1U2VB

Crystal structure of arp2/3 complex with bound adp and calcium
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
204
structure length
204
Chain Sequence
YAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Actin-Related Protein 3
total genus 57
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1u2vB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1u2vB02
4H0OA 3VEYA 1LOTB 4K42A 2P9PA 4QS8A 3WXIA 5KPTA 5JMVA 1V4TA 4QS7A 4IZ9A 4XH5A 1K8KA 5AFUA 3R9PA 3WQTA 1QZ6A 2A42A 1S22A 2BUPA 2Q0UA 3LDQA 5ADXH 4QS9A 1X3MA 4C23A 4IO8A 2GWJA 5LJWA 5BN8A 4PKIA 5KQDA 3CERA 3CJ1A 4BRNA 2I7NA 4DHYA 1WUAA 2E1YA 4BG9A 1BWFO 3KZBA 3WXKA 5BPLA 4IWVA 2E2PA 1RFQA 3MN7A 2V7ZA 3RSEA 1P8ZA 1GLFO 3O1BA 2HMPA 2P9IB 1WOQA 2ZF5O 5AQGA 1QQMA 3FZKA 3UKUA 4XH1A 2YHYA 4O5FA 2D4WA 2DPNA 3VOVA 4BROA 4BRHA 1SQKA 2VCPA 4M7XA 3C7NB 3O1WA 2NLXA 3FFKB 4DB3A 5AQTA 3VEOA 4FOIA 1GLAG 4BC2A 1NGGA 1NLVA 2FF6A 2FSJA 1HKBA 1BUPA 1NGEA 4JHDB 5BN9A 2I7PA 3EL2A 3H1QA 5AQSA 2P9KA 3M1FA 4IJAA 2A6AA 2E2QA 2QWLA 3UKUB 2ZWHA 2GTDA 2NRHA 1MWMA 4FWSA 4AM6A 3L4IA 2A3ZA 5FPNA 1QHAA 5FPDA 3DWLA 3AARA 1BO5O 4WQ5C 1ZXOA 2PAVA 2QW9A 4FWRA 1V4SA 4PL8A 1NM1A 3R6MA 1QZ5A 3ENOA 4BR2A 1LCUA 3UKRB 4O8KA 4BRMA 1GLLO 1JCFA 3HI0A 4HWIA 3VGKA 2Q2RA 3O8MA 4IXCA 3ZEUB 4MLHA 4CI6A 4PL7A 2P9LB 4FL9A 3L0QA 3MDQA 5BPNA 4BR9A 5AFUH 2QWPA 1HX1A 3F9MA 1XUPO 2YHXA 4WQ5A 1ZC6A 3UE5A 4B9QA 2CGJA 2QWNA 5EVZA 3CJ9A 1E4FT 3H1VX 5AZJB 2CGKA 3SK3A 3IFRA 3VETA 3VERA 5AQWA 3UKRA 4J8FA 4BRFA 1ATSA 3WEEB 2V7YA 4HTLA 1R59O 1GLCG 4XEIA 4BC4A 4BRCA 2AP1A 2Q1NA 4H0VB 3BEXA 4FWQA 3FE1A 3FZMA 3EO3A 4FO0A 1Q18A 3GE1A 5ADXA 4RWTA 3FZHA 5F1XA 3DXMA 3BP8A 3HBTA 4E1JA 3WUHA 2P9UB 3A8YA 1RGIA 1TYQB 3GG4A 3MCPA 3VEZA 3LDPA 5F0XA 3LL3A 1HLUA 2HOEA 3TPQA 1X9JA 1NBWA 4EAHD 2ITMA 3O4WA 2QXLA 2CH5A 1JCGA 4YDUA 5AR0A 1Z6RA 3SJHA 5AQFA 3ZETA 1MWKA 1H1VA 1KAYA 3D2EB 5JICA 1NGHA 4CD3A 1D4XA 3IMXA 3A5MC 5CE3A 3BUZB 4YDUC 2KHOA 2F9TA 3SMPA 4JAXA 5AQPA 1NWKA 2IVOA 5BPMA 3M6GA 1NMDA 4CZGA 1KAXA 1NGAA 2ZGYA 3ATVA 3KHYA 1T44A 2E1ZA 3CIPA 4H0TB 3R8EA 2QM1A 4CJ7A 2E20A 3CJCA 5BRDA 1JCEA 2OANA 3EKSA 3A5OC 3QFPA 2P9NB 5AQQA 4LC9B 5AQNA 4ISGA 4NO7A 3VEWA 2IVPA 3H3NO 3AY9A 5FPMA 3ZETB 1GLDG 2VWBA 5EXWA 4Z94A 4GY2B 1G99A 3KVGA 4H5VA 2ASPA 2V52B 3QBWA 5AQJA 4BRKA 4H5WA 1GLEG 4H5RA 3ZX3A 3UB5A 4CZFA 4BRPA 3LM9A 4EHUA 2UYTA 1CZAN 1K8KB 3A0IX 1HPMA 4H0PA 4JNEA 4H0XB 4DQ8A 3H6EA 2NZTA 3FLCO 3I8BA 3O80A 2P9KB 2HF3A 4BRLA 3GL1A 4BGAA 3FZFA 4K43A 2VYPA 1X3NA 5EX5A 1XC3A 3DXMB 4K41A 1HKGA 4EFHA 2Q36A 3LDOA 1Y64A 2FSKA 5AQVA 5F2RA 3ULEA 2W40A 4MO4A 5I9EB 1HJOA 3MK6A 5LJVA 3AAQA 3WT0A 3RSEB 5AQKA 4MO5A 1KXPA 2D0PA 4JN4A 4H5NA 3W3DA 4FWPA 2F9WA 1C0FA 2FXUA 3LM2A 3GBTA 3ZEUA 3CQYA 3VGMA 2GWKA 3U8XA 2H3GX 3QBXA 4PKGA 5JLFA 3HM8A 3I33A 3QB0A 2CH6A 2QWOA 3U4LA 1YUWA 2P9PB 1T6DA 4Y0WA 1SAZA 3VEVA 1YVNA 5E26A 4XH4A 4BC5A 4BR7A 4JD2A 5BRHA 3DXKB 3FR0A 3CJBA 1BA0A 1XQSC 1HKCA 2D1KA 4B1VA 5ELZA 5AQMA 3CJAA 4FSVA 2FF3B 3VGLA 4CZMA 2D0OA 2YCHA 1BU6O 5AQLA 2QWQA 5AZIA 3VENA 4CBWA 5KPZA 3BF3A 2QWRA 1TYQA 3A5LC 1QQNA 1GLBG 2FSNA 2PBDA 4MLEA 3CETA 1DEJA 5KPRA 4BVPA 1IG8A 1ESVA 2YHWA 2E8AA 3HTVA 1NGDA 3MN5A 5AQYA 3DXKA 4BQZA 5AQXA 2YI1A 4BR5A 4EIAA 1Z05A 3D2FB 4I6MB 3DAWA 3WQUA 1DKGD 3BF1A 4A61A 3IUCA 2GELA 2Q97A 2IIRA 1QQOA 1NGBA 3U9DA 1IJJA 4CD1A 5JLHA 4A2BA 1TUYA 5AZIB 4WYBA 5AQHA 1YAGA 4ISFA 3GDQA 3C7NA 4B1YB 4BGBA 4NB4A 2AA4A 4CBUA 5AQUA 5AZJA 5BREA 4A2AA 3WXJA 3M3ZA 2E2NA 3HSCA 4BQLA 3QDKA 2ZGZA 1OKJA 1SZ2A 1TUUA 3U9ZA 2A40A 4BC3A 3G25A 4BVOA 4F9OA 4WQ4C 3ID8A 1C0GA 4PKHA 4BRAA 3D7EO 2WUSA 3H46O 4H5TA 2FLOA 4B1XB 3VF4A 3J8AA 1YXQA 1NGJA 5EOYA 1U2VA 4FWLA 4BR4A 1S3XA 4IJNA 3P4IA 3CI5A 4B1ZA 2P9SB 1ZBSA 1NGFA 4BG8A 2Q0RA 4JD2B 4CZIA 4CZJA 2IVNA 5EY4A 3VF6A 2YJEA 2YJFA 2GEMA 3CJ7A 4B1UB 4CZKA 5B8HA 1T6CA 1U6ZA 3CHWA 2GUPA 3JS6A 4FOEA 2P9IA 4ISEA 3DJCA 3H3OB 2BTFA 2P9LA 1ATNA 3L6QA 3D2EA 4FWKA 4B1WB 5KQ8A 4FPBA 3O6WA 3ULEB 1U2VB 3FGUA 4RTFD 1E4GT 2P9SA 3C0BA 5AQOA 2EWSA 3JXUA 3LDNA 1BA1A 4A62A 3EKUA 1KAZA 3D2FA 4I6MA 1MDUB 3A5NC 3TU5A 5BR9A 2P9NA 3MN6A 5FPEA 3MN9A 2CGLA 3B8AX 2ASOA 3QFUA 2E88A 2P9UA 3H45C 4BR0A 2A41A 3SMSA 3ZX2A 1RDWX 1ATRA 4BRGA 4BRDA 4EHTA 3OHRA 2HF4A 4K25A 5BRFA 3WXLA 1J6ZA 3ATUA 3ENHA 3GOIA 3QICA 3EN9A 5E84A 4AM7A 2W41A 4CZEA 3HZ6A 4CZHA 3ZX0A 4BRQA 4BREA 3MMVA 4FPAA 2ASMA 4M63C 4CZLA 4BRIA 1HUXA 5AQRA 4DCHA 2V51B 3VEXA 4FWMA 4H0YB 1BDGA 2QWMA 1EQYA 3SLCA 4RCHA 4FWNA 5AQIA 4M7YA 4H03B 2E2OA 2Q31A 1NGCA 3VF2A 1NGIA 4JHDA 3WEEA 3LDLA 5TKYA 1DGKN 4FWOA 3IDHA 4KBOA 3W0LA 1MA9B 3VPZA 5LY3A 3QMLA 3FZLA 4GNIA 3O5BA 3CQXA 3EZWA 5AQZA 1BOTO 3AAPA 4WQ4A 2J4RA 4CBXA 3VESA 3O08A 4L3QA 3S41A 1GLJO 2A5XA 1BG3A
chains in the Genus database with same CATH superfamily
1BISA 3PLAA 4QS8A 3WXIA 5KPTA 4FK2A 1V4TA 4CJFA 1JLCA 1RT2A 3E9LA 3DLRA 4XH5A 4LH4A 1K8KA 1GOBA 1SS6A 5AFUA 3VQBA 4RW7A 4YOVA 1FKOA 1WSHA 3OYDA 1U04A 2Q0UA 4E7LA 4CESA 4C23A 2JWLA 5I3UA 4PKIA 4KHUA 4B9LA 1L3VA 4LF5K 1O1WA 4BG9A 1BWFO 3WXKA 2JLEA 2KFZA 4LF9K 3MN7A 2V7ZA 1RDDA 1ZBLA 4DV3K 1FK9A 5H1SQ 3UKUA 3N4QA 4CK2A 2YHYA 3VOVA 1RILA 3OS2A 4OPAA 1RTHA 4KH6A 5T7BA 4DF8A 3HPHA 3SPYA 3KKSA 1GLAG 1VSFA 3CG7A 4LY7A 1TK0A 3OYCA 1BUPA 4JHDB 3H1QA 3SUPA 3ID6A 2A6AA 4C8MA 1MWMA 4AM6A 1NJIO 5FPNA 1FXXA 1NMNA 3P38A 3DWLA 3AARA 3G6EN 3C6TA 1ZXOA 2QW9A 1V4SA 3ENOA 3JAMO 4KH5A 3RVCA 3UKRB 4O44A 4BRMA 4B9TA 2G8UA 1LAVA 3VGKA 4JRQA 3ZEUB 4MLHA 5C42A 5AFUH 5CZ1A 4WQ5A 3UE5A 1ZC6A 5M1QA 5J2MA 3PIPL 5AZJB 2CGKA 4HUGA 3VERA 4CJVA 5AQWA 1NU0A 4CGJA 4FJ7A 2OPSA 2FBXA 4CEBA 1ATSA 1OVQA 1N6QA 3DYAA 1T05A 3DI6A 3VQAA 2NRXA 5TKWA 2RN2A 4FO0A 3NF9A 5F1XA 4QCLA 5GAHP 3AO4A 1T7PA 3K2PA 4E1JA 3D0PA 3A8YA 1VQMN 4KB1A 1TYQB 4YOUA 1VQKN 1S1TA 1WAJA 4QAGA 1IBKK 4DLEA 1VAZA 3OW2M 2RPIA 3SQ4A 3TPQA 1T8EA 1B92A 2ITMA 2VQFK 4YORA 1CLQA 1VQLN 3C95A 5AR0A 3L4QA 3S3NA 1B9FA 3T69A 5J2NA 4FJHA 4CD3A 4DKWA 1RT1A 3IMXA 4Z0UA 4B8CA 4O0IA 3AVCA 4B08A 5CYMA 4IOCL 5JENA 3M6GA 1TK8A 3HOTA 1NGAA 2ZGYA 1HPZA 2RF2A 3S5TA 2E1ZA 4H0TB 1YHQN 4CJ7A 3O9SA 3CJCA 5BRDA 4FLYA 1RBTA 4LC9B 2UU9K 2E4LA 1T03A 3AY9A 3ZETB 3KLGA 1GLDG 2VWBA 3KVGA 4CEDA 3U6FA 5JVGL 5I42A 4BRKA 1VSKA 4H5WA 4LSNA 4H5RA 3CF5L 3G0ZA 4CZFA 3QEWA 3LM9A 4EHUA 3TAQA 4CW7B 2UYTA 3C65A 4A5AA 5GAGP 3AGKA 3OYKA 1K8KB 1NK8A 2BDPA 4H0PA 4OPHA 4CIEA 4JNEA 5SWMA 3SQ1A 4JKHA 2IOCA 3DLLL 4QOZB 3EE8A 4NYFA 3GL1A 4BGAA 4FLZA 3R1XA 1NJXA 4M3UA 3JSMA 4K41A 3NE6A 1N5YA 3HXMA 2Q36A 3SUOA 4FJLA 1Y64A 5AQVA 4JI1K 3ULEA 1ZBHA 1HJOA 3MK6A 4JKAA 2DFHA 3THXA 1Q86O 3VQ4A 2D0PA 4JN4A 3NH1A 3LM2A 1VSMA 1S9EA 3ZEUA 1U49A 1TKDA 3AVAA 4LSLA 4DG1A 1BIUA 5JLFA 4DSKA 3I33A 2IAJA 4JYAK 2QWOA 4DTMA 1YUWA 1R0AA 4FLUA 4AQYK 4BR7A 4XH4A 4BC5A 3MAQA 4DUYK 3DXKB 3V9ZA 1HKCA 1HNIA 1SL2A 4B1VA 2O8DB 3E9OA 1S5JA 2F96A 4DR6K 5AQMA 4FSVA 3NH0A 4CZMA 1S1VA 2YCHA 3VA0A 4WFNL 3TAEA 3OVNA 3CCEN 1WN7A 3BF3A 1YTUA 2FSNA 3KLEA 1Q8IA 2QI2A 3DMJA 3P83D 5DMRA 4PQUA 4B8AB 3TAPA 2E8AA 1S72N 1HQEA 1IO2A 1NGDA 2WOMA 5AQYA 3ZT0A 4K8XA 4BR5A 2O8BA 1KFSA 4YOXA 3VTHA 1KLNA 5GADP 3BF1A 3ZSQA 4N47A 1QHTA 2WC9A 4CD1A 5JLHA 3K9KA 4A2BA 5MLCQ 4WYBA 3T1YK 4GV3A 1C1CA 4LF8K 4BGBA 4DV4K 4CBUA 3WXJA 1LWFA 5JS2A 4JEPA 4Q0BA 4CJQA 3M3ZA 4OKJA 4BQLA 3QDKA 1UOCA 4FK0A 3TSQA 4JI0K 1SZ2A 4AHSA 3VQPA 3KK3A 4BC3A 1NOZA 4F8RA 4FJ8A 4F9OA 3TTFA 2PFUA 4H5TA 3PX4A 2FLOA 3J8AA 2RE2A 1S3XA 1YIJN 4IJNA 3V9XA 3ZSWA 3P4IA 4FJNA 1ZBSA 1NGFA 1UAXA 3VQ5A 5HRNA 4EP5A 4CZJA 5B8HA 2YJEA 2HNDA 4CJUA 1DTQA 3JS6A 4B9SA 2P9IA 1EP4A 4ISEA 1SL0A 2UXCK 4CK3A 3ZYYX 4FWKA 1HYVA 3THWB 3VMFB 4HVJA 5C2DA 4KI4A 3FGUA 3K59A 4HUFA 4IO9L 1E4GT 4ELUA 3M8PA 3NDKA 1BI4B 2XY6A 4CIFA 1BGXT 4I9QA 1WSGA 3D2FA 1MDUB 2GV9A 2OPQA 1SUQA 5BR9A 3OYEA 2VGNA 2B6AA 5FPEA 4PA1A 4CJKA 4BEBA 2G8HA 4JI3K 3QO9A 2UXBK 1C0UA 3OYGA 3ZSOA 2A41A 3CD6N 3AVLA 2HF4A 5KRTA 4CGIA 3LP0A 3CYGA 1WSJA 4CEEA 2VG7A 1KC8O 3G10A 4JKEA 4CFDA 4AM7A 3CQ8A 3HZ6A 1YJ9N 2FBTA 4FVMA 2VWKA 1SKWA 2ASMA 4BWMA 3PO4A 2HB5A 4CZLA 4JKCA 2V51B 3VEXA 4H0YB 4FLWA 1EQYA 1NK0A 4W5RA 2XY8A 1YJWN 3MCAB 5AQIA 4FW1A 4H03B 3HP9A 2AJQA 4J2EA 1NGCA 3PV8A 1NGIA 3TAFA 3LDLA 1ILYA 3KJVA 2OZMA 1TAUA 3HP6A 4I2PA 3FZLA 1N34K 3EZWA 4NXNK 1RT3A 5AQZA 3AAPA 2HBLA 3QEXA 4CJSA 1D8YA 3O08A 4L3QA 3O9UA 4JI4K 3NF8A 4Q5VA 4H0OA 4JLHA 4IG0A 4K42A 2P9PA 4CJ3A 4CK1A 4EP4A 4IZ9A 1UA1A 2Z1GA 4ILJA 1A5VA 5J2PA 1QZ6A 1S22A 4CJLA 4MDBA 2HVIA 5KGXA 2HHWA 4GV9A 3CCQN 1KQSM 3NHGA 1X3MA 1N32K 4N76A 2QEXN 2RHKA 3CM6A 5IT9O 4O8UA 1GOCA 4CF1A 4CF2A 3CJ1A 5LL6Z 1IKXA 2E1YA 4OO1J 4YOWA 1KFDA 4BY9C 4CHNA 1VK0A 3PX0A 2O8EA 1VSHA 3WNGA 2P9IB 4F2SA 2ZF5O 5LMNK 1Z25A 3Q7CA 3RMCA 1SKRA 4BROA 1HMVA 3T3FA 3AA4A 4DR2K 3SQ0A 3FFKB 3BZKA 3NGZA 5AQTA 3AA2A 4BC2A 1IG9A 1HKBA 2ZQBA 4JI6K 2HW3A 4KHYA 4BDYA 3EL2A 3L3VA 5C25A 3O3GA 2QWLA 2ZWHA 3DOKA 5M1KA 1QHAA 2XO7A 3V1QA 4YY3K 4OPJA 3C6UA 4W5NA 4BR2A 4ELTA 1EKEA 3OA9A 1N8RO 4C1NI 4O8KA 1XC9A 4CGFA 1JCFA 4DU3A 2KFNA 2Q2RA 4LFCK 3ZSYA 1QSSA 3EYZA 5BPNA 3VQ8A 1JLQA 1XUPO 4CJTA 4LFBK 2CGJA 2YHBA 4CF8A 3VTIA 3H1VX 1E4FT 4IBNA 1XNRK 3A2FA 2QK9A 4AH9A 4Z4HA 1HYZA 4J2BA 1BI4A 4CE9A 4IEEA 4BRFA 4DS5A 4DR3K 2V7YA 4Z4EA 4XEIA 2Q1NA 4DS4A 1OH7A 4H0VB 3I0SA 2YNIA 4FWQA 3FE1A 3RR7A 3M8QA 5M1PA 5KRSA 2W42A 3B6OA 4AHUA 4CHOA 3RMBA 2NRRA 2Q3SA 4B9VA 4ELVA 4FZXC 1IH7A 3VQ7A 3HBTA 4KTQA 2P9UB 4AHVA 1RGIA 2KLAA 1OH5A 3VEZA 4HHTA 1KVBA 1X9JA 1NBWA 3ZSZA 4OGCA 3V1RA 4DV7K 3O9RA 4BECA 4KHSA 5HLFA 2BGGA 4K0KK 4JI8K 1JCGA 3QINA 1WSEA 2IS3A 3L2WA 1S1WA 1Z6RA 4B3RK 3SJHA 5AQFA 3ZETA 1MWKA 4HCBA 4ZTJA 3D2EB 1TVRA 3RMAA 4CHYA 4GMJB 3BUZB 3F9KA 1C0TA 1JLFA 3SMPA 2HHSA 3MEDA 4YOTA 2OZSA 3K57A 3ATVA 3KHYA 2QM1A 2ZJPL 3QLHA 3OTOK 1JCEA 4DTJA 2OANA 3A5OC 3KD1E 3QESA 1VSJA 5AQNA 2KQ2A 1YTAA 5FPMA 5EXWA 3SAHA 2ASPA 3QBWA 3PX6A 1Q9YA 5C12A 4BRPA 1FKPA 4N5SA 1RTJA 1QVGM 3BDPA 2NZTA 3ZT4A 3CCJN 2OA8A 1A5WA 1RBSA 2BH1A 4DWIA 2HMIA 5EX5A 4JI2K 1XC3A 3DXMB 1TKTA 1EWRA 3AVKA 5F2RA 3AAQA 3SCXA 5CZ2A 1TV6A 1U4BA 2E6MA 1RTIA 4FWPA 3AVMA 3ULDA 2FXUA 4OKEA 3G4SN 3CQYA 3VGMA 3V4IA 3L8BA 2H3GX 3QBXA 3K9JA 4DMNA 1ZBIA 4DTSA 1CZ9A 4CERA 4Y0WA 1T6DA 4IFVA 5FROA 3VEVA 1O13A 4BACA 4JD2A 3CJBA 1REVA 1XQSC 4F3OA 1EETA 3KLHA 2D1KA 5HRRA 3KWIA 5ELZA 1S9GA 2KKZA 2XHBA 2FF3B 1FW6A 3CCUN 1JL1A 3LDSA 5AZIA 1VSIA 3VENA 3J7ZO 3DRSA 3AO5A 1QQNA 2BE2A 1GLBG 4MLEA 2WFBA 3TAGA 1IG8A 2YHWA 3HTVA 2WTUA 3AVFA 4I6MB 4F3TA 1N36K 3T7ZA 3DAWA 3WQUA 1DKGD 1TL1A 2OCEA 1IJJA 4KRFA 4RW4A 3VQEA 1TUYA 5AZIB 1D9DA 4O55A 3SPZA 3C7NA 2HHQA 1OH6A 4OPKA 5AZJA 4AHRA 5GIOA 1J5EK 2C1IA 4MQ3A 2ZGZA 1OKJA 4FM2A 1TUUA 4KI6A 3U9ZA 2A40A 4X66K 3QEPA 2UUCK 4WCEL 3G25A 4PY5A 5IWAK 4CJ4A 4FK4A 3VQQA 3HPOA 2WUSA 4B1XB 1YXQA 5FRMA 4RW6A 1EWQA 4DTOA 1Q81O 1HJRA 4BG8A 1XI1A 4JD2B 4CZIA 4M3WA 5EY4A 3VF6A 2GEMA 1T6CA 1U6ZA 2HBJA 4FCYA 4FJXA 1BCOA 3ASMA 3V9SA 3V1OA 2E6LA 4CFBA 1ATNA 3N4PA 2KTQA 3TR8A 3QIPA 2ZJRL 4HCCA 5HP1A 5KQ8A 3AVNA 3ULEB 4GKJK 3VN5A 2EWSA 2KZZA 4A62A 4LH5A 4MDAA 4I6MA 3A5NC 4WF9L 3TU5A 4C1NK 4WFAL 2P9NA 5K14A 4TSXA 3B8AX 2R7YA 2A1RA 2E88A 2HHUA 3L2VA 1W0HA 2NRWA 3ZX2A 2P51A 4R79A 3SUQA 1VQ7N 2G8WA 4OKKA 4W5QA 2OPPA 3ENHA 1NK9A 1WSFA 3EN9A 4M3TA 2W41A 4CZEA 5GINA 3K5MA 2NUBA 4BREA 4KV8A 4M45A 3LWLA 1U48A 3NMUA 4JRPA 3MX2A 3NGIA 3DLKA 1QTMA 1BDGA 1KCFA 3SLCA 4RCHA 1KLMA 1X1PA 3PO5A 3VF2A 4I9LA 3TTCA 3KTQA 1CXUA 3Q7BA 3U3GA 1DGKN 4FWOA 4KBOA 3W0LA 1MA9B 5LY3A 3QMLA 3CQXA 2P1JA 5M1FA 2HHIA 3K58A 4CBXA 4DQQA 5DK5A 4M42A 4IOAL 4Y1CA 3NGYA 2D0CA 4RW8A 4CGDA 3VEYA 1NK6A 3NVKA 3HSTB 5JMVA 3D45A 2W00A 1KVCA 4E72A 3AV9A 1L3UA 3LAKA 5LMUK 2HSTA 3LAMA 4CHQA 3R9PA 3CCVN 1YI2N 4FZYA 1CZBA 5HL7L 2BUPA 3AO3A 1BIZA 4IG3A 1S1UA 4C8OA 4BE1A 4YNQA 5ADXH 4QS9A 4IO8A 4JKDA 5LJWA 4NLBA 2C1GA 5BN8A 4UQGA 5KQDA 3OYMA 3BGRA 3ZCMA 4PWDA 3CERA 4BRNA 4DHYA 2I7NA 2IGIA 4CF0A 4DSEA 4X65K 4EZ9A 5BPLA 4IWVA 3C94A 4X64K 4CVNE 4RW9A 2DFFA 1GLFO 3O1BA 2HMPA 2PYJA 4RG8A 1G15A 4NCAA 1WOQA 4DFJA 5AQGA 1WAFA 4O5FA 2D4WA 2ZE2A 4BWJA 4BRHA 1SQKA 2VCPA 4M7XA 3C7NB 2NLXA 3VEOA 1KSPA 4FOIA 1NGGA 2FF6A 4KH4A 2FSJA 1KD1O 3C6AA 3KK1A 2I7PA 3MWPA 5AQSA 5KI6A 2P9KA 3M1FA 4IJAA 3EY1A 3UKUB 1VQ6N 4ZHRA 4CEOA 3OYLA 2B4JA 2A3ZA 3VQ9A 4DTRA 2G8IA 4JS4A 1NJWA 1BO5O 2KW4A 4FWRA 3OS1A 4KTWA 3L2UA 4PL8A 1I39A 1NM1A 3HJFA 1SV5A 4E1MA 4C8KA 1VSLA 3OBYA 3ZSRA 1J53A 2HBMA 4DFPA 4JK8A 4E3SA 1J9AA 1RDAA 2I5JA 2HVHA 2X6SA 3O3HA 1NG9A 3J7YP 4IXCA 4CI6A 4PL7A 4FL9A 2HBKA 3MDQA 3MWTA 3L2QA 4DQRA 3SUNA 2QWPA 1HX1A 1RCHA 5JS1A 1RDUA 1BQNA 3KK2A 1W97L 3E01A 4I7FA 5A2QO 2GBZA 1XHXA 4J8FA 4DR7K 3SI6A 2NNWA 3WEEB 2YV0X 4LD0A 1GLCG 4BC4A 3KLFA 2AP1A 1F21A 1RDBA 2HHVA 3FZMA 3EO3A 1YITN 5ADXA 1C6VA 4RWTA 4KHNA 1U47A 3DXMA 3BP8A 2WBNA 1HRHA 1QSYA 1TKZA 4BDPA 4BE0A 3CCMN 2PZSA 2BANA 3MXJA 3LDPA 5F0XA 1VQ8N 3LL3A 1HLUA 3AVBA 5HROA 4E7JA 2F7TA 4C8NA 4U7BA 4J2AA 4YDUA 2QA4N 4CGGA 4CEZA 1RT6A 4CGHA 1NGHA 2IC3A 4JKGA 4U67L 1VQPN 2YNGA 3A5MC 5CE3A 5M1OA 3J7AP 4YDUC 4NCGA 3TARA 4EZ6A 2E5LK 2F9TA 5AQPA 3E66A 4CJEA 3D6RA 3TABA 2G8FA 1NWKA 3HM9A 1NMDA 4IOXA 4G1QA 1KAXA 1M1KO 1TAQA 1C1BA 3CIPA 3R8EA 4KREA 4B3OA 3QFPA 3O4QA 4CEFA 4NO7A 4JI7K 3H3NO 4Z94A 4CJ5A 4G9ZA 1TK5A 3KIOA 4C8LA 3ENBA 1RT5A 1GLEG 3CYMA 3K5OA 3UB5A 4DV1K 1NKCA 4A59A 4CJWA 1S1XA 1Y97A 1NOYA 4E19A 3NAEA 2HHXA 3THXB 4AF1A 3CCSN 4CJPA 2P5OA 3VQ6A 3HVRA 3PIOL 3A0IX 1HPMA 2OTJN 2GUIA 4H0XB 4DQ8A 3S9HA 3H6EA 3FLCO 3I8BA 2VWJA 3KD5E 1HR0K 4K43A 3LZJA 3CC7N 4F4KA 1NKEA 1HKGA 2XY7A 4EFHA 3LDOA 1RT4A 1OH8A 5SZTA 2W40A 4MO4A 3OJUA 3CXCM 4DSJA 3P31A 2YKNA 3ISNC 2OPRA 5M1NA 2KZMA 1KXPA 5CYQA 2VQEK 1K6YA 3W3DA 2F9WA 1IKYA 2YHAA 3GBTA 3TWHA 1W9HA 2GWKA 2O8FB 1XWLA 4PKGA 4LFAK 3U4LA 3PSIA 4YFUA 3NCIA 3RTVA 3SZ2A 4V19S 5C0YA 5E26A 1JLGA 5J2QA 3C6HA 3FR0A 4CFCA 4BE2A 5CY4A 3DLGA 3NVMA 2OTLN 3JYTA 4LF6K 1EX4A 2O4IA 5D3GA 3CJAA 3LPTA 1VSDA 1IKWA 3RRGA 2X74A 3KLIA 5CHIA 5AQLA 2QWQA 4CBWA 1UA0A 3HO1A 3MXMA 3PSFA 1QE1A 3A5LC 3T1AA 2PBDA 3CETA 3AGRA 3I55N 4LF4K 1IBMK 3SBTA 3ZSVA 5AQXA 3O9QA 1ITGA 2YI1A 1EXQA 1Q82O 4EIAA 4BE7B 3D2FB 2DFEA 4E1NA 3QEVA 3OYFA 2GELA 2Q97A 4JI5K 1QQOA 3U9DA 1I3AA 1LW2A 1ZYQA 1JJ2M 4GVEA 1C1AA 4CF9A 4OVLA 1YAGA 4FM0A 3DLBA 4FJKA 1RDCA 4CEAA 4NB4A 2AA4A 5BREA 1VQ5N 1IKVA 4E0DA 2VGMA 4PUOA 2HNZA 1DT9A 3K0SA 1VHXA 1TL3A 4DFMA 3AA5X 4OJRA 4N56A 1K8AO 5C10A 1D9FA 1L3SA 2D0BA 3HYFA 4ICLA 4O4GA 1A5XA 4CIGA 3H46O 3CFOA 5C15A 1NGJA 2Z1HA 4FWLA 4BR4A 1W7AA 1VSEA 2UXDK 3M8RA 3OJSA 3OYHA 3O9TA 4B1ZA 1J54A 2P9SB 2QXFA 3F5TA 3R3LA 3QNNA 2Q0RA 3LP3A 2IVNA 5HOOA 3UIQA 4B9MA 3I0RA 4FLVA 2ZJQL 3T1HK 2GUPA 4FOEA 3J80O 3H3OB 4KB0A 3SQ2A 2YKMA 3DM2A 2P9LA 4GVMA 3LPUA 5FLXO 4B1WB 4NYNA 3WNFA 4HTUA 3O6WA 1LW0A 4IFEA 2GX9A 3C0BA 3HPGA 5AQOA 3EZ5A 3JXUA 3LDNA 1BA1A 4DR1K 1W2BM 4CHPA 3CM5A 1KAZA 4OLAA 4KHPK 5E41A 3HRGA 3MN6A 3MN9A 2ASOA 3QFUA 2P9UA 3SMSA 1ATRA 2QTDA 4BRGA 2RKIA 1IV0A 3MECA 4W5OA 4IEIA 5BRFA 3WNEA 2HHHK 4JKFA 4WE1A 3CCRN 3BY5A 1ASVA 3L2RA 3V6DA 3TAMA 4FLXA 4M63C 2VG6A 3SJJA 1SKSA 1HUXA 5AQRA 4R5PA 4DCHA 2UUAK 1B9DA 4DTXA 4CJRA 4DLGA 4FWMA 3O3FA 2W6KA 3CMAN 2QWMA 1JXBA 4IKFA 3TI0A 5HRSA 3CC4N 4DR4K 3WEEA 5GIPA 2O8BB 4XJXA 4JK7A 3FFIA 5TKYA 3OYBA 1HNWK 2PY5A 5CR4A 4GNIA 3ZT2A 3O5BA 4N41A 1BOTO 3CPWM 4WQ4A 3WXMB 3S41A 3ZSXA 3ZLJA 1JXEA 2G8KA 1BG3A 1LOTB 4FVUA 1RBVA 1QVFM 2ZD1A 4QS7A 1HQUA 4DV2K 3LANA 5HRPA 2Y1IA 1HNVA 1KRPA 4OGEA 3WQTA 2A42A 2NRTA 4AHCA 4FXDA 3K5LA 3ITHA 4H8KA 3PUFA 3LDQA 4JK9A 3TTDA 2GWJA 3P39A 1WLJA 4JKBA 1HNXK 1WUAA 4FJ5A 3KZBA 1ASUA 1YVUA 2E2PA 1SL1A 1RFQA 3I56N 1RNHA 2Z1IA 4NXMK 3RSEA 1P8ZA 1VQON 4OX9K 2ZM6K 3ZT1A 5FDLA 3NBPA 1QQMA 1VRUA 3FZKA 3CC2N 4IDKA 4XH1A 1JL2A 4Z4IA 3CPEA 2DPNA 1YJNN 1U45A 4AILC 4KKOA 4O5BA 1HYSA 3O1WA 4H4MA 5HBMA 4DB3A 3AVGA 1IBLK 1CXQA 3RRHA 2OYQA 4DSLA 3RMDA 1NLVA 1NGEA 3AVJA 3QERA 3E9PA 5BN9A 4KHQA 1KTQA 5KGWA 1ASWA 2E2QA 4FM1A 4KO0A 3AA3A 3M5RA 2GTDA 2NRHA 3OYNA 4FWSA 4E89A 3SV4A 3L4IA 1WB9A 4JS5A 4FZZA 5FPDA 3NF6A 4KFBA 4DV5K 4WQ5C 4YHHK 3THVA 2PAVA 3HL8A 1MU2A 1BQMA 3R6MA 1QZ5A 2YX6A 3SBGA 1LCUA 3EEQA 3IG1A 4I2QA 1RTDA 1GLLO 2PYLA 3HI0A 3P5JA 4E7KA 4HWIA 3O8MA 3KWGA 2P9LB 3L0QA 4H4OA 4BR9A 3TANA 4B9QA 3F9MA 3HVTA 2YHXA 1NK4A 1LV5A 3RWUA 4HUEA 1RT7A 2QWNA 5EVZA 3B6PA 3QEIA 4DV6K 3DOLA 3CJ9A 5GAEP 3SK3A 3VETA 3IFRA 1P90A 2QKKA 4DR5K 3UKRA 3THYB 1BL3A 3AVIA 4HTLA 1R59O 2F4VK 3OBWA 1I94K 4BRCA 2XY5A 3QNOA 3BEXA 2DTUA 1L5UA 4M3ZA 1Q18A 1X9SA 3GE1A 2JGUA 3FZHA 3F2KA 1XMQK 2JWKA 3DRPA 3WUHA 1RBRA 3GG4A 4PHTX 5BR8K 3MCPA 4M3XA 3LALA 5DM7L 1QSLA 3SAGA 3L3UA 4CCHA 3ALYA 2HOEA 1WNSA 3DLEA 4EAHD 3O4WA 4KPYA 3V81A 1S6PA 1LWCA 2QXLA 2CH5A 4DUZK 3MXIA 2ATQA 2B5JA 3AO2A 1H1VA 1KAYA 4IDHA 5JICA 3RR8A 3OY9A 4J2DA 1D4XA 4W5TA 4KHWA 1X9MA 3OYJA 4GW6A 3V9WA 2KHOA 4JAXA 3SAFA 4AHTA 1LAWA 2IVOA 5BPMA 1K73O 4CZGA 3NH2A 1Q9XA 3SNNA 1T44A 1ZBFA 2A1SA 4FW2A 3MEEA 4JV5K 2P5GA 3EE9A 1Q7YO 1LWEA 2E20A 3EKSA 2P9NB 4A5BA 5AQQA 2G8VA 3VEWA 4ISGA 2IVPA 3IRXA 4Z4FA 1JLBA 4GY2B 2LSNA 1G99A 4H5VA 4FLTA 3DLHA 2ITGA 3U3YA 2V52B 1D5AA 5AQJA 1E3MA 3ZX3A 4DTNA 1JKHA 1N33K 4CEQA 3KKRA 5EU7A 1CZAN 2NRVA 3CMEN 3E1YA 4X62K 4DV0K 1WBBA 4ILGB 3O80A 2P9KB 2F8TA 2HF3A 2O4GA 4BRLA 3FZFA 2VYPA 1X3NA 4DFKA 2FSKA 4E7IA 1WSIA 5I9EB 4F2RA 5LJVA 1TKXA 4B9UA 4BDZA 3WT0A 4WFBL 1NJYA 3RSEB 4NLCA 4MO5A 5AQKA 4OLBA 4FJIA 4H5NA 4FJGA 5FRNA 1C0FA 3AVHA 3NFAA 4IFYA 4L8RB 4ILHA 1XMOK 3U8XA 5J1EA 1NJZA 2X6NA 3HM8A 2VG5A 3QB0A 2CH6A 3AO1A 3MEGA 3SYZA 4A57A 2P9PB 1TGOA 3NF7A 3S3OA 1SAZA 2ETJA 1YVNA 1NK7A 2F8SA 1XHZA 1QS4A 5BRHA 3IAYA 1BA0A 5JVHL 4DTUA 1DLOA 1XNQK 3VGLA 2D0OA 1UWBA 3IKMA 4Z4GA 1BU6O 3SV3A 5KPZA 4GV6A 4O0JA 3THWA 2QWRA 1TYQA 1RBUA 3O4NA 1NK5A 1DEJA 3VQDA 2WONA 2X78A 4ID1A 1JLEA 5KPRA 3F73A 4DTPA 4CFAA 1L3TA 4BVPA 1ESVA 3MN5A 3DXKA 4BQZA 1HNZK 3QIOA 3IS9A 1Z05A 3CCLN 1YF5L 3TSPA 4A61A 3IUCA 4MFBA 3HK2A 1FJGK 2IIRA 1NGBA 2DY4A 1T3VA 5AQHA 4ISFA 3GDQA 1Z26A 4B1YB 3HT3A 1X9WA 5AQUA 4A2AA 1BCMA 1S6QA 2Z1JA 3OS0A 1VQ9N 2E2NA 3HSCA 2Y1JA 4KTZA 4B3TK 1JLAA 3MX5A 3V9UA 4FJ9A 5DM6L 1GOAA 2D0AA 4BVOA 4M3RA 2HNYA 4WQ4C 3ID8A 5AJ3K 1J5OA 1C0GA 4M41A 3T19A 1M90O 4PKHA 4CHZA 4BRAA 3D7EO 1BHLA 3VF4A 3J81O 5EOYA 1U2VA 4B3MK 3CI5A 3CFPA 4CZKA 4B1UB 3DRRA 2YJFA 3CJ7A 2O8EB 3CHWA 4GKKK 3VQCA 3S3MA 2O8DA 3DJCA 3OYIA 1ZBUA 4LF7K 1KVAA 3G71N 2BTFA 3LP1A 4Y1DA 2FBVA 2IDOA 3D2EA 3L6QA 4B9NA 1VQNN 2UUBK 4JKGB 1EO1A 3KK7A 4FPBA 4KAZA 3K5NA 4ZTFA 1U2VB 4DQPA 4DF4A 1VQ4N 1DTTA 4RTFD 2P9SA 3H08A 3THYA 4DU1A 1YT3A 4FYDA 3EKUA 4K8ZA 1K9MO 2FC0A 4DSIA 2EX3A 1NKBA 4YOYA 3BZCA 4B3SK 4XIUA 3QETA 4FJMA 1QQCA 1VRTA 2CGLA 3PY8A 5C24A 2O8CA 4DSFA 2NRZA 4BR0A 3H45C 4E7HA 4NCBA 4DQSA 1RDWX 3LZIA 4BRDA 4EHTA 3VA3A 4M3YA 4CECA 3OHRA 3LP2A 4K25A 4UY8O 3P1GA 3WXLA 4Z4CA 1J6ZA 3ATUA 1WBDA 3GOIA 3CFRA 3QICA 3HOSA 4FJJA 3ZT3A 5E84A 5KTQA 4CZHA 3ZX0A 4DU4A 4BRQA 3MMVA 4FPAA 2HHTA 3OYAA 2YNFA 4BRIA 3I8DA 2QKBA 2O8CB 1OVYA 4DQIA 3WNHA 1NNEA 2XRIA 3LWMA 5C2FA 1C0MA 3M8SA 4FWNA 4M7YA 2FBYA 2E2OA 2Q31A 4ID5A 4JHDA 2W6LA 3IDHA 2D5RA 3TSUA 3VPZA 2YNHA 2O8FA 2J4RA 3VESA 1GLJO 2EHGA 2A5XA
chains in the Genus database with same CATH topology
4H0OA 3VEYA 1LOTB 3PLAA 4K42A 2P9PA 4QS8A 3WXIA 5KPTA 1QVFM 5JMVA 1V4TA 3NVKA 4QS7A 4IZ9A 2W00A 3E9LA 4XH5A 1K8KA 2HSTA 4ILJA 1SS6A 3R9PA 5AFUA 3CCVN 3WQTA 1QZ6A 1YI2N 2A42A 1S22A 2NRTA 4YOVA 4MDBA 5HL7L 2BUPA 2Q0UA 3CCQN 4GV9A 3LDQA 1KQSM 4JK9A 5ADXH 4QS9A 1X3MA 3TTDA 4C23A 4IO8A 4JKDA 2GWJA 5LJWA 2JWLA 2RHKA 2QEXN 3P39A 4NLBA 2C1GA 5BN8A 4O8UA 4PKIA 5KQDA 4JKBA 3CERA 3CJ1A 4BRNA 2I7NA 4DHYA 1WUAA 2E1YA 4BG9A 1BWFO 4OO1J 3KZBA 3WXKA 4YOWA 5BPLA 4IWVA 2E2PA 4BY9C 1RFQA 3MN7A 3I56N 2V7ZA 3RSEA 1P8ZA 1VQON 1GLFO 3O1BA 2HMPA 2P9IB 5H1SQ 1WOQA 2ZF5O 5AQGA 1QQMA 3FZKA 3CC2N 3UKUA 4XH1A 3N4QA 3Q7CA 2YHYA 4O5FA 2D4WA 3CPEA 2DPNA 3VOVA 4BROA 4BRHA 1YJNN 1SQKA 2VCPA 4OPAA 4M7XA 4KH6A 3C7NB 3O1WA 2NLXA 3FFKB 4DB3A 5AQTA 3VEOA 4FOIA 1GLAG 4BC2A 1NGGA 1NLVA 2FF6A 4KH4A 2FSJA 1HKBA 1BUPA 1NGEA 4JHDB 3E9PA 3C6AA 5BN9A 2I7PA 3EL2A 1KD1O 3H1QA 3MWPA 5AQSA 2P9KA 3M1FA 4IJAA 3ID6A 2A6AA 2E2QA 2QWLA 3UKUB 2ZWHA 1VQ6N 3M5RA 2GTDA 2NRHA 1MWMA 4FWSA 4AM6A 5M1KA 3L4IA 2A3ZA 1NJIO 5FPNA 1QHAA 3P38A 5FPDA 3DWLA 3AARA 3G6EN 1BO5O 4WQ5C 1ZXOA 2PAVA 2QW9A 4FWRA 1V4SA 4PL8A 1NM1A 3R6MA 1QZ5A 2YX6A 3ENOA 3SBGA 4BR2A 3OA9A 1LCUA 3OBYA 4KH5A 3RVCA 3UKRB 4C1NI 1N8RO 4O8KA 2HBMA 4BRMA 1GLLO 1JCFA 4JK8A 3HI0A 4HWIA 3VGKA 2Q2RA 3O8MA 4IXCA 3KWGA 4MLHA 3ZEUB 4CI6A 2P9LB 4FL9A 4PL7A 2HBKA 3L0QA 3MDQA 5BPNA 3MWTA 4BR9A 5AFUH 2QWPA 1HX1A 3F9MA 1XUPO 2YHXA 4WQ5A 1ZC6A 3UE5A 4B9QA 2CGJA 5M1QA 2QWNA 5EVZA 3VTIA 1RDUA 3PIPL 3CJ9A 1E4FT 3H1VX 1W97L 2CGKA 5AZJB 3IFRA 3SK3A 3VERA 3VETA 5GAEP 1P90A 5AQWA 3UKRA 4J8FA 4IEEA 4BRFA 1ATSA 2NNWA 3WEEB 2V7YA 4HTLA 1R59O 1GLCG 3OBWA 4XEIA 4BC4A 4BRCA 2AP1A 2Q1NA 4H0VB 2NRXA 3BEXA 4FWQA 3FE1A 5TKWA 3FZMA 3EO3A 4FO0A 5M1PA 1Q18A 1YITN 3GE1A 5ADXA 4RWTA 3FZHA 3F2KA 5F1XA 2NRRA 3BP8A 3DXMA 5GAHP 2WBNA 3HBTA 2JWKA 4E1JA 3WUHA 2P9UB 3A8YA 1VQMN 1RGIA 1TYQB 2KLAA 3GG4A 4YOUA 4PHTX 3CCMN 1VQKN 3MCPA 3VEZA 3LDPA 5F0XA 1VQ8N 1VAZA 5DM7L 3LL3A 1HLUA 3OW2M 3SAGA 2HOEA 3TPQA 1X9JA 1NBWA 4EAHD 2ITMA 3O4WA 3O9RA 4BECA 4YORA 2QXLA 2CH5A 2F7TA 1JCGA 4U7BA 1VQLN 4YDUA 2QA4N 5AR0A 1Z6RA 3L4QA 3SJHA 5AQFA 3ZETA 3T69A 1MWKA 1H1VA 1KAYA 4IDHA 3D2EB 5JICA 1NGHA 4CD3A 4DKWA 4JKGA 1D4XA 3IMXA 4U67L 1VQPN 3A5MC 5CE3A 5M1OA 3BUZB 4YDUC 2KHOA 2F9TA 3SMPA 4JAXA 5AQPA 3E66A 3SAFA 4IOCL 3D6RA 4YOTA 1NWKA 2IVOA 5BPMA 3M6GA 1NMDA 1K73O 4IOXA 4CZGA 3HOTA 1KAXA 1NGAA 2ZGYA 3ATVA 3KHYA 1M1KO 1T44A 2E1ZA 3CIPA 4H0TB 1YHQN 3R8EA 2QM1A 3EE9A 3O9SA 4CJ7A 2ZJPL 2E20A 1Q7YO 3CJCA 5BRDA 1JCEA 2OANA 3EKSA 3A5OC 3QFPA 2P9NB 4A5BA 5AQQA 4LC9B 5AQNA 4ISGA 4NO7A 3VEWA 2IVPA 3AY9A 3H3NO 5FPMA 3ZETB 1GLDG 2VWBA 5EXWA 4Z94A 4GY2B 3SAHA 1G99A 3KVGA 4H5VA 2ASPA 2V52B 3QBWA 5AQJA 5JVGL 4BRKA 4H5WA 3ENBA 1GLEG 4H5RA 3ZX3A 3UB5A 3CF5L 4CZFA 5C12A 4A59A 4BRPA 3LM9A 4EHUA 4AF1A 3CCSN 2UYTA 1CZAN 3C65A 4A5AA 5GAGP 3AGKA 3PIOL 1K8KB 2NRVA 3A0IX 1HPMA 4H0PA 4OPHA 1QVGM 3CMEN 2OTJN 4JNEA 3E1YA 4H0XB 4DQ8A 3H6EA 2NZTA 3FLCO 3I8BA 3CCJN 4ILGB 3O80A 4JKHA 2P9KB 3DLLL 2HF3A 3EE8A 4BRLA 3GL1A 4BGAA 3FZFA 4K43A 2VYPA 1X3NA 2BH1A 3R1XA 3CC7N 5EX5A 1XC3A 3DXMB 4K41A 1HKGA 4EFHA 2Q36A 3LDOA 1Y64A 2FSKA 5AQVA 5F2RA 3ULEA 2W40A 4MO4A 5I9EB 3CXCM 1HJOA 3MK6A 4JKAA 5LJVA 3AAQA 3P31A 3WT0A 4WFBL 1Q86O 3RSEB 5M1NA 4NLCA 4MO5A 5AQKA 1KXPA 2D0PA 4JN4A 4H5NA 3W3DA 4FWPA 2F9WA 1C0FA 2FXUA 3LM2A 3G4SN 3GBTA 3ZEUA 3CQYA 3VGMA 4ILHA 2GWKA 3U8XA 2H3GX 3QBXA 4PKGA 5JLFA 3HM8A 3I33A 3QB0A 3K9JA 2CH6A 2QWOA 3U4LA 1YUWA 5C0YA 2P9PB 1T6DA 4Y0WA 4A57A 1SAZA 3VEVA 1YVNA 5E26A 1O13A 4XH4A 4BC5A 4BR7A 4JD2A 5BRHA 3C6HA 3DXKB 3FR0A 3CJBA 1BA0A 1XQSC 3NVMA 5JVHL 2OTLN 1HKCA 2D1KA 4B1VA 3E9OA 3KWIA 5ELZA 5AQMA 2KKZA 3CJAA 4FSVA 2FF3B 3VGLA 4CZMA 2D0OA 2YCHA 3IKMA 1BU6O 5CHIA 3CCUN 4WFNL 5AQLA 2QWQA 5AZIA 3VENA 4CBWA 5KPZA 3J7ZO 3CCEN 4GV6A 4FVUA 3BF3A 2QWRA 1TYQA 3A5LC 1QQNA 1GLBG 2FSNA 2PBDA 2WFBA 4MLEA 3CETA 1DEJA 5KPRA 3AGRA 3I55N 2QI2A 4BVPA 3SBTA 1IG8A 1ESVA 2YHWA 2E8AA 3HTVA 1S72N 1NGDA 3MN5A 5AQYA 3DXKA 4BQZA 5AQXA 3O9QA 2YI1A 4BR5A 1Q82O 4EIAA 4BE7B 1Z05A 3D2FB 4I6MB 4YOXA 3T7ZA 3VTHA 3DAWA 3CCLN 1YF5L 3WQUA 1DKGD 5GADP 3TSPA 3BF1A 4A61A 3IUCA 2GELA 2Q97A 2IIRA 1QQOA 1NGBA 3U9DA 1IJJA 2WC9A 1T3VA 4CD1A 5JLHA 3K9KA 1TUYA 4GVEA 4WYBA 5AZIB 4A2BA 5AQHA 5MLCQ 1JJ2M 4GV3A 1YAGA 4ISFA 3GDQA 3C7NA 4B1YB 4BGBA 4NB4A 2AA4A 4CBUA 5AQUA 5AZJA 5BREA 4A2AA 3WXJA 1VQ5N 2VGMA 1VQ9N 4JEPA 5GIOA 3M3ZA 2C1IA 2E2NA 3HSCA 1DT9A 4BQLA 3QDKA 2ZGZA 1OKJA 3TSQA 1SZ2A 3MX5A 1TUUA 3U9ZA 5C10A 2A40A 5DM6L 1K8AO 4BC3A 4WCEL 3G25A 4BVOA 4F9OA 3TTFA 4WQ4C 3ID8A 2PFUA 1C0GA 1M90O 4PKHA 4BRAA 3D7EO 2WUSA 3H46O 4H5TA 2FLOA 4B1XB 5C15A 3VF4A 3J8AA 1YXQA 1NGJA 2RE2A 5EOYA 1U2VA 4FWLA 4BR4A 1S3XA 1YIJN 4IJNA 3O9TA 3P4IA 3CI5A 4B1ZA 1Q81O 2P9SB 1ZBSA 1NGFA 3F5TA 3R3LA 4BG8A 2Q0RA 4JD2B 4CZIA 4CZJA 5HOOA 2IVNA 5EY4A 3VF6A 2YJEA 2YJFA 2GEMA 3CJ7A 4B1UB 4CZKA 5B8HA 1T6CA 1U6ZA 2HBJA 2ZJQL 3CHWA 2GUPA 3JS6A 4FOEA 2P9IA 4ISEA 3DJCA 3H3OB 3G71N 2BTFA 2P9LA 1ATNA 3L6QA 3D2EA 3N4PA 3ZYYX 1VQNN 4FWKA 4JKGB 4B1WB 1EO1A 3KK7A 2ZJRL 5KQ8A 4FPBA 3O6WA 3VMFB 5C2DA 3ULEB 1U2VB 3FGUA 1VQ4N 4IO9L 4IFEA 4RTFD 1E4GT 2GX9A 2P9SA 3C0BA 5AQOA 2EWSA 3JXUA 3LDNA 1BA1A 4A62A 3EKUA 1W2BM 1K9MO 4MDAA 1KAZA 3D2FA 4I6MA 1MDUB 3A5NC 4WF9L 3TU5A 4C1NK 5BR9A 4WFAL 4YOYA 2P9NA 2VGNA 3HRGA 3MN6A 5FPEA 3MN9A 4BEBA 2CGLA 3B8AX 2ASOA 3QFUA 2NRZA 2E88A 2P9UA 3H45C 4BR0A 2A41A 3SMSA 2NRWA 1ATRA 1RDWX 2QTDA 3ZX2A 4BRGA 4BRDA 3CD6N 4EHTA 4R79A 3OHRA 2HF4A 4IEIA 4K25A 5BRFA 1VQ7N 4UY8O 4JKFA 3WXLA 1J6ZA 3ATUA 3ENHA 3GOIA 1KC8O 3QICA 3EN9A 3HOSA 3CCRN 4JKEA 5E84A 4AM7A 2W41A 4CZEA 3HZ6A 4CZHA 5GINA 3ZX0A 4G9ZA 4BRQA 4BREA 1YJ9N 3MMVA 4FPAA 2ASMA 4M63C 3NMUA 4CZLA 4BRIA 1HUXA 1OVYA 4JKCA 5AQRA 4DCHA 2V51B 3VEXA 3MX2A 4FWMA 4H0YB 5C2FA 3CMAN 1BDGA 2QWMA 1EQYA 3SLCA 4RCHA 1YJWN 3MCAB 4FWNA 5AQIA 4M7YA 4H03B 2E2OA 2Q31A 1NGCA 3CC4N 3VF2A 1NGIA 4JHDA 3WEEA 5GIPA 3TTCA 3LDLA 4XJXA 1ILYA 4JK7A 3Q7BA 5TKYA 1DGKN 4FWOA 3IDHA 4KBOA 3W0LA 1MA9B 3VPZA 3TSUA 5LY3A 5CR4A 3QMLA 3FZLA 4GNIA 3O5BA 3CQXA 3EZWA 5AQZA 1BOTO 3AAPA 5M1FA 3CPWM 4WQ4A 2HBLA 2J4RA 4CBXA 3WXMB 3VESA 3O08A 4L3QA 3O9UA 4IOAL 3S41A 1GLJO 2A5XA 1BG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0O A;  3VEY A;  1LOT B;  4K42 A;  2P9P A;  4QS8 A;  3WXI A;  5KPT A;  5JMV A;  1V4T A;  4QS7 A;  4IZ9 A;  4XH5 A;  1K8K A;  5AFU A;  3R9P A;  3WQT A;  1QZ6 A;  2A42 A;  1S22 A;  2BUP A;  2Q0U A;  3LDQ A;  5ADX H;  4QS9 A;  1X3M A;  4C23 A;  4IO8 A;  2GWJ A;  5LJW A;  5BN8 A;  4PKI A;  5KQD A;  3CER A;  3CJ1 A;  4BRN A;  2I7N A;  4DHY A;  1WUA A;  2E1Y A;  4BG9 A;  1BWF O;  3KZB A;  3WXK A;  5BPL A;  4IWV A;  2E2P A;  1RFQ A;  3MN7 A;  2V7Z A;  3RSE A;  1P8Z A;  1GLF O;  3O1B A;  2HMP A;  2P9I B;  1WOQ A;  2ZF5 O;  5AQG A;  1QQM A;  3FZK A;  3UKU A;  4XH1 A;  2YHY A;  4O5F A;  2D4W A;  2DPN A;  3VOV A;  4BRO A;  4BRH A;  1SQK A;  2VCP A;  4M7X A;  3C7N B;  3O1W A;  2NLX A;  3FFK B;  4DB3 A;  5AQT A;  3VEO A;  4FOI A;  1GLA G;  4BC2 A;  1NGG A;  1NLV A;  2FF6 A;  2FSJ A;  1HKB A;  1BUP A;  1NGE A;  4JHD B;  5BN9 A;  2I7P A;  3EL2 A;  3H1Q A;  5AQS A;  2P9K A;  3M1F A;  4IJA A;  2A6A A;  2E2Q A;  2QWL A;  3UKU B;  2ZWH A;  2GTD A;  2NRH A;  1MWM A;  4FWS A;  4AM6 A;  3L4I A;  2A3Z A;  5FPN A;  1QHA A;  5FPD A;  3DWL A;  3AAR A;  1BO5 O;  4WQ5 C;  1ZXO A;  2PAV A;  2QW9 A;  4FWR A;  1V4S A;  4PL8 A;  1NM1 A;  3R6M A;  1QZ5 A;  3ENO A;  4BR2 A;  1LCU A;  3UKR B;  4O8K A;  4BRM A;  1GLL O;  1JCF A;  3HI0 A;  4HWI A;  3VGK A;  2Q2R A;  3O8M A;  4IXC A;  3ZEU B;  4MLH A;  4CI6 A;  4PL7 A;  2P9L B;  4FL9 A;  3L0Q A;  3MDQ A;  5BPN A;  4BR9 A;  5AFU H;  2QWP A;  1HX1 A;  3F9M A;  1XUP O;  2YHX A;  4WQ5 A;  1ZC6 A;  3UE5 A;  4B9Q A;  2CGJ A;  2QWN A;  5EVZ A;  3CJ9 A;  1E4F T;  3H1V X;  5AZJ B;  2CGK A;  3SK3 A;  3IFR A;  3VET A;  3VER A;  5AQW A;  3UKR A;  4J8F A;  4BRF A;  1ATS A;  3WEE B;  2V7Y A;  4HTL A;  1R59 O;  1GLC G;  4XEI A;  4BC4 A;  4BRC A;  2AP1 A;  2Q1N A;  4H0V B;  3BEX A;  4FWQ A;  3FE1 A;  3FZM A;  3EO3 A;  4FO0 A;  1Q18 A;  3GE1 A;  5ADX A;  4RWT A;  3FZH A;  5F1X A;  3DXM A;  3BP8 A;  3HBT A;  4E1J A;  3WUH A;  2P9U B;  3A8Y A;  1RGI A;  1TYQ B;  3GG4 A;  3MCP A;  3VEZ A;  3LDP A;  5F0X A;  3LL3 A;  1HLU A;  2HOE A;  3TPQ A;  1X9J A;  1NBW A;  4EAH D;  2ITM A;  3O4W A;  2QXL A;  2CH5 A;  1JCG A;  4YDU A;  5AR0 A;  1Z6R A;  3SJH A;  5AQF A;  3ZET A;  1MWK A;  1H1V A;  1KAY A;  3D2E B;  5JIC A;  1NGH A;  4CD3 A;  1D4X A;  3IMX A;  3A5M C;  5CE3 A;  3BUZ B;  4YDU C;  2KHO A;  2F9T A;  3SMP A;  4JAX A;  5AQP A;  1NWK A;  2IVO A;  5BPM A;  3M6G A;  1NMD A;  4CZG A;  1KAX A;  1NGA A;  2ZGY A;  3ATV A;  3KHY A;  1T44 A;  2E1Z A;  3CIP A;  4H0T B;  3R8E A;  2QM1 A;  4CJ7 A;  2E20 A;  3CJC A;  5BRD A;  1JCE A;  2OAN A;  3EKS A;  3A5O C;  3QFP A;  2P9N B;  5AQQ A;  4LC9 B;  5AQN A;  4ISG A;  4NO7 A;  3VEW A;  2IVP A;  3H3N O;  3AY9 A;  5FPM A;  3ZET B;  1GLD G;  2VWB A;  5EXW A;  4Z94 A;  4GY2 B;  1G99 A;  3KVG A;  4H5V A;  2ASP A;  2V52 B;  3QBW A;  5AQJ A;  4BRK A;  4H5W A;  1GLE G;  4H5R A;  3ZX3 A;  3UB5 A;  4CZF A;  4BRP A;  3LM9 A;  4EHU A;  2UYT A;  1CZA N;  1K8K B;  3A0I X;  1HPM A;  4H0P A;  4JNE A;  4H0X B;  4DQ8 A;  3H6E A;  2NZT A;  3FLC O;  3I8B A;  3O80 A;  2P9K B;  2HF3 A;  4BRL A;  3GL1 A;  4BGA A;  3FZF A;  4K43 A;  2VYP A;  1X3N A;  5EX5 A;  1XC3 A;  3DXM B;  4K41 A;  1HKG A;  4EFH A;  2Q36 A;  3LDO A;  1Y64 A;  2FSK A;  5AQV A;  5F2R A;  3ULE A;  2W40 A;  4MO4 A;  5I9E B;  1HJO A;  3MK6 A;  5LJV A;  3AAQ A;  3WT0 A;  3RSE B;  5AQK A;  4MO5 A;  1KXP A;  2D0P A;  4JN4 A;  4H5N A;  3W3D A;  4FWP A;  2F9W A;  1C0F A;  2FXU A;  3LM2 A;  3GBT A;  3ZEU A;  3CQY A;  3VGM A;  2GWK A;  3U8X A;  2H3G X;  3QBX A;  4PKG A;  5JLF A;  3HM8 A;  3I33 A;  3QB0 A;  2CH6 A;  2QWO A;  3U4L A;  1YUW A;  2P9P B;  1T6D A;  4Y0W A;  1SAZ A;  3VEV A;  1YVN A;  5E26 A;  4XH4 A;  4BC5 A;  4BR7 A;  4JD2 A;  5BRH A;  3DXK B;  3FR0 A;  3CJB A;  1BA0 A;  1XQS C;  1HKC A;  2D1K A;  4B1V A;  5ELZ A;  5AQM A;  3CJA A;  4FSV A;  2FF3 B;  3VGL A;  4CZM A;  2D0O A;  2YCH A;  1BU6 O;  5AQL A;  2QWQ A;  5AZI A;  3VEN A;  4CBW A;  5KPZ A;  3BF3 A;  2QWR A;  1TYQ A;  3A5L C;  1QQN A;  1GLB G;  2FSN A;  2PBD A;  4MLE A;  3CET A;  1DEJ A;  5KPR A;  4BVP A;  1IG8 A;  1ESV A;  2YHW A;  2E8A A;  3HTV A;  1NGD A;  3MN5 A;  5AQY A;  3DXK A;  4BQZ A;  5AQX A;  2YI1 A;  4BR5 A;  4EIA A;  1Z05 A;  3D2F B;  4I6M B;  3DAW A;  3WQU A;  1DKG D;  3BF1 A;  4A61 A;  3IUC A;  2GEL A;  2Q97 A;  2IIR A;  1QQO A;  1NGB A;  3U9D A;  1IJJ A;  4CD1 A;  5JLH A;  4A2B A;  1TUY A;  5AZI B;  4WYB A;  5AQH A;  1YAG A;  4ISF A;  3GDQ A;  3C7N A;  4B1Y B;  4BGB A;  4NB4 A;  2AA4 A;  4CBU A;  5AQU A;  5AZJ A;  5BRE A;  4A2A A;  3WXJ A;  3M3Z A;  2E2N A;  3HSC A;  4BQL A;  3QDK A;  2ZGZ A;  1OKJ A;  1SZ2 A;  1TUU A;  3U9Z A;  2A40 A;  4BC3 A;  3G25 A;  4BVO A;  4F9O A;  4WQ4 C;  3ID8 A;  1C0G A;  4PKH A;  4BRA A;  3D7E O;  2WUS A;  3H46 O;  4H5T A;  2FLO A;  4B1X B;  3VF4 A;  3J8A A;  1YXQ A;  1NGJ A;  5EOY A;  1U2V A;  4FWL A;  4BR4 A;  1S3X A;  4IJN A;  3P4I A;  3CI5 A;  4B1Z A;  2P9S B;  1ZBS A;  1NGF A;  4BG8 A;  2Q0R A;  4JD2 B;  4CZI A;  4CZJ A;  2IVN A;  5EY4 A;  3VF6 A;  2YJE A;  2YJF A;  2GEM A;  3CJ7 A;  4B1U B;  4CZK A;  5B8H A;  1T6C A;  1U6Z A;  3CHW A;  2GUP A;  3JS6 A;  4FOE A;  2P9I A;  4ISE A;  3DJC A;  3H3O B;  2BTF A;  2P9L A;  1ATN A;  3L6Q A;  3D2E A;  4FWK A;  4B1W B;  5KQ8 A;  4FPB A;  3O6W A;  3ULE B;  1U2V B;  3FGU A;  4RTF D;  1E4G T;  2P9S A;  3C0B A;  5AQO A;  2EWS A;  3JXU A;  3LDN A;  1BA1 A;  4A62 A;  3EKU A;  1KAZ A;  3D2F A;  4I6M A;  1MDU B;  3A5N C;  3TU5 A;  5BR9 A;  2P9N A;  3MN6 A;  5FPE A;  3MN9 A;  2CGL A;  3B8A X;  2ASO A;  3QFU A;  2E88 A;  2P9U A;  3H45 C;  4BR0 A;  2A41 A;  3SMS A;  3ZX2 A;  1RDW X;  1ATR A;  4BRG A;  4BRD A;  4EHT A;  3OHR A;  2HF4 A;  4K25 A;  5BRF A;  3WXL A;  1J6Z A;  3ATU A;  3ENH A;  3GOI A;  3QIC A;  3EN9 A;  5E84 A;  4AM7 A;  2W41 A;  4CZE A;  3HZ6 A;  4CZH A;  3ZX0 A;  4BRQ A;  4BRE A;  3MMV A;  4FPA A;  2ASM A;  4M63 C;  4CZL A;  4BRI A;  1HUX A;  5AQR A;  4DCH A;  2V51 B;  3VEX A;  4FWM A;  4H0Y B;  1BDG A;  2QWM A;  1EQY A;  3SLC A;  4RCH A;  4FWN A;  5AQI A;  4M7Y A;  4H03 B;  2E2O A;  2Q31 A;  1NGC A;  3VF2 A;  1NGI A;  4JHD A;  3WEE A;  3LDL A;  5TKY A;  1DGK N;  4FWO A;  3IDH A;  4KBO A;  3W0L A;  1MA9 B;  3VPZ A;  5LY3 A;  3QML A;  3FZL A;  4GNI A;  3O5B A;  3CQX A;  3EZW A;  5AQZ A;  1BOT O;  3AAP A;  4WQ4 A;  2J4R A;  4CBX A;  3VES A;  3O08 A;  4L3Q A;  3S41 A;  1GLJ O;  2A5X A;  1BG3 A; 
#chains in the Genus database with same CATH topology
 1BIS A;  3PLA A;  4QS8 A;  3WXI A;  5KPT A;  4FK2 A;  1V4T A;  4CJF A;  1JLC A;  1RT2 A;  3E9L A;  3DLR A;  4XH5 A;  4LH4 A;  1K8K A;  1GOB A;  1SS6 A;  5AFU A;  3VQB A;  4RW7 A;  4YOV A;  1FKO A;  1WSH A;  3OYD A;  1U04 A;  2Q0U A;  4E7L A;  4CES A;  4C23 A;  2JWL A;  5I3U A;  4PKI A;  4KHU A;  4B9L A;  1L3V A;  4LF5 K;  1O1W A;  4BG9 A;  1BWF O;  3WXK A;  2JLE A;  2KFZ A;  4LF9 K;  3MN7 A;  2V7Z A;  1RDD A;  1ZBL A;  4DV3 K;  1FK9 A;  5H1S Q;  3UKU A;  3N4Q A;  4CK2 A;  2YHY A;  3VOV A;  1RIL A;  3OS2 A;  4OPA A;  1RTH A;  4KH6 A;  5T7B A;  4DF8 A;  3HPH A;  3SPY A;  3KKS A;  1GLA G;  1VSF A;  3CG7 A;  4LY7 A;  1TK0 A;  3OYC A;  1BUP A;  4JHD B;  3H1Q A;  3SUP A;  3ID6 A;  2A6A A;  4C8M A;  1MWM A;  4AM6 A;  1NJI O;  5FPN A;  1FXX A;  1NMN A;  3P38 A;  3DWL A;  3AAR A;  3G6E N;  3C6T A;  1ZXO A;  2QW9 A;  1V4S A;  3ENO A;  3JAM O;  4KH5 A;  3RVC A;  3UKR B;  4O44 A;  4BRM A;  4B9T A;  2G8U A;  1LAV A;  3VGK A;  4JRQ A;  3ZEU B;  4MLH A;  5C42 A;  5AFU H;  5CZ1 A;  4WQ5 A;  3UE5 A;  1ZC6 A;  5M1Q A;  5J2M A;  3PIP L;  5AZJ B;  2CGK A;  4HUG A;  3VER A;  4CJV A;  5AQW A;  1NU0 A;  4CGJ A;  4FJ7 A;  2OPS A;  2FBX A;  4CEB A;  1ATS A;  1OVQ A;  1N6Q A;  3DYA A;  1T05 A;  3DI6 A;  3VQA A;  2NRX A;  5TKW A;  2RN2 A;  4FO0 A;  3NF9 A;  5F1X A;  4QCL A;  5GAH P;  3AO4 A;  1T7P A;  3K2P A;  4E1J A;  3D0P A;  3A8Y A;  1VQM N;  4KB1 A;  1TYQ B;  4YOU A;  1VQK N;  1S1T A;  1WAJ A;  4QAG A;  1IBK K;  4DLE A;  1VAZ A;  3OW2 M;  2RPI A;  3SQ4 A;  3TPQ A;  1T8E A;  1B92 A;  2ITM A;  2VQF K;  4YOR A;  1CLQ A;  1VQL N;  3C95 A;  5AR0 A;  3L4Q A;  3S3N A;  1B9F A;  3T69 A;  5J2N A;  4FJH A;  4CD3 A;  4DKW A;  1RT1 A;  3IMX A;  4Z0U A;  4B8C A;  4O0I A;  3AVC A;  4B08 A;  5CYM A;  4IOC L;  5JEN A;  3M6G A;  1TK8 A;  3HOT A;  1NGA A;  2ZGY A;  1HPZ A;  2RF2 A;  3S5T A;  2E1Z A;  4H0T B;  1YHQ N;  4CJ7 A;  3O9S A;  3CJC A;  5BRD A;  4FLY A;  1RBT A;  4LC9 B;  2UU9 K;  2E4L A;  1T03 A;  3AY9 A;  3ZET B;  3KLG A;  1GLD G;  2VWB A;  3KVG A;  4CED A;  3U6F A;  5JVG L;  5I42 A;  4BRK A;  1VSK A;  4H5W A;  4LSN A;  4H5R A;  3CF5 L;  3G0Z A;  4CZF A;  3QEW A;  3LM9 A;  4EHU A;  3TAQ A;  4CW7 B;  2UYT A;  3C65 A;  4A5A A;  5GAG P;  3AGK A;  3OYK A;  1K8K B;  1NK8 A;  2BDP A;  4H0P A;  4OPH A;  4CIE A;  4JNE A;  5SWM A;  3SQ1 A;  4JKH A;  2IOC A;  3DLL L;  4QOZ B;  3EE8 A;  4NYF A;  3GL1 A;  4BGA A;  4FLZ A;  3R1X A;  1NJX A;  4M3U A;  3JSM A;  4K41 A;  3NE6 A;  1N5Y A;  3HXM A;  2Q36 A;  3SUO A;  4FJL A;  1Y64 A;  5AQV A;  4JI1 K;  3ULE A;  1ZBH A;  1HJO A;  3MK6 A;  4JKA A;  2DFH A;  3THX A;  1Q86 O;  3VQ4 A;  2D0P A;  4JN4 A;  3NH1 A;  3LM2 A;  1VSM A;  1S9E A;  3ZEU A;  1U49 A;  1TKD A;  3AVA A;  4LSL A;  4DG1 A;  1BIU A;  5JLF A;  4DSK A;  3I33 A;  2IAJ A;  4JYA K;  2QWO A;  4DTM A;  1YUW A;  1R0A A;  4FLU A;  4AQY K;  4BR7 A;  4XH4 A;  4BC5 A;  3MAQ A;  4DUY K;  3DXK B;  3V9Z A;  1HKC A;  1HNI A;  1SL2 A;  4B1V A;  2O8D B;  3E9O A;  1S5J A;  2F96 A;  4DR6 K;  5AQM A;  4FSV A;  3NH0 A;  4CZM A;  1S1V A;  2YCH A;  3VA0 A;  4WFN L;  3TAE A;  3OVN A;  3CCE N;  1WN7 A;  3BF3 A;  1YTU A;  2FSN A;  3KLE A;  1Q8I A;  2QI2 A;  3DMJ A;  3P83 D;  5DMR A;  4PQU A;  4B8A B;  3TAP A;  2E8A A;  1S72 N;  1HQE A;  1IO2 A;  1NGD A;  2WOM A;  5AQY A;  3ZT0 A;  4K8X A;  4BR5 A;  2O8B A;  1KFS A;  4YOX A;  3VTH A;  1KLN A;  5GAD P;  3BF1 A;  3ZSQ A;  4N47 A;  1QHT A;  2WC9 A;  4CD1 A;  5JLH A;  3K9K A;  4A2B A;  5MLC Q;  4WYB A;  3T1Y K;  4GV3 A;  1C1C A;  4LF8 K;  4BGB A;  4DV4 K;  4CBU A;  3WXJ A;  1LWF A;  5JS2 A;  4JEP A;  4Q0B A;  4CJQ A;  3M3Z A;  4OKJ A;  4BQL A;  3QDK A;  1UOC A;  4FK0 A;  3TSQ A;  4JI0 K;  1SZ2 A;  4AHS A;  3VQP A;  3KK3 A;  4BC3 A;  1NOZ A;  4F8R A;  4FJ8 A;  4F9O A;  3TTF A;  2PFU A;  4H5T A;  3PX4 A;  2FLO A;  3J8A A;  2RE2 A;  1S3X A;  1YIJ N;  4IJN A;  3V9X A;  3ZSW A;  3P4I A;  4FJN A;  1ZBS A;  1NGF A;  1UAX A;  3VQ5 A;  5HRN A;  4EP5 A;  4CZJ A;  5B8H A;  2YJE A;  2HND A;  4CJU A;  1DTQ A;  3JS6 A;  4B9S A;  2P9I A;  1EP4 A;  4ISE A;  1SL0 A;  2UXC K;  4CK3 A;  3ZYY X;  4FWK A;  1HYV A;  3THW B;  3VMF B;  4HVJ A;  5C2D A;  4KI4 A;  3FGU A;  3K59 A;  4HUF A;  4IO9 L;  1E4G T;  4ELU A;  3M8P A;  3NDK A;  1BI4 B;  2XY6 A;  4CIF A;  1BGX T;  4I9Q A;  1WSG A;  3D2F A;  1MDU B;  2GV9 A;  2OPQ A;  1SUQ A;  5BR9 A;  3OYE A;  2VGN A;  2B6A A;  5FPE A;  4PA1 A;  4CJK A;  4BEB A;  2G8H A;  4JI3 K;  3QO9 A;  2UXB K;  1C0U A;  3OYG A;  3ZSO A;  2A41 A;  3CD6 N;  3AVL A;  2HF4 A;  5KRT A;  4CGI A;  3LP0 A;  3CYG A;  1WSJ A;  4CEE A;  2VG7 A;  1KC8 O;  3G10 A;  4JKE A;  4CFD A;  4AM7 A;  3CQ8 A;  3HZ6 A;  1YJ9 N;  2FBT A;  4FVM A;  2VWK A;  1SKW A;  2ASM A;  4BWM A;  3PO4 A;  2HB5 A;  4CZL A;  4JKC A;  2V51 B;  3VEX A;  4H0Y B;  4FLW A;  1EQY A;  1NK0 A;  4W5R A;  2XY8 A;  1YJW N;  3MCA B;  5AQI A;  4FW1 A;  4H03 B;  3HP9 A;  2AJQ A;  4J2E A;  1NGC A;  3PV8 A;  1NGI A;  3TAF A;  3LDL A;  1ILY A;  3KJV A;  2OZM A;  1TAU A;  3HP6 A;  4I2P A;  3FZL A;  1N34 K;  3EZW A;  4NXN K;  1RT3 A;  5AQZ A;  3AAP A;  2HBL A;  3QEX A;  4CJS A;  1D8Y A;  3O08 A;  4L3Q A;  3O9U A;  4JI4 K;  3NF8 A;  4Q5V A;  4H0O A;  4JLH A;  4IG0 A;  4K42 A;  2P9P A;  4CJ3 A;  4CK1 A;  4EP4 A;  4IZ9 A;  1UA1 A;  2Z1G A;  4ILJ A;  1A5V A;  5J2P A;  1QZ6 A;  1S22 A;  4CJL A;  4MDB A;  2HVI A;  5KGX A;  2HHW A;  4GV9 A;  3CCQ N;  1KQS M;  3NHG A;  1X3M A;  1N32 K;  4N76 A;  2QEX N;  2RHK A;  3CM6 A;  5IT9 O;  4O8U A;  1GOC A;  4CF1 A;  4CF2 A;  3CJ1 A;  5LL6 Z;  1IKX A;  2E1Y A;  4OO1 J;  4YOW A;  1KFD A;  4BY9 C;  4CHN A;  1VK0 A;  3PX0 A;  2O8E A;  1VSH A;  3WNG A;  2P9I B;  4F2S A;  2ZF5 O;  5LMN K;  1Z25 A;  3Q7C A;  3RMC A;  1SKR A;  4BRO A;  1HMV A;  3T3F A;  3AA4 A;  4DR2 K;  3SQ0 A;  3FFK B;  3BZK A;  3NGZ A;  5AQT A;  3AA2 A;  4BC2 A;  1IG9 A;  1HKB A;  2ZQB A;  4JI6 K;  2HW3 A;  4KHY A;  4BDY A;  3EL2 A;  3L3V A;  5C25 A;  3O3G A;  2QWL A;  2ZWH A;  3DOK A;  5M1K A;  1QHA A;  2XO7 A;  3V1Q A;  4YY3 K;  4OPJ A;  3C6U A;  4W5N A;  4BR2 A;  4ELT A;  1EKE A;  3OA9 A;  1N8R O;  4C1N I;  4O8K A;  1XC9 A;  4CGF A;  1JCF A;  4DU3 A;  2KFN A;  2Q2R A;  4LFC K;  3ZSY A;  1QSS A;  3EYZ A;  5BPN A;  3VQ8 A;  1JLQ A;  1XUP O;  4CJT A;  4LFB K;  2CGJ A;  2YHB A;  4CF8 A;  3VTI A;  3H1V X;  1E4F T;  4IBN A;  1XNR K;  3A2F A;  2QK9 A;  4AH9 A;  4Z4H A;  1HYZ A;  4J2B A;  1BI4 A;  4CE9 A;  4IEE A;  4BRF A;  4DS5 A;  4DR3 K;  2V7Y A;  4Z4E A;  4XEI A;  2Q1N A;  4DS4 A;  1OH7 A;  4H0V B;  3I0S A;  2YNI A;  4FWQ A;  3FE1 A;  3RR7 A;  3M8Q A;  5M1P A;  5KRS A;  2W42 A;  3B6O A;  4AHU A;  4CHO A;  3RMB A;  2NRR A;  2Q3S A;  4B9V A;  4ELV A;  4FZX C;  1IH7 A;  3VQ7 A;  3HBT A;  4KTQ A;  2P9U B;  4AHV A;  1RGI A;  2KLA A;  1OH5 A;  3VEZ A;  4HHT A;  1KVB A;  1X9J A;  1NBW A;  3ZSZ A;  4OGC A;  3V1R A;  4DV7 K;  3O9R A;  4BEC A;  4KHS A;  5HLF A;  2BGG A;  4K0K K;  4JI8 K;  1JCG A;  3QIN A;  1WSE A;  2IS3 A;  3L2W A;  1S1W A;  1Z6R A;  4B3R K;  3SJH A;  5AQF A;  3ZET A;  1MWK A;  4HCB A;  4ZTJ A;  3D2E B;  1TVR A;  3RMA A;  4CHY A;  4GMJ B;  3BUZ B;  3F9K A;  1C0T A;  1JLF A;  3SMP A;  2HHS A;  3MED A;  4YOT A;  2OZS A;  3K57 A;  3ATV A;  3KHY A;  2QM1 A;  2ZJP L;  3QLH A;  3OTO K;  1JCE A;  4DTJ A;  2OAN A;  3A5O C;  3KD1 E;  3QES A;  1VSJ A;  5AQN A;  2KQ2 A;  1YTA A;  5FPM A;  5EXW A;  3SAH A;  2ASP A;  3QBW A;  3PX6 A;  1Q9Y A;  5C12 A;  4BRP A;  1FKP A;  4N5S A;  1RTJ A;  1QVG M;  3BDP A;  2NZT A;  3ZT4 A;  3CCJ N;  2OA8 A;  1A5W A;  1RBS A;  2BH1 A;  4DWI A;  2HMI A;  5EX5 A;  4JI2 K;  1XC3 A;  3DXM B;  1TKT A;  1EWR A;  3AVK A;  5F2R A;  3AAQ A;  3SCX A;  5CZ2 A;  1TV6 A;  1U4B A;  2E6M A;  1RTI A;  4FWP A;  3AVM A;  3ULD A;  2FXU A;  4OKE A;  3G4S N;  3CQY A;  3VGM A;  3V4I A;  3L8B A;  2H3G X;  3QBX A;  3K9J A;  4DMN A;  1ZBI A;  4DTS A;  1CZ9 A;  4CER A;  4Y0W A;  1T6D A;  4IFV A;  5FRO A;  3VEV A;  1O13 A;  4BAC A;  4JD2 A;  3CJB A;  1REV A;  1XQS C;  4F3O A;  1EET A;  3KLH A;  2D1K A;  5HRR A;  3KWI A;  5ELZ A;  1S9G A;  2KKZ A;  2XHB A;  2FF3 B;  1FW6 A;  3CCU N;  1JL1 A;  3LDS A;  5AZI A;  1VSI A;  3VEN A;  3J7Z O;  3DRS A;  3AO5 A;  1QQN A;  2BE2 A;  1GLB G;  4MLE A;  2WFB A;  3TAG A;  1IG8 A;  2YHW A;  3HTV A;  2WTU A;  3AVF A;  4I6M B;  4F3T A;  1N36 K;  3T7Z A;  3DAW A;  3WQU A;  1DKG D;  1TL1 A;  2OCE A;  1IJJ A;  4KRF A;  4RW4 A;  3VQE A;  1TUY A;  5AZI B;  1D9D A;  4O55 A;  3SPZ A;  3C7N A;  2HHQ A;  1OH6 A;  4OPK A;  5AZJ A;  4AHR A;  5GIO A;  1J5E K;  2C1I A;  4MQ3 A;  2ZGZ A;  1OKJ A;  4FM2 A;  1TUU A;  4KI6 A;  3U9Z A;  2A40 A;  4X66 K;  3QEP A;  2UUC K;  4WCE L;  3G25 A;  4PY5 A;  5IWA K;  4CJ4 A;  4FK4 A;  3VQQ A;  3HPO A;  2WUS A;  4B1X B;  1YXQ A;  5FRM A;  4RW6 A;  1EWQ A;  4DTO A;  1Q81 O;  1HJR A;  4BG8 A;  1XI1 A;  4JD2 B;  4CZI A;  4M3W A;  5EY4 A;  3VF6 A;  2GEM A;  1T6C A;  1U6Z A;  2HBJ A;  4FCY A;  4FJX A;  1BCO A;  3ASM A;  3V9S A;  3V1O A;  2E6L A;  4CFB A;  1ATN A;  3N4P A;  2KTQ A;  3TR8 A;  3QIP A;  2ZJR L;  4HCC A;  5HP1 A;  5KQ8 A;  3AVN A;  3ULE B;  4GKJ K;  3VN5 A;  2EWS A;  2KZZ A;  4A62 A;  4LH5 A;  4MDA A;  4I6M A;  3A5N C;  4WF9 L;  3TU5 A;  4C1N K;  4WFA L;  2P9N A;  5K14 A;  4TSX A;  3B8A X;  2R7Y A;  2A1R A;  2E88 A;  2HHU A;  3L2V A;  1W0H A;  2NRW A;  3ZX2 A;  2P51 A;  4R79 A;  3SUQ A;  1VQ7 N;  2G8W A;  4OKK A;  4W5Q A;  2OPP A;  3ENH A;  1NK9 A;  1WSF A;  3EN9 A;  4M3T A;  2W41 A;  4CZE A;  5GIN A;  3K5M A;  2NUB A;  4BRE A;  4KV8 A;  4M45 A;  3LWL A;  1U48 A;  3NMU A;  4JRP A;  3MX2 A;  3NGI A;  3DLK A;  1QTM A;  1BDG A;  1KCF A;  3SLC A;  4RCH A;  1KLM A;  1X1P A;  3PO5 A;  3VF2 A;  4I9L A;  3TTC A;  3KTQ A;  1CXU A;  3Q7B A;  3U3G A;  1DGK N;  4FWO A;  4KBO A;  3W0L A;  1MA9 B;  5LY3 A;  3QML A;  3CQX A;  2P1J A;  5M1F A;  2HHI A;  3K58 A;  4CBX A;  4DQQ A;  5DK5 A;  4M42 A;  4IOA L;  4Y1C A;  3NGY A;  2D0C A;  4RW8 A;  4CGD A;  3VEY A;  1NK6 A;  3NVK A;  3HST B;  5JMV A;  3D45 A;  2W00 A;  1KVC A;  4E72 A;  3AV9 A;  1L3U A;  3LAK A;  5LMU K;  2HST A;  3LAM A;  4CHQ A;  3R9P A;  3CCV N;  1YI2 N;  4FZY A;  1CZB A;  5HL7 L;  2BUP A;  3AO3 A;  1BIZ A;  4IG3 A;  1S1U A;  4C8O A;  4BE1 A;  4YNQ A;  5ADX H;  4QS9 A;  4IO8 A;  4JKD A;  5LJW A;  4NLB A;  2C1G A;  5BN8 A;  4UQG A;  5KQD A;  3OYM A;  3BGR A;  3ZCM A;  4PWD A;  3CER A;  4BRN A;  4DHY A;  2I7N A;  2IGI A;  4CF0 A;  4DSE A;  4X65 K;  4EZ9 A;  5BPL A;  4IWV A;  3C94 A;  4X64 K;  4CVN E;  4RW9 A;  2DFF A;  1GLF O;  3O1B A;  2HMP A;  2PYJ A;  4RG8 A;  1G15 A;  4NCA A;  1WOQ A;  4DFJ A;  5AQG A;  1WAF A;  4O5F A;  2D4W A;  2ZE2 A;  4BWJ A;  4BRH A;  1SQK A;  2VCP A;  4M7X A;  3C7N B;  2NLX A;  3VEO A;  1KSP A;  4FOI A;  1NGG A;  2FF6 A;  4KH4 A;  2FSJ A;  1KD1 O;  3C6A A;  3KK1 A;  2I7P A;  3MWP A;  5AQS A;  5KI6 A;  2P9K A;  3M1F A;  4IJA A;  3EY1 A;  3UKU B;  1VQ6 N;  4ZHR A;  4CEO A;  3OYL A;  2B4J A;  2A3Z A;  3VQ9 A;  4DTR A;  2G8I A;  4JS4 A;  1NJW A;  1BO5 O;  2KW4 A;  4FWR A;  3OS1 A;  4KTW A;  3L2U A;  4PL8 A;  1I39 A;  1NM1 A;  3HJF A;  1SV5 A;  4E1M A;  4C8K A;  1VSL A;  3OBY A;  3ZSR A;  1J53 A;  2HBM A;  4DFP A;  4JK8 A;  4E3S A;  1J9A A;  1RDA A;  2I5J A;  2HVH A;  2X6S A;  3O3H A;  1NG9 A;  3J7Y P;  4IXC A;  4CI6 A;  4PL7 A;  4FL9 A;  2HBK A;  3MDQ A;  3MWT A;  3L2Q A;  4DQR A;  3SUN A;  2QWP A;  1HX1 A;  1RCH A;  5JS1 A;  1RDU A;  1BQN A;  3KK2 A;  1W97 L;  3E01 A;  4I7F A;  5A2Q O;  2GBZ A;  1XHX A;  4J8F A;  4DR7 K;  3SI6 A;  2NNW A;  3WEE B;  2YV0 X;  4LD0 A;  1GLC G;  4BC4 A;  3KLF A;  2AP1 A;  1F21 A;  1RDB A;  2HHV A;  3FZM A;  3EO3 A;  1YIT N;  5ADX A;  1C6V A;  4RWT A;  4KHN A;  1U47 A;  3DXM A;  3BP8 A;  2WBN A;  1HRH A;  1QSY A;  1TKZ A;  4BDP A;  4BE0 A;  3CCM N;  2PZS A;  2BAN A;  3MXJ A;  3LDP A;  5F0X A;  1VQ8 N;  3LL3 A;  1HLU A;  3AVB A;  5HRO A;  4E7J A;  2F7T A;  4C8N A;  4U7B A;  4J2A A;  4YDU A;  2QA4 N;  4CGG A;  4CEZ A;  1RT6 A;  4CGH A;  1NGH A;  2IC3 A;  4JKG A;  4U67 L;  1VQP N;  2YNG A;  3A5M C;  5CE3 A;  5M1O A;  3J7A P;  4YDU C;  4NCG A;  3TAR A;  4EZ6 A;  2E5L K;  2F9T A;  5AQP A;  3E66 A;  4CJE A;  3D6R A;  3TAB A;  2G8F A;  1NWK A;  3HM9 A;  1NMD A;  4IOX A;  4G1Q A;  1KAX A;  1M1K O;  1TAQ A;  1C1B A;  3CIP A;  3R8E A;  4KRE A;  4B3O A;  3QFP A;  3O4Q A;  4CEF A;  4NO7 A;  4JI7 K;  3H3N O;  4Z94 A;  4CJ5 A;  4G9Z A;  1TK5 A;  3KIO A;  4C8L A;  3ENB A;  1RT5 A;  1GLE G;  3CYM A;  3K5O A;  3UB5 A;  4DV1 K;  1NKC A;  4A59 A;  4CJW A;  1S1X A;  1Y97 A;  1NOY A;  4E19 A;  3NAE A;  2HHX A;  3THX B;  4AF1 A;  3CCS N;  4CJP A;  2P5O A;  3VQ6 A;  3HVR A;  3PIO L;  3A0I X;  1HPM A;  2OTJ N;  2GUI A;  4H0X B;  4DQ8 A;  3S9H A;  3H6E A;  3FLC O;  3I8B A;  2VWJ A;  3KD5 E;  1HR0 K;  4K43 A;  3LZJ A;  3CC7 N;  4F4K A;  1NKE A;  1HKG A;  2XY7 A;  4EFH A;  3LDO A;  1RT4 A;  1OH8 A;  5SZT A;  2W40 A;  4MO4 A;  3OJU A;  3CXC M;  4DSJ A;  3P31 A;  2YKN A;  3ISN C;  2OPR A;  5M1N A;  2KZM A;  1KXP A;  5CYQ A;  2VQE K;  1K6Y A;  3W3D A;  2F9W A;  1IKY A;  2YHA A;  3GBT A;  3TWH A;  1W9H A;  2GWK A;  2O8F B;  1XWL A;  4PKG A;  4LFA K;  3U4L A;  3PSI A;  4YFU A;  3NCI A;  3RTV A;  3SZ2 A;  4V19 S;  5C0Y A;  5E26 A;  1JLG A;  5J2Q A;  3C6H A;  3FR0 A;  4CFC A;  4BE2 A;  5CY4 A;  3DLG A;  3NVM A;  2OTL N;  3JYT A;  4LF6 K;  1EX4 A;  2O4I A;  5D3G A;  3CJA A;  3LPT A;  1VSD A;  1IKW A;  3RRG A;  2X74 A;  3KLI A;  5CHI A;  5AQL A;  2QWQ A;  4CBW A;  1UA0 A;  3HO1 A;  3MXM A;  3PSF A;  1QE1 A;  3A5L C;  3T1A A;  2PBD A;  3CET A;  3AGR A;  3I55 N;  4LF4 K;  1IBM K;  3SBT A;  3ZSV A;  5AQX A;  3O9Q A;  1ITG A;  2YI1 A;  1EXQ A;  1Q82 O;  4EIA A;  4BE7 B;  3D2F B;  2DFE A;  4E1N A;  3QEV A;  3OYF A;  2GEL A;  2Q97 A;  4JI5 K;  1QQO A;  3U9D A;  1I3A A;  1LW2 A;  1ZYQ A;  1JJ2 M;  4GVE A;  1C1A A;  4CF9 A;  4OVL A;  1YAG A;  4FM0 A;  3DLB A;  4FJK A;  1RDC A;  4CEA A;  4NB4 A;  2AA4 A;  5BRE A;  1VQ5 N;  1IKV A;  4E0D A;  2VGM A;  4PUO A;  2HNZ A;  1DT9 A;  3K0S A;  1VHX A;  1TL3 A;  4DFM A;  3AA5 X;  4OJR A;  4N56 A;  1K8A O;  5C10 A;  1D9F A;  1L3S A;  2D0B A;  3HYF A;  4ICL A;  4O4G A;  1A5X A;  4CIG A;  3H46 O;  3CFO A;  5C15 A;  1NGJ A;  2Z1H A;  4FWL A;  4BR4 A;  1W7A A;  1VSE A;  2UXD K;  3M8R A;  3OJS A;  3OYH A;  3O9T A;  4B1Z A;  1J54 A;  2P9S B;  2QXF A;  3F5T A;  3R3L A;  3QNN A;  2Q0R A;  3LP3 A;  2IVN A;  5HOO A;  3UIQ A;  4B9M A;  3I0R A;  4FLV A;  2ZJQ L;  3T1H K;  2GUP A;  4FOE A;  3J80 O;  3H3O B;  4KB0 A;  3SQ2 A;  2YKM A;  3DM2 A;  2P9L A;  4GVM A;  3LPU A;  5FLX O;  4B1W B;  4NYN A;  3WNF A;  4HTU A;  3O6W A;  1LW0 A;  4IFE A;  2GX9 A;  3C0B A;  3HPG A;  5AQO A;  3EZ5 A;  3JXU A;  3LDN A;  1BA1 A;  4DR1 K;  1W2B M;  4CHP A;  3CM5 A;  1KAZ A;  4OLA A;  4KHP K;  5E41 A;  3HRG A;  3MN6 A;  3MN9 A;  2ASO A;  3QFU A;  2P9U A;  3SMS A;  1ATR A;  2QTD A;  4BRG A;  2RKI A;  1IV0 A;  3MEC A;  4W5O A;  4IEI A;  5BRF A;  3WNE A;  2HHH K;  4JKF A;  4WE1 A;  3CCR N;  3BY5 A;  1ASV A;  3L2R A;  3V6D A;  3TAM A;  4FLX A;  4M63 C;  2VG6 A;  3SJJ A;  1SKS A;  1HUX A;  5AQR A;  4R5P A;  4DCH A;  2UUA K;  1B9D A;  4DTX A;  4CJR A;  4DLG A;  4FWM A;  3O3F A;  2W6K A;  3CMA N;  2QWM A;  1JXB A;  4IKF A;  3TI0 A;  5HRS A;  3CC4 N;  4DR4 K;  3WEE A;  5GIP A;  2O8B B;  4XJX A;  4JK7 A;  3FFI A;  5TKY A;  3OYB A;  1HNW K;  2PY5 A;  5CR4 A;  4GNI A;  3ZT2 A;  3O5B A;  4N41 A;  1BOT O;  3CPW M;  4WQ4 A;  3WXM B;  3S41 A;  3ZSX A;  3ZLJ A;  1JXE A;  2G8K A;  1BG3 A;  1LOT B;  4FVU A;  1RBV A;  1QVF M;  2ZD1 A;  4QS7 A;  1HQU A;  4DV2 K;  3LAN A;  5HRP A;  2Y1I A;  1HNV A;  1KRP A;  4OGE A;  3WQT A;  2A42 A;  2NRT A;  4AHC A;  4FXD A;  3K5L A;  3ITH A;  4H8K A;  3PUF A;  3LDQ A;  4JK9 A;  3TTD A;  2GWJ A;  3P39 A;  1WLJ A;  4JKB A;  1HNX K;  1WUA A;  4FJ5 A;  3KZB A;  1ASU A;  1YVU A;  2E2P A;  1SL1 A;  1RFQ A;  3I56 N;  1RNH A;  2Z1I A;  4NXM K;  3RSE A;  1P8Z A;  1VQO N;  4OX9 K;  2ZM6 K;  3ZT1 A;  5FDL A;  3NBP A;  1QQM A;  1VRU A;  3FZK A;  3CC2 N;  4IDK A;  4XH1 A;  1JL2 A;  4Z4I A;  3CPE A;  2DPN A;  1YJN N;  1U45 A;  4AIL C;  4KKO A;  4O5B A;  1HYS A;  3O1W A;  4H4M A;  5HBM A;  4DB3 A;  3AVG A;  1IBL K;  1CXQ A;  3RRH A;  2OYQ A;  4DSL A;  3RMD A;  1NLV A;  1NGE A;  3AVJ A;  3QER A;  3E9P A;  5BN9 A;  4KHQ A;  1KTQ A;  5KGW A;  1ASW A;  2E2Q A;  4FM1 A;  4KO0 A;  3AA3 A;  3M5R A;  2GTD A;  2NRH A;  3OYN A;  4FWS A;  4E89 A;  3SV4 A;  3L4I A;  1WB9 A;  4JS5 A;  4FZZ A;  5FPD A;  3NF6 A;  4KFB A;  4DV5 K;  4WQ5 C;  4YHH K;  3THV A;  2PAV A;  3HL8 A;  1MU2 A;  1BQM A;  3R6M A;  1QZ5 A;  2YX6 A;  3SBG A;  1LCU A;  3EEQ A;  3IG1 A;  4I2Q A;  1RTD A;  1GLL O;  2PYL A;  3HI0 A;  3P5J A;  4E7K A;  4HWI A;  3O8M A;  3KWG A;  2P9L B;  3L0Q A;  4H4O A;  4BR9 A;  3TAN A;  4B9Q A;  3F9M A;  3HVT A;  2YHX A;  1NK4 A;  1LV5 A;  3RWU A;  4HUE A;  1RT7 A;  2QWN A;  5EVZ A;  3B6P A;  3QEI A;  4DV6 K;  3DOL A;  3CJ9 A;  5GAE P;  3SK3 A;  3VET A;  3IFR A;  1P90 A;  2QKK A;  4DR5 K;  3UKR A;  3THY B;  1BL3 A;  3AVI A;  4HTL A;  1R59 O;  2F4V K;  3OBW A;  1I94 K;  4BRC A;  2XY5 A;  3QNO A;  3BEX A;  2DTU A;  1L5U A;  4M3Z A;  1Q18 A;  1X9S A;  3GE1 A;  2JGU A;  3FZH A;  3F2K A;  1XMQ K;  2JWK A;  3DRP A;  3WUH A;  1RBR A;  3GG4 A;  4PHT X;  5BR8 K;  3MCP A;  4M3X A;  3LAL A;  5DM7 L;  1QSL A;  3SAG A;  3L3U A;  4CCH A;  3ALY A;  2HOE A;  1WNS A;  3DLE A;  4EAH D;  3O4W A;  4KPY A;  3V81 A;  1S6P A;  1LWC A;  2QXL A;  2CH5 A;  4DUZ K;  3MXI A;  2ATQ A;  2B5J A;  3AO2 A;  1H1V A;  1KAY A;  4IDH A;  5JIC A;  3RR8 A;  3OY9 A;  4J2D A;  1D4X A;  4W5T A;  4KHW A;  1X9M A;  3OYJ A;  4GW6 A;  3V9W A;  2KHO A;  4JAX A;  3SAF A;  4AHT A;  1LAW A;  2IVO A;  5BPM A;  1K73 O;  4CZG A;  3NH2 A;  1Q9X A;  3SNN A;  1T44 A;  1ZBF A;  2A1S A;  4FW2 A;  3MEE A;  4JV5 K;  2P5G A;  3EE9 A;  1Q7Y O;  1LWE A;  2E20 A;  3EKS A;  2P9N B;  4A5B A;  5AQQ A;  2G8V A;  3VEW A;  4ISG A;  2IVP A;  3IRX A;  4Z4F A;  1JLB A;  4GY2 B;  2LSN A;  1G99 A;  4H5V A;  4FLT A;  3DLH A;  2ITG A;  3U3Y A;  2V52 B;  1D5A A;  5AQJ A;  1E3M A;  3ZX3 A;  4DTN A;  1JKH A;  1N33 K;  4CEQ A;  3KKR A;  5EU7 A;  1CZA N;  2NRV A;  3CME N;  3E1Y A;  4X62 K;  4DV0 K;  1WBB A;  4ILG B;  3O80 A;  2P9K B;  2F8T A;  2HF3 A;  2O4G A;  4BRL A;  3FZF A;  2VYP A;  1X3N A;  4DFK A;  2FSK A;  4E7I A;  1WSI A;  5I9E B;  4F2R A;  5LJV A;  1TKX A;  4B9U A;  4BDZ A;  3WT0 A;  4WFB L;  1NJY A;  3RSE B;  4NLC A;  4MO5 A;  5AQK A;  4OLB A;  4FJI A;  4H5N A;  4FJG A;  5FRN A;  1C0F A;  3AVH A;  3NFA A;  4IFY A;  4L8R B;  4ILH A;  1XMO K;  3U8X A;  5J1E A;  1NJZ A;  2X6N A;  3HM8 A;  2VG5 A;  3QB0 A;  2CH6 A;  3AO1 A;  3MEG A;  3SYZ A;  4A57 A;  2P9P B;  1TGO A;  3NF7 A;  3S3O A;  1SAZ A;  2ETJ A;  1YVN A;  1NK7 A;  2F8S A;  1XHZ A;  1QS4 A;  5BRH A;  3IAY A;  1BA0 A;  5JVH L;  4DTU A;  1DLO A;  1XNQ K;  3VGL A;  2D0O A;  1UWB A;  3IKM A;  4Z4G A;  1BU6 O;  3SV3 A;  5KPZ A;  4GV6 A;  4O0J A;  3THW A;  2QWR A;  1TYQ A;  1RBU A;  3O4N A;  1NK5 A;  1DEJ A;  3VQD A;  2WON A;  2X78 A;  4ID1 A;  1JLE A;  5KPR A;  3F73 A;  4DTP A;  4CFA A;  1L3T A;  4BVP A;  1ESV A;  3MN5 A;  3DXK A;  4BQZ A;  1HNZ K;  3QIO A;  3IS9 A;  1Z05 A;  3CCL N;  1YF5 L;  3TSP A;  4A61 A;  3IUC A;  4MFB A;  3HK2 A;  1FJG K;  2IIR A;  1NGB A;  2DY4 A;  1T3V A;  5AQH A;  4ISF A;  3GDQ A;  1Z26 A;  4B1Y B;  3HT3 A;  1X9W A;  5AQU A;  4A2A A;  1BCM A;  1S6Q A;  2Z1J A;  3OS0 A;  1VQ9 N;  2E2N A;  3HSC A;  2Y1J A;  4KTZ A;  4B3T K;  1JLA A;  3MX5 A;  3V9U A;  4FJ9 A;  5DM6 L;  1GOA A;  2D0A A;  4BVO A;  4M3R A;  2HNY A;  4WQ4 C;  3ID8 A;  5AJ3 K;  1J5O A;  1C0G A;  4M41 A;  3T19 A;  1M90 O;  4PKH A;  4CHZ A;  4BRA A;  3D7E O;  1BHL A;  3VF4 A;  3J81 O;  5EOY A;  1U2V A;  4B3M K;  3CI5 A;  3CFP A;  4CZK A;  4B1U B;  3DRR A;  2YJF A;  3CJ7 A;  2O8E B;  3CHW A;  4GKK K;  3VQC A;  3S3M A;  2O8D A;  3DJC A;  3OYI A;  1ZBU A;  4LF7 K;  1KVA A;  3G71 N;  2BTF A;  3LP1 A;  4Y1D A;  2FBV A;  2IDO A;  3D2E A;  3L6Q A;  4B9N A;  1VQN N;  2UUB K;  4JKG B;  1EO1 A;  3KK7 A;  4FPB A;  4KAZ A;  3K5N A;  4ZTF A;  1U2V B;  4DQP A;  4DF4 A;  1VQ4 N;  1DTT A;  4RTF D;  2P9S A;  3H08 A;  3THY A;  4DU1 A;  1YT3 A;  4FYD A;  3EKU A;  4K8Z A;  1K9M O;  2FC0 A;  4DSI A;  2EX3 A;  1NKB A;  4YOY A;  3BZC A;  4B3S K;  4XIU A;  3QET A;  4FJM A;  1QQC A;  1VRT A;  2CGL A;  3PY8 A;  5C24 A;  2O8C A;  4DSF A;  2NRZ A;  4BR0 A;  3H45 C;  4E7H A;  4NCB A;  4DQS A;  1RDW X;  3LZI A;  4BRD A;  4EHT A;  3VA3 A;  4M3Y A;  4CEC A;  3OHR A;  3LP2 A;  4K25 A;  4UY8 O;  3P1G A;  3WXL A;  4Z4C A;  1J6Z A;  3ATU A;  1WBD A;  3GOI A;  3CFR A;  3QIC A;  3HOS A;  4FJJ A;  3ZT3 A;  5E84 A;  5KTQ A;  4CZH A;  3ZX0 A;  4DU4 A;  4BRQ A;  3MMV A;  4FPA A;  2HHT A;  3OYA A;  2YNF A;  4BRI A;  3I8D A;  2QKB A;  2O8C B;  1OVY A;  4DQI A;  3WNH A;  1NNE A;  2XRI A;  3LWM A;  5C2F A;  1C0M A;  3M8S A;  4FWN A;  4M7Y A;  2FBY A;  2E2O A;  2Q31 A;  4ID5 A;  4JHD A;  2W6L A;  3IDH A;  2D5R A;  3TSU A;  3VPZ A;  2YNH A;  2O8F A;  2J4R A;  3VES A;  1GLJ O;  2EHG A;  2A5X A; 
#chains in the Genus database with same CATH homology
 4H0O A;  3VEY A;  1LOT B;  3PLA A;  4K42 A;  2P9P A;  4QS8 A;  3WXI A;  5KPT A;  1QVF M;  5JMV A;  1V4T A;  3NVK A;  4QS7 A;  4IZ9 A;  2W00 A;  3E9L A;  4XH5 A;  1K8K A;  2HST A;  4ILJ A;  1SS6 A;  3R9P A;  5AFU A;  3CCV N;  3WQT A;  1QZ6 A;  1YI2 N;  2A42 A;  1S22 A;  2NRT A;  4YOV A;  4MDB A;  5HL7 L;  2BUP A;  2Q0U A;  3CCQ N;  4GV9 A;  3LDQ A;  1KQS M;  4JK9 A;  5ADX H;  4QS9 A;  1X3M A;  3TTD A;  4C23 A;  4IO8 A;  4JKD A;  2GWJ A;  5LJW A;  2JWL A;  2RHK A;  2QEX N;  3P39 A;  4NLB A;  2C1G A;  5BN8 A;  4O8U A;  4PKI A;  5KQD A;  4JKB A;  3CER A;  3CJ1 A;  4BRN A;  2I7N A;  4DHY A;  1WUA A;  2E1Y A;  4BG9 A;  1BWF O;  4OO1 J;  3KZB A;  3WXK A;  4YOW A;  5BPL A;  4IWV A;  2E2P A;  4BY9 C;  1RFQ A;  3MN7 A;  3I56 N;  2V7Z A;  3RSE A;  1P8Z A;  1VQO N;  1GLF O;  3O1B A;  2HMP A;  2P9I B;  5H1S Q;  1WOQ A;  2ZF5 O;  5AQG A;  1QQM A;  3FZK A;  3CC2 N;  3UKU A;  4XH1 A;  3N4Q A;  3Q7C A;  2YHY A;  4O5F A;  2D4W A;  3CPE A;  2DPN A;  3VOV A;  4BRO A;  4BRH A;  1YJN N;  1SQK A;  2VCP A;  4OPA A;  4M7X A;  4KH6 A;  3C7N B;  3O1W A;  2NLX A;  3FFK B;  4DB3 A;  5AQT A;  3VEO A;  4FOI A;  1GLA G;  4BC2 A;  1NGG A;  1NLV A;  2FF6 A;  4KH4 A;  2FSJ A;  1HKB A;  1BUP A;  1NGE A;  4JHD B;  3E9P A;  3C6A A;  5BN9 A;  2I7P A;  3EL2 A;  1KD1 O;  3H1Q A;  3MWP A;  5AQS A;  2P9K A;  3M1F A;  4IJA A;  3ID6 A;  2A6A A;  2E2Q A;  2QWL A;  3UKU B;  2ZWH A;  1VQ6 N;  3M5R A;  2GTD A;  2NRH A;  1MWM A;  4FWS A;  4AM6 A;  5M1K A;  3L4I A;  2A3Z A;  1NJI O;  5FPN A;  1QHA A;  3P38 A;  5FPD A;  3DWL A;  3AAR A;  3G6E N;  1BO5 O;  4WQ5 C;  1ZXO A;  2PAV A;  2QW9 A;  4FWR A;  1V4S A;  4PL8 A;  1NM1 A;  3R6M A;  1QZ5 A;  2YX6 A;  3ENO A;  3SBG A;  4BR2 A;  3OA9 A;  1LCU A;  3OBY A;  4KH5 A;  3RVC A;  3UKR B;  4C1N I;  1N8R O;  4O8K A;  2HBM A;  4BRM A;  1GLL O;  1JCF A;  4JK8 A;  3HI0 A;  4HWI A;  3VGK A;  2Q2R A;  3O8M A;  4IXC A;  3KWG A;  4MLH A;  3ZEU B;  4CI6 A;  2P9L B;  4FL9 A;  4PL7 A;  2HBK A;  3L0Q A;  3MDQ A;  5BPN A;  3MWT A;  4BR9 A;  5AFU H;  2QWP A;  1HX1 A;  3F9M A;  1XUP O;  2YHX A;  4WQ5 A;  1ZC6 A;  3UE5 A;  4B9Q A;  2CGJ A;  5M1Q A;  2QWN A;  5EVZ A;  3VTI A;  1RDU A;  3PIP L;  3CJ9 A;  1E4F T;  3H1V X;  1W97 L;  2CGK A;  5AZJ B;  3IFR A;  3SK3 A;  3VER A;  3VET A;  5GAE P;  1P90 A;  5AQW A;  3UKR A;  4J8F A;  4IEE A;  4BRF A;  1ATS A;  2NNW A;  3WEE B;  2V7Y A;  4HTL A;  1R59 O;  1GLC G;  3OBW A;  4XEI A;  4BC4 A;  4BRC A;  2AP1 A;  2Q1N A;  4H0V B;  2NRX A;  3BEX A;  4FWQ A;  3FE1 A;  5TKW A;  3FZM A;  3EO3 A;  4FO0 A;  5M1P A;  1Q18 A;  1YIT N;  3GE1 A;  5ADX A;  4RWT A;  3FZH A;  3F2K A;  5F1X A;  2NRR A;  3BP8 A;  3DXM A;  5GAH P;  2WBN A;  3HBT A;  2JWK A;  4E1J A;  3WUH A;  2P9U B;  3A8Y A;  1VQM N;  1RGI A;  1TYQ B;  2KLA A;  3GG4 A;  4YOU A;  4PHT X;  3CCM N;  1VQK N;  3MCP A;  3VEZ A;  3LDP A;  5F0X A;  1VQ8 N;  1VAZ A;  5DM7 L;  3LL3 A;  1HLU A;  3OW2 M;  3SAG A;  2HOE A;  3TPQ A;  1X9J A;  1NBW A;  4EAH D;  2ITM A;  3O4W A;  3O9R A;  4BEC A;  4YOR A;  2QXL A;  2CH5 A;  2F7T A;  1JCG A;  4U7B A;  1VQL N;  4YDU A;  2QA4 N;  5AR0 A;  1Z6R A;  3L4Q A;  3SJH A;  5AQF A;  3ZET A;  3T69 A;  1MWK A;  1H1V A;  1KAY A;  4IDH A;  3D2E B;  5JIC A;  1NGH A;  4CD3 A;  4DKW A;  4JKG A;  1D4X A;  3IMX A;  4U67 L;  1VQP N;  3A5M C;  5CE3 A;  5M1O A;  3BUZ B;  4YDU C;  2KHO A;  2F9T A;  3SMP A;  4JAX A;  5AQP A;  3E66 A;  3SAF A;  4IOC L;  3D6R A;  4YOT A;  1NWK A;  2IVO A;  5BPM A;  3M6G A;  1NMD A;  1K73 O;  4IOX A;  4CZG A;  3HOT A;  1KAX A;  1NGA A;  2ZGY A;  3ATV A;  3KHY A;  1M1K O;  1T44 A;  2E1Z A;  3CIP A;  4H0T B;  1YHQ N;  3R8E A;  2QM1 A;  3EE9 A;  3O9S A;  4CJ7 A;  2ZJP L;  2E20 A;  1Q7Y O;  3CJC A;  5BRD A;  1JCE A;  2OAN A;  3EKS A;  3A5O C;  3QFP A;  2P9N B;  4A5B A;  5AQQ A;  4LC9 B;  5AQN A;  4ISG A;  4NO7 A;  3VEW A;  2IVP A;  3AY9 A;  3H3N O;  5FPM A;  3ZET B;  1GLD G;  2VWB A;  5EXW A;  4Z94 A;  4GY2 B;  3SAH A;  1G99 A;  3KVG A;  4H5V A;  2ASP A;  2V52 B;  3QBW A;  5AQJ A;  5JVG L;  4BRK A;  4H5W A;  3ENB A;  1GLE G;  4H5R A;  3ZX3 A;  3UB5 A;  3CF5 L;  4CZF A;  5C12 A;  4A59 A;  4BRP A;  3LM9 A;  4EHU A;  4AF1 A;  3CCS N;  2UYT A;  1CZA N;  3C65 A;  4A5A A;  5GAG P;  3AGK A;  3PIO L;  1K8K B;  2NRV A;  3A0I X;  1HPM A;  4H0P A;  4OPH A;  1QVG M;  3CME N;  2OTJ N;  4JNE A;  3E1Y A;  4H0X B;  4DQ8 A;  3H6E A;  2NZT A;  3FLC O;  3I8B A;  3CCJ N;  4ILG B;  3O80 A;  4JKH A;  2P9K B;  3DLL L;  2HF3 A;  3EE8 A;  4BRL A;  3GL1 A;  4BGA A;  3FZF A;  4K43 A;  2VYP A;  1X3N A;  2BH1 A;  3R1X A;  3CC7 N;  5EX5 A;  1XC3 A;  3DXM B;  4K41 A;  1HKG A;  4EFH A;  2Q36 A;  3LDO A;  1Y64 A;  2FSK A;  5AQV A;  5F2R A;  3ULE A;  2W40 A;  4MO4 A;  5I9E B;  3CXC M;  1HJO A;  3MK6 A;  4JKA A;  5LJV A;  3AAQ A;  3P31 A;  3WT0 A;  4WFB L;  1Q86 O;  3RSE B;  5M1N A;  4NLC A;  4MO5 A;  5AQK A;  1KXP A;  2D0P A;  4JN4 A;  4H5N A;  3W3D A;  4FWP A;  2F9W A;  1C0F A;  2FXU A;  3LM2 A;  3G4S N;  3GBT A;  3ZEU A;  3CQY A;  3VGM A;  4ILH A;  2GWK A;  3U8X A;  2H3G X;  3QBX A;  4PKG A;  5JLF A;  3HM8 A;  3I33 A;  3QB0 A;  3K9J A;  2CH6 A;  2QWO A;  3U4L A;  1YUW A;  5C0Y A;  2P9P B;  1T6D A;  4Y0W A;  4A57 A;  1SAZ A;  3VEV A;  1YVN A;  5E26 A;  1O13 A;  4XH4 A;  4BC5 A;  4BR7 A;  4JD2 A;  5BRH A;  3C6H A;  3DXK B;  3FR0 A;  3CJB A;  1BA0 A;  1XQS C;  3NVM A;  5JVH L;  2OTL N;  1HKC A;  2D1K A;  4B1V A;  3E9O A;  3KWI A;  5ELZ A;  5AQM A;  2KKZ A;  3CJA A;  4FSV A;  2FF3 B;  3VGL A;  4CZM A;  2D0O A;  2YCH A;  3IKM A;  1BU6 O;  5CHI A;  3CCU N;  4WFN L;  5AQL A;  2QWQ A;  5AZI A;  3VEN A;  4CBW A;  5KPZ A;  3J7Z O;  3CCE N;  4GV6 A;  4FVU A;  3BF3 A;  2QWR A;  1TYQ A;  3A5L C;  1QQN A;  1GLB G;  2FSN A;  2PBD A;  2WFB A;  4MLE A;  3CET A;  1DEJ A;  5KPR A;  3AGR A;  3I55 N;  2QI2 A;  4BVP A;  3SBT A;  1IG8 A;  1ESV A;  2YHW A;  2E8A A;  3HTV A;  1S72 N;  1NGD A;  3MN5 A;  5AQY A;  3DXK A;  4BQZ A;  5AQX A;  3O9Q A;  2YI1 A;  4BR5 A;  1Q82 O;  4EIA A;  4BE7 B;  1Z05 A;  3D2F B;  4I6M B;  4YOX A;  3T7Z A;  3VTH A;  3DAW A;  3CCL N;  1YF5 L;  3WQU A;  1DKG D;  5GAD P;  3TSP A;  3BF1 A;  4A61 A;  3IUC A;  2GEL A;  2Q97 A;  2IIR A;  1QQO A;  1NGB A;  3U9D A;  1IJJ A;  2WC9 A;  1T3V A;  4CD1 A;  5JLH A;  3K9K A;  1TUY A;  4GVE A;  4WYB A;  5AZI B;  4A2B A;  5AQH A;  5MLC Q;  1JJ2 M;  4GV3 A;  1YAG A;  4ISF A;  3GDQ A;  3C7N A;  4B1Y B;  4BGB A;  4NB4 A;  2AA4 A;  4CBU A;  5AQU A;  5AZJ A;  5BRE A;  4A2A A;  3WXJ A;  1VQ5 N;  2VGM A;  1VQ9 N;  4JEP A;  5GIO A;  3M3Z A;  2C1I A;  2E2N A;  3HSC A;  1DT9 A;  4BQL A;  3QDK A;  2ZGZ A;  1OKJ A;  3TSQ A;  1SZ2 A;  3MX5 A;  1TUU A;  3U9Z A;  5C10 A;  2A40 A;  5DM6 L;  1K8A O;  4BC3 A;  4WCE L;  3G25 A;  4BVO A;  4F9O A;  3TTF A;  4WQ4 C;  3ID8 A;  2PFU A;  1C0G A;  1M90 O;  4PKH A;  4BRA A;  3D7E O;  2WUS A;  3H46 O;  4H5T A;  2FLO A;  4B1X B;  5C15 A;  3VF4 A;  3J8A A;  1YXQ A;  1NGJ A;  2RE2 A;  5EOY A;  1U2V A;  4FWL A;  4BR4 A;  1S3X A;  1YIJ N;  4IJN A;  3O9T A;  3P4I A;  3CI5 A;  4B1Z A;  1Q81 O;  2P9S B;  1ZBS A;  1NGF A;  3F5T A;  3R3L A;  4BG8 A;  2Q0R A;  4JD2 B;  4CZI A;  4CZJ A;  5HOO A;  2IVN A;  5EY4 A;  3VF6 A;  2YJE A;  2YJF A;  2GEM A;  3CJ7 A;  4B1U B;  4CZK A;  5B8H A;  1T6C A;  1U6Z A;  2HBJ A;  2ZJQ L;  3CHW A;  2GUP A;  3JS6 A;  4FOE A;  2P9I A;  4ISE A;  3DJC A;  3H3O B;  3G71 N;  2BTF A;  2P9L A;  1ATN A;  3L6Q A;  3D2E A;  3N4P A;  3ZYY X;  1VQN N;  4FWK A;  4JKG B;  4B1W B;  1EO1 A;  3KK7 A;  2ZJR L;  5KQ8 A;  4FPB A;  3O6W A;  3VMF B;  5C2D A;  3ULE B;  1U2V B;  3FGU A;  1VQ4 N;  4IO9 L;  4IFE A;  4RTF D;  1E4G T;  2GX9 A;  2P9S A;  3C0B A;  5AQO A;  2EWS A;  3JXU A;  3LDN A;  1BA1 A;  4A62 A;  3EKU A;  1W2B M;  1K9M O;  4MDA A;  1KAZ A;  3D2F A;  4I6M A;  1MDU B;  3A5N C;  4WF9 L;  3TU5 A;  4C1N K;  5BR9 A;  4WFA L;  4YOY A;  2P9N A;  2VGN A;  3HRG A;  3MN6 A;  5FPE A;  3MN9 A;  4BEB A;  2CGL A;  3B8A X;  2ASO A;  3QFU A;  2NRZ A;  2E88 A;  2P9U A;  3H45 C;  4BR0 A;  2A41 A;  3SMS A;  2NRW A;  1ATR A;  1RDW X;  2QTD A;  3ZX2 A;  4BRG A;  4BRD A;  3CD6 N;  4EHT A;  4R79 A;  3OHR A;  2HF4 A;  4IEI A;  4K25 A;  5BRF A;  1VQ7 N;  4UY8 O;  4JKF A;  3WXL A;  1J6Z A;  3ATU A;  3ENH A;  3GOI A;  1KC8 O;  3QIC A;  3EN9 A;  3HOS A;  3CCR N;  4JKE A;  5E84 A;  4AM7 A;  2W41 A;  4CZE A;  3HZ6 A;  4CZH A;  5GIN A;  3ZX0 A;  4G9Z A;  4BRQ A;  4BRE A;  1YJ9 N;  3MMV A;  4FPA A;  2ASM A;  4M63 C;  3NMU A;  4CZL A;  4BRI A;  1HUX A;  1OVY A;  4JKC A;  5AQR A;  4DCH A;  2V51 B;  3VEX A;  3MX2 A;  4FWM A;  4H0Y B;  5C2F A;  3CMA N;  1BDG A;  2QWM A;  1EQY A;  3SLC A;  4RCH A;  1YJW N;  3MCA B;  4FWN A;  5AQI A;  4M7Y A;  4H03 B;  2E2O A;  2Q31 A;  1NGC A;  3CC4 N;  3VF2 A;  1NGI A;  4JHD A;  3WEE A;  5GIP A;  3TTC A;  3LDL A;  4XJX A;  1ILY A;  4JK7 A;  3Q7B A;  5TKY A;  1DGK N;  4FWO A;  3IDH A;  4KBO A;  3W0L A;  1MA9 B;  3VPZ A;  3TSU A;  5LY3 A;  5CR4 A;  3QML A;  3FZL A;  4GNI A;  3O5B A;  3CQX A;  3EZW A;  5AQZ A;  1BOT O;  3AAP A;  5M1F A;  3CPW M;  4WQ4 A;  2HBL A;  2J4R A;  4CBX A;  3WXM B;  3VES A;  3O08 A;  4L3Q A;  3O9U A;  4IOA L;  3S41 A;  1GLJ O;  2A5X A;  1BG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...