1U2VB

Crystal structure of arp2/3 complex with bound adp and calcium
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
204
structure length
204
Chain Sequence
b'YAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-Related Protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
molecule tags Structural protein
total genus 57
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1u2vB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1u2vB02
4B1XB 1DGKN 3O4WA 5AZJB 2YJEA 1GLBG 1QQNA 3CJCA 3F9MA 4CD3A 3O1BA 4JD2B 1GLJO 5AQGA 5FPMA 3UKRA 5EXWA 3FZKA 3VF6A 3VERA 4M7YA 3O1WA 4XH4A 2A5XA 1S22A 2QWLA 3L6QA 1NM1A 3CIPA 5AFUH 1RDWX 4DHYA 2HF3A 1U6ZA 3UKUA 4EFHA 4FO0A 2Q1NA 4CZKA 5AZIB 1HJOA 1KXPA 1SAZA 2D4WA 2QWQA 3EKUA 4JHDB 3U9DA 3CJ9A 5EOYA 2CGKA 3FGUA 1QQMA 3WXIA 3HBTA 3CJ1A 2ITMA 1QZ5A 1WUAA 2Q0RA 2E2OA 3BUZB 5KPZA 3O6WA 2YCHA 2FF3B 5AQPA 3CQXA 4CI6A 1HKGA 3QB0A 1T44A 4H0OA 3ZEUB 4CJ7A 2FSJA 3U9ZA 4FPBA 2P9NA 4BR4A 2HOEA 1NGAA 2E2PA 4HWIA 4Z94A 3VF2A 1X9JA 4WQ5A 3U4LA 4BC5A 5LJVA 3FR0A 2FF6A 5EX5A 3AY9A 5FPEA 1WOQA 3OHRA 2GUPA 4BRHA 3QFPA 4I6MB 3TU5A 1X3MA 2VYPA 3LDQA 1ATNA 1GLLO 3DXMA 4BGBA 3O80A 2ASMA 4BRIA 2J4RA 3FZLA 3GBTA 4EHTA 4XEIA 3WUHA 4CBXA 4BR2A 3ULEA 1GLFO 2GEMA 2Q0UA 2V51B 3H45C 4H5TA 4CBUA 1T6CA 1TYQB 2GELA 2P9UA 4IXCA 5AQSA 3QBWA 3ENHA 1NGFA 1BDGA 4IJAA 4IWVA 3GL1A 3H6EA 1NWKA 4BRCA 2ASOA 4FWSA 3BF3A 1YVNA 4H03B 1ZC6A 4BC4A 3B8AX 5AQRA 3IDHA 5BRFA 1KAYA 2Q31A 2ZF5O 2P9PB 5BPMA 4K43A 4BR7A 1Z6RA 4BRQA 4M63C 3JS6A 4IZ9A 4BGAA 4JN4A 3M3ZA 4EHUA 4H0XB 2CH6A 4FWNA 3VEXA 5F1XA 3KVGA 5ADXH 1X3NA 2A3ZA 1MWMA 4MLEA 1T6DA 1H1VA 4EAHD 2OANA 3ZX2A 3P4IA 2FSKA 1GLAG 4PKGA 3GG4A 4FWRA 4CZMA 5JLHA 5BRDA 3A5NC 3I8BA 5BPNA 2P9IB 4XH5A 3WXJA 3LDOA 5BPLA 1KAZA 4FWKA 3VENA 5F0XA 1JCEA 4WYBA 3R9PA 4B1VA 3FLCO 5E84A 3DWLA 4O5FA 4FPAA 4MO5A 4Y0WA 2UYTA 1LOTB 4A2BA 2BUPA 4PL8A 5JMVA 1E4GT 2P9SB 1U2VB 5KPTA 4BRDA 1MDUB 3HZ6A 1ATRA 2H3GX 1TUYA 2AP1A 4CZGA 4F9OA 2WUSA 3MN7A 2P9NB 3GE1A 5BN9A 3MN6A 2P9LB 2CGJA 3EN9A 2QWOA 2HMPA 3EO3A 3S41A 3VF4A 2PAVA 5FPNA 3WEEA 4A62A 3MK6A 3SMSA 3C7NB 1NMDA 3ATVA 3D2EA 3FE1A 3ZETB 2E8AA 1BOTO 1QHAA 4BRGA 3GOIA 3QICA 1XQSC 1K8KA 1E4FT 4B1WB 4FOIA 5FPDA 2YJFA 2GTDA 2P9UB 4WQ4A 4BRKA 2E20A 4H5WA 3AAQA 5JLFA 3LDNA 4XH1A 3VGKA 3A0IX 3MCPA 5JICA 3VETA 3MDQA 2V52B 5KQDA 5KPRA 3UB5A 4RWTA 2QWPA 2QWMA 5AQHA 5F2RA 3LM9A 4ISEA 3R6MA 4GY2B 3J8AA 1NGIA 3DXKA 4H5NA 4LC9B 3MN5A 1D4XA 4CBWA 2D0PA 4YDUC 1KAXA 4BVPA 1RFQA 4JD2A 1V4SA 5AQFA 1NBWA 3EL2A 3IUCA 3QBXA 3I33A 4BRAA 1ZXOA 2A42A 2FLOA 2YHWA 3M1FA 4BRPA 3WQTA 5B8HA 4FWPA 4B9QA 3EZWA 3AARA 4H0PA 4FWQA 1NLVA 3A5MC 5ADXA 4CZJA 4CZLA 1XC3A 2GWKA 3MN9A 4B1YB 1MWKA 4BG9A 4DQ8A 3CHWA 2Q36A 1IJJA 2YI1A 3A5OC 5BR9A 3A8YA 1BWFO 3VEVA 1HKBA 3HM8A 3ATUA 5AZIA 1HKCA 1NGBA 4PL7A 1Q18A 3D7EO 1EQYA 4JHDA 4QS9A 3H46O 5AQJA 4CZFA 2I7NA 3QFUA 4QS8A 1YAGA 1IG8A 1GLEG 5TKYA 3DAWA 4H0TB 3BEXA 3ZEUA 3UKRB 4BG8A 1HLUA 4K42A 5AQNA 2D1KA 3WXLA 4CZHA 3HSCA 1YXQA 5EY4A 3O8MA 2FXUA 1S3XA 2DPNA 5BREA 4BR9A 1JCGA 4CD1A 4GNIA 3UKUB 4DB3A 4YDUA 2NZTA 1HX1A 2P9KA 3L4IA 4I6MA 2VCPA 5CE3A 3D2EB 4BVOA 3CQYA 3LL3A 4CZEA 3VEZA 3D2FA 1K8KB 3FZFA 3SMPA 5AFUA 4MLHA 1J6ZA 4C23A 3QDKA 4JNEA 4RCHA 4BR0A 3ENOA 2E2QA 4BC2A 1CZAN 4H5RA 3SJHA 1BA1A 1BU6O 3RSEA 4DCHA 1TYQA 4FSVA 4JAXA 2EWSA 1MA9B 3H1VX 5E26A 3L0QA 3WQUA 3TPQA 1TUUA 2ZWHA 3HTVA 4B1UB 1NGEA 4AM6A 1Z05A 5EVZA 2A6AA 1HPMA 3U8XA 2AA4A 2I7PA 3M6GA 4BR5A 1DKGD 2P9PA 3DXMB 4K41A 2VWBA 3SLCA 5KQ8A 4MO4A 2CH5A 4M7XA 3BF1A 1BA0A 5AQUA 1OKJA 3W0LA 3AAPA 4E1JA 4FWMA 2A41A 4H0VB 1G99A 4BC3A 2D0OA 2KHOA 3ULEB 3QMLA 3CI5A 2W40A 3CERA 3H1QA 1V4TA 4BRMA 3LDPA 2P9IA 5ELZA 1SZ2A 3KHYA 4A61A 4CZIA 2CGLA 4H0YB 5AQMA 1SQKA 4HTLA 1HUXA 2ZGZA 4QS7A 3WT0A 5LJWA 5AQXA 3VESA 5AQZA 3BP8A 5AQOA 3IFRA 3VGLA 4BROA 3C0BA 3CJBA 1C0GA 4A2AA 1ATSA 2P9SA 4ISGA 1C0FA 1U2VA 1NGJA 5AZJA 3HI0A 3KZBA 3FFKB 4FWLA 3VGMA 4RTFD 2Q97A 2W41A 2IVNA 4IO8A 1BUPA 1QQOA 2V7ZA 5AR0A 2F9WA 3W3DA 4PKIA 4B1ZA 2P9LA 2E1ZA 2E88A 2QWNA 2NRHA 1Y64A 3EKSA 2IVPA 1P8ZA 1NGHA 2E1YA 5AQQA 5BN8A 4IJNA 3R8EA 3LM2A 4BREA 2QWRA 5AQIA 5I9EB 2V7YA 3H3NO 2P9KB 2Q2RA 2QW9A 1ESVA 1QZ6A 3C7NA 2A40A 4ISFA 3D2FB 3ZETA 1GLDG 3FZHA 1BG3A 3VEWA 1NGDA 3DJCA 2GWJA 2HF4A 3ZX3A 3O5BA 5AQLA 3RSEB 3CETA 1R59O 2BTFA 3IMXA 4KBOA 2IVOA 3WXKA 1ZBSA 1RGIA 1JCFA 3VEYA 4BQZA 2QXLA 4EIAA 2NLXA 3VEOA 4BQLA 3ZX0A 5AQWA 4BRNA 1GLCG 3WEEB 1BO5O 3H3OB 4BRFA 1DEJA 3GDQA 4FOEA 5AQYA 3G25A 4H5VA 1NGGA 4L3QA 4FL9A 4NO7A 4BRLA 1LCUA 1XUPO 2F9TA 4AM7A 3ID8A 4O8KA 3LDLA 2QM1A 4FWOA 3VPZA 5LY3A 2YHXA 2ASPA 3CJ7A 3VOVA 1NGCA 4WQ4C 2IIRA 2YHYA 5AQTA 2PBDA 2FSNA 4NB4A 1YUWA 2E2NA 3MMVA 5AQVA 5BRHA 4PKHA 5AQKA 3SK3A 3CJAA 4WQ5C 3JXUA 3DXKB 3A5LC 3FZMA 3UE5A 3O08A 2ZGYA 4K25A 4J8FA
chains in the Genus database with same CATH superfamily
3KD5E 3O4WA 5JVHL 1GLBG 4DTRA 1QQNA 2VGNA 5FPMA 1S72N 1E3MA 1IH7A 4HUEA 3O1WA 4XH4A 1L3SA 2A5XA 3L6QA 4MFBA 3SQ1A 2PY5A 5AFUH 3MECA 4B3RK 1U6ZA 4FO0A 3P5JA 4CZKA 1HJOA 5E41A 3EKUA 2HNZA 3CJ9A 1TK0A 3WXIA 1ZBUA 3CJ1A 5GAGP 3BUZB 3ZSZA 2Y1IA 5JS2A 4FW1A 2YCHA 2GBZA 5AQPA 4CJPA 4IBNA 4CI6A 1KVBA 1LWCA 4CE9A 3ZEUB 2X6SA 1T44A 4H0OA 1VQPN 2FSJA 3LALA 2B4JA 4DV7K 1HYVA 4Z94A 1NK0A 3VF2A 3RMCA 1YITN 4A59A 4WQ5A 3C65A 4WFAL 3CC7N 3DLHA 2YX6A 4BC5A 5LJVA 5EX5A 3KJVA 3LWMA 1WOQA 3OHRA 4FJLA 4QOZB 2GUPA 3I0SA 4BRHA 3QFPA 4I6MB 1X3MA 2VYPA 3VN5A 4CJQA 4BGBA 3OYHA 2HMIA 4DV6K 2HHSA 5EU7A 2XHBA 5FDLA 3V81A 1RBSA 4CBXA 4BR2A 3ULEA 4JK7A 3G4SN 1T6CA 4BACA 2P9UA 4DV4K 4IOCL 2HSTA 2Z1IA 3C6TA 3C94A 3ENHA 2XO7A 4W5NA 3J7ZO 3GL1A 5M1KA 4FWSA 3BF3A 1YVNA 4H03B 2PZSA 4CK2A 1QVGM 1HQUA 4BC4A 2FBTA 3LPTA 3IDHA 2IAJA 4IDHA 5BPMA 3LWLA 3F5TA 4ILGB 4IZ9A 3AVBA 4BGAA 3EE9A 5M1FA 2IC3A 3OJUA 3M3ZA 4FWNA 2DY4A 4ZTJA 1X3NA 2GX9A 2E5LK 3QLHA 4EAHD 3ZX2A 2ZE2A 3NF6A 1GLAG 3MAQA 3GG4A 4CZMA 4LY7A 4B9SA 4LFCK 2WC9A 4XH5A 2KLAA 1VSKA 2HVIA 4LF7K 3R9PA 1W97L 4RG8A 3HO1A 4I2PA 3FLCO 3AVKA 4CK3A 4GV9A 2P1JA 3ZT1A 4K0KK 4DV1K 4PL8A 3THXA 4RW7A 4FLTA 3NCIA 5KPTA 2XY7A 3HZ6A 1ATRA 2YHBA 1TUYA 4CZGA 4HCBA 3MN7A 4DTNA 4AHTA 3MN6A 1B9FA 1ILYA 2HMPA 4DTMA 3S41A 3IRXA 4N76A 3F73A 3OYMA 3QIPA 4CJWA 4CW7B 2UXCK 4HCCA 4X64K 4FJXA 1WSEA 4M45A 3J7YP 3CFPA 2UXBK 3NMUA 1C0MA 4BRGA 1QHAA 4AHCA 3GOIA 3HOSA 1A5WA 4CHYA 1NNEA 5TKWA 1Q8IA 3THWA 3TAEA 5T7BA 4KI6A 2F8TA 4B1WB 5FPDA 1HNWK 3CM6A 4FM2A 1N6QA 3O9QA 4EP4A 2GTDA 2P9UB 4WQ4A 3HJFA 3TAGA 4CGHA 5CR4A 3Q7BA 5JLFA 1VQMN 3VGKA 5JICA 5HRSA 3UB5A 3O4QA 4YOXA 4CHZA 4FK2A 1TKDA 4N47A 2VQEK 4ISEA 1YJ9N 3DXKA 4H5NA 4LC9B 3NGIA 4FK0A 4AHVA 4CBWA 1VK0A 2HHTA 3F9KA 2D0PA 4C8NA 3CFOA 3TAMA 1YJWN 5JVGL 4CJLA 1JL1A 4CEDA 1RFQA 1JL2A 5HBMA 4BDPA 4FJ9A 3IUCA 1CLQA 5C2DA 3I33A 2A42A 2FLOA 4DR5K 1JLAA 2Z1JA 4CFBA 3CMAN 1ITGA 1Q82O 3AARA 1NLVA 2GWKA 4B1YB 4FW2A 3M8SA 3CHWA 4DS4A 3A5OC 5BR9A 4I9QA 3CCQN 1K8AO 1XWLA 4F2SA 4C1NK 1HKBA 3QNOA 5AZIA 1N32K 3M8PA 2VGMA 3D7EO 4JKFA 3IAYA 1YF5L 1UAXA 5GAHP 3QFUA 1TK5A 1QSLA 4QS8A 4XJXA 1IG8A 1GLEG 3IKMA 4JS4A 3DAWA 4H0TB 3BEXA 3Q7CA 4E19A 1JXBA 4NYNA 3UKRB 3TSPA 3ASMA 4OLBA 2ETJA 3D6RA 3NF9A 1U45A 3O8MA 5LMUK 1YTUA 4DB3A 2ITGA 4RW9A 1K9MO 1NK6A 3R1XA 3BZCA 1C1BA 3CQYA 1ASVA 3H08A 5C10A 3L2VA 1L3VA 3FZFA 3HPHA 3ZSRA 1RILA 2HBLA 4C23A 1N5YA 1F21A 3QDKA 1NJZA 3NH0A 3SJJA 1VSHA 3SJHA 1XI1A 4DQPA 2WFBA 4FSVA 3ENBA 4JAXA 3J81O 1C0TA 2PFUA 1KVCA 1RT1A 3DOLA 3LAKA 3WQUA 3MX2A 2ZWHA 3L2QA 3O9TA 1KFSA 1WLJA 2KFNA 4J2DA 5EVZA 3KLEA 1HMVA 4AF1A 4CESA 4BR5A 2P9PA 1SKRA 3M8QA 3I8DA 2CH5A 1RDBA 3W0LA 3AAPA 3T1HK 2D0OA 1M90O 3U3YA 3D0PA 2XY8A 1TAUA 2JGUA 1YTAA 1UA1A 1V4TA 4IEEA 4M41A 2P9IA 1SZ2A 3NAEA 5KTQA 3KWIA 4HTLA 1T8EA 4UY8O 3K0SA 2YKMA 3BP8A 3E9PA 1HNVA 1P90A 5AQOA 1U04A 4DR4K 4B3OA 3CJBA 3A2FA 3AA5X 1C0GA 4LD0A 1O1WA 1ATSA 2P9SA 2I5JA 1X1PA 1U2VA 4B9NA 4KTQA 1YVUA 2QTDA 2W41A 2IVNA 2V7ZA 1J53A 1J5OA 5DMRA 2E88A 2RKIA 4JI4K 4F3TA 1HNIA 4B9TA 4ELVA 2KZZA 2E1YA 4E1NA 4KH4A 3LM2A 1IKWA 2QWRA 2O8BB 2FBXA 2V7YA 3H3NO 2Q2RA 3DLBA 2ZJPL 1QZ6A 3QEWA 3ZETA 1NMNA 1RT4A 2VG5A 1XMOK 2JWLA 3O9RA 3C6HA 5HOOA 3ZX3A 4ELTA 4O5BA 3O5BA 3OBWA 4JKGA 1IKVA 4CJ4A 4KPYA 1JCFA 1NOZA 4EIAA 4B3MK 4BEBA 2NLXA 2HHXA 5GINA 5AQWA 3TWHA 2OZSA 3WEEB 1DEJA 3GDQA 1NK8A 4H5VA 1JLCA 3V6DA 4FJNA 1LCUA 4GV3A 2O8CA 5IT9O 4OKJA 3QEVA 3VPZA 4I2QA 4CGDA 4CIFA 2PBDA 5FRMA 4NLCA 5DM7L 4WCEL 5AQVA 1YIJN 5BRHA 3VQBA 4WQ5C 4Z4HA 4LF6K 1NKCA 3NF7A 1NOYA 2XRIA 3J80O 4DU4A 1XNRK 4JKCA 2C1IA 2RPIA 3O08A 2ZGYA 3OYEA 1LW0A 3TI0A 1SKSA 3MEGA 1C6VA 1DGKN 2HB5A 4CD3A 3F9MA 4JD2B 3RTVA 4KTWA 5AQGA 3OYLA 1Y97A 3KK2A 3FZKA 3OYBA 4FLYA 3QEXA 4MDBA 3VERA 4JK8A 3S5TA 1S22A 4KHUA 3L3UA 2O8FA 1RBUA 3OYCA 4UQGA 2Q1NA 4FJMA 1CZBA 1SAZA 5EOYA 3FGUA 4ZHRA 1RDUA 2ITMA 1X9SA 2Q0RA 5HL7L 2G8HA 3SUQA 1J5EK 2KQ2A 3CQXA 1HKGA 4CJ7A 1Q7YO 4DR1K 4JKGB 3U9ZA 4FPBA 4M3ZA 2HOEA 1NGAA 2E6MA 4MDAA 3LP2A 1N36K 3I0RA 4GMJB 4WFBL 3U4LA 3AY9A 5FPEA 4KREA 4HTUA 1S9EA 2Z1HA 5M1NA 3TU5A 1GLLO 3DXMA 3P31A 1BQNA 3O80A 2ASMA 4NCGA 4PA1A 1JLBA 3TAFA 2YNIA 4PUOA 3E66A 3DLRA 4NCBA 4KB1A 4CGGA 3EYZA 1L3TA 1C1AA 2OPRA 2GELA 1RTDA 3IS9A 5AQSA 3TTDA 5KGXA 3QBWA 4FYDA 3N4PA 1IV0A 3K59A 4JI8K 3H6EA 2ASOA 1ZC6A 4CF8A 1TKZA 4KTZA 4QCLA 1RBRA 5BRFA 2Q31A 4LF8K 4OO1J 3SAHA 4BE7B 4BR7A 4KRFA 1Z6RA 5F1XA 1T6DA 3E1YA 3P4IA 5CZ1A 4LFBK 5JLHA 3I8BA 4CF2A 4CHQA 2O8EB 3AA3A 5KRSA 5LMNK 3LDOA 5BPLA 1KAZA 3VENA 3VTHA 2O8FB 2DTUA 5FROA 2UUCK 1JCEA 2KW4A 3THVA 4KHNA 4FM1A 2HHHK 4O5FA 3VA3A 3AVCA 4Y0WA 1B92A 3U3GA 1SL1A 2BUPA 5JMVA 2VQFK 1DLOA 3CD6N 2EX3A 1JLGA 2X74A 1MDUB 3KD1E 2AP1A 4F9OA 3VQ5A 2WUSA 3HT3A 1N8RO 3GE1A 1ZBLA 5BN9A 3SUPA 1WSIA 2QA4N 1KFDA 3VQ7A 2P9LB 2ZQBA 5C42A 3EN9A 4E89A 4IG0A 3PSIA 4O0JA 1RT7A 3PX4A 4BWJA 3DLEA 4BE0A 1KC8O 2KZMA 3CC2N 5FPNA 3PO5A 1NK5A 4A62A 3RMDA 3SMSA 4B3TK 3TSQA 1T3VA 4DTUA 1NMDA 1K6YA 3ATVA 4LH5A 3D2EA 1BOTO 2IS3A 5GADP 3OYAA 3NBPA 4FOIA 4JKDA 4X65K 2YJFA 3MXMA 1SL2A 4BRKA 4H5WA 3AAQA 4WF9L 3ZYYX 3LDNA 3S3MA 3A0IX 3VETA 5KPRA 5C25A 2UU9K 4ICLA 4CJEA 2HNDA 4GKKK 4GY2B 1Z25A 1VQ4N 3LP3A 3HPOA 4DTSA 1V4SA 1HRHA 5AQFA 2UUAK 3OY9A 1X9MA 3EL2A 3TSUA 1RDCA 4BRAA 1ZXOA 3M1FA 4BRPA 3WNHA 4OX9K 3NFAA 3EZWA 1TKXA 4FWQA 1SS6A 5ADXA 5DM6L 3NHGA 3MN9A 4DQ8A 1UWBA 2YI1A 4FXDA 3O3FA 3TAQA 1BIUA 1BWFO 4YORA 3HM8A 3HP6A 3ATUA 1JKHA 5K14A 1ZYQA 4B8AB 1Q18A 3AVAA 4JHDA 4Z0UA 4FLZA 4JI2K 3P38A 4JKAA 3SV3A 5J2QA 4M3XA 3ZCMA 4CZFA 4AILC 3F2KA 4FLVA 4CEOA 4NCAA 3O9SA 4Z4IA 1JLQA 4F2RA 3SQ0A 3V9ZA 5AQNA 2D1KA 2A1SA 3HSCA 4BY9C 3KK3A 4AHUA 2UXDK 4YOTA 1TL3A 2FXUA 1S3XA 5FRNA 1JCGA 4CD1A 4YDUA 5CE3A 2P9KA 3D2EB 4CZEA 3OJSA 1BCMA 4MLHA 4DWIA 4DFMA 2E2QA 4Y1CA 1ZBFA 1RTIA 3RSEA 1TYQA 4CK1A 3KLFA 2QKKA 3VQ6A 3L0QA 3O3HA 4GV6A 4JRQA 3DRRA 4B1UB 1I3AA 1NGEA 4Z4CA 4AM6A 1Z05A 2A6AA 2E6LA 4LF9K 3NDKA 1DKGD 4DUYK 5KQ8A 1GOAA 2HHVA 3CCEN 1BA0A 1G99A 1OH5A 2KHOA 3ULEB 2BDPA 2HHWA 5CYMA 1S1TA 3PLAA 1SKWA 3H1QA 5ELZA 3AVJA 4A61A 1FJGK 5AQMA 1SQKA 4KFBA 3ZSWA 3JSMA 3N4QA 3VQPA 1JJ2M 4A5BA 3IFRA 1M1KO 2AJQA 5DK5A 4A2AA 1Q9XA 1ASWA 4DLGA 4AQYK 2NRXA 4ISGA 1C0FA 1D9DA 3FFIA 3MWPA 3T7ZA 1NGJA 5AZJA 3HI0A 3KZBA 3FFKB 3PSFA 1KRPA 1WNSA 1VQ9N 3HSTB 4CJ3A 4B8CA 1OH6A 1BUPA 4DQRA 1RBTA 5AR0A 2F9WA 3W3DA 4CEEA 2E1ZA 3KK1A 2NRHA 1VRUA 4F8RA 2IVPA 1P8ZA 1VSMA 5BN8A 4BECA 3R8EA 3O9UA 4FJIA 4G9ZA 3SQ4A 5AQIA 3DLGA 3SAGA 5I9EB 4CF9A 2P9KB 4EZ6A 2QW9A 3ID6A 4IFVA 1EX4A 3C95A 4U7BA 3C7NA 4M3YA 4E7KA 1GLDG 4IO9L 3RRGA 3K2PA 3PIOL 3THXB 4E72A 2HF4A 2ZJQL 3CYMA 2O4GA 1VAZA 3RSEB 4DR3K 2BTFA 3IMXA 3PUFA 4KBOA 4A5AA 2G8IA 3WXKA 3SV4A 1RGIA 4IEIA 4ZTFA 3QEPA 1KSPA 4BQZA 1NJXA 4BE2A 4DU3A 4BQLA 4DF8A 3ZX0A 4CEZA 5JS1A 1GLCG 3LPUA 4YNQA 4YHHK 2G8VA 3JYTA 4BRFA 2F96A 4FJJA 1QSYA 5AQYA 3G25A 2QK9A 1NGGA 1ZBIA 4BRLA 1XUPO 4CGIA 4R79A 2P5OA 3ID8A 3DI6A 3LDLA 1RT3A 4FWOA 3THWB 3VOVA 1NGCA 3TTFA 3MCAB 4NB4A 2RHKA 1YUWA 4DTXA 1RBVA 4DFKA 3SK3A 3CJAA 4B3SK 3KWGA 5HRRA 5A2QO 3DXKB 4B9MA 3A5LC 3LP0A 3UE5A 3CFRA 1TV6A 5D3GA 3OS0A 4O55A 2X6NA 3E9OA 4B1XB 2D5RA 5AZJB 1SL0A 2YJEA 4E1MA 3CJCA 3O1BA 1HPZA 3BY5A 4HVJA 3ZSXA 5EXWA 2KFZA 2HBMA 3LANA 3VF6A 3O3GA 5SWMA 4XIUA 4M7YA 5HRNA 1C0UA 1YI2N 4DV3K 3LZIA 1RNHA 4CIGA 4DHYA 4C1NI 3UKUA 1GOCA 4EFHA 1VQ5N 5AZIB 2F4VK 4IG3A 2QI2A 4C8MA 1N34K 1QQMA 3HBTA 1U47A 1QZ5A 4KHWA 4ELUA 1WUAA 2E2OA 3M5RA 1TKTA 4O8UA 2FF3B 4FJGA 2R7YA 3HYFA 3VTIA 3LP1A 2B6AA 4LH4A 4BR4A 4CJSA 4N5SA 5C0YA 4E7LA 1X9JA 2JWKA 4ILHA 3FR0A 3MXIA 4DSLA 1KQSM 4DR6K 3AVIA 4B9UA 3QINA 4AHRA 3LDQA 2BH1A 4X62K 4BRIA 2J4RA 5CYQA 3FZLA 3GBTA 4EHTA 5J2NA 4DF4A 2W6KA 3D45A 4WE1A 4XEIA 3HVRA 1JXEA 4F4KA 3O4NA 2EHGA 3P83D 4YOVA 2GEMA 2Q0UA 2V51B 4CBUA 4IXCA 4U67L 2OTJN 4FZZA 4IJAA 1BI4A 3VQ9A 3AO4A 1NWKA 1CXUA 3B8AX 5AQRA 3SNNA 4DQQA 1FXXA 2P9PB 2G8FA 1B9DA 4CGFA 4JN4A 4EHUA 2CH6A 3KVGA 4CFCA 2OA8A 2ZM6K 2A3ZA 3RR7A 4CGJA 2P51A 1H1VA 2OANA 4PKGA 4YOWA 5J2MA 3NH1A 2ZJRL 4JI5K 1NU0A 5BRDA 3KIOA 3QETA 5BPNA 4EZ9A 2P9IB 4AH9A 3WXJA 3P1GA 1TAQA 5MLCQ 5F0XA 4CJVA 1WBDA 5E84A 1FKOA 4FPAA 4MO5A 2UYTA 1LOTB 5C15A 4A2BA 1E4GT 3QESA 1Z26A 2P9SB 1U2VB 2OPPA 1NKBA 1IKYA 4BRDA 2H3GX 1LWFA 3MEDA 5GIPA 3RMAA 4HUGA 3HK2A 3DMJA 3T19A 1TVRA 3OVNA 2CGJA 2QWOA 4Q5VA 3ZT4A 2PAVA 1GOBA 4RW8A 4M3UA 3IG1A 3ZETB 5C12A 2W42A 2E8AA 4FJHA 1XQSC 1K8KA 1TK8A 1E4FT 1T7PA 3K5LA 3S9HA 5FLXO 4IFYA 4Z4GA 2E20A 1LAWA 1IO2A 1JLEA 4KV8A 2NUBA 3K9JA 1C1CA 2V52B 5KQDA 4RWTA 3NF8A 2QWMA 4CJRA 4M3TA 3HVTA 3R6MA 1NGIA 1VQKN 4OPJA 3QEIA 5IWAK 1IBLK 4FCYA 3MN5A 3L2WA 4M42A 4YDUC 1KAXA 4DR7K 4BVPA 1A5VA 1KLNA 1YHQN 2O8CB 3LDSA 2YHWA 3WQTA 1HNZK 2HHIA 2IGIA 2NRVA 3AVNA 3LAMA 4FWPA 3EY1A 3VQDA 3ZT2A 4KH6A 1Q86O 3KLIA 3SBTA 3CC4N 2NRWA 3A5MC 4CZLA 1W7AA 1XC3A 3LZJA 4OKEA 4BG9A 3EEQA 1IJJA 2ZD1A 3ZSQA 3VEVA 3G10A 2NRZA 3B6OA 1NGBA 2G8UA 4QS9A 2A1RA 4K8XA 3SZ2A 3T1YK 1XC9A 3KKSA 4JKHA 3KLGA 3RR8A 1YAGA 5TKYA 2YNGA 5H1SQ 3ZEUA 1R0AA 1QSSA 4NYFA 1HLUA 4BG8A 4K42A 4E3SA 4GKJK 2HVHA 4KI4A 4CJ5A 1DTQA 3K9KA 4NXNK 5HROA 2DPNA 5BREA 4BR9A 4IFEA 3V1RA 2YV0X 4ID5A 2Q3SA 2X78A 4I6MA 1HX1A 4J2EA 4BVOA 4O0IA 3JAMO 3LL3A 1KLMA 1VSLA 5CHIA 1K8KB 4KO0A 2XY5A 1J9AA 5I3UA 4JNEA 1YT3A 2IDOA 3ENOA 4BC2A 3NE6A 3DLLL 4H5RA 3V9SA 1BU6O 2KTQA 2EWSA 5E26A 1VHXA 3TPQA 3HTVA 5KRTA 1KD1O 2OZMA 5J1EA 1IKXA 4KB0A 3SQ2A 2RN2A 3U8XA 3M6GA 1WAFA 1LW2A 3T69A 3OYJA 4DQIA 3DXMB 3TARA 4K41A 4Z4EA 4PQUA 2VWBA 1VQ7N 1DT9A 4PHTX 1U48A 4E1JA 4FWMA 2A41A 4H0VB 4BC3A 4G1QA 4CJUA 4E7HA 4BWMA 1TGOA 3QMLA 3AA4A 2B5JA 1IG9A 1S5JA 3CERA 3VQ4A 2HNYA 4JI6K 4X66K 4DSIA 4CZIA 2CGLA 4LSLA 2ZGZA 4QS7A 5LJWA 3SAFA 3VESA 3C0BA 2HHUA 3B6PA 3AGKA 4GVEA 1NK7A 3L4QA 1I39A 4FWLA 3PY8A 3VGMA 3T1AA 2Q97A 5CY4A 3CCUN 1QQOA 5J2PA 1IBMK 2YHAA 3SPZA 4B1ZA 3WNFA 3V9XA 3S3OA 3K5OA 1Y64A 3VQQA 3HM9A 1NGHA 3NVKA 5AQQA 1T03A 4M3RA 4IJNA 1XNQK 4H4MA 4YFUA 1NK9A 2IOCA 1HR0K 4DFJA 4FZYA 1NJYA 2A40A 1VSEA 4ISFA 2DFFA 2W00A 3FZHA 1G15A 3OTOK 2C1GA 4DLEA 3DJCA 3V9UA 3OW2M 1S1WA 4O4GA 1FKPA 3CCJN 3K57A 1HYZA 4CEQA 1WSFA 3CETA 4HUFA 3U6FA 1ZBSA 3ULDA 4DKWA 3L8BA 3VMFB 2D0BA 3OYDA 2QXLA 4FM0A 3CCMN 3VEOA 3NH2A 5HLFA 4JV5K 3AVMA 4BRNA 3H3OB 1S6QA 2Z1GA 4FOEA 3DYAA 4L3QA 3QNNA 4NO7A 3CCLN 4AM7A 2F9TA 3MEEA 4CCHA 3AVLA 4CFDA 4O8KA 1ZBHA 1WAJA 4QAGA 3AGRA 2QM1A 3AVHA 3HL8A 4H8KA 4W5TA 5HRPA 1FW6A 2ASPA 1BL3A 4DSFA 4LF4K 4OJRA 1U4BA 4FJ8A 2RF2A 2FSNA 1XMQK 3MMVA 1K73O 1NK4A 4PKHA 1L3UA 1JLFA 1UA0A 4Y1DA 2XY6A 4DUZK 1BQMA 3KK7A 2P5GA 4K25A 3I56N 2OYQA 4CIEA 3OS1A 1VSJA 1GLJO 4FVMA 4DG1A 4DTOA 4JS5A 3UKRA 4CVNE 4OGCA 4J2AA 3AO1A 3PIPL 1BGXT 4RW4A 1HJRA 5M1QA 2QWLA 5JENA 1NM1A 4KHQA 3CIPA 1RDWX 2NRRA 5C2FA 2HF3A 4LSNA 3PX0A 1HYSA 1KXPA 1QQCA 2D4WA 2QWQA 3U9DA 4JHDB 2CGKA 3G6EN 5KPZA 3O6WA 2VWKA 2LSNA 4DTJA 4M3WA 3OS2A 3QB0A 4KAZA 3L3VA 1VQLN 2P9NA 2E2PA 4HWIA 1D5AA 1QVFM 1QHTA 1WN7A 1BISA 4AHSA 4FJKA 2FF6A 3NGYA 2PYJA 3DM2A 3CXCM 4OPKA 4KHPK 3VQAA 1ATNA 3DLKA 3MX5A 4CEAA 3NGZA 4DFPA 3CCRN 4IDKA 1RT5A 4OKKA 4DSKA 3UIQA 2FBVA 3OYIA 3WUHA 3AVGA 1GLFO 1WSJA 3SUOA 3H45C 4H5TA 2WONA 1TYQB 4DU1A 4CJKA 2O8DA 3SUNA 4JLHA 1NGFA 1BDGA 2NRTA 4IWVA 5I42A 3MWTA 3AV9A 4BRCA 1BCOA 1W9HA 1RDDA 4JK9A 3P39A 4JYAK 2OTLN 1KCFA 4JRPA 4DSJA 1KAYA 2ZF5O 4K43A 1RCHA 4BRQA 4M63C 3JS6A 3TTCA 3DRSA 4H0XB 3VEXA 2OPQA 1VQ8N 5ADXH 1OH7A 1MWMA 1NG9A 4FK4A 4F3OA 4MLEA 1S1VA 4CEFA 2FSKA 4CF0A 1VSDA 3ZSOA 4FWRA 4B9LA 3A5NC 3HXMA 4V19S 2O4IA 4DTPA 2VWJA 3ISNC 4JI7K 4FWKA 2D0CA 2O8BA 4WYBA 4FLUA 2VG6A 3E9LA 4B1VA 1Q81O 4CHNA 4TSXA 1WBBA 2YNHA 4LF5K 3DWLA 4JI3K 3TANA 3QO9A 4CERA 4WFNL 2QEXN 4C8OA 4MQ3A 3WNEA 2E4LA 3C6AA 2FBYA 4CECA 2P9NB 4L8RB 1VQ6N 3CCSN 3OBYA 4O44A 1KVAA 4NLBA 4KKOA 4GVMA 1X9WA 2WBNA 4JKBA 4CF1A 3EO3A 4BE1A 1N33K 3VF4A 3WEEA 4W5QA 3MK6A 2PYLA 2DFEA 3C7NB 4CFAA 3FE1A 3M8RA 2F8SA 3MXJA 3QICA 1D9FA 2HBJA 4KH5A 4JI1K 3QIOA 3VQCA 3ZLJA 3OYKA 2O8DB 1Q9YA 1SV5A 3HOTA 4XH1A 3PX6A 3MCPA 2JLEA 3MDQA 4PWDA 3CCVN 2QWPA 1L5UA 3KTQA 5AQHA 5F2RA 3VA0A 4CHPA 3LM9A 1QE1A 2G8KA 3J8AA 1D4XA 3BZKA 1EETA 4DV5K 3WNGA 4OPAA 3EZ5A 5LL6Z 5BR8K 4JD2A 1ASUA 2YKNA 3QERA 1NBWA 3QBXA 3OYGA 3PO4A 5B8HA 4H4OA 3CYGA 4B9QA 1XHZA 4W5RA 4H0PA 2YNFA 4CZJA 1EO1A 1MWKA 4CJTA 2Q36A 4DQSA 3SCXA 1BIZA 2BANA 3A8YA 3ITHA 1HKCA 4PL7A 1LWEA 4HHTA 3V4IA 1EQYA 3TABA 2QKBA 3H46O 4FVUA 1RDAA 5AQJA 2I7NA 4J2BA 4FZXC 3ALYA 4K8ZA 1LAVA 1VQON 3BDPA 3SBGA 1TL1A 4DV2K 3K5MA 3WXLA 1RTHA 1VSFA 1IBKK 4CZHA 4IOXA 1OVYA 1YXQA 5CZ2A 5EY4A 4E7IA 3CPWM 3HRGA 3CMEN 3THYA 2OPSA 4IKFA 4GNIA 3UKUB 1CXQA 2NZTA 3L4IA 3S3NA 4C8LA 2VCPA 1CZ9A 4W5OA 1NJWA 3VEZA 3WXMB 3RWUA 1A5XA 3D2FA 3TR8A 3AA2A 3SMPA 2ATQA 2W6LA 5AFUA 3L2RA 1J6ZA 1WSGA 3AO2A 2WTUA 5SZTA 1S9GA 4RCHA 4BR0A 3CQ8A 1CZAN 4JI0K 1WB9A 1BA1A 4DCHA 3VQEA 1VRTA 1XHXA 3K5NA 3V9WA 1MA9B 3H1VX 3AO5A 1REVA 2DFHA 4FJ7A 1QS4A 4ID1A 1HQEA 1TUUA 4KHSA 4C8KA 3G0ZA 2G8WA 5C24A 1O13A 1HPMA 1RTJA 2AA4A 2I7PA 3CPEA 3BGRA 3I55N 3ZSVA 5GAEP 4N56A 3SLCA 4YY3K 4MO4A 4M7XA 3BF1A 4OGEA 5AQUA 1OKJA 4I9LA 1RT2A 3OYNA 4CEBA 2HW3A 3ZSYA 2HBKA 1UOCA 2WOMA 1U49A 2UUBK 1S1XA 3CI5A 3SYZA 2W40A 4BRMA 3LDPA 2O8EA 2VG7A 4DMNA 3KHYA 2GV9A 4B9VA 4H0YB 4YOUA 3V1OA 3CF5L 1BI4B 1HUXA 3WT0A 5AQXA 5AQZA 4E0DA 4IOAL 2RE2A 1J54A 3RVCA 4OVLA 3VGLA 4BROA 4Z4FA 3RMBA 1BHLA 4RTFD 1MU2A 1WSHA 4IO8A 1SUQA 3RRHA 4PKIA 1EP4A 4N41A 2P9LA 4BDYA 2BGGA 2QWNA 1EKEA 4FJ5A 3EKSA 4CHOA 1I94K 4YOYA 2HHQA 4JKEA 3THYB 5KGWA 4RW6A 4BREA 4DS5A 1OH8A 3ZT3A 1ESVA 2D0AA 5M1PA 3SI6A 3D2FB 1W2BM 2KKZA 1EWQA 1BG3A 3VEWA 4E7JA 3AVFA 3CG7A 4I7FA 1NGDA 2FC0A 2GWJA 3E01A 1EWRA 3KKRA 3AO3A 3ZT0A 4A57A 3V1QA 3OYFA 4LFAK 5AQLA 1R59O 4FLWA 3G71N 3SPYA 2IVOA 2F7TA 3NVMA 1W0HA 4OPHA 4NXMK 5KI6A 4JEPA 4R5PA 3DRPA 3TAPA 3K58A 5M1OA 1DTTA 3VEYA 3PV8A 4Q0BA 3CM5A 4GW6A 4DR2K 1QTMA 1HNXK 3HP9A 1BO5O 2OCEA 3KLHA 4DSEA 4FL9A 4ILJA 3DOKA 2QXFA 4B08A 4OLAA 1T05A 4CJFA 3J7AP 4PY5A 1FK9A 1OVQA 5LY3A 5GIOA 3EE8A 2YHXA 1NKEA 2Y1JA 5AJ3K 1VQNN 3CJ7A 2BE2A 4WQ4C 3T3FA 2IIRA 1YJNN 2YHYA 3HPGA 2GUIA 5HP1A 5AQTA 1RT6A 3R3LA 1S6PA 1S1UA 2E2NA 1KTQA 4FLXA 1EXQA 1LV5A 5AQKA 3VQ8A 4BDZA 3JXUA 1VSIA 4EP5A 1D8YA 3C6UA 3OA9A 1NJIO 2NNWA 3FZMA 3L2UA 4KHYA 4J8FA 4DV0K
chains in the Genus database with same CATH topology
3E9OA 4B1XB 1DGKN 3O4WA 5AZJB 5JVHL 2YJEA 1GLBG 1QQNA 3CJCA 3F9MA 4CD3A 3O1BA 4JD2B 1GLJO 5AQGA 2VGNA 5FPMA 1S72N 3UKRA 5EXWA 2HBMA 3FZKA 3VF6A 3PIPL 4MDBA 3VERA 4M7YA 4JK8A 3O1WA 4XH4A 2A5XA 1S22A 2QWLA 5M1QA 3L6QA 1YI2N 1NM1A 3CIPA 5AFUH 1RDWX 2NRRA 4DHYA 5C2FA 2HF3A 4C1NI 1U6ZA 3UKUA 1VQ5N 4EFHA 4FO0A 2Q1NA 4CZKA 5AZIB 1HJOA 1KXPA 1SAZA 2D4WA 2QWQA 3EKUA 4JHDB 3U9DA 3CJ9A 2QI2A 5EOYA 2CGKA 3FGUA 1QQMA 3WXIA 1RDUA 3HBTA 3CJ1A 2ITMA 1QZ5A 5GAGP 1WUAA 2Q0RA 2E2OA 3BUZB 5HL7L 3G6EN 5KPZA 3O6WA 3M5RA 4O8UA 2YCHA 2FF3B 5AQPA 3CQXA 4CI6A 1VQPN 1HKGA 3QB0A 1T44A 4H0OA 3ZEUB 4CJ7A 1Q7YO 4JKGB 2FSJA 3VTIA 3U9ZA 1VQLN 4FPBA 2P9NA 4BR4A 2HOEA 1NGAA 2E2PA 4HWIA 4MDAA 4Z94A 1QVFM 3VF2A 5C0YA 1YITN 4A59A 1X9JA 4WQ5A 3C65A 4WFAL 3CC7N 2JWKA 2YX6A 4ILHA 4WFBL 3U4LA 4BC5A 5LJVA 3FR0A 2FF6A 5EX5A 3AY9A 5FPEA 1KQSM 1WOQA 3OHRA 3CXCM 2GUPA 4BRHA 5M1NA 3QFPA 4I6MB 3TU5A 1X3MA 2VYPA 3LDQA 1ATNA 1GLLO 3DXMA 3MX5A 2BH1A 3P31A 3O80A 4BGBA 3CCRN 2ASMA 4BRIA 2J4RA 3FZLA 3GBTA 4EHTA 4XEIA 3E66A 3WUHA 4CBXA 4BR2A 3ULEA 1GLFO 4YOVA 2GEMA 2Q0UA 4JK7A 3G4SN 2V51B 3H45C 4H5TA 4CBUA 1T6CA 1TYQB 2GELA 2P9UA 4IOCL 4IXCA 4U67L 2HSTA 5AQSA 3TTDA 3QBWA 2OTJN 3N4PA 3ENHA 1NGFA 1BDGA 4IJAA 2NRTA 4IWVA 3J7ZO 3GL1A 3MWTA 5M1KA 3H6EA 1NWKA 4BRCA 2ASOA 4JK9A 4FWSA 3BF3A 1YVNA 4H03B 1ZC6A 3P39A 1QVGM 4BC4A 3B8AX 5AQRA 2OTLN 3IDHA 5BRFA 4IDHA 1KAYA 2Q31A 2ZF5O 2P9PB 5BPMA 3SAHA 4OO1J 4BE7B 4K43A 4BR7A 1Z6RA 4BRQA 3F5TA 4ILGB 3JS6A 4IZ9A 4M63C 3EE9A 4JN4A 3TTCA 4BGAA 5M1FA 3M3ZA 4EHUA 4H0XB 2CH6A 4FWNA 3VEXA 5F1XA 3KVGA 1VQ8N 5ADXH 1X3NA 2A3ZA 2GX9A 1MWMA 4MLEA 1T6DA 1H1VA 4EAHD 2OANA 3E1YA 3ZX2A 3P4IA 2FSKA 1GLAG 4PKGA 4YOWA 2ZJRL 3GG4A 4FWRA 4CZMA 5JLHA 5BRDA 3A5NC 3I8BA 5BPNA 2P9IB 2WC9A 4XH5A 3WXJA 3LDOA 2KLAA 5BPLA 1KAZA 4FWKA 3VENA 3VTHA 5MLCQ 5F0XA 1JCEA 4WYBA 1W97L 3E9LA 3R9PA 4B1VA 1Q81O 3FLCO 4GV9A 5E84A 3DWLA 4O5FA 4FPAA 4MO5A 4Y0WA 2UYTA 1LOTB 5C15A 4A2BA 2BUPA 4PL8A 5JMVA 4WFNL 1E4GT 2QEXN 2P9SB 3CD6N 1U2VB 5KPTA 4BRDA 1MDUB 3HZ6A 1ATRA 2H3GX 1TUYA 2AP1A 4CZGA 4F9OA 3C6AA 2WUSA 3MN7A 5GIPA 2P9NB 1N8RO 3GE1A 1VQ6N 5BN9A 3CCSN 2QA4N 3OBYA 3MN6A 2P9LB 2CGJA 4NLBA 1ILYA 2WBNA 3EN9A 4JKBA 2QWOA 2HMPA 3EO3A 3S41A 1KC8O 3VF4A 3CC2N 2PAVA 5FPNA 3WEEA 4A62A 3MK6A 3SMSA 3TSQA 1T3VA 3C7NB 1NMDA 3ATVA 3D2EA 3FE1A 3ZETB 5C12A 3NMUA 2E8AA 1BOTO 1QHAA 4BRGA 3GOIA 3HOSA 3QICA 1XQSC 1K8KA 1E4FT 5TKWA 5GADP 2HBJA 4KH5A 4B1WB 4FOIA 5FPDA 4JKDA 2YJFA 3O9QA 2GTDA 2P9UB 4WQ4A 4BRKA 2E20A 4H5WA 3AAQA 5CR4A 3Q7BA 5JLFA 4WF9L 3ZYYX 3LDNA 3HOTA 4XH1A 3VGKA 1VQMN 3A0IX 3MCPA 5JICA 3K9JA 3MDQA 2V52B 3VETA 5KQDA 3UB5A 5KPRA 4RWTA 2QWPA 3CCVN 2QWMA 4YOXA 5AQHA 5F2RA 3LM9A 4ISEA 3R6MA 1YJ9N 4GY2B 3J8AA 1NGIA 3DXKA 4H5NA 4LC9B 1VQKN 3MN5A 1D4XA 1VQ4N 4CBWA 2D0PA 4OPAA 1YJWN 4YDUC 1KAXA 5JVGL 4BVPA 1RFQA 4JD2A 1V4SA 5AQFA 1NBWA 3EL2A 3IUCA 3TSUA 1YHQN 3QBXA 3I33A 4BRAA 5C2DA 1ZXOA 2A42A 2FLOA 2YHWA 3M1FA 4BRPA 3WQTA 5B8HA 2NRVA 3CMAN 4FWPA 1Q82O 4KH6A 4B9QA 3EZWA 1Q86O 3SBTA 3AARA 4H0PA 4FWQA 1NLVA 1SS6A 2NRWA 3A5MC 4CZJA 4CZLA 5ADXA 5DM6L 1XC3A 2GWKA 3MN9A 4B1YB 1MWKA 4BG9A 4DQ8A 1EO1A 3CHWA 2Q36A 1IJJA 2YI1A 3A5OC 5BR9A 3CCQN 3A8YA 1K8AO 1BWFO 4YORA 3VEVA 2NRZA 4C1NK 1HKBA 3HM8A 3ATUA 5AZIA 1HKCA 1NGBA 4PL7A 2VGMA 1Q18A 3D7EO 1EQYA 4JHDA 4QS9A 4JKFA 3P38A 3H46O 4JKAA 4FVUA 1YF5L 5AQJA 4CZFA 5GAHP 2I7NA 3QFUA 4JKHA 4QS8A 4XJXA 1YAGA 1IG8A 1GLEG 3F2KA 3IKMA 3DAWA 4H0TB 3BEXA 5TKYA 1VQON 5H1SQ 3Q7CA 3SBGA 3ZEUA 3O9SA 3UKRB 4BG8A 1HLUA 3TSPA 4K42A 3CC4N 5AQNA 2D1KA 3WXLA 4CZHA 3HSCA 4BY9C 3D6RA 4IOXA 1OVYA 1YXQA 3K9KA 5EY4A 3CPWM 3HRGA 4YOTA 3O8MA 2FXUA 1S3XA 2DPNA 5BREA 4BR9A 3CMEN 1JCGA 4CD1A 4IFEA 4GNIA 3UKUB 4DB3A 1K9MO 4YDUA 2NZTA 1HX1A 2P9KA 3L4IA 3R1XA 2VCPA 4I6MA 5CE3A 3D2EB 4BVOA 3CQYA 3LL3A 4CZEA 3VEZA 3WXMB 3D2FA 5C10A 5CHIA 1K8KB 3FZFA 3SMPA 5AFUA 4MLHA 1J6ZA 2HBLA 4C23A 3QDKA 4JNEA 4RCHA 4BR0A 3ENOA 2E2QA 4BC2A 1CZAN 3DLLL 4H5RA 3SJHA 1BA1A 1BU6O 3RSEA 2WFBA 1TYQA 4DCHA 4FSVA 3ENBA 4JAXA 2EWSA 2PFUA 1MA9B 3H1VX 5E26A 3L0QA 3WQUA 4GV6A 3TPQA 1TUUA 2ZWHA 3HTVA 3MX2A 4B1UB 1NGEA 3O9TA 1KD1O 4AM6A 1Z05A 5EVZA 2A6AA 1O13A 1HPMA 3U8XA 2AA4A 2I7PA 4AF1A 3M6GA 3CPEA 1DKGD 4BR5A 3I55N 3T69A 2P9PA 3DXMB 5GAEP 4K41A 2VWBA 3SLCA 5KQ8A 1VQ7N 4MO4A 1DT9A 2CH5A 4PHTX 4M7XA 3BF1A 1BA0A 5AQUA 3CCEN 1OKJA 3W0LA 3AAPA 4E1JA 4FWMA 2A41A 4H0VB 1G99A 4BC3A 2D0OA 1M90O 2KHOA 2HBKA 3ULEB 3QMLA 3CI5A 2W40A 3CERA 3PLAA 3H1QA 1V4TA 4BRMA 4IEEA 3LDPA 2P9IA 5ELZA 1SZ2A 3KHYA 4A61A 4CZIA 2CGLA 4H0YB 4YOUA 3KWIA 5AQMA 1SQKA 4HTLA 3CF5L 1HUXA 2ZGZA 4UY8O 4QS7A 3WT0A 5LJWA 5AQXA 3SAFA 3VESA 5AQZA 3BP8A 3E9PA 3N4QA 4IOAL 1JJ2M 2RE2A 4A5BA 1P90A 3IFRA 5AQOA 3RVCA 3VGLA 4BROA 1M1KO 3C0BA 3CJBA 1C0GA 4A2AA 3AGKA 1ATSA 2NRXA 2P9SA 4ISGA 1C0FA 1U2VA 3MWPA 1NGJA 3L4QA 4GVEA 3T7ZA 3HI0A 3KZBA 5AZJA 3FFKB 4FWLA 3VGMA 2QTDA 1VQ9N 4RTFD 2Q97A 2W41A 3CCUN 2IVNA 4IO8A 1BUPA 1QQOA 2V7ZA 5AR0A 2F9WA 3W3DA 4PKIA 4B1ZA 2P9LA 2E1ZA 2E88A 2QWNA 2NRHA 1Y64A 3EKSA 2IVPA 1P8ZA 1NGHA 4YOYA 3NVKA 2E1YA 5AQQA 5BN8A 4BECA 4IJNA 3R8EA 4JKEA 4KH4A 3O9UA 3LM2A 4BREA 4G9ZA 2QWRA 5AQIA 3SAGA 5I9EB 2V7YA 3H3NO 2P9KB 2Q2RA 2QW9A 3ID6A 2ZJPL 1ESVA 4U7BA 1QZ6A 3C7NA 2A40A 4ISFA 5M1PA 2W00A 3D2FB 3ZETA 2KKZA 1W2BM 1GLDG 3FZHA 4IO9L 1BG3A 3VEWA 2C1GA 2JWLA 1NGDA 3DJCA 3O9RA 3PIOL 3C6HA 2GWJA 2HF4A 2ZJQL 5HOOA 3OW2M 3ZX3A 4A57A 3O5BA 1VAZA 5AQLA 3OBWA 3RSEB 3CCJN 3CETA 1R59O 2BTFA 3IMXA 4JKGA 4KBOA 4A5AA 2IVOA 3G71N 3WXKA 1ZBSA 2F7TA 3NVMA 1RGIA 4OPHA 4JEPA 1JCFA 4IEIA 4DKWA 3VMFB 5M1OA 3VEYA 4BQZA 2QXLA 4EIAA 4BEBA 2NLXA 3CCMN 3VEOA 4BQLA 5GINA 3ZX0A 5AQWA 4BRNA 1GLCG 3WEEB 1BO5O 3H3OB 4BRFA 1DEJA 3GDQA 4FOEA 5AQYA 3G25A 4H5VA 1NGGA 4L3QA 4FL9A 4NO7A 4ILJA 1LCUA 1XUPO 2F9TA 4AM7A 4BRLA 3CCLN 4R79A 3ID8A 4O8KA 4GV3A 3LDLA 3AGRA 2QM1A 4FWOA 3VPZA 5LY3A 5GIOA 3EE8A 2YHXA 1VQNN 2ASPA 3CJ7A 3VOVA 1NGCA 3TTFA 4WQ4C 2IIRA 1YJNN 2YHYA 3MCAB 5AQTA 2PBDA 2FSNA 4NB4A 3R3LA 4NLCA 2RHKA 1YUWA 5DM7L 4WCEL 2E2NA 3MMVA 5AQVA 1YIJN 5BRHA 1K73O 4PKHA 5AQKA 3SK3A 3CJAA 4WQ5C 3JXUA 3KWGA 3OA9A 1NJIO 3DXKB 2NNWA 3A5LC 3FZMA 3UE5A 3KK7A 4JKCA 2C1IA 3O08A 2ZGYA 4K25A 4J8FA 3I56N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B1X B;  1DGK N;  3O4W A;  5AZJ B;  2YJE A;  1GLB G;  1QQN A;  3CJC A;  3F9M A;  4CD3 A;  3O1B A;  4JD2 B;  1GLJ O;  5AQG A;  5FPM A;  3UKR A;  5EXW A;  3FZK A;  3VF6 A;  3VER A;  4M7Y A;  3O1W A;  4XH4 A;  2A5X A;  1S22 A;  2QWL A;  3L6Q A;  1NM1 A;  3CIP A;  5AFU H;  1RDW X;  4DHY A;  2HF3 A;  1U6Z A;  3UKU A;  4EFH A;  4FO0 A;  2Q1N A;  4CZK A;  5AZI B;  1HJO A;  1KXP A;  1SAZ A;  2D4W A;  2QWQ A;  3EKU A;  4JHD B;  3U9D A;  3CJ9 A;  5EOY A;  2CGK A;  3FGU A;  1QQM A;  3WXI A;  3HBT A;  3CJ1 A;  2ITM A;  1QZ5 A;  1WUA A;  2Q0R A;  2E2O A;  3BUZ B;  5KPZ A;  3O6W A;  2YCH A;  2FF3 B;  5AQP A;  3CQX A;  4CI6 A;  1HKG A;  3QB0 A;  1T44 A;  4H0O A;  3ZEU B;  4CJ7 A;  2FSJ A;  3U9Z A;  4FPB A;  2P9N A;  4BR4 A;  2HOE A;  1NGA A;  2E2P A;  4HWI A;  4Z94 A;  3VF2 A;  1X9J A;  4WQ5 A;  3U4L A;  4BC5 A;  5LJV A;  3FR0 A;  2FF6 A;  5EX5 A;  3AY9 A;  5FPE A;  1WOQ A;  3OHR A;  2GUP A;  4BRH A;  3QFP A;  4I6M B;  3TU5 A;  1X3M A;  2VYP A;  3LDQ A;  1ATN A;  1GLL O;  3DXM A;  4BGB A;  3O80 A;  2ASM A;  4BRI A;  2J4R A;  3FZL A;  3GBT A;  4EHT A;  4XEI A;  3WUH A;  4CBX A;  4BR2 A;  3ULE A;  1GLF O;  2GEM A;  2Q0U A;  2V51 B;  3H45 C;  4H5T A;  4CBU A;  1T6C A;  1TYQ B;  2GEL A;  2P9U A;  4IXC A;  5AQS A;  3QBW A;  3ENH A;  1NGF A;  1BDG A;  4IJA A;  4IWV A;  3GL1 A;  3H6E A;  1NWK A;  4BRC A;  2ASO A;  4FWS A;  3BF3 A;  1YVN A;  4H03 B;  1ZC6 A;  4BC4 A;  3B8A X;  5AQR A;  3IDH A;  5BRF A;  1KAY A;  2Q31 A;  2ZF5 O;  2P9P B;  5BPM A;  4K43 A;  4BR7 A;  1Z6R A;  4BRQ A;  4M63 C;  3JS6 A;  4IZ9 A;  4BGA A;  4JN4 A;  3M3Z A;  4EHU A;  4H0X B;  2CH6 A;  4FWN A;  3VEX A;  5F1X A;  3KVG A;  5ADX H;  1X3N A;  2A3Z A;  1MWM A;  4MLE A;  1T6D A;  1H1V A;  4EAH D;  2OAN A;  3ZX2 A;  3P4I A;  2FSK A;  1GLA G;  4PKG A;  3GG4 A;  4FWR A;  4CZM A;  5JLH A;  5BRD A;  3A5N C;  3I8B A;  5BPN A;  2P9I B;  4XH5 A;  3WXJ A;  3LDO A;  5BPL A;  1KAZ A;  4FWK A;  3VEN A;  5F0X A;  1JCE A;  4WYB A;  3R9P A;  4B1V A;  3FLC O;  5E84 A;  3DWL A;  4O5F A;  4FPA A;  4MO5 A;  4Y0W A;  2UYT A;  1LOT B;  4A2B A;  2BUP A;  4PL8 A;  5JMV A;  1E4G T;  2P9S B;  1U2V B;  5KPT A;  4BRD A;  1MDU B;  3HZ6 A;  1ATR A;  2H3G X;  1TUY A;  2AP1 A;  4CZG A;  4F9O A;  2WUS A;  3MN7 A;  2P9N B;  3GE1 A;  5BN9 A;  3MN6 A;  2P9L B;  2CGJ A;  3EN9 A;  2QWO A;  2HMP A;  3EO3 A;  3S41 A;  3VF4 A;  2PAV A;  5FPN A;  3WEE A;  4A62 A;  3MK6 A;  3SMS A;  3C7N B;  1NMD A;  3ATV A;  3D2E A;  3FE1 A;  3ZET B;  2E8A A;  1BOT O;  1QHA A;  4BRG A;  3GOI A;  3QIC A;  1XQS C;  1K8K A;  1E4F T;  4B1W B;  4FOI A;  5FPD A;  2YJF A;  2GTD A;  2P9U B;  4WQ4 A;  4BRK A;  2E20 A;  4H5W A;  3AAQ A;  5JLF A;  3LDN A;  4XH1 A;  3VGK A;  3A0I X;  3MCP A;  5JIC A;  3VET A;  3MDQ A;  2V52 B;  5KQD A;  5KPR A;  3UB5 A;  4RWT A;  2QWP A;  2QWM A;  5AQH A;  5F2R A;  3LM9 A;  4ISE A;  3R6M A;  4GY2 B;  3J8A A;  1NGI A;  3DXK A;  4H5N A;  4LC9 B;  3MN5 A;  1D4X A;  4CBW A;  2D0P A;  4YDU C;  1KAX A;  4BVP A;  1RFQ A;  4JD2 A;  1V4S A;  5AQF A;  1NBW A;  3EL2 A;  3IUC A;  3QBX A;  3I33 A;  4BRA A;  1ZXO A;  2A42 A;  2FLO A;  2YHW A;  3M1F A;  4BRP A;  3WQT A;  5B8H A;  4FWP A;  4B9Q A;  3EZW A;  3AAR A;  4H0P A;  4FWQ A;  1NLV A;  3A5M C;  5ADX A;  4CZJ A;  4CZL A;  1XC3 A;  2GWK A;  3MN9 A;  4B1Y B;  1MWK A;  4BG9 A;  4DQ8 A;  3CHW A;  2Q36 A;  1IJJ A;  2YI1 A;  3A5O C;  5BR9 A;  3A8Y A;  1BWF O;  3VEV A;  1HKB A;  3HM8 A;  3ATU A;  5AZI A;  1HKC A;  1NGB A;  4PL7 A;  1Q18 A;  3D7E O;  1EQY A;  4JHD A;  4QS9 A;  3H46 O;  5AQJ A;  4CZF A;  2I7N A;  3QFU A;  4QS8 A;  1YAG A;  1IG8 A;  1GLE G;  5TKY A;  3DAW A;  4H0T B;  3BEX A;  3ZEU A;  3UKR B;  4BG8 A;  1HLU A;  4K42 A;  5AQN A;  2D1K A;  3WXL A;  4CZH A;  3HSC A;  1YXQ A;  5EY4 A;  3O8M A;  2FXU A;  1S3X A;  2DPN A;  5BRE A;  4BR9 A;  1JCG A;  4CD1 A;  4GNI A;  3UKU B;  4DB3 A;  4YDU A;  2NZT A;  1HX1 A;  2P9K A;  3L4I A;  4I6M A;  2VCP A;  5CE3 A;  3D2E B;  4BVO A;  3CQY A;  3LL3 A;  4CZE A;  3VEZ A;  3D2F A;  1K8K B;  3FZF A;  3SMP A;  5AFU A;  4MLH A;  1J6Z A;  4C23 A;  3QDK A;  4JNE A;  4RCH A;  4BR0 A;  3ENO A;  2E2Q A;  4BC2 A;  1CZA N;  4H5R A;  3SJH A;  1BA1 A;  1BU6 O;  3RSE A;  4DCH A;  1TYQ A;  4FSV A;  4JAX A;  2EWS A;  1MA9 B;  3H1V X;  5E26 A;  3L0Q A;  3WQU A;  3TPQ A;  1TUU A;  2ZWH A;  3HTV A;  4B1U B;  1NGE A;  4AM6 A;  1Z05 A;  5EVZ A;  2A6A A;  1HPM A;  3U8X A;  2AA4 A;  2I7P A;  3M6G A;  4BR5 A;  1DKG D;  2P9P A;  3DXM B;  4K41 A;  2VWB A;  3SLC A;  5KQ8 A;  4MO4 A;  2CH5 A;  4M7X A;  3BF1 A;  1BA0 A;  5AQU A;  1OKJ A;  3W0L A;  3AAP A;  4E1J A;  4FWM A;  2A41 A;  4H0V B;  1G99 A;  4BC3 A;  2D0O A;  2KHO A;  3ULE B;  3QML A;  3CI5 A;  2W40 A;  3CER A;  3H1Q A;  1V4T A;  4BRM A;  3LDP A;  2P9I A;  5ELZ A;  1SZ2 A;  3KHY A;  4A61 A;  4CZI A;  2CGL A;  4H0Y B;  5AQM A;  1SQK A;  4HTL A;  1HUX A;  2ZGZ A;  4QS7 A;  3WT0 A;  5LJW A;  5AQX A;  3VES A;  5AQZ A;  3BP8 A;  5AQO A;  3IFR A;  3VGL A;  4BRO A;  3C0B A;  3CJB A;  1C0G A;  4A2A A;  1ATS A;  2P9S A;  4ISG A;  1C0F A;  1U2V A;  1NGJ A;  5AZJ A;  3HI0 A;  3KZB A;  3FFK B;  4FWL A;  3VGM A;  4RTF D;  2Q97 A;  2W41 A;  2IVN A;  4IO8 A;  1BUP A;  1QQO A;  2V7Z A;  5AR0 A;  2F9W A;  3W3D A;  4PKI A;  4B1Z A;  2P9L A;  2E1Z A;  2E88 A;  2QWN A;  2NRH A;  1Y64 A;  3EKS A;  2IVP A;  1P8Z A;  1NGH A;  2E1Y A;  5AQQ A;  5BN8 A;  4IJN A;  3R8E A;  3LM2 A;  4BRE A;  2QWR A;  5AQI A;  5I9E B;  2V7Y A;  3H3N O;  2P9K B;  2Q2R A;  2QW9 A;  1ESV A;  1QZ6 A;  3C7N A;  2A40 A;  4ISF A;  3D2F B;  3ZET A;  1GLD G;  3FZH A;  1BG3 A;  3VEW A;  1NGD A;  3DJC A;  2GWJ A;  2HF4 A;  3ZX3 A;  3O5B A;  5AQL A;  3RSE B;  3CET A;  1R59 O;  2BTF A;  3IMX A;  4KBO A;  2IVO A;  3WXK A;  1ZBS A;  1RGI A;  1JCF A;  3VEY A;  4BQZ A;  2QXL A;  4EIA A;  2NLX A;  3VEO A;  4BQL A;  3ZX0 A;  5AQW A;  4BRN A;  1GLC G;  3WEE B;  1BO5 O;  3H3O B;  4BRF A;  1DEJ A;  3GDQ A;  4FOE A;  5AQY A;  3G25 A;  4H5V A;  1NGG A;  4L3Q A;  4FL9 A;  4NO7 A;  4BRL A;  1LCU A;  1XUP O;  2F9T A;  4AM7 A;  3ID8 A;  4O8K A;  3LDL A;  2QM1 A;  4FWO A;  3VPZ A;  5LY3 A;  2YHX A;  2ASP A;  3CJ7 A;  3VOV A;  1NGC A;  4WQ4 C;  2IIR A;  2YHY A;  5AQT A;  2PBD A;  2FSN A;  4NB4 A;  1YUW A;  2E2N A;  3MMV A;  5AQV A;  5BRH A;  4PKH A;  5AQK A;  3SK3 A;  3CJA A;  4WQ5 C;  3JXU A;  3DXK B;  3A5L C;  3FZM A;  3UE5 A;  3O08 A;  2ZGY A;  4K25 A;  4J8F A; 
#chains in the Genus database with same CATH topology
 3KD5 E;  3O4W A;  5JVH L;  1GLB G;  4DTR A;  1QQN A;  2VGN A;  5FPM A;  1S72 N;  1E3M A;  1IH7 A;  4HUE A;  3O1W A;  4XH4 A;  1L3S A;  2A5X A;  3L6Q A;  4MFB A;  3SQ1 A;  2PY5 A;  5AFU H;  3MEC A;  4B3R K;  1U6Z A;  4FO0 A;  3P5J A;  4CZK A;  1HJO A;  5E41 A;  3EKU A;  2HNZ A;  3CJ9 A;  1TK0 A;  3WXI A;  1ZBU A;  3CJ1 A;  5GAG P;  3BUZ B;  3ZSZ A;  2Y1I A;  5JS2 A;  4FW1 A;  2YCH A;  2GBZ A;  5AQP A;  4CJP A;  4IBN A;  4CI6 A;  1KVB A;  1LWC A;  4CE9 A;  3ZEU B;  2X6S A;  1T44 A;  4H0O A;  1VQP N;  2FSJ A;  3LAL A;  2B4J A;  4DV7 K;  1HYV A;  4Z94 A;  1NK0 A;  3VF2 A;  3RMC A;  1YIT N;  4A59 A;  4WQ5 A;  3C65 A;  4WFA L;  3CC7 N;  3DLH A;  2YX6 A;  4BC5 A;  5LJV A;  5EX5 A;  3KJV A;  3LWM A;  1WOQ A;  3OHR A;  4FJL A;  4QOZ B;  2GUP A;  3I0S A;  4BRH A;  3QFP A;  4I6M B;  1X3M A;  2VYP A;  3VN5 A;  4CJQ A;  4BGB A;  3OYH A;  2HMI A;  4DV6 K;  2HHS A;  5EU7 A;  2XHB A;  5FDL A;  3V81 A;  1RBS A;  4CBX A;  4BR2 A;  3ULE A;  4JK7 A;  3G4S N;  1T6C A;  4BAC A;  2P9U A;  4DV4 K;  4IOC L;  2HST A;  2Z1I A;  3C6T A;  3C94 A;  3ENH A;  2XO7 A;  4W5N A;  3J7Z O;  3GL1 A;  5M1K A;  4FWS A;  3BF3 A;  1YVN A;  4H03 B;  2PZS A;  4CK2 A;  1QVG M;  1HQU A;  4BC4 A;  2FBT A;  3LPT A;  3IDH A;  2IAJ A;  4IDH A;  5BPM A;  3LWL A;  3F5T A;  4ILG B;  4IZ9 A;  3AVB A;  4BGA A;  3EE9 A;  5M1F A;  2IC3 A;  3OJU A;  3M3Z A;  4FWN A;  2DY4 A;  4ZTJ A;  1X3N A;  2GX9 A;  2E5L K;  3QLH A;  4EAH D;  3ZX2 A;  2ZE2 A;  3NF6 A;  1GLA G;  3MAQ A;  3GG4 A;  4CZM A;  4LY7 A;  4B9S A;  4LFC K;  2WC9 A;  4XH5 A;  2KLA A;  1VSK A;  2HVI A;  4LF7 K;  3R9P A;  1W97 L;  4RG8 A;  3HO1 A;  4I2P A;  3FLC O;  3AVK A;  4CK3 A;  4GV9 A;  2P1J A;  3ZT1 A;  4K0K K;  4DV1 K;  4PL8 A;  3THX A;  4RW7 A;  4FLT A;  3NCI A;  5KPT A;  2XY7 A;  3HZ6 A;  1ATR A;  2YHB A;  1TUY A;  4CZG A;  4HCB A;  3MN7 A;  4DTN A;  4AHT A;  3MN6 A;  1B9F A;  1ILY A;  2HMP A;  4DTM A;  3S41 A;  3IRX A;  4N76 A;  3F73 A;  3OYM A;  3QIP A;  4CJW A;  4CW7 B;  2UXC K;  4HCC A;  4X64 K;  4FJX A;  1WSE A;  4M45 A;  3J7Y P;  3CFP A;  2UXB K;  3NMU A;  1C0M A;  4BRG A;  1QHA A;  4AHC A;  3GOI A;  3HOS A;  1A5W A;  4CHY A;  1NNE A;  5TKW A;  1Q8I A;  3THW A;  3TAE A;  5T7B A;  4KI6 A;  2F8T A;  4B1W B;  5FPD A;  1HNW K;  3CM6 A;  4FM2 A;  1N6Q A;  3O9Q A;  4EP4 A;  2GTD A;  2P9U B;  4WQ4 A;  3HJF A;  3TAG A;  4CGH A;  5CR4 A;  3Q7B A;  5JLF A;  1VQM N;  3VGK A;  5JIC A;  5HRS A;  3UB5 A;  3O4Q A;  4YOX A;  4CHZ A;  4FK2 A;  1TKD A;  4N47 A;  2VQE K;  4ISE A;  1YJ9 N;  3DXK A;  4H5N A;  4LC9 B;  3NGI A;  4FK0 A;  4AHV A;  4CBW A;  1VK0 A;  2HHT A;  3F9K A;  2D0P A;  4C8N A;  3CFO A;  3TAM A;  1YJW N;  5JVG L;  4CJL A;  1JL1 A;  4CED A;  1RFQ A;  1JL2 A;  5HBM A;  4BDP A;  4FJ9 A;  3IUC A;  1CLQ A;  5C2D A;  3I33 A;  2A42 A;  2FLO A;  4DR5 K;  1JLA A;  2Z1J A;  4CFB A;  3CMA N;  1ITG A;  1Q82 O;  3AAR A;  1NLV A;  2GWK A;  4B1Y B;  4FW2 A;  3M8S A;  3CHW A;  4DS4 A;  3A5O C;  5BR9 A;  4I9Q A;  3CCQ N;  1K8A O;  1XWL A;  4F2S A;  4C1N K;  1HKB A;  3QNO A;  5AZI A;  1N32 K;  3M8P A;  2VGM A;  3D7E O;  4JKF A;  3IAY A;  1YF5 L;  1UAX A;  5GAH P;  3QFU A;  1TK5 A;  1QSL A;  4QS8 A;  4XJX A;  1IG8 A;  1GLE G;  3IKM A;  4JS4 A;  3DAW A;  4H0T B;  3BEX A;  3Q7C A;  4E19 A;  1JXB A;  4NYN A;  3UKR B;  3TSP A;  3ASM A;  4OLB A;  2ETJ A;  3D6R A;  3NF9 A;  1U45 A;  3O8M A;  5LMU K;  1YTU A;  4DB3 A;  2ITG A;  4RW9 A;  1K9M O;  1NK6 A;  3R1X A;  3BZC A;  1C1B A;  3CQY A;  1ASV A;  3H08 A;  5C10 A;  3L2V A;  1L3V A;  3FZF A;  3HPH A;  3ZSR A;  1RIL A;  2HBL A;  4C23 A;  1N5Y A;  1F21 A;  3QDK A;  1NJZ A;  3NH0 A;  3SJJ A;  1VSH A;  3SJH A;  1XI1 A;  4DQP A;  2WFB A;  4FSV A;  3ENB A;  4JAX A;  3J81 O;  1C0T A;  2PFU A;  1KVC A;  1RT1 A;  3DOL A;  3LAK A;  3WQU A;  3MX2 A;  2ZWH A;  3L2Q A;  3O9T A;  1KFS A;  1WLJ A;  2KFN A;  4J2D A;  5EVZ A;  3KLE A;  1HMV A;  4AF1 A;  4CES A;  4BR5 A;  2P9P A;  1SKR A;  3M8Q A;  3I8D A;  2CH5 A;  1RDB A;  3W0L A;  3AAP A;  3T1H K;  2D0O A;  1M90 O;  3U3Y A;  3D0P A;  2XY8 A;  1TAU A;  2JGU A;  1YTA A;  1UA1 A;  1V4T A;  4IEE A;  4M41 A;  2P9I A;  1SZ2 A;  3NAE A;  5KTQ A;  3KWI A;  4HTL A;  1T8E A;  4UY8 O;  3K0S A;  2YKM A;  3BP8 A;  3E9P A;  1HNV A;  1P90 A;  5AQO A;  1U04 A;  4DR4 K;  4B3O A;  3CJB A;  3A2F A;  3AA5 X;  1C0G A;  4LD0 A;  1O1W A;  1ATS A;  2P9S A;  2I5J A;  1X1P A;  1U2V A;  4B9N A;  4KTQ A;  1YVU A;  2QTD A;  2W41 A;  2IVN A;  2V7Z A;  1J53 A;  1J5O A;  5DMR A;  2E88 A;  2RKI A;  4JI4 K;  4F3T A;  1HNI A;  4B9T A;  4ELV A;  2KZZ A;  2E1Y A;  4E1N A;  4KH4 A;  3LM2 A;  1IKW A;  2QWR A;  2O8B B;  2FBX A;  2V7Y A;  3H3N O;  2Q2R A;  3DLB A;  2ZJP L;  1QZ6 A;  3QEW A;  3ZET A;  1NMN A;  1RT4 A;  2VG5 A;  1XMO K;  2JWL A;  3O9R A;  3C6H A;  5HOO A;  3ZX3 A;  4ELT A;  4O5B A;  3O5B A;  3OBW A;  4JKG A;  1IKV A;  4CJ4 A;  4KPY A;  1JCF A;  1NOZ A;  4EIA A;  4B3M K;  4BEB A;  2NLX A;  2HHX A;  5GIN A;  5AQW A;  3TWH A;  2OZS A;  3WEE B;  1DEJ A;  3GDQ A;  1NK8 A;  4H5V A;  1JLC A;  3V6D A;  4FJN A;  1LCU A;  4GV3 A;  2O8C A;  5IT9 O;  4OKJ A;  3QEV A;  3VPZ A;  4I2Q A;  4CGD A;  4CIF A;  2PBD A;  5FRM A;  4NLC A;  5DM7 L;  4WCE L;  5AQV A;  1YIJ N;  5BRH A;  3VQB A;  4WQ5 C;  4Z4H A;  4LF6 K;  1NKC A;  3NF7 A;  1NOY A;  2XRI A;  3J80 O;  4DU4 A;  1XNR K;  4JKC A;  2C1I A;  2RPI A;  3O08 A;  2ZGY A;  3OYE A;  1LW0 A;  3TI0 A;  1SKS A;  3MEG A;  1C6V A;  1DGK N;  2HB5 A;  4CD3 A;  3F9M A;  4JD2 B;  3RTV A;  4KTW A;  5AQG A;  3OYL A;  1Y97 A;  3KK2 A;  3FZK A;  3OYB A;  4FLY A;  3QEX A;  4MDB A;  3VER A;  4JK8 A;  3S5T A;  1S22 A;  4KHU A;  3L3U A;  2O8F A;  1RBU A;  3OYC A;  4UQG A;  2Q1N A;  4FJM A;  1CZB A;  1SAZ A;  5EOY A;  3FGU A;  4ZHR A;  1RDU A;  2ITM A;  1X9S A;  2Q0R A;  5HL7 L;  2G8H A;  3SUQ A;  1J5E K;  2KQ2 A;  3CQX A;  1HKG A;  4CJ7 A;  1Q7Y O;  4DR1 K;  4JKG B;  3U9Z A;  4FPB A;  4M3Z A;  2HOE A;  1NGA A;  2E6M A;  4MDA A;  3LP2 A;  1N36 K;  3I0R A;  4GMJ B;  4WFB L;  3U4L A;  3AY9 A;  5FPE A;  4KRE A;  4HTU A;  1S9E A;  2Z1H A;  5M1N A;  3TU5 A;  1GLL O;  3DXM A;  3P31 A;  1BQN A;  3O80 A;  2ASM A;  4NCG A;  4PA1 A;  1JLB A;  3TAF A;  2YNI A;  4PUO A;  3E66 A;  3DLR A;  4NCB A;  4KB1 A;  4CGG A;  3EYZ A;  1L3T A;  1C1A A;  2OPR A;  2GEL A;  1RTD A;  3IS9 A;  5AQS A;  3TTD A;  5KGX A;  3QBW A;  4FYD A;  3N4P A;  1IV0 A;  3K59 A;  4JI8 K;  3H6E A;  2ASO A;  1ZC6 A;  4CF8 A;  1TKZ A;  4KTZ A;  4QCL A;  1RBR A;  5BRF A;  2Q31 A;  4LF8 K;  4OO1 J;  3SAH A;  4BE7 B;  4BR7 A;  4KRF A;  1Z6R A;  5F1X A;  1T6D A;  3E1Y A;  3P4I A;  5CZ1 A;  4LFB K;  5JLH A;  3I8B A;  4CF2 A;  4CHQ A;  2O8E B;  3AA3 A;  5KRS A;  5LMN K;  3LDO A;  5BPL A;  1KAZ A;  3VEN A;  3VTH A;  2O8F B;  2DTU A;  5FRO A;  2UUC K;  1JCE A;  2KW4 A;  3THV A;  4KHN A;  4FM1 A;  2HHH K;  4O5F A;  3VA3 A;  3AVC A;  4Y0W A;  1B92 A;  3U3G A;  1SL1 A;  2BUP A;  5JMV A;  2VQF K;  1DLO A;  3CD6 N;  2EX3 A;  1JLG A;  2X74 A;  1MDU B;  3KD1 E;  2AP1 A;  4F9O A;  3VQ5 A;  2WUS A;  3HT3 A;  1N8R O;  3GE1 A;  1ZBL A;  5BN9 A;  3SUP A;  1WSI A;  2QA4 N;  1KFD A;  3VQ7 A;  2P9L B;  2ZQB A;  5C42 A;  3EN9 A;  4E89 A;  4IG0 A;  3PSI A;  4O0J A;  1RT7 A;  3PX4 A;  4BWJ A;  3DLE A;  4BE0 A;  1KC8 O;  2KZM A;  3CC2 N;  5FPN A;  3PO5 A;  1NK5 A;  4A62 A;  3RMD A;  3SMS A;  4B3T K;  3TSQ A;  1T3V A;  4DTU A;  1NMD A;  1K6Y A;  3ATV A;  4LH5 A;  3D2E A;  1BOT O;  2IS3 A;  5GAD P;  3OYA A;  3NBP A;  4FOI A;  4JKD A;  4X65 K;  2YJF A;  3MXM A;  1SL2 A;  4BRK A;  4H5W A;  3AAQ A;  4WF9 L;  3ZYY X;  3LDN A;  3S3M A;  3A0I X;  3VET A;  5KPR A;  5C25 A;  2UU9 K;  4ICL A;  4CJE A;  2HND A;  4GKK K;  4GY2 B;  1Z25 A;  1VQ4 N;  3LP3 A;  3HPO A;  4DTS A;  1V4S A;  1HRH A;  5AQF A;  2UUA K;  3OY9 A;  1X9M A;  3EL2 A;  3TSU A;  1RDC A;  4BRA A;  1ZXO A;  3M1F A;  4BRP A;  3WNH A;  4OX9 K;  3NFA A;  3EZW A;  1TKX A;  4FWQ A;  1SS6 A;  5ADX A;  5DM6 L;  3NHG A;  3MN9 A;  4DQ8 A;  1UWB A;  2YI1 A;  4FXD A;  3O3F A;  3TAQ A;  1BIU A;  1BWF O;  4YOR A;  3HM8 A;  3HP6 A;  3ATU A;  1JKH A;  5K14 A;  1ZYQ A;  4B8A B;  1Q18 A;  3AVA A;  4JHD A;  4Z0U A;  4FLZ A;  4JI2 K;  3P38 A;  4JKA A;  3SV3 A;  5J2Q A;  4M3X A;  3ZCM A;  4CZF A;  4AIL C;  3F2K A;  4FLV A;  4CEO A;  4NCA A;  3O9S A;  4Z4I A;  1JLQ A;  4F2R A;  3SQ0 A;  3V9Z A;  5AQN A;  2D1K A;  2A1S A;  3HSC A;  4BY9 C;  3KK3 A;  4AHU A;  2UXD K;  4YOT A;  1TL3 A;  2FXU A;  1S3X A;  5FRN A;  1JCG A;  4CD1 A;  4YDU A;  5CE3 A;  2P9K A;  3D2E B;  4CZE A;  3OJS A;  1BCM A;  4MLH A;  4DWI A;  4DFM A;  2E2Q A;  4Y1C A;  1ZBF A;  1RTI A;  3RSE A;  1TYQ A;  4CK1 A;  3KLF A;  2QKK A;  3VQ6 A;  3L0Q A;  3O3H A;  4GV6 A;  4JRQ A;  3DRR A;  4B1U B;  1I3A A;  1NGE A;  4Z4C A;  4AM6 A;  1Z05 A;  2A6A A;  2E6L A;  4LF9 K;  3NDK A;  1DKG D;  4DUY K;  5KQ8 A;  1GOA A;  2HHV A;  3CCE N;  1BA0 A;  1G99 A;  1OH5 A;  2KHO A;  3ULE B;  2BDP A;  2HHW A;  5CYM A;  1S1T A;  3PLA A;  1SKW A;  3H1Q A;  5ELZ A;  3AVJ A;  4A61 A;  1FJG K;  5AQM A;  1SQK A;  4KFB A;  3ZSW A;  3JSM A;  3N4Q A;  3VQP A;  1JJ2 M;  4A5B A;  3IFR A;  1M1K O;  2AJQ A;  5DK5 A;  4A2A A;  1Q9X A;  1ASW A;  4DLG A;  4AQY K;  2NRX A;  4ISG A;  1C0F A;  1D9D A;  3FFI A;  3MWP A;  3T7Z A;  1NGJ A;  5AZJ A;  3HI0 A;  3KZB A;  3FFK B;  3PSF A;  1KRP A;  1WNS A;  1VQ9 N;  3HST B;  4CJ3 A;  4B8C A;  1OH6 A;  1BUP A;  4DQR A;  1RBT A;  5AR0 A;  2F9W A;  3W3D A;  4CEE A;  2E1Z A;  3KK1 A;  2NRH A;  1VRU A;  4F8R A;  2IVP A;  1P8Z A;  1VSM A;  5BN8 A;  4BEC A;  3R8E A;  3O9U A;  4FJI A;  4G9Z A;  3SQ4 A;  5AQI A;  3DLG A;  3SAG A;  5I9E B;  4CF9 A;  2P9K B;  4EZ6 A;  2QW9 A;  3ID6 A;  4IFV A;  1EX4 A;  3C95 A;  4U7B A;  3C7N A;  4M3Y A;  4E7K A;  1GLD G;  4IO9 L;  3RRG A;  3K2P A;  3PIO L;  3THX B;  4E72 A;  2HF4 A;  2ZJQ L;  3CYM A;  2O4G A;  1VAZ A;  3RSE B;  4DR3 K;  2BTF A;  3IMX A;  3PUF A;  4KBO A;  4A5A A;  2G8I A;  3WXK A;  3SV4 A;  1RGI A;  4IEI A;  4ZTF A;  3QEP A;  1KSP A;  4BQZ A;  1NJX A;  4BE2 A;  4DU3 A;  4BQL A;  4DF8 A;  3ZX0 A;  4CEZ A;  5JS1 A;  1GLC G;  3LPU A;  4YNQ A;  4YHH K;  2G8V A;  3JYT A;  4BRF A;  2F96 A;  4FJJ A;  1QSY A;  5AQY A;  3G25 A;  2QK9 A;  1NGG A;  1ZBI A;  4BRL A;  1XUP O;  4CGI A;  4R79 A;  2P5O A;  3ID8 A;  3DI6 A;  3LDL A;  1RT3 A;  4FWO A;  3THW B;  3VOV A;  1NGC A;  3TTF A;  3MCA B;  4NB4 A;  2RHK A;  1YUW A;  4DTX A;  1RBV A;  4DFK A;  3SK3 A;  3CJA A;  4B3S K;  3KWG A;  5HRR A;  5A2Q O;  3DXK B;  4B9M A;  3A5L C;  3LP0 A;  3UE5 A;  3CFR A;  1TV6 A;  5D3G A;  3OS0 A;  4O55 A;  2X6N A;  3E9O A;  4B1X B;  2D5R A;  5AZJ B;  1SL0 A;  2YJE A;  4E1M A;  3CJC A;  3O1B A;  1HPZ A;  3BY5 A;  4HVJ A;  3ZSX A;  5EXW A;  2KFZ A;  2HBM A;  3LAN A;  3VF6 A;  3O3G A;  5SWM A;  4XIU A;  4M7Y A;  5HRN A;  1C0U A;  1YI2 N;  4DV3 K;  3LZI A;  1RNH A;  4CIG A;  4DHY A;  4C1N I;  3UKU A;  1GOC A;  4EFH A;  1VQ5 N;  5AZI B;  2F4V K;  4IG3 A;  2QI2 A;  4C8M A;  1N34 K;  1QQM A;  3HBT A;  1U47 A;  1QZ5 A;  4KHW A;  4ELU A;  1WUA A;  2E2O A;  3M5R A;  1TKT A;  4O8U A;  2FF3 B;  4FJG A;  2R7Y A;  3HYF A;  3VTI A;  3LP1 A;  2B6A A;  4LH4 A;  4BR4 A;  4CJS A;  4N5S A;  5C0Y A;  4E7L A;  1X9J A;  2JWK A;  4ILH A;  3FR0 A;  3MXI A;  4DSL A;  1KQS M;  4DR6 K;  3AVI A;  4B9U A;  3QIN A;  4AHR A;  3LDQ A;  2BH1 A;  4X62 K;  4BRI A;  2J4R A;  5CYQ A;  3FZL A;  3GBT A;  4EHT A;  5J2N A;  4DF4 A;  2W6K A;  3D45 A;  4WE1 A;  4XEI A;  3HVR A;  1JXE A;  4F4K A;  3O4N A;  2EHG A;  3P83 D;  4YOV A;  2GEM A;  2Q0U A;  2V51 B;  4CBU A;  4IXC A;  4U67 L;  2OTJ N;  4FZZ A;  4IJA A;  1BI4 A;  3VQ9 A;  3AO4 A;  1NWK A;  1CXU A;  3B8A X;  5AQR A;  3SNN A;  4DQQ A;  1FXX A;  2P9P B;  2G8F A;  1B9D A;  4CGF A;  4JN4 A;  4EHU A;  2CH6 A;  3KVG A;  4CFC A;  2OA8 A;  2ZM6 K;  2A3Z A;  3RR7 A;  4CGJ A;  2P51 A;  1H1V A;  2OAN A;  4PKG A;  4YOW A;  5J2M A;  3NH1 A;  2ZJR L;  4JI5 K;  1NU0 A;  5BRD A;  3KIO A;  3QET A;  5BPN A;  4EZ9 A;  2P9I B;  4AH9 A;  3WXJ A;  3P1G A;  1TAQ A;  5MLC Q;  5F0X A;  4CJV A;  1WBD A;  5E84 A;  1FKO A;  4FPA A;  4MO5 A;  2UYT A;  1LOT B;  5C15 A;  4A2B A;  1E4G T;  3QES A;  1Z26 A;  2P9S B;  1U2V B;  2OPP A;  1NKB A;  1IKY A;  4BRD A;  2H3G X;  1LWF A;  3MED A;  5GIP A;  3RMA A;  4HUG A;  3HK2 A;  3DMJ A;  3T19 A;  1TVR A;  3OVN A;  2CGJ A;  2QWO A;  4Q5V A;  3ZT4 A;  2PAV A;  1GOB A;  4RW8 A;  4M3U A;  3IG1 A;  3ZET B;  5C12 A;  2W42 A;  2E8A A;  4FJH A;  1XQS C;  1K8K A;  1TK8 A;  1E4F T;  1T7P A;  3K5L A;  3S9H A;  5FLX O;  4IFY A;  4Z4G A;  2E20 A;  1LAW A;  1IO2 A;  1JLE A;  4KV8 A;  2NUB A;  3K9J A;  1C1C A;  2V52 B;  5KQD A;  4RWT A;  3NF8 A;  2QWM A;  4CJR A;  4M3T A;  3HVT A;  3R6M A;  1NGI A;  1VQK N;  4OPJ A;  3QEI A;  5IWA K;  1IBL K;  4FCY A;  3MN5 A;  3L2W A;  4M42 A;  4YDU C;  1KAX A;  4DR7 K;  4BVP A;  1A5V A;  1KLN A;  1YHQ N;  2O8C B;  3LDS A;  2YHW A;  3WQT A;  1HNZ K;  2HHI A;  2IGI A;  2NRV A;  3AVN A;  3LAM A;  4FWP A;  3EY1 A;  3VQD A;  3ZT2 A;  4KH6 A;  1Q86 O;  3KLI A;  3SBT A;  3CC4 N;  2NRW A;  3A5M C;  4CZL A;  1W7A A;  1XC3 A;  3LZJ A;  4OKE A;  4BG9 A;  3EEQ A;  1IJJ A;  2ZD1 A;  3ZSQ A;  3VEV A;  3G10 A;  2NRZ A;  3B6O A;  1NGB A;  2G8U A;  4QS9 A;  2A1R A;  4K8X A;  3SZ2 A;  3T1Y K;  1XC9 A;  3KKS A;  4JKH A;  3KLG A;  3RR8 A;  1YAG A;  5TKY A;  2YNG A;  5H1S Q;  3ZEU A;  1R0A A;  1QSS A;  4NYF A;  1HLU A;  4BG8 A;  4K42 A;  4E3S A;  4GKJ K;  2HVH A;  4KI4 A;  4CJ5 A;  1DTQ A;  3K9K A;  4NXN K;  5HRO A;  2DPN A;  5BRE A;  4BR9 A;  4IFE A;  3V1R A;  2YV0 X;  4ID5 A;  2Q3S A;  2X78 A;  4I6M A;  1HX1 A;  4J2E A;  4BVO A;  4O0I A;  3JAM O;  3LL3 A;  1KLM A;  1VSL A;  5CHI A;  1K8K B;  4KO0 A;  2XY5 A;  1J9A A;  5I3U A;  4JNE A;  1YT3 A;  2IDO A;  3ENO A;  4BC2 A;  3NE6 A;  3DLL L;  4H5R A;  3V9S A;  1BU6 O;  2KTQ A;  2EWS A;  5E26 A;  1VHX A;  3TPQ A;  3HTV A;  5KRT A;  1KD1 O;  2OZM A;  5J1E A;  1IKX A;  4KB0 A;  3SQ2 A;  2RN2 A;  3U8X A;  3M6G A;  1WAF A;  1LW2 A;  3T69 A;  3OYJ A;  4DQI A;  3DXM B;  3TAR A;  4K41 A;  4Z4E A;  4PQU A;  2VWB A;  1VQ7 N;  1DT9 A;  4PHT X;  1U48 A;  4E1J A;  4FWM A;  2A41 A;  4H0V B;  4BC3 A;  4G1Q A;  4CJU A;  4E7H A;  4BWM A;  1TGO A;  3QML A;  3AA4 A;  2B5J A;  1IG9 A;  1S5J A;  3CER A;  3VQ4 A;  2HNY A;  4JI6 K;  4X66 K;  4DSI A;  4CZI A;  2CGL A;  4LSL A;  2ZGZ A;  4QS7 A;  5LJW A;  3SAF A;  3VES A;  3C0B A;  2HHU A;  3B6P A;  3AGK A;  4GVE A;  1NK7 A;  3L4Q A;  1I39 A;  4FWL A;  3PY8 A;  3VGM A;  3T1A A;  2Q97 A;  5CY4 A;  3CCU N;  1QQO A;  5J2P A;  1IBM K;  2YHA A;  3SPZ A;  4B1Z A;  3WNF A;  3V9X A;  3S3O A;  3K5O A;  1Y64 A;  3VQQ A;  3HM9 A;  1NGH A;  3NVK A;  5AQQ A;  1T03 A;  4M3R A;  4IJN A;  1XNQ K;  4H4M A;  4YFU A;  1NK9 A;  2IOC A;  1HR0 K;  4DFJ A;  4FZY A;  1NJY A;  2A40 A;  1VSE A;  4ISF A;  2DFF A;  2W00 A;  3FZH A;  1G15 A;  3OTO K;  2C1G A;  4DLE A;  3DJC A;  3V9U A;  3OW2 M;  1S1W A;  4O4G A;  1FKP A;  3CCJ N;  3K57 A;  1HYZ A;  4CEQ A;  1WSF A;  3CET A;  4HUF A;  3U6F A;  1ZBS A;  3ULD A;  4DKW A;  3L8B A;  3VMF B;  2D0B A;  3OYD A;  2QXL A;  4FM0 A;  3CCM N;  3VEO A;  3NH2 A;  5HLF A;  4JV5 K;  3AVM A;  4BRN A;  3H3O B;  1S6Q A;  2Z1G A;  4FOE A;  3DYA A;  4L3Q A;  3QNN A;  4NO7 A;  3CCL N;  4AM7 A;  2F9T A;  3MEE A;  4CCH A;  3AVL A;  4CFD A;  4O8K A;  1ZBH A;  1WAJ A;  4QAG A;  3AGR A;  2QM1 A;  3AVH A;  3HL8 A;  4H8K A;  4W5T A;  5HRP A;  1FW6 A;  2ASP A;  1BL3 A;  4DSF A;  4LF4 K;  4OJR A;  1U4B A;  4FJ8 A;  2RF2 A;  2FSN A;  1XMQ K;  3MMV A;  1K73 O;  1NK4 A;  4PKH A;  1L3U A;  1JLF A;  1UA0 A;  4Y1D A;  2XY6 A;  4DUZ K;  1BQM A;  3KK7 A;  2P5G A;  4K25 A;  3I56 N;  2OYQ A;  4CIE A;  3OS1 A;  1VSJ A;  1GLJ O;  4FVM A;  4DG1 A;  4DTO A;  4JS5 A;  3UKR A;  4CVN E;  4OGC A;  4J2A A;  3AO1 A;  3PIP L;  1BGX T;  4RW4 A;  1HJR A;  5M1Q A;  2QWL A;  5JEN A;  1NM1 A;  4KHQ A;  3CIP A;  1RDW X;  2NRR A;  5C2F A;  2HF3 A;  4LSN A;  3PX0 A;  1HYS A;  1KXP A;  1QQC A;  2D4W A;  2QWQ A;  3U9D A;  4JHD B;  2CGK A;  3G6E N;  5KPZ A;  3O6W A;  2VWK A;  2LSN A;  4DTJ A;  4M3W A;  3OS2 A;  3QB0 A;  4KAZ A;  3L3V A;  1VQL N;  2P9N A;  2E2P A;  4HWI A;  1D5A A;  1QVF M;  1QHT A;  1WN7 A;  1BIS A;  4AHS A;  4FJK A;  2FF6 A;  3NGY A;  2PYJ A;  3DM2 A;  3CXC M;  4OPK A;  4KHP K;  3VQA A;  1ATN A;  3DLK A;  3MX5 A;  4CEA A;  3NGZ A;  4DFP A;  3CCR N;  4IDK A;  1RT5 A;  4OKK A;  4DSK A;  3UIQ A;  2FBV A;  3OYI A;  3WUH A;  3AVG A;  1GLF O;  1WSJ A;  3SUO A;  3H45 C;  4H5T A;  2WON A;  1TYQ B;  4DU1 A;  4CJK A;  2O8D A;  3SUN A;  4JLH A;  1NGF A;  1BDG A;  2NRT A;  4IWV A;  5I42 A;  3MWT A;  3AV9 A;  4BRC A;  1BCO A;  1W9H A;  1RDD A;  4JK9 A;  3P39 A;  4JYA K;  2OTL N;  1KCF A;  4JRP A;  4DSJ A;  1KAY A;  2ZF5 O;  4K43 A;  1RCH A;  4BRQ A;  4M63 C;  3JS6 A;  3TTC A;  3DRS A;  4H0X B;  3VEX A;  2OPQ A;  1VQ8 N;  5ADX H;  1OH7 A;  1MWM A;  1NG9 A;  4FK4 A;  4F3O A;  4MLE A;  1S1V A;  4CEF A;  2FSK A;  4CF0 A;  1VSD A;  3ZSO A;  4FWR A;  4B9L A;  3A5N C;  3HXM A;  4V19 S;  2O4I A;  4DTP A;  2VWJ A;  3ISN C;  4JI7 K;  4FWK A;  2D0C A;  2O8B A;  4WYB A;  4FLU A;  2VG6 A;  3E9L A;  4B1V A;  1Q81 O;  4CHN A;  4TSX A;  1WBB A;  2YNH A;  4LF5 K;  3DWL A;  4JI3 K;  3TAN A;  3QO9 A;  4CER A;  4WFN L;  2QEX N;  4C8O A;  4MQ3 A;  3WNE A;  2E4L A;  3C6A A;  2FBY A;  4CEC A;  2P9N B;  4L8R B;  1VQ6 N;  3CCS N;  3OBY A;  4O44 A;  1KVA A;  4NLB A;  4KKO A;  4GVM A;  1X9W A;  2WBN A;  4JKB A;  4CF1 A;  3EO3 A;  4BE1 A;  1N33 K;  3VF4 A;  3WEE A;  4W5Q A;  3MK6 A;  2PYL A;  2DFE A;  3C7N B;  4CFA A;  3FE1 A;  3M8R A;  2F8S A;  3MXJ A;  3QIC A;  1D9F A;  2HBJ A;  4KH5 A;  4JI1 K;  3QIO A;  3VQC A;  3ZLJ A;  3OYK A;  2O8D B;  1Q9Y A;  1SV5 A;  3HOT A;  4XH1 A;  3PX6 A;  3MCP A;  2JLE A;  3MDQ A;  4PWD A;  3CCV N;  2QWP A;  1L5U A;  3KTQ A;  5AQH A;  5F2R A;  3VA0 A;  4CHP A;  3LM9 A;  1QE1 A;  2G8K A;  3J8A A;  1D4X A;  3BZK A;  1EET A;  4DV5 K;  3WNG A;  4OPA A;  3EZ5 A;  5LL6 Z;  5BR8 K;  4JD2 A;  1ASU A;  2YKN A;  3QER A;  1NBW A;  3QBX A;  3OYG A;  3PO4 A;  5B8H A;  4H4O A;  3CYG A;  4B9Q A;  1XHZ A;  4W5R A;  4H0P A;  2YNF A;  4CZJ A;  1EO1 A;  1MWK A;  4CJT A;  2Q36 A;  4DQS A;  3SCX A;  1BIZ A;  2BAN A;  3A8Y A;  3ITH A;  1HKC A;  4PL7 A;  1LWE A;  4HHT A;  3V4I A;  1EQY A;  3TAB A;  2QKB A;  3H46 O;  4FVU A;  1RDA A;  5AQJ A;  2I7N A;  4J2B A;  4FZX C;  3ALY A;  4K8Z A;  1LAV A;  1VQO N;  3BDP A;  3SBG A;  1TL1 A;  4DV2 K;  3K5M A;  3WXL A;  1RTH A;  1VSF A;  1IBK K;  4CZH A;  4IOX A;  1OVY A;  1YXQ A;  5CZ2 A;  5EY4 A;  4E7I A;  3CPW M;  3HRG A;  3CME N;  3THY A;  2OPS A;  4IKF A;  4GNI A;  3UKU B;  1CXQ A;  2NZT A;  3L4I A;  3S3N A;  4C8L A;  2VCP A;  1CZ9 A;  4W5O A;  1NJW A;  3VEZ A;  3WXM B;  3RWU A;  1A5X A;  3D2F A;  3TR8 A;  3AA2 A;  3SMP A;  2ATQ A;  2W6L A;  5AFU A;  3L2R A;  1J6Z A;  1WSG A;  3AO2 A;  2WTU A;  5SZT A;  1S9G A;  4RCH A;  4BR0 A;  3CQ8 A;  1CZA N;  4JI0 K;  1WB9 A;  1BA1 A;  4DCH A;  3VQE A;  1VRT A;  1XHX A;  3K5N A;  3V9W A;  1MA9 B;  3H1V X;  3AO5 A;  1REV A;  2DFH A;  4FJ7 A;  1QS4 A;  4ID1 A;  1HQE A;  1TUU A;  4KHS A;  4C8K A;  3G0Z A;  2G8W A;  5C24 A;  1O13 A;  1HPM A;  1RTJ A;  2AA4 A;  2I7P A;  3CPE A;  3BGR A;  3I55 N;  3ZSV A;  5GAE P;  4N56 A;  3SLC A;  4YY3 K;  4MO4 A;  4M7X A;  3BF1 A;  4OGE A;  5AQU A;  1OKJ A;  4I9L A;  1RT2 A;  3OYN A;  4CEB A;  2HW3 A;  3ZSY A;  2HBK A;  1UOC A;  2WOM A;  1U49 A;  2UUB K;  1S1X A;  3CI5 A;  3SYZ A;  2W40 A;  4BRM A;  3LDP A;  2O8E A;  2VG7 A;  4DMN A;  3KHY A;  2GV9 A;  4B9V A;  4H0Y B;  4YOU A;  3V1O A;  3CF5 L;  1BI4 B;  1HUX A;  3WT0 A;  5AQX A;  5AQZ A;  4E0D A;  4IOA L;  2RE2 A;  1J54 A;  3RVC A;  4OVL A;  3VGL A;  4BRO A;  4Z4F A;  3RMB A;  1BHL A;  4RTF D;  1MU2 A;  1WSH A;  4IO8 A;  1SUQ A;  3RRH A;  4PKI A;  1EP4 A;  4N41 A;  2P9L A;  4BDY A;  2BGG A;  2QWN A;  1EKE A;  4FJ5 A;  3EKS A;  4CHO A;  1I94 K;  4YOY A;  2HHQ A;  4JKE A;  3THY B;  5KGW A;  4RW6 A;  4BRE A;  4DS5 A;  1OH8 A;  3ZT3 A;  1ESV A;  2D0A A;  5M1P A;  3SI6 A;  3D2F B;  1W2B M;  2KKZ A;  1EWQ A;  1BG3 A;  3VEW A;  4E7J A;  3AVF A;  3CG7 A;  4I7F A;  1NGD A;  2FC0 A;  2GWJ A;  3E01 A;  1EWR A;  3KKR A;  3AO3 A;  3ZT0 A;  4A57 A;  3V1Q A;  3OYF A;  4LFA K;  5AQL A;  1R59 O;  4FLW A;  3G71 N;  3SPY A;  2IVO A;  2F7T A;  3NVM A;  1W0H A;  4OPH A;  4NXM K;  5KI6 A;  4JEP A;  4R5P A;  3DRP A;  3TAP A;  3K58 A;  5M1O A;  1DTT A;  3VEY A;  3PV8 A;  4Q0B A;  3CM5 A;  4GW6 A;  4DR2 K;  1QTM A;  1HNX K;  3HP9 A;  1BO5 O;  2OCE A;  3KLH A;  4DSE A;  4FL9 A;  4ILJ A;  3DOK A;  2QXF A;  4B08 A;  4OLA A;  1T05 A;  4CJF A;  3J7A P;  4PY5 A;  1FK9 A;  1OVQ A;  5LY3 A;  5GIO A;  3EE8 A;  2YHX A;  1NKE A;  2Y1J A;  5AJ3 K;  1VQN N;  3CJ7 A;  2BE2 A;  4WQ4 C;  3T3F A;  2IIR A;  1YJN N;  2YHY A;  3HPG A;  2GUI A;  5HP1 A;  5AQT A;  1RT6 A;  3R3L A;  1S6P A;  1S1U A;  2E2N A;  1KTQ A;  4FLX A;  1EXQ A;  1LV5 A;  5AQK A;  3VQ8 A;  4BDZ A;  3JXU A;  1VSI A;  4EP5 A;  1D8Y A;  3C6U A;  3OA9 A;  1NJI O;  2NNW A;  3FZM A;  3L2U A;  4KHY A;  4J8F A;  4DV0 K; 
#chains in the Genus database with same CATH homology
 3E9O A;  4B1X B;  1DGK N;  3O4W A;  5AZJ B;  5JVH L;  2YJE A;  1GLB G;  1QQN A;  3CJC A;  3F9M A;  4CD3 A;  3O1B A;  4JD2 B;  1GLJ O;  5AQG A;  2VGN A;  5FPM A;  1S72 N;  3UKR A;  5EXW A;  2HBM A;  3FZK A;  3VF6 A;  3PIP L;  4MDB A;  3VER A;  4M7Y A;  4JK8 A;  3O1W A;  4XH4 A;  2A5X A;  1S22 A;  2QWL A;  5M1Q A;  3L6Q A;  1YI2 N;  1NM1 A;  3CIP A;  5AFU H;  1RDW X;  2NRR A;  4DHY A;  5C2F A;  2HF3 A;  4C1N I;  1U6Z A;  3UKU A;  1VQ5 N;  4EFH A;  4FO0 A;  2Q1N A;  4CZK A;  5AZI B;  1HJO A;  1KXP A;  1SAZ A;  2D4W A;  2QWQ A;  3EKU A;  4JHD B;  3U9D A;  3CJ9 A;  2QI2 A;  5EOY A;  2CGK A;  3FGU A;  1QQM A;  3WXI A;  1RDU A;  3HBT A;  3CJ1 A;  2ITM A;  1QZ5 A;  5GAG P;  1WUA A;  2Q0R A;  2E2O A;  3BUZ B;  5HL7 L;  3G6E N;  5KPZ A;  3O6W A;  3M5R A;  4O8U A;  2YCH A;  2FF3 B;  5AQP A;  3CQX A;  4CI6 A;  1VQP N;  1HKG A;  3QB0 A;  1T44 A;  4H0O A;  3ZEU B;  4CJ7 A;  1Q7Y O;  4JKG B;  2FSJ A;  3VTI A;  3U9Z A;  1VQL N;  4FPB A;  2P9N A;  4BR4 A;  2HOE A;  1NGA A;  2E2P A;  4HWI A;  4MDA A;  4Z94 A;  1QVF M;  3VF2 A;  5C0Y A;  1YIT N;  4A59 A;  1X9J A;  4WQ5 A;  3C65 A;  4WFA L;  3CC7 N;  2JWK A;  2YX6 A;  4ILH A;  4WFB L;  3U4L A;  4BC5 A;  5LJV A;  3FR0 A;  2FF6 A;  5EX5 A;  3AY9 A;  5FPE A;  1KQS M;  1WOQ A;  3OHR A;  3CXC M;  2GUP A;  4BRH A;  5M1N A;  3QFP A;  4I6M B;  3TU5 A;  1X3M A;  2VYP A;  3LDQ A;  1ATN A;  1GLL O;  3DXM A;  3MX5 A;  2BH1 A;  3P31 A;  3O80 A;  4BGB A;  3CCR N;  2ASM A;  4BRI A;  2J4R A;  3FZL A;  3GBT A;  4EHT A;  4XEI A;  3E66 A;  3WUH A;  4CBX A;  4BR2 A;  3ULE A;  1GLF O;  4YOV A;  2GEM A;  2Q0U A;  4JK7 A;  3G4S N;  2V51 B;  3H45 C;  4H5T A;  4CBU A;  1T6C A;  1TYQ B;  2GEL A;  2P9U A;  4IOC L;  4IXC A;  4U67 L;  2HST A;  5AQS A;  3TTD A;  3QBW A;  2OTJ N;  3N4P A;  3ENH A;  1NGF A;  1BDG A;  4IJA A;  2NRT A;  4IWV A;  3J7Z O;  3GL1 A;  3MWT A;  5M1K A;  3H6E A;  1NWK A;  4BRC A;  2ASO A;  4JK9 A;  4FWS A;  3BF3 A;  1YVN A;  4H03 B;  1ZC6 A;  3P39 A;  1QVG M;  4BC4 A;  3B8A X;  5AQR A;  2OTL N;  3IDH A;  5BRF A;  4IDH A;  1KAY A;  2Q31 A;  2ZF5 O;  2P9P B;  5BPM A;  3SAH A;  4OO1 J;  4BE7 B;  4K43 A;  4BR7 A;  1Z6R A;  4BRQ A;  3F5T A;  4ILG B;  3JS6 A;  4IZ9 A;  4M63 C;  3EE9 A;  4JN4 A;  3TTC A;  4BGA A;  5M1F A;  3M3Z A;  4EHU A;  4H0X B;  2CH6 A;  4FWN A;  3VEX A;  5F1X A;  3KVG A;  1VQ8 N;  5ADX H;  1X3N A;  2A3Z A;  2GX9 A;  1MWM A;  4MLE A;  1T6D A;  1H1V A;  4EAH D;  2OAN A;  3E1Y A;  3ZX2 A;  3P4I A;  2FSK A;  1GLA G;  4PKG A;  4YOW A;  2ZJR L;  3GG4 A;  4FWR A;  4CZM A;  5JLH A;  5BRD A;  3A5N C;  3I8B A;  5BPN A;  2P9I B;  2WC9 A;  4XH5 A;  3WXJ A;  3LDO A;  2KLA A;  5BPL A;  1KAZ A;  4FWK A;  3VEN A;  3VTH A;  5MLC Q;  5F0X A;  1JCE A;  4WYB A;  1W97 L;  3E9L A;  3R9P A;  4B1V A;  1Q81 O;  3FLC O;  4GV9 A;  5E84 A;  3DWL A;  4O5F A;  4FPA A;  4MO5 A;  4Y0W A;  2UYT A;  1LOT B;  5C15 A;  4A2B A;  2BUP A;  4PL8 A;  5JMV A;  4WFN L;  1E4G T;  2QEX N;  2P9S B;  3CD6 N;  1U2V B;  5KPT A;  4BRD A;  1MDU B;  3HZ6 A;  1ATR A;  2H3G X;  1TUY A;  2AP1 A;  4CZG A;  4F9O A;  3C6A A;  2WUS A;  3MN7 A;  5GIP A;  2P9N B;  1N8R O;  3GE1 A;  1VQ6 N;  5BN9 A;  3CCS N;  2QA4 N;  3OBY A;  3MN6 A;  2P9L B;  2CGJ A;  4NLB A;  1ILY A;  2WBN A;  3EN9 A;  4JKB A;  2QWO A;  2HMP A;  3EO3 A;  3S41 A;  1KC8 O;  3VF4 A;  3CC2 N;  2PAV A;  5FPN A;  3WEE A;  4A62 A;  3MK6 A;  3SMS A;  3TSQ A;  1T3V A;  3C7N B;  1NMD A;  3ATV A;  3D2E A;  3FE1 A;  3ZET B;  5C12 A;  3NMU A;  2E8A A;  1BOT O;  1QHA A;  4BRG A;  3GOI A;  3HOS A;  3QIC A;  1XQS C;  1K8K A;  1E4F T;  5TKW A;  5GAD P;  2HBJ A;  4KH5 A;  4B1W B;  4FOI A;  5FPD A;  4JKD A;  2YJF A;  3O9Q A;  2GTD A;  2P9U B;  4WQ4 A;  4BRK A;  2E20 A;  4H5W A;  3AAQ A;  5CR4 A;  3Q7B A;  5JLF A;  4WF9 L;  3ZYY X;  3LDN A;  3HOT A;  4XH1 A;  3VGK A;  1VQM N;  3A0I X;  3MCP A;  5JIC A;  3K9J A;  3MDQ A;  2V52 B;  3VET A;  5KQD A;  3UB5 A;  5KPR A;  4RWT A;  2QWP A;  3CCV N;  2QWM A;  4YOX A;  5AQH A;  5F2R A;  3LM9 A;  4ISE A;  3R6M A;  1YJ9 N;  4GY2 B;  3J8A A;  1NGI A;  3DXK A;  4H5N A;  4LC9 B;  1VQK N;  3MN5 A;  1D4X A;  1VQ4 N;  4CBW A;  2D0P A;  4OPA A;  1YJW N;  4YDU C;  1KAX A;  5JVG L;  4BVP A;  1RFQ A;  4JD2 A;  1V4S A;  5AQF A;  1NBW A;  3EL2 A;  3IUC A;  3TSU A;  1YHQ N;  3QBX A;  3I33 A;  4BRA A;  5C2D A;  1ZXO A;  2A42 A;  2FLO A;  2YHW A;  3M1F A;  4BRP A;  3WQT A;  5B8H A;  2NRV A;  3CMA N;  4FWP A;  1Q82 O;  4KH6 A;  4B9Q A;  3EZW A;  1Q86 O;  3SBT A;  3AAR A;  4H0P A;  4FWQ A;  1NLV A;  1SS6 A;  2NRW A;  3A5M C;  4CZJ A;  4CZL A;  5ADX A;  5DM6 L;  1XC3 A;  2GWK A;  3MN9 A;  4B1Y B;  1MWK A;  4BG9 A;  4DQ8 A;  1EO1 A;  3CHW A;  2Q36 A;  1IJJ A;  2YI1 A;  3A5O C;  5BR9 A;  3CCQ N;  3A8Y A;  1K8A O;  1BWF O;  4YOR A;  3VEV A;  2NRZ A;  4C1N K;  1HKB A;  3HM8 A;  3ATU A;  5AZI A;  1HKC A;  1NGB A;  4PL7 A;  2VGM A;  1Q18 A;  3D7E O;  1EQY A;  4JHD A;  4QS9 A;  4JKF A;  3P38 A;  3H46 O;  4JKA A;  4FVU A;  1YF5 L;  5AQJ A;  4CZF A;  5GAH P;  2I7N A;  3QFU A;  4JKH A;  4QS8 A;  4XJX A;  1YAG A;  1IG8 A;  1GLE G;  3F2K A;  3IKM A;  3DAW A;  4H0T B;  3BEX A;  5TKY A;  1VQO N;  5H1S Q;  3Q7C A;  3SBG A;  3ZEU A;  3O9S A;  3UKR B;  4BG8 A;  1HLU A;  3TSP A;  4K42 A;  3CC4 N;  5AQN A;  2D1K A;  3WXL A;  4CZH A;  3HSC A;  4BY9 C;  3D6R A;  4IOX A;  1OVY A;  1YXQ A;  3K9K A;  5EY4 A;  3CPW M;  3HRG A;  4YOT A;  3O8M A;  2FXU A;  1S3X A;  2DPN A;  5BRE A;  4BR9 A;  3CME N;  1JCG A;  4CD1 A;  4IFE A;  4GNI A;  3UKU B;  4DB3 A;  1K9M O;  4YDU A;  2NZT A;  1HX1 A;  2P9K A;  3L4I A;  3R1X A;  2VCP A;  4I6M A;  5CE3 A;  3D2E B;  4BVO A;  3CQY A;  3LL3 A;  4CZE A;  3VEZ A;  3WXM B;  3D2F A;  5C10 A;  5CHI A;  1K8K B;  3FZF A;  3SMP A;  5AFU A;  4MLH A;  1J6Z A;  2HBL A;  4C23 A;  3QDK A;  4JNE A;  4RCH A;  4BR0 A;  3ENO A;  2E2Q A;  4BC2 A;  1CZA N;  3DLL L;  4H5R A;  3SJH A;  1BA1 A;  1BU6 O;  3RSE A;  2WFB A;  1TYQ A;  4DCH A;  4FSV A;  3ENB A;  4JAX A;  2EWS A;  2PFU A;  1MA9 B;  3H1V X;  5E26 A;  3L0Q A;  3WQU A;  4GV6 A;  3TPQ A;  1TUU A;  2ZWH A;  3HTV A;  3MX2 A;  4B1U B;  1NGE A;  3O9T A;  1KD1 O;  4AM6 A;  1Z05 A;  5EVZ A;  2A6A A;  1O13 A;  1HPM A;  3U8X A;  2AA4 A;  2I7P A;  4AF1 A;  3M6G A;  3CPE A;  1DKG D;  4BR5 A;  3I55 N;  3T69 A;  2P9P A;  3DXM B;  5GAE P;  4K41 A;  2VWB A;  3SLC A;  5KQ8 A;  1VQ7 N;  4MO4 A;  1DT9 A;  2CH5 A;  4PHT X;  4M7X A;  3BF1 A;  1BA0 A;  5AQU A;  3CCE N;  1OKJ A;  3W0L A;  3AAP A;  4E1J A;  4FWM A;  2A41 A;  4H0V B;  1G99 A;  4BC3 A;  2D0O A;  1M90 O;  2KHO A;  2HBK A;  3ULE B;  3QML A;  3CI5 A;  2W40 A;  3CER A;  3PLA A;  3H1Q A;  1V4T A;  4BRM A;  4IEE A;  3LDP A;  2P9I A;  5ELZ A;  1SZ2 A;  3KHY A;  4A61 A;  4CZI A;  2CGL A;  4H0Y B;  4YOU A;  3KWI A;  5AQM A;  1SQK A;  4HTL A;  3CF5 L;  1HUX A;  2ZGZ A;  4UY8 O;  4QS7 A;  3WT0 A;  5LJW A;  5AQX A;  3SAF A;  3VES A;  5AQZ A;  3BP8 A;  3E9P A;  3N4Q A;  4IOA L;  1JJ2 M;  2RE2 A;  4A5B A;  1P90 A;  3IFR A;  5AQO A;  3RVC A;  3VGL A;  4BRO A;  1M1K O;  3C0B A;  3CJB A;  1C0G A;  4A2A A;  3AGK A;  1ATS A;  2NRX A;  2P9S A;  4ISG A;  1C0F A;  1U2V A;  3MWP A;  1NGJ A;  3L4Q A;  4GVE A;  3T7Z A;  3HI0 A;  3KZB A;  5AZJ A;  3FFK B;  4FWL A;  3VGM A;  2QTD A;  1VQ9 N;  4RTF D;  2Q97 A;  2W41 A;  3CCU N;  2IVN A;  4IO8 A;  1BUP A;  1QQO A;  2V7Z A;  5AR0 A;  2F9W A;  3W3D A;  4PKI A;  4B1Z A;  2P9L A;  2E1Z A;  2E88 A;  2QWN A;  2NRH A;  1Y64 A;  3EKS A;  2IVP A;  1P8Z A;  1NGH A;  4YOY A;  3NVK A;  2E1Y A;  5AQQ A;  5BN8 A;  4BEC A;  4IJN A;  3R8E A;  4JKE A;  4KH4 A;  3O9U A;  3LM2 A;  4BRE A;  4G9Z A;  2QWR A;  5AQI A;  3SAG A;  5I9E B;  2V7Y A;  3H3N O;  2P9K B;  2Q2R A;  2QW9 A;  3ID6 A;  2ZJP L;  1ESV A;  4U7B A;  1QZ6 A;  3C7N A;  2A40 A;  4ISF A;  5M1P A;  2W00 A;  3D2F B;  3ZET A;  2KKZ A;  1W2B M;  1GLD G;  3FZH A;  4IO9 L;  1BG3 A;  3VEW A;  2C1G A;  2JWL A;  1NGD A;  3DJC A;  3O9R A;  3PIO L;  3C6H A;  2GWJ A;  2HF4 A;  2ZJQ L;  5HOO A;  3OW2 M;  3ZX3 A;  4A57 A;  3O5B A;  1VAZ A;  5AQL A;  3OBW A;  3RSE B;  3CCJ N;  3CET A;  1R59 O;  2BTF A;  3IMX A;  4JKG A;  4KBO A;  4A5A A;  2IVO A;  3G71 N;  3WXK A;  1ZBS A;  2F7T A;  3NVM A;  1RGI A;  4OPH A;  4JEP A;  1JCF A;  4IEI A;  4DKW A;  3VMF B;  5M1O A;  3VEY A;  4BQZ A;  2QXL A;  4EIA A;  4BEB A;  2NLX A;  3CCM N;  3VEO A;  4BQL A;  5GIN A;  3ZX0 A;  5AQW A;  4BRN A;  1GLC G;  3WEE B;  1BO5 O;  3H3O B;  4BRF A;  1DEJ A;  3GDQ A;  4FOE A;  5AQY A;  3G25 A;  4H5V A;  1NGG A;  4L3Q A;  4FL9 A;  4NO7 A;  4ILJ A;  1LCU A;  1XUP O;  2F9T A;  4AM7 A;  4BRL A;  3CCL N;  4R79 A;  3ID8 A;  4O8K A;  4GV3 A;  3LDL A;  3AGR A;  2QM1 A;  4FWO A;  3VPZ A;  5LY3 A;  5GIO A;  3EE8 A;  2YHX A;  1VQN N;  2ASP A;  3CJ7 A;  3VOV A;  1NGC A;  3TTF A;  4WQ4 C;  2IIR A;  1YJN N;  2YHY A;  3MCA B;  5AQT A;  2PBD A;  2FSN A;  4NB4 A;  3R3L A;  4NLC A;  2RHK A;  1YUW A;  5DM7 L;  4WCE L;  2E2N A;  3MMV A;  5AQV A;  1YIJ N;  5BRH A;  1K73 O;  4PKH A;  5AQK A;  3SK3 A;  3CJA A;  4WQ5 C;  3JXU A;  3KWG A;  3OA9 A;  1NJI O;  3DXK B;  2NNW A;  3A5L C;  3FZM A;  3UE5 A;  3KK7 A;  4JKC A;  2C1I A;  3O08 A;  2ZGY A;  4K25 A;  4J8F A;  3I56 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...