1U2VB

Crystal structure of arp2/3 complex with bound adp and calcium
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
204
structure length
204
Chain Sequence
YAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-Related Protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
molecule tags Structural protein
total genus 57
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1u2vB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1u2vB02
1NGBA 1HX1A 1ZXOA 2QWQA 3CJ7A 4CBWA 2P9KA 3VGLA 3MK6A 5KPTA 3VF6A 2P9SA 4CD3A 3ZEUB 5EY4A 3SK3A 1TUYA 4BROA 2QW9A 2A6AA 4H5VA 5AQXA 3ULEB 2ZGZA 2D0OA 4BC4A 3CERA 3A5NC 2AP1A 3FZHA 5EVZA 1TUUA 4WQ4A 3WQUA 5CE3A 4Z94A 4LC9B 1SQKA 3ID8A 2A3ZA 3W3DA 3ZX3A 4PKGA 1X3NA 3JXUA 3TPQA 2FSKA 2ASPA 4HTLA 4CJ7A 2V7ZA 2GUPA 3H1VX 1SZ2A 4FWOA 4CBXA 4RCHA 5BRFA 3HM8A 4BRGA 4CZLA 4JD2B 4QS9A 5BR9A 3J8AA 1BA0A 1HPMA 4EFHA 3BF3A 3RSEA 4BQLA 4BRLA 4K25A 5AQLA 5KPRA 3WXKA 3O8MA 2ASMA 3DXKA 5FPEA 2P9PB 3CJ9A 2ZGYA 1YVNA 3R6MA 4L3QA 3LDLA 3H1QA 1ATNA 3C0BA 3M6GA 4WYBA 3R9PA 4AM6A 1BDGA 2HF3A 3O4WA 2D1KA 1E4FT 5JLFA 5FPDA 3HI0A 4HWIA 1NLVA 4FOIA 4MO5A 1V4TA 2NZTA 3UKUB 4XH1A 2ZWHA 1X3MA 3WEEA 3U9ZA 4ISFA 4IZ9A 1JCFA 5AQJA 4FWPA 3DXMA 3U9DA 5BN8A 3BP8A 3MN6A 5BREA 1Z6RA 4MO4A 3LL3A 2P9KB 2FLOA 4RTFD 3B8AX 2P9SB 5AQSA 1NGDA 5AZIB 4BRKA 4ISGA 3BF1A 4Y0WA 2YHWA 3DWLA 3QDKA 1DGKN 3CETA 4H5TA 4H5RA 3CQYA 2YCHA 1RFQA 3QICA 5F0XA 3GBTA 1XUPO 1GLEG 3H3NO 4H0VB 4BVOA 1NMDA 2J4RA 5AQMA 2QWRA 1IG8A 4IJNA 2IVPA 4FL9A 3QBXA 3EZWA 3L0QA 2QWNA 4BRNA 2P9IA 3DAWA 3SMSA 3AAQA 4B9QA 1U2VA 2QXLA 5EX5A 3KHYA 2BTFA 1CZAN 2P9UB 3H46O 3GDQA 3W0LA 3ENOA 3P4IA 1LCUA 3LDPA 3RSEB 2CGJA 3C7NA 2E1YA 3I8BA 1TYQA 2IIRA 3GE1A 4CD1A 5LJWA 4CZMA 3MCPA 1RGIA 5AQVA 1YUWA 2ITMA 5LY3A 5FPMA 4IWVA 3H6EA 2IVOA 4BR2A 1Z05A 5BPMA 3DXKB 1K8KA 1NGFA 2Q2RA 5KQDA 3ZETB 4BC2A 1BA1A 1MWKA 2GEMA 3QB0A 4FPAA 5AFUH 2QWLA 3WXJA 4CBUA 3QBWA 4BR7A 2I7PA 2GTDA 4IO8A 2UYTA 3MN7A 1BOTO 5JMVA 4WQ5C 3AAPA 2QWMA 4I6MA 3VEWA 3EN9A 1NGIA 2VCPA 2YJFA 2FF3B 2BUPA 2GWJA 3SLCA 4FWLA 5AFUA 5AQUA 1HLUA 1HJOA 1GLAG 5F2RA 3O08A 3S41A 1MA9B 1SAZA 3HBTA 3G25A 3QMLA 2D0PA 2IVNA 2YJEA 5F1XA 5BRDA 5AQYA 2Q0UA 4ISEA 2FF6A 1YAGA 3UE5A 1C0FA 1IJJA 5AQNA 5AQRA 5LJVA 3M3ZA 4H0YB 4CZFA 4BRDA 4FOEA 3AY9A 2EWSA 3SJHA 1DEJA 1DKGD 2A41A 3FZLA 2F9TA 3VOVA 3EKUA 2Q97A 3H45C 4E1JA 2A5XA 4BC3A 2FSNA 3LDOA 4IJAA 1ATSA 1R59O 3CHWA 3FFKB 4IXCA 2P9IB 2Q1NA 5I9EB 1T6DA 3GOIA 1EQYA 5AQWA 2P9NA 2Q36A 3ATVA 3VPZA 4BR9A 3KZBA 1RDWX 1QQNA 3FGUA 2CH5A 3C7NB 3EO3A 4PL7A 1Q18A 5JLHA 1TYQB 4CZKA 4H0PA 1GLLO 3IUCA 3LDQA 3LM2A 2ZF5O 4FPBA 4DHYA 4BG9A 4BG8A 3CIPA 5E84A 2QWOA 3CJAA 3AARA 4WQ5A 4H0TB 1K8KB 3SMPA 3ATUA 4FO0A 1JCEA 5JICA 2A40A 3HZ6A 5ADXH 3O6WA 3L6QA 5BN9A 1MWMA 2F9WA 2QM1A 3ZX2A 3GG4A 1QZ5A 4BR5A 4A61A 3O1WA 4JD2A 3CJCA 2E2OA 2E8AA 4FWSA 2DPNA 4BGBA 3EKSA 1QQOA 3TU5A 3WUHA 1E4GT 5TKYA 4BC5A 2Q31A 4CZGA 5ADXA 4J8FA 4FWRA 2YHYA 1KAXA 4NB4A 3FZKA 3A5LC 2OANA 2E2NA 1BU6O 3H3OB 4M7YA 1BO5O 4B1UB 4BRMA 4EIAA 3FE1A 2CH6A 3UKRA 5AQTA 2WUSA 2HF4A 2A42A 2E2QA 5AQGA 2I7NA 4BRFA 2Q0RA 4XH4A 4FWNA 3UKUA 2PBDA 3F9MA 3KVGA 3VEYA 1GLJO 2PAVA 4FWQA 3VEOA 4RWTA 3O5BA 3DJCA 4BRHA 4K43A 1ZC6A 4KBOA 2GELA 3BUZB 4BRPA 5AZJA 2ASOA 4H0OA 4MLHA 2E1ZA 3IDHA 5EOYA 5AQKA 3QFPA 4DQ8A 1X9JA 3WT0A 3WEEB 5KPZA 2P9NB 3D2EA 4H03B 1XC3A 3CI5A 5ELZA 4B1YB 3MMVA 3WQTA 3GL1A 2QWPA 3DXMB 2VYPA 2KHOA 3A5MC 5AQOA 4CZIA 5BPLA 3FZFA 1NGHA 5AZIA 2V7YA 4C23A 3MN5A 2E20A 3U8XA 3D2FA 3JS6A 2W40A 5AR0A 3CJ1A 4EAHD 1NGGA 4H5NA 4H5WA 4O5FA 3ENHA 3VENA 3WXIA 4BREA 5BPNA 3A0IX 4XEIA 2HOEA 4JAXA 2AA4A 3FLCO 4DCHA 1T6CA 1KAZA 3VF4A 1ATRA 5FPNA 1HKGA 2W41A 4FSVA 3QFUA 4BVPA 3OHRA 1GLFO 2D4WA 1NM1A 2GWKA 3WXLA 4BR0A 1U6ZA 2FXUA 5KQ8A 1WOQA 2P9UA 5B8HA 3VESA 3UB5A 2P9LA 2NRHA 5AQFA 4F9OA 4JHDA 3HTVA 1HUXA 3I33A 4B1XB 2YI1A 2NLXA 1ESVA 3FR0A 3IFRA 4CZHA 3HSCA 1OKJA 5AQIA 3VEVA 4YDUC 1KAYA 1U2VB 4MLEA 3ZEUA 5AQQA 2CGLA 3O80A 3MDQA 3EL2A 2V51B 3UKRB 3FZMA 2E88A 3ZETA 3ULEA 4BRQA 3BEXA 4O8KA 2E2PA 4PKIA 5AQHA 4PL8A 3D7EO 1ZBSA 5BRHA 2CGKA 1C0GA 4K42A 1H1VA 5AQPA 4QS8A 4FWKA 4M63C 5AZJB 2FSJA 3L4IA 2VWBA 4BRIA 4WQ4C 1NGJA 4B1WB 4QS7A 2H3GX 1NGCA 1BG3A 3VF2A 4GNIA 1HKCA 3U4LA 4I6MB 3MN9A 1HKBA 2HMPA 1NWKA 4CI6A 3D2EB 4FWMA 5AQZA 1NGAA 4PKHA 5EXWA 1NBWA 1BWFO 4JNEA 4A2BA 4A2AA 4BRAA 1G99A 4M7XA 4JN4A 3IMXA 3D2FB 1QZ6A 1XQSC 3LDNA 4BRCA 1JCGA 4EHUA 3VETA 1YXQA 3M1FA 3R8EA 1KXPA 4GY2B 2V52B 4H0XB 3ZX0A 2P9PA 4BGAA 1D4XA 3VGMA 3LM9A 1NGEA 1GLBG 4DB3A 3VERA 4A62A 4EHTA 4BQZA 3VEZA 4B1VA 2YHXA 4BR4A 1V4SA 4NO7A 1J6ZA 1Y64A 3O1BA 1MDUB 4K41A 4CZEA 1WUAA 1QQMA 3CQXA 5E26A 1S22A 1GLDG 1P8ZA 1BUPA 4CZJA 4XH5A 4B1ZA 1QHAA 3A5OC 4YDUA 1GLCG 3CJBA 3VGKA 4AM7A 2P9LB 3VEXA 3A8YA 4JHDB 1LOTB 1S3XA 1T44A
chains in the Genus database with same CATH superfamily
1BGXT 3CJ7A 1HX1A 3KLHA 3AO1A 2BANA 4CBWA 2P9KA 3MK6A 4E3SA 2P9SA 3HPGA 3ZEUB 1OH8A 1CXUA 3I0SA 3TANA 2A6AA 4H5VA 1Z25A 4BDZA 1W9HA 3KKSA 3K5LA 3CCJN 4BC4A 2X74A 4CHOA 1SKSA 4DQSA 3OA9A 4FM0A 3DLHA 3CERA 3OYGA 3FZHA 1EETA 4JRQA 2VG6A 3HP9A 3AV9A 2A3ZA 3THYB 1S1XA 4E7JA 1VSDA 1NJXA 3JXUA 2FSKA 5FLXO 3RR7A 4B3OA 1SZ2A 4DU3A 2GV9A 4BRGA 1YITN 3HPHA 4AHRA 2P5GA 3RWUA 4CHNA 3RSEA 2XY7A 3HOSA 3V4IA 3C65A 2Q3SA 4IDKA 3J7ZO 2XHBA 2E5LK 3THWB 3O8MA 2ASMA 4CK3A 2P9PB 3R6MA 4L3QA 3LDLA 3H1QA 4JKFA 1BDGA 4O0IA 2GUIA 5D3GA 1ZBFA 3E01A 2P5OA 1VSIA 4IEEA 1VQPN 4FYDA 3LP2A 4DV0K 5DMRA 4QOZB 3UKUB 2ZWHA 3P38A 5HLFA 1X3MA 2E6MA 3VQ8A 5GAHP 2NRWA 3DXMA 4JYAK 3O3GA 5HP1A 3NF9A 5FROA 3O9QA 3HSTB 3MN6A 1ZBUA 4KH6A 3MEGA 3ZT1A 3HJFA 4ELTA 3V9WA 1HQEA 4RTFD 3B8AX 1VQNN 1VSKA 3VA0A 2OZSA 4Y0WA 1EXQA 5C2FA 2YHWA 3PY8A 4A59A 1IV0A 1RNHA 3ZSVA 5I3UA 3QDKA 3EEQA 2G8HA 2YCHA 1RFQA 1MU2A 2O4GA 4JRPA 3CCQN 3H3NO 4H0VB 5E41A 3HXMA 2J4RA 5AQMA 2QWRA 3KK3A 4FL9A 4YOXA 3EZWA 4W5OA 1OH6A 4BRNA 3D45A 3SMSA 3AAQA 2O8FA 3PLAA 1CZAN 4DMNA 2P9UB 4OPJA 1M90O 4BDPA 3W0LA 1XNRK 1LCUA 3LDPA 3LDSA 3T1HK 1T8EA 4CD1A 1N34K 3S3OA 1HQUA 3MCPA 1NK7A 4CGDA 1DTQA 1XI1A 4DTJA 3DLEA 5FPMA 1J54A 3THVA 2IVOA 3SQ4A 3CCVN 1WSIA 1RBUA 1VRTA 4EZ9A 5GAEP 5KQDA 1BIUA 2IDOA 1BI4B 1KD1O 4CERA 3ZSRA 2YNFA 4JK8A 3THXB 4FVUA 2GTDA 4CK1A 4UY8O 2UXCK 5JMVA 3AAPA 2QWMA 1ZYQA 4I6MA 1NGIA 4Z4HA 2YJFA 2FF3B 4EP4A 3CCUN 2BUPA 4DF4A 1Y97A 1HLUA 1YF5L 3MWPA 1HJOA 4FM1A 5HRPA 3CMAN 1MA9B 1SAZA 1VSHA 4DSIA 3DOKA 1JLCA 4N76A 2KTQA 4H4MA 3SUOA 1XWLA 3ZSZA 5LJVA 4H0YB 4FLTA 4BRDA 4KFBA 1KCFA 4MQ3A 2JLEA 1DEJA 1K73O 2UUCK 3FZLA 2F9TA 5C2DA 3VOVA 4DFPA 3EKUA 4DFJA 4DQIA 2Q97A 3PIPL 3KWGA 4IOAL 4NXNK 1QVGM 4DF8A 4BC3A 4CEAA 2XY6A 3F73A 4IXCA 2P9IB 5I9EB 1EQYA 1HJRA 3VPZA 4CJQA 1R0AA 1RDWX 3FGUA 4O0JA 1S1VA 4PL7A 3MX2A 1TYQB 1ASUA 1GLLO 2X6SA 2KKZA 5M1PA 4NCAA 4B9UA 4PHTX 4BG9A 4JI5K 1W97L 4HCCA 2QWOA 4N5SA 1RT7A 4DV5K 3AARA 4H0TB 3VQAA 4JI2K 1K8KB 3K2PA 1NOYA 2RN2A 4GV3A 4XIUA 4K8XA 3IAYA 3AGKA 5ADXH 2QKKA 3O6WA 1C6VA 2F9WA 2QM1A 3ZX2A 4DTPA 5JVHL 3MEEA 2YHBA 3O1WA 4JD2A 3ZYYX 2E8AA 5A2QO 2DPNA 4CEFA 3TU5A 3KLIA 5ADXA 4CZGA 1NJWA 3S5TA 3TWHA 4J8FA 4FK0A 1C1CA 3PSFA 4NB4A 3FZKA 1JKHA 4I2PA 1RBSA 4M7YA 5KRSA 4EIAA 2KFNA 3NH0A 4CHZA 5AQTA 3LPTA 1VSLA 1TKXA 3CXCM 5JENA 4E1MA 2D5RA 5AQGA 2P1JA 3CCLN 2I7NA 1VAZA 3R3LA 4XH4A 4EZ6A 3SQ1A 5GADP 3ID6A 4DQRA 1LAVA 3RVCA 4ZTJA 3VEYA 4I9QA 4DV1K 1N32K 2NRTA 1GLJO 4RWTA 3AA4A 3O5BA 3SQ0A 4KTQA 3DJCA 3TABA 4E7LA 3CCEN 1RTHA 1EWRA 1W2BM 3BUZB 3PX4A 1N33K 1IKXA 2O8EA 2OPRA 4AH9A 2HBMA 5EOYA 5AQKA 1OVYA 4DTXA 2Z1JA 2ETJA 2VG7A 1HNIA 3WEEB 2P9NB 3LANA 2HNZA 3RMBA 3CI5A 5ELZA 3QEPA 2VYPA 1BQMA 3A5MC 4CZIA 5DK5A 1J9AA 4DV4K 3MN5A 3NVKA 2E20A 4DFKA 4B3RK 3QESA 3ENHA 3VENA 1XNQK 3WXIA 5BPNA 3A0IX 4XEIA 3OYBA 3U3GA 1WBBA 1RTJA 2DFFA 3C95A 1LWFA 1T6CA 1KAZA 4JI7K 3VN5A 4CJVA 5FPNA 4WFNL 4DSLA 4CIEA 3F9KA 1S1WA 4JKGB 4F3TA 5KRTA 1S5JA 3WNGA 3DI6A 3RR8A 3OYKA 2HHWA 2YNHA 2FXUA 5B8HA 4B9TA 3UB5A 4LF7K 3H08A 2NRHA 3ZSXA 4F9OA 4ZHRA 1B9FA 4JHDA 1OH5A 1HUXA 1TAQA 4B1XB 3KD5E 4JI0K 4UQGA 4F3OA 1SL1A 3IFRA 3HSCA 4KREA 1KAYA 1U2VB 1QQCA 4MLEA 4CJFA 3O80A 3MDQA 3K58A 3IS9A 1IBKK 5KI6A 3UKRB 2E6LA 3ZETA 3OTOK 4Y1DA 4DR4K 5J2NA 4PKIA 3NBPA 2VQEK 4DTOA 3D7EO 4N56A 5BRHA 4KRFA 1KTQA 4Z0UA 1I39A 4CEZA 4K42A 5AQPA 4CJEA 1GOAA 5J2PA 2FSJA 4BRIA 1JXEA 1UOCA 3M8RA 4ILJA 1BG3A 4LD0A 4BE7B 2OZMA 2B5JA 1S1UA 4IDHA 3D2EB 4PKHA 5EXWA 4CJLA 4JNEA 1NK8A 1ILYA 5HRNA 3MXMA 4B3MK 1WBDA 1IO2A 1QS4A 1OVQA 3O9SA 3IMXA 3D2FB 1XQSC 3LDNA 1YJ9N 2KLAA 5GINA 1QTMA 2HHSA 1VQ7N 3M1FA 3R8EA 4GY2B 4H0XB 3ZX0A 3VGMA 3LAMA 3LM9A 4EHTA 4BQZA 4KB1A 4Z4CA 1V4SA 1IH7A 2EHGA 4CZEA 3UIQA 5E26A 4GVEA 4CZJA 1TV6A 4CJTA 3VGKA 2O8BA 2I5JA 4M3RA 4FJXA 3I8DA 1KVBA 5J2QA 3VGLA 4HTUA 3AVFA 4OX9K 2O8DA 4BROA 4O55A 1EP4A 3ULEB 1TL1A 4WCEL 2ZGZA 2D0OA 4O5BA 4DQPA 3ALYA 2D0CA 5GAGP 3R1XA 4JK7A 1WSEA 5CE3A 1TUUA 1D9FA 2RPIA 3ID8A 1OH7A 4KHQA 3L2WA 1RBVA 3TPQA 4I7FA 1C0UA 1QVFM 2GUPA 3H1VX 4CJ4A 5JS1A 2QXFA 3C94A 4AHVA 4C8MA 4CZLA 4DU1A 4JI3K 4QS9A 5HROA 5BR9A 2IAJA 3EZ5A 3NGYA 4A57A 3M8QA 5FRNA 1S9GA 5AQLA 5I42A 5KPRA 3SUPA 5FPEA 4KHNA 4NCGA 1YVNA 3M6GA 3C0BA 4AF1A 3CFRA 2HF3A 3S3NA 5FPDA 4CFDA 3CF5L 3V1OA 2ZJPL 5KTQA 1S6QA 3L8BA 4FJIA 4CEOA 3AA2A 2WBNA 1JCFA 3OYCA 2G8FA 4CHPA 1A5WA 4E7IA 4CJ3A 5BREA 1KFDA 1VSFA 3LL3A 2P9KB 2FLOA 1RBTA 1U49A 2P9SB 4ELUA 4DR3K 1J5EK 2HHHK 1RDCA 1NGDA 5AZIB 4BRKA 4ISGA 3BF1A 1L5UA 3BZKA 3Q7CA 4DS5A 3DWLA 1X1PA 1YJWN 2VGMA 3OYJA 3LP3A 3HM9A 1SS6A 3OVNA 1IG8A 1C0MA 4IJNA 3L0QA 2OPSA 4LFCK 3KIOA 3DAWA 2RF2A 2PYLA 1ASWA 4B9QA 1T05A 3VQQA 3KHYA 3P4IA 3RSEB 3C7NA 2E1YA 4FXDA 4BDYA 2WTUA 2IIRA 1A5VA 1RT2A 4CZMA 1RGIA 5AQVA 5J1EA 3S3MA 2IGIA 4H4OA 1D5AA 1YUWA 1ZBLA 3VQ5A 4BR2A 4IFVA 3SV4A 5BPMA 3CC4N 3RRHA 3NF7A 1SKWA 4CGFA 4FJLA 4CHYA 4B9NA 3QNNA 3QB0A 2W6KA 5AFUH 3VQ6A 3EY1A 4B8CA 4BR7A 2I7PA 1N36K 4IO8A 2UYTA 1RT4A 3FFIA 3MN7A 5HOOA 1BOTO 1HNXK 4AQYK 4LSLA 1S6PA 3EN9A 3VEWA 4FJJA 5AFUA 3WNEA 5AQUA 2VQFK 3AVHA 3ZCMA 3HL8A 3VQCA 1C1BA 3WNFA 4DSEA 2NUBA 3QMLA 2VWKA 3WXMB 1HR0K 2YJEA 1LWEA 3SYZA 5BRDA 5AQYA 4HVJA 3SAFA 2Q0UA 4IKFA 1HMVA 5AQNA 1NKCA 4QCLA 3M3ZA 4NCBA 4Y1CA 4JI6K 4L8RB 3VMFB 1IG9A 3SJHA 1NNEA 4YOWA 3EE9A 3T19A 4DR7K 3L2VA 3TTFA 2OTLN 3LDOA 3NE6A 3FFKB 4H8KA 2A1RA 4PA1A 4GV9A 3DLLL 1T6DA 5AQWA 2O8FB 2FC0A 3AVKA 3DLGA 4BR9A 3KZBA 1YJNN 1WLJA 2CH5A 4DTMA 4X64K 4J2DA 3QEIA 1IBMK 1REVA 4CIFA 1IBLK 4OJRA 1NJIO 3LM2A 4DHYA 4DU4A 2HHVA 4ID1A 2E4LA 3THYA 4JK9A 1DTTA 2NRXA 4FO0A 1JCEA 4IFYA 4BY9C 2F7TA 4FLZA 1BQNA 1QZ5A 4BR5A 3BY5A 4F8RA 2E2OA 4FWSA 1RTDA 4FJMA 4ILGB 1QQOA 5M1NA 1W7AA 3D0PA 4PY5A 1KVCA 2YHYA 3AA5X 4FWRA 2E2NA 4KTZA 4BRMA 3OYHA 2VG5A 3OYMA 3FE1A 2CH6A 2HNYA 3O4QA 3NMUA 3KLFA 2WUSA 3SPYA 3VQ9A 5CYQA 3T7ZA 3N4PA 2X78A 4FWNA 4IG0A 3UKUA 4CW7B 4DV3K 2PBDA 3DRPA 2EX3A 5CHIA 3MAQA 3VEOA 2PAVA 4FWQA 2LSNA 4BRHA 4K43A 4CEEA 2GELA 4BRPA 2E1ZA 2OA8A 4FJ8A 1CXQA 3LP0A 3IDHA 4PQUA 3QFPA 4F4KA 4FLYA 4B1YB 4EP5A 5BPLA 1WSJA 2W40A 3ZT3A 3KK2A 3CJ1A 4EAHD 4KI4A 4H5NA 3O3HA 1G15A 4O5FA 4BE0A 2C1IA 2OTJN 1TKTA 2D0BA 2HOEA 2AA4A 4DCHA 5C25A 4BACA 4IOCL 1FK9A 1ATRA 4HUGA 1DLOA 2VGNA 4E0DA 3VQDA 1HKGA 1SUQA 2W41A 3KK1A 3QFUA 4BVPA 4E19A 3AVLA 1GLFO 3LALA 4KH5A 2OCEA 3TSPA 1J5OA 3O9UA 2HW3A 3WXLA 5T7BA 1WOQA 2P9UA 3CPWM 3DLBA 2P9LA 1TAUA 3HTVA 1HYZA 4RW8A 4RW9A 1ESVA 2PYJA 4WFAL 4F2SA 4YDUC 2NRVA 4CJSA 4FZXC 2V51B 2QA4N 4BRQA 1BI4A 3MECA 2HHXA 3LZJA 5AQHA 5K14A 3THXA 1ZBSA 4A5AA 3OYLA 1C0GA 3O4NA 4GMJB 2D0AA 2W42A 4CE9A 4DUZK 4M63C 1T7PA 1T03A 1FKPA 4O8UA 3L4IA 4WQ4C 4B1WB 1LW0A 2H3GX 2O8EB 2W6LA 4O44A 3L2RA 4BWMA 3VQEA 1YVUA 3MN9A 2VWJA 1NWKA 4B9SA 4FWMA 3QINA 2WONA 1BWFO 1XHZA 3OYEA 4M7XA 1L3UA 3E66A 2RHKA 2DTUA 3VETA 1Q9XA 3OS2A 5TKWA 5JVGL 5KGXA 4FM2A 2ZM6K 4V19S 4CF8A 4B9LA 3T69A 2HHQA 4A62A 5C42A 4BR4A 2YHXA 3NGZA 4NO7A 1J6ZA 1Y64A 1K8AO 4IO9L 1QQMA 4B8AB 3OW2M 1S22A 1BUPA 3VA3A 2GBZA 3DLKA 4B1ZA 3A5OC 4M3WA 1VQ4N 1TGOA 1U47A 3OY9A 3VEXA 4LY7A 4JHDB 1LOTB 4WE1A 1T44A 4IOXA 4FJ7A 1NGBA 1VQLN 1ZXOA 2QWQA 3IG1A 1J53A 3CC7N 5KPTA 3I55N 3VF6A 4DTUA 3O9RA 4K0KK 3SK3A 1YT3A 4Q0BA 3SCXA 2AJQA 5LMNK 4Q5VA 2YX6A 1FJGK 4B3TK 4LF8K 4FVMA 2F8SA 4DUYK 1SL0A 3PSIA 1HYSA 1LAWA 2AP1A 1NK0A 4Z94A 4LC9B 3ASMA 1SQKA 2KW4A 3W3DA 3QEXA 4MFBA 4Z4EA 5C0YA 4PKGA 4OPHA 1IKYA 3K5OA 3VQPA 2PFUA 3HVRA 4DFMA 2ASPA 4CJ7A 1BIZA 2C1GA 3LWMA 5FDLA 4BWJA 4DSKA 3G10A 4BE1A 1JXBA 4FWOA 3V1QA 3JSMA 4RCHA 5BRFA 4DWIA 4CJKA 4FZZA 3J8AA 2DFEA 2Z1IA 3V1RA 4FLVA 5IT9O 4BQLA 4BRLA 4KHYA 2OPPA 4K25A 4JI4K 3WXKA 4X65K 3MEDA 3DXKA 1U45A 1WN7A 4JKHA 3U3YA 3R9PA 1BCMA 2YV0X 4YHHK 1WSFA 2D1KA 5JLFA 2ZQBA 4YNQA 2YKMA 1JLGA 1NLVA 2WFBA 1JLEA 1V4TA 2NZTA 4MO5A 5MLCQ 3KLGA 4YORA 3WEEA 3U9ZA 3LZIA 4IZ9A 2UU9K 5AQJA 2BGGA 3CD6N 2O8BB 4KHUA 3DOLA 3V9XA 3V9UA 3ITHA 4MDAA 4OKKA 1VQ8N 1UAXA 2O8DB 4KHSA 1T3VA 4G1QA 4NYFA 3NHGA 3MXJA 3NCIA 1NJYA 1NU0A 3QLHA 4JKGA 1GOBA 4DV2K 4H5RA 3CQYA 3O9TA 1NK4A 3QICA 3ZT0A 5F0XA 2QTDA 3GBTA 3AVCA 1XUPO 3VQ4A 4CHQA 3SAGA 4BVOA 2ITGA 2OYQA 4IBNA 1NMDA 3AVNA 3E9PA 4JKEA 2IVPA 4JLHA 3J7YP 1TK0A 2QWNA 3B6OA 4M45A 3CYGA 2QK9A 1U2VA 1BHLA 5EX5A 1XC9A 2BTFA 1HYVA 3H46O 3OJUA 4YOVA 3M8PA 4E72A 3I8BA 1KC8O 3CYMA 3GE1A 4OLBA 1Q86O 4PWDA 1Q81O 3PIOL 3OJSA 4LFBK 3V9SA 3DRRA 1Z05A 5HL7L 4ILHA 1NGFA 4FZYA 2Q2RA 1VK0A 1EX4A 3DRSA 4J2EA 4BC2A 1BA1A 3WXJA 2QWLA 2IS3A 2HVIA 2PZSA 3E9OA 1VQMN 1RDAA 3CC2N 4J2BA 1NKBA 3N4QA 5HRSA 4WQ5C 5DM6L 1VRUA 1KQSM 2GWJA 3SLCA 4QAGA 3SQ2A 1GLAG 1VSJA 2W00A 3JAMO 2NRRA 3NFAA 2D0PA 4Z4GA 1NMNA 1BISA 5F1XA 1BCOA 1LWCA 1YI2N 4OLAA 1KFSA 2UUBK 4DR5K 3UE5A 1C0FA 5AQRA 4OPKA 4OO1J 1KSPA 1GOCA 1RT3A 2EWSA 3SNNA 1ZBIA 4E1JA 4Z4FA 4NLCA 3F5TA 1RTIA 2IOCA 1R59O 4HUFA 2Q1NA 4A5BA 3GOIA 3K5MA 4OGCA 2NRZA 2Q36A 3AGRA 3DMJA 4OKJA 1S1TA 5GIOA 2O8CA 3C7NB 4RW7A 3EO3A 1Q18A 4H0PA 3IUCA 1VSMA 3LDQA 4BG8A 4OKEA 4R79A 3SPZA 3CCRN 3SMPA 3ATUA 4LF6K 1RILA 4KV8A 2HVHA 5JICA 3T1AA 2A40A 3HZ6A 3L6QA 1MWMA 2FBYA 3GG4A 1YIJN 4A61A 1TL3A 3TI0A 1TK8A 3VTIA 3CJCA 2UXBK 5SWMA 3OS0A 3G6EN 3EKSA 4DR2K 3KKRA 2XRIA 3WUHA 3EE8A 5TKYA 4BC5A 1DT9A 1N8RO 4U67L 3NF6A 3A5LC 1HNWK 2OANA 3PX6A 1BU6O 2XO7A 3H3OB 1BO5O 3SAHA 1N6QA 4FJ5A 2QKBA 3G4SN 4IEIA 3A2FA 3SBGA 3HPOA 3VQBA 2A42A 2E2QA 3SUQA 4JKDA 2RKIA 1VQ6N 3CPEA 4KI6A 4RG8A 3KVGA 3QERA 3AVJA 3J81O 2HB5A 3AVMA 3QETA 1HNVA 4FLXA 4JEPA 4LF9K 5AZJA 4H0OA 4MLHA 1NKEA 4CK2A 4FLWA 4DQ8A 4JS5A 1X9JA 3WT0A 3CFOA 5KPZA 1XC3A 2B6AA 3MMVA 2QWPA 4CF2A 3DXMB 2KHOA 3FZFA 1NGHA 5AZIA 1RBRA 2V7YA 4CGJA 3JS6A 2YHAA 1NGGA 1CLQA 4OVLA 4H5WA 4GKJK 4BREA 4FK2A 2Y1IA 4JAXA 1FXXA 1WAFA 3FLCO 3P5JA 4NLBA 4FJHA 4CF0A 2B4JA 1VHXA 2GWKA 4YOUA 2BE2A 1KVAA 4BR0A 1UWBA 3V81A 2DFHA 1QSLA 3E1YA 5KQ8A 3CQ8A 3QNOA 3VESA 4HCBA 5AQFA 3P31A 3AVBA 2F4VK 3I33A 3PUFA 1U04A 5LL6Z 3AO3A 4CEQA 3QIOA 2HSTA 2NLXA 4BE2A 4CECA 1OKJA 3VEVA 3ZEUA 4CFCA 5AQQA 3I0RA 4FW2A 2XY8A 2ZE2A 5JS2A 2E2PA 3LWLA 3K9KA 4FW1A 2GX9A 4PL8A 4DV7K 4AHSA 1NK9A 4WFBL 1KRPA 5FRMA 2BH1A 2CGKA 3AVIA 5BR8K 4MDBA 1D8YA 1H1VA 4JKBA 4FWKA 4CJ5A 1NGJA 3TSQA 4QS7A 1I94K 4GNIA 4CEDA 4I6MB 3L4QA 4CGIA 3TARA 4FJKA 2YNIA 1F21A 4CESA 1NBWA 5GIPA 3T1YK 4A2BA 4A2AA 4BRAA 5M1KA 4CVNE 5LMUK 4I9LA 1XMQK 4EHUA 3K0SA 3SI6A 3THWA 5CZ2A 1YXQA 3OS1A 1NK6A 2V52B 2YNGA 4F2RA 2P9PA 4BGAA 4KH4A 2ZJQL 1NGEA 1GLBG 4DB3A 3VERA 1TKDA 3PO5A 4C8OA 4LSNA 5CZ1A 4JI1K 4FLUA 4M3ZA 3C6HA 3VEZA 4KTWA 5SZTA 3QEVA 3TAPA 1U48A 4DTNA 2Z1GA 3CQXA 3MX5A 4LF4K 1P8ZA 4YDUA 1C1AA 2OPQA 1GLCG 4AM7A 4LFAK 2P9LB 1VQKN 1YTUA 4BECA 2A1SA 4ICLA 3HO1A 3L3VA 4CD3A 5EY4A 1TUYA 3MCAB 4CJRA 4K8ZA 3CM6A 2QW9A 1HPZA 5AQXA 1KLNA 4DV6K 2HBKA 4AHCA 2IC3A 3AVAA 3J7AP 3A5NC 4JI8K 5EVZA 3WQUA 4WQ4A 2KZMA 4OGEA 3NDKA 3ZX3A 2F8TA 4J2AA 4M3XA 1X3NA 4CF1A 2BDPA 1O1WA 3K57A 1NK5A 4HTLA 5KGWA 2V7ZA 3RTVA 2DY4A 5HRRA 3JYTA 2JGUA 3AA3A 4HHTA 3BZCA 4CBXA 2G8VA 3HM8A 4KKOA 3HT3A 4JD2B 1W0HA 5IWAK 4GV6A 1ITGA 1BA0A 1RDBA 1HPMA 4LF5K 4EFHA 3BF3A 4DSJA 1X9MA 3QIPA 2UXDK 3HRGA 4B9VA 4CJWA 4AHTA 1XHXA 3O3FA 3CJ9A 2ZGYA 4ZTFA 3QEWA 1ATNA 4WYBA 4AM6A 4TSXA 3O4WA 1E4FT 5C10A 4C1NI 2P51A 3PX0A 3HI0A 4HWIA 4FOIA 3TR8A 1Q82O 2FBVA 3CFPA 4XH1A 4B08A 4ISFA 3C6AA 3TTDA 1K9MO 4FWPA 3U9DA 5BN8A 3KWIA 1Q7YO 3HK2A 3BP8A 4W5QA 1QHTA 3DM2A 4JV5K 1IKWA 5AJ3K 2KQ2A 1Z6RA 4MO4A 1RDDA 2WOMA 3B6PA 4YOTA 3NF8A 1Q8IA 4X62K 5AQSA 2PY5A 2G8UA 1HRHA 3OBWA 1EWQA 3RRGA 2UUAK 4LH4A 1DGKN 2R7YA 1WAJA 3CETA 4GW6A 4H5TA 4LH5A 4FCYA 1QSYA 3TAMA 1GLEG 1RDUA 3K59A 4E7HA 4CGGA 3QBXA 4E7KA 4DR6K 3SBTA 3BDPA 4B3SK 3EYZA 3SV3A 3LAKA 4C8NA 2P9IA 4WF9L 2HMIA 2HHIA 2X6NA 1JL2A 2QXLA 4YFUA 3CM5A 4AHUA 3GDQA 3J80O 3ENOA 4M42A 3KLEA 2CGJA 1TYQA 4YOYA 5LJWA 5J2MA 1SL2A 2FBXA 2G8WA 3DLRA 2ITMA 5LY3A 4E89A 3KTQA 3ISNC 4BEBA 4IWVA 3H6EA 5CR4A 3ZSWA 3CCMN 3ENBA 3DXKB 1K8KA 4DLGA 3ZETB 3M8SA 3MXIA 1MWKA 2GEMA 4FPAA 4CBUA 4HUEA 3QBWA 1C0TA 3ZT2A 4OPAA 1Q9YA 3G0ZA 1RT1A 1I3AA 2VCPA 1CZBA 4DS4A 4KPYA 4FWLA 3RMDA 5F2RA 3VQ7A 3O08A 3S41A 3K5NA 1ASVA 3HBTA 3L3UA 3P39A 4CIGA 3G25A 2IVNA 1FKOA 4ELVA 3NVMA 3U6FA 4ISEA 2FF6A 5CY4A 1YAGA 4DQQA 4YY3K 4B9MA 3SZ2A 1WSGA 1IJJA 4O4GA 4I2QA 1D9DA 4W5NA 1N5YA 4IG3A 1UA1A 4CZFA 4FOEA 3AY9A 1TVRA 3BGRA 4CFBA 3ZSOA 3DYAA 1JLBA 1DKGD 2A41A 3LP1A 3PO4A 3H45C 2A5XA 4NXMK 2FSNA 3HP6A 3T3FA 4IJAA 4R5PA 1ATSA 3CHWA 3L2QA 4U7BA 3OYFA 1X9SA 4DTRA 2P9NA 3ATVA 3KJVA 1YHQN 3ULDA 3LPUA 1LV5A 1QQNA 4JKAA 1X9WA 3M5RA 3TAFA 5H1SQ 1O13A 5JLHA 4CZKA 3E9LA 4FPBA 2ZF5O 1TKZA 3F2KA 3CIPA 1VSEA 5E84A 3TSUA 1A5XA 1S9EA 4CEBA 3CJAA 4WQ5A 3P83D 1BL3A 1NJZA 1NOZA 4C1NK 1L3VA 3ZT4A 1QSSA 4GKKK 3NH1A 3HYFA 5BN9A 4RW4A 2WC9A 3HVTA 3I56N 2RE2A 3WNHA 4DG1A 1TK5A 4KHPK 4BGBA 2FBTA 2O4IA 4CFAA 1Z26A 1E4GT 1LW2A 1XMOK 1RT6A 2Q31A 1K6YA 2Y1JA 1UA0A 1KAXA 2QEXN 3VTHA 1CZ9A 4B1UB 4CJPA 5HBMA 3C6TA 3UKRA 1WB9A 1B92A 4XJXA 4FJ9A 2HF4A 3PV8A 4M3YA 1E3MA 4Z4IA 4BRFA 2Q0RA 1FW6A 3SJJA 3QO9A 3F9MA 5M1FA 4FJGA 3NGIA 2YKNA 2JWKA 2G8IA 3V9ZA 1ZC6A 2JWLA 4KBOA 2ASOA 4DKWA 1M1KO 4KHWA 3NH2A 2HHUA 1NG9A 1YTAA 4M41A 3L2UA 3OYDA 1VQ5N 1HNZK 4RW6A 1RCHA 4H03B 3D2EA 1QE1A 1ZBHA 3TTCA 3WQTA 3GL1A 5AQOA 1WSHA 3V6DA 2O8CB 4KAZA 1P90A 4C23A 3U8XA 3D2FA 5AR0A 2ZD1A 2Z1HA 2KZZA 3CMEN 5C12A 3OYIA 3AO2A 1SKRA 1KLMA 4M3UA 3VF4A 1JJ2M 1SV5A 4FSVA 4PUOA 3MWTA 5M1QA 2G8KA 3OHRA 2D4WA 3IKMA 3Q7BA 1NM1A 3OYAA 3P1GA 3CCSN 1U6ZA 4DSFA 3HOTA 3D6RA 3KK7A 4CF9A 4W5TA 3ZLJA 2HNDA 3TAEA 2HBLA 2YI1A 4C8LA 1U4BA 3RMCA 3FR0A 4CZHA 5AQIA 3RMAA 3SUNA 1JLAA 3AO5A 2CGLA 3G71N 1JLFA 3OBYA 3EL2A 3FZMA 2E88A 4N41A 1WNSA 3ULEA 5DM7L 3BEXA 4O8KA 4FK4A 3AVGA 4G9ZA 4CGHA 4NYNA 2HBJA 3KD1E 4QS8A 2QI2A 2XY5A 4M3TA 5AZJB 1EO1A 2VWBA 2HHTA 1NGCA 3AO4A 3S9HA 3VF2A 4ID5A 1HKCA 2NNWA 1VQ9N 3U4LA 2KFZA 1HKBA 2HMPA 4CI6A 4W5RA 3C6UA 5AQZA 1NGAA 4DTSA 1L3TA 1EKEA 4FJNA 1G99A 4KO0A 4JN4A 1QZ6A 4BRCA 1JCGA 5M1OA 3TAQA 1KXPA 1D4XA 2ATQA 3K9JA 3NAEA 4E1NA 5EU7A 4B1VA 2F96A 3IRXA 4DLEA 3O1BA 3OYNA 1MDUB 4K41A 3ZSQA 1JL1A 3CG7A 5CYMA 4CJUA 1WUAA 4AILC 4GVMA 1JLQA 4IFEA 3ZSYA 1GLDG 1RT5A 5C24A 1B9DA 2ZJRL 4XH5A 1QHAA 3TAGA 4KB0A 4C8KA 3CJBA 5C15A 4DR1K 1S72N 1L3SA 4JS4A 3A8YA 1IKVA 1S3XA 4CCHA 4N47A 4JKCA 1VQON 4X66K
chains in the Genus database with same CATH topology
1NGBA 1HX1A 1ZXOA 2QWQA 3CJ7A 1VQLN 4CBWA 2P9KA 3VGLA 3MK6A 5KPTA 3CC7N 3I55N 3VF6A 3O9RA 2P9SA 4CD3A 3ZEUB 5EY4A 3SK3A 1TUYA 3MCAB 4BROA 2QW9A 2A6AA 2YX6A 4H5VA 5AQXA 3ULEB 3CCJN 4WCEL 2ZGZA 2D0OA 4BC4A 2HBKA 5GAGP 3OA9A 3R1XA 4JK7A 3CERA 3A5NC 2AP1A 3FZHA 5EVZA 1TUUA 4WQ4A 3WQUA 5CE3A 4Z94A 4LC9B 1SQKA 3ID8A 2A3ZA 3W3DA 3ZX3A 5C0YA 4PKGA 1X3NA 4OPHA 3JXUA 3TPQA 2PFUA 2FSKA 2ASPA 4HTLA 4CJ7A 2C1GA 2V7ZA 1QVFM 2GUPA 3H1VX 1SZ2A 4FWOA 4CBXA 4RCHA 5BRFA 3HM8A 4BRGA 4CZLA 4JD2B 4QS9A 4GV6A 1YITN 5BR9A 3J8AA 1BA0A 1HPMA 4A57A 4EFHA 3BF3A 3RSEA 4BQLA 4BRLA 3HOSA 3C65A 4K25A 3HRGA 5AQLA 3J7ZO 5KPRA 3WXKA 3O8MA 2ASMA 3DXKA 5FPEA 2P9PB 3CJ9A 2ZGYA 4JKHA 1YVNA 3R6MA 4L3QA 3LDLA 3H1QA 1ATNA 3C0BA 3M6GA 4WYBA 4JKFA 3R9PA 4AF1A 1BDGA 4AM6A 2HF3A 3O4WA 2D1KA 1E4FT 5C10A 4C1NI 5JLFA 5FPDA 3HI0A 4HWIA 3CF5L 4IEEA 1NLVA 2WFBA 4FOIA 2ZJPL 1VQPN 4MO5A 1V4TA 2NZTA 5MLCQ 3UKUB 4XH1A 2ZWHA 1Q82O 4YORA 3P38A 1X3MA 3WEEA 3U9ZA 4ISFA 3C6AA 2WBNA 4IZ9A 5GAHP 1JCFA 3TTDA 5AQJA 1K9MO 2NRWA 4FWPA 3CD6N 3DXMA 3U9DA 5BN8A 3KWIA 1Q7YO 3BP8A 3O9QA 3MN6A 5BREA 1Z6RA 4KH6A 4MO4A 4YOTA 3LL3A 2P9KB 2FLOA 4MDAA 4RTFD 3B8AX 2P9SB 1VQNN 5AQSA 1VQ8N 1T3VA 1NGDA 5AZIB 4BRKA 4ISGA 3BF1A 4Y0WA 5C2FA 2YHWA 4A59A 3OBWA 3Q7CA 3DWLA 3QDKA 4JKGA 1DGKN 1YJWN 3CETA 4H5TA 4H5RA 3CQYA 2YCHA 2VGMA 3O9TA 1RFQA 3QICA 5F0XA 3CCQN 2QTDA 3GBTA 1XUPO 3SAGA 1GLEG 1SS6A 3H3NO 4H0VB 4BVOA 1RDUA 1NMDA 2J4RA 3E9PA 2QWRA 4JKEA 5AQMA 1IG8A 4IJNA 2IVPA 4FL9A 3QBXA 4YOXA 3SBTA 3EZWA 3L0QA 2QWNA 4BRNA 2P9IA 4WF9L 3DAWA 3SMSA 3AAQA 4B9QA 1U2VA 2QXLA 5EX5A 3KHYA 2BTFA 1CZAN 3PLAA 2P9UB 3H46O 3GDQA 1M90O 3W0LA 4YOVA 3ENOA 3P4IA 1LCUA 3LDPA 3RSEB 2CGJA 3C7NA 2E1YA 3I8BA 1KC8O 1TYQA 2IIRA 3GE1A 4CD1A 4YOYA 5LJWA 4CZMA 1Q86O 3MCPA 1Q81O 1RGIA 5AQVA 3PIOL 1YUWA 2ITMA 5LY3A 5FPMA 4BEBA 4IWVA 3H6EA 2IVOA 4BR2A 1Z05A 5CR4A 5BPMA 5HL7L 3ENBA 3CCMN 3CCVN 3CC4N 3DXKB 4ILHA 1K8KA 1NGFA 5GAEP 2Q2RA 5KQDA 3ZETB 4BC2A 1KD1O 1BA1A 1MWKA 2GEMA 3QB0A 4FPAA 5AFUH 2QWLA 3WXJA 4CBUA 3E9OA 3QBWA 1VQMN 4OPAA 4JK8A 3CC2N 4BR7A 2I7PA 4FVUA 2GTDA 4UY8O 3N4QA 4IO8A 2UYTA 3MN7A 5HOOA 1BOTO 5JMVA 4WQ5C 3AAPA 5DM6L 2QWMA 4I6MA 3VEWA 3EN9A 1NGIA 2VCPA 2YJFA 2FF3B 1KQSM 3CCUN 2BUPA 2GWJA 3SLCA 4FWLA 5AFUA 5AQUA 1HLUA 1YF5L 3MWPA 1HJOA 1GLAG 5F2RA 3CMAN 3O08A 3S41A 2W00A 1MA9B 1SAZA 2NRRA 3HBTA 3P39A 3G25A 3QMLA 3WXMB 2D0PA 2IVNA 2YJEA 5F1XA 5BRDA 5AQYA 3NVMA 3SAFA 2Q0UA 1YI2N 4ISEA 2FF6A 1YAGA 3UE5A 1C0FA 1IJJA 5AQNA 5AQRA 5LJVA 3M3ZA 4H0YB 4OO1J 4CZFA 4BRDA 3VMFB 4FOEA 3AY9A 2EWSA 3SJHA 1DEJA 1DKGD 1K73O 2A41A 3FZLA 2F9TA 5C2DA 3VOVA 3EKUA 2Q97A 4YOWA 3PIPL 3KWGA 4IOAL 3EE9A 3H45C 4E1JA 1QVGM 2A5XA 4NLCA 3TTFA 2FSNA 3F5TA 4BC3A 2OTLN 3LDOA 4IJAA 1ATSA 1R59O 3CHWA 3FFKB 4U7BA 4IXCA 2P9IB 2Q1NA 5I9EB 4A5BA 1T6DA 3GOIA 3DLLL 1EQYA 5AQWA 2P9NA 2NRZA 2Q36A 3AGRA 3ATVA 3VPZA 1YHQN 4BR9A 3KZBA 1YJNN 1RDWX 1QQNA 3FGUA 4JKAA 5GIOA 3M5RA 2CH5A 3C7NB 5H1SQ 1O13A 3EO3A 4PL7A 1Q18A 5JLHA 3MX2A 1TYQB 4CZKA 4H0PA 1GLLO 3IUCA 3E9LA 2KKZA 5M1PA 1NJIO 3LDQA 3LM2A 2ZF5O 4FPBA 4DHYA 4PHTX 3F2KA 4BG8A 3CIPA 4BG9A 4R79A 5E84A 1W97L 3TSUA 2QWOA 3CJAA 3AARA 4WQ5A 4H0TB 3CCRN 1K8KB 4JK9A 3SMPA 4GV3A 2NRXA 3ATUA 4FO0A 4C1NK 1JCEA 4BY9C 5JICA 2A40A 3AGKA 3HZ6A 5ADXH 3O6WA 2F7TA 3L6QA 5BN9A 1MWMA 2F9WA 2QM1A 3ZX2A 3GG4A 2WC9A 1QZ5A 1YIJN 4BR5A 4A61A 3I56N 5JVHL 2RE2A 3O1WA 4JD2A 3VTIA 3CJCA 2E2OA 3ZYYX 2E8AA 4FWSA 2DPNA 4BGBA 3G6EN 3EKSA 4ILGB 1QQOA 3TU5A 5M1NA 3WUHA 3EE8A 1E4GT 5TKYA 4BC5A 2Q31A 4CZGA 5ADXA 1DT9A 4J8FA 4FWRA 2YHYA 1N8RO 1KAXA 4U67L 3VTHA 4NB4A 2QEXN 3FZKA 3A5LC 2OANA 2E2NA 1BU6O 3H3OB 4M7YA 1BO5O 4B1UB 3SAHA 4BRMA 4EIAA 3FE1A 2CH6A 3UKRA 3G4SN 5AQTA 4IEIA 3NMUA 4XJXA 2WUSA 3SBGA 3CXCM 2HF4A 2A42A 2E2QA 5AQGA 3CCLN 2I7NA 1VAZA 3R3LA 2Q0RA 4XH4A 4BRFA 4JKDA 5GADP 3T7ZA 1VQ6N 3N4PA 4FWNA 3ID6A 3UKUA 3CPEA 2PBDA 3F9MA 3KVGA 3RVCA 3VEYA 5CHIA 2NRTA 1GLJO 2PAVA 4FWQA 3VEOA 4RWTA 5M1FA 3O5BA 3DJCA 4JEPA 4BRHA 4K43A 2JWKA 3CCEN 1ZC6A 2JWLA 1W2BM 4KBOA 2GELA 3BUZB 4BRPA 5AZJA 2ASOA 4H0OA 4DKWA 4MLHA 1M1KO 2E1ZA 1VQ5N 3IDHA 2HBMA 5EOYA 5AQKA 3QFPA 4DQ8A 1OVYA 1X9JA 3WT0A 3WEEB 5KPZA 2P9NB 3D2EA 4H03B 1XC3A 3CI5A 5ELZA 4B1YB 3MMVA 3TTCA 3GL1A 3WQTA 2QWPA 3DXMB 2VYPA 2KHOA 3A5MC 5AQOA 4CZIA 5BPLA 3FZFA 1NGHA 5AZIA 1P90A 2V7YA 4C23A 3MN5A 3NVKA 2E20A 3U8XA 3D2FA 3JS6A 2W40A 5AR0A 3CJ1A 4EAHD 1NGGA 4H5NA 3CMEN 4H5WA 4O5FA 3ENHA 5C12A 3VENA 2C1IA 3WXIA 4BREA 5BPNA 3A0IX 4XEIA 2OTJN 2HOEA 4JAXA 2AA4A 3FLCO 4DCHA 4IOCL 1T6CA 1KAZA 4NLBA 3VF4A 1ATRA 1JJ2M 2VGNA 5FPNA 1HKGA 4WFNL 2W41A 4FSVA 3QFUA 3MWTA 4JKGB 5M1QA 4BVPA 3OHRA 1GLFO 2D4WA 3IKMA 3Q7BA 4KH5A 1NM1A 2GWKA 4YOUA 3TSPA 3O9UA 3WXLA 4BR0A 1U6ZA 3CCSN 3E1YA 2FXUA 5KQ8A 1WOQA 2P9UA 5B8HA 3HOTA 3VESA 3CPWM 3D6RA 3KK7A 3UB5A 2P9LA 2NRHA 5AQFA 3P31A 4F9OA 4JHDA 3HTVA 1HUXA 3I33A 4B1XB 2HBLA 2YI1A 2HSTA 2NLXA 1ESVA 3FR0A 3IFRA 4CZHA 3HSCA 1OKJA 5AQIA 3VEVA 4WFAL 4YDUC 1KAYA 1U2VB 4MLEA 3ZEUA 2NRVA 5AQQA 2CGLA 3G71N 3O80A 3MDQA 3OBYA 3EL2A 2V51B 3UKRB 2QA4N 3FZMA 2E88A 3ZETA 3ULEA 4BRQA 3BEXA 4O8KA 5DM7L 2E2PA 4PKIA 3K9KA 2GX9A 5AQHA 4PL8A 3D7EO 4G9ZA 1ZBSA 4WFBL 5BRHA 4A5AA 2BH1A 2CGKA 2HBJA 4MDBA 1C0GA 4K42A 1H1VA 5AQPA 4QS8A 4JKBA 2QI2A 4FWKA 4M63C 5AZJB 2FSJA 4O8UA 1EO1A 3L4IA 2VWBA 4BRIA 4WQ4C 1NGJA 3TSQA 4B1WB 4QS7A 2H3GX 1NGCA 4ILJA 1BG3A 3VF2A 4GNIA 1HKCA 2NNWA 1VQ9N 3U4LA 4BE7B 4I6MB 3MN9A 3L4QA 1HKBA 2HMPA 1NWKA 4IDHA 3D2EB 4CI6A 4FWMA 5AQZA 1NGAA 4PKHA 5EXWA 1NBWA 5GIPA 1BWFO 4JNEA 4A2BA 4A2AA 4BRAA 1ILYA 5M1KA 1G99A 4M7XA 3E66A 3O9SA 3IMXA 4JN4A 3D2FB 1QZ6A 1XQSC 2RHKA 3LDNA 2KLAA 4BRCA 1JCGA 5M1OA 3VETA 4EHUA 5GINA 1YJ9N 1VQ7N 1YXQA 3M1FA 5TKWA 5JVGL 3R8EA 1KXPA 4GY2B 2V52B 4H0XB 3ZX0A 2P9PA 4BGAA 4KH4A 1D4XA 3K9JA 3VGMA 3LM9A 2ZJQL 1NGEA 1GLBG 4DB3A 3T69A 3VERA 4A62A 4EHTA 4BQZA 3C6HA 3VEZA 2YHXA 4B1VA 1V4SA 4NO7A 1J6ZA 4BR4A 1Y64A 3O1BA 1MDUB 4K41A 4CZEA 1K8AO 4IO9L 1WUAA 1QQMA 3CQXA 3MX5A 5E26A 3OW2M 4IFEA 2ZJRL 1S22A 1GLDG 1P8ZA 1BUPA 4GVEA 4CZJA 4XH5A 4B1ZA 1QHAA 3A5OC 4YDUA 1VQ4N 1GLCG 3CJBA 3VGKA 4GV9A 4AM7A 5C15A 1S72N 2P9LB 1VQKN 3VEXA 3A8YA 4BECA 4JHDB 1LOTB 1S3XA 1T44A 4IOXA 4JKCA 1VQON
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGB A;  1HX1 A;  1ZXO A;  2QWQ A;  3CJ7 A;  4CBW A;  2P9K A;  3VGL A;  3MK6 A;  5KPT A;  3VF6 A;  2P9S A;  4CD3 A;  3ZEU B;  5EY4 A;  3SK3 A;  1TUY A;  4BRO A;  2QW9 A;  2A6A A;  4H5V A;  5AQX A;  3ULE B;  2ZGZ A;  2D0O A;  4BC4 A;  3CER A;  3A5N C;  2AP1 A;  3FZH A;  5EVZ A;  1TUU A;  4WQ4 A;  3WQU A;  5CE3 A;  4Z94 A;  4LC9 B;  1SQK A;  3ID8 A;  2A3Z A;  3W3D A;  3ZX3 A;  4PKG A;  1X3N A;  3JXU A;  3TPQ A;  2FSK A;  2ASP A;  4HTL A;  4CJ7 A;  2V7Z A;  2GUP A;  3H1V X;  1SZ2 A;  4FWO A;  4CBX A;  4RCH A;  5BRF A;  3HM8 A;  4BRG A;  4CZL A;  4JD2 B;  4QS9 A;  5BR9 A;  3J8A A;  1BA0 A;  1HPM A;  4EFH A;  3BF3 A;  3RSE A;  4BQL A;  4BRL A;  4K25 A;  5AQL A;  5KPR A;  3WXK A;  3O8M A;  2ASM A;  3DXK A;  5FPE A;  2P9P B;  3CJ9 A;  2ZGY A;  1YVN A;  3R6M A;  4L3Q A;  3LDL A;  3H1Q A;  1ATN A;  3C0B A;  3M6G A;  4WYB A;  3R9P A;  4AM6 A;  1BDG A;  2HF3 A;  3O4W A;  2D1K A;  1E4F T;  5JLF A;  5FPD A;  3HI0 A;  4HWI A;  1NLV A;  4FOI A;  4MO5 A;  1V4T A;  2NZT A;  3UKU B;  4XH1 A;  2ZWH A;  1X3M A;  3WEE A;  3U9Z A;  4ISF A;  4IZ9 A;  1JCF A;  5AQJ A;  4FWP A;  3DXM A;  3U9D A;  5BN8 A;  3BP8 A;  3MN6 A;  5BRE A;  1Z6R A;  4MO4 A;  3LL3 A;  2P9K B;  2FLO A;  4RTF D;  3B8A X;  2P9S B;  5AQS A;  1NGD A;  5AZI B;  4BRK A;  4ISG A;  3BF1 A;  4Y0W A;  2YHW A;  3DWL A;  3QDK A;  1DGK N;  3CET A;  4H5T A;  4H5R A;  3CQY A;  2YCH A;  1RFQ A;  3QIC A;  5F0X A;  3GBT A;  1XUP O;  1GLE G;  3H3N O;  4H0V B;  4BVO A;  1NMD A;  2J4R A;  5AQM A;  2QWR A;  1IG8 A;  4IJN A;  2IVP A;  4FL9 A;  3QBX A;  3EZW A;  3L0Q A;  2QWN A;  4BRN A;  2P9I A;  3DAW A;  3SMS A;  3AAQ A;  4B9Q A;  1U2V A;  2QXL A;  5EX5 A;  3KHY A;  2BTF A;  1CZA N;  2P9U B;  3H46 O;  3GDQ A;  3W0L A;  3ENO A;  3P4I A;  1LCU A;  3LDP A;  3RSE B;  2CGJ A;  3C7N A;  2E1Y A;  3I8B A;  1TYQ A;  2IIR A;  3GE1 A;  4CD1 A;  5LJW A;  4CZM A;  3MCP A;  1RGI A;  5AQV A;  1YUW A;  2ITM A;  5LY3 A;  5FPM A;  4IWV A;  3H6E A;  2IVO A;  4BR2 A;  1Z05 A;  5BPM A;  3DXK B;  1K8K A;  1NGF A;  2Q2R A;  5KQD A;  3ZET B;  4BC2 A;  1BA1 A;  1MWK A;  2GEM A;  3QB0 A;  4FPA A;  5AFU H;  2QWL A;  3WXJ A;  4CBU A;  3QBW A;  4BR7 A;  2I7P A;  2GTD A;  4IO8 A;  2UYT A;  3MN7 A;  1BOT O;  5JMV A;  4WQ5 C;  3AAP A;  2QWM A;  4I6M A;  3VEW A;  3EN9 A;  1NGI A;  2VCP A;  2YJF A;  2FF3 B;  2BUP A;  2GWJ A;  3SLC A;  4FWL A;  5AFU A;  5AQU A;  1HLU A;  1HJO A;  1GLA G;  5F2R A;  3O08 A;  3S41 A;  1MA9 B;  1SAZ A;  3HBT A;  3G25 A;  3QML A;  2D0P A;  2IVN A;  2YJE A;  5F1X A;  5BRD A;  5AQY A;  2Q0U A;  4ISE A;  2FF6 A;  1YAG A;  3UE5 A;  1C0F A;  1IJJ A;  5AQN A;  5AQR A;  5LJV A;  3M3Z A;  4H0Y B;  4CZF A;  4BRD A;  4FOE A;  3AY9 A;  2EWS A;  3SJH A;  1DEJ A;  1DKG D;  2A41 A;  3FZL A;  2F9T A;  3VOV A;  3EKU A;  2Q97 A;  3H45 C;  4E1J A;  2A5X A;  4BC3 A;  2FSN A;  3LDO A;  4IJA A;  1ATS A;  1R59 O;  3CHW A;  3FFK B;  4IXC A;  2P9I B;  2Q1N A;  5I9E B;  1T6D A;  3GOI A;  1EQY A;  5AQW A;  2P9N A;  2Q36 A;  3ATV A;  3VPZ A;  4BR9 A;  3KZB A;  1RDW X;  1QQN A;  3FGU A;  2CH5 A;  3C7N B;  3EO3 A;  4PL7 A;  1Q18 A;  5JLH A;  1TYQ B;  4CZK A;  4H0P A;  1GLL O;  3IUC A;  3LDQ A;  3LM2 A;  2ZF5 O;  4FPB A;  4DHY A;  4BG9 A;  4BG8 A;  3CIP A;  5E84 A;  2QWO A;  3CJA A;  3AAR A;  4WQ5 A;  4H0T B;  1K8K B;  3SMP A;  3ATU A;  4FO0 A;  1JCE A;  5JIC A;  2A40 A;  3HZ6 A;  5ADX H;  3O6W A;  3L6Q A;  5BN9 A;  1MWM A;  2F9W A;  2QM1 A;  3ZX2 A;  3GG4 A;  1QZ5 A;  4BR5 A;  4A61 A;  3O1W A;  4JD2 A;  3CJC A;  2E2O A;  2E8A A;  4FWS A;  2DPN A;  4BGB A;  3EKS A;  1QQO A;  3TU5 A;  3WUH A;  1E4G T;  5TKY A;  4BC5 A;  2Q31 A;  4CZG A;  5ADX A;  4J8F A;  4FWR A;  2YHY A;  1KAX A;  4NB4 A;  3FZK A;  3A5L C;  2OAN A;  2E2N A;  1BU6 O;  3H3O B;  4M7Y A;  1BO5 O;  4B1U B;  4BRM A;  4EIA A;  3FE1 A;  2CH6 A;  3UKR A;  5AQT A;  2WUS A;  2HF4 A;  2A42 A;  2E2Q A;  5AQG A;  2I7N A;  4BRF A;  2Q0R A;  4XH4 A;  4FWN A;  3UKU A;  2PBD A;  3F9M A;  3KVG A;  3VEY A;  1GLJ O;  2PAV A;  4FWQ A;  3VEO A;  4RWT A;  3O5B A;  3DJC A;  4BRH A;  4K43 A;  1ZC6 A;  4KBO A;  2GEL A;  3BUZ B;  4BRP A;  5AZJ A;  2ASO A;  4H0O A;  4MLH A;  2E1Z A;  3IDH A;  5EOY A;  5AQK A;  3QFP A;  4DQ8 A;  1X9J A;  3WT0 A;  3WEE B;  5KPZ A;  2P9N B;  3D2E A;  4H03 B;  1XC3 A;  3CI5 A;  5ELZ A;  4B1Y B;  3MMV A;  3WQT A;  3GL1 A;  2QWP A;  3DXM B;  2VYP A;  2KHO A;  3A5M C;  5AQO A;  4CZI A;  5BPL A;  3FZF A;  1NGH A;  5AZI A;  2V7Y A;  4C23 A;  3MN5 A;  2E20 A;  3U8X A;  3D2F A;  3JS6 A;  2W40 A;  5AR0 A;  3CJ1 A;  4EAH D;  1NGG A;  4H5N A;  4H5W A;  4O5F A;  3ENH A;  3VEN A;  3WXI A;  4BRE A;  5BPN A;  3A0I X;  4XEI A;  2HOE A;  4JAX A;  2AA4 A;  3FLC O;  4DCH A;  1T6C A;  1KAZ A;  3VF4 A;  1ATR A;  5FPN A;  1HKG A;  2W41 A;  4FSV A;  3QFU A;  4BVP A;  3OHR A;  1GLF O;  2D4W A;  1NM1 A;  2GWK A;  3WXL A;  4BR0 A;  1U6Z A;  2FXU A;  5KQ8 A;  1WOQ A;  2P9U A;  5B8H A;  3VES A;  3UB5 A;  2P9L A;  2NRH A;  5AQF A;  4F9O A;  4JHD A;  3HTV A;  1HUX A;  3I33 A;  4B1X B;  2YI1 A;  2NLX A;  1ESV A;  3FR0 A;  3IFR A;  4CZH A;  3HSC A;  1OKJ A;  5AQI A;  3VEV A;  4YDU C;  1KAY A;  1U2V B;  4MLE A;  3ZEU A;  5AQQ A;  2CGL A;  3O80 A;  3MDQ A;  3EL2 A;  2V51 B;  3UKR B;  3FZM A;  2E88 A;  3ZET A;  3ULE A;  4BRQ A;  3BEX A;  4O8K A;  2E2P A;  4PKI A;  5AQH A;  4PL8 A;  3D7E O;  1ZBS A;  5BRH A;  2CGK A;  1C0G A;  4K42 A;  1H1V A;  5AQP A;  4QS8 A;  4FWK A;  4M63 C;  5AZJ B;  2FSJ A;  3L4I A;  2VWB A;  4BRI A;  4WQ4 C;  1NGJ A;  4B1W B;  4QS7 A;  2H3G X;  1NGC A;  1BG3 A;  3VF2 A;  4GNI A;  1HKC A;  3U4L A;  4I6M B;  3MN9 A;  1HKB A;  2HMP A;  1NWK A;  4CI6 A;  3D2E B;  4FWM A;  5AQZ A;  1NGA A;  4PKH A;  5EXW A;  1NBW A;  1BWF O;  4JNE A;  4A2B A;  4A2A A;  4BRA A;  1G99 A;  4M7X A;  4JN4 A;  3IMX A;  3D2F B;  1QZ6 A;  1XQS C;  3LDN A;  4BRC A;  1JCG A;  4EHU A;  3VET A;  1YXQ A;  3M1F A;  3R8E A;  1KXP A;  4GY2 B;  2V52 B;  4H0X B;  3ZX0 A;  2P9P A;  4BGA A;  1D4X A;  3VGM A;  3LM9 A;  1NGE A;  1GLB G;  4DB3 A;  3VER A;  4A62 A;  4EHT A;  4BQZ A;  3VEZ A;  4B1V A;  2YHX A;  4BR4 A;  1V4S A;  4NO7 A;  1J6Z A;  1Y64 A;  3O1B A;  1MDU B;  4K41 A;  4CZE A;  1WUA A;  1QQM A;  3CQX A;  5E26 A;  1S22 A;  1GLD G;  1P8Z A;  1BUP A;  4CZJ A;  4XH5 A;  4B1Z A;  1QHA A;  3A5O C;  4YDU A;  1GLC G;  3CJB A;  3VGK A;  4AM7 A;  2P9L B;  3VEX A;  3A8Y A;  4JHD B;  1LOT B;  1S3X A;  1T44 A; 
#chains in the Genus database with same CATH topology
 1BGX T;  3CJ7 A;  1HX1 A;  3KLH A;  3AO1 A;  2BAN A;  4CBW A;  2P9K A;  3MK6 A;  4E3S A;  2P9S A;  3HPG A;  3ZEU B;  1OH8 A;  1CXU A;  3I0S A;  3TAN A;  2A6A A;  4H5V A;  1Z25 A;  4BDZ A;  1W9H A;  3KKS A;  3K5L A;  3CCJ N;  4BC4 A;  2X74 A;  4CHO A;  1SKS A;  4DQS A;  3OA9 A;  4FM0 A;  3DLH A;  3CER A;  3OYG A;  3FZH A;  1EET A;  4JRQ A;  2VG6 A;  3HP9 A;  3AV9 A;  2A3Z A;  3THY B;  1S1X A;  4E7J A;  1VSD A;  1NJX A;  3JXU A;  2FSK A;  5FLX O;  3RR7 A;  4B3O A;  1SZ2 A;  4DU3 A;  2GV9 A;  4BRG A;  1YIT N;  3HPH A;  4AHR A;  2P5G A;  3RWU A;  4CHN A;  3RSE A;  2XY7 A;  3HOS A;  3V4I A;  3C65 A;  2Q3S A;  4IDK A;  3J7Z O;  2XHB A;  2E5L K;  3THW B;  3O8M A;  2ASM A;  4CK3 A;  2P9P B;  3R6M A;  4L3Q A;  3LDL A;  3H1Q A;  4JKF A;  1BDG A;  4O0I A;  2GUI A;  5D3G A;  1ZBF A;  3E01 A;  2P5O A;  1VSI A;  4IEE A;  1VQP N;  4FYD A;  3LP2 A;  4DV0 K;  5DMR A;  4QOZ B;  3UKU B;  2ZWH A;  3P38 A;  5HLF A;  1X3M A;  2E6M A;  3VQ8 A;  5GAH P;  2NRW A;  3DXM A;  4JYA K;  3O3G A;  5HP1 A;  3NF9 A;  5FRO A;  3O9Q A;  3HST B;  3MN6 A;  1ZBU A;  4KH6 A;  3MEG A;  3ZT1 A;  3HJF A;  4ELT A;  3V9W A;  1HQE A;  4RTF D;  3B8A X;  1VQN N;  1VSK A;  3VA0 A;  2OZS A;  4Y0W A;  1EXQ A;  5C2F A;  2YHW A;  3PY8 A;  4A59 A;  1IV0 A;  1RNH A;  3ZSV A;  5I3U A;  3QDK A;  3EEQ A;  2G8H A;  2YCH A;  1RFQ A;  1MU2 A;  2O4G A;  4JRP A;  3CCQ N;  3H3N O;  4H0V B;  5E41 A;  3HXM A;  2J4R A;  5AQM A;  2QWR A;  3KK3 A;  4FL9 A;  4YOX A;  3EZW A;  4W5O A;  1OH6 A;  4BRN A;  3D45 A;  3SMS A;  3AAQ A;  2O8F A;  3PLA A;  1CZA N;  4DMN A;  2P9U B;  4OPJ A;  1M90 O;  4BDP A;  3W0L A;  1XNR K;  1LCU A;  3LDP A;  3LDS A;  3T1H K;  1T8E A;  4CD1 A;  1N34 K;  3S3O A;  1HQU A;  3MCP A;  1NK7 A;  4CGD A;  1DTQ A;  1XI1 A;  4DTJ A;  3DLE A;  5FPM A;  1J54 A;  3THV A;  2IVO A;  3SQ4 A;  3CCV N;  1WSI A;  1RBU A;  1VRT A;  4EZ9 A;  5GAE P;  5KQD A;  1BIU A;  2IDO A;  1BI4 B;  1KD1 O;  4CER A;  3ZSR A;  2YNF A;  4JK8 A;  3THX B;  4FVU A;  2GTD A;  4CK1 A;  4UY8 O;  2UXC K;  5JMV A;  3AAP A;  2QWM A;  1ZYQ A;  4I6M A;  1NGI A;  4Z4H A;  2YJF A;  2FF3 B;  4EP4 A;  3CCU N;  2BUP A;  4DF4 A;  1Y97 A;  1HLU A;  1YF5 L;  3MWP A;  1HJO A;  4FM1 A;  5HRP A;  3CMA N;  1MA9 B;  1SAZ A;  1VSH A;  4DSI A;  3DOK A;  1JLC A;  4N76 A;  2KTQ A;  4H4M A;  3SUO A;  1XWL A;  3ZSZ A;  5LJV A;  4H0Y B;  4FLT A;  4BRD A;  4KFB A;  1KCF A;  4MQ3 A;  2JLE A;  1DEJ A;  1K73 O;  2UUC K;  3FZL A;  2F9T A;  5C2D A;  3VOV A;  4DFP A;  3EKU A;  4DFJ A;  4DQI A;  2Q97 A;  3PIP L;  3KWG A;  4IOA L;  4NXN K;  1QVG M;  4DF8 A;  4BC3 A;  4CEA A;  2XY6 A;  3F73 A;  4IXC A;  2P9I B;  5I9E B;  1EQY A;  1HJR A;  3VPZ A;  4CJQ A;  1R0A A;  1RDW X;  3FGU A;  4O0J A;  1S1V A;  4PL7 A;  3MX2 A;  1TYQ B;  1ASU A;  1GLL O;  2X6S A;  2KKZ A;  5M1P A;  4NCA A;  4B9U A;  4PHT X;  4BG9 A;  4JI5 K;  1W97 L;  4HCC A;  2QWO A;  4N5S A;  1RT7 A;  4DV5 K;  3AAR A;  4H0T B;  3VQA A;  4JI2 K;  1K8K B;  3K2P A;  1NOY A;  2RN2 A;  4GV3 A;  4XIU A;  4K8X A;  3IAY A;  3AGK A;  5ADX H;  2QKK A;  3O6W A;  1C6V A;  2F9W A;  2QM1 A;  3ZX2 A;  4DTP A;  5JVH L;  3MEE A;  2YHB A;  3O1W A;  4JD2 A;  3ZYY X;  2E8A A;  5A2Q O;  2DPN A;  4CEF A;  3TU5 A;  3KLI A;  5ADX A;  4CZG A;  1NJW A;  3S5T A;  3TWH A;  4J8F A;  4FK0 A;  1C1C A;  3PSF A;  4NB4 A;  3FZK A;  1JKH A;  4I2P A;  1RBS A;  4M7Y A;  5KRS A;  4EIA A;  2KFN A;  3NH0 A;  4CHZ A;  5AQT A;  3LPT A;  1VSL A;  1TKX A;  3CXC M;  5JEN A;  4E1M A;  2D5R A;  5AQG A;  2P1J A;  3CCL N;  2I7N A;  1VAZ A;  3R3L A;  4XH4 A;  4EZ6 A;  3SQ1 A;  5GAD P;  3ID6 A;  4DQR A;  1LAV A;  3RVC A;  4ZTJ A;  3VEY A;  4I9Q A;  4DV1 K;  1N32 K;  2NRT A;  1GLJ O;  4RWT A;  3AA4 A;  3O5B A;  3SQ0 A;  4KTQ A;  3DJC A;  3TAB A;  4E7L A;  3CCE N;  1RTH A;  1EWR A;  1W2B M;  3BUZ B;  3PX4 A;  1N33 K;  1IKX A;  2O8E A;  2OPR A;  4AH9 A;  2HBM A;  5EOY A;  5AQK A;  1OVY A;  4DTX A;  2Z1J A;  2ETJ A;  2VG7 A;  1HNI A;  3WEE B;  2P9N B;  3LAN A;  2HNZ A;  3RMB A;  3CI5 A;  5ELZ A;  3QEP A;  2VYP A;  1BQM A;  3A5M C;  4CZI A;  5DK5 A;  1J9A A;  4DV4 K;  3MN5 A;  3NVK A;  2E20 A;  4DFK A;  4B3R K;  3QES A;  3ENH A;  3VEN A;  1XNQ K;  3WXI A;  5BPN A;  3A0I X;  4XEI A;  3OYB A;  3U3G A;  1WBB A;  1RTJ A;  2DFF A;  3C95 A;  1LWF A;  1T6C A;  1KAZ A;  4JI7 K;  3VN5 A;  4CJV A;  5FPN A;  4WFN L;  4DSL A;  4CIE A;  3F9K A;  1S1W A;  4JKG B;  4F3T A;  5KRT A;  1S5J A;  3WNG A;  3DI6 A;  3RR8 A;  3OYK A;  2HHW A;  2YNH A;  2FXU A;  5B8H A;  4B9T A;  3UB5 A;  4LF7 K;  3H08 A;  2NRH A;  3ZSX A;  4F9O A;  4ZHR A;  1B9F A;  4JHD A;  1OH5 A;  1HUX A;  1TAQ A;  4B1X B;  3KD5 E;  4JI0 K;  4UQG A;  4F3O A;  1SL1 A;  3IFR A;  3HSC A;  4KRE A;  1KAY A;  1U2V B;  1QQC A;  4MLE A;  4CJF A;  3O80 A;  3MDQ A;  3K58 A;  3IS9 A;  1IBK K;  5KI6 A;  3UKR B;  2E6L A;  3ZET A;  3OTO K;  4Y1D A;  4DR4 K;  5J2N A;  4PKI A;  3NBP A;  2VQE K;  4DTO A;  3D7E O;  4N56 A;  5BRH A;  4KRF A;  1KTQ A;  4Z0U A;  1I39 A;  4CEZ A;  4K42 A;  5AQP A;  4CJE A;  1GOA A;  5J2P A;  2FSJ A;  4BRI A;  1JXE A;  1UOC A;  3M8R A;  4ILJ A;  1BG3 A;  4LD0 A;  4BE7 B;  2OZM A;  2B5J A;  1S1U A;  4IDH A;  3D2E B;  4PKH A;  5EXW A;  4CJL A;  4JNE A;  1NK8 A;  1ILY A;  5HRN A;  3MXM A;  4B3M K;  1WBD A;  1IO2 A;  1QS4 A;  1OVQ A;  3O9S A;  3IMX A;  3D2F B;  1XQS C;  3LDN A;  1YJ9 N;  2KLA A;  5GIN A;  1QTM A;  2HHS A;  1VQ7 N;  3M1F A;  3R8E A;  4GY2 B;  4H0X B;  3ZX0 A;  3VGM A;  3LAM A;  3LM9 A;  4EHT A;  4BQZ A;  4KB1 A;  4Z4C A;  1V4S A;  1IH7 A;  2EHG A;  4CZE A;  3UIQ A;  5E26 A;  4GVE A;  4CZJ A;  1TV6 A;  4CJT A;  3VGK A;  2O8B A;  2I5J A;  4M3R A;  4FJX A;  3I8D A;  1KVB A;  5J2Q A;  3VGL A;  4HTU A;  3AVF A;  4OX9 K;  2O8D A;  4BRO A;  4O55 A;  1EP4 A;  3ULE B;  1TL1 A;  4WCE L;  2ZGZ A;  2D0O A;  4O5B A;  4DQP A;  3ALY A;  2D0C A;  5GAG P;  3R1X A;  4JK7 A;  1WSE A;  5CE3 A;  1TUU A;  1D9F A;  2RPI A;  3ID8 A;  1OH7 A;  4KHQ A;  3L2W A;  1RBV A;  3TPQ A;  4I7F A;  1C0U A;  1QVF M;  2GUP A;  3H1V X;  4CJ4 A;  5JS1 A;  2QXF A;  3C94 A;  4AHV A;  4C8M A;  4CZL A;  4DU1 A;  4JI3 K;  4QS9 A;  5HRO A;  5BR9 A;  2IAJ A;  3EZ5 A;  3NGY A;  4A57 A;  3M8Q A;  5FRN A;  1S9G A;  5AQL A;  5I42 A;  5KPR A;  3SUP A;  5FPE A;  4KHN A;  4NCG A;  1YVN A;  3M6G A;  3C0B A;  4AF1 A;  3CFR A;  2HF3 A;  3S3N A;  5FPD A;  4CFD A;  3CF5 L;  3V1O A;  2ZJP L;  5KTQ A;  1S6Q A;  3L8B A;  4FJI A;  4CEO A;  3AA2 A;  2WBN A;  1JCF A;  3OYC A;  2G8F A;  4CHP A;  1A5W A;  4E7I A;  4CJ3 A;  5BRE A;  1KFD A;  1VSF A;  3LL3 A;  2P9K B;  2FLO A;  1RBT A;  1U49 A;  2P9S B;  4ELU A;  4DR3 K;  1J5E K;  2HHH K;  1RDC A;  1NGD A;  5AZI B;  4BRK A;  4ISG A;  3BF1 A;  1L5U A;  3BZK A;  3Q7C A;  4DS5 A;  3DWL A;  1X1P A;  1YJW N;  2VGM A;  3OYJ A;  3LP3 A;  3HM9 A;  1SS6 A;  3OVN A;  1IG8 A;  1C0M A;  4IJN A;  3L0Q A;  2OPS A;  4LFC K;  3KIO A;  3DAW A;  2RF2 A;  2PYL A;  1ASW A;  4B9Q A;  1T05 A;  3VQQ A;  3KHY A;  3P4I A;  3RSE B;  3C7N A;  2E1Y A;  4FXD A;  4BDY A;  2WTU A;  2IIR A;  1A5V A;  1RT2 A;  4CZM A;  1RGI A;  5AQV A;  5J1E A;  3S3M A;  2IGI A;  4H4O A;  1D5A A;  1YUW A;  1ZBL A;  3VQ5 A;  4BR2 A;  4IFV A;  3SV4 A;  5BPM A;  3CC4 N;  3RRH A;  3NF7 A;  1SKW A;  4CGF A;  4FJL A;  4CHY A;  4B9N A;  3QNN A;  3QB0 A;  2W6K A;  5AFU H;  3VQ6 A;  3EY1 A;  4B8C A;  4BR7 A;  2I7P A;  1N36 K;  4IO8 A;  2UYT A;  1RT4 A;  3FFI A;  3MN7 A;  5HOO A;  1BOT O;  1HNX K;  4AQY K;  4LSL A;  1S6P A;  3EN9 A;  3VEW A;  4FJJ A;  5AFU A;  3WNE A;  5AQU A;  2VQF K;  3AVH A;  3ZCM A;  3HL8 A;  3VQC A;  1C1B A;  3WNF A;  4DSE A;  2NUB A;  3QML A;  2VWK A;  3WXM B;  1HR0 K;  2YJE A;  1LWE A;  3SYZ A;  5BRD A;  5AQY A;  4HVJ A;  3SAF A;  2Q0U A;  4IKF A;  1HMV A;  5AQN A;  1NKC A;  4QCL A;  3M3Z A;  4NCB A;  4Y1C A;  4JI6 K;  4L8R B;  3VMF B;  1IG9 A;  3SJH A;  1NNE A;  4YOW A;  3EE9 A;  3T19 A;  4DR7 K;  3L2V A;  3TTF A;  2OTL N;  3LDO A;  3NE6 A;  3FFK B;  4H8K A;  2A1R A;  4PA1 A;  4GV9 A;  3DLL L;  1T6D A;  5AQW A;  2O8F B;  2FC0 A;  3AVK A;  3DLG A;  4BR9 A;  3KZB A;  1YJN N;  1WLJ A;  2CH5 A;  4DTM A;  4X64 K;  4J2D A;  3QEI A;  1IBM K;  1REV A;  4CIF A;  1IBL K;  4OJR A;  1NJI O;  3LM2 A;  4DHY A;  4DU4 A;  2HHV A;  4ID1 A;  2E4L A;  3THY A;  4JK9 A;  1DTT A;  2NRX A;  4FO0 A;  1JCE A;  4IFY A;  4BY9 C;  2F7T A;  4FLZ A;  1BQN A;  1QZ5 A;  4BR5 A;  3BY5 A;  4F8R A;  2E2O A;  4FWS A;  1RTD A;  4FJM A;  4ILG B;  1QQO A;  5M1N A;  1W7A A;  3D0P A;  4PY5 A;  1KVC A;  2YHY A;  3AA5 X;  4FWR A;  2E2N A;  4KTZ A;  4BRM A;  3OYH A;  2VG5 A;  3OYM A;  3FE1 A;  2CH6 A;  2HNY A;  3O4Q A;  3NMU A;  3KLF A;  2WUS A;  3SPY A;  3VQ9 A;  5CYQ A;  3T7Z A;  3N4P A;  2X78 A;  4FWN A;  4IG0 A;  3UKU A;  4CW7 B;  4DV3 K;  2PBD A;  3DRP A;  2EX3 A;  5CHI A;  3MAQ A;  3VEO A;  2PAV A;  4FWQ A;  2LSN A;  4BRH A;  4K43 A;  4CEE A;  2GEL A;  4BRP A;  2E1Z A;  2OA8 A;  4FJ8 A;  1CXQ A;  3LP0 A;  3IDH A;  4PQU A;  3QFP A;  4F4K A;  4FLY A;  4B1Y B;  4EP5 A;  5BPL A;  1WSJ A;  2W40 A;  3ZT3 A;  3KK2 A;  3CJ1 A;  4EAH D;  4KI4 A;  4H5N A;  3O3H A;  1G15 A;  4O5F A;  4BE0 A;  2C1I A;  2OTJ N;  1TKT A;  2D0B A;  2HOE A;  2AA4 A;  4DCH A;  5C25 A;  4BAC A;  4IOC L;  1FK9 A;  1ATR A;  4HUG A;  1DLO A;  2VGN A;  4E0D A;  3VQD A;  1HKG A;  1SUQ A;  2W41 A;  3KK1 A;  3QFU A;  4BVP A;  4E19 A;  3AVL A;  1GLF O;  3LAL A;  4KH5 A;  2OCE A;  3TSP A;  1J5O A;  3O9U A;  2HW3 A;  3WXL A;  5T7B A;  1WOQ A;  2P9U A;  3CPW M;  3DLB A;  2P9L A;  1TAU A;  3HTV A;  1HYZ A;  4RW8 A;  4RW9 A;  1ESV A;  2PYJ A;  4WFA L;  4F2S A;  4YDU C;  2NRV A;  4CJS A;  4FZX C;  2V51 B;  2QA4 N;  4BRQ A;  1BI4 A;  3MEC A;  2HHX A;  3LZJ A;  5AQH A;  5K14 A;  3THX A;  1ZBS A;  4A5A A;  3OYL A;  1C0G A;  3O4N A;  4GMJ B;  2D0A A;  2W42 A;  4CE9 A;  4DUZ K;  4M63 C;  1T7P A;  1T03 A;  1FKP A;  4O8U A;  3L4I A;  4WQ4 C;  4B1W B;  1LW0 A;  2H3G X;  2O8E B;  2W6L A;  4O44 A;  3L2R A;  4BWM A;  3VQE A;  1YVU A;  3MN9 A;  2VWJ A;  1NWK A;  4B9S A;  4FWM A;  3QIN A;  2WON A;  1BWF O;  1XHZ A;  3OYE A;  4M7X A;  1L3U A;  3E66 A;  2RHK A;  2DTU A;  3VET A;  1Q9X A;  3OS2 A;  5TKW A;  5JVG L;  5KGX A;  4FM2 A;  2ZM6 K;  4V19 S;  4CF8 A;  4B9L A;  3T69 A;  2HHQ A;  4A62 A;  5C42 A;  4BR4 A;  2YHX A;  3NGZ A;  4NO7 A;  1J6Z A;  1Y64 A;  1K8A O;  4IO9 L;  1QQM A;  4B8A B;  3OW2 M;  1S22 A;  1BUP A;  3VA3 A;  2GBZ A;  3DLK A;  4B1Z A;  3A5O C;  4M3W A;  1VQ4 N;  1TGO A;  1U47 A;  3OY9 A;  3VEX A;  4LY7 A;  4JHD B;  1LOT B;  4WE1 A;  1T44 A;  4IOX A;  4FJ7 A;  1NGB A;  1VQL N;  1ZXO A;  2QWQ A;  3IG1 A;  1J53 A;  3CC7 N;  5KPT A;  3I55 N;  3VF6 A;  4DTU A;  3O9R A;  4K0K K;  3SK3 A;  1YT3 A;  4Q0B A;  3SCX A;  2AJQ A;  5LMN K;  4Q5V A;  2YX6 A;  1FJG K;  4B3T K;  4LF8 K;  4FVM A;  2F8S A;  4DUY K;  1SL0 A;  3PSI A;  1HYS A;  1LAW A;  2AP1 A;  1NK0 A;  4Z94 A;  4LC9 B;  3ASM A;  1SQK A;  2KW4 A;  3W3D A;  3QEX A;  4MFB A;  4Z4E A;  5C0Y A;  4PKG A;  4OPH A;  1IKY A;  3K5O A;  3VQP A;  2PFU A;  3HVR A;  4DFM A;  2ASP A;  4CJ7 A;  1BIZ A;  2C1G A;  3LWM A;  5FDL A;  4BWJ A;  4DSK A;  3G10 A;  4BE1 A;  1JXB A;  4FWO A;  3V1Q A;  3JSM A;  4RCH A;  5BRF A;  4DWI A;  4CJK A;  4FZZ A;  3J8A A;  2DFE A;  2Z1I A;  3V1R A;  4FLV A;  5IT9 O;  4BQL A;  4BRL A;  4KHY A;  2OPP A;  4K25 A;  4JI4 K;  3WXK A;  4X65 K;  3MED A;  3DXK A;  1U45 A;  1WN7 A;  4JKH A;  3U3Y A;  3R9P A;  1BCM A;  2YV0 X;  4YHH K;  1WSF A;  2D1K A;  5JLF A;  2ZQB A;  4YNQ A;  2YKM A;  1JLG A;  1NLV A;  2WFB A;  1JLE A;  1V4T A;  2NZT A;  4MO5 A;  5MLC Q;  3KLG A;  4YOR A;  3WEE A;  3U9Z A;  3LZI A;  4IZ9 A;  2UU9 K;  5AQJ A;  2BGG A;  3CD6 N;  2O8B B;  4KHU A;  3DOL A;  3V9X A;  3V9U A;  3ITH A;  4MDA A;  4OKK A;  1VQ8 N;  1UAX A;  2O8D B;  4KHS A;  1T3V A;  4G1Q A;  4NYF A;  3NHG A;  3MXJ A;  3NCI A;  1NJY A;  1NU0 A;  3QLH A;  4JKG A;  1GOB A;  4DV2 K;  4H5R A;  3CQY A;  3O9T A;  1NK4 A;  3QIC A;  3ZT0 A;  5F0X A;  2QTD A;  3GBT A;  3AVC A;  1XUP O;  3VQ4 A;  4CHQ A;  3SAG A;  4BVO A;  2ITG A;  2OYQ A;  4IBN A;  1NMD A;  3AVN A;  3E9P A;  4JKE A;  2IVP A;  4JLH A;  3J7Y P;  1TK0 A;  2QWN A;  3B6O A;  4M45 A;  3CYG A;  2QK9 A;  1U2V A;  1BHL A;  5EX5 A;  1XC9 A;  2BTF A;  1HYV A;  3H46 O;  3OJU A;  4YOV A;  3M8P A;  4E72 A;  3I8B A;  1KC8 O;  3CYM A;  3GE1 A;  4OLB A;  1Q86 O;  4PWD A;  1Q81 O;  3PIO L;  3OJS A;  4LFB K;  3V9S A;  3DRR A;  1Z05 A;  5HL7 L;  4ILH A;  1NGF A;  4FZY A;  2Q2R A;  1VK0 A;  1EX4 A;  3DRS A;  4J2E A;  4BC2 A;  1BA1 A;  3WXJ A;  2QWL A;  2IS3 A;  2HVI A;  2PZS A;  3E9O A;  1VQM N;  1RDA A;  3CC2 N;  4J2B A;  1NKB A;  3N4Q A;  5HRS A;  4WQ5 C;  5DM6 L;  1VRU A;  1KQS M;  2GWJ A;  3SLC A;  4QAG A;  3SQ2 A;  1GLA G;  1VSJ A;  2W00 A;  3JAM O;  2NRR A;  3NFA A;  2D0P A;  4Z4G A;  1NMN A;  1BIS A;  5F1X A;  1BCO A;  1LWC A;  1YI2 N;  4OLA A;  1KFS A;  2UUB K;  4DR5 K;  3UE5 A;  1C0F A;  5AQR A;  4OPK A;  4OO1 J;  1KSP A;  1GOC A;  1RT3 A;  2EWS A;  3SNN A;  1ZBI A;  4E1J A;  4Z4F A;  4NLC A;  3F5T A;  1RTI A;  2IOC A;  1R59 O;  4HUF A;  2Q1N A;  4A5B A;  3GOI A;  3K5M A;  4OGC A;  2NRZ A;  2Q36 A;  3AGR A;  3DMJ A;  4OKJ A;  1S1T A;  5GIO A;  2O8C A;  3C7N B;  4RW7 A;  3EO3 A;  1Q18 A;  4H0P A;  3IUC A;  1VSM A;  3LDQ A;  4BG8 A;  4OKE A;  4R79 A;  3SPZ A;  3CCR N;  3SMP A;  3ATU A;  4LF6 K;  1RIL A;  4KV8 A;  2HVH A;  5JIC A;  3T1A A;  2A40 A;  3HZ6 A;  3L6Q A;  1MWM A;  2FBY A;  3GG4 A;  1YIJ N;  4A61 A;  1TL3 A;  3TI0 A;  1TK8 A;  3VTI A;  3CJC A;  2UXB K;  5SWM A;  3OS0 A;  3G6E N;  3EKS A;  4DR2 K;  3KKR A;  2XRI A;  3WUH A;  3EE8 A;  5TKY A;  4BC5 A;  1DT9 A;  1N8R O;  4U67 L;  3NF6 A;  3A5L C;  1HNW K;  2OAN A;  3PX6 A;  1BU6 O;  2XO7 A;  3H3O B;  1BO5 O;  3SAH A;  1N6Q A;  4FJ5 A;  2QKB A;  3G4S N;  4IEI A;  3A2F A;  3SBG A;  3HPO A;  3VQB A;  2A42 A;  2E2Q A;  3SUQ A;  4JKD A;  2RKI A;  1VQ6 N;  3CPE A;  4KI6 A;  4RG8 A;  3KVG A;  3QER A;  3AVJ A;  3J81 O;  2HB5 A;  3AVM A;  3QET A;  1HNV A;  4FLX A;  4JEP A;  4LF9 K;  5AZJ A;  4H0O A;  4MLH A;  1NKE A;  4CK2 A;  4FLW A;  4DQ8 A;  4JS5 A;  1X9J A;  3WT0 A;  3CFO A;  5KPZ A;  1XC3 A;  2B6A A;  3MMV A;  2QWP A;  4CF2 A;  3DXM B;  2KHO A;  3FZF A;  1NGH A;  5AZI A;  1RBR A;  2V7Y A;  4CGJ A;  3JS6 A;  2YHA A;  1NGG A;  1CLQ A;  4OVL A;  4H5W A;  4GKJ K;  4BRE A;  4FK2 A;  2Y1I A;  4JAX A;  1FXX A;  1WAF A;  3FLC O;  3P5J A;  4NLB A;  4FJH A;  4CF0 A;  2B4J A;  1VHX A;  2GWK A;  4YOU A;  2BE2 A;  1KVA A;  4BR0 A;  1UWB A;  3V81 A;  2DFH A;  1QSL A;  3E1Y A;  5KQ8 A;  3CQ8 A;  3QNO A;  3VES A;  4HCB A;  5AQF A;  3P31 A;  3AVB A;  2F4V K;  3I33 A;  3PUF A;  1U04 A;  5LL6 Z;  3AO3 A;  4CEQ A;  3QIO A;  2HST A;  2NLX A;  4BE2 A;  4CEC A;  1OKJ A;  3VEV A;  3ZEU A;  4CFC A;  5AQQ A;  3I0R A;  4FW2 A;  2XY8 A;  2ZE2 A;  5JS2 A;  2E2P A;  3LWL A;  3K9K A;  4FW1 A;  2GX9 A;  4PL8 A;  4DV7 K;  4AHS A;  1NK9 A;  4WFB L;  1KRP A;  5FRM A;  2BH1 A;  2CGK A;  3AVI A;  5BR8 K;  4MDB A;  1D8Y A;  1H1V A;  4JKB A;  4FWK A;  4CJ5 A;  1NGJ A;  3TSQ A;  4QS7 A;  1I94 K;  4GNI A;  4CED A;  4I6M B;  3L4Q A;  4CGI A;  3TAR A;  4FJK A;  2YNI A;  1F21 A;  4CES A;  1NBW A;  5GIP A;  3T1Y K;  4A2B A;  4A2A A;  4BRA A;  5M1K A;  4CVN E;  5LMU K;  4I9L A;  1XMQ K;  4EHU A;  3K0S A;  3SI6 A;  3THW A;  5CZ2 A;  1YXQ A;  3OS1 A;  1NK6 A;  2V52 B;  2YNG A;  4F2R A;  2P9P A;  4BGA A;  4KH4 A;  2ZJQ L;  1NGE A;  1GLB G;  4DB3 A;  3VER A;  1TKD A;  3PO5 A;  4C8O A;  4LSN A;  5CZ1 A;  4JI1 K;  4FLU A;  4M3Z A;  3C6H A;  3VEZ A;  4KTW A;  5SZT A;  3QEV A;  3TAP A;  1U48 A;  4DTN A;  2Z1G A;  3CQX A;  3MX5 A;  4LF4 K;  1P8Z A;  4YDU A;  1C1A A;  2OPQ A;  1GLC G;  4AM7 A;  4LFA K;  2P9L B;  1VQK N;  1YTU A;  4BEC A;  2A1S A;  4ICL A;  3HO1 A;  3L3V A;  4CD3 A;  5EY4 A;  1TUY A;  3MCA B;  4CJR A;  4K8Z A;  3CM6 A;  2QW9 A;  1HPZ A;  5AQX A;  1KLN A;  4DV6 K;  2HBK A;  4AHC A;  2IC3 A;  3AVA A;  3J7A P;  3A5N C;  4JI8 K;  5EVZ A;  3WQU A;  4WQ4 A;  2KZM A;  4OGE A;  3NDK A;  3ZX3 A;  2F8T A;  4J2A A;  4M3X A;  1X3N A;  4CF1 A;  2BDP A;  1O1W A;  3K57 A;  1NK5 A;  4HTL A;  5KGW A;  2V7Z A;  3RTV A;  2DY4 A;  5HRR A;  3JYT A;  2JGU A;  3AA3 A;  4HHT A;  3BZC A;  4CBX A;  2G8V A;  3HM8 A;  4KKO A;  3HT3 A;  4JD2 B;  1W0H A;  5IWA K;  4GV6 A;  1ITG A;  1BA0 A;  1RDB A;  1HPM A;  4LF5 K;  4EFH A;  3BF3 A;  4DSJ A;  1X9M A;  3QIP A;  2UXD K;  3HRG A;  4B9V A;  4CJW A;  4AHT A;  1XHX A;  3O3F A;  3CJ9 A;  2ZGY A;  4ZTF A;  3QEW A;  1ATN A;  4WYB A;  4AM6 A;  4TSX A;  3O4W A;  1E4F T;  5C10 A;  4C1N I;  2P51 A;  3PX0 A;  3HI0 A;  4HWI A;  4FOI A;  3TR8 A;  1Q82 O;  2FBV A;  3CFP A;  4XH1 A;  4B08 A;  4ISF A;  3C6A A;  3TTD A;  1K9M O;  4FWP A;  3U9D A;  5BN8 A;  3KWI A;  1Q7Y O;  3HK2 A;  3BP8 A;  4W5Q A;  1QHT A;  3DM2 A;  4JV5 K;  1IKW A;  5AJ3 K;  2KQ2 A;  1Z6R A;  4MO4 A;  1RDD A;  2WOM A;  3B6P A;  4YOT A;  3NF8 A;  1Q8I A;  4X62 K;  5AQS A;  2PY5 A;  2G8U A;  1HRH A;  3OBW A;  1EWQ A;  3RRG A;  2UUA K;  4LH4 A;  1DGK N;  2R7Y A;  1WAJ A;  3CET A;  4GW6 A;  4H5T A;  4LH5 A;  4FCY A;  1QSY A;  3TAM A;  1GLE G;  1RDU A;  3K59 A;  4E7H A;  4CGG A;  3QBX A;  4E7K A;  4DR6 K;  3SBT A;  3BDP A;  4B3S K;  3EYZ A;  3SV3 A;  3LAK A;  4C8N A;  2P9I A;  4WF9 L;  2HMI A;  2HHI A;  2X6N A;  1JL2 A;  2QXL A;  4YFU A;  3CM5 A;  4AHU A;  3GDQ A;  3J80 O;  3ENO A;  4M42 A;  3KLE A;  2CGJ A;  1TYQ A;  4YOY A;  5LJW A;  5J2M A;  1SL2 A;  2FBX A;  2G8W A;  3DLR A;  2ITM A;  5LY3 A;  4E89 A;  3KTQ A;  3ISN C;  4BEB A;  4IWV A;  3H6E A;  5CR4 A;  3ZSW A;  3CCM N;  3ENB A;  3DXK B;  1K8K A;  4DLG A;  3ZET B;  3M8S A;  3MXI A;  1MWK A;  2GEM A;  4FPA A;  4CBU A;  4HUE A;  3QBW A;  1C0T A;  3ZT2 A;  4OPA A;  1Q9Y A;  3G0Z A;  1RT1 A;  1I3A A;  2VCP A;  1CZB A;  4DS4 A;  4KPY A;  4FWL A;  3RMD A;  5F2R A;  3VQ7 A;  3O08 A;  3S41 A;  3K5N A;  1ASV A;  3HBT A;  3L3U A;  3P39 A;  4CIG A;  3G25 A;  2IVN A;  1FKO A;  4ELV A;  3NVM A;  3U6F A;  4ISE A;  2FF6 A;  5CY4 A;  1YAG A;  4DQQ A;  4YY3 K;  4B9M A;  3SZ2 A;  1WSG A;  1IJJ A;  4O4G A;  4I2Q A;  1D9D A;  4W5N A;  1N5Y A;  4IG3 A;  1UA1 A;  4CZF A;  4FOE A;  3AY9 A;  1TVR A;  3BGR A;  4CFB A;  3ZSO A;  3DYA A;  1JLB A;  1DKG D;  2A41 A;  3LP1 A;  3PO4 A;  3H45 C;  2A5X A;  4NXM K;  2FSN A;  3HP6 A;  3T3F A;  4IJA A;  4R5P A;  1ATS A;  3CHW A;  3L2Q A;  4U7B A;  3OYF A;  1X9S A;  4DTR A;  2P9N A;  3ATV A;  3KJV A;  1YHQ N;  3ULD A;  3LPU A;  1LV5 A;  1QQN A;  4JKA A;  1X9W A;  3M5R A;  3TAF A;  5H1S Q;  1O13 A;  5JLH A;  4CZK A;  3E9L A;  4FPB A;  2ZF5 O;  1TKZ A;  3F2K A;  3CIP A;  1VSE A;  5E84 A;  3TSU A;  1A5X A;  1S9E A;  4CEB A;  3CJA A;  4WQ5 A;  3P83 D;  1BL3 A;  1NJZ A;  1NOZ A;  4C1N K;  1L3V A;  3ZT4 A;  1QSS A;  4GKK K;  3NH1 A;  3HYF A;  5BN9 A;  4RW4 A;  2WC9 A;  3HVT A;  3I56 N;  2RE2 A;  3WNH A;  4DG1 A;  1TK5 A;  4KHP K;  4BGB A;  2FBT A;  2O4I A;  4CFA A;  1Z26 A;  1E4G T;  1LW2 A;  1XMO K;  1RT6 A;  2Q31 A;  1K6Y A;  2Y1J A;  1UA0 A;  1KAX A;  2QEX N;  3VTH A;  1CZ9 A;  4B1U B;  4CJP A;  5HBM A;  3C6T A;  3UKR A;  1WB9 A;  1B92 A;  4XJX A;  4FJ9 A;  2HF4 A;  3PV8 A;  4M3Y A;  1E3M A;  4Z4I A;  4BRF A;  2Q0R A;  1FW6 A;  3SJJ A;  3QO9 A;  3F9M A;  5M1F A;  4FJG A;  3NGI A;  2YKN A;  2JWK A;  2G8I A;  3V9Z A;  1ZC6 A;  2JWL A;  4KBO A;  2ASO A;  4DKW A;  1M1K O;  4KHW A;  3NH2 A;  2HHU A;  1NG9 A;  1YTA A;  4M41 A;  3L2U A;  3OYD A;  1VQ5 N;  1HNZ K;  4RW6 A;  1RCH A;  4H03 B;  3D2E A;  1QE1 A;  1ZBH A;  3TTC A;  3WQT A;  3GL1 A;  5AQO A;  1WSH A;  3V6D A;  2O8C B;  4KAZ A;  1P90 A;  4C23 A;  3U8X A;  3D2F A;  5AR0 A;  2ZD1 A;  2Z1H A;  2KZZ A;  3CME N;  5C12 A;  3OYI A;  3AO2 A;  1SKR A;  1KLM A;  4M3U A;  3VF4 A;  1JJ2 M;  1SV5 A;  4FSV A;  4PUO A;  3MWT A;  5M1Q A;  2G8K A;  3OHR A;  2D4W A;  3IKM A;  3Q7B A;  1NM1 A;  3OYA A;  3P1G A;  3CCS N;  1U6Z A;  4DSF A;  3HOT A;  3D6R A;  3KK7 A;  4CF9 A;  4W5T A;  3ZLJ A;  2HND A;  3TAE A;  2HBL A;  2YI1 A;  4C8L A;  1U4B A;  3RMC A;  3FR0 A;  4CZH A;  5AQI A;  3RMA A;  3SUN A;  1JLA A;  3AO5 A;  2CGL A;  3G71 N;  1JLF A;  3OBY A;  3EL2 A;  3FZM A;  2E88 A;  4N41 A;  1WNS A;  3ULE A;  5DM7 L;  3BEX A;  4O8K A;  4FK4 A;  3AVG A;  4G9Z A;  4CGH A;  4NYN A;  2HBJ A;  3KD1 E;  4QS8 A;  2QI2 A;  2XY5 A;  4M3T A;  5AZJ B;  1EO1 A;  2VWB A;  2HHT A;  1NGC A;  3AO4 A;  3S9H A;  3VF2 A;  4ID5 A;  1HKC A;  2NNW A;  1VQ9 N;  3U4L A;  2KFZ A;  1HKB A;  2HMP A;  4CI6 A;  4W5R A;  3C6U A;  5AQZ A;  1NGA A;  4DTS A;  1L3T A;  1EKE A;  4FJN A;  1G99 A;  4KO0 A;  4JN4 A;  1QZ6 A;  4BRC A;  1JCG A;  5M1O A;  3TAQ A;  1KXP A;  1D4X A;  2ATQ A;  3K9J A;  3NAE A;  4E1N A;  5EU7 A;  4B1V A;  2F96 A;  3IRX A;  4DLE A;  3O1B A;  3OYN A;  1MDU B;  4K41 A;  3ZSQ A;  1JL1 A;  3CG7 A;  5CYM A;  4CJU A;  1WUA A;  4AIL C;  4GVM A;  1JLQ A;  4IFE A;  3ZSY A;  1GLD G;  1RT5 A;  5C24 A;  1B9D A;  2ZJR L;  4XH5 A;  1QHA A;  3TAG A;  4KB0 A;  4C8K A;  3CJB A;  5C15 A;  4DR1 K;  1S72 N;  1L3S A;  4JS4 A;  3A8Y A;  1IKV A;  1S3X A;  4CCH A;  4N47 A;  4JKC A;  1VQO N;  4X66 K; 
#chains in the Genus database with same CATH homology
 1NGB A;  1HX1 A;  1ZXO A;  2QWQ A;  3CJ7 A;  1VQL N;  4CBW A;  2P9K A;  3VGL A;  3MK6 A;  5KPT A;  3CC7 N;  3I55 N;  3VF6 A;  3O9R A;  2P9S A;  4CD3 A;  3ZEU B;  5EY4 A;  3SK3 A;  1TUY A;  3MCA B;  4BRO A;  2QW9 A;  2A6A A;  2YX6 A;  4H5V A;  5AQX A;  3ULE B;  3CCJ N;  4WCE L;  2ZGZ A;  2D0O A;  4BC4 A;  2HBK A;  5GAG P;  3OA9 A;  3R1X A;  4JK7 A;  3CER A;  3A5N C;  2AP1 A;  3FZH A;  5EVZ A;  1TUU A;  4WQ4 A;  3WQU A;  5CE3 A;  4Z94 A;  4LC9 B;  1SQK A;  3ID8 A;  2A3Z A;  3W3D A;  3ZX3 A;  5C0Y A;  4PKG A;  1X3N A;  4OPH A;  3JXU A;  3TPQ A;  2PFU A;  2FSK A;  2ASP A;  4HTL A;  4CJ7 A;  2C1G A;  2V7Z A;  1QVF M;  2GUP A;  3H1V X;  1SZ2 A;  4FWO A;  4CBX A;  4RCH A;  5BRF A;  3HM8 A;  4BRG A;  4CZL A;  4JD2 B;  4QS9 A;  4GV6 A;  1YIT N;  5BR9 A;  3J8A A;  1BA0 A;  1HPM A;  4A57 A;  4EFH A;  3BF3 A;  3RSE A;  4BQL A;  4BRL A;  3HOS A;  3C65 A;  4K25 A;  3HRG A;  5AQL A;  3J7Z O;  5KPR A;  3WXK A;  3O8M A;  2ASM A;  3DXK A;  5FPE A;  2P9P B;  3CJ9 A;  2ZGY A;  4JKH A;  1YVN A;  3R6M A;  4L3Q A;  3LDL A;  3H1Q A;  1ATN A;  3C0B A;  3M6G A;  4WYB A;  4JKF A;  3R9P A;  4AF1 A;  1BDG A;  4AM6 A;  2HF3 A;  3O4W A;  2D1K A;  1E4F T;  5C10 A;  4C1N I;  5JLF A;  5FPD A;  3HI0 A;  4HWI A;  3CF5 L;  4IEE A;  1NLV A;  2WFB A;  4FOI A;  2ZJP L;  1VQP N;  4MO5 A;  1V4T A;  2NZT A;  5MLC Q;  3UKU B;  4XH1 A;  2ZWH A;  1Q82 O;  4YOR A;  3P38 A;  1X3M A;  3WEE A;  3U9Z A;  4ISF A;  3C6A A;  2WBN A;  4IZ9 A;  5GAH P;  1JCF A;  3TTD A;  5AQJ A;  1K9M O;  2NRW A;  4FWP A;  3CD6 N;  3DXM A;  3U9D A;  5BN8 A;  3KWI A;  1Q7Y O;  3BP8 A;  3O9Q A;  3MN6 A;  5BRE A;  1Z6R A;  4KH6 A;  4MO4 A;  4YOT A;  3LL3 A;  2P9K B;  2FLO A;  4MDA A;  4RTF D;  3B8A X;  2P9S B;  1VQN N;  5AQS A;  1VQ8 N;  1T3V A;  1NGD A;  5AZI B;  4BRK A;  4ISG A;  3BF1 A;  4Y0W A;  5C2F A;  2YHW A;  4A59 A;  3OBW A;  3Q7C A;  3DWL A;  3QDK A;  4JKG A;  1DGK N;  1YJW N;  3CET A;  4H5T A;  4H5R A;  3CQY A;  2YCH A;  2VGM A;  3O9T A;  1RFQ A;  3QIC A;  5F0X A;  3CCQ N;  2QTD A;  3GBT A;  1XUP O;  3SAG A;  1GLE G;  1SS6 A;  3H3N O;  4H0V B;  4BVO A;  1RDU A;  1NMD A;  2J4R A;  3E9P A;  2QWR A;  4JKE A;  5AQM A;  1IG8 A;  4IJN A;  2IVP A;  4FL9 A;  3QBX A;  4YOX A;  3SBT A;  3EZW A;  3L0Q A;  2QWN A;  4BRN A;  2P9I A;  4WF9 L;  3DAW A;  3SMS A;  3AAQ A;  4B9Q A;  1U2V A;  2QXL A;  5EX5 A;  3KHY A;  2BTF A;  1CZA N;  3PLA A;  2P9U B;  3H46 O;  3GDQ A;  1M90 O;  3W0L A;  4YOV A;  3ENO A;  3P4I A;  1LCU A;  3LDP A;  3RSE B;  2CGJ A;  3C7N A;  2E1Y A;  3I8B A;  1KC8 O;  1TYQ A;  2IIR A;  3GE1 A;  4CD1 A;  4YOY A;  5LJW A;  4CZM A;  1Q86 O;  3MCP A;  1Q81 O;  1RGI A;  5AQV A;  3PIO L;  1YUW A;  2ITM A;  5LY3 A;  5FPM A;  4BEB A;  4IWV A;  3H6E A;  2IVO A;  4BR2 A;  1Z05 A;  5CR4 A;  5BPM A;  5HL7 L;  3ENB A;  3CCM N;  3CCV N;  3CC4 N;  3DXK B;  4ILH A;  1K8K A;  1NGF A;  5GAE P;  2Q2R A;  5KQD A;  3ZET B;  4BC2 A;  1KD1 O;  1BA1 A;  1MWK A;  2GEM A;  3QB0 A;  4FPA A;  5AFU H;  2QWL A;  3WXJ A;  4CBU A;  3E9O A;  3QBW A;  1VQM N;  4OPA A;  4JK8 A;  3CC2 N;  4BR7 A;  2I7P A;  4FVU A;  2GTD A;  4UY8 O;  3N4Q A;  4IO8 A;  2UYT A;  3MN7 A;  5HOO A;  1BOT O;  5JMV A;  4WQ5 C;  3AAP A;  5DM6 L;  2QWM A;  4I6M A;  3VEW A;  3EN9 A;  1NGI A;  2VCP A;  2YJF A;  2FF3 B;  1KQS M;  3CCU N;  2BUP A;  2GWJ A;  3SLC A;  4FWL A;  5AFU A;  5AQU A;  1HLU A;  1YF5 L;  3MWP A;  1HJO A;  1GLA G;  5F2R A;  3CMA N;  3O08 A;  3S41 A;  2W00 A;  1MA9 B;  1SAZ A;  2NRR A;  3HBT A;  3P39 A;  3G25 A;  3QML A;  3WXM B;  2D0P A;  2IVN A;  2YJE A;  5F1X A;  5BRD A;  5AQY A;  3NVM A;  3SAF A;  2Q0U A;  1YI2 N;  4ISE A;  2FF6 A;  1YAG A;  3UE5 A;  1C0F A;  1IJJ A;  5AQN A;  5AQR A;  5LJV A;  3M3Z A;  4H0Y B;  4OO1 J;  4CZF A;  4BRD A;  3VMF B;  4FOE A;  3AY9 A;  2EWS A;  3SJH A;  1DEJ A;  1DKG D;  1K73 O;  2A41 A;  3FZL A;  2F9T A;  5C2D A;  3VOV A;  3EKU A;  2Q97 A;  4YOW A;  3PIP L;  3KWG A;  4IOA L;  3EE9 A;  3H45 C;  4E1J A;  1QVG M;  2A5X A;  4NLC A;  3TTF A;  2FSN A;  3F5T A;  4BC3 A;  2OTL N;  3LDO A;  4IJA A;  1ATS A;  1R59 O;  3CHW A;  3FFK B;  4U7B A;  4IXC A;  2P9I B;  2Q1N A;  5I9E B;  4A5B A;  1T6D A;  3GOI A;  3DLL L;  1EQY A;  5AQW A;  2P9N A;  2NRZ A;  2Q36 A;  3AGR A;  3ATV A;  3VPZ A;  1YHQ N;  4BR9 A;  3KZB A;  1YJN N;  1RDW X;  1QQN A;  3FGU A;  4JKA A;  5GIO A;  3M5R A;  2CH5 A;  3C7N B;  5H1S Q;  1O13 A;  3EO3 A;  4PL7 A;  1Q18 A;  5JLH A;  3MX2 A;  1TYQ B;  4CZK A;  4H0P A;  1GLL O;  3IUC A;  3E9L A;  2KKZ A;  5M1P A;  1NJI O;  3LDQ A;  3LM2 A;  2ZF5 O;  4FPB A;  4DHY A;  4PHT X;  3F2K A;  4BG8 A;  3CIP A;  4BG9 A;  4R79 A;  5E84 A;  1W97 L;  3TSU A;  2QWO A;  3CJA A;  3AAR A;  4WQ5 A;  4H0T B;  3CCR N;  1K8K B;  4JK9 A;  3SMP A;  4GV3 A;  2NRX A;  3ATU A;  4FO0 A;  4C1N K;  1JCE A;  4BY9 C;  5JIC A;  2A40 A;  3AGK A;  3HZ6 A;  5ADX H;  3O6W A;  2F7T A;  3L6Q A;  5BN9 A;  1MWM A;  2F9W A;  2QM1 A;  3ZX2 A;  3GG4 A;  2WC9 A;  1QZ5 A;  1YIJ N;  4BR5 A;  4A61 A;  3I56 N;  5JVH L;  2RE2 A;  3O1W A;  4JD2 A;  3VTI A;  3CJC A;  2E2O A;  3ZYY X;  2E8A A;  4FWS A;  2DPN A;  4BGB A;  3G6E N;  3EKS A;  4ILG B;  1QQO A;  3TU5 A;  5M1N A;  3WUH A;  3EE8 A;  1E4G T;  5TKY A;  4BC5 A;  2Q31 A;  4CZG A;  5ADX A;  1DT9 A;  4J8F A;  4FWR A;  2YHY A;  1N8R O;  1KAX A;  4U67 L;  3VTH A;  4NB4 A;  2QEX N;  3FZK A;  3A5L C;  2OAN A;  2E2N A;  1BU6 O;  3H3O B;  4M7Y A;  1BO5 O;  4B1U B;  3SAH A;  4BRM A;  4EIA A;  3FE1 A;  2CH6 A;  3UKR A;  3G4S N;  5AQT A;  4IEI A;  3NMU A;  4XJX A;  2WUS A;  3SBG A;  3CXC M;  2HF4 A;  2A42 A;  2E2Q A;  5AQG A;  3CCL N;  2I7N A;  1VAZ A;  3R3L A;  2Q0R A;  4XH4 A;  4BRF A;  4JKD A;  5GAD P;  3T7Z A;  1VQ6 N;  3N4P A;  4FWN A;  3ID6 A;  3UKU A;  3CPE A;  2PBD A;  3F9M A;  3KVG A;  3RVC A;  3VEY A;  5CHI A;  2NRT A;  1GLJ O;  2PAV A;  4FWQ A;  3VEO A;  4RWT A;  5M1F A;  3O5B A;  3DJC A;  4JEP A;  4BRH A;  4K43 A;  2JWK A;  3CCE N;  1ZC6 A;  2JWL A;  1W2B M;  4KBO A;  2GEL A;  3BUZ B;  4BRP A;  5AZJ A;  2ASO A;  4H0O A;  4DKW A;  4MLH A;  1M1K O;  2E1Z A;  1VQ5 N;  3IDH A;  2HBM A;  5EOY A;  5AQK A;  3QFP A;  4DQ8 A;  1OVY A;  1X9J A;  3WT0 A;  3WEE B;  5KPZ A;  2P9N B;  3D2E A;  4H03 B;  1XC3 A;  3CI5 A;  5ELZ A;  4B1Y B;  3MMV A;  3TTC A;  3GL1 A;  3WQT A;  2QWP A;  3DXM B;  2VYP A;  2KHO A;  3A5M C;  5AQO A;  4CZI A;  5BPL A;  3FZF A;  1NGH A;  5AZI A;  1P90 A;  2V7Y A;  4C23 A;  3MN5 A;  3NVK A;  2E20 A;  3U8X A;  3D2F A;  3JS6 A;  2W40 A;  5AR0 A;  3CJ1 A;  4EAH D;  1NGG A;  4H5N A;  3CME N;  4H5W A;  4O5F A;  3ENH A;  5C12 A;  3VEN A;  2C1I A;  3WXI A;  4BRE A;  5BPN A;  3A0I X;  4XEI A;  2OTJ N;  2HOE A;  4JAX A;  2AA4 A;  3FLC O;  4DCH A;  4IOC L;  1T6C A;  1KAZ A;  4NLB A;  3VF4 A;  1ATR A;  1JJ2 M;  2VGN A;  5FPN A;  1HKG A;  4WFN L;  2W41 A;  4FSV A;  3QFU A;  3MWT A;  4JKG B;  5M1Q A;  4BVP A;  3OHR A;  1GLF O;  2D4W A;  3IKM A;  3Q7B A;  4KH5 A;  1NM1 A;  2GWK A;  4YOU A;  3TSP A;  3O9U A;  3WXL A;  4BR0 A;  1U6Z A;  3CCS N;  3E1Y A;  2FXU A;  5KQ8 A;  1WOQ A;  2P9U A;  5B8H A;  3HOT A;  3VES A;  3CPW M;  3D6R A;  3KK7 A;  3UB5 A;  2P9L A;  2NRH A;  5AQF A;  3P31 A;  4F9O A;  4JHD A;  3HTV A;  1HUX A;  3I33 A;  4B1X B;  2HBL A;  2YI1 A;  2HST A;  2NLX A;  1ESV A;  3FR0 A;  3IFR A;  4CZH A;  3HSC A;  1OKJ A;  5AQI A;  3VEV A;  4WFA L;  4YDU C;  1KAY A;  1U2V B;  4MLE A;  3ZEU A;  2NRV A;  5AQQ A;  2CGL A;  3G71 N;  3O80 A;  3MDQ A;  3OBY A;  3EL2 A;  2V51 B;  3UKR B;  2QA4 N;  3FZM A;  2E88 A;  3ZET A;  3ULE A;  4BRQ A;  3BEX A;  4O8K A;  5DM7 L;  2E2P A;  4PKI A;  3K9K A;  2GX9 A;  5AQH A;  4PL8 A;  3D7E O;  4G9Z A;  1ZBS A;  4WFB L;  5BRH A;  4A5A A;  2BH1 A;  2CGK A;  2HBJ A;  4MDB A;  1C0G A;  4K42 A;  1H1V A;  5AQP A;  4QS8 A;  4JKB A;  2QI2 A;  4FWK A;  4M63 C;  5AZJ B;  2FSJ A;  4O8U A;  1EO1 A;  3L4I A;  2VWB A;  4BRI A;  4WQ4 C;  1NGJ A;  3TSQ A;  4B1W B;  4QS7 A;  2H3G X;  1NGC A;  4ILJ A;  1BG3 A;  3VF2 A;  4GNI A;  1HKC A;  2NNW A;  1VQ9 N;  3U4L A;  4BE7 B;  4I6M B;  3MN9 A;  3L4Q A;  1HKB A;  2HMP A;  1NWK A;  4IDH A;  3D2E B;  4CI6 A;  4FWM A;  5AQZ A;  1NGA A;  4PKH A;  5EXW A;  1NBW A;  5GIP A;  1BWF O;  4JNE A;  4A2B A;  4A2A A;  4BRA A;  1ILY A;  5M1K A;  1G99 A;  4M7X A;  3E66 A;  3O9S A;  3IMX A;  4JN4 A;  3D2F B;  1QZ6 A;  1XQS C;  2RHK A;  3LDN A;  2KLA A;  4BRC A;  1JCG A;  5M1O A;  3VET A;  4EHU A;  5GIN A;  1YJ9 N;  1VQ7 N;  1YXQ A;  3M1F A;  5TKW A;  5JVG L;  3R8E A;  1KXP A;  4GY2 B;  2V52 B;  4H0X B;  3ZX0 A;  2P9P A;  4BGA A;  4KH4 A;  1D4X A;  3K9J A;  3VGM A;  3LM9 A;  2ZJQ L;  1NGE A;  1GLB G;  4DB3 A;  3T69 A;  3VER A;  4A62 A;  4EHT A;  4BQZ A;  3C6H A;  3VEZ A;  2YHX A;  4B1V A;  1V4S A;  4NO7 A;  1J6Z A;  4BR4 A;  1Y64 A;  3O1B A;  1MDU B;  4K41 A;  4CZE A;  1K8A O;  4IO9 L;  1WUA A;  1QQM A;  3CQX A;  3MX5 A;  5E26 A;  3OW2 M;  4IFE A;  2ZJR L;  1S22 A;  1GLD G;  1P8Z A;  1BUP A;  4GVE A;  4CZJ A;  4XH5 A;  4B1Z A;  1QHA A;  3A5O C;  4YDU A;  1VQ4 N;  1GLC G;  3CJB A;  3VGK A;  4GV9 A;  4AM7 A;  5C15 A;  1S72 N;  2P9L B;  1VQK N;  3VEX A;  3A8Y A;  4BEC A;  4JHD B;  1LOT B;  1S3X A;  1T44 A;  4IOX A;  4JKC A;  1VQO N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...