2YE3A 3K99A 1B63A 5FNFA 1NHIA 1QYEA 2O1VA 2ZDXA
chains in the Genus database with same CATH topology
2O1UA 4ZVIA 5CF0A 2CCSA 1UYHA 3KE6A 4YKUA 2Q8IA 2XHRA 4H7QA 3D36A 1BXDA 2BRCA 1YT1A 4FCPA 3GIEA 3PEJA 3O6OA 2Q8HA 5FNDA 5CPHA 4LP0A 2VCJA 2JJCA 4BQGA 4CE3A 4GCZA 2H55A 5IDMA 2XJGA 1Y8PA 2VW5A 4XCLA 4QPKA 4K4OA 1Z5AA 2HKJA 2YEAA 4EFUA 3ZKDA 4EGIA 1YS3A 5M4HA 2GFDA 2ESAA 2XHTA 4L8ZA 5CTYA 1NHHA 3T2SA 1TILA 3U2DA 4HY1A 1H7SA 4WUCA 2YEIA 2GQPA 2FXSA 2FYPA 1GKZA 4I5SA 3K60A 3HZ5A 1YC1A 5CTWA 4MOTA 4JAUA 1YESA 1UYEA 2XCMA 4LWGA 1UYCA 2BU6A 1NHJA 1B3QA 4JASA 4NH7A 1Y4UA 3U67A 3OWBA 1ZW9A 2E0AA 3K98A 5D6PA 4WUBA 2WI7A 1YT2A 4GEEA 3VHCA 3WHAA 4BXIA 2YEBA 1Z5BA 4MPEA 5D7RA 1GJVA 2QF6A 5M4EA 3RLQA 4KSHA 2BSMA 1QY8A 4DZYA 2BZ5A 3R4OA 4HY6A 4BAEA 2QFOA 2AKPA 1UYFA 2FWYA 1ZWHA 1YSZA 2YE2A 2YE6A 1S16A 4EGHA 2XX2A 1A4HA 3CGYA 3U2KA 1I5AA 5C93A 3QTFA 2YECA 4LWHA 5CTUA 1Y8NA 5GGZA 2YI0A 1Z5CA 2CG9A 3B27A 1ZXMA 2XABA 4NH9A 3H4LA 4HYMA 1TC0A 4L91A 4QPJA 4PL9A 3O0IA 3CRLA 5J71A 4MP2A 4YKQA 4ASAA 3EHGA 2YEEA 3R92A 4U7OA 3WQ9A 4E01A 2BYHA 4YKWA 3CGZA 2YI6A 1I5DA 4XKAA 3ZXOA 1UYMA 4V25A 4FCRA 4PRVA 2BT0A 2YKEA 1AM1A 2XHXA 1BYQA 2XD6A 3C11A 2IOPA 3PEHA 3T0HA 2XDUA 4XKKA 4UROA 4B7PA 4LPBA 1PVGA 3B25A 2WI1A 4BIZA 2YI7A 2YEFA 4YKXA 4H85A 4CWQA 3OMUA 4U93A 4URLA 1YC3A 3MNRP 2YE5A 4EM7A 3TUHA 2YEJA 3T10A 3FT5A 4XDMA 2IORA 2HCHA 2XX5A 4HXZA 2YKBA 3C0EA 2WI4A 2WEQA 4XC0A 5M4NA 4O04A 5BOCA 1UY9A 2WI3A 3TTZA 1TBWA 2XJJA 3EHJA 3DGEA 4R3MA 1EI1A 3R4PA 3ZKBA 2XK2A 1KIJA 1Y8OA 2CH4A 3A0XA 3H80A 3R4NA 4FMTA 4W7TA 2C2AA 1US7A 4L94A 4ASFA 4X9LA 3CRKA 4BQJA 3FT8A 2XJXA 2Q8GA 2YKCA 2YK2A 2ZKJA 1S14A 1UYIA 3A0RA 5M4PA 1QZRA 1Y4SA 2VWCA 3ZM7A 2YI5A 4KFGA 1UY7A 4HXWA 3D0BA 3CWVA 3GIGA 3INXA 4XITA 2BU8A 3A0TA 2VCIA 4YKZA 5M4MA 3GIFA 2IWXA 4YKTA 3TZ5A 4FPPA 4XTJA 2YGFA 4P7AA 3VADA 1U2OA 3OW6A 4P8OA 1UYGA 4B6CA 4MBCA 1I58A 3B24A 3O2FA 4JQLA 2YJWA 2ZBKB 2IWUA 4AWQA 4KP4A 3A0ZA 4ASGA 4EGKA 1UYDA 1AH6A 2WERA 4XCJA 4KTNA 2CGFA 3T0ZA 2IWSA 2YK9A 1H7UA 1I5CA 2Q8FA 4XIQA 1OSFA 4WUDA 4HZ5A 5J6AA 4CWPA 4E02A 1MX0A 4CWRA 2EXLA 4BIUA 3HZ1A 2IOQA 4CE1A 3ZXQA 4CWNA 4MPCA 4O0BA 4CE2A 5IDJA 2HG1A 4GT8A 2YE8A 1TH8A 3BM9A 4XKOA 1ID0A 4O07A 1UYKA 4JAVA 3GIGB 4O05A 2XDLA 4O09A 4GFNA 3RKZA 4ASBA 4AWPA 3OPDA 4MPNA 1THNA 3HEKA 2BU2A 3LNUA 4LWFA 4GQTA 2QG2A 4MP7A 5L3JA 4KSGA 1B62A 3TZ0A 4R1FA 1KZNA 3BMYA 2JKIA 3A0WA 4KQVA 5D7CA 2XDXA 2XDSA 1GKXA 2YGEA 1JM6A 4XD8A 2H8MA 2WI6A 4ZKIA 4FCQA 4L93A 4E00A 3LPSA 2YGAA 3RLPA 4CWFA 1R62A 1YSRA 2WEPA 3K97A 4DUHA 2YJXA 2PNRA 2O1WA 3EKOA 5FNCA 4CWTA 4URMA 3HYZA 5F5RA 5M4KA 1AH8A 1BKNA 1Z59A 1UYLA 2CCUA 4U7NA 3HHUA 1YT0A 2YEDA 2BYIA 3R91A 4CWOA 3D2RA 2Q2EB 4XIPA 2K5BA 4PRXA 4V26A 4Q20A 4AWOA 2YEHA 4I3HA 4LWIA 5D7DA 4EEHA 1I59A 2BREA 3TZ4A 4GGLA 1AMWA 3NMQA 3SL2A 3Q5JA 3Q5KA 3INWA 1UY8A 2XX4A 3B28A 2XDKA 1I5BA 2YE7A 3R4MA 1UY6A 2YKIA 4R3AA 4YKYA 3VHDA 2BTZA 5F3KA 3IEDA 3QDDA 3T1KA 3RLRA 2ZDYA 2YKJA 1BGQA 2BU5A 3FV5A 3TZ2A 3JZ3A 3EHHA 4URNA 5CTXA 3A0YA 5BODA 1YC4A 3G75A 5FWKA 4LWEA 1YERA 4XE2A 3EKRA 4XIRA 3EHFA 5D6QA 1AJ6A 4H81A 3VHAA 1TIDA 4L90A 3G7BA 1MU5A 1U0ZA 4HZ0A 2WI5A 2YE4A 4CWSA 4NH8A 4PU9A 2BU7A 1YETA 1ZXNA 5IN9A 3HYYA 4HYPA 4AS9A 4EMVA 3Q5LA 3G7EA 1TC6A 1EA6A 3B26A 4MB9A 4YKRA 2YEGA 2YE9A 3OWDA 2FWZA 2CCTA 4EFTA 2UWDA 2QG0A 1L0OA 2WI2A 2YE3A 3K99A 1B63A 5FNFA 1NHIA 1QYEA 2O1VA 2ZDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1U A;  4ZVI A;  5CF0 A;  2CCS A;  1UYH A;  3KE6 A;  4YKU A;  2Q8I A;  2XHR A;  4H7Q A;  3D36 A;  1BXD A;  2BRC A;  1YT1 A;  4FCP A;  3GIE A;  3PEJ A;  3O6O A;  2Q8H A;  5FND A;  5CPH A;  4LP0 A;  2VCJ A;  2JJC A;  4BQG A;  4CE3 A;  4GCZ A;  2H55 A;  5IDM A;  2XJG A;  1Y8P A;  2VW5 A;  4XCL A;  4QPK A;  4K4O A;  1Z5A A;  2HKJ A;  2YEA A;  4EFU A;  3ZKD A;  4EGI A;  1YS3 A;  5M4H A;  2GFD A;  2ESA A;  2XHT A;  4L8Z A;  5CTY A;  1NHH A;  3T2S A;  1TIL A;  3U2D A;  4HY1 A;  1H7S A;  4WUC A;  2YEI A;  2GQP A;  2FXS A;  2FYP A;  1GKZ A;  4I5S A;  3K60 A;  3HZ5 A;  1YC1 A;  5CTW A;  4MOT A;  4JAU A;  1YES A;  1UYE A;  2XCM A;  4LWG A;  1UYC A;  2BU6 A;  1NHJ A;  1B3Q A;  4JAS A;  4NH7 A;  1Y4U A;  3U67 A;  3OWB A;  1ZW9 A;  2E0A A;  3K98 A;  5D6P A;  4WUB A;  2WI7 A;  1YT2 A;  4GEE A;  3VHC A;  3WHA A;  4BXI A;  2YEB A;  1Z5B A;  4MPE A;  5D7R A;  1GJV A;  2QF6 A;  5M4E A;  3RLQ A;  4KSH A;  2BSM A;  1QY8 A;  4DZY A;  2BZ5 A;  3R4O A;  4HY6 A;  4BAE A;  2QFO A;  2AKP A;  1UYF A;  2FWY A;  1ZWH A;  1YSZ A;  2YE2 A;  2YE6 A;  1S16 A;  4EGH A;  2XX2 A;  1A4H A;  3CGY A;  3U2K A;  1I5A A;  5C93 A;  3QTF A;  2YEC A;  4LWH A;  5CTU A;  1Y8N A;  5GGZ A;  2YI0 A;  1Z5C A;  2CG9 A;  3B27 A;  1ZXM A;  2XAB A;  4NH9 A;  3H4L A;  4HYM A;  1TC0 A;  4L91 A;  4QPJ A;  4PL9 A;  3O0I A;  3CRL A;  5J71 A;  4MP2 A;  4YKQ A;  4ASA A;  3EHG A;  2YEE A;  3R92 A;  4U7O A;  3WQ9 A;  4E01 A;  2BYH A;  4YKW A;  3CGZ A;  2YI6 A;  1I5D A;  4XKA A;  3ZXO A;  1UYM A;  4V25 A;  4FCR A;  4PRV A;  2BT0 A;  2YKE A;  1AM1 A;  2XHX A;  1BYQ A;  2XD6 A;  3C11 A;  2IOP A;  3PEH A;  3T0H A;  2XDU A;  4XKK A;  4URO A;  4B7P A;  4LPB A;  1PVG A;  3B25 A;  2WI1 A;  4BIZ A;  2YI7 A;  2YEF A;  4YKX A;  4H85 A;  4CWQ A;  3OMU A;  4U93 A;  4URL A;  1YC3 A;  3MNR P;  2YE5 A;  4EM7 A;  3TUH A;  2YEJ A;  3T10 A;  3FT5 A;  4XDM A;  2IOR A;  2HCH A;  2XX5 A;  4HXZ A;  2YKB A;  3C0E A;  2WI4 A;  2WEQ A;  4XC0 A;  5M4N A;  4O04 A;  5BOC A;  1UY9 A;  2WI3 A;  3TTZ A;  1TBW A;  2XJJ A;  3EHJ A;  3DGE A;  4R3M A;  1EI1 A;  3R4P A;  3ZKB A;  2XK2 A;  1KIJ A;  1Y8O A;  2CH4 A;  3A0X A;  3H80 A;  3R4N A;  4FMT A;  4W7T A;  2C2A A;  1US7 A;  4L94 A;  4ASF A;  4X9L A;  3CRK A;  4BQJ A;  3FT8 A;  2XJX A;  2Q8G A;  2YKC A;  2YK2 A;  2ZKJ A;  1S14 A;  1UYI A;  3A0R A;  5M4P A;  1QZR A;  1Y4S A;  2VWC A;  3ZM7 A;  2YI5 A;  4KFG A;  1UY7 A;  4HXW A;  3D0B A;  3CWV A;  3GIG A;  3INX A;  4XIT A;  2BU8 A;  3A0T A;  2VCI A;  4YKZ A;  5M4M A;  3GIF A;  2IWX A;  4YKT A;  3TZ5 A;  4FPP A;  4XTJ A;  2YGF A;  4P7A A;  3VAD A;  1U2O A;  3OW6 A;  4P8O A;  1UYG A;  4B6C A;  4MBC A;  1I58 A;  3B24 A;  3O2F A;  4JQL A;  2YJW A;  2ZBK B;  2IWU A;  4AWQ A;  4KP4 A;  3A0Z A;  4ASG A;  4EGK A;  1UYD A;  1AH6 A;  2WER A;  4XCJ A;  4KTN A;  2CGF A;  3T0Z A;  2IWS A;  2YK9 A;  1H7U A;  1I5C A;  2Q8F A;  4XIQ A;  1OSF A;  4WUD A;  4HZ5 A;  5J6A A;  4CWP A;  4E02 A;  1MX0 A;  4CWR A;  2EXL A;  4BIU A;  3HZ1 A;  2IOQ A;  4CE1 A;  3ZXQ A;  4CWN A;  4MPC A;  4O0B A;  4CE2 A;  5IDJ A;  2HG1 A;  4GT8 A;  2YE8 A;  1TH8 A;  3BM9 A;  4XKO A;  1ID0 A;  4O07 A;  1UYK A;  4JAV A;  3GIG B;  4O05 A;  2XDL A;  4O09 A;  4GFN A;  3RKZ A;  4ASB A;  4AWP A;  3OPD A;  4MPN A;  1THN A;  3HEK A;  2BU2 A;  3LNU A;  4LWF A;  4GQT A;  2QG2 A;  4MP7 A;  5L3J A;  4KSG A;  1B62 A;  3TZ0 A;  4R1F A;  1KZN A;  3BMY A;  2JKI A;  3A0W A;  4KQV A;  5D7C A;  2XDX A;  2XDS A;  1GKX A;  2YGE A;  1JM6 A;  4XD8 A;  2H8M A;  2WI6 A;  4ZKI A;  4FCQ A;  4L93 A;  4E00 A;  3LPS A;  2YGA A;  3RLP A;  4CWF A;  1R62 A;  1YSR A;  2WEP A;  3K97 A;  4DUH A;  2YJX A;  2PNR A;  2O1W A;  3EKO A;  5FNC A;  4CWT A;  4URM A;  3HYZ A;  5F5R A;  5M4K A;  1AH8 A;  1BKN A;  1Z59 A;  1UYL A;  2CCU A;  4U7N A;  3HHU A;  1YT0 A;  2YED A;  2BYI A;  3R91 A;  4CWO A;  3D2R A;  2Q2E B;  4XIP A;  2K5B A;  4PRX A;  4V26 A;  4Q20 A;  4AWO A;  2YEH A;  4I3H A;  4LWI A;  5D7D A;  4EEH A;  1I59 A;  2BRE A;  3TZ4 A;  4GGL A;  1AMW A;  3NMQ A;  3SL2 A;  3Q5J A;  3Q5K A;  3INW A;  1UY8 A;  2XX4 A;  3B28 A;  2XDK A;  1I5B A;  2YE7 A;  3R4M A;  1UY6 A;  2YKI A;  4R3A A;  4YKY A;  3VHD A;  2BTZ A;  5F3K A;  3IED A;  3QDD A;  3T1K A;  3RLR A;  2ZDY A;  2YKJ A;  1BGQ A;  2BU5 A;  3FV5 A;  3TZ2 A;  3JZ3 A;  3EHH A;  4URN A;  5CTX A;  3A0Y A;  5BOD A;  1YC4 A;  3G75 A;  5FWK A;  4LWE A;  1YER A;  4XE2 A;  3EKR A;  4XIR A;  3EHF A;  5D6Q A;  1AJ6 A;  4H81 A;  3VHA A;  1TID A;  4L90 A;  3G7B A;  1MU5 A;  1U0Z A;  4HZ0 A;  2WI5 A;  2YE4 A;  4CWS A;  4NH8 A;  4PU9 A;  2BU7 A;  1YET A;  1ZXN A;  5IN9 A;  3HYY A;  4HYP A;  4AS9 A;  4EMV A;  3Q5L A;  3G7E A;  1TC6 A;  1EA6 A;  3B26 A;  4MB9 A;  4YKR A;  2YEG A;  2YE9 A;  3OWD A;  2FWZ A;  2CCT A;  4EFT A;  2UWD A;  2QG0 A;  1L0O A;  2WI2 A;  2YE3 A;  3K99 A;  1B63 A;  5FNF A;  1NHI A;  1QYE A;  2O1V A;  2ZDX A; 
#chains in the Genus database with same CATH topology
 2O1U A;  4ZVI A;  5CF0 A;  2CCS A;  1UYH A;  3KE6 A;  4YKU A;  2Q8I A;  2XHR A;  4H7Q A;  3D36 A;  1BXD A;  2BRC A;  1YT1 A;  4FCP A;  3GIE A;  3PEJ A;  3O6O A;  2Q8H A;  5FND A;  5CPH A;  4LP0 A;  2VCJ A;  2JJC A;  4BQG A;  4CE3 A;  4GCZ A;  2H55 A;  5IDM A;  2XJG A;  1Y8P A;  2VW5 A;  4XCL A;  4QPK A;  4K4O A;  1Z5A A;  2HKJ A;  2YEA A;  4EFU A;  3ZKD A;  4EGI A;  1YS3 A;  5M4H A;  2GFD A;  2ESA A;  2XHT A;  4L8Z A;  5CTY A;  1NHH A;  3T2S A;  1TIL A;  3U2D A;  4HY1 A;  1H7S A;  4WUC A;  2YEI A;  2GQP A;  2FXS A;  2FYP A;  1GKZ A;  4I5S A;  3K60 A;  3HZ5 A;  1YC1 A;  5CTW A;  4MOT A;  4JAU A;  1YES A;  1UYE A;  2XCM A;  4LWG A;  1UYC A;  2BU6 A;  1NHJ A;  1B3Q A;  4JAS A;  4NH7 A;  1Y4U A;  3U67 A;  3OWB A;  1ZW9 A;  2E0A A;  3K98 A;  5D6P A;  4WUB A;  2WI7 A;  1YT2 A;  4GEE A;  3VHC A;  3WHA A;  4BXI A;  2YEB A;  1Z5B A;  4MPE A;  5D7R A;  1GJV A;  2QF6 A;  5M4E A;  3RLQ A;  4KSH A;  2BSM A;  1QY8 A;  4DZY A;  2BZ5 A;  3R4O A;  4HY6 A;  4BAE A;  2QFO A;  2AKP A;  1UYF A;  2FWY A;  1ZWH A;  1YSZ A;  2YE2 A;  2YE6 A;  5JEN A;  1S16 A;  3S5T A;  4EGH A;  2XX2 A;  1A4H A;  3CGY A;  3U2K A;  1I5A A;  5C93 A;  3QTF A;  2YEC A;  4LWH A;  5CTU A;  1Y8N A;  5GGZ A;  2YI0 A;  1Z5C A;  2CG9 A;  3B27 A;  1ZXM A;  2XAB A;  4NH9 A;  3H4L A;  4HYM A;  1TC0 A;  4L91 A;  4QPJ A;  4PL9 A;  3O0I A;  3CRL A;  5J71 A;  4MP2 A;  4YKQ A;  4ASA A;  3EHG A;  2YEE A;  3R92 A;  4U7O A;  3WQ9 A;  4E01 A;  2BYH A;  4YKW A;  3CGZ A;  2YI6 A;  1I5D A;  4XKA A;  3ZXO A;  1UYM A;  4V25 A;  4FCR A;  4PRV A;  2BT0 A;  2YKE A;  1AM1 A;  2XHX A;  1BYQ A;  2XD6 A;  3C11 A;  2IOP A;  3PEH A;  3T0H A;  2XDU A;  1F51 A;  4XKK A;  4URO A;  4B7P A;  4LPB A;  1PVG A;  3B25 A;  2WI1 A;  4BIZ A;  2YI7 A;  2YEF A;  4YKX A;  4H85 A;  4CWQ A;  3OMU A;  4U93 A;  4URL A;  1YC3 A;  3MNR P;  3CYG A;  2YE5 A;  4EM7 A;  3TUH A;  2YEJ A;  3T10 A;  3FT5 A;  4XDM A;  2IOR A;  2C1I A;  2HCH A;  2XX5 A;  4HXZ A;  2YKB A;  3C0E A;  2WI4 A;  2WEQ A;  4XC0 A;  5M4N A;  4O04 A;  5BOC A;  1UY9 A;  2WI3 A;  3TTZ A;  1TBW A;  2XJJ A;  3EHJ A;  1IXM A;  3DGE A;  4R3M A;  1EI1 A;  3R4P A;  3ZKB A;  2XK2 A;  1KIJ A;  1Y8O A;  2CH4 A;  3A0X A;  3H80 A;  3R4N A;  4FMT A;  4W7T A;  2C2A A;  1US7 A;  4L94 A;  4ASF A;  4X9L A;  3CRK A;  4BQJ A;  3FT8 A;  2XJX A;  2Q8G A;  2YKC A;  2YK2 A;  2ZKJ A;  1S14 A;  1UYI A;  3A0R A;  5M4P A;  1QZR A;  1Y4S A;  2VWC A;  3ZM7 A;  2HHI A;  2YI5 A;  4KFG A;  1UY7 A;  4HXW A;  3D0B A;  3CWV A;  3GIG A;  3INX A;  4XIT A;  2BU8 A;  3A0T A;  2VCI A;  4YKZ A;  5M4M A;  3GIF A;  2IWX A;  4YKT A;  3TZ5 A;  2C1G A;  4FPP A;  4XTJ A;  2YGF A;  4P7A A;  3VAD A;  1U2O A;  3OW6 A;  4P8O A;  1UYG A;  4B6C A;  4MBC A;  1I58 A;  3B24 A;  3O2F A;  4JQL A;  2YJW A;  2ZBK B;  2IWU A;  4AWQ A;  4KP4 A;  3A0Z A;  4ASG A;  2FTK A;  4EGK A;  1UYD A;  1AH6 A;  2WER A;  4XCJ A;  4KTN A;  2CGF A;  3T0Z A;  2IWS A;  2YK9 A;  1H7U A;  1I5C A;  2Q8F A;  4XIQ A;  1OSF A;  4WUD A;  4HZ5 A;  5J6A A;  4CWP A;  4E02 A;  1MX0 A;  4CWR A;  2EXL A;  4BIU A;  3HZ1 A;  2IOQ A;  4CE1 A;  3ZXQ A;  4CWN A;  4MPC A;  4O0B A;  4CE2 A;  5IDJ A;  2HG1 A;  4GT8 A;  2YE8 A;  1TH8 A;  3BM9 A;  4XKO A;  1ID0 A;  4O07 A;  1UYK A;  4JAV A;  3GIG B;  4O05 A;  2XDL A;  4O09 A;  4GFN A;  3RKZ A;  4ASB A;  4AWP A;  3OPD A;  4MPN A;  1THN A;  3HEK A;  2BU2 A;  3LNU A;  4LWF A;  4E72 A;  4GQT A;  2QG2 A;  4MP7 A;  5L3J A;  4KSG A;  1B62 A;  3TZ0 A;  4R1F A;  1KZN A;  3BMY A;  2JKI A;  3A0W A;  4KQV A;  5D7C A;  2XDX A;  2XDS A;  1GKX A;  2YGE A;  1JM6 A;  4XD8 A;  2H8M A;  2WI6 A;  4ZKI A;  4FCQ A;  4L93 A;  4E00 A;  3LPS A;  2YGA A;  3RLP A;  4CWF A;  1R62 A;  1YSR A;  2WEP A;  3K97 A;  4DUH A;  2YJX A;  2PNR A;  2O1W A;  3EKO A;  5FNC A;  4CWT A;  4URM A;  3HYZ A;  5F5R A;  5M4K A;  1AH8 A;  1BKN A;  1Z59 A;  1UYL A;  2CCU A;  4U7N A;  3HHU A;  1YT0 A;  3LMM A;  2YED A;  2BYI A;  3R91 A;  4CWO A;  3D2R A;  2Q2E B;  4XIP A;  2K5B A;  4PRX A;  4V26 A;  4Q20 A;  4AWO A;  2YEH A;  4I3H A;  4LWI A;  5D7D A;  4EEH A;  1I59 A;  2BRE A;  3TZ4 A;  4GGL A;  1AMW A;  3NMQ A;  3SL2 A;  3Q5J A;  3Q5K A;  3INW A;  1UY8 A;  2XX4 A;  3B28 A;  2XDK A;  1I5B A;  2YE7 A;  3R4M A;  1UY6 A;  2YKI A;  4R3A A;  4YKY A;  3VHD A;  2BTZ A;  5F3K A;  3IED A;  3QDD A;  3T1K A;  3RLR A;  2ZDY A;  2YKJ A;  1BGQ A;  2BU5 A;  3FV5 A;  3TZ2 A;  3JZ3 A;  3EHH A;  4URN A;  5CTX A;  3A0Y A;  5BOD A;  1YC4 A;  3G75 A;  5FWK A;  4LWE A;  1YER A;  4XE2 A;  3EKR A;  4XIR A;  3EHF A;  5D6Q A;  1AJ6 A;  4H81 A;  3VHA A;  1TID A;  4L90 A;  3G7B A;  1MU5 A;  1U0Z A;  4HZ0 A;  2WI5 A;  2YE4 A;  4CWS A;  4NH8 A;  4PU9 A;  2BU7 A;  1YET A;  1ZXN A;  5IN9 A;  3HYY A;  4HYP A;  4AS9 A;  4EMV A;  3Q5L A;  3G7E A;  1TC6 A;  1EA6 A;  3B26 A;  4MB9 A;  4YKR A;  2YEG A;  2YE9 A;  3OWD A;  2FWZ A;  2CCT A;  4EFT A;  2UWD A;  2QG0 A;  1L0O A;  2WI2 A;  2YE3 A;  3K99 A;  1B63 A;  5FNF A;  1NHI A;  1QYE A;  2O1V A;  2ZDX A; 
#chains in the Genus database with same CATH homology
 2O1U A;  4ZVI A;  5CF0 A;  2CCS A;  1UYH A;  3KE6 A;  4YKU A;  2Q8I A;  2XHR A;  4H7Q A;  3D36 A;  1BXD A;  2BRC A;  1YT1 A;  4FCP A;  3GIE A;  3PEJ A;  3O6O A;  2Q8H A;  5FND A;  5CPH A;  4LP0 A;  2VCJ A;  2JJC A;  4BQG A;  4CE3 A;  4GCZ A;  2H55 A;  5IDM A;  2XJG A;  1Y8P A;  2VW5 A;  4XCL A;  4QPK A;  4K4O A;  1Z5A A;  2HKJ A;  2YEA A;  4EFU A;  3ZKD A;  4EGI A;  1YS3 A;  5M4H A;  2GFD A;  2ESA A;  2XHT A;  4L8Z A;  5CTY A;  1NHH A;  3T2S A;  1TIL A;  3U2D A;  4HY1 A;  1H7S A;  4WUC A;  2YEI A;  2GQP A;  2FXS A;  2FYP A;  1GKZ A;  4I5S A;  3K60 A;  3HZ5 A;  1YC1 A;  5CTW A;  4MOT A;  4JAU A;  1YES A;  1UYE A;  2XCM A;  4LWG A;  1UYC A;  2BU6 A;  1NHJ A;  1B3Q A;  4JAS A;  4NH7 A;  1Y4U A;  3U67 A;  3OWB A;  1ZW9 A;  2E0A A;  3K98 A;  5D6P A;  4WUB A;  2WI7 A;  1YT2 A;  4GEE A;  3VHC A;  3WHA A;  4BXI A;  2YEB A;  1Z5B A;  4MPE A;  5D7R A;  1GJV A;  2QF6 A;  5M4E A;  3RLQ A;  4KSH A;  2BSM A;  1QY8 A;  4DZY A;  2BZ5 A;  3R4O A;  4HY6 A;  4BAE A;  2QFO A;  2AKP A;  1UYF A;  2FWY A;  1ZWH A;  1YSZ A;  2YE2 A;  2YE6 A;  1S16 A;  4EGH A;  2XX2 A;  1A4H A;  3CGY A;  3U2K A;  1I5A A;  5C93 A;  3QTF A;  2YEC A;  4LWH A;  5CTU A;  1Y8N A;  5GGZ A;  2YI0 A;  1Z5C A;  2CG9 A;  3B27 A;  1ZXM A;  2XAB A;  4NH9 A;  3H4L A;  4HYM A;  1TC0 A;  4L91 A;  4QPJ A;  4PL9 A;  3O0I A;  3CRL A;  5J71 A;  4MP2 A;  4YKQ A;  4ASA A;  3EHG A;  2YEE A;  3R92 A;  4U7O A;  3WQ9 A;  4E01 A;  2BYH A;  4YKW A;  3CGZ A;  2YI6 A;  1I5D A;  4XKA A;  3ZXO A;  1UYM A;  4V25 A;  4FCR A;  4PRV A;  2BT0 A;  2YKE A;  1AM1 A;  2XHX A;  1BYQ A;  2XD6 A;  3C11 A;  2IOP A;  3PEH A;  3T0H A;  2XDU A;  4XKK A;  4URO A;  4B7P A;  4LPB A;  1PVG A;  3B25 A;  2WI1 A;  4BIZ A;  2YI7 A;  2YEF A;  4YKX A;  4H85 A;  4CWQ A;  3OMU A;  4U93 A;  4URL A;  1YC3 A;  3MNR P;  2YE5 A;  4EM7 A;  3TUH A;  2YEJ A;  3T10 A;  3FT5 A;  4XDM A;  2IOR A;  2HCH A;  2XX5 A;  4HXZ A;  2YKB A;  3C0E A;  2WI4 A;  2WEQ A;  4XC0 A;  5M4N A;  4O04 A;  5BOC A;  1UY9 A;  2WI3 A;  3TTZ A;  1TBW A;  2XJJ A;  3EHJ A;  3DGE A;  4R3M A;  1EI1 A;  3R4P A;  3ZKB A;  2XK2 A;  1KIJ A;  1Y8O A;  2CH4 A;  3A0X A;  3H80 A;  3R4N A;  4FMT A;  4W7T A;  2C2A A;  1US7 A;  4L94 A;  4ASF A;  4X9L A;  3CRK A;  4BQJ A;  3FT8 A;  2XJX A;  2Q8G A;  2YKC A;  2YK2 A;  2ZKJ A;  1S14 A;  1UYI A;  3A0R A;  5M4P A;  1QZR A;  1Y4S A;  2VWC A;  3ZM7 A;  2YI5 A;  4KFG A;  1UY7 A;  4HXW A;  3D0B A;  3CWV A;  3GIG A;  3INX A;  4XIT A;  2BU8 A;  3A0T A;  2VCI A;  4YKZ A;  5M4M A;  3GIF A;  2IWX A;  4YKT A;  3TZ5 A;  4FPP A;  4XTJ A;  2YGF A;  4P7A A;  3VAD A;  1U2O A;  3OW6 A;  4P8O A;  1UYG A;  4B6C A;  4MBC A;  1I58 A;  3B24 A;  3O2F A;  4JQL A;  2YJW A;  2ZBK B;  2IWU A;  4AWQ A;  4KP4 A;  3A0Z A;  4ASG A;  4EGK A;  1UYD A;  1AH6 A;  2WER A;  4XCJ A;  4KTN A;  2CGF A;  3T0Z A;  2IWS A;  2YK9 A;  1H7U A;  1I5C A;  2Q8F A;  4XIQ A;  1OSF A;  4WUD A;  4HZ5 A;  5J6A A;  4CWP A;  4E02 A;  1MX0 A;  4CWR A;  2EXL A;  4BIU A;  3HZ1 A;  2IOQ A;  4CE1 A;  3ZXQ A;  4CWN A;  4MPC A;  4O0B A;  4CE2 A;  5IDJ A;  2HG1 A;  4GT8 A;  2YE8 A;  1TH8 A;  3BM9 A;  4XKO A;  1ID0 A;  4O07 A;  1UYK A;  4JAV A;  3GIG B;  4O05 A;  2XDL A;  4O09 A;  4GFN A;  3RKZ A;  4ASB A;  4AWP A;  3OPD A;  4MPN A;  1THN A;  3HEK A;  2BU2 A;  3LNU A;  4LWF A;  4GQT A;  2QG2 A;  4MP7 A;  5L3J A;  4KSG A;  1B62 A;  3TZ0 A;  4R1F A;  1KZN A;  3BMY A;  2JKI A;  3A0W A;  4KQV A;  5D7C A;  2XDX A;  2XDS A;  1GKX A;  2YGE A;  1JM6 A;  4XD8 A;  2H8M A;  2WI6 A;  4ZKI A;  4FCQ A;  4L93 A;  4E00 A;  3LPS A;  2YGA A;  3RLP A;  4CWF A;  1R62 A;  1YSR A;  2WEP A;  3K97 A;  4DUH A;  2YJX A;  2PNR A;  2O1W A;  3EKO A;  5FNC A;  4CWT A;  4URM A;  3HYZ A;  5F5R A;  5M4K A;  1AH8 A;  1BKN A;  1Z59 A;  1UYL A;  2CCU A;  4U7N A;  3HHU A;  1YT0 A;  2YED A;  2BYI A;  3R91 A;  4CWO A;  3D2R A;  2Q2E B;  4XIP A;  2K5B A;  4PRX A;  4V26 A;  4Q20 A;  4AWO A;  2YEH A;  4I3H A;  4LWI A;  5D7D A;  4EEH A;  1I59 A;  2BRE A;  3TZ4 A;  4GGL A;  1AMW A;  3NMQ A;  3SL2 A;  3Q5J A;  3Q5K A;  3INW A;  1UY8 A;  2XX4 A;  3B28 A;  2XDK A;  1I5B A;  2YE7 A;  3R4M A;  1UY6 A;  2YKI A;  4R3A A;  4YKY A;  3VHD A;  2BTZ A;  5F3K A;  3IED A;  3QDD A;  3T1K A;  3RLR A;  2ZDY A;  2YKJ A;  1BGQ A;  2BU5 A;  3FV5 A;  3TZ2 A;  3JZ3 A;  3EHH A;  4URN A;  5CTX A;  3A0Y A;  5BOD A;  1YC4 A;  3G75 A;  5FWK A;  4LWE A;  1YER A;  4XE2 A;  3EKR A;  4XIR A;  3EHF A;  5D6Q A;  1AJ6 A;  4H81 A;  3VHA A;  1TID A;  4L90 A;  3G7B A;  1MU5 A;  1U0Z A;  4HZ0 A;  2WI5 A;  2YE4 A;  4CWS A;  4NH8 A;  4PU9 A;  2BU7 A;  1YET A;  1ZXN A;  5IN9 A;  3HYY A;  4HYP A;  4AS9 A;  4EMV A;  3Q5L A;  3G7E A;  1TC6 A;  1EA6 A;  3B26 A;  4MB9 A;  4YKR A;  2YEG A;  2YE9 A;  3OWD A;  2FWZ A;  2CCT A;  4EFT A;  2UWD A;  2QG0 A;  1L0O A;  2WI2 A;  2YE3 A;  3K99 A;  1B63 A;  5FNF A;  1NHI A;  1QYE A;  2O1V A;  2ZDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...