1U2OA

Crystal structure of the n-domain of grp94 lacking the charged domain in complex with neca
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
236
structure length
226
Chain Sequence
GSHMLREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQESTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal domain of GRP94. Basis for ligand specificity and regulation
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 66
structure length 226
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1u2oA00
4R3MA 4YKYA 4MB9A 3K98A 4HXWA 3OWDA 3A0TA 4XCJA 3ZKBA 1YESA 3HYYA 4JAUA 1UYDA 2BRCA 1ZW9A 2XDUA 2YKBA 2XHTA 1B63A 4KFGA 4MOTA 1UYHA 2YEHA 1TIDA 2YE4A 4LPBA 1GKXA 4MPNA 2E0AA 2AKPA 1YC3A 4ASFA 1S16A 3EHHA 3HEKA 4U7OA 3CRLA 2WI5A 3R91A 3G7EA 1AMWA 4MPCA 4R1FA 1Y8NA 2ZKJA 4HZ0A 3LNUA 1AH6A 2XCMA 3T1KA 2YK9A 2IOPA 4CWQA 3H4LA 3HZ5A 3OWBA 4YKUA 4EM7A 3QDDA 4URLA 3HYZA 3T0HA 4ASBA 3INXA 4EFUA 2FWYA 5M4MA 5M4EA 3HZ1A 2XHRA 4O09A 2YKEA 3TZ4A 4KP4A 1R62A 1UYFA 1L0OA 4BQJA 5J6AA 3K97A 3VHAA 1EA6A 4GFNA 2XD6A 2YE6A 2XDSA 3K60A 3B28A 1YT1A 4URMA 4L93A 4PRXA 5IN9A 4V25A 1H7SA 1MU5A 3BM9A 3EHFA 4BXIA 1I5BA 1YSZA 3KE6A 1H7UA 2PNRA 1KIJA 2QFOA 4EEHA 1UY6A 3GIFA 2XX2A 1S14A 1ID0A 4CE2A 2YEJA 4PL9A 3H80A 4MP7A 3D36A 3VADA 1I5AA 4WUDA 4GQTA 4U7NA 4E01A 3R4OA 2XK2A 2YE3A 4XKAA 4KSGA 1I5DA 3G7BA 4GT8A 1MX0A 1Z5BA 3B24A 2BU6A 3EKOA 4UROA 4WUCA 4K4OA 1ZXMA 1GJVA 3T10A 4L8ZA 2WI6A 4ASAA 4R3AA 2VCJA 1QYEA 2YI6A 3TZ2A 4XTJA 4LWEA 3G75A 4CWPA 3EKRA 4W7TA 1Y8OA 3CRKA 4B7PA 3CWVA 2H8MA 1JM6A 1UYEA 2YE7A 4H7QA 4LWGA 2Q8GA 2Q2EB 4O0BA 3LPSA 2BU5A 2BSMA 4BIZA 4GCZA 2HG1A 3O6OA 1TH8A 4PRVA 1U0ZA 4CWSA 3GIGB 2VWCA 2Q8HA 2WI1A 3OW6A 1UYIA 4CE3A 3CGZA 2HKJA 1BGQA 3R4PA 4BIUA 2VCIA 1US7A 3T2SA 4YKQA 3A0XA 2CCTA 3GIGA 4CWOA 4EFTA 2WERA 2IWUA 4QPKA 4AS9A 2WI2A 4YKRA 1THNA 4FCQA 1U2OA 4KQVA 4E02A 4YKWA 1YERA 1BXDA 5D7CA 4U93A 3D0BA 4EGHA 1A4HA 4JQLA 1I5CA 2YE9A 4LWHA 2FYPA 4L94A 2HCHA 3MNRP 4GGLA 3RLQA 3R4NA 4HYMA 3A0ZA 2CGFA 1I59A 2WEQA 1Z59A 5CPHA 1UYKA 2XHXA 5CTXA 4XC0A 3WQ9A 3JZ3A 5C93A 3B26A 2YJXA 4P7AA 1AH8A 4KTNA 4P8OA 1TC6A 2IWSA 2YEGA 2BREA 2BU2A 2IOQA 3QTFA 3U67A 4CWTA 4H81A 2YGFA 3TZ0A 3B25A 3FT5A 4KSHA 2ZBKB 4LWFA 5D6PA 1AM1A 2YI0A 1EI1A 4LWIA 4DUHA 2H55A 4L90A 2YECA 4CE1A 4L91A 4FCRA 1ZWHA 4XKOA 1UYMA 2XX4A 5D7DA 2QF6A 2YKIA 3BMYA 2ZDXA 2K5BA 4XIQA 4AWQA 1KZNA 3R4MA 3OMUA 1QZRA 4DZYA 3EHJA 1YSRA 2BYHA 2IORA 4NH8A 3RLRA 4EGKA 3U2KA 4EGIA 3ZM7A 4HY6A 1OSFA 3PEJA 3CGYA 3A0WA 2YEBA 3FT8A 3RKZA 2YGAA 1YT2A 2YK2A 5FWKA 2IWXA 4I5SA 1YS3A 2BT0A 2YI5A 5FNDA 4MBCA 1NHHA 3TTZA 4YKXA 3GIEA 4CWRA 4QPJA 1ZXNA 2WI7A 3Q5JA 4URNA 2YJWA 2BYIA 4AWPA 2CCUA 4HZ5A 3HHUA 5BODA 3C11A 4FPPA 4EMVA 3A0YA 4XE2A 5M4PA 2CCSA 4XIPA 5M4NA 5IDMA 4O07A 2CG9A 3INWA 4XDMA 4LP0A 4XD8A 2GQPA 3C0EA 4YKTA 2GFDA 4CWFA 4NH7A 3R92A 2ESAA 2O1WA 2ZDYA 1B3QA 2YKCA 4XITA 1NHJA 1UY8A 4MP2A 3T0ZA 1Y4SA 2Q8FA 5CTYA 4JAVA 2FWZA 4FCPA 2XJGA 4X9LA 5CTUA 2XJXA 2CH4A 4O05A 4I3HA 1PVGA 3IEDA 1UYLA 1YETA 2YEIA 1TC0A 5M4KA 2XJJA 2YGEA 1Z5AA 5F5RA 5CF0A 4FMTA 5GGZA 4HYPA 3O0IA 5L3JA 4AWOA 2YI7A 1BKNA 2XDLA 2VW5A 2BTZA 4XKKA 3D2RA 3ZXOA 1UY7A 4ZKIA 4BQGA 3FV5A 3TUHA 4YKZA 2YEAA 1Z5CA 2YEDA 4Q20A 3RLPA 3NMQA 3SL2A 3TZ5A 1NHIA 3PEHA 2BZ5A 3B27A 4PU9A 5D7RA 3O2FA 2WI3A 2C2AA 4V26A 1Y8PA 5FNCA 3Q5KA 4ZVIA 2Q8IA 5BOCA 2QG2A 4HY1A 2JJCA 5M4HA 4CWNA 1YT0A 4WUBA 2UWDA 2BU7A 2XDKA 4B6CA 1UYCA 1BYQA 5J71A 4H85A 2BU8A 3DGEA 5FNFA 3A0RA 1TBWA 4JASA 2FXSA 5CTWA 3VHDA 2YEFA 3VHCA 2QG0A 5D6QA 2WI4A 2JKIA 1AJ6A 2XABA 3Q5LA 3ZXQA 2O1UA 2YKJA 1UY9A 4O04A 2YE5A 4E00A 2O1VA 5F3KA 3U2DA 1B62A 2XDXA 2EXLA 2YE2A 4MPEA 2YEEA 4XIRA 1GKZA 2WEPA 3ZKDA 1QY8A 5IDJA 1YC4A 2XX5A 2YE8A 4HXZA 4ASGA 3EHGA 1UYGA 4GEEA 4NH9A 3K99A 1Y4UA 3WHAA 1TILA 1YC1A 3OPDA 4BAEA 1I58A 4XCLA
chains in the Genus database with same CATH superfamily
4R3MA 4YKYA 4MB9A 3K98A 4HXWA 3OWDA 3A0TA 4XCJA 3ZKBA 1YESA 3HYYA 4JAUA 1UYDA 2BRCA 1ZW9A 2XDUA 2YKBA 2XHTA 1B63A 4KFGA 4MOTA 1UYHA 2YEHA 1TIDA 2YE4A 4LPBA 1GKXA 4MPNA 2E0AA 2AKPA 1YC3A 4ASFA 1S16A 3EHHA 3HEKA 4U7OA 3CRLA 3CYGA 2WI5A 3R91A 3G7EA 1AMWA 4MPCA 4R1FA 1Y8NA 2ZKJA 4HZ0A 3LNUA 1AH6A 2XCMA 3T1KA 2YK9A 2IOPA 4CWQA 3H4LA 3HZ5A 3OWBA 4YKUA 4EM7A 3QDDA 2FTKA 4URLA 3HYZA 3T0HA 4ASBA 3INXA 4EFUA 2FWYA 5M4MA 5M4EA 3HZ1A 2XHRA 4O09A 2YKEA 3TZ4A 4KP4A 1R62A 1UYFA 1L0OA 4BQJA 5J6AA 3K97A 3VHAA 1EA6A 4GFNA 2XD6A 2YE6A 2XDSA 3K60A 3B28A 1YT1A 4URMA 4L93A 4PRXA 5IN9A 4V25A 1H7SA 1MU5A 3BM9A 3EHFA 4BXIA 1I5BA 1YSZA 3KE6A 1H7UA 2C1GA 2PNRA 1KIJA 2QFOA 4EEHA 1UY6A 3GIFA 2XX2A 1S14A 1ID0A 4CE2A 2YEJA 4PL9A 3H80A 4MP7A 1IXMA 3D36A 3VADA 1I5AA 4WUDA 4GQTA 4U7NA 4E01A 3R4OA 2XK2A 2YE3A 4XKAA 3S5TA 4KSGA 1I5DA 3G7BA 4GT8A 1MX0A 1Z5BA 3B24A 2BU6A 3EKOA 4UROA 4WUCA 4K4OA 1ZXMA 1GJVA 3T10A 4L8ZA 2WI6A 4ASAA 4R3AA 2VCJA 1QYEA 2YI6A 3TZ2A 4XTJA 4LWEA 1F51A 3G75A 4CWPA 3EKRA 4W7TA 1Y8OA 3CRKA 4B7PA 3CWVA 2H8MA 1JM6A 1UYEA 2YE7A 4H7QA 4LWGA 2Q8GA 2Q2EB 4O0BA 3LPSA 2BU5A 2BSMA 4BIZA 4GCZA 2HG1A 3O6OA 1TH8A 4PRVA 1U0ZA 4CWSA 3GIGB 2VWCA 2Q8HA 2WI1A 3OW6A 1UYIA 4CE3A 3CGZA 2HKJA 1BGQA 3R4PA 4BIUA 2VCIA 1US7A 3T2SA 4YKQA 3A0XA 2CCTA 3GIGA 4CWOA 4EFTA 2WERA 2IWUA 4QPKA 4AS9A 2WI2A 4YKRA 1THNA 4FCQA 1U2OA 2HHIA 4KQVA 4E02A 4YKWA 1YERA 1BXDA 5D7CA 4U93A 3D0BA 4EGHA 1A4HA 4JQLA 1I5CA 2YE9A 4LWHA 2FYPA 4L94A 2HCHA 3MNRP 4GGLA 3RLQA 3R4NA 4HYMA 3A0ZA 2CGFA 1I59A 2WEQA 1Z59A 5CPHA 1UYKA 2XHXA 5CTXA 4XC0A 3WQ9A 3JZ3A 5C93A 3B26A 2YJXA 4P7AA 1AH8A 4KTNA 2C1IA 4P8OA 1TC6A 2IWSA 2YEGA 2BREA 2BU2A 2IOQA 3QTFA 5JENA 3U67A 4CWTA 4H81A 2YGFA 3TZ0A 3B25A 3FT5A 4KSHA 2ZBKB 4LWFA 5D6PA 1AM1A 2YI0A 1EI1A 4LWIA 4DUHA 2H55A 4L90A 2YECA 4CE1A 4L91A 4FCRA 1ZWHA 4XKOA 1UYMA 2XX4A 5D7DA 2QF6A 2YKIA 3BMYA 2ZDXA 2K5BA 4XIQA 4AWQA 1KZNA 3R4MA 3OMUA 1QZRA 4DZYA 3EHJA 1YSRA 2BYHA 2IORA 4NH8A 3RLRA 4EGKA 3U2KA 4EGIA 3ZM7A 4HY6A 1OSFA 3PEJA 3CGYA 3A0WA 2YEBA 3FT8A 3RKZA 2YGAA 1YT2A 2YK2A 5FWKA 2IWXA 4I5SA 1YS3A 2BT0A 2YI5A 5FNDA 4MBCA 1NHHA 3TTZA 4YKXA 3GIEA 4CWRA 4QPJA 1ZXNA 2WI7A 3Q5JA 4URNA 2YJWA 2BYIA 4AWPA 2CCUA 4HZ5A 3HHUA 5BODA 3C11A 4FPPA 4EMVA 3A0YA 4XE2A 5M4PA 2CCSA 4XIPA 5M4NA 5IDMA 4O07A 2CG9A 3INWA 4XDMA 4LP0A 4XD8A 2GQPA 3C0EA 4YKTA 2GFDA 4CWFA 4NH7A 3R92A 2ESAA 2O1WA 2ZDYA 1B3QA 2YKCA 4E72A 4XITA 1NHJA 1UY8A 4MP2A 3T0ZA 1Y4SA 2Q8FA 5CTYA 4JAVA 2FWZA 4FCPA 2XJGA 4X9LA 5CTUA 2XJXA 2CH4A 4O05A 4I3HA 1PVGA 3IEDA 1UYLA 1YETA 2YEIA 1TC0A 5M4KA 2XJJA 2YGEA 1Z5AA 5F5RA 5CF0A 4FMTA 5GGZA 4HYPA 3O0IA 5L3JA 4AWOA 2YI7A 1BKNA 2XDLA 2VW5A 2BTZA 4XKKA 3D2RA 3ZXOA 1UY7A 4ZKIA 4BQGA 3FV5A 3TUHA 4YKZA 2YEAA 1Z5CA 2YEDA 4Q20A 3RLPA 3NMQA 3SL2A 3TZ5A 1NHIA 3PEHA 2BZ5A 3B27A 4PU9A 5D7RA 3O2FA 2WI3A 2C2AA 4V26A 1Y8PA 5FNCA 3Q5KA 4ZVIA 2Q8IA 5BOCA 2QG2A 4HY1A 2JJCA 5M4HA 4CWNA 1YT0A 4WUBA 2UWDA 2BU7A 2XDKA 4B6CA 1UYCA 1BYQA 5J71A 4H85A 2BU8A 3DGEA 5FNFA 3A0RA 1TBWA 4JASA 2FXSA 5CTWA 3VHDA 2YEFA 3VHCA 2QG0A 5D6QA 2WI4A 2JKIA 1AJ6A 2XABA 3Q5LA 3ZXQA 2O1UA 2YKJA 1UY9A 4O04A 2YE5A 4E00A 2O1VA 5F3KA 3U2DA 1B62A 2XDXA 2EXLA 2YE2A 3LMMA 4MPEA 2YEEA 4XIRA 1GKZA 2WEPA 3ZKDA 1QY8A 5IDJA 1YC4A 2XX5A 2YE8A 4HXZA 4ASGA 3EHGA 1UYGA 4GEEA 4NH9A 3K99A 1Y4UA 3WHAA 1TILA 1YC1A 3OPDA 4BAEA 1I58A 4XCLA
chains in the Genus database with same CATH topology
4R3MA 4YKYA 4MB9A 3K98A 4HXWA 3OWDA 3A0TA 4XCJA 3ZKBA 1YESA 3HYYA 4JAUA 1UYDA 2BRCA 1ZW9A 2XDUA 2YKBA 2XHTA 1B63A 4KFGA 4MOTA 1UYHA 2YEHA 1TIDA 2YE4A 4LPBA 1GKXA 4MPNA 2E0AA 2AKPA 1YC3A 4ASFA 1S16A 3EHHA 3HEKA 4U7OA 3CRLA 2WI5A 3R91A 3G7EA 1AMWA 4MPCA 4R1FA 1Y8NA 2ZKJA 4HZ0A 3LNUA 1AH6A 2XCMA 3T1KA 2YK9A 2IOPA 4CWQA 3H4LA 3HZ5A 3OWBA 4YKUA 4EM7A 3QDDA 4URLA 3HYZA 3T0HA 4ASBA 3INXA 4EFUA 2FWYA 5M4MA 5M4EA 3HZ1A 2XHRA 4O09A 2YKEA 3TZ4A 4KP4A 1R62A 1UYFA 1L0OA 4BQJA 5J6AA 3K97A 3VHAA 1EA6A 4GFNA 2XD6A 2YE6A 2XDSA 3K60A 3B28A 1YT1A 4URMA 4L93A 4PRXA 5IN9A 4V25A 1H7SA 1MU5A 3BM9A 3EHFA 4BXIA 1I5BA 1YSZA 3KE6A 1H7UA 2PNRA 1KIJA 2QFOA 4EEHA 1UY6A 3GIFA 2XX2A 1S14A 1ID0A 4CE2A 2YEJA 4PL9A 3H80A 4MP7A 3D36A 3VADA 1I5AA 4WUDA 4GQTA 4U7NA 4E01A 3R4OA 2XK2A 2YE3A 4XKAA 4KSGA 1I5DA 3G7BA 4GT8A 1MX0A 1Z5BA 3B24A 2BU6A 3EKOA 4UROA 4WUCA 4K4OA 1ZXMA 1GJVA 3T10A 4L8ZA 2WI6A 4ASAA 4R3AA 2VCJA 1QYEA 2YI6A 3TZ2A 4XTJA 4LWEA 3G75A 4CWPA 3EKRA 4W7TA 1Y8OA 3CRKA 4B7PA 3CWVA 2H8MA 1JM6A 1UYEA 2YE7A 4H7QA 4LWGA 2Q8GA 2Q2EB 4O0BA 3LPSA 2BU5A 2BSMA 4BIZA 4GCZA 2HG1A 3O6OA 1TH8A 4PRVA 1U0ZA 4CWSA 3GIGB 2VWCA 2Q8HA 2WI1A 3OW6A 1UYIA 4CE3A 3CGZA 2HKJA 1BGQA 3R4PA 4BIUA 2VCIA 1US7A 3T2SA 4YKQA 3A0XA 2CCTA 3GIGA 4CWOA 4EFTA 2WERA 2IWUA 4QPKA 4AS9A 2WI2A 4YKRA 1THNA 4FCQA 1U2OA 4KQVA 4E02A 4YKWA 1YERA 1BXDA 5D7CA 4U93A 3D0BA 4EGHA 1A4HA 4JQLA 1I5CA 2YE9A 4LWHA 2FYPA 4L94A 2HCHA 3MNRP 4GGLA 3RLQA 3R4NA 4HYMA 3A0ZA 2CGFA 1I59A 2WEQA 1Z59A 5CPHA 1UYKA 2XHXA 5CTXA 4XC0A 3WQ9A 3JZ3A 5C93A 3B26A 2YJXA 4P7AA 1AH8A 4KTNA 4P8OA 1TC6A 2IWSA 2YEGA 2BREA 2BU2A 2IOQA 3QTFA 3U67A 4CWTA 4H81A 2YGFA 3TZ0A 3B25A 3FT5A 4KSHA 2ZBKB 4LWFA 5D6PA 1AM1A 2YI0A 1EI1A 4LWIA 4DUHA 2H55A 4L90A 2YECA 4CE1A 4L91A 4FCRA 1ZWHA 4XKOA 1UYMA 2XX4A 5D7DA 2QF6A 2YKIA 3BMYA 2ZDXA 2K5BA 4XIQA 4AWQA 1KZNA 3R4MA 3OMUA 1QZRA 4DZYA 3EHJA 1YSRA 2BYHA 2IORA 4NH8A 3RLRA 4EGKA 3U2KA 4EGIA 3ZM7A 4HY6A 1OSFA 3PEJA 3CGYA 3A0WA 2YEBA 3FT8A 3RKZA 2YGAA 1YT2A 2YK2A 5FWKA 2IWXA 4I5SA 1YS3A 2BT0A 2YI5A 5FNDA 4MBCA 1NHHA 3TTZA 4YKXA 3GIEA 4CWRA 4QPJA 1ZXNA 2WI7A 3Q5JA 4URNA 2YJWA 2BYIA 4AWPA 2CCUA 4HZ5A 3HHUA 5BODA 3C11A 4FPPA 4EMVA 3A0YA 4XE2A 5M4PA 2CCSA 4XIPA 5M4NA 5IDMA 4O07A 2CG9A 3INWA 4XDMA 4LP0A 4XD8A 2GQPA 3C0EA 4YKTA 2GFDA 4CWFA 4NH7A 3R92A 2ESAA 2O1WA 2ZDYA 1B3QA 2YKCA 4XITA 1NHJA 1UY8A 4MP2A 3T0ZA 1Y4SA 2Q8FA 5CTYA 4JAVA 2FWZA 4FCPA 2XJGA 4X9LA 5CTUA 2XJXA 2CH4A 4O05A 4I3HA 1PVGA 3IEDA 1UYLA 1YETA 2YEIA 1TC0A 5M4KA 2XJJA 2YGEA 1Z5AA 5F5RA 5CF0A 4FMTA 5GGZA 4HYPA 3O0IA 5L3JA 4AWOA 2YI7A 1BKNA 2XDLA 2VW5A 2BTZA 4XKKA 3D2RA 3ZXOA 1UY7A 4ZKIA 4BQGA 3FV5A 3TUHA 4YKZA 2YEAA 1Z5CA 2YEDA 4Q20A 3RLPA 3NMQA 3SL2A 3TZ5A 1NHIA 3PEHA 2BZ5A 3B27A 4PU9A 5D7RA 3O2FA 2WI3A 2C2AA 4V26A 1Y8PA 5FNCA 3Q5KA 4ZVIA 2Q8IA 5BOCA 2QG2A 4HY1A 2JJCA 5M4HA 4CWNA 1YT0A 4WUBA 2UWDA 2BU7A 2XDKA 4B6CA 1UYCA 1BYQA 5J71A 4H85A 2BU8A 3DGEA 5FNFA 3A0RA 1TBWA 4JASA 2FXSA 5CTWA 3VHDA 2YEFA 3VHCA 2QG0A 5D6QA 2WI4A 2JKIA 1AJ6A 2XABA 3Q5LA 3ZXQA 2O1UA 2YKJA 1UY9A 4O04A 2YE5A 4E00A 2O1VA 5F3KA 3U2DA 1B62A 2XDXA 2EXLA 2YE2A 4MPEA 2YEEA 4XIRA 1GKZA 2WEPA 3ZKDA 1QY8A 5IDJA 1YC4A 2XX5A 2YE8A 4HXZA 4ASGA 3EHGA 1UYGA 4GEEA 4NH9A 3K99A 1Y4UA 3WHAA 1TILA 1YC1A 3OPDA 4BAEA 1I58A 4XCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R3M A;  4YKY A;  4MB9 A;  3K98 A;  4HXW A;  3OWD A;  3A0T A;  4XCJ A;  3ZKB A;  1YES A;  3HYY A;  4JAU A;  1UYD A;  2BRC A;  1ZW9 A;  2XDU A;  2YKB A;  2XHT A;  1B63 A;  4KFG A;  4MOT A;  1UYH A;  2YEH A;  1TID A;  2YE4 A;  4LPB A;  1GKX A;  4MPN A;  2E0A A;  2AKP A;  1YC3 A;  4ASF A;  1S16 A;  3EHH A;  3HEK A;  4U7O A;  3CRL A;  2WI5 A;  3R91 A;  3G7E A;  1AMW A;  4MPC A;  4R1F A;  1Y8N A;  2ZKJ A;  4HZ0 A;  3LNU A;  1AH6 A;  2XCM A;  3T1K A;  2YK9 A;  2IOP A;  4CWQ A;  3H4L A;  3HZ5 A;  3OWB A;  4YKU A;  4EM7 A;  3QDD A;  4URL A;  3HYZ A;  3T0H A;  4ASB A;  3INX A;  4EFU A;  2FWY A;  5M4M A;  5M4E A;  3HZ1 A;  2XHR A;  4O09 A;  2YKE A;  3TZ4 A;  4KP4 A;  1R62 A;  1UYF A;  1L0O A;  4BQJ A;  5J6A A;  3K97 A;  3VHA A;  1EA6 A;  4GFN A;  2XD6 A;  2YE6 A;  2XDS A;  3K60 A;  3B28 A;  1YT1 A;  4URM A;  4L93 A;  4PRX A;  5IN9 A;  4V25 A;  1H7S A;  1MU5 A;  3BM9 A;  3EHF A;  4BXI A;  1I5B A;  1YSZ A;  3KE6 A;  1H7U A;  2PNR A;  1KIJ A;  2QFO A;  4EEH A;  1UY6 A;  3GIF A;  2XX2 A;  1S14 A;  1ID0 A;  4CE2 A;  2YEJ A;  4PL9 A;  3H80 A;  4MP7 A;  3D36 A;  3VAD A;  1I5A A;  4WUD A;  4GQT A;  4U7N A;  4E01 A;  3R4O A;  2XK2 A;  2YE3 A;  4XKA A;  4KSG A;  1I5D A;  3G7B A;  4GT8 A;  1MX0 A;  1Z5B A;  3B24 A;  2BU6 A;  3EKO A;  4URO A;  4WUC A;  4K4O A;  1ZXM A;  1GJV A;  3T10 A;  4L8Z A;  2WI6 A;  4ASA A;  4R3A A;  2VCJ A;  1QYE A;  2YI6 A;  3TZ2 A;  4XTJ A;  4LWE A;  3G75 A;  4CWP A;  3EKR A;  4W7T A;  1Y8O A;  3CRK A;  4B7P A;  3CWV A;  2H8M A;  1JM6 A;  1UYE A;  2YE7 A;  4H7Q A;  4LWG A;  2Q8G A;  2Q2E B;  4O0B A;  3LPS A;  2BU5 A;  2BSM A;  4BIZ A;  4GCZ A;  2HG1 A;  3O6O A;  1TH8 A;  4PRV A;  1U0Z A;  4CWS A;  3GIG B;  2VWC A;  2Q8H A;  2WI1 A;  3OW6 A;  1UYI A;  4CE3 A;  3CGZ A;  2HKJ A;  1BGQ A;  3R4P A;  4BIU A;  2VCI A;  1US7 A;  3T2S A;  4YKQ A;  3A0X A;  2CCT A;  3GIG A;  4CWO A;  4EFT A;  2WER A;  2IWU A;  4QPK A;  4AS9 A;  2WI2 A;  4YKR A;  1THN A;  4FCQ A;  1U2O A;  4KQV A;  4E02 A;  4YKW A;  1YER A;  1BXD A;  5D7C A;  4U93 A;  3D0B A;  4EGH A;  1A4H A;  4JQL A;  1I5C A;  2YE9 A;  4LWH A;  2FYP A;  4L94 A;  2HCH A;  3MNR P;  4GGL A;  3RLQ A;  3R4N A;  4HYM A;  3A0Z A;  2CGF A;  1I59 A;  2WEQ A;  1Z59 A;  5CPH A;  1UYK A;  2XHX A;  5CTX A;  4XC0 A;  3WQ9 A;  3JZ3 A;  5C93 A;  3B26 A;  2YJX A;  4P7A A;  1AH8 A;  4KTN A;  4P8O A;  1TC6 A;  2IWS A;  2YEG A;  2BRE A;  2BU2 A;  2IOQ A;  3QTF A;  3U67 A;  4CWT A;  4H81 A;  2YGF A;  3TZ0 A;  3B25 A;  3FT5 A;  4KSH A;  2ZBK B;  4LWF A;  5D6P A;  1AM1 A;  2YI0 A;  1EI1 A;  4LWI A;  4DUH A;  2H55 A;  4L90 A;  2YEC A;  4CE1 A;  4L91 A;  4FCR A;  1ZWH A;  4XKO A;  1UYM A;  2XX4 A;  5D7D A;  2QF6 A;  2YKI A;  3BMY A;  2ZDX A;  2K5B A;  4XIQ A;  4AWQ A;  1KZN A;  3R4M A;  3OMU A;  1QZR A;  4DZY A;  3EHJ A;  1YSR A;  2BYH A;  2IOR A;  4NH8 A;  3RLR A;  4EGK A;  3U2K A;  4EGI A;  3ZM7 A;  4HY6 A;  1OSF A;  3PEJ A;  3CGY A;  3A0W A;  2YEB A;  3FT8 A;  3RKZ A;  2YGA A;  1YT2 A;  2YK2 A;  5FWK A;  2IWX A;  4I5S A;  1YS3 A;  2BT0 A;  2YI5 A;  5FND A;  4MBC A;  1NHH A;  3TTZ A;  4YKX A;  3GIE A;  4CWR A;  4QPJ A;  1ZXN A;  2WI7 A;  3Q5J A;  4URN A;  2YJW A;  2BYI A;  4AWP A;  2CCU A;  4HZ5 A;  3HHU A;  5BOD A;  3C11 A;  4FPP A;  4EMV A;  3A0Y A;  4XE2 A;  5M4P A;  2CCS A;  4XIP A;  5M4N A;  5IDM A;  4O07 A;  2CG9 A;  3INW A;  4XDM A;  4LP0 A;  4XD8 A;  2GQP A;  3C0E A;  4YKT A;  2GFD A;  4CWF A;  4NH7 A;  3R92 A;  2ESA A;  2O1W A;  2ZDY A;  1B3Q A;  2YKC A;  4XIT A;  1NHJ A;  1UY8 A;  4MP2 A;  3T0Z A;  1Y4S A;  2Q8F A;  5CTY A;  4JAV A;  2FWZ A;  4FCP A;  2XJG A;  4X9L A;  5CTU A;  2XJX A;  2CH4 A;  4O05 A;  4I3H A;  1PVG A;  3IED A;  1UYL A;  1YET A;  2YEI A;  1TC0 A;  5M4K A;  2XJJ A;  2YGE A;  1Z5A A;  5F5R A;  5CF0 A;  4FMT A;  5GGZ A;  4HYP A;  3O0I A;  5L3J A;  4AWO A;  2YI7 A;  1BKN A;  2XDL A;  2VW5 A;  2BTZ A;  4XKK A;  3D2R A;  3ZXO A;  1UY7 A;  4ZKI A;  4BQG A;  3FV5 A;  3TUH A;  4YKZ A;  2YEA A;  1Z5C A;  2YED A;  4Q20 A;  3RLP A;  3NMQ A;  3SL2 A;  3TZ5 A;  1NHI A;  3PEH A;  2BZ5 A;  3B27 A;  4PU9 A;  5D7R A;  3O2F A;  2WI3 A;  2C2A A;  4V26 A;  1Y8P A;  5FNC A;  3Q5K A;  4ZVI A;  2Q8I A;  5BOC A;  2QG2 A;  4HY1 A;  2JJC A;  5M4H A;  4CWN A;  1YT0 A;  4WUB A;  2UWD A;  2BU7 A;  2XDK A;  4B6C A;  1UYC A;  1BYQ A;  5J71 A;  4H85 A;  2BU8 A;  3DGE A;  5FNF A;  3A0R A;  1TBW A;  4JAS A;  2FXS A;  5CTW A;  3VHD A;  2YEF A;  3VHC A;  2QG0 A;  5D6Q A;  2WI4 A;  2JKI A;  1AJ6 A;  2XAB A;  3Q5L A;  3ZXQ A;  2O1U A;  2YKJ A;  1UY9 A;  4O04 A;  2YE5 A;  4E00 A;  2O1V A;  5F3K A;  3U2D A;  1B62 A;  2XDX A;  2EXL A;  2YE2 A;  4MPE A;  2YEE A;  4XIR A;  1GKZ A;  2WEP A;  3ZKD A;  1QY8 A;  5IDJ A;  1YC4 A;  2XX5 A;  2YE8 A;  4HXZ A;  4ASG A;  3EHG A;  1UYG A;  4GEE A;  4NH9 A;  3K99 A;  1Y4U A;  3WHA A;  1TIL A;  1YC1 A;  3OPD A;  4BAE A;  1I58 A;  4XCL A; 
#chains in the Genus database with same CATH topology
 4R3M A;  4YKY A;  4MB9 A;  3K98 A;  4HXW A;  3OWD A;  3A0T A;  4XCJ A;  3ZKB A;  1YES A;  3HYY A;  4JAU A;  1UYD A;  2BRC A;  1ZW9 A;  2XDU A;  2YKB A;  2XHT A;  1B63 A;  4KFG A;  4MOT A;  1UYH A;  2YEH A;  1TID A;  2YE4 A;  4LPB A;  1GKX A;  4MPN A;  2E0A A;  2AKP A;  1YC3 A;  4ASF A;  1S16 A;  3EHH A;  3HEK A;  4U7O A;  3CRL A;  3CYG A;  2WI5 A;  3R91 A;  3G7E A;  1AMW A;  4MPC A;  4R1F A;  1Y8N A;  2ZKJ A;  4HZ0 A;  3LNU A;  1AH6 A;  2XCM A;  3T1K A;  2YK9 A;  2IOP A;  4CWQ A;  3H4L A;  3HZ5 A;  3OWB A;  4YKU A;  4EM7 A;  3QDD A;  2FTK A;  4URL A;  3HYZ A;  3T0H A;  4ASB A;  3INX A;  4EFU A;  2FWY A;  5M4M A;  5M4E A;  3HZ1 A;  2XHR A;  4O09 A;  2YKE A;  3TZ4 A;  4KP4 A;  1R62 A;  1UYF A;  1L0O A;  4BQJ A;  5J6A A;  3K97 A;  3VHA A;  1EA6 A;  4GFN A;  2XD6 A;  2YE6 A;  2XDS A;  3K60 A;  3B28 A;  1YT1 A;  4URM A;  4L93 A;  4PRX A;  5IN9 A;  4V25 A;  1H7S A;  1MU5 A;  3BM9 A;  3EHF A;  4BXI A;  1I5B A;  1YSZ A;  3KE6 A;  1H7U A;  2C1G A;  2PNR A;  1KIJ A;  2QFO A;  4EEH A;  1UY6 A;  3GIF A;  2XX2 A;  1S14 A;  1ID0 A;  4CE2 A;  2YEJ A;  4PL9 A;  3H80 A;  4MP7 A;  1IXM A;  3D36 A;  3VAD A;  1I5A A;  4WUD A;  4GQT A;  4U7N A;  4E01 A;  3R4O A;  2XK2 A;  2YE3 A;  4XKA A;  3S5T A;  4KSG A;  1I5D A;  3G7B A;  4GT8 A;  1MX0 A;  1Z5B A;  3B24 A;  2BU6 A;  3EKO A;  4URO A;  4WUC A;  4K4O A;  1ZXM A;  1GJV A;  3T10 A;  4L8Z A;  2WI6 A;  4ASA A;  4R3A A;  2VCJ A;  1QYE A;  2YI6 A;  3TZ2 A;  4XTJ A;  4LWE A;  1F51 A;  3G75 A;  4CWP A;  3EKR A;  4W7T A;  1Y8O A;  3CRK A;  4B7P A;  3CWV A;  2H8M A;  1JM6 A;  1UYE A;  2YE7 A;  4H7Q A;  4LWG A;  2Q8G A;  2Q2E B;  4O0B A;  3LPS A;  2BU5 A;  2BSM A;  4BIZ A;  4GCZ A;  2HG1 A;  3O6O A;  1TH8 A;  4PRV A;  1U0Z A;  4CWS A;  3GIG B;  2VWC A;  2Q8H A;  2WI1 A;  3OW6 A;  1UYI A;  4CE3 A;  3CGZ A;  2HKJ A;  1BGQ A;  3R4P A;  4BIU A;  2VCI A;  1US7 A;  3T2S A;  4YKQ A;  3A0X A;  2CCT A;  3GIG A;  4CWO A;  4EFT A;  2WER A;  2IWU A;  4QPK A;  4AS9 A;  2WI2 A;  4YKR A;  1THN A;  4FCQ A;  1U2O A;  2HHI A;  4KQV A;  4E02 A;  4YKW A;  1YER A;  1BXD A;  5D7C A;  4U93 A;  3D0B A;  4EGH A;  1A4H A;  4JQL A;  1I5C A;  2YE9 A;  4LWH A;  2FYP A;  4L94 A;  2HCH A;  3MNR P;  4GGL A;  3RLQ A;  3R4N A;  4HYM A;  3A0Z A;  2CGF A;  1I59 A;  2WEQ A;  1Z59 A;  5CPH A;  1UYK A;  2XHX A;  5CTX A;  4XC0 A;  3WQ9 A;  3JZ3 A;  5C93 A;  3B26 A;  2YJX A;  4P7A A;  1AH8 A;  4KTN A;  2C1I A;  4P8O A;  1TC6 A;  2IWS A;  2YEG A;  2BRE A;  2BU2 A;  2IOQ A;  3QTF A;  5JEN A;  3U67 A;  4CWT A;  4H81 A;  2YGF A;  3TZ0 A;  3B25 A;  3FT5 A;  4KSH A;  2ZBK B;  4LWF A;  5D6P A;  1AM1 A;  2YI0 A;  1EI1 A;  4LWI A;  4DUH A;  2H55 A;  4L90 A;  2YEC A;  4CE1 A;  4L91 A;  4FCR A;  1ZWH A;  4XKO A;  1UYM A;  2XX4 A;  5D7D A;  2QF6 A;  2YKI A;  3BMY A;  2ZDX A;  2K5B A;  4XIQ A;  4AWQ A;  1KZN A;  3R4M A;  3OMU A;  1QZR A;  4DZY A;  3EHJ A;  1YSR A;  2BYH A;  2IOR A;  4NH8 A;  3RLR A;  4EGK A;  3U2K A;  4EGI A;  3ZM7 A;  4HY6 A;  1OSF A;  3PEJ A;  3CGY A;  3A0W A;  2YEB A;  3FT8 A;  3RKZ A;  2YGA A;  1YT2 A;  2YK2 A;  5FWK A;  2IWX A;  4I5S A;  1YS3 A;  2BT0 A;  2YI5 A;  5FND A;  4MBC A;  1NHH A;  3TTZ A;  4YKX A;  3GIE A;  4CWR A;  4QPJ A;  1ZXN A;  2WI7 A;  3Q5J A;  4URN A;  2YJW A;  2BYI A;  4AWP A;  2CCU A;  4HZ5 A;  3HHU A;  5BOD A;  3C11 A;  4FPP A;  4EMV A;  3A0Y A;  4XE2 A;  5M4P A;  2CCS A;  4XIP A;  5M4N A;  5IDM A;  4O07 A;  2CG9 A;  3INW A;  4XDM A;  4LP0 A;  4XD8 A;  2GQP A;  3C0E A;  4YKT A;  2GFD A;  4CWF A;  4NH7 A;  3R92 A;  2ESA A;  2O1W A;  2ZDY A;  1B3Q A;  2YKC A;  4E72 A;  4XIT A;  1NHJ A;  1UY8 A;  4MP2 A;  3T0Z A;  1Y4S A;  2Q8F A;  5CTY A;  4JAV A;  2FWZ A;  4FCP A;  2XJG A;  4X9L A;  5CTU A;  2XJX A;  2CH4 A;  4O05 A;  4I3H A;  1PVG A;  3IED A;  1UYL A;  1YET A;  2YEI A;  1TC0 A;  5M4K A;  2XJJ A;  2YGE A;  1Z5A A;  5F5R A;  5CF0 A;  4FMT A;  5GGZ A;  4HYP A;  3O0I A;  5L3J A;  4AWO A;  2YI7 A;  1BKN A;  2XDL A;  2VW5 A;  2BTZ A;  4XKK A;  3D2R A;  3ZXO A;  1UY7 A;  4ZKI A;  4BQG A;  3FV5 A;  3TUH A;  4YKZ A;  2YEA A;  1Z5C A;  2YED A;  4Q20 A;  3RLP A;  3NMQ A;  3SL2 A;  3TZ5 A;  1NHI A;  3PEH A;  2BZ5 A;  3B27 A;  4PU9 A;  5D7R A;  3O2F A;  2WI3 A;  2C2A A;  4V26 A;  1Y8P A;  5FNC A;  3Q5K A;  4ZVI A;  2Q8I A;  5BOC A;  2QG2 A;  4HY1 A;  2JJC A;  5M4H A;  4CWN A;  1YT0 A;  4WUB A;  2UWD A;  2BU7 A;  2XDK A;  4B6C A;  1UYC A;  1BYQ A;  5J71 A;  4H85 A;  2BU8 A;  3DGE A;  5FNF A;  3A0R A;  1TBW A;  4JAS A;  2FXS A;  5CTW A;  3VHD A;  2YEF A;  3VHC A;  2QG0 A;  5D6Q A;  2WI4 A;  2JKI A;  1AJ6 A;  2XAB A;  3Q5L A;  3ZXQ A;  2O1U A;  2YKJ A;  1UY9 A;  4O04 A;  2YE5 A;  4E00 A;  2O1V A;  5F3K A;  3U2D A;  1B62 A;  2XDX A;  2EXL A;  2YE2 A;  3LMM A;  4MPE A;  2YEE A;  4XIR A;  1GKZ A;  2WEP A;  3ZKD A;  1QY8 A;  5IDJ A;  1YC4 A;  2XX5 A;  2YE8 A;  4HXZ A;  4ASG A;  3EHG A;  1UYG A;  4GEE A;  4NH9 A;  3K99 A;  1Y4U A;  3WHA A;  1TIL A;  1YC1 A;  3OPD A;  4BAE A;  1I58 A;  4XCL A; 
#chains in the Genus database with same CATH homology
 4R3M A;  4YKY A;  4MB9 A;  3K98 A;  4HXW A;  3OWD A;  3A0T A;  4XCJ A;  3ZKB A;  1YES A;  3HYY A;  4JAU A;  1UYD A;  2BRC A;  1ZW9 A;  2XDU A;  2YKB A;  2XHT A;  1B63 A;  4KFG A;  4MOT A;  1UYH A;  2YEH A;  1TID A;  2YE4 A;  4LPB A;  1GKX A;  4MPN A;  2E0A A;  2AKP A;  1YC3 A;  4ASF A;  1S16 A;  3EHH A;  3HEK A;  4U7O A;  3CRL A;  2WI5 A;  3R91 A;  3G7E A;  1AMW A;  4MPC A;  4R1F A;  1Y8N A;  2ZKJ A;  4HZ0 A;  3LNU A;  1AH6 A;  2XCM A;  3T1K A;  2YK9 A;  2IOP A;  4CWQ A;  3H4L A;  3HZ5 A;  3OWB A;  4YKU A;  4EM7 A;  3QDD A;  4URL A;  3HYZ A;  3T0H A;  4ASB A;  3INX A;  4EFU A;  2FWY A;  5M4M A;  5M4E A;  3HZ1 A;  2XHR A;  4O09 A;  2YKE A;  3TZ4 A;  4KP4 A;  1R62 A;  1UYF A;  1L0O A;  4BQJ A;  5J6A A;  3K97 A;  3VHA A;  1EA6 A;  4GFN A;  2XD6 A;  2YE6 A;  2XDS A;  3K60 A;  3B28 A;  1YT1 A;  4URM A;  4L93 A;  4PRX A;  5IN9 A;  4V25 A;  1H7S A;  1MU5 A;  3BM9 A;  3EHF A;  4BXI A;  1I5B A;  1YSZ A;  3KE6 A;  1H7U A;  2PNR A;  1KIJ A;  2QFO A;  4EEH A;  1UY6 A;  3GIF A;  2XX2 A;  1S14 A;  1ID0 A;  4CE2 A;  2YEJ A;  4PL9 A;  3H80 A;  4MP7 A;  3D36 A;  3VAD A;  1I5A A;  4WUD A;  4GQT A;  4U7N A;  4E01 A;  3R4O A;  2XK2 A;  2YE3 A;  4XKA A;  4KSG A;  1I5D A;  3G7B A;  4GT8 A;  1MX0 A;  1Z5B A;  3B24 A;  2BU6 A;  3EKO A;  4URO A;  4WUC A;  4K4O A;  1ZXM A;  1GJV A;  3T10 A;  4L8Z A;  2WI6 A;  4ASA A;  4R3A A;  2VCJ A;  1QYE A;  2YI6 A;  3TZ2 A;  4XTJ A;  4LWE A;  3G75 A;  4CWP A;  3EKR A;  4W7T A;  1Y8O A;  3CRK A;  4B7P A;  3CWV A;  2H8M A;  1JM6 A;  1UYE A;  2YE7 A;  4H7Q A;  4LWG A;  2Q8G A;  2Q2E B;  4O0B A;  3LPS A;  2BU5 A;  2BSM A;  4BIZ A;  4GCZ A;  2HG1 A;  3O6O A;  1TH8 A;  4PRV A;  1U0Z A;  4CWS A;  3GIG B;  2VWC A;  2Q8H A;  2WI1 A;  3OW6 A;  1UYI A;  4CE3 A;  3CGZ A;  2HKJ A;  1BGQ A;  3R4P A;  4BIU A;  2VCI A;  1US7 A;  3T2S A;  4YKQ A;  3A0X A;  2CCT A;  3GIG A;  4CWO A;  4EFT A;  2WER A;  2IWU A;  4QPK A;  4AS9 A;  2WI2 A;  4YKR A;  1THN A;  4FCQ A;  1U2O A;  4KQV A;  4E02 A;  4YKW A;  1YER A;  1BXD A;  5D7C A;  4U93 A;  3D0B A;  4EGH A;  1A4H A;  4JQL A;  1I5C A;  2YE9 A;  4LWH A;  2FYP A;  4L94 A;  2HCH A;  3MNR P;  4GGL A;  3RLQ A;  3R4N A;  4HYM A;  3A0Z A;  2CGF A;  1I59 A;  2WEQ A;  1Z59 A;  5CPH A;  1UYK A;  2XHX A;  5CTX A;  4XC0 A;  3WQ9 A;  3JZ3 A;  5C93 A;  3B26 A;  2YJX A;  4P7A A;  1AH8 A;  4KTN A;  4P8O A;  1TC6 A;  2IWS A;  2YEG A;  2BRE A;  2BU2 A;  2IOQ A;  3QTF A;  3U67 A;  4CWT A;  4H81 A;  2YGF A;  3TZ0 A;  3B25 A;  3FT5 A;  4KSH A;  2ZBK B;  4LWF A;  5D6P A;  1AM1 A;  2YI0 A;  1EI1 A;  4LWI A;  4DUH A;  2H55 A;  4L90 A;  2YEC A;  4CE1 A;  4L91 A;  4FCR A;  1ZWH A;  4XKO A;  1UYM A;  2XX4 A;  5D7D A;  2QF6 A;  2YKI A;  3BMY A;  2ZDX A;  2K5B A;  4XIQ A;  4AWQ A;  1KZN A;  3R4M A;  3OMU A;  1QZR A;  4DZY A;  3EHJ A;  1YSR A;  2BYH A;  2IOR A;  4NH8 A;  3RLR A;  4EGK A;  3U2K A;  4EGI A;  3ZM7 A;  4HY6 A;  1OSF A;  3PEJ A;  3CGY A;  3A0W A;  2YEB A;  3FT8 A;  3RKZ A;  2YGA A;  1YT2 A;  2YK2 A;  5FWK A;  2IWX A;  4I5S A;  1YS3 A;  2BT0 A;  2YI5 A;  5FND A;  4MBC A;  1NHH A;  3TTZ A;  4YKX A;  3GIE A;  4CWR A;  4QPJ A;  1ZXN A;  2WI7 A;  3Q5J A;  4URN A;  2YJW A;  2BYI A;  4AWP A;  2CCU A;  4HZ5 A;  3HHU A;  5BOD A;  3C11 A;  4FPP A;  4EMV A;  3A0Y A;  4XE2 A;  5M4P A;  2CCS A;  4XIP A;  5M4N A;  5IDM A;  4O07 A;  2CG9 A;  3INW A;  4XDM A;  4LP0 A;  4XD8 A;  2GQP A;  3C0E A;  4YKT A;  2GFD A;  4CWF A;  4NH7 A;  3R92 A;  2ESA A;  2O1W A;  2ZDY A;  1B3Q A;  2YKC A;  4XIT A;  1NHJ A;  1UY8 A;  4MP2 A;  3T0Z A;  1Y4S A;  2Q8F A;  5CTY A;  4JAV A;  2FWZ A;  4FCP A;  2XJG A;  4X9L A;  5CTU A;  2XJX A;  2CH4 A;  4O05 A;  4I3H A;  1PVG A;  3IED A;  1UYL A;  1YET A;  2YEI A;  1TC0 A;  5M4K A;  2XJJ A;  2YGE A;  1Z5A A;  5F5R A;  5CF0 A;  4FMT A;  5GGZ A;  4HYP A;  3O0I A;  5L3J A;  4AWO A;  2YI7 A;  1BKN A;  2XDL A;  2VW5 A;  2BTZ A;  4XKK A;  3D2R A;  3ZXO A;  1UY7 A;  4ZKI A;  4BQG A;  3FV5 A;  3TUH A;  4YKZ A;  2YEA A;  1Z5C A;  2YED A;  4Q20 A;  3RLP A;  3NMQ A;  3SL2 A;  3TZ5 A;  1NHI A;  3PEH A;  2BZ5 A;  3B27 A;  4PU9 A;  5D7R A;  3O2F A;  2WI3 A;  2C2A A;  4V26 A;  1Y8P A;  5FNC A;  3Q5K A;  4ZVI A;  2Q8I A;  5BOC A;  2QG2 A;  4HY1 A;  2JJC A;  5M4H A;  4CWN A;  1YT0 A;  4WUB A;  2UWD A;  2BU7 A;  2XDK A;  4B6C A;  1UYC A;  1BYQ A;  5J71 A;  4H85 A;  2BU8 A;  3DGE A;  5FNF A;  3A0R A;  1TBW A;  4JAS A;  2FXS A;  5CTW A;  3VHD A;  2YEF A;  3VHC A;  2QG0 A;  5D6Q A;  2WI4 A;  2JKI A;  1AJ6 A;  2XAB A;  3Q5L A;  3ZXQ A;  2O1U A;  2YKJ A;  1UY9 A;  4O04 A;  2YE5 A;  4E00 A;  2O1V A;  5F3K A;  3U2D A;  1B62 A;  2XDX A;  2EXL A;  2YE2 A;  4MPE A;  2YEE A;  4XIR A;  1GKZ A;  2WEP A;  3ZKD A;  1QY8 A;  5IDJ A;  1YC4 A;  2XX5 A;  2YE8 A;  4HXZ A;  4ASG A;  3EHG A;  1UYG A;  4GEE A;  4NH9 A;  3K99 A;  1Y4U A;  3WHA A;  1TIL A;  1YC1 A;  3OPD A;  4BAE A;  1I58 A;  4XCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...