1U2VB

Crystal structure of arp2/3 complex with bound adp and calcium
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
204
structure length
204
Chain Sequence
b'YAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-Related Protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
molecule tags Structural protein
total genus 57
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1u2vB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1u2vB02
1NBWA 1X9JA 5BRDA 1TYQB 5E84A 4I6MA 3CJBA 2A42A 2GTDA 4M7YA 1YUWA 2A41A 4B1XB 3FLCO 4B1YB 4FWSA 4BRNA 2CH6A 4EFHA 4JHDA 2A3ZA 5AFUA 1QQMA 3M6GA 1QZ6A 5I9EB 4AM6A 4FWMA 3O6WA 5AZIA 4BRQA 1U6ZA 2EWSA 3D2FB 5AR0A 4LC9B 3DWLA 3IDHA 4XH4A 3CERA 4A61A 3WUHA 5ADXH 1CZAN 3M3ZA 4QS9A 1NMDA 4M63C 1XC3A 5ELZA 5AQZA 3H1VX 4WQ4C 4BR9A 1NM1A 1T6CA 3IMXA 5F2RA 5AZJA 1KAZA 4IJAA 1S22A 1GLCG 2YJFA 4H5VA 2Q97A 4A2AA 1BA0A 3H46O 2FSJA 5KPTA 3VESA 4BR2A 4JD2B 2D1KA 1NGBA 4CZMA 1WOQA 4H0PA 3VGMA 1BDGA 3VEZA 3CQXA 4XH1A 4WYBA 3WQUA 3AY9A 4CI6A 3VERA 1DEJA 5BPNA 2QXLA 5BRHA 1YXQA 3H6EA 4BC3A 2CH5A 1SAZA 3D2EB 1HPMA 4FPAA 2P9LA 3VEOA 3C7NB 2AA4A 5BN9A 4FWQA 4BRKA 4K41A 4HTLA 3M1FA 3EZWA 3O4WA 4BC5A 4BRLA 4YDUA 5EX5A 3H3NO 4AM7A 2DPNA 2P9NB 3JXUA 4BR4A 4JN4A 2YHYA 3WXJA 1K8KA 1SZ2A 4FOIA 2W40A 4FOEA 1BWFO 3H1QA 3SMSA 2HF3A 2P9KB 5F0XA 3CJ9A 3QFUA 4H0XB 3ZX3A 4BRHA 4DCHA 4BREA 5BREA 5JLHA 2NRHA 3L4IA 4H5NA 2D4WA 3MMVA 4ISEA 3DJCA 2D0PA 3EO3A 5JLFA 2CGKA 3SJHA 1XUPO 3ZEUB 4RWTA 1NGGA 4IO8A 2F9TA 1NGEA 1HKCA 1HX1A 1MWMA 4B1WB 1KAYA 2PAVA 4K43A 3LL3A 2Q36A 4FWRA 4MO5A 2QWMA 1NGJA 1TUUA 4PL8A 3GG4A 4L3QA 2ASOA 5AQPA 1BUPA 4JAXA 1BU6O 4O8KA 3WQTA 5AQGA 2P9SB 4CZLA 3U8XA 3P4IA 4MLEA 1MWKA 4PL7A 4FWPA 5EY4A 3ZETA 3U9DA 3MN9A 1LCUA 2P9PB 4F9OA 5AQKA 2A5XA 1S3XA 4BG8A 1ESVA 3ENHA 2GWJA 3W0LA 2ZF5O 3KZBA 1T44A 5EXWA 4BC4A 5KQDA 2GWKA 3MCPA 4BRCA 3MN7A 1IG8A 3VOVA 3O08A 4B9QA 4BRPA 3H3OB 5BR9A 1JCFA 3FZLA 3QICA 3HSCA 2P9IB 1SQKA 4XEIA 4JHDB 1TYQA 5AQNA 1P8ZA 4C23A 1ZBSA 2BTFA 3FE1A 4HWIA 2Q0UA 4IWVA 3EKSA 3LDQA 1TUYA 4PKGA 1NGCA 5AZIB 3IFRA 3CJ1A 2FSNA 1MA9B 5EOYA 4H0YB 5AQQA 2FXUA 1RGIA 5BPLA 1BOTO 3UKUA 5LJWA 1Z6RA 2E1YA 1HLUA 3LM2A 1QHAA 3LDLA 1NGHA 5JICA 2A6AA 5FPMA 4YDUC 4GNIA 3A5LC 1R59O 2IVOA 4H0OA 4B1ZA 3QDKA 3R9PA 3BEXA 4ISGA 3VETA 1MDUB 1V4TA 4RTFD 1IJJA 2VCPA 4CBWA 2QWPA 2E2NA 2FF6A 2HOEA 5AQVA 3CQYA 4EIAA 1E4GT 3O80A 3R6MA 2V7YA 5AQJA 3VGLA 5AQMA 3ATUA 2P9LB 1GLLO 5AQYA 1BG3A 3ULEB 3VEVA 4H0VB 1C0GA 1KAXA 3TU5A 3O1WA 4GY2B 4WQ5C 4BRFA 1HUXA 3DXKA 4BC2A 3WEEA 3VEWA 3HBTA 2Q2RA 1WUAA 3U9ZA 3C7NA 2YHXA 4WQ4A 3LDNA 1GLBG 1K8KB 2QWRA 2E2QA 5ADXA 3L6QA 2ASPA 4CD3A 4FWNA 4H03B 2GELA 4FSVA 2V7ZA 3OHRA 2Q1NA 5E26A 4DB3A 2QWLA 4CZGA 3FZHA 2P9NA 4DHYA 2OANA 1BA1A 3WXKA 1OKJA 3QB0A 3CJAA 3R8EA 4MO4A 4A62A 4NB4A 4BR7A 1JCEA 2CGLA 3FGUA 2P9KA 2AP1A 5AQFA 3C0BA 3HM8A 5AQLA 3UKRA 4FL9A 1NLVA 3RSEA 1E4FT 5AQWA 2Q0RA 2V52B 5AFUH 2FF3B 2FSKA 4M7XA 4QS8A 5KPZA 1HJOA 1ATRA 1HKBA 3CJCA 3A0IX 5FPDA 1X3NA 1ZC6A 3H45C 3BP8A 2E2PA 3ZEUA 4H5WA 2A40A 4BR0A 1Q18A 3CHWA 3VPZA 4K42A 2QWOA 4E1JA 4KBOA 5AQTA 3S41A 3FR0A 4IJNA 3DXMB 3A5NC 1LOTB 1U2VA 2P9UA 2IVPA 3VEXA 4JNEA 3HTVA 2VWBA 2P9SA 1NGIA 4PKHA 4H5RA 4I6MB 3D7EO 3O1BA 3VF6A 1YVNA 4ISFA 5BRFA 3HZ6A 3O8MA 2P9PA 3G25A 3WXIA 1RFQA 2YCHA 2YHWA 1DKGD 3KHYA 4BVOA 1GLEG 1QZ5A 4CJ7A 1ZXOA 4QS7A 4BQLA 1GLDG 2NZTA 4Z94A 4EHTA 4CZHA 3CJ7A 3MDQA 3SLCA 3CIPA 1KXPA 4EAHD 1YAGA 4BVPA 5BPMA 5LJVA 4RCHA 3IUCA 3LM9A 2P9IA 3BF3A 2E88A 1NWKA 1C0FA 5BN8A 2HMPA 2IVNA 2E8AA 3FZKA 5AZJB 3UKUB 3UB5A 1ATSA 3D2FA 5KQ8A 3VEYA 3WXLA 2QWQA 2YI1A 3ID8A 2WUSA 3EN9A 3FZFA 3QBXA 4DQ8A 5TKYA 4BRDA 3L0QA 2E1ZA 3I33A 5AQIA 1GLAG 4B1VA 3GBTA 4FWLA 3AAQA 3QMLA 3VENA 3F9MA 1J6ZA 1NGDA 2E2OA 1T6DA 2I7NA 3GDQA 4JD2A 1HKGA 4EHUA 5JMVA 3BUZB 1GLFO 5FPEA 2UYTA 1JCGA 3JS6A 5CE3A 2QW9A 3ATVA 1XQSC 2ZWHA 4O5FA 4B1UB 2QWNA 3MK6A 1V4SA 1DGKN 3GE1A 2PBDA 5LY3A 2FLOA 4NO7A 3A5MC 4MLHA 4CBUA 3ZX0A 2GEMA 4CZIA 2KHOA 3D2EA 4IZ9A 5KPRA 3DXKB 2HF4A 2W41A 4BG9A 4CZEA 3W3DA 3FZMA 3WEEB 4BGBA 4J8FA 1BO5O 2Q31A 3CI5A 1ATNA 4IXCA 3ULEA 3VF4A 3O5BA 4BRAA 4BQZA 3WT0A 3ZX2A 2ITMA 1NGFA 3KVGA 3TPQA 2VYPA 3A5OC 2NLXA 4H0TB 3LDOA 3EKUA 1X3MA 3AAPA 2F9WA 1Z05A 3HI0A 3BF1A 3FFKB 1G99A 2I7PA 2D0OA 1D4XA 3AARA 1EQYA 5FPNA 3SK3A 3GL1A 3CETA 4BROA 1GLJO 5AQXA 2ASMA 2YJEA 3UKRB 5F1XA 3A8YA 3QFPA 2CGJA 3B8AX 3RSEB 1NGAA 4XH5A 4CZKA 4BGAA 3VGKA 3MN6A 4FO0A 1RDWX 4WQ5A 3U4LA 4BRMA 2GUPA 3UE5A 4CBXA 4FWKA 5B8HA 3LDPA 4H5TA 3I8BA 5EVZA 3J8AA 4FWOA 1QQOA 2ZGYA 2J4RA 4CZFA 1QQNA 4FPBA 3ZETB 3GOIA 2QM1A 2BUPA 3MN5A 1Y64A 4Y0WA 2IIRA 5AQRA 4BRGA 5AQSA 1U2VB 2H3GX 2ZGZA 2P9UB 3SMPA 3EL2A 5AQOA 3QBWA 4K25A 3ENOA 3VF2A 4BR5A 5AQUA 1H1VA 4PKIA 2V51B 4CD1A 3DAWA 5AQHA 3DXMA 2E20A 4A2BA 4CZJA 4BRIA
chains in the Genus database with same CATH superfamily
4DS4A 5BRDA 1TYQB 1W7AA 3O9UA 2NRRA 4FVMA 2GTDA 4YOWA 4M7YA 5KRTA 3FLCO 3CFOA 4FWSA 3VQCA 4QOZB 1DTQA 4W5OA 1QZ6A 3LWLA 1W9HA 4MDBA 4KHUA 4FWMA 3O6WA 2OTJN 4FCYA 1VQ5N 4CCHA 1LAVA 1VSDA 3ZSZA 2VG6A 4DFMA 3WUHA 4M63C 2KFNA 1XC3A 3VQ8A 4LD0A 4CJ3A 4HUFA 2O8CA 3IMXA 1T6CA 5F2RA 1Q81O 4KFBA 3L8BA 3BZKA 1S22A 3DM2A 1HNZK 3C94A 2Q97A 2QK9A 1UOCA 3H46O 4FJKA 3VQ9A 4W5RA 5KPTA 2OYQA 1Q9YA 3OYDA 4L8RB 4CZMA 1WOQA 3VEZA 3K2PA 4CI6A 4GV6A 3ULDA 3VN5A 1KVCA 4CERA 5BPNA 2IOCA 1IKXA 3C65A 4CEEA 4BC3A 4LH5A 2W6KA 4DTMA 3MXMA 4CHQA 1JL2A 3D2EB 1S1WA 4FJ8A 3E9OA 3VEOA 4CFCA 2ATQA 4K41A 2GX9A 3KKRA 3EZWA 5C15A 4I7FA 3MEGA 5EX5A 3H3NO 3G10A 1DLOA 2P9NB 1J5EK 2YHYA 1N5YA 3WXJA 3DLGA 3NE6A 1WLJA 3U6FA 3PUFA 3T3FA 3TARA 4FZYA 1N33K 4IEEA 4AH9A 3H1QA 1C1AA 2OZSA 4CFDA 3OYKA 3ZT2A 4NLCA 3K59A 3TAGA 1DT9A 3LPTA 5DM6L 1NK4A 2DTUA 1HPZA 3MEDA 3OBYA 2D4WA 2HNDA 1SKWA 4ISEA 1SL1A 4IDKA 1UAXA 1VAZA 2CGKA 3B6OA 4DSLA 1NK5A 4Q0BA 1HKCA 1MWMA 1KAYA 1HYZA 1KD1O 1N32K 3WNHA 1ZBFA 3GG4A 5GINA 3OYHA 1C6VA 4JI1K 4WCEL 4JAXA 1BU6O 5D3GA 4O55A 4CZLA 2JWKA 3P4IA 2OPSA 3OJSA 1HRHA 4JI4K 4Z4HA 4O0IA 1VQ7N 3CQ8A 4JEPA 1S6PA 4B3RK 3DRSA 2QTDA 3D6RA 3U9DA 3MN9A 1LCUA 2A5XA 3ENHA 1CZ9A 2HHVA 2GWJA 3KTQA 3TR8A 5EXWA 2KKZA 1RTJA 2GWKA 4KB1A 3NGIA 4BRPA 3H3OB 3HYFA 5J2QA 3RRHA 3QICA 2WFBA 3HSCA 3HP6A 1SQKA 4M42A 4CJFA 4JHDB 3OBWA 3VQQA 1TYQA 4GKJK 3JSMA 4DV3K 1ZBSA 2BTFA 1KFSA 3LDQA 4DR7K 3ZSWA 4PKGA 3VQBA 4OKEA 3L2WA 3O3HA 4PWDA 4M3WA 4FJMA 1D5AA 4CJ5A 3OYMA 5LJWA 3EYZA 4E72A 3U3YA 3ZLJA 4JK7A 1HLUA 3I0SA 3LDLA 2Z1JA 4IFYA 1WBDA 4WFNL 3CYMA 5FPMA 4ZHRA 1NNEA 5C2DA 1U04A 4FW1A 4N76A 3CCLN 4BE0A 3VQEA 2IVOA 3EE8A 1W97L 3BEXA 1MDUB 3AVKA 3P1GA 4RTFD 4CBWA 4UY8O 2YNGA 3OYCA 4LFAK 4KREA 1NKCA 3J7ZO 4V19S 4CK3A 3AO3A 1J9AA 5HL7L 5JS1A 3CQYA 3R6MA 3NVMA 2V7YA 4W5NA 5AQJA 4DFPA 1FK9A 4HUGA 3CF5L 3ULEB 4F2SA 1C0GA 4WQ5C 4CW7B 3SUOA 3DXKA 3VEWA 4I9LA 1WUAA 3U9ZA 4E3SA 2YHXA 3NMUA 1FXXA 1GOBA 1GLBG 1K8KB 2E2QA 2X6SA 3L6QA 3QEVA 2VWJA 1S1UA 2ASPA 2Y1IA 4CD3A 2XO7A 4N41A 1UA0A 4FSVA 2V7ZA 4B9MA 3EZ5A 4FJJA 3NVKA 2HNYA 2YKNA 2P9NA 4DHYA 1YHQN 1BA1A 4QCLA 4JRQA 3I56N 1EXQA 1M1KO 3R8EA 2PYJA 4RW7A 4NB4A 1ZYQA 2CGLA 3FGUA 5HRSA 2HB5A 1O13A 3G0ZA 5AQFA 1VRUA 5I42A 3MAQA 2D0BA 2PFUA 5AQWA 2V52B 1HJOA 1ITGA 1A5WA 3PX0A 5GADP 2WONA 4GMJB 5C12A 2NNWA 3T19A 2VWKA 4Z0UA 1Q18A 3VPZA 1N8RO 4K42A 4OJRA 4E1JA 3S41A 3FR0A 4KRFA 4IJNA 4CJVA 4RW8A 5GIPA 1EP4A 1K6YA 1N36K 2QKBA 3HTVA 2VWBA 1BQNA 1NGIA 3NDKA 1YVNA 4ISFA 3BY5A 3WXIA 4CJKA 3RRGA 3O4QA 2B6AA 2ZJRL 4HCCA 2UUCK 1GLEG 1BCMA 1U4BA 5HBMA 5FDLA 4QS7A 1GLDG 4Z94A 3CJ7A 3MDQA 4B9NA 3CIPA 2KLAA 3NFAA 2O8DB 5CYQA 1YAGA 2E6LA 1VSEA 2KW4A 4RCHA 1FW6A 3BF3A 1FJGK 3L3UA 4MFBA 2IVNA 4DFJA 3ISNC 2HHWA 1VSFA 4OPHA 1LWFA 3WXLA 1SKSA 1UWBA 4GKKK 3EN9A 3QBXA 4BRDA 2X6NA 3QO9A 4PUOA 1GLAG 3WNFA 3J7YP 3RMAA 3AVIA 3GBTA 4LFCK 4FWLA 3AAQA 3SBGA 4NCGA 1J6ZA 4R79A 2E2OA 4C8NA 1T6DA 3C6TA 4CJPA 3SV3A 4IFEA 4OLBA 3NBPA 2IC3A 1JCGA 3ATVA 4RW9A 2NRXA 4B1UB 3CC4N 4FLVA 3MK6A 4BWJA 1XWLA 1HNVA 2ZJPL 5LY3A 2HBKA 3HO1A 4JKFA 4YOXA 3ZX0A 1RT2A 4CZIA 4RG8A 4IZ9A 2W41A 3W3DA 4DTXA 3WEEB 1IBKK 1EO1A 4Z4CA 4DKWA 4I9QA 4FK0A 4O4GA 3ULEA 4CJQA 3BGRA 1BL3A 1EX4A 4BRAA 3WT0A 3DMJA 2ITMA 4MQ3A 3L4QA 1QVFM 5FROA 1TL3A 4EP5A 1VQON 4HVJA 2P5OA 1Z05A 3HI0A 2G8IA 2ZQBA 2JWLA 3FFKB 4KTWA 2Z1IA 3TAQA 3SPZA 3K57A 1EQYA 4OVLA 1BI4B 3GL1A 4KH5A 3S5TA 1RDBA 5F1XA 3JAMO 2HHHK 3RMDA 4IEIA 1NGAA 5FLXO 3DRPA 4CZKA 3VGKA 1WB9A 3K5OA 3P39A 1NKEA 3U4LA 1KVBA 4JI2K 5I3UA 3E01A 4Z4IA 1WSHA 4DR6K 3LDPA 2C1GA 4YOTA 3MXIA 1QQOA 4CZFA 4LH4A 2D5RA 3CM6A 3ZT0A 2QM1A 1YF5L 2B5JA 4Y0WA 1LV5A 2H3GX 2VG5A 1BCOA 2O8BA 3DLBA 3EL2A 3QBWA 3VQ6A 4K25A 4O5BA 3VF2A 5AQUA 4OO1J 4ZTFA 4ILJA 4DF4A 4BRIA 2A1SA 3TTDA 1X9JA 3J81O 4Z4EA 4K0KK 5E84A 1S9EA 3CJBA 1VHXA 5CY4A 3VTIA 4CGIA 4RW6A 2P1JA 3OYEA 4B1YB 3PO5A 4DWIA 5CHIA 5AFUA 1QQMA 3M6GA 3HVTA 1M90O 5C0YA 1RTIA 5AZIA 4OKJA 4BRQA 4DV7K 1U6ZA 2EWSA 2F7TA 4JRPA 3IDHA 4XH4A 3CPEA 2YKMA 3M3ZA 1J54A 5ELZA 4DTSA 4NCBA 4WQ4C 2OA8A 3NCIA 4K8XA 2G8FA 1NM1A 3WNGA 1K8AO 1QSSA 1KAZA 4CHYA 3AGRA 4FM1A 3E9LA 4DTOA 2YJFA 4H5VA 1U48A 1EKEA 3TAPA 3F5TA 4JD2B 2D1KA 3SPYA 2ITGA 1BDGA 4CGFA 1WAFA 3WQUA 4GV9A 1RT4A 2KZZA 1DEJA 3N4QA 3NHGA 4CF9A 3VA3A 2CH5A 3SNNA 4CJEA 1HPMA 2P9LA 1VSHA 2AA4A 5BN9A 1C0TA 1BISA 4JKGB 1NK9A 4KKOA 4BC5A 5GAGP 4DV1K 4AM7A 3G71N 2BGGA 3JXUA 2HBMA 4JKCA 1BQMA 2W40A 4C1NI 3SMSA 1KFDA 3SQ2A 2P51A 4CK1A 5LMUK 4FJ5A 1YJ9N 5F0XA 3QFUA 5M1QA 1NK0A 5BREA 1XI1A 2NRHA 3SUPA 3CMAN 4XIUA 1ASWA 3LP3A 5KGWA 4LF6K 2D0PA 3SJHA 3CC7N 4F8RA 3OYBA 1SV5A 3ZSVA 1BI4A 4YOVA 3ZEUB 4DV4K 4OKKA 4IO8A 3QNOA 2F9TA 1NGEA 4LF8K 5J1EA 4YY3K 3QEWA 2PAVA 1HQUA 4KPYA 4FWRA 2QWMA 4E19A 3KK3A 4GVMA 1NGJA 4I2QA 1TUUA 1QS4A 3E9PA 5AQPA 3I0RA 3OYAA 4DQRA 3HL8A 2O8EA 5AQGA 3KWGA 1RDDA 1J53A 3PSIA 4N56A 2O4GA 1WAJA 4F9OA 1S3XA 2RF2A 1QSYA 4CIEA 4FLWA 1HMVA 3KZBA 4BC4A 4FLUA 4X62K 3C6UA 3QETA 3QESA 4BRCA 4DU3A 3O08A 4ZTJA 4B9QA 4PQUA 1T3VA 4AHCA 5BR9A 3THWA 1JCFA 4FJHA 3JYTA 4XEIA 1RDCA 4JKBA 3V9XA 1P8ZA 3ZT4A 4HWIA 4IWVA 1TAQA 2HNZA 4BACA 2NRZA 1NGCA 1RBSA 4BDYA 4FM2A 5A2QO 4H0YB 2FXUA 5BPLA 4E7HA 3V9UA 4NCAA 1BOTO 3UKUA 2OPRA 2XRIA 2D0AA 1QHAA 4DUZK 2A6AA 4AQYK 4DFKA 1SUQA 4GNIA 3A5LC 1R59O 3O3FA 1W0HA 4FJGA 3CCQN 2XY8A 5DMRA 1IJJA 2VCPA 1VSJA 2QWPA 5EU7A 4CF0A 3ZSQA 1YI2N 2IAJA 3DLEA 3DI6A 4JI6K 3MEEA 1L3TA 1E4GT 4KTZA 4CF1A 2ZJQL 3ATUA 1GLLO 5AQYA 1BG3A 4DUYK 5GAEP 1KAXA 3O1WA 4DSIA 1HUXA 1TAUA 3ZT3A 4BEBA 3SYZA 4CJLA 1HQEA 3HBTA 3KK7A 2E5LK 4CVNE 1ZBIA 3NH2A 3FFIA 1XMQK 4C8LA 2XY5A 3HJFA 3SV4A 4H03B 1RT3A 3OHRA 4NXMK 2Q1NA 3L2VA 3HPOA 1OKJA 1QSLA 4M45A 1NU0A 3QB0A 3CJAA 4A62A 3UIQA 4R5PA 3PIPL 3V9ZA 3C0BA 3HM8A 4AHSA 5AQLA 4B9LA 3NGZA 3RSEA 2HSTA 4A57A 2Q0RA 5AFUH 2FF3B 1WNSA 4M7XA 3OS0A 3O9RA 1HKBA 4G1QA 4LF7K 4ELTA 3H45C 5C10A 2E2PA 3ZEUA 3QIPA 4CHNA 3AO4A 2AJQA 4BR0A 2G8WA 3QEXA 1TK0A 1I94K 3LZIA 3ZT1A 1L3UA 3OYIA 1GOAA 3DXMB 3A5NC 3DLHA 1U2VA 2P9UA 2YX6A 2IVPA 3VEXA 4FVUA 4JNEA 1NK8A 3KK2A 4FW2A 4N47A 4H5RA 3AO1A 2BDPA 1SS6A 1IKVA 3THXB 2PYLA 5BRFA 1MU2A 3HZ6A 3G25A 1RFQA 4CEBA 2DFHA 4M3YA 3KHYA 3SZ2A 4E7IA 1P90A 1ZXOA 4MDAA 2G8UA 2NZTA 4DLEA 4DSJA 4EHTA 3V9SA 3SLCA 1N34K 1KXPA 4EAHD 4BVPA 4IG0A 4M3ZA 1ASVA 2HBJA 4NLBA 3CCVN 4FYDA 3KLFA 1U47A 4DR4K 1IH7A 1Z26A 3VEYA 1JLBA 3ZSXA 3LALA 1RBRA 1X9MA 4X65K 1J5OA 3N4PA 4LY7A 2ZM6K 3AVHA 5C25A 3SAHA 2RE2A 5TKYA 2WTUA 4BWMA 3TTCA 4ID5A 3I33A 5AQIA 4B1VA 3VENA 5C24A 3NF7A 1A5VA 5HRNA 1ZBHA 4DQIA 4IOAL 2I7NA 1JXBA 1S5JA 1HKGA 2IS3A 4EHUA 5JMVA 3BUZB 1GLFO 3JS6A 5SWMA 4K8ZA 3D45A 4O5FA 2QWNA 4KI6A 2OPQA 2PBDA 3WNEA 2FLOA 1HYVA 4NO7A 2GEMA 3D2EA 5KPRA 3A2FA 3E66A 4BG9A 3PV8A 4YOYA 2RHKA 3FZMA 1QE1A 1ATNA 3P31A 3LWMA 2RPIA 3O5BA 3KJVA 3ZX2A 3O9TA 5J2PA 1NGFA 3KVGA 3TPQA 4BDPA 3C6AA 3P83D 1Z25A 1ASUA 3P5JA 4LF5K 3AAPA 2F9WA 3D0PA 3IKMA 1NJYA 3HSTB 4EZ6A 4CFAA 1G99A 2D0OA 4DV6K 1D9DA 5FPNA 3SK3A 4FJ9A 3KWIA 1JKHA 1GLJO 3UKRB 3M5RA 3DYAA 4AF1A 1WN7A 4FO0A 1RDWX 1CXQA 3O3GA 1JLGA 4LFBK 4FWKA 2UXBK 4DTNA 1YJNN 4DQQA 3S3MA 1VSLA 3J8AA 3DLKA 4FZZA 2ZGYA 3LPUA 4FPBA 3ZETB 3TSUA 4KAZA 1Y64A 2X78A 4B9UA 1BHLA 4CGJA 5AQOA 4BE7B 1H1VA 1U45A 1VK0A 4X64K 3DAWA 5AQHA 4GV3A 3DXMA 3SQ4A 4JI8K 3SQ1A 2WC9A 1VQNN 1NBWA 3HOTA 1TKXA 1RTDA 5SZTA 4KHQA 4FLZA 3K58A 2A42A 1IV0A 3THXA 4B1XB 2FBYA 1L3VA 1VQMN 1C0MA 4JHDA 1SKRA 3EY1A 1NG9A 3VQ7A 4BE2A 5I9EB 1QVGM 3T7ZA 4KHWA 3VTHA 3THVA 4FXDA 2E6MA 3D2FB 4A61A 4JKAA 1CZAN 5H1SQ 3LZJA 3TABA 5AQZA 3H1VX 4Y1CA 3PX4A 4CJSA 1GLCG 2EX3A 1RBTA 1BA0A 2FSJA 3Q7CA 5DM7L 3VESA 2GV9A 1YVUA 4H0PA 3VGMA 5K14A 3KD5E 1T03A 4N5SA 4WE1A 3AY9A 4BE1A 3AA5X 1YIJN 2QXLA 5BRHA 3H6EA 3TSPA 4M3TA 4A5AA 1X1PA 3MX5A 3SI6A 2UU9K 2UUAK 4ICLA 1C1CA 4FWQA 3VQDA 4DR3K 2HHSA 1LWEA 4HTLA 1D8YA 3M1FA 3CG7A 4BRLA 2GBZA 4X66K 1VQPN 4YDUA 1KLMA 1HJRA 1VSIA 1K8KA 1IG9A 2R7YA 2QKKA 4JV5K 1JLQA 3B6PA 3O9QA 3R1XA 4J2AA 4UQGA 2JGUA 4E1MA 1ZBUA 3QERA 3CJ9A 4IO9L 4M41A 1K9MO 3ZX3A 4BRHA 4BREA 4M3RA 3TTFA 4H5NA 3MMVA 4W5QA 3EO3A 5JLFA 4O0JA 3F9KA 4E7JA 4FJ7A 1NGGA 1C0UA 3O9SA 2YNIA 4B1WB 4K43A 3LL3A 4JI7K 2OZMA 1YJWN 4OGCA 3AVGA 1TVRA 4PL8A 4FJIA 4OPAA 1Q8IA 3LP2A 1BUPA 4O8KA 2P9SB 3K5NA 4F4KA 1XNQK 4XJXA 4MLEA 1MWKA 4CHPA 3OYLA 4PL7A 4IG3A 4FWPA 3DLLL 4NYFA 4JS4A 1KVAA 2NRTA 5EY4A 4DG1A 3ZETA 1VQLN 4KV8A 5AQKA 3O4NA 1ESVA 3CCRN 1S6QA 2ZF5O 2IGIA 1T44A 1X9WA 1Q9XA 3L2UA 2BH1A 3V1OA 3MN7A 4CIGA 3OS1A 2KZMA 3ZSOA 4CF2A 2KQ2A 2HVIA 1R0AA 1N6QA 5AQNA 4LF9K 4DTPA 1OVQA 2IDOA 3VQ4A 4C23A 3RTVA 2Q0UA 1YT3A 3EKSA 1TUYA 3NF8A 1VSMA 2O8DA 3TAEA 3IFRA 4DTUA 3LP0A 3K9KA 1MA9B 3AA4A 5EOYA 5AQQA 2UXDK 3THYB 1WSJA 1RGIA 4YHHK 1KSPA 3LM2A 1NGHA 3VQ5A 4E89A 5M1KA 3SUQA 4ELVA 4YDUC 4B9VA 4FLYA 3S3NA 2YNHA 4B1ZA 3QDKA 4Q5VA 3T69A 4B3OA 1TGOA 1RT1A 3KKSA 4IOCL 2YV0X 4O8UA 4ILHA 4F3TA 2E2NA 4CGDA 5AQVA 4CGHA 3PY8A 2B4JA 1HYSA 4CEDA 1LW0A 4C8KA 4EIAA 3RVCA 4CEZA 2DFFA 3QINA 4H0VB 3IRXA 4BRFA 4BC2A 4JS5A 4HTUA 3WXMB 4E7KA 3WEEA 4YORA 2G8HA 1JLCA 3SCXA 5ADXA 3CCUN 1ILYA 4DV5K 4FWNA 5GIOA 5E26A 4DB3A 4CZGA 2OANA 1BIZA 2HHXA 1WSGA 2G8VA 4DR5K 1VQ4N 2PY5A 2AP1A 4GVEA 1NJZA 2YHAA 2Z1GA 1NLVA 3L3VA 4FLXA 2HMIA 1JLFA 3G6EN 4NXNK 5FRNA 4DTRA 5LL6Z 5KPZA 3OJUA 2A1RA 1ATRA 3CJCA 3A0IX 5CR4A 5FPDA 5C42A 1RDAA 1X3NA 2BE2A 1RDUA 3OW2M 4KHYA 2WBNA 3AVBA 3CHWA 1S9GA 5M1FA 5AQTA 1QHTA 4KTQA 2QI2A 3CXCM 3VMFB 4FZXC 1Q82O 4OX9K 4W5TA 1LOTB 3V6DA 1L3SA 5KTQA 1RCHA 3TSQA 2P9SA 4PKHA 3KLIA 2HHIA 3RMCA 3AO5A 4I6MB 2FBXA 1XNRK 3LANA 1A5XA 3J80O 3V4IA 3EE9A 1DKGD 1QZ5A 3KIOA 4CJ7A 4FJXA 4Z4FA 1WBBA 3PLAA 1FKPA 4BQLA 5JS2A 2NUBA 4CFBA 5BPMA 5LJVA 1XMOK 3IUCA 5JVHL 2E88A 1C0FA 5BN8A 3SUNA 3DOLA 5HOOA 3FZKA 2XY7A 1HR0K 2C1IA 3V1QA 5AZJB 5KQ8A 2O8FB 1JLEA 3CM5A 4CJWA 2NRVA 1Y97A 3KLGA 1G15A 3THYA 4KI4A 3L0QA 1WSIA 3DLRA 1B92A 3AVLA 3AVJA 2NRWA 3MCAB 3QMLA 3F9MA 1CXUA 1NGDA 3AGKA 5HRPA 3K5MA 3VA0A 4JD2A 4U67L 4CF8A 1JL1A 4B8AB 5FPEA 4PHTX 2HVHA 1XQSC 2F4VK 4JK9A 1V4SA 1DGKN 1KQSM 4JKHA 1KRPA 4MLHA 3OYJA 1C1BA 4DSKA 2KHOA 3DXKB 2HF4A 1S1XA 3U3GA 2Q3SA 4H4MA 4B3MK 1S72N 4BGBA 4F3OA 1S1TA 1BO5O 2Q31A 4JKGA 2W00A 2VGMA 3OYNA 4HUEA 1B9FA 3CI5A 1NJIO 3AVMA 3VF4A 3QEIA 4DMNA 1CZBA 4BQZA 3OA9A 4OPJA 2VYPA 3A5OC 1F21A 1RT7A 1NOZA 3RWUA 4JLHA 3OYFA 3QEPA 1TKZA 5IWAK 4HCBA 3AARA 4BROA 3M8PA 5AQXA 2ASMA 1RT6A 2YJEA 3AVCA 4AILC 3QNNA 4B9SA 3QFPA 2CGJA 3B8AX 3ZSYA 3L2QA 2ZE2A 4XH5A 3MN6A 3LP1A 1E3MA 4WQ5A 3PSFA 4BRMA 2GUPA 3UE5A 1EWRA 4I2PA 1WSEA 3SAFA 4CESA 3HT3A 4CECA 4A5BA 1EWQA 4H5TA 5EVZA 4JI5K 2LSNA 3T1AA 1QQNA 1RBUA 3GOIA 2BUPA 1NJXA 3MN5A 5AQRA 1LAWA 2ZGZA 3NGYA 4DQSA 1I39A 3ALYA 4CEOA 4A2BA 4CZJA 3AVFA 2O4IA 5AJ3K 2KTQA 2QEXN 2I5JA 4AHVA 3IS9A 4I6MA 1B9DA 3SJJA 1YUWA 4O44A 4YNQA 4U7BA 2A41A 3PO4A 4BRNA 2CH6A 4EFHA 3T1YK 2A3ZA 4JKDA 3IAYA 4J2BA 4E7LA 4AM6A 4JK8A 5CYMA 4C8MA 5KRSA 5AR0A 3V9WA 4LC9B 1YITN 3DWLA 3CYGA 3CERA 4DU1A 5ADXH 4QS9A 4PA1A 1NMDA 4LSNA 3SAGA 3RR7A 4BR9A 2FBVA 1VRTA 2P5GA 2OPPA 5AZJA 4LSLA 2O8FA 4LF4K 1OH5A 4IJAA 3TI0A 3E1YA 3EEQA 1JJ2M 4CE9A 2KFZA 4A2AA 2JLEA 4BR2A 1NGBA 1NOYA 1VSKA 3NH1A 3CQXA 4XH1A 3ASMA 4WYBA 3VERA 3K0SA 3F2KA 5C2FA 5KGXA 3TANA 1VQ9N 1YXQA 3HOSA 3OVNA 1SAZA 4FPAA 3C7NB 1NJWA 4KH4A 4H8KA 4BRKA 3RMBA 1NK7A 1T05A 1QTMA 4ILGB 5HROA 2YNFA 2Z1HA 3O4WA 2X74A 4CHOA 3ITHA 1X9SA 3CD6N 1QQCA 2DPNA 3AV9A 4WFBL 5M1PA 1JLAA 4BR4A 4JN4A 1SZ2A 4FOIA 3LAKA 4FOEA 1BWFO 4C1NK 3TWHA 2HF3A 3VQPA 1VQ8N 2P9KB 2D0CA 4H0XB 1OH6A 3OY9A 1TV6A 5KI6A 4DCHA 4BECA 4OPKA 5JLHA 3CCSN 3L4IA 1TK5A 1OH7A 5HRRA 1HNXK 2VG7A 3DJCA 3HXMA 2F8TA 3H08A 4WFAL 3MWTA 1XUPO 1YTAA 4RWTA 2UUBK 4YOUA 3QLHA 1HX1A 4HHTA 3AVNA 3ZSRA 3LAMA 2Q36A 4IOXA 4MO5A 2VQEK 4FK2A 4OGEA 2HHTA 4L3QA 2ASOA 4KHNA 3CPWM 2QXFA 3WQTA 1XC9A 3U8XA 5M1NA 3KLHA 2O8BB 5DK5A 4TSXA 2F8SA 4B3TK 1O1WA 2FBTA 3RR8A 2P9PB 3TAFA 4IBNA 1BIUA 4BG8A 3HP9A 5HLFA 1VQKN 3W0LA 4FM0A 3ID6A 4F2RA 3AA3A 3OTOK 2EHGA 1OH8A 1YTUA 5KQDA 3HVRA 3MCPA 1IG8A 1Q7YO 3VOVA 1RILA 3R3LA 3MXJA 4QAGA 4A59A 1NKBA 3FZLA 5TKWA 3OYGA 5CZ2A 3ZYYX 1OVYA 2P9IB 1Q86O 1LW2A 5BR8K 4IFVA 3FE1A 1JXEA 3NH0A 3OS2A 5AZIB 4CIFA 4IKFA 3CJ1A 2FSNA 3HK2A 4CEAA 4CK2A 4J2EA 3J7AP 3V1RA 4BDZA 1Z6RA 2E1YA 5JICA 2QA4N 3CCEN 2YHBA 3VQAA 4DS5A 5GAHP 1KLNA 4J2DA 4CJRA 4H0OA 3S3OA 3R9PA 4ISGA 3HRGA 3VETA 4DQPA 3M8RA 4DV0K 1V4TA 1D9FA 4DR1K 2FF6A 5E41A 5T7BA 1U49A 4CJTA 1RTHA 2HOEA 4G9ZA 3C95A 3MECA 1KTQA 3CCMN 1ZBLA 3NAEA 4E0DA 1BGXT 3PIOL 3O80A 2E4LA 3VGLA 5AQMA 1RNHA 2HHQA 2P9LB 3VEVA 2DY4A 3CMEN 3TU5A 4GY2B 3AO2A 2HBLA 2WOMA 1REVA 2Q2RA 3AA2A 3C7NA 4WQ4A 1IO2A 3LDNA 1DTTA 2QWRA 2W6LA 3IG1A 3T1HK 2GELA 1NMNA 2QWLA 1TK8A 3FZHA 3WXKA 4FJNA 4CHZA 4C8OA 1NK6A 4MO4A 2W42A 3SBTA 4BR7A 1JCEA 3Q7BA 3LDSA 1IKYA 4EZ9A 2P9KA 1RBVA 3UKRA 4JI3K 4FL9A 4WF9L 4M3XA 1E4FT 3SQ0A 2FSKA 4QS8A 4RW4A 4KB0A 5JENA 1ZC6A 3ZCMA 3BP8A 4H5WA 2A40A 3BZCA 4DTJA 2O8EB 2QWOA 3TAMA 3QIOA 4KBOA 5FRMA 4Y1DA 5M1OA 1UA1A 4FJLA 3MWPA 3MX2A 4DLGA 3D7EO 3O1BA 3VF6A 1IBLK 3PX6A 3CC2N 4CGGA 4CJ4A 1KCFA 3O8MA 2P9PA 4AHTA 2YCHA 3THWB 2YHWA 3L2RA 3K5LA 4M3UA 4DSEA 4BVOA 3HPHA 3HM9A 5HP1A 3DOKA 1WSFA 4CZHA 5JVGL 3P38A 4DU4A 2DFEA 4OLAA 3LM9A 2P9IA 1NWKA 2HMPA 3I8DA 2E8AA 2OCEA 1LWCA 2O8CB 3C6HA 1EETA 4DV2K 3UKUB 3UB5A 1ATSA 3D2FA 4KHSA 4YFUA 2QWQA 2YI1A 4DF8A 4BY9C 3ID8A 2GUIA 4ELUA 2WUSA 3M8QA 2G8KA 4PY5A 3FZFA 1SL2A 4DQ8A 3BDPA 1TKTA 2E1ZA 4KH6A 4CEFA 1SL0A 1VQ6N 3ENBA 4CJUA 3GDQA 4KO0A 3V81A 4IDHA 4JYAK 2UYTA 1XHZA 5CE3A 1XHXA 2QW9A 2ZWHA 3M8SA 3CFRA 1KC8O 4JI0K 3NF6A 3GE1A 3K9JA 3A5MC 4CBUA 2F96A 3NF9A 4CZEA 1W2BM 3KLEA 4J8FA 4KHPK 3KD1E 4IXCA 4NYNA 2VQFK 1IBMK 1T7PA 1HNWK 3DRRA 3AVAA 2BANA 1CLQA 2ETJA 5IT9O 1RT5A 2NLXA 4H0TB 3F73A 3LDOA 3EKUA 1X3MA 2UXCK 1TL1A 5MLCQ 1FKOA 3BF1A 2I7PA 2OTLN 2Y1JA 1D4XA 4H4OA 3CETA 3KK1A 2PZSA 4Z4GA 1S1VA 5J2NA 3A8YA 3RSEB 4ID1A 4AHUA 3CFPA 5LMNK 4AHRA 4B3SK 2HHUA 4GW6A 4BGAA 2ZD1A 1I3AA 4JKEA 1T8EA 4CBXA 1TKDA 4CEQA 4B08A 1HNIA 4DR2K 5B8HA 3I8BA 4E1NA 2FC0A 3I55N 3CCJN 1K73O 4FWOA 2J4RA 5J2MA 4EP4A 4FLTA 2RKIA 2XHBA 2IIRA 4BRGA 1IKWA 1U2VB 5AQSA 2P9UB 4DSFA 4B8CA 3SMPA 4B9TA 3S9HA 2RN2A 2XY6A 2HW3A 3ENOA 1L5UA 2VGNA 4BR5A 4PKIA 2V51B 4CD1A 4FK4A 1GOCA 2E20A 5CZ1A 3G4SN 3HPGA
chains in the Genus database with same CATH topology
1NBWA 3TTDA 3HOTA 1X9JA 2QEXN 5BRDA 1TYQB 5E84A 4I6MA 3CJBA 3VTIA 3O9UA 2A42A 2NRRA 2GTDA 4YOWA 4M7YA 1YUWA 4U7BA 2A41A 4BRIA 4B1XB 3FLCO 4B1YB 4FWSA 4BRNA 2CH6A 4EFHA 1VQMN 4JHDA 5CHIA 2A3ZA 5AFUA 1QQMA 4JKDA 3M6GA 1QZ6A 1M90O 5C0YA 4MDBA 5I9EB 4AM6A 4FWMA 3O6WA 4JK8A 5AZIA 3T7ZA 4BRQA 1QVGM 3VTHA 1U6ZA 2EWSA 2F7TA 2OTJN 3D2FB 5AR0A 4LC9B 1YITN 1VQ5N 3DWLA 3IDHA 4XH4A 3CERA 3CPEA 4JKAA 3WUHA 4A61A 5ADXH 1CZAN 3M3ZA 4QS9A 5H1SQ 1NMDA 4M63C 1XC3A 5ELZA 5AQZA 3H1VX 4WQ4C 4BR9A 3SAGA 1NM1A 1T6CA 3IMXA 5F2RA 1Q81O 5AZJA 1K8AO 1KAZA 4IJAA 1S22A 3AGRA 1GLCG 3E1YA 3E9LA 2YJFA 4H5VA 2Q97A 1JJ2M 4A2AA 1BA0A 3H46O 2FSJA 3Q7CA 5KPTA 3VESA 4BR2A 3F5TA 4JD2B 2D1KA 5DM7L 1NGBA 4CZMA 1WOQA 4H0PA 3VGMA 1BDGA 3VEZA 3CQXA 4XH1A 4WYBA 3WQUA 3AY9A 4CI6A 4GV6A 3VERA 4GV9A 1YIJN 1DEJA 3N4QA 3F2KA 5BPNA 2QXLA 5C2FA 5BRHA 1VQ9N 1YXQA 3C65A 3HOSA 3H6EA 3TSPA 4BC3A 2CH5A 4A5AA 1SAZA 3MX5A 3D2EB 1HPMA 3E9OA 4FPAA 2P9LA 3VEOA 3C7NB 2AA4A 4KH4A 5BN9A 4FWQA 4BRKA 4K41A 4ILGB 2GX9A 4JKGB 4HTLA 3M1FA 3EZWA 3O4WA 4BC5A 4BRLA 5GAGP 1VQPN 4YDUA 5C15A 5EX5A 3H3NO 4AM7A 3G71N 3CD6N 2DPNA 2P9NB 3JXUA 4WFBL 2HBMA 5M1PA 4BR4A 4JN4A 2YHYA 4JKCA 3WXJA 1K8KA 1SZ2A 4FOIA 2W40A 4FOEA 4IEEA 4C1NI 1BWFO 4C1NK 3H1QA 3O9QA 3R1XA 3SMSA 2HF3A 1VQ8N 2P9KB 1YJ9N 5F0XA 4NLCA 1DT9A 3CJ9A 3QFUA 4H0XB 4IO9L 1K9MO 3ZX3A 4BRHA 4DCHA 5M1QA 4BREA 3TTFA 4BECA 5DM6L 5BREA 5JLHA 3CCSN 2NRHA 3OBYA 3L4IA 4H5NA 2D4WA 3CMAN 3MMVA 4ISEA 3DJCA 2D0PA 3EO3A 4WFAL 5JLFA 2CGKA 1VAZA 3MWTA 3SJHA 3CC7N 4YOVA 1XUPO 3ZEUB 4RWTA 1NGGA 4YOUA 4IO8A 2F9TA 1NGEA 1HKCA 1HX1A 3O9SA 1MWMA 4B1WB 1KAYA 2PAVA 4K43A 3LL3A 1KD1O 4IOXA 2Q36A 4FWRA 4MO5A 2QWMA 1YJWN 1NGJA 1TUUA 4PL8A 3E9PA 3GG4A 5GINA 4L3QA 2ASOA 4OPAA 5AQPA 4WCEL 1BUPA 4JAXA 1BU6O 4O8KA 3CPWM 3WQTA 5AQGA 2P9SB 4CZLA 3KWGA 2JWKA 3U8XA 3P4IA 4XJXA 5M1NA 4MLEA 1MWKA 1VQ7N 4PL7A 4JEPA 4FWPA 3DLLL 2NRTA 5EY4A 2QTDA 3D6RA 3ZETA 3U9DA 3MN9A 1LCUA 2P9PB 4F9OA 5AQKA 1VQLN 2A5XA 1S3XA 4BG8A 1ESVA 3ENHA 1VQKN 2GWJA 3W0LA 3ID6A 3CCRN 2ZF5O 3KZBA 1T44A 5EXWA 4BC4A 2KKZA 5KQDA 2BH1A 2GWKA 3MCPA 4BRCA 3MN7A 1IG8A 1Q7YO 3VOVA 3O08A 3R3LA 4B9QA 1T3VA 4BRPA 3H3OB 5BR9A 4A59A 1JCFA 3FZLA 3QICA 2WFBA 3HSCA 5TKWA 3ZYYX 1OVYA 2P9IB 1SQKA 4XEIA 1Q86O 4JHDB 3OBWA 1TYQA 5AQNA 4JKBA 1P8ZA 4C23A 1ZBSA 2BTFA 3FE1A 4HWIA 2Q0UA 4IWVA 3EKSA 3LDQA 1TUYA 4PKGA 2NRZA 1NGCA 5AZIB 3IFRA 3CJ1A 2FSNA 3K9KA 1MA9B 5EOYA 4H0YB 5AQQA 2FXUA 1RGIA 5BPLA 1BOTO 3UKUA 5LJWA 1Z6RA 2E1YA 4JK7A 1HLUA 3LM2A 1QHAA 3LDLA 1NGHA 5JICA 2QA4N 2A6AA 4WFNL 3CCEN 5FPMA 5C2DA 5M1KA 4YDUC 4GNIA 3A5LC 3CCLN 5GAHP 1R59O 2IVOA 4H0OA 4B1ZA 3EE8A 3QDKA 3R9PA 1W97L 3BEXA 4ISGA 3T69A 3CCQN 3HRGA 3VETA 1MDUB 1V4TA 4RTFD 1IJJA 4IOCL 2VCPA 4CBWA 4O8UA 4ILHA 4UY8O 2QWPA 2E2NA 2FF6A 3J7ZO 2HOEA 4G9ZA 5AQVA 1YI2N 3CCMN 5HL7L 3CQYA 3PIOL 4EIAA 1E4GT 3NVMA 3O80A 3R6MA 2V7YA 5AQJA 3VGLA 5AQMA 2ZJQL 3ATUA 3RVCA 2P9LB 1GLLO 5AQYA 1BG3A 5GAEP 3CF5L 3ULEB 3VEVA 4H0VB 3CMEN 1C0GA 1KAXA 3TU5A 3O1WA 4GY2B 4WQ5C 4BRFA 1HUXA 3DXKA 2HBLA 4BC2A 3WXMB 4BEBA 3WEEA 3VEWA 3HBTA 2Q2RA 4YORA 3KK7A 1WUAA 3U9ZA 3C7NA 2YHXA 3NMUA 4WQ4A 3LDNA 1GLBG 1K8KB 2QWRA 2E2QA 5ADXA 3L6QA 3CCUN 2ASPA 1ILYA 4CD3A 4FWNA 4H03B 5GIOA 2GELA 4FSVA 2V7ZA 3OHRA 2Q1NA 5E26A 4DB3A 2QWLA 4CZGA 3NVKA 3FZHA 2P9NA 4DHYA 2OANA 1YHQN 1BA1A 3WXKA 3I56N 1OKJA 1M1KO 3QB0A 3CJAA 3R8EA 4MO4A 4A62A 4NB4A 3SBTA 4BR7A 1JCEA 3Q7BA 2CGLA 3PIPL 3FGUA 1VQ4N 2P9KA 2AP1A 1O13A 5AQFA 3C0BA 4GVEA 3HM8A 5AQLA 3UKRA 4FL9A 1NLVA 4WF9L 2PFUA 3RSEA 2HSTA 4A57A 3G6EN 1E4FT 5AQWA 2Q0RA 2V52B 5AFUH 2FF3B 2FSKA 4M7XA 4QS8A 3O9RA 5KPZA 1HJOA 1ATRA 1HKBA 3CJCA 3A0IX 5CR4A 5FPDA 1X3NA 1ZC6A 3H45C 5C10A 5GADP 3BP8A 2E2PA 3ZEUA 1RDUA 5C12A 3OW2M 2NNWA 2WBNA 4H5WA 2A40A 4BR0A 1Q18A 3CHWA 3VPZA 4K42A 2QWOA 4E1JA 1N8RO 5M1FA 4KBOA 5AQTA 3S41A 3FR0A 2QI2A 4IJNA 3CXCM 3DXMB 3A5NC 3VMFB 1Q82O 1LOTB 5GIPA 1U2VA 2P9UA 2YX6A 5M1OA 2IVPA 3VEXA 4FVUA 4JNEA 3HTVA 2VWBA 2P9SA 3MWPA 3MX2A 3TSQA 1NGIA 4PKHA 4H5RA 4I6MB 3D7EO 3O1BA 3VF6A 1YVNA 1SS6A 4ISFA 3CC2N 5BRFA 3HZ6A 3O8MA 2P9PA 3G25A 3WXIA 1RFQA 2YCHA 2YHWA 3EE9A 2ZJRL 1DKGD 3KHYA 4BVOA 1GLEG 1P90A 1QZ5A 4CJ7A 1ZXOA 4MDAA 3PLAA 4QS7A 4BQLA 1GLDG 2NZTA 4Z94A 4EHTA 4CZHA 3CJ7A 3MDQA 3SLCA 3CIPA 1KXPA 2KLAA 4EAHD 3P38A 5JVGL 1YAGA 4BVPA 5BPMA 5LJVA 4RCHA 3IUCA 3LM9A 2P9IA 5JVHL 3BF3A 2E88A 2HBJA 1NWKA 1C0FA 4NLBA 5BN8A 3CCVN 2HMPA 2IVNA 5HOOA 2E8AA 3FZKA 2C1IA 3C6HA 5AZJB 3UKUB 4OPHA 3UB5A 1ATSA 3D2FA 5KQ8A 3VEYA 3WXLA 2QWQA 2YI1A 3N4PA 4BY9C 3ID8A 2NRVA 2WUSA 3EN9A 3FZFA 3QBXA 3SAHA 4DQ8A 2RE2A 5TKYA 4BRDA 3L0QA 2E1ZA 3TTCA 3I33A 4KH6A 5AQIA 1GLAG 1VQ6N 4B1VA 3GBTA 4FWLA 2NRWA 3AAQA 3MCAB 3QMLA 3SBGA 3F9MA 3VENA 3ENBA 1J6ZA 1NGDA 4R79A 2E2OA 3AGKA 4IOAL 1T6DA 2I7NA 3GDQA 4JD2A 4U67L 1HKGA 4IDHA 4EHUA 4IFEA 5JMVA 3BUZB 1GLFO 5FPEA 2UYTA 1JCGA 3JS6A 4PHTX 5CE3A 2QW9A 3ATVA 1XQSC 2ZWHA 2NRXA 4O5FA 4JK9A 4B1UB 2QWNA 1KC8O 3CC4N 3MK6A 2ZJPL 1V4SA 1DGKN 3GE1A 2PBDA 2HBKA 4JKHA 5LY3A 3K9JA 1KQSM 2FLOA 4NO7A 3A5MC 4JKFA 4MLHA 3ZX0A 4CBUA 4YOXA 2GEMA 4CZIA 2KHOA 3D2EA 4IZ9A 5KPRA 3DXKB 2HF4A 2W41A 3E66A 4BG9A 4CZEA 3W3DA 4YOYA 2RHKA 3FZMA 3WEEB 1S72N 1W2BM 4BGBA 1EO1A 4J8FA 4DKWA 1BO5O 2Q31A 4JKGA 2W00A 2VGMA 1NJIO 3CI5A 1ATNA 3P31A 4IXCA 3ULEA 3VF4A 3O5BA 4BRAA 4BQZA 3OA9A 3WT0A 3ZX2A 3O9TA 2ITMA 1NGFA 3KVGA 3TPQA 2VYPA 3L4QA 3A5OC 1QVFM 3C6AA 2NLXA 4H0TB 3LDOA 3EKUA 1X3MA 3AAPA 1VQON 2F9WA 3IKMA 1Z05A 5MLCQ 3HI0A 2JWLA 3BF1A 3FFKB 1G99A 2I7PA 2OTLN 2D0OA 1D4XA 3AARA 1EQYA 5FPNA 3SK3A 3GL1A 3CETA 4KH5A 4BROA 3KWIA 1GLJO 5AQXA 2ASMA 2YJEA 3UKRB 5F1XA 3A8YA 3QFPA 2CGJA 3B8AX 3RSEB 3M5RA 4IEIA 1NGAA 4AF1A 4XH5A 4CZKA 4BGAA 3VGKA 3MN6A 4FO0A 3P39A 1RDWX 4WQ5A 3U4LA 4JKEA 4BRMA 2GUPA 3UE5A 4CBXA 4FWKA 3SAFA 1YJNN 5B8HA 4A5BA 3LDPA 4H5TA 3I8BA 5EVZA 3I55N 4YOTA 3J8AA 3CCJN 1K73O 2C1GA 4FWOA 1QQOA 2ZGYA 2J4RA 4CZFA 1QQNA 4FPBA 3ZETB 3TSUA 3GOIA 2QM1A 2BUPA 1YF5L 3MN5A 1Y64A 4Y0WA 2IIRA 5AQRA 4BRGA 5AQSA 1U2VB 2H3GX 2ZGZA 2P9UB 3SMPA 3EL2A 5AQOA 3QBWA 4K25A 3ENOA 2VGNA 3VF2A 4BR5A 4BE7B 5AQUA 1H1VA 4PKIA 2V51B 4OO1J 4CD1A 3DAWA 5AQHA 4GV3A 3DXMA 2E20A 3G4SN 4A2BA 4CZJA 4ILJA 2WC9A 1VQNN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NBW A;  1X9J A;  5BRD A;  1TYQ B;  5E84 A;  4I6M A;  3CJB A;  2A42 A;  2GTD A;  4M7Y A;  1YUW A;  2A41 A;  4B1X B;  3FLC O;  4B1Y B;  4FWS A;  4BRN A;  2CH6 A;  4EFH A;  4JHD A;  2A3Z A;  5AFU A;  1QQM A;  3M6G A;  1QZ6 A;  5I9E B;  4AM6 A;  4FWM A;  3O6W A;  5AZI A;  4BRQ A;  1U6Z A;  2EWS A;  3D2F B;  5AR0 A;  4LC9 B;  3DWL A;  3IDH A;  4XH4 A;  3CER A;  4A61 A;  3WUH A;  5ADX H;  1CZA N;  3M3Z A;  4QS9 A;  1NMD A;  4M63 C;  1XC3 A;  5ELZ A;  5AQZ A;  3H1V X;  4WQ4 C;  4BR9 A;  1NM1 A;  1T6C A;  3IMX A;  5F2R A;  5AZJ A;  1KAZ A;  4IJA A;  1S22 A;  1GLC G;  2YJF A;  4H5V A;  2Q97 A;  4A2A A;  1BA0 A;  3H46 O;  2FSJ A;  5KPT A;  3VES A;  4BR2 A;  4JD2 B;  2D1K A;  1NGB A;  4CZM A;  1WOQ A;  4H0P A;  3VGM A;  1BDG A;  3VEZ A;  3CQX A;  4XH1 A;  4WYB A;  3WQU A;  3AY9 A;  4CI6 A;  3VER A;  1DEJ A;  5BPN A;  2QXL A;  5BRH A;  1YXQ A;  3H6E A;  4BC3 A;  2CH5 A;  1SAZ A;  3D2E B;  1HPM A;  4FPA A;  2P9L A;  3VEO A;  3C7N B;  2AA4 A;  5BN9 A;  4FWQ A;  4BRK A;  4K41 A;  4HTL A;  3M1F A;  3EZW A;  3O4W A;  4BC5 A;  4BRL A;  4YDU A;  5EX5 A;  3H3N O;  4AM7 A;  2DPN A;  2P9N B;  3JXU A;  4BR4 A;  4JN4 A;  2YHY A;  3WXJ A;  1K8K A;  1SZ2 A;  4FOI A;  2W40 A;  4FOE A;  1BWF O;  3H1Q A;  3SMS A;  2HF3 A;  2P9K B;  5F0X A;  3CJ9 A;  3QFU A;  4H0X B;  3ZX3 A;  4BRH A;  4DCH A;  4BRE A;  5BRE A;  5JLH A;  2NRH A;  3L4I A;  4H5N A;  2D4W A;  3MMV A;  4ISE A;  3DJC A;  2D0P A;  3EO3 A;  5JLF A;  2CGK A;  3SJH A;  1XUP O;  3ZEU B;  4RWT A;  1NGG A;  4IO8 A;  2F9T A;  1NGE A;  1HKC A;  1HX1 A;  1MWM A;  4B1W B;  1KAY A;  2PAV A;  4K43 A;  3LL3 A;  2Q36 A;  4FWR A;  4MO5 A;  2QWM A;  1NGJ A;  1TUU A;  4PL8 A;  3GG4 A;  4L3Q A;  2ASO A;  5AQP A;  1BUP A;  4JAX A;  1BU6 O;  4O8K A;  3WQT A;  5AQG A;  2P9S B;  4CZL A;  3U8X A;  3P4I A;  4MLE A;  1MWK A;  4PL7 A;  4FWP A;  5EY4 A;  3ZET A;  3U9D A;  3MN9 A;  1LCU A;  2P9P B;  4F9O A;  5AQK A;  2A5X A;  1S3X A;  4BG8 A;  1ESV A;  3ENH A;  2GWJ A;  3W0L A;  2ZF5 O;  3KZB A;  1T44 A;  5EXW A;  4BC4 A;  5KQD A;  2GWK A;  3MCP A;  4BRC A;  3MN7 A;  1IG8 A;  3VOV A;  3O08 A;  4B9Q A;  4BRP A;  3H3O B;  5BR9 A;  1JCF A;  3FZL A;  3QIC A;  3HSC A;  2P9I B;  1SQK A;  4XEI A;  4JHD B;  1TYQ A;  5AQN A;  1P8Z A;  4C23 A;  1ZBS A;  2BTF A;  3FE1 A;  4HWI A;  2Q0U A;  4IWV A;  3EKS A;  3LDQ A;  1TUY A;  4PKG A;  1NGC A;  5AZI B;  3IFR A;  3CJ1 A;  2FSN A;  1MA9 B;  5EOY A;  4H0Y B;  5AQQ A;  2FXU A;  1RGI A;  5BPL A;  1BOT O;  3UKU A;  5LJW A;  1Z6R A;  2E1Y A;  1HLU A;  3LM2 A;  1QHA A;  3LDL A;  1NGH A;  5JIC A;  2A6A A;  5FPM A;  4YDU C;  4GNI A;  3A5L C;  1R59 O;  2IVO A;  4H0O A;  4B1Z A;  3QDK A;  3R9P A;  3BEX A;  4ISG A;  3VET A;  1MDU B;  1V4T A;  4RTF D;  1IJJ A;  2VCP A;  4CBW A;  2QWP A;  2E2N A;  2FF6 A;  2HOE A;  5AQV A;  3CQY A;  4EIA A;  1E4G T;  3O80 A;  3R6M A;  2V7Y A;  5AQJ A;  3VGL A;  5AQM A;  3ATU A;  2P9L B;  1GLL O;  5AQY A;  1BG3 A;  3ULE B;  3VEV A;  4H0V B;  1C0G A;  1KAX A;  3TU5 A;  3O1W A;  4GY2 B;  4WQ5 C;  4BRF A;  1HUX A;  3DXK A;  4BC2 A;  3WEE A;  3VEW A;  3HBT A;  2Q2R A;  1WUA A;  3U9Z A;  3C7N A;  2YHX A;  4WQ4 A;  3LDN A;  1GLB G;  1K8K B;  2QWR A;  2E2Q A;  5ADX A;  3L6Q A;  2ASP A;  4CD3 A;  4FWN A;  4H03 B;  2GEL A;  4FSV A;  2V7Z A;  3OHR A;  2Q1N A;  5E26 A;  4DB3 A;  2QWL A;  4CZG A;  3FZH A;  2P9N A;  4DHY A;  2OAN A;  1BA1 A;  3WXK A;  1OKJ A;  3QB0 A;  3CJA A;  3R8E A;  4MO4 A;  4A62 A;  4NB4 A;  4BR7 A;  1JCE A;  2CGL A;  3FGU A;  2P9K A;  2AP1 A;  5AQF A;  3C0B A;  3HM8 A;  5AQL A;  3UKR A;  4FL9 A;  1NLV A;  3RSE A;  1E4F T;  5AQW A;  2Q0R A;  2V52 B;  5AFU H;  2FF3 B;  2FSK A;  4M7X A;  4QS8 A;  5KPZ A;  1HJO A;  1ATR A;  1HKB A;  3CJC A;  3A0I X;  5FPD A;  1X3N A;  1ZC6 A;  3H45 C;  3BP8 A;  2E2P A;  3ZEU A;  4H5W A;  2A40 A;  4BR0 A;  1Q18 A;  3CHW A;  3VPZ A;  4K42 A;  2QWO A;  4E1J A;  4KBO A;  5AQT A;  3S41 A;  3FR0 A;  4IJN A;  3DXM B;  3A5N C;  1LOT B;  1U2V A;  2P9U A;  2IVP A;  3VEX A;  4JNE A;  3HTV A;  2VWB A;  2P9S A;  1NGI A;  4PKH A;  4H5R A;  4I6M B;  3D7E O;  3O1B A;  3VF6 A;  1YVN A;  4ISF A;  5BRF A;  3HZ6 A;  3O8M A;  2P9P A;  3G25 A;  3WXI A;  1RFQ A;  2YCH A;  2YHW A;  1DKG D;  3KHY A;  4BVO A;  1GLE G;  1QZ5 A;  4CJ7 A;  1ZXO A;  4QS7 A;  4BQL A;  1GLD G;  2NZT A;  4Z94 A;  4EHT A;  4CZH A;  3CJ7 A;  3MDQ A;  3SLC A;  3CIP A;  1KXP A;  4EAH D;  1YAG A;  4BVP A;  5BPM A;  5LJV A;  4RCH A;  3IUC A;  3LM9 A;  2P9I A;  3BF3 A;  2E88 A;  1NWK A;  1C0F A;  5BN8 A;  2HMP A;  2IVN A;  2E8A A;  3FZK A;  5AZJ B;  3UKU B;  3UB5 A;  1ATS A;  3D2F A;  5KQ8 A;  3VEY A;  3WXL A;  2QWQ A;  2YI1 A;  3ID8 A;  2WUS A;  3EN9 A;  3FZF A;  3QBX A;  4DQ8 A;  5TKY A;  4BRD A;  3L0Q A;  2E1Z A;  3I33 A;  5AQI A;  1GLA G;  4B1V A;  3GBT A;  4FWL A;  3AAQ A;  3QML A;  3VEN A;  3F9M A;  1J6Z A;  1NGD A;  2E2O A;  1T6D A;  2I7N A;  3GDQ A;  4JD2 A;  1HKG A;  4EHU A;  5JMV A;  3BUZ B;  1GLF O;  5FPE A;  2UYT A;  1JCG A;  3JS6 A;  5CE3 A;  2QW9 A;  3ATV A;  1XQS C;  2ZWH A;  4O5F A;  4B1U B;  2QWN A;  3MK6 A;  1V4S A;  1DGK N;  3GE1 A;  2PBD A;  5LY3 A;  2FLO A;  4NO7 A;  3A5M C;  4MLH A;  4CBU A;  3ZX0 A;  2GEM A;  4CZI A;  2KHO A;  3D2E A;  4IZ9 A;  5KPR A;  3DXK B;  2HF4 A;  2W41 A;  4BG9 A;  4CZE A;  3W3D A;  3FZM A;  3WEE B;  4BGB A;  4J8F A;  1BO5 O;  2Q31 A;  3CI5 A;  1ATN A;  4IXC A;  3ULE A;  3VF4 A;  3O5B A;  4BRA A;  4BQZ A;  3WT0 A;  3ZX2 A;  2ITM A;  1NGF A;  3KVG A;  3TPQ A;  2VYP A;  3A5O C;  2NLX A;  4H0T B;  3LDO A;  3EKU A;  1X3M A;  3AAP A;  2F9W A;  1Z05 A;  3HI0 A;  3BF1 A;  3FFK B;  1G99 A;  2I7P A;  2D0O A;  1D4X A;  3AAR A;  1EQY A;  5FPN A;  3SK3 A;  3GL1 A;  3CET A;  4BRO A;  1GLJ O;  5AQX A;  2ASM A;  2YJE A;  3UKR B;  5F1X A;  3A8Y A;  3QFP A;  2CGJ A;  3B8A X;  3RSE B;  1NGA A;  4XH5 A;  4CZK A;  4BGA A;  3VGK A;  3MN6 A;  4FO0 A;  1RDW X;  4WQ5 A;  3U4L A;  4BRM A;  2GUP A;  3UE5 A;  4CBX A;  4FWK A;  5B8H A;  3LDP A;  4H5T A;  3I8B A;  5EVZ A;  3J8A A;  4FWO A;  1QQO A;  2ZGY A;  2J4R A;  4CZF A;  1QQN A;  4FPB A;  3ZET B;  3GOI A;  2QM1 A;  2BUP A;  3MN5 A;  1Y64 A;  4Y0W A;  2IIR A;  5AQR A;  4BRG A;  5AQS A;  1U2V B;  2H3G X;  2ZGZ A;  2P9U B;  3SMP A;  3EL2 A;  5AQO A;  3QBW A;  4K25 A;  3ENO A;  3VF2 A;  4BR5 A;  5AQU A;  1H1V A;  4PKI A;  2V51 B;  4CD1 A;  3DAW A;  5AQH A;  3DXM A;  2E20 A;  4A2B A;  4CZJ A;  4BRI A; 
#chains in the Genus database with same CATH topology
 4DS4 A;  5BRD A;  1TYQ B;  1W7A A;  3O9U A;  2NRR A;  4FVM A;  2GTD A;  4YOW A;  4M7Y A;  5KRT A;  3FLC O;  3CFO A;  4FWS A;  3VQC A;  4QOZ B;  1DTQ A;  4W5O A;  1QZ6 A;  3LWL A;  1W9H A;  4MDB A;  4KHU A;  4FWM A;  3O6W A;  2OTJ N;  4FCY A;  1VQ5 N;  4CCH A;  1LAV A;  1VSD A;  3ZSZ A;  2VG6 A;  4DFM A;  3WUH A;  4M63 C;  2KFN A;  1XC3 A;  3VQ8 A;  4LD0 A;  4CJ3 A;  4HUF A;  2O8C A;  3IMX A;  1T6C A;  5F2R A;  1Q81 O;  4KFB A;  3L8B A;  3BZK A;  1S22 A;  3DM2 A;  1HNZ K;  3C94 A;  2Q97 A;  2QK9 A;  1UOC A;  3H46 O;  4FJK A;  3VQ9 A;  4W5R A;  5KPT A;  2OYQ A;  1Q9Y A;  3OYD A;  4L8R B;  4CZM A;  1WOQ A;  3VEZ A;  3K2P A;  4CI6 A;  4GV6 A;  3ULD A;  3VN5 A;  1KVC A;  4CER A;  5BPN A;  2IOC A;  1IKX A;  3C65 A;  4CEE A;  4BC3 A;  4LH5 A;  2W6K A;  4DTM A;  3MXM A;  4CHQ A;  1JL2 A;  3D2E B;  1S1W A;  4FJ8 A;  3E9O A;  3VEO A;  4CFC A;  2ATQ A;  4K41 A;  2GX9 A;  3KKR A;  3EZW A;  5C15 A;  4I7F A;  3MEG A;  5EX5 A;  3H3N O;  3G10 A;  1DLO A;  2P9N B;  1J5E K;  2YHY A;  1N5Y A;  3WXJ A;  3DLG A;  3NE6 A;  1WLJ A;  3U6F A;  3PUF A;  3T3F A;  3TAR A;  4FZY A;  1N33 K;  4IEE A;  4AH9 A;  3H1Q A;  1C1A A;  2OZS A;  4CFD A;  3OYK A;  3ZT2 A;  4NLC A;  3K59 A;  3TAG A;  1DT9 A;  3LPT A;  5DM6 L;  1NK4 A;  2DTU A;  1HPZ A;  3MED A;  3OBY A;  2D4W A;  2HND A;  1SKW A;  4ISE A;  1SL1 A;  4IDK A;  1UAX A;  1VAZ A;  2CGK A;  3B6O A;  4DSL A;  1NK5 A;  4Q0B A;  1HKC A;  1MWM A;  1KAY A;  1HYZ A;  1KD1 O;  1N32 K;  3WNH A;  1ZBF A;  3GG4 A;  5GIN A;  3OYH A;  1C6V A;  4JI1 K;  4WCE L;  4JAX A;  1BU6 O;  5D3G A;  4O55 A;  4CZL A;  2JWK A;  3P4I A;  2OPS A;  3OJS A;  1HRH A;  4JI4 K;  4Z4H A;  4O0I A;  1VQ7 N;  3CQ8 A;  4JEP A;  1S6P A;  4B3R K;  3DRS A;  2QTD A;  3D6R A;  3U9D A;  3MN9 A;  1LCU A;  2A5X A;  3ENH A;  1CZ9 A;  2HHV A;  2GWJ A;  3KTQ A;  3TR8 A;  5EXW A;  2KKZ A;  1RTJ A;  2GWK A;  4KB1 A;  3NGI A;  4BRP A;  3H3O B;  3HYF A;  5J2Q A;  3RRH A;  3QIC A;  2WFB A;  3HSC A;  3HP6 A;  1SQK A;  4M42 A;  4CJF A;  4JHD B;  3OBW A;  3VQQ A;  1TYQ A;  4GKJ K;  3JSM A;  4DV3 K;  1ZBS A;  2BTF A;  1KFS A;  3LDQ A;  4DR7 K;  3ZSW A;  4PKG A;  3VQB A;  4OKE A;  3L2W A;  3O3H A;  4PWD A;  4M3W A;  4FJM A;  1D5A A;  4CJ5 A;  3OYM A;  5LJW A;  3EYZ A;  4E72 A;  3U3Y A;  3ZLJ A;  4JK7 A;  1HLU A;  3I0S A;  3LDL A;  2Z1J A;  4IFY A;  1WBD A;  4WFN L;  3CYM A;  5FPM A;  4ZHR A;  1NNE A;  5C2D A;  1U04 A;  4FW1 A;  4N76 A;  3CCL N;  4BE0 A;  3VQE A;  2IVO A;  3EE8 A;  1W97 L;  3BEX A;  1MDU B;  3AVK A;  3P1G A;  4RTF D;  4CBW A;  4UY8 O;  2YNG A;  3OYC A;  4LFA K;  4KRE A;  1NKC A;  3J7Z O;  4V19 S;  4CK3 A;  3AO3 A;  1J9A A;  5HL7 L;  5JS1 A;  3CQY A;  3R6M A;  3NVM A;  2V7Y A;  4W5N A;  5AQJ A;  4DFP A;  1FK9 A;  4HUG A;  3CF5 L;  3ULE B;  4F2S A;  1C0G A;  4WQ5 C;  4CW7 B;  3SUO A;  3DXK A;  3VEW A;  4I9L A;  1WUA A;  3U9Z A;  4E3S A;  2YHX A;  3NMU A;  1FXX A;  1GOB A;  1GLB G;  1K8K B;  2E2Q A;  2X6S A;  3L6Q A;  3QEV A;  2VWJ A;  1S1U A;  2ASP A;  2Y1I A;  4CD3 A;  2XO7 A;  4N41 A;  1UA0 A;  4FSV A;  2V7Z A;  4B9M A;  3EZ5 A;  4FJJ A;  3NVK A;  2HNY A;  2YKN A;  2P9N A;  4DHY A;  1YHQ N;  1BA1 A;  4QCL A;  4JRQ A;  3I56 N;  1EXQ A;  1M1K O;  3R8E A;  2PYJ A;  4RW7 A;  4NB4 A;  1ZYQ A;  2CGL A;  3FGU A;  5HRS A;  2HB5 A;  1O13 A;  3G0Z A;  5AQF A;  1VRU A;  5I42 A;  3MAQ A;  2D0B A;  2PFU A;  5AQW A;  2V52 B;  1HJO A;  1ITG A;  1A5W A;  3PX0 A;  5GAD P;  2WON A;  4GMJ B;  5C12 A;  2NNW A;  3T19 A;  2VWK A;  4Z0U A;  1Q18 A;  3VPZ A;  1N8R O;  4K42 A;  4OJR A;  4E1J A;  3S41 A;  3FR0 A;  4KRF A;  4IJN A;  4CJV A;  4RW8 A;  5GIP A;  1EP4 A;  1K6Y A;  1N36 K;  2QKB A;  3HTV A;  2VWB A;  1BQN A;  1NGI A;  3NDK A;  1YVN A;  4ISF A;  3BY5 A;  3WXI A;  4CJK A;  3RRG A;  3O4Q A;  2B6A A;  2ZJR L;  4HCC A;  2UUC K;  1GLE G;  1BCM A;  1U4B A;  5HBM A;  5FDL A;  4QS7 A;  1GLD G;  4Z94 A;  3CJ7 A;  3MDQ A;  4B9N A;  3CIP A;  2KLA A;  3NFA A;  2O8D B;  5CYQ A;  1YAG A;  2E6L A;  1VSE A;  2KW4 A;  4RCH A;  1FW6 A;  3BF3 A;  1FJG K;  3L3U A;  4MFB A;  2IVN A;  4DFJ A;  3ISN C;  2HHW A;  1VSF A;  4OPH A;  1LWF A;  3WXL A;  1SKS A;  1UWB A;  4GKK K;  3EN9 A;  3QBX A;  4BRD A;  2X6N A;  3QO9 A;  4PUO A;  1GLA G;  3WNF A;  3J7Y P;  3RMA A;  3AVI A;  3GBT A;  4LFC K;  4FWL A;  3AAQ A;  3SBG A;  4NCG A;  1J6Z A;  4R79 A;  2E2O A;  4C8N A;  1T6D A;  3C6T A;  4CJP A;  3SV3 A;  4IFE A;  4OLB A;  3NBP A;  2IC3 A;  1JCG A;  3ATV A;  4RW9 A;  2NRX A;  4B1U B;  3CC4 N;  4FLV A;  3MK6 A;  4BWJ A;  1XWL A;  1HNV A;  2ZJP L;  5LY3 A;  2HBK A;  3HO1 A;  4JKF A;  4YOX A;  3ZX0 A;  1RT2 A;  4CZI A;  4RG8 A;  4IZ9 A;  2W41 A;  3W3D A;  4DTX A;  3WEE B;  1IBK K;  1EO1 A;  4Z4C A;  4DKW A;  4I9Q A;  4FK0 A;  4O4G A;  3ULE A;  4CJQ A;  3BGR A;  1BL3 A;  1EX4 A;  4BRA A;  3WT0 A;  3DMJ A;  2ITM A;  4MQ3 A;  3L4Q A;  1QVF M;  5FRO A;  1TL3 A;  4EP5 A;  1VQO N;  4HVJ A;  2P5O A;  1Z05 A;  3HI0 A;  2G8I A;  2ZQB A;  2JWL A;  3FFK B;  4KTW A;  2Z1I A;  3TAQ A;  3SPZ A;  3K57 A;  1EQY A;  4OVL A;  1BI4 B;  3GL1 A;  4KH5 A;  3S5T A;  1RDB A;  5F1X A;  3JAM O;  2HHH K;  3RMD A;  4IEI A;  1NGA A;  5FLX O;  3DRP A;  4CZK A;  3VGK A;  1WB9 A;  3K5O A;  3P39 A;  1NKE A;  3U4L A;  1KVB A;  4JI2 K;  5I3U A;  3E01 A;  4Z4I A;  1WSH A;  4DR6 K;  3LDP A;  2C1G A;  4YOT A;  3MXI A;  1QQO A;  4CZF A;  4LH4 A;  2D5R A;  3CM6 A;  3ZT0 A;  2QM1 A;  1YF5 L;  2B5J A;  4Y0W A;  1LV5 A;  2H3G X;  2VG5 A;  1BCO A;  2O8B A;  3DLB A;  3EL2 A;  3QBW A;  3VQ6 A;  4K25 A;  4O5B A;  3VF2 A;  5AQU A;  4OO1 J;  4ZTF A;  4ILJ A;  4DF4 A;  4BRI A;  2A1S A;  3TTD A;  1X9J A;  3J81 O;  4Z4E A;  4K0K K;  5E84 A;  1S9E A;  3CJB A;  1VHX A;  5CY4 A;  3VTI A;  4CGI A;  4RW6 A;  2P1J A;  3OYE A;  4B1Y B;  3PO5 A;  4DWI A;  5CHI A;  5AFU A;  1QQM A;  3M6G A;  3HVT A;  1M90 O;  5C0Y A;  1RTI A;  5AZI A;  4OKJ A;  4BRQ A;  4DV7 K;  1U6Z A;  2EWS A;  2F7T A;  4JRP A;  3IDH A;  4XH4 A;  3CPE A;  2YKM A;  3M3Z A;  1J54 A;  5ELZ A;  4DTS A;  4NCB A;  4WQ4 C;  2OA8 A;  3NCI A;  4K8X A;  2G8F A;  1NM1 A;  3WNG A;  1K8A O;  1QSS A;  1KAZ A;  4CHY A;  3AGR A;  4FM1 A;  3E9L A;  4DTO A;  2YJF A;  4H5V A;  1U48 A;  1EKE A;  3TAP A;  3F5T A;  4JD2 B;  2D1K A;  3SPY A;  2ITG A;  1BDG A;  4CGF A;  1WAF A;  3WQU A;  4GV9 A;  1RT4 A;  2KZZ A;  1DEJ A;  3N4Q A;  3NHG A;  4CF9 A;  3VA3 A;  2CH5 A;  3SNN A;  4CJE A;  1HPM A;  2P9L A;  1VSH A;  2AA4 A;  5BN9 A;  1C0T A;  1BIS A;  4JKG B;  1NK9 A;  4KKO A;  4BC5 A;  5GAG P;  4DV1 K;  4AM7 A;  3G71 N;  2BGG A;  3JXU A;  2HBM A;  4JKC A;  1BQM A;  2W40 A;  4C1N I;  3SMS A;  1KFD A;  3SQ2 A;  2P51 A;  4CK1 A;  5LMU K;  4FJ5 A;  1YJ9 N;  5F0X A;  3QFU A;  5M1Q A;  1NK0 A;  5BRE A;  1XI1 A;  2NRH A;  3SUP A;  3CMA N;  4XIU A;  1ASW A;  3LP3 A;  5KGW A;  4LF6 K;  2D0P A;  3SJH A;  3CC7 N;  4F8R A;  3OYB A;  1SV5 A;  3ZSV A;  1BI4 A;  4YOV A;  3ZEU B;  4DV4 K;  4OKK A;  4IO8 A;  3QNO A;  2F9T A;  1NGE A;  4LF8 K;  5J1E A;  4YY3 K;  3QEW A;  2PAV A;  1HQU A;  4KPY A;  4FWR A;  2QWM A;  4E19 A;  3KK3 A;  4GVM A;  1NGJ A;  4I2Q A;  1TUU A;  1QS4 A;  3E9P A;  5AQP A;  3I0R A;  3OYA A;  4DQR A;  3HL8 A;  2O8E A;  5AQG A;  3KWG A;  1RDD A;  1J53 A;  3PSI A;  4N56 A;  2O4G A;  1WAJ A;  4F9O A;  1S3X A;  2RF2 A;  1QSY A;  4CIE A;  4FLW A;  1HMV A;  3KZB A;  4BC4 A;  4FLU A;  4X62 K;  3C6U A;  3QET A;  3QES A;  4BRC A;  4DU3 A;  3O08 A;  4ZTJ A;  4B9Q A;  4PQU A;  1T3V A;  4AHC A;  5BR9 A;  3THW A;  1JCF A;  4FJH A;  3JYT A;  4XEI A;  1RDC A;  4JKB A;  3V9X A;  1P8Z A;  3ZT4 A;  4HWI A;  4IWV A;  1TAQ A;  2HNZ A;  4BAC A;  2NRZ A;  1NGC A;  1RBS A;  4BDY A;  4FM2 A;  5A2Q O;  4H0Y B;  2FXU A;  5BPL A;  4E7H A;  3V9U A;  4NCA A;  1BOT O;  3UKU A;  2OPR A;  2XRI A;  2D0A A;  1QHA A;  4DUZ K;  2A6A A;  4AQY K;  4DFK A;  1SUQ A;  4GNI A;  3A5L C;  1R59 O;  3O3F A;  1W0H A;  4FJG A;  3CCQ N;  2XY8 A;  5DMR A;  1IJJ A;  2VCP A;  1VSJ A;  2QWP A;  5EU7 A;  4CF0 A;  3ZSQ A;  1YI2 N;  2IAJ A;  3DLE A;  3DI6 A;  4JI6 K;  3MEE A;  1L3T A;  1E4G T;  4KTZ A;  4CF1 A;  2ZJQ L;  3ATU A;  1GLL O;  5AQY A;  1BG3 A;  4DUY K;  5GAE P;  1KAX A;  3O1W A;  4DSI A;  1HUX A;  1TAU A;  3ZT3 A;  4BEB A;  3SYZ A;  4CJL A;  1HQE A;  3HBT A;  3KK7 A;  2E5L K;  4CVN E;  1ZBI A;  3NH2 A;  3FFI A;  1XMQ K;  4C8L A;  2XY5 A;  3HJF A;  3SV4 A;  4H03 B;  1RT3 A;  3OHR A;  4NXM K;  2Q1N A;  3L2V A;  3HPO A;  1OKJ A;  1QSL A;  4M45 A;  1NU0 A;  3QB0 A;  3CJA A;  4A62 A;  3UIQ A;  4R5P A;  3PIP L;  3V9Z A;  3C0B A;  3HM8 A;  4AHS A;  5AQL A;  4B9L A;  3NGZ A;  3RSE A;  2HST A;  4A57 A;  2Q0R A;  5AFU H;  2FF3 B;  1WNS A;  4M7X A;  3OS0 A;  3O9R A;  1HKB A;  4G1Q A;  4LF7 K;  4ELT A;  3H45 C;  5C10 A;  2E2P A;  3ZEU A;  3QIP A;  4CHN A;  3AO4 A;  2AJQ A;  4BR0 A;  2G8W A;  3QEX A;  1TK0 A;  1I94 K;  3LZI A;  3ZT1 A;  1L3U A;  3OYI A;  1GOA A;  3DXM B;  3A5N C;  3DLH A;  1U2V A;  2P9U A;  2YX6 A;  2IVP A;  3VEX A;  4FVU A;  4JNE A;  1NK8 A;  3KK2 A;  4FW2 A;  4N47 A;  4H5R A;  3AO1 A;  2BDP A;  1SS6 A;  1IKV A;  3THX B;  2PYL A;  5BRF A;  1MU2 A;  3HZ6 A;  3G25 A;  1RFQ A;  4CEB A;  2DFH A;  4M3Y A;  3KHY A;  3SZ2 A;  4E7I A;  1P90 A;  1ZXO A;  4MDA A;  2G8U A;  2NZT A;  4DLE A;  4DSJ A;  4EHT A;  3V9S A;  3SLC A;  1N34 K;  1KXP A;  4EAH D;  4BVP A;  4IG0 A;  4M3Z A;  1ASV A;  2HBJ A;  4NLB A;  3CCV N;  4FYD A;  3KLF A;  1U47 A;  4DR4 K;  1IH7 A;  1Z26 A;  3VEY A;  1JLB A;  3ZSX A;  3LAL A;  1RBR A;  1X9M A;  4X65 K;  1J5O A;  3N4P A;  4LY7 A;  2ZM6 K;  3AVH A;  5C25 A;  3SAH A;  2RE2 A;  5TKY A;  2WTU A;  4BWM A;  3TTC A;  4ID5 A;  3I33 A;  5AQI A;  4B1V A;  3VEN A;  5C24 A;  3NF7 A;  1A5V A;  5HRN A;  1ZBH A;  4DQI A;  4IOA L;  2I7N A;  1JXB A;  1S5J A;  1HKG A;  2IS3 A;  4EHU A;  5JMV A;  3BUZ B;  1GLF O;  3JS6 A;  5SWM A;  4K8Z A;  3D45 A;  4O5F A;  2QWN A;  4KI6 A;  2OPQ A;  2PBD A;  3WNE A;  2FLO A;  1HYV A;  4NO7 A;  2GEM A;  3D2E A;  5KPR A;  3A2F A;  3E66 A;  4BG9 A;  3PV8 A;  4YOY A;  2RHK A;  3FZM A;  1QE1 A;  1ATN A;  3P31 A;  3LWM A;  2RPI A;  3O5B A;  3KJV A;  3ZX2 A;  3O9T A;  5J2P A;  1NGF A;  3KVG A;  3TPQ A;  4BDP A;  3C6A A;  3P83 D;  1Z25 A;  1ASU A;  3P5J A;  4LF5 K;  3AAP A;  2F9W A;  3D0P A;  3IKM A;  1NJY A;  3HST B;  4EZ6 A;  4CFA A;  1G99 A;  2D0O A;  4DV6 K;  1D9D A;  5FPN A;  3SK3 A;  4FJ9 A;  3KWI A;  1JKH A;  1GLJ O;  3UKR B;  3M5R A;  3DYA A;  4AF1 A;  1WN7 A;  4FO0 A;  1RDW X;  1CXQ A;  3O3G A;  1JLG A;  4LFB K;  4FWK A;  2UXB K;  4DTN A;  1YJN N;  4DQQ A;  3S3M A;  1VSL A;  3J8A A;  3DLK A;  4FZZ A;  2ZGY A;  3LPU A;  4FPB A;  3ZET B;  3TSU A;  4KAZ A;  1Y64 A;  2X78 A;  4B9U A;  1BHL A;  4CGJ A;  5AQO A;  4BE7 B;  1H1V A;  1U45 A;  1VK0 A;  4X64 K;  3DAW A;  5AQH A;  4GV3 A;  3DXM A;  3SQ4 A;  4JI8 K;  3SQ1 A;  2WC9 A;  1VQN N;  1NBW A;  3HOT A;  1TKX A;  1RTD A;  5SZT A;  4KHQ A;  4FLZ A;  3K58 A;  2A42 A;  1IV0 A;  3THX A;  4B1X B;  2FBY A;  1L3V A;  1VQM N;  1C0M A;  4JHD A;  1SKR A;  3EY1 A;  1NG9 A;  3VQ7 A;  4BE2 A;  5I9E B;  1QVG M;  3T7Z A;  4KHW A;  3VTH A;  3THV A;  4FXD A;  2E6M A;  3D2F B;  4A61 A;  4JKA A;  1CZA N;  5H1S Q;  3LZJ A;  3TAB A;  5AQZ A;  3H1V X;  4Y1C A;  3PX4 A;  4CJS A;  1GLC G;  2EX3 A;  1RBT A;  1BA0 A;  2FSJ A;  3Q7C A;  5DM7 L;  3VES A;  2GV9 A;  1YVU A;  4H0P A;  3VGM A;  5K14 A;  3KD5 E;  1T03 A;  4N5S A;  4WE1 A;  3AY9 A;  4BE1 A;  3AA5 X;  1YIJ N;  2QXL A;  5BRH A;  3H6E A;  3TSP A;  4M3T A;  4A5A A;  1X1P A;  3MX5 A;  3SI6 A;  2UU9 K;  2UUA K;  4ICL A;  1C1C A;  4FWQ A;  3VQD A;  4DR3 K;  2HHS A;  1LWE A;  4HTL A;  1D8Y A;  3M1F A;  3CG7 A;  4BRL A;  2GBZ A;  4X66 K;  1VQP N;  4YDU A;  1KLM A;  1HJR A;  1VSI A;  1K8K A;  1IG9 A;  2R7Y A;  2QKK A;  4JV5 K;  1JLQ A;  3B6P A;  3O9Q A;  3R1X A;  4J2A A;  4UQG A;  2JGU A;  4E1M A;  1ZBU A;  3QER A;  3CJ9 A;  4IO9 L;  4M41 A;  1K9M O;  3ZX3 A;  4BRH A;  4BRE A;  4M3R A;  3TTF A;  4H5N A;  3MMV A;  4W5Q A;  3EO3 A;  5JLF A;  4O0J A;  3F9K A;  4E7J A;  4FJ7 A;  1NGG A;  1C0U A;  3O9S A;  2YNI A;  4B1W B;  4K43 A;  3LL3 A;  4JI7 K;  2OZM A;  1YJW N;  4OGC A;  3AVG A;  1TVR A;  4PL8 A;  4FJI A;  4OPA A;  1Q8I A;  3LP2 A;  1BUP A;  4O8K A;  2P9S B;  3K5N A;  4F4K A;  1XNQ K;  4XJX A;  4MLE A;  1MWK A;  4CHP A;  3OYL A;  4PL7 A;  4IG3 A;  4FWP A;  3DLL L;  4NYF A;  4JS4 A;  1KVA A;  2NRT A;  5EY4 A;  4DG1 A;  3ZET A;  1VQL N;  4KV8 A;  5AQK A;  3O4N A;  1ESV A;  3CCR N;  1S6Q A;  2ZF5 O;  2IGI A;  1T44 A;  1X9W A;  1Q9X A;  3L2U A;  2BH1 A;  3V1O A;  3MN7 A;  4CIG A;  3OS1 A;  2KZM A;  3ZSO A;  4CF2 A;  2KQ2 A;  2HVI A;  1R0A A;  1N6Q A;  5AQN A;  4LF9 K;  4DTP A;  1OVQ A;  2IDO A;  3VQ4 A;  4C23 A;  3RTV A;  2Q0U A;  1YT3 A;  3EKS A;  1TUY A;  3NF8 A;  1VSM A;  2O8D A;  3TAE A;  3IFR A;  4DTU A;  3LP0 A;  3K9K A;  1MA9 B;  3AA4 A;  5EOY A;  5AQQ A;  2UXD K;  3THY B;  1WSJ A;  1RGI A;  4YHH K;  1KSP A;  3LM2 A;  1NGH A;  3VQ5 A;  4E89 A;  5M1K A;  3SUQ A;  4ELV A;  4YDU C;  4B9V A;  4FLY A;  3S3N A;  2YNH A;  4B1Z A;  3QDK A;  4Q5V A;  3T69 A;  4B3O A;  1TGO A;  1RT1 A;  3KKS A;  4IOC L;  2YV0 X;  4O8U A;  4ILH A;  4F3T A;  2E2N A;  4CGD A;  5AQV A;  4CGH A;  3PY8 A;  2B4J A;  1HYS A;  4CED A;  1LW0 A;  4C8K A;  4EIA A;  3RVC A;  4CEZ A;  2DFF A;  3QIN A;  4H0V B;  3IRX A;  4BRF A;  4BC2 A;  4JS5 A;  4HTU A;  3WXM B;  4E7K A;  3WEE A;  4YOR A;  2G8H A;  1JLC A;  3SCX A;  5ADX A;  3CCU N;  1ILY A;  4DV5 K;  4FWN A;  5GIO A;  5E26 A;  4DB3 A;  4CZG A;  2OAN A;  1BIZ A;  2HHX A;  1WSG A;  2G8V A;  4DR5 K;  1VQ4 N;  2PY5 A;  2AP1 A;  4GVE A;  1NJZ A;  2YHA A;  2Z1G A;  1NLV A;  3L3V A;  4FLX A;  2HMI A;  1JLF A;  3G6E N;  4NXN K;  5FRN A;  4DTR A;  5LL6 Z;  5KPZ A;  3OJU A;  2A1R A;  1ATR A;  3CJC A;  3A0I X;  5CR4 A;  5FPD A;  5C42 A;  1RDA A;  1X3N A;  2BE2 A;  1RDU A;  3OW2 M;  4KHY A;  2WBN A;  3AVB A;  3CHW A;  1S9G A;  5M1F A;  5AQT A;  1QHT A;  4KTQ A;  2QI2 A;  3CXC M;  3VMF B;  4FZX C;  1Q82 O;  4OX9 K;  4W5T A;  1LOT B;  3V6D A;  1L3S A;  5KTQ A;  1RCH A;  3TSQ A;  2P9S A;  4PKH A;  3KLI A;  2HHI A;  3RMC A;  3AO5 A;  4I6M B;  2FBX A;  1XNR K;  3LAN A;  1A5X A;  3J80 O;  3V4I A;  3EE9 A;  1DKG D;  1QZ5 A;  3KIO A;  4CJ7 A;  4FJX A;  4Z4F A;  1WBB A;  3PLA A;  1FKP A;  4BQL A;  5JS2 A;  2NUB A;  4CFB A;  5BPM A;  5LJV A;  1XMO K;  3IUC A;  5JVH L;  2E88 A;  1C0F A;  5BN8 A;  3SUN A;  3DOL A;  5HOO A;  3FZK A;  2XY7 A;  1HR0 K;  2C1I A;  3V1Q A;  5AZJ B;  5KQ8 A;  2O8F B;  1JLE A;  3CM5 A;  4CJW A;  2NRV A;  1Y97 A;  3KLG A;  1G15 A;  3THY A;  4KI4 A;  3L0Q A;  1WSI A;  3DLR A;  1B92 A;  3AVL A;  3AVJ A;  2NRW A;  3MCA B;  3QML A;  3F9M A;  1CXU A;  1NGD A;  3AGK A;  5HRP A;  3K5M A;  3VA0 A;  4JD2 A;  4U67 L;  4CF8 A;  1JL1 A;  4B8A B;  5FPE A;  4PHT X;  2HVH A;  1XQS C;  2F4V K;  4JK9 A;  1V4S A;  1DGK N;  1KQS M;  4JKH A;  1KRP A;  4MLH A;  3OYJ A;  1C1B A;  4DSK A;  2KHO A;  3DXK B;  2HF4 A;  1S1X A;  3U3G A;  2Q3S A;  4H4M A;  4B3M K;  1S72 N;  4BGB A;  4F3O A;  1S1T A;  1BO5 O;  2Q31 A;  4JKG A;  2W00 A;  2VGM A;  3OYN A;  4HUE A;  1B9F A;  3CI5 A;  1NJI O;  3AVM A;  3VF4 A;  3QEI A;  4DMN A;  1CZB A;  4BQZ A;  3OA9 A;  4OPJ A;  2VYP A;  3A5O C;  1F21 A;  1RT7 A;  1NOZ A;  3RWU A;  4JLH A;  3OYF A;  3QEP A;  1TKZ A;  5IWA K;  4HCB A;  3AAR A;  4BRO A;  3M8P A;  5AQX A;  2ASM A;  1RT6 A;  2YJE A;  3AVC A;  4AIL C;  3QNN A;  4B9S A;  3QFP A;  2CGJ A;  3B8A X;  3ZSY A;  3L2Q A;  2ZE2 A;  4XH5 A;  3MN6 A;  3LP1 A;  1E3M A;  4WQ5 A;  3PSF A;  4BRM A;  2GUP A;  3UE5 A;  1EWR A;  4I2P A;  1WSE A;  3SAF A;  4CES A;  3HT3 A;  4CEC A;  4A5B A;  1EWQ A;  4H5T A;  5EVZ A;  4JI5 K;  2LSN A;  3T1A A;  1QQN A;  1RBU A;  3GOI A;  2BUP A;  1NJX A;  3MN5 A;  5AQR A;  1LAW A;  2ZGZ A;  3NGY A;  4DQS A;  1I39 A;  3ALY A;  4CEO A;  4A2B A;  4CZJ A;  3AVF A;  2O4I A;  5AJ3 K;  2KTQ A;  2QEX N;  2I5J A;  4AHV A;  3IS9 A;  4I6M A;  1B9D A;  3SJJ A;  1YUW A;  4O44 A;  4YNQ A;  4U7B A;  2A41 A;  3PO4 A;  4BRN A;  2CH6 A;  4EFH A;  3T1Y K;  2A3Z A;  4JKD A;  3IAY A;  4J2B A;  4E7L A;  4AM6 A;  4JK8 A;  5CYM A;  4C8M A;  5KRS A;  5AR0 A;  3V9W A;  4LC9 B;  1YIT N;  3DWL A;  3CYG A;  3CER A;  4DU1 A;  5ADX H;  4QS9 A;  4PA1 A;  1NMD A;  4LSN A;  3SAG A;  3RR7 A;  4BR9 A;  2FBV A;  1VRT A;  2P5G A;  2OPP A;  5AZJ A;  4LSL A;  2O8F A;  4LF4 K;  1OH5 A;  4IJA A;  3TI0 A;  3E1Y A;  3EEQ A;  1JJ2 M;  4CE9 A;  2KFZ A;  4A2A A;  2JLE A;  4BR2 A;  1NGB A;  1NOY A;  1VSK A;  3NH1 A;  3CQX A;  4XH1 A;  3ASM A;  4WYB A;  3VER A;  3K0S A;  3F2K A;  5C2F A;  5KGX A;  3TAN A;  1VQ9 N;  1YXQ A;  3HOS A;  3OVN A;  1SAZ A;  4FPA A;  3C7N B;  1NJW A;  4KH4 A;  4H8K A;  4BRK A;  3RMB A;  1NK7 A;  1T05 A;  1QTM A;  4ILG B;  5HRO A;  2YNF A;  2Z1H A;  3O4W A;  2X74 A;  4CHO A;  3ITH A;  1X9S A;  3CD6 N;  1QQC A;  2DPN A;  3AV9 A;  4WFB L;  5M1P A;  1JLA A;  4BR4 A;  4JN4 A;  1SZ2 A;  4FOI A;  3LAK A;  4FOE A;  1BWF O;  4C1N K;  3TWH A;  2HF3 A;  3VQP A;  1VQ8 N;  2P9K B;  2D0C A;  4H0X B;  1OH6 A;  3OY9 A;  1TV6 A;  5KI6 A;  4DCH A;  4BEC A;  4OPK A;  5JLH A;  3CCS N;  3L4I A;  1TK5 A;  1OH7 A;  5HRR A;  1HNX K;  2VG7 A;  3DJC A;  3HXM A;  2F8T A;  3H08 A;  4WFA L;  3MWT A;  1XUP O;  1YTA A;  4RWT A;  2UUB K;  4YOU A;  3QLH A;  1HX1 A;  4HHT A;  3AVN A;  3ZSR A;  3LAM A;  2Q36 A;  4IOX A;  4MO5 A;  2VQE K;  4FK2 A;  4OGE A;  2HHT A;  4L3Q A;  2ASO A;  4KHN A;  3CPW M;  2QXF A;  3WQT A;  1XC9 A;  3U8X A;  5M1N A;  3KLH A;  2O8B B;  5DK5 A;  4TSX A;  2F8S A;  4B3T K;  1O1W A;  2FBT A;  3RR8 A;  2P9P B;  3TAF A;  4IBN A;  1BIU A;  4BG8 A;  3HP9 A;  5HLF A;  1VQK N;  3W0L A;  4FM0 A;  3ID6 A;  4F2R A;  3AA3 A;  3OTO K;  2EHG A;  1OH8 A;  1YTU A;  5KQD A;  3HVR A;  3MCP A;  1IG8 A;  1Q7Y O;  3VOV A;  1RIL A;  3R3L A;  3MXJ A;  4QAG A;  4A59 A;  1NKB A;  3FZL A;  5TKW A;  3OYG A;  5CZ2 A;  3ZYY X;  1OVY A;  2P9I B;  1Q86 O;  1LW2 A;  5BR8 K;  4IFV A;  3FE1 A;  1JXE A;  3NH0 A;  3OS2 A;  5AZI B;  4CIF A;  4IKF A;  3CJ1 A;  2FSN A;  3HK2 A;  4CEA A;  4CK2 A;  4J2E A;  3J7A P;  3V1R A;  4BDZ A;  1Z6R A;  2E1Y A;  5JIC A;  2QA4 N;  3CCE N;  2YHB A;  3VQA A;  4DS5 A;  5GAH P;  1KLN A;  4J2D A;  4CJR A;  4H0O A;  3S3O A;  3R9P A;  4ISG A;  3HRG A;  3VET A;  4DQP A;  3M8R A;  4DV0 K;  1V4T A;  1D9F A;  4DR1 K;  2FF6 A;  5E41 A;  5T7B A;  1U49 A;  4CJT A;  1RTH A;  2HOE A;  4G9Z A;  3C95 A;  3MEC A;  1KTQ A;  3CCM N;  1ZBL A;  3NAE A;  4E0D A;  1BGX T;  3PIO L;  3O80 A;  2E4L A;  3VGL A;  5AQM A;  1RNH A;  2HHQ A;  2P9L B;  3VEV A;  2DY4 A;  3CME N;  3TU5 A;  4GY2 B;  3AO2 A;  2HBL A;  2WOM A;  1REV A;  2Q2R A;  3AA2 A;  3C7N A;  4WQ4 A;  1IO2 A;  3LDN A;  1DTT A;  2QWR A;  2W6L A;  3IG1 A;  3T1H K;  2GEL A;  1NMN A;  2QWL A;  1TK8 A;  3FZH A;  3WXK A;  4FJN A;  4CHZ A;  4C8O A;  1NK6 A;  4MO4 A;  2W42 A;  3SBT A;  4BR7 A;  1JCE A;  3Q7B A;  3LDS A;  1IKY A;  4EZ9 A;  2P9K A;  1RBV A;  3UKR A;  4JI3 K;  4FL9 A;  4WF9 L;  4M3X A;  1E4F T;  3SQ0 A;  2FSK A;  4QS8 A;  4RW4 A;  4KB0 A;  5JEN A;  1ZC6 A;  3ZCM A;  3BP8 A;  4H5W A;  2A40 A;  3BZC A;  4DTJ A;  2O8E B;  2QWO A;  3TAM A;  3QIO A;  4KBO A;  5FRM A;  4Y1D A;  5M1O A;  1UA1 A;  4FJL A;  3MWP A;  3MX2 A;  4DLG A;  3D7E O;  3O1B A;  3VF6 A;  1IBL K;  3PX6 A;  3CC2 N;  4CGG A;  4CJ4 A;  1KCF A;  3O8M A;  2P9P A;  4AHT A;  2YCH A;  3THW B;  2YHW A;  3L2R A;  3K5L A;  4M3U A;  4DSE A;  4BVO A;  3HPH A;  3HM9 A;  5HP1 A;  3DOK A;  1WSF A;  4CZH A;  5JVG L;  3P38 A;  4DU4 A;  2DFE A;  4OLA A;  3LM9 A;  2P9I A;  1NWK A;  2HMP A;  3I8D A;  2E8A A;  2OCE A;  1LWC A;  2O8C B;  3C6H A;  1EET A;  4DV2 K;  3UKU B;  3UB5 A;  1ATS A;  3D2F A;  4KHS A;  4YFU A;  2QWQ A;  2YI1 A;  4DF8 A;  4BY9 C;  3ID8 A;  2GUI A;  4ELU A;  2WUS A;  3M8Q A;  2G8K A;  4PY5 A;  3FZF A;  1SL2 A;  4DQ8 A;  3BDP A;  1TKT A;  2E1Z A;  4KH6 A;  4CEF A;  1SL0 A;  1VQ6 N;  3ENB A;  4CJU A;  3GDQ A;  4KO0 A;  3V81 A;  4IDH A;  4JYA K;  2UYT A;  1XHZ A;  5CE3 A;  1XHX A;  2QW9 A;  2ZWH A;  3M8S A;  3CFR A;  1KC8 O;  4JI0 K;  3NF6 A;  3GE1 A;  3K9J A;  3A5M C;  4CBU A;  2F96 A;  3NF9 A;  4CZE A;  1W2B M;  3KLE A;  4J8F A;  4KHP K;  3KD1 E;  4IXC A;  4NYN A;  2VQF K;  1IBM K;  1T7P A;  1HNW K;  3DRR A;  3AVA A;  2BAN A;  1CLQ A;  2ETJ A;  5IT9 O;  1RT5 A;  2NLX A;  4H0T B;  3F73 A;  3LDO A;  3EKU A;  1X3M A;  2UXC K;  1TL1 A;  5MLC Q;  1FKO A;  3BF1 A;  2I7P A;  2OTL N;  2Y1J A;  1D4X A;  4H4O A;  3CET A;  3KK1 A;  2PZS A;  4Z4G A;  1S1V A;  5J2N A;  3A8Y A;  3RSE B;  4ID1 A;  4AHU A;  3CFP A;  5LMN K;  4AHR A;  4B3S K;  2HHU A;  4GW6 A;  4BGA A;  2ZD1 A;  1I3A A;  4JKE A;  1T8E A;  4CBX A;  1TKD A;  4CEQ A;  4B08 A;  1HNI A;  4DR2 K;  5B8H A;  3I8B A;  4E1N A;  2FC0 A;  3I55 N;  3CCJ N;  1K73 O;  4FWO A;  2J4R A;  5J2M A;  4EP4 A;  4FLT A;  2RKI A;  2XHB A;  2IIR A;  4BRG A;  1IKW A;  1U2V B;  5AQS A;  2P9U B;  4DSF A;  4B8C A;  3SMP A;  4B9T A;  3S9H A;  2RN2 A;  2XY6 A;  2HW3 A;  3ENO A;  1L5U A;  2VGN A;  4BR5 A;  4PKI A;  2V51 B;  4CD1 A;  4FK4 A;  1GOC A;  2E20 A;  5CZ1 A;  3G4S N;  3HPG A; 
#chains in the Genus database with same CATH homology
 1NBW A;  3TTD A;  3HOT A;  1X9J A;  2QEX N;  5BRD A;  1TYQ B;  5E84 A;  4I6M A;  3CJB A;  3VTI A;  3O9U A;  2A42 A;  2NRR A;  2GTD A;  4YOW A;  4M7Y A;  1YUW A;  4U7B A;  2A41 A;  4BRI A;  4B1X B;  3FLC O;  4B1Y B;  4FWS A;  4BRN A;  2CH6 A;  4EFH A;  1VQM N;  4JHD A;  5CHI A;  2A3Z A;  5AFU A;  1QQM A;  4JKD A;  3M6G A;  1QZ6 A;  1M90 O;  5C0Y A;  4MDB A;  5I9E B;  4AM6 A;  4FWM A;  3O6W A;  4JK8 A;  5AZI A;  3T7Z A;  4BRQ A;  1QVG M;  3VTH A;  1U6Z A;  2EWS A;  2F7T A;  2OTJ N;  3D2F B;  5AR0 A;  4LC9 B;  1YIT N;  1VQ5 N;  3DWL A;  3IDH A;  4XH4 A;  3CER A;  3CPE A;  4JKA A;  3WUH A;  4A61 A;  5ADX H;  1CZA N;  3M3Z A;  4QS9 A;  5H1S Q;  1NMD A;  4M63 C;  1XC3 A;  5ELZ A;  5AQZ A;  3H1V X;  4WQ4 C;  4BR9 A;  3SAG A;  1NM1 A;  1T6C A;  3IMX A;  5F2R A;  1Q81 O;  5AZJ A;  1K8A O;  1KAZ A;  4IJA A;  1S22 A;  3AGR A;  1GLC G;  3E1Y A;  3E9L A;  2YJF A;  4H5V A;  2Q97 A;  1JJ2 M;  4A2A A;  1BA0 A;  3H46 O;  2FSJ A;  3Q7C A;  5KPT A;  3VES A;  4BR2 A;  3F5T A;  4JD2 B;  2D1K A;  5DM7 L;  1NGB A;  4CZM A;  1WOQ A;  4H0P A;  3VGM A;  1BDG A;  3VEZ A;  3CQX A;  4XH1 A;  4WYB A;  3WQU A;  3AY9 A;  4CI6 A;  4GV6 A;  3VER A;  4GV9 A;  1YIJ N;  1DEJ A;  3N4Q A;  3F2K A;  5BPN A;  2QXL A;  5C2F A;  5BRH A;  1VQ9 N;  1YXQ A;  3C65 A;  3HOS A;  3H6E A;  3TSP A;  4BC3 A;  2CH5 A;  4A5A A;  1SAZ A;  3MX5 A;  3D2E B;  1HPM A;  3E9O A;  4FPA A;  2P9L A;  3VEO A;  3C7N B;  2AA4 A;  4KH4 A;  5BN9 A;  4FWQ A;  4BRK A;  4K41 A;  4ILG B;  2GX9 A;  4JKG B;  4HTL A;  3M1F A;  3EZW A;  3O4W A;  4BC5 A;  4BRL A;  5GAG P;  1VQP N;  4YDU A;  5C15 A;  5EX5 A;  3H3N O;  4AM7 A;  3G71 N;  3CD6 N;  2DPN A;  2P9N B;  3JXU A;  4WFB L;  2HBM A;  5M1P A;  4BR4 A;  4JN4 A;  2YHY A;  4JKC A;  3WXJ A;  1K8K A;  1SZ2 A;  4FOI A;  2W40 A;  4FOE A;  4IEE A;  4C1N I;  1BWF O;  4C1N K;  3H1Q A;  3O9Q A;  3R1X A;  3SMS A;  2HF3 A;  1VQ8 N;  2P9K B;  1YJ9 N;  5F0X A;  4NLC A;  1DT9 A;  3CJ9 A;  3QFU A;  4H0X B;  4IO9 L;  1K9M O;  3ZX3 A;  4BRH A;  4DCH A;  5M1Q A;  4BRE A;  3TTF A;  4BEC A;  5DM6 L;  5BRE A;  5JLH A;  3CCS N;  2NRH A;  3OBY A;  3L4I A;  4H5N A;  2D4W A;  3CMA N;  3MMV A;  4ISE A;  3DJC A;  2D0P A;  3EO3 A;  4WFA L;  5JLF A;  2CGK A;  1VAZ A;  3MWT A;  3SJH A;  3CC7 N;  4YOV A;  1XUP O;  3ZEU B;  4RWT A;  1NGG A;  4YOU A;  4IO8 A;  2F9T A;  1NGE A;  1HKC A;  1HX1 A;  3O9S A;  1MWM A;  4B1W B;  1KAY A;  2PAV A;  4K43 A;  3LL3 A;  1KD1 O;  4IOX A;  2Q36 A;  4FWR A;  4MO5 A;  2QWM A;  1YJW N;  1NGJ A;  1TUU A;  4PL8 A;  3E9P A;  3GG4 A;  5GIN A;  4L3Q A;  2ASO A;  4OPA A;  5AQP A;  4WCE L;  1BUP A;  4JAX A;  1BU6 O;  4O8K A;  3CPW M;  3WQT A;  5AQG A;  2P9S B;  4CZL A;  3KWG A;  2JWK A;  3U8X A;  3P4I A;  4XJX A;  5M1N A;  4MLE A;  1MWK A;  1VQ7 N;  4PL7 A;  4JEP A;  4FWP A;  3DLL L;  2NRT A;  5EY4 A;  2QTD A;  3D6R A;  3ZET A;  3U9D A;  3MN9 A;  1LCU A;  2P9P B;  4F9O A;  5AQK A;  1VQL N;  2A5X A;  1S3X A;  4BG8 A;  1ESV A;  3ENH A;  1VQK N;  2GWJ A;  3W0L A;  3ID6 A;  3CCR N;  2ZF5 O;  3KZB A;  1T44 A;  5EXW A;  4BC4 A;  2KKZ A;  5KQD A;  2BH1 A;  2GWK A;  3MCP A;  4BRC A;  3MN7 A;  1IG8 A;  1Q7Y O;  3VOV A;  3O08 A;  3R3L A;  4B9Q A;  1T3V A;  4BRP A;  3H3O B;  5BR9 A;  4A59 A;  1JCF A;  3FZL A;  3QIC A;  2WFB A;  3HSC A;  5TKW A;  3ZYY X;  1OVY A;  2P9I B;  1SQK A;  4XEI A;  1Q86 O;  4JHD B;  3OBW A;  1TYQ A;  5AQN A;  4JKB A;  1P8Z A;  4C23 A;  1ZBS A;  2BTF A;  3FE1 A;  4HWI A;  2Q0U A;  4IWV A;  3EKS A;  3LDQ A;  1TUY A;  4PKG A;  2NRZ A;  1NGC A;  5AZI B;  3IFR A;  3CJ1 A;  2FSN A;  3K9K A;  1MA9 B;  5EOY A;  4H0Y B;  5AQQ A;  2FXU A;  1RGI A;  5BPL A;  1BOT O;  3UKU A;  5LJW A;  1Z6R A;  2E1Y A;  4JK7 A;  1HLU A;  3LM2 A;  1QHA A;  3LDL A;  1NGH A;  5JIC A;  2QA4 N;  2A6A A;  4WFN L;  3CCE N;  5FPM A;  5C2D A;  5M1K A;  4YDU C;  4GNI A;  3A5L C;  3CCL N;  5GAH P;  1R59 O;  2IVO A;  4H0O A;  4B1Z A;  3EE8 A;  3QDK A;  3R9P A;  1W97 L;  3BEX A;  4ISG A;  3T69 A;  3CCQ N;  3HRG A;  3VET A;  1MDU B;  1V4T A;  4RTF D;  1IJJ A;  4IOC L;  2VCP A;  4CBW A;  4O8U A;  4ILH A;  4UY8 O;  2QWP A;  2E2N A;  2FF6 A;  3J7Z O;  2HOE A;  4G9Z A;  5AQV A;  1YI2 N;  3CCM N;  5HL7 L;  3CQY A;  3PIO L;  4EIA A;  1E4G T;  3NVM A;  3O80 A;  3R6M A;  2V7Y A;  5AQJ A;  3VGL A;  5AQM A;  2ZJQ L;  3ATU A;  3RVC A;  2P9L B;  1GLL O;  5AQY A;  1BG3 A;  5GAE P;  3CF5 L;  3ULE B;  3VEV A;  4H0V B;  3CME N;  1C0G A;  1KAX A;  3TU5 A;  3O1W A;  4GY2 B;  4WQ5 C;  4BRF A;  1HUX A;  3DXK A;  2HBL A;  4BC2 A;  3WXM B;  4BEB A;  3WEE A;  3VEW A;  3HBT A;  2Q2R A;  4YOR A;  3KK7 A;  1WUA A;  3U9Z A;  3C7N A;  2YHX A;  3NMU A;  4WQ4 A;  3LDN A;  1GLB G;  1K8K B;  2QWR A;  2E2Q A;  5ADX A;  3L6Q A;  3CCU N;  2ASP A;  1ILY A;  4CD3 A;  4FWN A;  4H03 B;  5GIO A;  2GEL A;  4FSV A;  2V7Z A;  3OHR A;  2Q1N A;  5E26 A;  4DB3 A;  2QWL A;  4CZG A;  3NVK A;  3FZH A;  2P9N A;  4DHY A;  2OAN A;  1YHQ N;  1BA1 A;  3WXK A;  3I56 N;  1OKJ A;  1M1K O;  3QB0 A;  3CJA A;  3R8E A;  4MO4 A;  4A62 A;  4NB4 A;  3SBT A;  4BR7 A;  1JCE A;  3Q7B A;  2CGL A;  3PIP L;  3FGU A;  1VQ4 N;  2P9K A;  2AP1 A;  1O13 A;  5AQF A;  3C0B A;  4GVE A;  3HM8 A;  5AQL A;  3UKR A;  4FL9 A;  1NLV A;  4WF9 L;  2PFU A;  3RSE A;  2HST A;  4A57 A;  3G6E N;  1E4F T;  5AQW A;  2Q0R A;  2V52 B;  5AFU H;  2FF3 B;  2FSK A;  4M7X A;  4QS8 A;  3O9R A;  5KPZ A;  1HJO A;  1ATR A;  1HKB A;  3CJC A;  3A0I X;  5CR4 A;  5FPD A;  1X3N A;  1ZC6 A;  3H45 C;  5C10 A;  5GAD P;  3BP8 A;  2E2P A;  3ZEU A;  1RDU A;  5C12 A;  3OW2 M;  2NNW A;  2WBN A;  4H5W A;  2A40 A;  4BR0 A;  1Q18 A;  3CHW A;  3VPZ A;  4K42 A;  2QWO A;  4E1J A;  1N8R O;  5M1F A;  4KBO A;  5AQT A;  3S41 A;  3FR0 A;  2QI2 A;  4IJN A;  3CXC M;  3DXM B;  3A5N C;  3VMF B;  1Q82 O;  1LOT B;  5GIP A;  1U2V A;  2P9U A;  2YX6 A;  5M1O A;  2IVP A;  3VEX A;  4FVU A;  4JNE A;  3HTV A;  2VWB A;  2P9S A;  3MWP A;  3MX2 A;  3TSQ A;  1NGI A;  4PKH A;  4H5R A;  4I6M B;  3D7E O;  3O1B A;  3VF6 A;  1YVN A;  1SS6 A;  4ISF A;  3CC2 N;  5BRF A;  3HZ6 A;  3O8M A;  2P9P A;  3G25 A;  3WXI A;  1RFQ A;  2YCH A;  2YHW A;  3EE9 A;  2ZJR L;  1DKG D;  3KHY A;  4BVO A;  1GLE G;  1P90 A;  1QZ5 A;  4CJ7 A;  1ZXO A;  4MDA A;  3PLA A;  4QS7 A;  4BQL A;  1GLD G;  2NZT A;  4Z94 A;  4EHT A;  4CZH A;  3CJ7 A;  3MDQ A;  3SLC A;  3CIP A;  1KXP A;  2KLA A;  4EAH D;  3P38 A;  5JVG L;  1YAG A;  4BVP A;  5BPM A;  5LJV A;  4RCH A;  3IUC A;  3LM9 A;  2P9I A;  5JVH L;  3BF3 A;  2E88 A;  2HBJ A;  1NWK A;  1C0F A;  4NLB A;  5BN8 A;  3CCV N;  2HMP A;  2IVN A;  5HOO A;  2E8A A;  3FZK A;  2C1I A;  3C6H A;  5AZJ B;  3UKU B;  4OPH A;  3UB5 A;  1ATS A;  3D2F A;  5KQ8 A;  3VEY A;  3WXL A;  2QWQ A;  2YI1 A;  3N4P A;  4BY9 C;  3ID8 A;  2NRV A;  2WUS A;  3EN9 A;  3FZF A;  3QBX A;  3SAH A;  4DQ8 A;  2RE2 A;  5TKY A;  4BRD A;  3L0Q A;  2E1Z A;  3TTC A;  3I33 A;  4KH6 A;  5AQI A;  1GLA G;  1VQ6 N;  4B1V A;  3GBT A;  4FWL A;  2NRW A;  3AAQ A;  3MCA B;  3QML A;  3SBG A;  3F9M A;  3VEN A;  3ENB A;  1J6Z A;  1NGD A;  4R79 A;  2E2O A;  3AGK A;  4IOA L;  1T6D A;  2I7N A;  3GDQ A;  4JD2 A;  4U67 L;  1HKG A;  4IDH A;  4EHU A;  4IFE A;  5JMV A;  3BUZ B;  1GLF O;  5FPE A;  2UYT A;  1JCG A;  3JS6 A;  4PHT X;  5CE3 A;  2QW9 A;  3ATV A;  1XQS C;  2ZWH A;  2NRX A;  4O5F A;  4JK9 A;  4B1U B;  2QWN A;  1KC8 O;  3CC4 N;  3MK6 A;  2ZJP L;  1V4S A;  1DGK N;  3GE1 A;  2PBD A;  2HBK A;  4JKH A;  5LY3 A;  3K9J A;  1KQS M;  2FLO A;  4NO7 A;  3A5M C;  4JKF A;  4MLH A;  3ZX0 A;  4CBU A;  4YOX A;  2GEM A;  4CZI A;  2KHO A;  3D2E A;  4IZ9 A;  5KPR A;  3DXK B;  2HF4 A;  2W41 A;  3E66 A;  4BG9 A;  4CZE A;  3W3D A;  4YOY A;  2RHK A;  3FZM A;  3WEE B;  1S72 N;  1W2B M;  4BGB A;  1EO1 A;  4J8F A;  4DKW A;  1BO5 O;  2Q31 A;  4JKG A;  2W00 A;  2VGM A;  1NJI O;  3CI5 A;  1ATN A;  3P31 A;  4IXC A;  3ULE A;  3VF4 A;  3O5B A;  4BRA A;  4BQZ A;  3OA9 A;  3WT0 A;  3ZX2 A;  3O9T A;  2ITM A;  1NGF A;  3KVG A;  3TPQ A;  2VYP A;  3L4Q A;  3A5O C;  1QVF M;  3C6A A;  2NLX A;  4H0T B;  3LDO A;  3EKU A;  1X3M A;  3AAP A;  1VQO N;  2F9W A;  3IKM A;  1Z05 A;  5MLC Q;  3HI0 A;  2JWL A;  3BF1 A;  3FFK B;  1G99 A;  2I7P A;  2OTL N;  2D0O A;  1D4X A;  3AAR A;  1EQY A;  5FPN A;  3SK3 A;  3GL1 A;  3CET A;  4KH5 A;  4BRO A;  3KWI A;  1GLJ O;  5AQX A;  2ASM A;  2YJE A;  3UKR B;  5F1X A;  3A8Y A;  3QFP A;  2CGJ A;  3B8A X;  3RSE B;  3M5R A;  4IEI A;  1NGA A;  4AF1 A;  4XH5 A;  4CZK A;  4BGA A;  3VGK A;  3MN6 A;  4FO0 A;  3P39 A;  1RDW X;  4WQ5 A;  3U4L A;  4JKE A;  4BRM A;  2GUP A;  3UE5 A;  4CBX A;  4FWK A;  3SAF A;  1YJN N;  5B8H A;  4A5B A;  3LDP A;  4H5T A;  3I8B A;  5EVZ A;  3I55 N;  4YOT A;  3J8A A;  3CCJ N;  1K73 O;  2C1G A;  4FWO A;  1QQO A;  2ZGY A;  2J4R A;  4CZF A;  1QQN A;  4FPB A;  3ZET B;  3TSU A;  3GOI A;  2QM1 A;  2BUP A;  1YF5 L;  3MN5 A;  1Y64 A;  4Y0W A;  2IIR A;  5AQR A;  4BRG A;  5AQS A;  1U2V B;  2H3G X;  2ZGZ A;  2P9U B;  3SMP A;  3EL2 A;  5AQO A;  3QBW A;  4K25 A;  3ENO A;  2VGN A;  3VF2 A;  4BR5 A;  4BE7 B;  5AQU A;  1H1V A;  4PKI A;  2V51 B;  4OO1 J;  4CD1 A;  3DAW A;  5AQH A;  4GV3 A;  3DXM A;  2E20 A;  3G4S N;  4A2B A;  4CZJ A;  4ILJ A;  2WC9 A;  1VQN N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...