1U2OA

Crystal structure of the n-domain of grp94 lacking the charged domain in complex with neca
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
236
structure length
226
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQESTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal domain of GRP94. Basis for ligand specificity and regulation
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 66
structure length 226
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1u2oA00
5D7DA 2ZKJA 1H7UA 4H85A 1Y4SA 4GFNA 3QTFA 2CCUA 1BYQA 2YK2A 4H81A 4XE2A 3Q5LA 4P8OA 4MPCA 3QDDA 3Q5KA 4CE1A 4E00A 4ZKIA 1GKZA 2BU6A 1UYDA 1U2OA 4YKXA 2YE4A 1S14A 4L90A 4JAVA 5CTXA 2IOQA 2O1WA 4P7AA 1NHJA 4O07A 2O1UA 4EGIA 3T1KA 3GIGA 3A0TA 3EKOA 4H7QA 4HY1A 4EFTA 1BKNA 2FWZA 4HXZA 4L94A 1UYLA 1PVGA 4DZYA 3A0RA 2YKEA 2WI3A 4XITA 2XDLA 5CTYA 3R92A 4CE3A 4X9LA 3VHDA 2YEBA 2BRCA 2WI4A 2Q8IA 2YGAA 3C0EA 3D0BA 2YGEA 3RLQA 2BU5A 5BODA 1OSFA 4B7PA 4WUCA 2YKIA 5CF0A 3B25A 3GIFA 2K5BA 4U93A 2YI0A 3SL2A 1MX0A 2YEGA 2IWUA 4CE2A 3OWBA 4NH8A 3WHAA 4O04A 3HHUA 4KSHA 1I5BA 2Q2EB 4V26A 3A0XA 3FT5A 1GKXA 1UYGA 1YERA 2YEIA 3EHHA 2XJGA 3VHCA 2AKPA 3C11A 4ASGA 4B6CA 3O2FA 1KIJA 4LWGA 4QPKA 4YKTA 3R4PA 4O0BA 1YT1A 2WI1A 3PEHA 1TBWA 3GIEA 1Z5AA 4O09A 2XDSA 4JAUA 1Y8OA 1AMWA 3LPSA 4YKZA 2FYPA 3R4MA 4XKOA 1AH8A 4KP4A 1EI1A 4LWHA 5M4HA 2YEDA 4URMA 2YE7A 4HYMA 4MP7A 4AS9A 2CCSA 4E01A 4JQLA 2YE8A 2BU7A 4JASA 2XX4A 2XDXA 3B28A 4XD8A 1TC6A 4MBCA 4MOTA 1UYKA 2YE6A 1YT0A 1QZRA 2XDKA 3D2RA 3O0IA 3TZ4A 4MP2A 4EM7A 4U7OA 4YKWA 4FCQA 3CRLA 1YS3A 3K99A 4XIRA 3HYYA 4YKRA 3K97A 4I3HA 3D36A 2Q8HA 4BQGA 4KTNA 2FXSA 1A4HA 4KQVA 4CWOA 2FWYA 4HZ0A 4FPPA 5FNFA 4XIPA 1Y8NA 3K98A 2ESAA 4LPBA 5F5RA 4BXIA 2BYHA 5GGZA 2CG9A 3T10A 1ID0A 4MPEA 2XCMA 1I5CA 2IWXA 4ASFA 3TZ5A 1TH8A 2XJJA 2YK9A 2WI7A 1I58A 4R1FA 5CPHA 1UYCA 4HZ5A 2XD6A 4CWTA 4CWNA 2YECA 2YJXA 1US7A 4FMTA 2QG2A 1QY8A 1ZW9A 2BU2A 3A0YA 3EKRA 3A0ZA 4CWQA 4W7TA 1H7SA 4ASBA 5D6PA 3OMUA 2EXLA 4YKYA 3G7BA 3ZKBA 1NHHA 1TC0A 1ZWHA 4U7NA 4L93A 3B27A 2IOPA 2WI6A 4URLA 4E02A 2GFDA 2YI7A 1ZXMA 2QG0A 3CWVA 4Q20A 1UYFA 3DGEA 1YSRA 1JM6A 4XTJA 3CRKA 1AH6A 1Z59A 5M4PA 3OW6A 4EEHA 5J6AA 4FCRA 3FV5A 4BIZA 4EGHA 2CCTA 1BXDA 2UWDA 3T2SA 5CTWA 5FNDA 4BAEA 4L8ZA 4HYPA 4CWFA 3R4NA 3R91A 3VHAA 4XCLA 1AJ6A 2E0AA 2IORA 1GJVA 1YT2A 3INXA 2BU8A 1UYIA 4AWQA 5M4KA 1S16A 2VCIA 4PRXA 1B62A 5IN9A 4V25A 1YC3A 3MNRP 1BGQA 3Q5JA 2Q8GA 1R62A 3CGZA 4KFGA 3EHGA 2XHTA 2C2AA 3KE6A 4BQJA 3HEKA 4I5SA 3A0WA 2BZ5A 3VADA 3B26A 1YC1A 1U0ZA 2WI5A 3O6OA 4YKQA 2BYIA 5D7CA 2PNRA 3H4LA 4LWEA 2Q8FA 4BIUA 3HZ5A 3IEDA 2GQPA 1UY9A 2WI2A 3EHFA 3G7EA 1B63A 4PU9A 3ZXOA 2CGFA 4EGKA 2XX5A 4XKKA 3T0HA 4LWFA 1B3QA 5CTUA 2JJCA 4LWIA 4FCPA 4GCZA 2YE5A 3GIGB 4NH9A 3TZ2A 2YKCA 2WEQA 2YE3A 4MPNA 2O1VA 4DUHA 1NHIA 4GQTA 1QYEA 2IWSA 4PRVA 4L91A 5F3KA 4HY6A 4AWOA 2H8MA 5M4EA 5IDMA 2YI6A 2YEEA 2BSMA 2YE2A 3G75A 1UYHA 4PL9A 4R3AA 1UY8A 3OPDA 1UYMA 3TZ0A 2YEHA 3INWA 4LP0A 2YEJA 2CH4A 3R4OA 2H55A 3RLRA 4R3MA 2BTZA 5J71A 3TTZA 4GEEA 4WUDA 2JKIA 2XHXA 3EHJA 3BM9A 2YJWA 1EA6A 2XK2A 3BMYA 2QF6A 2ZDXA 5L3JA 2QFOA 1MU5A 3LNUA 3ZKDA 1THNA 4WUBA 3JZ3A 3K60A 2BT0A 1ZXNA 4XKAA 4XIQA 4AWPA 1Y4UA 5FNCA 3OWDA 4HXWA 3U2KA 2ZDYA 1KZNA 3RLPA 1YSZA 1UY6A 2WEPA 2VCJA 2YKBA 1I5AA 4EFUA 4K4OA 4UROA 4CWSA 2HKJA 2VW5A 5D7RA 1I59A 1L0OA 3B24A 1YETA 4KSGA 2XHRA 1YESA 1TIDA 5C93A 5BOCA 1UY7A 3H80A 4MB9A 4EMVA 3PEJA 4GGLA 4XC0A 3WQ9A 2XABA 4URNA 3NMQA 2XJXA 3RKZA 2BREA 2YKJA 4NH7A 3U2DA 3U67A 1Z5CA 5D6QA 2VWCA 4XCJA 5IDJA 5M4MA 4O05A 3T0ZA 4CWPA 2XX2A 3CGYA 4ZVIA 2YEAA 5M4NA 3TUHA 1AM1A 4QPJA 2ZBKB 4YKUA 1Z5BA 1I5DA 1TILA 2YI5A 4GT8A 3ZXQA 1Y8PA 1YC4A 2XDUA 2YE9A 4ASAA 4CWRA 4XDMA 2WERA 5FWKA 2HCHA 2HG1A 3FT8A 1UYEA 2YGFA 3HZ1A 3ZM7A 3HYZA 2YEFA
chains in the Genus database with same CATH superfamily
5D7DA 2ZKJA 1F51A 1H7UA 4H85A 1Y4SA 4GFNA 3QTFA 2CCUA 1BYQA 2YK2A 4H81A 4XE2A 3Q5LA 4P8OA 4MPCA 3QDDA 3Q5KA 4CE1A 4E00A 4ZKIA 1GKZA 2BU6A 1UYDA 3S5TA 1U2OA 4YKXA 2YE4A 1S14A 4L90A 4JAVA 5CTXA 2C1IA 2IOQA 2O1WA 4P7AA 1NHJA 4O07A 2O1UA 4EGIA 3T1KA 3GIGA 3A0TA 3EKOA 4H7QA 4HY1A 4EFTA 1BKNA 2FWZA 4HXZA 4L94A 1UYLA 1PVGA 4DZYA 3A0RA 2YKEA 2WI3A 4XITA 2XDLA 5CTYA 3R92A 4CE3A 4X9LA 3VHDA 2YEBA 2BRCA 2WI4A 2Q8IA 2YGAA 3C0EA 3D0BA 5JENA 2YGEA 3RLQA 2BU5A 5BODA 1OSFA 4B7PA 4WUCA 2YKIA 5CF0A 3B25A 3GIFA 2K5BA 4U93A 2YI0A 3SL2A 1MX0A 2YEGA 2IWUA 4CE2A 3OWBA 3CYGA 4NH8A 3WHAA 4O04A 3HHUA 4KSHA 1I5BA 2Q2EB 4V26A 3A0XA 3FT5A 1GKXA 1UYGA 1YERA 2YEIA 3EHHA 2XJGA 3VHCA 2AKPA 3C11A 4ASGA 4B6CA 3O2FA 1KIJA 4LWGA 4QPKA 4YKTA 3R4PA 4O0BA 1YT1A 2WI1A 3PEHA 1TBWA 3GIEA 1Z5AA 4O09A 2XDSA 4JAUA 1Y8OA 1AMWA 3LPSA 4YKZA 2FYPA 3R4MA 4XKOA 1AH8A 4KP4A 1EI1A 4LWHA 5M4HA 2YEDA 4URMA 2YE7A 4HYMA 4MP7A 2C1GA 4AS9A 2CCSA 4E01A 4JQLA 2YE8A 2BU7A 4JASA 2XX4A 2XDXA 3B28A 4XD8A 1TC6A 4MBCA 4MOTA 1UYKA 2YE6A 1YT0A 1QZRA 2XDKA 3D2RA 3O0IA 3TZ4A 4MP2A 4EM7A 4U7OA 4YKWA 4FCQA 3CRLA 1YS3A 3K99A 4XIRA 3HYYA 4YKRA 3K97A 4I3HA 3D36A 2Q8HA 4BQGA 4KTNA 2FXSA 1A4HA 4KQVA 4CWOA 2FWYA 4HZ0A 4FPPA 5FNFA 4XIPA 1Y8NA 3K98A 2ESAA 4LPBA 5F5RA 4BXIA 2BYHA 5GGZA 2CG9A 3T10A 1ID0A 4MPEA 2XCMA 1I5CA 2IWXA 4ASFA 3TZ5A 1TH8A 2XJJA 2YK9A 2WI7A 1I58A 4R1FA 5CPHA 1UYCA 4HZ5A 2XD6A 4CWTA 4CWNA 2YECA 2YJXA 1US7A 4FMTA 2QG2A 1QY8A 1ZW9A 2BU2A 3A0YA 3EKRA 3A0ZA 4CWQA 4W7TA 1H7SA 4ASBA 5D6PA 3OMUA 2EXLA 4YKYA 3G7BA 3ZKBA 1NHHA 1TC0A 1ZWHA 4U7NA 4L93A 3B27A 2IOPA 2WI6A 4URLA 4E02A 2GFDA 2YI7A 1ZXMA 2QG0A 3CWVA 4Q20A 1UYFA 3DGEA 1YSRA 1JM6A 4XTJA 3CRKA 1AH6A 1Z59A 5M4PA 3OW6A 4EEHA 5J6AA 4FCRA 3FV5A 4BIZA 4EGHA 2CCTA 1BXDA 2UWDA 3T2SA 5CTWA 5FNDA 4BAEA 4L8ZA 4HYPA 4CWFA 3R4NA 3R91A 3VHAA 4XCLA 1AJ6A 2E0AA 2IORA 1GJVA 1YT2A 3INXA 2BU8A 1UYIA 4AWQA 5M4KA 1S16A 2VCIA 4PRXA 1B62A 5IN9A 4V25A 1YC3A 3MNRP 1BGQA 3Q5JA 2Q8GA 1R62A 3CGZA 4KFGA 3EHGA 2XHTA 2C2AA 3KE6A 4BQJA 3HEKA 4I5SA 3A0WA 2BZ5A 3VADA 3B26A 1YC1A 1U0ZA 2WI5A 3O6OA 4YKQA 2BYIA 5D7CA 2PNRA 3H4LA 4LWEA 2Q8FA 4BIUA 3HZ5A 3IEDA 2GQPA 1UY9A 2WI2A 3EHFA 3G7EA 1B63A 4PU9A 3ZXOA 2CGFA 4EGKA 2XX5A 4XKKA 3T0HA 4LWFA 1B3QA 5CTUA 2JJCA 4LWIA 4FCPA 4GCZA 2YE5A 3GIGB 4NH9A 3TZ2A 2YKCA 2WEQA 2YE3A 4MPNA 2O1VA 4DUHA 1NHIA 4GQTA 1QYEA 2IWSA 4PRVA 4L91A 3LMMA 5F3KA 4HY6A 4AWOA 2H8MA 5M4EA 5IDMA 2YI6A 2YEEA 2BSMA 2YE2A 3G75A 1UYHA 4PL9A 4R3AA 1UY8A 3OPDA 1UYMA 3TZ0A 2YEHA 3INWA 4LP0A 2YEJA 2CH4A 3R4OA 2H55A 3RLRA 4R3MA 2BTZA 5J71A 3TTZA 4GEEA 4WUDA 2JKIA 2XHXA 2FTKA 3EHJA 3BM9A 2YJWA 1EA6A 2XK2A 3BMYA 2QF6A 2ZDXA 5L3JA 2QFOA 4E72A 1MU5A 3LNUA 3ZKDA 1THNA 4WUBA 3JZ3A 3K60A 2BT0A 1ZXNA 4XKAA 4XIQA 4AWPA 1Y4UA 2HHIA 5FNCA 3OWDA 4HXWA 3U2KA 2ZDYA 1KZNA 3RLPA 1YSZA 1UY6A 2WEPA 2VCJA 2YKBA 1I5AA 4EFUA 4K4OA 4UROA 4CWSA 2HKJA 2VW5A 5D7RA 1IXMA 1I59A 1L0OA 1YETA 3B24A 4KSGA 2XHRA 1YESA 1TIDA 5C93A 5BOCA 1UY7A 3H80A 4MB9A 4EMVA 3PEJA 4GGLA 4XC0A 3WQ9A 2XABA 4URNA 3NMQA 2XJXA 3RKZA 2BREA 2YKJA 4NH7A 3U2DA 3U67A 1Z5CA 5D6QA 2VWCA 4XCJA 5IDJA 5M4MA 4O05A 3T0ZA 4CWPA 2XX2A 3CGYA 4ZVIA 2YEAA 5M4NA 3TUHA 1AM1A 4QPJA 2ZBKB 4YKUA 1Z5BA 1I5DA 1TILA 2YI5A 4GT8A 3ZXQA 1Y8PA 1YC4A 2XDUA 2YE9A 4ASAA 4CWRA 4XDMA 2WERA 5FWKA 2HCHA 2HG1A 3FT8A 1UYEA 2YGFA 3HZ1A 3ZM7A 3HYZA 2YEFA
chains in the Genus database with same CATH topology
5D7DA 2ZKJA 1H7UA 4H85A 1Y4SA 4GFNA 3QTFA 2CCUA 1BYQA 2YK2A 4H81A 4XE2A 3Q5LA 4P8OA 4MPCA 3QDDA 3Q5KA 4CE1A 4E00A 4ZKIA 1GKZA 2BU6A 1UYDA 1U2OA 4YKXA 2YE4A 1S14A 4L90A 4JAVA 5CTXA 2IOQA 2O1WA 4P7AA 1NHJA 4O07A 2O1UA 4EGIA 3T1KA 3GIGA 3A0TA 3EKOA 4H7QA 4HY1A 4EFTA 1BKNA 2FWZA 4HXZA 4L94A 1UYLA 1PVGA 4DZYA 3A0RA 2YKEA 2WI3A 4XITA 2XDLA 5CTYA 3R92A 4CE3A 4X9LA 3VHDA 2YEBA 2BRCA 2WI4A 2Q8IA 2YGAA 3C0EA 3D0BA 2YGEA 3RLQA 2BU5A 5BODA 1OSFA 4B7PA 4WUCA 2YKIA 5CF0A 3B25A 3GIFA 2K5BA 4U93A 2YI0A 3SL2A 1MX0A 2YEGA 2IWUA 4CE2A 3OWBA 4NH8A 3WHAA 4O04A 3HHUA 4KSHA 1I5BA 2Q2EB 4V26A 3A0XA 3FT5A 1GKXA 1UYGA 1YERA 2YEIA 3EHHA 2XJGA 3VHCA 2AKPA 3C11A 4ASGA 4B6CA 3O2FA 1KIJA 4LWGA 4QPKA 4YKTA 3R4PA 4O0BA 1YT1A 2WI1A 3PEHA 1TBWA 3GIEA 1Z5AA 4O09A 2XDSA 4JAUA 1Y8OA 1AMWA 3LPSA 4YKZA 2FYPA 3R4MA 4XKOA 1AH8A 4KP4A 1EI1A 4LWHA 5M4HA 2YEDA 4URMA 2YE7A 4HYMA 4MP7A 4AS9A 2CCSA 4E01A 4JQLA 2YE8A 2BU7A 4JASA 2XX4A 2XDXA 3B28A 4XD8A 1TC6A 4MBCA 4MOTA 1UYKA 2YE6A 1YT0A 1QZRA 2XDKA 3D2RA 3O0IA 3TZ4A 4MP2A 4EM7A 4U7OA 4YKWA 4FCQA 3CRLA 1YS3A 3K99A 4XIRA 3HYYA 4YKRA 3K97A 4I3HA 3D36A 2Q8HA 4BQGA 4KTNA 2FXSA 1A4HA 4KQVA 4CWOA 2FWYA 4HZ0A 4FPPA 5FNFA 4XIPA 1Y8NA 3K98A 2ESAA 4LPBA 5F5RA 4BXIA 2BYHA 5GGZA 2CG9A 3T10A 1ID0A 4MPEA 2XCMA 1I5CA 2IWXA 4ASFA 3TZ5A 1TH8A 2XJJA 2YK9A 2WI7A 1I58A 4R1FA 5CPHA 1UYCA 4HZ5A 2XD6A 4CWTA 4CWNA 2YECA 2YJXA 1US7A 4FMTA 2QG2A 1QY8A 1ZW9A 2BU2A 3A0YA 3EKRA 3A0ZA 4CWQA 4W7TA 1H7SA 4ASBA 5D6PA 3OMUA 2EXLA 4YKYA 3G7BA 3ZKBA 1NHHA 1TC0A 1ZWHA 4U7NA 4L93A 3B27A 2IOPA 2WI6A 4URLA 4E02A 2GFDA 2YI7A 1ZXMA 2QG0A 3CWVA 4Q20A 1UYFA 3DGEA 1YSRA 1JM6A 4XTJA 3CRKA 1AH6A 1Z59A 5M4PA 3OW6A 4EEHA 5J6AA 4FCRA 3FV5A 4BIZA 4EGHA 2CCTA 1BXDA 2UWDA 3T2SA 5CTWA 5FNDA 4BAEA 4L8ZA 4HYPA 4CWFA 3R4NA 3R91A 3VHAA 4XCLA 1AJ6A 2E0AA 2IORA 1GJVA 1YT2A 3INXA 2BU8A 1UYIA 4AWQA 5M4KA 1S16A 2VCIA 4PRXA 1B62A 5IN9A 4V25A 1YC3A 3MNRP 1BGQA 3Q5JA 2Q8GA 1R62A 3CGZA 4KFGA 3EHGA 2XHTA 2C2AA 3KE6A 4BQJA 3HEKA 4I5SA 3A0WA 2BZ5A 3VADA 3B26A 1YC1A 1U0ZA 2WI5A 3O6OA 4YKQA 2BYIA 5D7CA 2PNRA 3H4LA 4LWEA 2Q8FA 4BIUA 3HZ5A 3IEDA 2GQPA 1UY9A 2WI2A 3EHFA 3G7EA 1B63A 4PU9A 3ZXOA 2CGFA 4EGKA 2XX5A 4XKKA 3T0HA 4LWFA 1B3QA 5CTUA 2JJCA 4LWIA 4FCPA 4GCZA 2YE5A 3GIGB 4NH9A 3TZ2A 2YKCA 2WEQA 2YE3A 4MPNA 2O1VA 4DUHA 1NHIA 4GQTA 1QYEA 2IWSA 4PRVA 4L91A 5F3KA 4HY6A 4AWOA 2H8MA 5M4EA 5IDMA 2YI6A 2YEEA 2BSMA 2YE2A 3G75A 1UYHA 4PL9A 4R3AA 1UY8A 3OPDA 1UYMA 3TZ0A 2YEHA 3INWA 4LP0A 2YEJA 2CH4A 3R4OA 2H55A 3RLRA 4R3MA 2BTZA 5J71A 3TTZA 4GEEA 4WUDA 2JKIA 2XHXA 3EHJA 3BM9A 2YJWA 1EA6A 2XK2A 3BMYA 2QF6A 2ZDXA 5L3JA 2QFOA 1MU5A 3LNUA 3ZKDA 1THNA 4WUBA 3JZ3A 3K60A 2BT0A 1ZXNA 4XKAA 4XIQA 4AWPA 1Y4UA 5FNCA 3OWDA 4HXWA 3U2KA 2ZDYA 1KZNA 3RLPA 1YSZA 1UY6A 2WEPA 2VCJA 2YKBA 1I5AA 4EFUA 4K4OA 4UROA 4CWSA 2HKJA 2VW5A 5D7RA 1I59A 1L0OA 3B24A 1YETA 4KSGA 2XHRA 1YESA 1TIDA 5C93A 5BOCA 1UY7A 3H80A 4MB9A 4EMVA 3PEJA 4GGLA 4XC0A 3WQ9A 2XABA 4URNA 3NMQA 2XJXA 3RKZA 2BREA 2YKJA 4NH7A 3U2DA 3U67A 1Z5CA 5D6QA 2VWCA 4XCJA 5IDJA 5M4MA 4O05A 3T0ZA 4CWPA 2XX2A 3CGYA 4ZVIA 2YEAA 5M4NA 3TUHA 1AM1A 4QPJA 2ZBKB 4YKUA 1Z5BA 1I5DA 1TILA 2YI5A 4GT8A 3ZXQA 1Y8PA 1YC4A 2XDUA 2YE9A 4ASAA 4CWRA 4XDMA 2WERA 5FWKA 2HCHA 2HG1A 3FT8A 1UYEA 2YGFA 3HZ1A 3ZM7A 3HYZA 2YEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7D A;  2ZKJ A;  1H7U A;  4H85 A;  1Y4S A;  4GFN A;  3QTF A;  2CCU A;  1BYQ A;  2YK2 A;  4H81 A;  4XE2 A;  3Q5L A;  4P8O A;  4MPC A;  3QDD A;  3Q5K A;  4CE1 A;  4E00 A;  4ZKI A;  1GKZ A;  2BU6 A;  1UYD A;  1U2O A;  4YKX A;  2YE4 A;  1S14 A;  4L90 A;  4JAV A;  5CTX A;  2IOQ A;  2O1W A;  4P7A A;  1NHJ A;  4O07 A;  2O1U A;  4EGI A;  3T1K A;  3GIG A;  3A0T A;  3EKO A;  4H7Q A;  4HY1 A;  4EFT A;  1BKN A;  2FWZ A;  4HXZ A;  4L94 A;  1UYL A;  1PVG A;  4DZY A;  3A0R A;  2YKE A;  2WI3 A;  4XIT A;  2XDL A;  5CTY A;  3R92 A;  4CE3 A;  4X9L A;  3VHD A;  2YEB A;  2BRC A;  2WI4 A;  2Q8I A;  2YGA A;  3C0E A;  3D0B A;  2YGE A;  3RLQ A;  2BU5 A;  5BOD A;  1OSF A;  4B7P A;  4WUC A;  2YKI A;  5CF0 A;  3B25 A;  3GIF A;  2K5B A;  4U93 A;  2YI0 A;  3SL2 A;  1MX0 A;  2YEG A;  2IWU A;  4CE2 A;  3OWB A;  4NH8 A;  3WHA A;  4O04 A;  3HHU A;  4KSH A;  1I5B A;  2Q2E B;  4V26 A;  3A0X A;  3FT5 A;  1GKX A;  1UYG A;  1YER A;  2YEI A;  3EHH A;  2XJG A;  3VHC A;  2AKP A;  3C11 A;  4ASG A;  4B6C A;  3O2F A;  1KIJ A;  4LWG A;  4QPK A;  4YKT A;  3R4P A;  4O0B A;  1YT1 A;  2WI1 A;  3PEH A;  1TBW A;  3GIE A;  1Z5A A;  4O09 A;  2XDS A;  4JAU A;  1Y8O A;  1AMW A;  3LPS A;  4YKZ A;  2FYP A;  3R4M A;  4XKO A;  1AH8 A;  4KP4 A;  1EI1 A;  4LWH A;  5M4H A;  2YED A;  4URM A;  2YE7 A;  4HYM A;  4MP7 A;  4AS9 A;  2CCS A;  4E01 A;  4JQL A;  2YE8 A;  2BU7 A;  4JAS A;  2XX4 A;  2XDX A;  3B28 A;  4XD8 A;  1TC6 A;  4MBC A;  4MOT A;  1UYK A;  2YE6 A;  1YT0 A;  1QZR A;  2XDK A;  3D2R A;  3O0I A;  3TZ4 A;  4MP2 A;  4EM7 A;  4U7O A;  4YKW A;  4FCQ A;  3CRL A;  1YS3 A;  3K99 A;  4XIR A;  3HYY A;  4YKR A;  3K97 A;  4I3H A;  3D36 A;  2Q8H A;  4BQG A;  4KTN A;  2FXS A;  1A4H A;  4KQV A;  4CWO A;  2FWY A;  4HZ0 A;  4FPP A;  5FNF A;  4XIP A;  1Y8N A;  3K98 A;  2ESA A;  4LPB A;  5F5R A;  4BXI A;  2BYH A;  5GGZ A;  2CG9 A;  3T10 A;  1ID0 A;  4MPE A;  2XCM A;  1I5C A;  2IWX A;  4ASF A;  3TZ5 A;  1TH8 A;  2XJJ A;  2YK9 A;  2WI7 A;  1I58 A;  4R1F A;  5CPH A;  1UYC A;  4HZ5 A;  2XD6 A;  4CWT A;  4CWN A;  2YEC A;  2YJX A;  1US7 A;  4FMT A;  2QG2 A;  1QY8 A;  1ZW9 A;  2BU2 A;  3A0Y A;  3EKR A;  3A0Z A;  4CWQ A;  4W7T A;  1H7S A;  4ASB A;  5D6P A;  3OMU A;  2EXL A;  4YKY A;  3G7B A;  3ZKB A;  1NHH A;  1TC0 A;  1ZWH A;  4U7N A;  4L93 A;  3B27 A;  2IOP A;  2WI6 A;  4URL A;  4E02 A;  2GFD A;  2YI7 A;  1ZXM A;  2QG0 A;  3CWV A;  4Q20 A;  1UYF A;  3DGE A;  1YSR A;  1JM6 A;  4XTJ A;  3CRK A;  1AH6 A;  1Z59 A;  5M4P A;  3OW6 A;  4EEH A;  5J6A A;  4FCR A;  3FV5 A;  4BIZ A;  4EGH A;  2CCT A;  1BXD A;  2UWD A;  3T2S A;  5CTW A;  5FND A;  4BAE A;  4L8Z A;  4HYP A;  4CWF A;  3R4N A;  3R91 A;  3VHA A;  4XCL A;  1AJ6 A;  2E0A A;  2IOR A;  1GJV A;  1YT2 A;  3INX A;  2BU8 A;  1UYI A;  4AWQ A;  5M4K A;  1S16 A;  2VCI A;  4PRX A;  1B62 A;  5IN9 A;  4V25 A;  1YC3 A;  3MNR P;  1BGQ A;  3Q5J A;  2Q8G A;  1R62 A;  3CGZ A;  4KFG A;  3EHG A;  2XHT A;  2C2A A;  3KE6 A;  4BQJ A;  3HEK A;  4I5S A;  3A0W A;  2BZ5 A;  3VAD A;  3B26 A;  1YC1 A;  1U0Z A;  2WI5 A;  3O6O A;  4YKQ A;  2BYI A;  5D7C A;  2PNR A;  3H4L A;  4LWE A;  2Q8F A;  4BIU A;  3HZ5 A;  3IED A;  2GQP A;  1UY9 A;  2WI2 A;  3EHF A;  3G7E A;  1B63 A;  4PU9 A;  3ZXO A;  2CGF A;  4EGK A;  2XX5 A;  4XKK A;  3T0H A;  4LWF A;  1B3Q A;  5CTU A;  2JJC A;  4LWI A;  4FCP A;  4GCZ A;  2YE5 A;  3GIG B;  4NH9 A;  3TZ2 A;  2YKC A;  2WEQ A;  2YE3 A;  4MPN A;  2O1V A;  4DUH A;  1NHI A;  4GQT A;  1QYE A;  2IWS A;  4PRV A;  4L91 A;  5F3K A;  4HY6 A;  4AWO A;  2H8M A;  5M4E A;  5IDM A;  2YI6 A;  2YEE A;  2BSM A;  2YE2 A;  3G75 A;  1UYH A;  4PL9 A;  4R3A A;  1UY8 A;  3OPD A;  1UYM A;  3TZ0 A;  2YEH A;  3INW A;  4LP0 A;  2YEJ A;  2CH4 A;  3R4O A;  2H55 A;  3RLR A;  4R3M A;  2BTZ A;  5J71 A;  3TTZ A;  4GEE A;  4WUD A;  2JKI A;  2XHX A;  3EHJ A;  3BM9 A;  2YJW A;  1EA6 A;  2XK2 A;  3BMY A;  2QF6 A;  2ZDX A;  5L3J A;  2QFO A;  1MU5 A;  3LNU A;  3ZKD A;  1THN A;  4WUB A;  3JZ3 A;  3K60 A;  2BT0 A;  1ZXN A;  4XKA A;  4XIQ A;  4AWP A;  1Y4U A;  5FNC A;  3OWD A;  4HXW A;  3U2K A;  2ZDY A;  1KZN A;  3RLP A;  1YSZ A;  1UY6 A;  2WEP A;  2VCJ A;  2YKB A;  1I5A A;  4EFU A;  4K4O A;  4URO A;  4CWS A;  2HKJ A;  2VW5 A;  5D7R A;  1I59 A;  1L0O A;  3B24 A;  1YET A;  4KSG A;  2XHR A;  1YES A;  1TID A;  5C93 A;  5BOC A;  1UY7 A;  3H80 A;  4MB9 A;  4EMV A;  3PEJ A;  4GGL A;  4XC0 A;  3WQ9 A;  2XAB A;  4URN A;  3NMQ A;  2XJX A;  3RKZ A;  2BRE A;  2YKJ A;  4NH7 A;  3U2D A;  3U67 A;  1Z5C A;  5D6Q A;  2VWC A;  4XCJ A;  5IDJ A;  5M4M A;  4O05 A;  3T0Z A;  4CWP A;  2XX2 A;  3CGY A;  4ZVI A;  2YEA A;  5M4N A;  3TUH A;  1AM1 A;  4QPJ A;  2ZBK B;  4YKU A;  1Z5B A;  1I5D A;  1TIL A;  2YI5 A;  4GT8 A;  3ZXQ A;  1Y8P A;  1YC4 A;  2XDU A;  2YE9 A;  4ASA A;  4CWR A;  4XDM A;  2WER A;  5FWK A;  2HCH A;  2HG1 A;  3FT8 A;  1UYE A;  2YGF A;  3HZ1 A;  3ZM7 A;  3HYZ A;  2YEF A; 
#chains in the Genus database with same CATH topology
 5D7D A;  2ZKJ A;  1F51 A;  1H7U A;  4H85 A;  1Y4S A;  4GFN A;  3QTF A;  2CCU A;  1BYQ A;  2YK2 A;  4H81 A;  4XE2 A;  3Q5L A;  4P8O A;  4MPC A;  3QDD A;  3Q5K A;  4CE1 A;  4E00 A;  4ZKI A;  1GKZ A;  2BU6 A;  1UYD A;  3S5T A;  1U2O A;  4YKX A;  2YE4 A;  1S14 A;  4L90 A;  4JAV A;  5CTX A;  2C1I A;  2IOQ A;  2O1W A;  4P7A A;  1NHJ A;  4O07 A;  2O1U A;  4EGI A;  3T1K A;  3GIG A;  3A0T A;  3EKO A;  4H7Q A;  4HY1 A;  4EFT A;  1BKN A;  2FWZ A;  4HXZ A;  4L94 A;  1UYL A;  1PVG A;  4DZY A;  3A0R A;  2YKE A;  2WI3 A;  4XIT A;  2XDL A;  5CTY A;  3R92 A;  4CE3 A;  4X9L A;  3VHD A;  2YEB A;  2BRC A;  2WI4 A;  2Q8I A;  2YGA A;  3C0E A;  3D0B A;  5JEN A;  2YGE A;  3RLQ A;  2BU5 A;  5BOD A;  1OSF A;  4B7P A;  4WUC A;  2YKI A;  5CF0 A;  3B25 A;  3GIF A;  2K5B A;  4U93 A;  2YI0 A;  3SL2 A;  1MX0 A;  2YEG A;  2IWU A;  4CE2 A;  3OWB A;  3CYG A;  4NH8 A;  3WHA A;  4O04 A;  3HHU A;  4KSH A;  1I5B A;  2Q2E B;  4V26 A;  3A0X A;  3FT5 A;  1GKX A;  1UYG A;  1YER A;  2YEI A;  3EHH A;  2XJG A;  3VHC A;  2AKP A;  3C11 A;  4ASG A;  4B6C A;  3O2F A;  1KIJ A;  4LWG A;  4QPK A;  4YKT A;  3R4P A;  4O0B A;  1YT1 A;  2WI1 A;  3PEH A;  1TBW A;  3GIE A;  1Z5A A;  4O09 A;  2XDS A;  4JAU A;  1Y8O A;  1AMW A;  3LPS A;  4YKZ A;  2FYP A;  3R4M A;  4XKO A;  1AH8 A;  4KP4 A;  1EI1 A;  4LWH A;  5M4H A;  2YED A;  4URM A;  2YE7 A;  4HYM A;  4MP7 A;  2C1G A;  4AS9 A;  2CCS A;  4E01 A;  4JQL A;  2YE8 A;  2BU7 A;  4JAS A;  2XX4 A;  2XDX A;  3B28 A;  4XD8 A;  1TC6 A;  4MBC A;  4MOT A;  1UYK A;  2YE6 A;  1YT0 A;  1QZR A;  2XDK A;  3D2R A;  3O0I A;  3TZ4 A;  4MP2 A;  4EM7 A;  4U7O A;  4YKW A;  4FCQ A;  3CRL A;  1YS3 A;  3K99 A;  4XIR A;  3HYY A;  4YKR A;  3K97 A;  4I3H A;  3D36 A;  2Q8H A;  4BQG A;  4KTN A;  2FXS A;  1A4H A;  4KQV A;  4CWO A;  2FWY A;  4HZ0 A;  4FPP A;  5FNF A;  4XIP A;  1Y8N A;  3K98 A;  2ESA A;  4LPB A;  5F5R A;  4BXI A;  2BYH A;  5GGZ A;  2CG9 A;  3T10 A;  1ID0 A;  4MPE A;  2XCM A;  1I5C A;  2IWX A;  4ASF A;  3TZ5 A;  1TH8 A;  2XJJ A;  2YK9 A;  2WI7 A;  1I58 A;  4R1F A;  5CPH A;  1UYC A;  4HZ5 A;  2XD6 A;  4CWT A;  4CWN A;  2YEC A;  2YJX A;  1US7 A;  4FMT A;  2QG2 A;  1QY8 A;  1ZW9 A;  2BU2 A;  3A0Y A;  3EKR A;  3A0Z A;  4CWQ A;  4W7T A;  1H7S A;  4ASB A;  5D6P A;  3OMU A;  2EXL A;  4YKY A;  3G7B A;  3ZKB A;  1NHH A;  1TC0 A;  1ZWH A;  4U7N A;  4L93 A;  3B27 A;  2IOP A;  2WI6 A;  4URL A;  4E02 A;  2GFD A;  2YI7 A;  1ZXM A;  2QG0 A;  3CWV A;  4Q20 A;  1UYF A;  3DGE A;  1YSR A;  1JM6 A;  4XTJ A;  3CRK A;  1AH6 A;  1Z59 A;  5M4P A;  3OW6 A;  4EEH A;  5J6A A;  4FCR A;  3FV5 A;  4BIZ A;  4EGH A;  2CCT A;  1BXD A;  2UWD A;  3T2S A;  5CTW A;  5FND A;  4BAE A;  4L8Z A;  4HYP A;  4CWF A;  3R4N A;  3R91 A;  3VHA A;  4XCL A;  1AJ6 A;  2E0A A;  2IOR A;  1GJV A;  1YT2 A;  3INX A;  2BU8 A;  1UYI A;  4AWQ A;  5M4K A;  1S16 A;  2VCI A;  4PRX A;  1B62 A;  5IN9 A;  4V25 A;  1YC3 A;  3MNR P;  1BGQ A;  3Q5J A;  2Q8G A;  1R62 A;  3CGZ A;  4KFG A;  3EHG A;  2XHT A;  2C2A A;  3KE6 A;  4BQJ A;  3HEK A;  4I5S A;  3A0W A;  2BZ5 A;  3VAD A;  3B26 A;  1YC1 A;  1U0Z A;  2WI5 A;  3O6O A;  4YKQ A;  2BYI A;  5D7C A;  2PNR A;  3H4L A;  4LWE A;  2Q8F A;  4BIU A;  3HZ5 A;  3IED A;  2GQP A;  1UY9 A;  2WI2 A;  3EHF A;  3G7E A;  1B63 A;  4PU9 A;  3ZXO A;  2CGF A;  4EGK A;  2XX5 A;  4XKK A;  3T0H A;  4LWF A;  1B3Q A;  5CTU A;  2JJC A;  4LWI A;  4FCP A;  4GCZ A;  2YE5 A;  3GIG B;  4NH9 A;  3TZ2 A;  2YKC A;  2WEQ A;  2YE3 A;  4MPN A;  2O1V A;  4DUH A;  1NHI A;  4GQT A;  1QYE A;  2IWS A;  4PRV A;  4L91 A;  3LMM A;  5F3K A;  4HY6 A;  4AWO A;  2H8M A;  5M4E A;  5IDM A;  2YI6 A;  2YEE A;  2BSM A;  2YE2 A;  3G75 A;  1UYH A;  4PL9 A;  4R3A A;  1UY8 A;  3OPD A;  1UYM A;  3TZ0 A;  2YEH A;  3INW A;  4LP0 A;  2YEJ A;  2CH4 A;  3R4O A;  2H55 A;  3RLR A;  4R3M A;  2BTZ A;  5J71 A;  3TTZ A;  4GEE A;  4WUD A;  2JKI A;  2XHX A;  2FTK A;  3EHJ A;  3BM9 A;  2YJW A;  1EA6 A;  2XK2 A;  3BMY A;  2QF6 A;  2ZDX A;  5L3J A;  2QFO A;  4E72 A;  1MU5 A;  3LNU A;  3ZKD A;  1THN A;  4WUB A;  3JZ3 A;  3K60 A;  2BT0 A;  1ZXN A;  4XKA A;  4XIQ A;  4AWP A;  1Y4U A;  2HHI A;  5FNC A;  3OWD A;  4HXW A;  3U2K A;  2ZDY A;  1KZN A;  3RLP A;  1YSZ A;  1UY6 A;  2WEP A;  2VCJ A;  2YKB A;  1I5A A;  4EFU A;  4K4O A;  4URO A;  4CWS A;  2HKJ A;  2VW5 A;  5D7R A;  1IXM A;  1I59 A;  1L0O A;  1YET A;  3B24 A;  4KSG A;  2XHR A;  1YES A;  1TID A;  5C93 A;  5BOC A;  1UY7 A;  3H80 A;  4MB9 A;  4EMV A;  3PEJ A;  4GGL A;  4XC0 A;  3WQ9 A;  2XAB A;  4URN A;  3NMQ A;  2XJX A;  3RKZ A;  2BRE A;  2YKJ A;  4NH7 A;  3U2D A;  3U67 A;  1Z5C A;  5D6Q A;  2VWC A;  4XCJ A;  5IDJ A;  5M4M A;  4O05 A;  3T0Z A;  4CWP A;  2XX2 A;  3CGY A;  4ZVI A;  2YEA A;  5M4N A;  3TUH A;  1AM1 A;  4QPJ A;  2ZBK B;  4YKU A;  1Z5B A;  1I5D A;  1TIL A;  2YI5 A;  4GT8 A;  3ZXQ A;  1Y8P A;  1YC4 A;  2XDU A;  2YE9 A;  4ASA A;  4CWR A;  4XDM A;  2WER A;  5FWK A;  2HCH A;  2HG1 A;  3FT8 A;  1UYE A;  2YGF A;  3HZ1 A;  3ZM7 A;  3HYZ A;  2YEF A; 
#chains in the Genus database with same CATH homology
 5D7D A;  2ZKJ A;  1H7U A;  4H85 A;  1Y4S A;  4GFN A;  3QTF A;  2CCU A;  1BYQ A;  2YK2 A;  4H81 A;  4XE2 A;  3Q5L A;  4P8O A;  4MPC A;  3QDD A;  3Q5K A;  4CE1 A;  4E00 A;  4ZKI A;  1GKZ A;  2BU6 A;  1UYD A;  1U2O A;  4YKX A;  2YE4 A;  1S14 A;  4L90 A;  4JAV A;  5CTX A;  2IOQ A;  2O1W A;  4P7A A;  1NHJ A;  4O07 A;  2O1U A;  4EGI A;  3T1K A;  3GIG A;  3A0T A;  3EKO A;  4H7Q A;  4HY1 A;  4EFT A;  1BKN A;  2FWZ A;  4HXZ A;  4L94 A;  1UYL A;  1PVG A;  4DZY A;  3A0R A;  2YKE A;  2WI3 A;  4XIT A;  2XDL A;  5CTY A;  3R92 A;  4CE3 A;  4X9L A;  3VHD A;  2YEB A;  2BRC A;  2WI4 A;  2Q8I A;  2YGA A;  3C0E A;  3D0B A;  2YGE A;  3RLQ A;  2BU5 A;  5BOD A;  1OSF A;  4B7P A;  4WUC A;  2YKI A;  5CF0 A;  3B25 A;  3GIF A;  2K5B A;  4U93 A;  2YI0 A;  3SL2 A;  1MX0 A;  2YEG A;  2IWU A;  4CE2 A;  3OWB A;  4NH8 A;  3WHA A;  4O04 A;  3HHU A;  4KSH A;  1I5B A;  2Q2E B;  4V26 A;  3A0X A;  3FT5 A;  1GKX A;  1UYG A;  1YER A;  2YEI A;  3EHH A;  2XJG A;  3VHC A;  2AKP A;  3C11 A;  4ASG A;  4B6C A;  3O2F A;  1KIJ A;  4LWG A;  4QPK A;  4YKT A;  3R4P A;  4O0B A;  1YT1 A;  2WI1 A;  3PEH A;  1TBW A;  3GIE A;  1Z5A A;  4O09 A;  2XDS A;  4JAU A;  1Y8O A;  1AMW A;  3LPS A;  4YKZ A;  2FYP A;  3R4M A;  4XKO A;  1AH8 A;  4KP4 A;  1EI1 A;  4LWH A;  5M4H A;  2YED A;  4URM A;  2YE7 A;  4HYM A;  4MP7 A;  4AS9 A;  2CCS A;  4E01 A;  4JQL A;  2YE8 A;  2BU7 A;  4JAS A;  2XX4 A;  2XDX A;  3B28 A;  4XD8 A;  1TC6 A;  4MBC A;  4MOT A;  1UYK A;  2YE6 A;  1YT0 A;  1QZR A;  2XDK A;  3D2R A;  3O0I A;  3TZ4 A;  4MP2 A;  4EM7 A;  4U7O A;  4YKW A;  4FCQ A;  3CRL A;  1YS3 A;  3K99 A;  4XIR A;  3HYY A;  4YKR A;  3K97 A;  4I3H A;  3D36 A;  2Q8H A;  4BQG A;  4KTN A;  2FXS A;  1A4H A;  4KQV A;  4CWO A;  2FWY A;  4HZ0 A;  4FPP A;  5FNF A;  4XIP A;  1Y8N A;  3K98 A;  2ESA A;  4LPB A;  5F5R A;  4BXI A;  2BYH A;  5GGZ A;  2CG9 A;  3T10 A;  1ID0 A;  4MPE A;  2XCM A;  1I5C A;  2IWX A;  4ASF A;  3TZ5 A;  1TH8 A;  2XJJ A;  2YK9 A;  2WI7 A;  1I58 A;  4R1F A;  5CPH A;  1UYC A;  4HZ5 A;  2XD6 A;  4CWT A;  4CWN A;  2YEC A;  2YJX A;  1US7 A;  4FMT A;  2QG2 A;  1QY8 A;  1ZW9 A;  2BU2 A;  3A0Y A;  3EKR A;  3A0Z A;  4CWQ A;  4W7T A;  1H7S A;  4ASB A;  5D6P A;  3OMU A;  2EXL A;  4YKY A;  3G7B A;  3ZKB A;  1NHH A;  1TC0 A;  1ZWH A;  4U7N A;  4L93 A;  3B27 A;  2IOP A;  2WI6 A;  4URL A;  4E02 A;  2GFD A;  2YI7 A;  1ZXM A;  2QG0 A;  3CWV A;  4Q20 A;  1UYF A;  3DGE A;  1YSR A;  1JM6 A;  4XTJ A;  3CRK A;  1AH6 A;  1Z59 A;  5M4P A;  3OW6 A;  4EEH A;  5J6A A;  4FCR A;  3FV5 A;  4BIZ A;  4EGH A;  2CCT A;  1BXD A;  2UWD A;  3T2S A;  5CTW A;  5FND A;  4BAE A;  4L8Z A;  4HYP A;  4CWF A;  3R4N A;  3R91 A;  3VHA A;  4XCL A;  1AJ6 A;  2E0A A;  2IOR A;  1GJV A;  1YT2 A;  3INX A;  2BU8 A;  1UYI A;  4AWQ A;  5M4K A;  1S16 A;  2VCI A;  4PRX A;  1B62 A;  5IN9 A;  4V25 A;  1YC3 A;  3MNR P;  1BGQ A;  3Q5J A;  2Q8G A;  1R62 A;  3CGZ A;  4KFG A;  3EHG A;  2XHT A;  2C2A A;  3KE6 A;  4BQJ A;  3HEK A;  4I5S A;  3A0W A;  2BZ5 A;  3VAD A;  3B26 A;  1YC1 A;  1U0Z A;  2WI5 A;  3O6O A;  4YKQ A;  2BYI A;  5D7C A;  2PNR A;  3H4L A;  4LWE A;  2Q8F A;  4BIU A;  3HZ5 A;  3IED A;  2GQP A;  1UY9 A;  2WI2 A;  3EHF A;  3G7E A;  1B63 A;  4PU9 A;  3ZXO A;  2CGF A;  4EGK A;  2XX5 A;  4XKK A;  3T0H A;  4LWF A;  1B3Q A;  5CTU A;  2JJC A;  4LWI A;  4FCP A;  4GCZ A;  2YE5 A;  3GIG B;  4NH9 A;  3TZ2 A;  2YKC A;  2WEQ A;  2YE3 A;  4MPN A;  2O1V A;  4DUH A;  1NHI A;  4GQT A;  1QYE A;  2IWS A;  4PRV A;  4L91 A;  5F3K A;  4HY6 A;  4AWO A;  2H8M A;  5M4E A;  5IDM A;  2YI6 A;  2YEE A;  2BSM A;  2YE2 A;  3G75 A;  1UYH A;  4PL9 A;  4R3A A;  1UY8 A;  3OPD A;  1UYM A;  3TZ0 A;  2YEH A;  3INW A;  4LP0 A;  2YEJ A;  2CH4 A;  3R4O A;  2H55 A;  3RLR A;  4R3M A;  2BTZ A;  5J71 A;  3TTZ A;  4GEE A;  4WUD A;  2JKI A;  2XHX A;  3EHJ A;  3BM9 A;  2YJW A;  1EA6 A;  2XK2 A;  3BMY A;  2QF6 A;  2ZDX A;  5L3J A;  2QFO A;  1MU5 A;  3LNU A;  3ZKD A;  1THN A;  4WUB A;  3JZ3 A;  3K60 A;  2BT0 A;  1ZXN A;  4XKA A;  4XIQ A;  4AWP A;  1Y4U A;  5FNC A;  3OWD A;  4HXW A;  3U2K A;  2ZDY A;  1KZN A;  3RLP A;  1YSZ A;  1UY6 A;  2WEP A;  2VCJ A;  2YKB A;  1I5A A;  4EFU A;  4K4O A;  4URO A;  4CWS A;  2HKJ A;  2VW5 A;  5D7R A;  1I59 A;  1L0O A;  3B24 A;  1YET A;  4KSG A;  2XHR A;  1YES A;  1TID A;  5C93 A;  5BOC A;  1UY7 A;  3H80 A;  4MB9 A;  4EMV A;  3PEJ A;  4GGL A;  4XC0 A;  3WQ9 A;  2XAB A;  4URN A;  3NMQ A;  2XJX A;  3RKZ A;  2BRE A;  2YKJ A;  4NH7 A;  3U2D A;  3U67 A;  1Z5C A;  5D6Q A;  2VWC A;  4XCJ A;  5IDJ A;  5M4M A;  4O05 A;  3T0Z A;  4CWP A;  2XX2 A;  3CGY A;  4ZVI A;  2YEA A;  5M4N A;  3TUH A;  1AM1 A;  4QPJ A;  2ZBK B;  4YKU A;  1Z5B A;  1I5D A;  1TIL A;  2YI5 A;  4GT8 A;  3ZXQ A;  1Y8P A;  1YC4 A;  2XDU A;  2YE9 A;  4ASA A;  4CWR A;  4XDM A;  2WER A;  5FWK A;  2HCH A;  2HG1 A;  3FT8 A;  1UYE A;  2YGF A;  3HZ1 A;  3ZM7 A;  3HYZ A;  2YEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...