1U2YA

In situ extension as an approach for identifying novel alpha-amylase inhibitors, structure containing d-gluconhydroximo-1,5-lactam
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Situ Extension as an Approach for Identifying Novel alpha-Amylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 179
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1u2yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1u2yA01
4PTXA 4D6HA 4DUVA 3SCOA 3ARTA 2DSUA 1TQTA 4EE9A 3MO4A 3AYSA 1E1FA 4FLOA 1XC6A 3MUIA 3VMPA 3CMGA 5ABEA 3SEPA 1EDQA 4QDMA 3NSMA 1Y7VA 1VB9A 2EEXA 4AZ6A 3LXCA 1DWJM 3AS1A 3A5VA 3WNOA 1C91A 4P8VA 4HPGA 5E70A 1W9DM 5I23A 1MVYA 3CV5A 4FK9A 1TFVA 5IHRA 3PHAA 3GXIA 7CGTA 3DHPA 1GJWA 3K1DA 2GJXB 1XCWA 4MAVA 3U5YA 3VIHA 3D51A 2DDXA 4PBGA 4BF7A 3GTNA 2G3MA 1NP0A 1W9PA 1M01A 1LL7A 3FY1A 3GXPA 4MNLA 3WY1A 2PC8A 1WDRA 2BY1A 1H0IA 4PEEA 1ISWA 1VAHA 2D22A 1EOKA 1E56A 2X8RA 3CTTA 4Z2KA 1UYQA 1VF8A 3WY4A 3AS3A 1B3ZA 5IDIA 2DEPA 3HG3A 2FH8A 4W8LA 3LRMA 2CKSA 3VDBA 3S6TA 4LXFA 3ARWA 1RP8A 5E6YA 5E09A 3WD1A 4BCEA 1TG7A 1XH0A 3SURA 1ZS2A 3T0BA 3BAJA 4MNMA 1HJXA 3QHMA 1HKMA 3VX0A 3A47A 1PAMA 1PS3A 1BG9A 2WZIA 2VZVA 4HU8A 1HKIA 5BYWA 4J3SA 2DT2A 2FHBA 1ZBVA 2YJQA 4GQQA 1BYAA 4MNJA 4GI9A 5A1AA 4PMNA 4CN1A 4F9JA 4CN6A 3UERA 4AIOA 4D6EA 3I3EA 5ABFB 4KGLA 1F4AA 4JZ5A 3VD9A 1XCXA 1OB0A 1UZ1A 2YL5A 3MMDA 2VR4A 1J0JA 2A3EA 4NI3A 1XSJA 3CUFA 1W9UA 1V0NA 5BRQA 2D20A 1GOKA 1WZAA 3MUAA 1K6AA 2XSBA 4NZFA 5LA0A 1TVPA 2PB1A 3WNKA 3N17A 1E6SM 3FHQA 1E55A 3TV8A 2WC4A 2ZWYA 2VCBA 2X2IA 3RMEA 4NZJA 2FYVA 3VU2A 1J0KA 4ZENA 1WZKA 1VJSA 3ARZA 4JFSA 4MNKA 2Y4SA 3CZEA 4KGJA 1KTCA 3HG5A 3TOPA 3UR8A 1JD9A 1UD4A 1GOMA 2PBOA 1MFUA 2QMKA 3VX1A 5LYRA 3WN6A 1VEMA 4JFUA 1E1EA 5CLTA 1E6ZA 1DP0A 1Q6GA 3CHEA 4M1RA 5M3WA 1E0VA 1NOWA 4AD5A 2OWWA 2VQUA 1R85A 5A6BA 5D9MA 1CYGA 1KGXA 2FE0A 3ARVA 2WMJA 3VGFA 1U33A 3W0KA 3W82A 1D2KA 3WENA 2WMGA 4BQ5A 2VX4A 1J10A 1VFOA 3BVVA 2F7OA 1H09A 4BQ2A 3CH9A 5CXPA 2F2HA 5HOSA 3WQWA 2V3EA 3QHNA 1CENA 3BCDA 3MSDA 3NUKA 3ALGA 3QR3A 3VNYA 4HTYA 1HTYA 3K46A 3PZTA 3DDGA 4FMVA 2XUCA 5HPCA 1JYNA 5BRPA 2OSWA 5HBFA 1QNPA 4GI8A 5BWFA 3ARSA 5A2AA 1JF6A 4X0VA 3U7BA 3AIQA 4UOZA 5I78A 1WDSA 1HNYA 3CUHA 3QHOA 1Q6EA 2YKKA 1R34A 4D6GA 5D9OA 3CZKA 2Q8XA 1W1YA 3WH9A 2BXZA 3D5HA 3OLEA 3BAXA 3M6DA 2WHLA 1W9VA 2F7PA 1HXKA 5AYBA 1VFMA 3WEZA 3VD4A 5CJ5A 2GVYA 4OOZA 4BQ3A 1HIZA 2MANA 3HN3A 3VD3A 1BQCA 3DX1A 2ZUSA 2WVTA 1G9HA 1W91A 2J7BA 1JIBA 1QHZA 3N15A 5FOOA 3ZT5A 1E15A 2VZTA 3VILA 4YHEA 3BAYA 3EJRA 3BUIA 3AROA 4N42A 1DEDA 1KXHA 1BYDA 2EO7A 4GKLA 2DSWA 2CBUA 2YBTA 5IXEA 5A8NA 3A4AA 3A6OA 5EB8A 4DWSC 1JZ2A 2ZIDA 4AD4A 3AHXA 3UG3A 1QWUA 5I79A 1E6NA 1LG1A 3W53A 1GORA 4U5IA 1RPKA 4U5KA 1GQIA 1JI2A 4DUWA 1FFQA 3VDCA 1LL6A 3WUGA 4W7VA 5AC4A 1K9TA 4JFVA 5FL0A 3WF3A 1JYXA 4AZBA 1CXLA 1G1YA 2X09A 3WNMA 1V3KA 3KEHA 4AYGA 2D1ZA 3RJYA 1HL9A 3UCQA 4CCDA 2DT0A 2ZUWA 1WO2A 1DWHM 3OLIA 1QHPA 4LQ1A 2XN0A 2WNWA 2CETA 4PUEA 5CG0A 2F1AA 2O9PA 2ZUMA 1CXKA 4ZFMA 2CHOA 2EPKX 5DEZA 4M56A 4MB5A 4XX6A 5E1QA 3BAIA 5IFTA 3K8LA 4TVCA 1IV8A 4D6JA 1M53A 2NW0A 1W3JA 2VOTA 3D4ZA 3MS8A 1V6UA 3WMCA 3A23A 4P7NA 4UFHA 2BHYA 3VD5A 1VRXA 2WVUA 1UQYA 3AXHA 2UY5A 3DX0A 2WC7A 2PWDA 1ZBCA 1HJUA 1HJWA 1ZU8A 3VUPA 4Z2LA 2EABA 2VT0A 1R7OA 1FH7A 3IAPA 3CIVA 1JI1A 1JF5A 3FXYA 3KL3A 4NRRA 4A4AA 3MI6A 1X1NA 1CEOA 5ABFA 2D23A 2F7QA 4PYSA 1UA7A 3ARRA 3WMBA 1QI3A 2WZEA 4JL1A 3LPFA 4UOJA 2E9MA 1GVIA 5JIWA 3A3HA 2WVSA 4U2ZA 1I1WA 7A3HA 1N82A 3OG2A 1E4NA 1FA2A 4AD1A 1JFXA 1MWOA 2J7EA 2NSXA 3ZJ7A 3F5JA 3VSVA 4GO9A 3UG5A 4CGTA 2DGAA 1JAEA 3APGA 1EOMA 2ZOXA 4FLRA 3VIMA 2V3GA 2UY4A 1XH1A 4P7LA 2F7RA 3LXBA 5KEZA 4GO8A 4YN5A 3WD3A 2GDVA 3RIKA 5A2BA 2CEQA 4CD5A 3PZ9A 3T2QA 3WQVA 1OIMA 4ACYA 3IJ8A 3AYRA 5F7UA 4CU6A 3N11A 4HZ7A 3RILA 4TX6A 5E0CA 1AVAA 3GBDA 5A8PA 1TCMA 4IISA 1ITXA 1ISYA 3TONA 1ZJAA 3U57A 1UR0A 4GI6A 2XFRA 3PZGA 3F4VA 3GXFA 1H4PA 1HP5A 4J7RA 2X2YA 1SYTA 2BY2A 1ISZA 1EO7A 2XWEA 3POHA 3ZJ6A 1TR1A 1MFVA 2GFTA 3WF1A 1WZLA 1PX4A 1EXPA 2XVKA 4S3JA 3VGHA 4AC1X 1ISXA 1GHSA 2FHFA 3L4VA 2J7FA 1EH9A 3BLKA 4U33A 4HP5A 4UFKA 1CECA 3RM9A 3OGVA 3ARQA 1JG9A 4TX8A 3VIOA 4JKKA 4LYRA 3BCFA 2GK1A 1UKOA 5I2UA 3BGAA 2E0PA 5A6SA 2YDQA 4D1IA 1LWJA 4PMOA 3AMLA 3RDKA 4H7VA 3DYPA 1KXTA 2G3NA 3K8MA 2O92A 2IXUA 3SCNA 2GDUA 4UZUA 1AMYA 2DT1A 4F9DA 4F66A 4AD3A 1U2YA 2VRKA 3W38A 4W8BA 4AD2A 2ZICA 2DIEA 1SR0A 3ZT6A 3E1F1 3AI0A 1G5AA 2XGBA 1E0XA 4BZYA 1W9XA 3SIMA 1TMQA 4U2YA 3WY2A 1QNSA 4GXPA 5DF0A 1V3JA 2C7FA 4AY1A 2PWEA 5E9AA 4CKQA 3W6MA 2Y8KA 5IFPA 2PF0A 3RO8A 1KQZA 3DHUA 3CO4A 3WL0A 1HWWA 1BYBA 3L4YA 4HOXA 6CGTA 5CPQA 3QGVA 1BGGA 2FDMA 2XSAA 5A6KA 1QI4A 3B9EA 5FIPA 4V27A 2YLAA 3AQUA 2VCAA 4Z2GA 2EPMX 4AZIA 5GNYA 4HU0A 3H55A 4B9YA 1W2PA 2RGLA 1V02A 4CD7A 5KZ6A 2VNCA 4HZ8A 5CLWA 1US3A 1OT1A 3HJEA 2XFYA 2G3IA 1KXVA 4B9ZA 1UH4A 4CVUA 3ARUA 3T08A 1QWNA 2WMHA 2WXDM 1JYWA 4Q7NA 2ZX6A 4RE2A 3UR7A 3BUDA 3L2MA 1GOQA 3MMWA 1VJZA 2ZX5A 1K9FA 3SUSA 4J3XA 1LLOA 4EANA 2BS9A 1TQVA 5FD0A 4JIEA 5JUVA 1OGGA 4QP0A 2X1IA 4OUEA 3T0AA 4AMWA 3UETA 2HISA 2ZUVA 5A6MA 5DT7A 1B31A 2E8YA 3ZSTA 3WUFA 1GQLA 4PTVA 2C8NA 3CHDA 2AAAA 2HVMA 2QMJA 1SMDA 3AJ7A 4MPKA 3LX9A 1JZ4A 2CXGA 1H1NA 3AMCA 4D1JA 4P7RA 5A94A 1JNEA 1Q6CA 1VBUA 5GNZA 3VSTA 2VZOA 3WH6A 1W2VA 2DSZA 3VDHA 4FLQA 1K9EA 1JFHA 1SMAA 1TZ7A 1AQ0A 1E4IA 4R27A 1G94A 1E71M 5CPSA 3VPLA 4XZWA 2VJXA 3AHVA 2UY3A 2W66A 3TTSA 2WHJA 2DSKA 1Z32X 2W61A 4R5EA 4W7WA 1XH2A 3FAWA 2X0YA 2VURA 2FHCA 3WDIA 3LXAA 1E3XA 1TE1A 2PBGA 3ZJ8A 3GXDA 3I3DA 2ZXBA 1R75A 5AYIA 1V3HA 3CUGA 1MW0A 1LQ0A 1OSEA 2XVNA 3PZQA 3TTQA 1UD6A 2XIBA 3WL1A 1UR4A 2CESA 1J01A 4UQDA 5CGMA 1E6RA 1XSIA 1WCGA 4OOUA 4BA0A 4A3HA 1J0ZA 1HT6A 1UG6A 5A8MA 3GYCA 5C70A 1J0HA 1JXJA 2ZXAA 1UOKA 1NOUA 1WNOA 4N0RA 3CZLA 2XM1A 4CVWA 2EPNA 1V6XA 5E6ZA 1J0YA 2J77A 3OGSA 1V3MA 3VSUA 2A3AA 2WZHA 3A4XA 4HOZA 3AFBA 3T2OA 1UD5A 4AIUA 5LA1A 4IM4A 1JZ7A 4S3KA 3BUQA 1UD3A 1KBKA 3U7VA 2PI6A 1M7XA 5BXSA 2XG9A 2WCAA 1E6QM 1GONA 5A6AA 3W6LA 1QNRA 3ALFA 4P7QA 1VEPA 3BLBA 5CGTA 3VIKA 3PTKA 2E40A 2EPOA 3PZIA 2E4TA 3BLPX 2YFOA 4PMDA 2ZUTA 3NYDA 3SCRA 2ESCA 1DWFM 1Q6DA 2BVDA 2W4XA 4IUGA 2BVTA 1MYRA 1C3FA 1ZL1A 4WKFA 3BVXA 1ESWA 2JF7A 1L8NA 5E0FA 1KQYA 4QLLA 3WELA 4LYPA 3KLKA 2PWHA 3HU7A 3GDBA 4NXSA 3JUGA 6TAAA 3BSHA 3ZO9A 2VX7A 3WNLA 1JZ6A 2OYLA 4J3VA 1HX0A 4GZJA 4PMVA 3WDJA 5HNNA 2V3DA 1XSKA 4UFJA 1R33A 3AS2A 4C7FA 1NH6A 2VZSA 3OZPA 3RPMA 1Q4NX 3MV11 3PZVA 1HKJA 3ZM8A 7TAAA 3ZIZA 4X9YA 1NM9A 3WQ6A 2BXYA 4JCMA 1W1PA 3VGGA 1LL4A 1EHNA 1EO5A 4AMXA 2F1BA 1W3HA 2WVVA 2XWDA 4AIEA 4TOQA 1ISVA 4WJXA 3PZOA 1R47A 5CPTA 4YPJA 2DSVA 3I3BA 2XVPA 1VENA 1TQUA 1E6PA 2JF6A 4PSRA 4PMRA 4AZ5A 4DWSB 2WHMA 1I75A 3UG4A 3K4AA 4PCTA 2J47A 2VVNA 4CD4A 3ARXA 4D72A 1H11A 1CGUA 2YIHA 1JGIA 2JALA 3CZSA 4FF5A 4M8UA 3LRKA 2EADA 1ZBWA 3WQ4A 1E72M 2YA2A 1JNDA 2XIIA 1UHVA 5D8WA 1E43A 1R46A 1HF6A 1C8XA 3PZMA 4AEEA 3GH7A 1GQKA 3RJXA 3D52A 3MU7A 2J7DA 4WKHA 1E9LA 3AHYA 3IANA 3VIJA 3DYMA 1O6IA 1E40A 1GOIA 3OZOA 4AZHA 1P6WA 3TP4A 1HKKA 4BS0A 1ZB5A 3BXWA 2YDRA 1VIWA 3TTYA 4RE4A 2O9OA 4W84A 1KGWA 2BY3A 2D0HA 1PX3A 3MMUA 3ZR6A 2GJRA 1HP4A 2X2HA 5C71A 2XHYA 4C7DA 1JD7A 1E5JA 1C90A 2BHUA 4E4PA 1HXJA 3QOMA 4U3CA 2EAEA 2ZUUA 1VFFA 1JZ3A 3S5ZA 2EQDA 2VVSA 4CD6A 2Y8VA 5A6BD 3BVTA 3NDZA 3DC0A 3SCTA 3W81A 3ZQ9A 3KWXA 1V0LA 2WWDA 4KWUA 2YL6A 1TUXA 4H8UA 4AEFA 3DYOA 1BG4A 3MANA 1GOWA 1NQ6A 4DM2A 4KMQA 1UWUA 2V5CA 2VZUA 1NWRA 5CSUA 1UKQA 2C0HA 2NT1A 3MUY1 4Q22A 3THDA 2J79A 1IT0A 4GQRA 1QW9A 1EGZA 5M03A 1KGUA 2G3JA 3PN8A 1GHRA 1OCQA 4HMEA 1XYFA 3CGTA 4XZBA 1UQZA 1VFUA 3WH8A 1B3VA 4FNSA 2JE8A 2CCRA 1CWYA 1S46A 2D73A 4W8AA 5ABGA 4RL3A 3NDYA 3VIPA 2CPUA 3OLGA 2FH6A 5HXMA 4QLKA 4QCFA 3D50A 2WM0A 1J9YA 1KCLA 1EIBA 3G6LA 5D9NA 4TVUA 5EMYA 3T2PA 1PEZA 1WAWA 1TQSA 2Z1KA 1E0WA 3VMNA 3MSGA 2X0HA 1WB0A 1UH2A 4PTWA 4HPHA 4DO6A 3PTQA 3AOFA 4W7UA 4DWSD 3RM8A 3KL0A 5EFFA 1PJ9A 4H2CA 1XYZA 4M82A 1UR8A 2BFGA 2CITA 4JAWA 4PMUA 2J75A 3ZJKA 5GNXA 2J25A 1FH8A 1TVNA 1GPFA 1CGYA 1E4LA 5I3DA 3EYPA 3L4WA 4W88A 2VRQA 3BVWA 2CKRA 3AIEA 4W85A 1L0PA 3M07A 3VO0A 3W28A 3DECA 5AC5A 2ZXDA 1WDQA 1QNOA 2VX5A 1EDGA 2VTFA 2WKGA 2AMGA 2WSKA 2AOSA 5EFDA 4CU8A 4LPCA 3CUIA 1JDAA 1GZJA 4RE3A 1CXEA 2Y24A 2XVLA 1ZBKA 3GH4A 3W29A 5I24A 3BUPA 2WMFA 2VR5A 4URIA 3CC1A 4Y7EA 3W37A 1YQ2A 1IZJA 2EBNA 2G41A 2D0FA 1CLXA 4PMZA 1B9ZA 1XGZA 2IXVA 1D7FA 2J8FA 4DO4A 1OT2A 3U5UA 3L4XA 3CZNA 3N9KA 3ZT7A 2F61A 3IJ7A 4UQAA 3FHAA 4A3YA 3WSUA 1NARA 2BV9A 4CCCA 3GXNA 1KBBA 3II1A 3OIHA 1XRVA 4Z2IA 2YBUA 3L4TA 1UWQA 3WIJA 1C93A 5AY7A 2F18A 1GUVA 1CNVA 4FNPA 1JYVA 3O6AA 3AIRA 1IZKA 1E3ZA 1UUQA 2VQTA 3VKKA 4OIFA 2WVVB 2GUYA 2CBIA 8CGTA 2OLHA 4OJYA 2X2JA 3HZ3A 1V02E 2WANA 3KE0A 2IGTA 3CLWA 1H2JA 3EBVA 1HJQA 4OBSA 4DM1A 1GOOA 4HZ6A 3AMGA 4IPNB 4PUDA 1V3LA 1TQWA 4GZIA 4AISA 2OWXA 3CZ8A 2ZX8A 1W32A 3A24A 1F4HA 3GXTA 2WPGA 3LPOA 1DWAM 1B3YA 1V03A 1JDCA 3WH5A 1V0KA 1QW8A 2YL9A 5JBDA 4CD8A 1JXKA 1CPUA 4GZEA 5GPRA 3AZSA 4M80A 2XVGA 1CGVA 2ALWA 2VRJA 2A3HA 3D3AA 2UY2A 3WD2A 1GW1A 2CBVA 5BCAA 1OGSA 3EDDA 1PZ3A 4GPNA 1FH9A 3VINA 1CXIA 1C7SA 5CSYA 1OD8A 3ZOAA 2GK1B 2W5FA 2OWCA 3BVUA 3AIWA 4MJ4A 2Y5EA 3B9DA 4K68A 4X0NA 2J7GA 4AD0A 1E70M 3AIBA 1QI5A 4OKDA 1OWQA 5D9PA 1M03A 1E5NA 3FNDA 4UQ9A 4NF7A 4TTGA 3DX4A 2EPLX 3CBWA 1CDGA 4ZXOA 4MB3A 3WD4A 1WZMA 1T0OA 2QF8A 2A3BA 4WSJA 4JHZA 2J4GA 3NSNA 2CYGA 1UD2A 4J28A 1GVYA 4UQBA 4MB1A 1UWIA 2E9BA 1OD0A 3VTRA 5A8QA 2WLZA 4JKMA 1EQCA 2XPKA 1PIFA 1XD0A 3QOKA 1C92A 2DPEA 1HN1A 4B15A 2ZX9A 1DWIM 4J3TA 2WMIB 5DFAA 3F5KA 3GH5A 1X6NA 5M17A 3WUEA 1W3KA 2OW7A 1PBGA 3AHTA 1TA3B 2WB5A 2V5DA 1M04A 2W63A 3VDAA 2ZX7A 2WSPA 3J7HA 3NSXA 1V0MA 2FGZA 3ECQA 4WSKA 4JCLA 1B90A 1MW3A 5I0DA 3H54A 2CHNA 3OLDA 3ARYA 4OGZA 3WY3A 1KCKA 5ECUA 3WF0A 2GSJA 1PIGA 1V3IA 3GZAA 3FW6A 5DMYA 5IHSA 3HMCA 4UZSA 1GNXA 1DTUA 1NWTA 2EXOA 1EA9C 1HJSA 1BGAA 1WPCA 3BC9A 4JL2A 3WMSA 3N13A 4NSBA 4UQCA 1JZ8A 2E3ZA 3WFLA 1ODUA 4FNQA 4WIWA 3WF4A 5A2CA 1H3GA 4ACZA 5FL1A 3VGBA 3LMYA 3EJSA 2WLYA 3WEOA 4KRUA 2YOCA 4F79A 1JDDA 2J74A 1SFSA 4H8VA 2W62A 3BAWA 3VGDA 2O9TA 3WBAA 4D6DA 3OA5A 1CTNA 4D6IA 1UKPA 2G4FA 2WHKA 1HL8A 2DH2A 3DX3A 4WLCA 2W91A 1BLIA 4HOWA 4CU7A 3AMKA 1MQPA 2YA1A 4C7GA 4AZCA 4HA4A 3GXMA 1OBAA 2XYLA 1EDTA 1B0IA 5D8ZA 1XD1A 2VMFA 1UR2A 1NWSA 3TTOA 4KH2A 4NRSA 1G01A 3CMJA 3FN9A 1NP2A 3ZSSA 4E8DA 1V6VA 1H41A 5BXRA 2XN1A 4XUYA 4LYQA 4W5UA 3THCA 4UFIA 4B16A 4WK9A 3OGRA 2JIEA 1ZJBA 4PMYA 2ZXQA 1NOFA 4V2XA 4YHGA 2WKLA 2OYKA 1FHDA 5I5RA 2XFFA 2J62A 2VO5A 2JEPA 4ATDA 1W3LA 5ABHA 3WBEA 3CHFA 4MAZA 5FCZA 3NJ3A 3VIFA 2ZWZA 4PCSA 1C8YA 3PBGA 4KRTA 5DT5A 1W1TA 4FLSA 1US2A 4UTFA 1GCYA 2YA0A 1E6XM 3SCSA 1YHTA 3PZNA 2WK2A 2WAGA 2WBKA 1SZNA 2YL8A 1QNQA 1KXQA 4TVDA 4L4OA 1R8LA 4J3WA 4MTVA 3VIIA 4HMDA 3LPGA 1E4MM 5I6SA 4AYSA 1FHLA 1RH9A 2YLLA 1CXHA 1QPKA 1J12A 4AZ7A 3SCPA 1R87A 3DX2A 3IJ9A 3SUTA 2VUYA 2J7HA 3GNRA 3KLLA 3K8KA 4WF7A 1WDPA 1H0GA 3CZGA 3L4UA 2EJ1A 1W9BM 2WC3A 4D71A 4PMXA 3BAKA 3F5LA 4P8UA 1I1XA 3OB8A 4UFMA 3VOCA 5TD4A 4EK7A 1JAKA 4CUCA 1BPLB 1UA3A 1B3WA 2WCSA 4AW7A 1B30A 2JEQA 1AQMA 4F8XA 4HA3A 5FKYA 1BVZA 4FNRA 5JIPA 4QCEA 1OINA 3O2LA 1UR1A 2GJPA 2GJXA 4QLJA 5BXTA 3HG4A 3VM7A 2OYMA 3SCWA 2WYSA 2G8ZA 1QBAA 3GNOA 3PZUA 3VMOA 4DUXA 3VGEA 3AISA 4D6FA 1LJYA 3FAXA 1HJVA 2VC9A 3VVGA 4MADA 3ARPA 1QHOA 4P8WA 2YFNA 4FNTA 1CXFA 1E73M 1FOBA 4BQ4A 5JBEA 1CZ1A 2FGLA 6A3HA 3IGUA 1MQRA 2BHZA 1J0IA 1PX8A 3CHCA 4MDOA 1KR1A 1WP6A 3WH7A 1XV8A 1QVBA 4D6CA 4P8XA 5A3HA 4EAMA 4L4PA 1NWUA 1BTCA 2NT0A 3EDJA 4E8CA 1UKTA 2J7CA 1QBBA 4CN4A 4OZOA 4XB3A 2DT3A 1LWHA 3K4DA 1K9DA 1R7AA 3WD0A 4TUFA 2BNJA 4W87A 2CNCA 1B1YA 2D3LA 5CQ1A 3EMQA 4V28A 2WMIA 4B3KA 1UZ4A 4QAWA 1KFWA 4UFLA 1X6LA 3T09A 2WMKA 3WQ8A 3GBEA 4QFUA 3W24A 3OBAA 1VBRA 4B3LA 3KL5A 1TA3A 4AXNA 1MW2A 3WDHA 3CZJA 4CCEA 2OW6A 4ATWA 1MXDA 5HPOA 4M24A 2WCGA 1BSIA 4MDPA 3EDFA 1R86A 4DWSA 3W25A 1RP9A 3LPPA 1OGBA 3G6MA 3NIYA 1WKYA 3WNPA 1JL8A 4Z2HA 3BUBA 3S2CA 3SUWA 2D3NA 4JHOA 1CIUA 1QX1A 1DHKA 3N1AA 3WF2A 1FP9A 1CGWA 5GQBA 3AZTA 5M5DA 1MQQA 1UD8A 2CIPA 4PMQA 3AIVA 4ACZB 1O7AA 1EQPA 8A3HA 3N04A 1KWKA 2XM2A 2D2OA 2OSXA 1VEOA 2IUZA 3L4ZA 1QI0A 3W26A 3VNZA 3EJQA 1CGTA 1HVQA 3A22A 2QV4A 4UOQA 1J11A 1XHGA 2JIWA 2ZE0A 4UNIA 3AXIA 3L2LA 1BYCA 2DH3A 4GIAA 3SCUA 5A69A 2PWGA 3EMZA 2Y2WA 2WWCA 3M46A 4ZE4A 4NXKA 2A3CA 2QHAA 2V38A 3MV01 2VCCA 2E9LA 3MUZ1 4AZCB 1GQJA 1LG2A 3AMDA 2WBGA 5JBFA 5I77A 3T0DA 1H49A 5HDRA 4MJ2A 1BAGA 4E2OA 1BHGA 1UWTA 4ATLA 3BSGA 2VL4A 2O9RA 4PRWA 1D3CA 3AXXA 4W89A 1EHAA 2VI0A 3ZMRA 3A4WA 4OBRA 3EJTA 2XJ7A 1WE5A 4MB4A 3BMWA 4TTUA 2TAAA 4M29A 4ML4A 2D0GA 2D24A 3PTMA 2RGMA 2UWFA 3KZSA 4PN2A 1MW1A 4AWEA 1UR9A 3W4RA 5A8OA 3EDKA 4NX0A 2XGIA 4W5ZA 1BF2A 3WQ5A 1B3XA 3IAQA 1UWRA 4M81A 1U30A 3S5YA 2F8QA 2V3FA 3W27A 1A47A 1OIFA 2YDSA 2CERA 5LA2A 2PWFA 5D4YA 5A6JA 2CBJA 3AICA 3EJUA 3GM8A 2XN2A 3GNPA 3WKZA 3AS0A 1BVNP 2BVYA 4EKJA 4IPLA 4JFWA 4J3UA 2QPUA 4UQEA 2VX6A 3CPUA 4TXEA 1CLVA 3DDFA 1QI2A 3TA9A 4HA1A 4LGXA 3H53A 2X05A 1V6WA 1W1VA 5C8BB 4PTMA 4NZCA 1J18A 3O9NA 2W67A 1KWGA 1DWGM 5A6LA 3VM5A 2XTKA 3WDRA 4Z2JA 4GINA 2Z1SA 5A95A 3B8SA 1CBGA 3AHZA 4JFTA 2OSYA 1AQHA 3ZR5A 1ECEA 2J78A 3M7SA 3BH4A 1ITCA 4H04A 1CGXA 4H8HA 3IK2A 2EACA 3A21A 3HG2A 1HVXA 3D4YA 2JFEX 1A3HA 3SCQA 1C7TA 3RM4A 4J27A 4DO5A 3EMCA 3WEMA 3WUBA 1OM0A 4PSPA 2QPSA 1GJUA 4U3AA 1KB3A 1V08A 4W86A 3MKKA 4P7OA 3NCOA 4ZXLA 2B31A 5DO8A 4WKAA 2QLYA 9CGTA 1BFNA 2E8ZA 3N18A 5EBAA 1C8QA 3SUUA 4AMCA 4W93A 1JZ5A 3AIUA 4XV0A 4UR9A 3SCVA 4FNUA 1QOXA 1RD6A 1Q6FA 4H41A 4U31A 4UCFA 3POCA 1G0CA 2BY0A 4HMCA 3RCNA 2DIJA 3CUJA 1ODZA 1UKSA 2J8GA 1UH3A 1H5VA 5BXPA 3VD7A 3LRLA 1KTBA 1B2YA 3VIGA 1FP8A 2ZUNA 4ZE5A 3UESA 4ZEPA 4LX4A 3EDEA 3SUVA 2DQXA 3UEQA 1V6YA 4JKLA 1LF1A 3B9AA 1PZ2A 3WFZA 3BMVA 5BROA 2WW5A 5CZKA 1PPIA 1UASA 2W92A 3EJPA 3AZRA 1O7DC 4AZGA 1KR0A 1UWSA 3N12A 1MXGA 3WNNA 3WDPP 1FFRA 3WDQA
chains in the Genus database with same CATH superfamily
4V2BA 1KEGL 4N85A 4DUVA 2B7PA 2X4RA 4I0PB 4Z7AA 4HQQH 1TU2A 3CMFA 2E4FA 3FK3A 4XVUD 3WIHL 2HTLD 2IWEA 1QFWI 4XZUB 3S3GA 4ADUA 2NV2A 2UBPC 2ZP9A 4M9PA 4XVTL 4X4YB 1FWBC 4Z7UF 4C8XA 4B5XA 4LU5L 3UACA 1KYOK 3U0TB 1XC6A 2XI9A 3GI9L 1IYXA 3UZYA 1INQB 2HKFH 3VMPA 3KXFD 1HZHL 3W73A 4PTDA 1NCBL 1QABA 4ZFOB 4KRZA 2R1LA 1FNHA 3V5DB 2ZNWA 4S1RL 1N55A 2EEXA 3RHWK 4I2XB 2YMXL 4J3OG 4MLRA 2GVJA 2VLKB 3K6NA 5C0EA 4GK8A 2AXWA 2XIDA 4ICXA 4U1IA 4LBRA 2P8PB 1WIUA 5BU6A 4X22A 2OX5B 3L1EA 2ADIA 5I23A 2VE6A 4B91A 4PJ7B 4KKCD 3LBMA 1P6FA 2YUZA 2WAQA 4PJBA 2YCKX 1EC9A 4ZTPH 3GVQA 2GGGA 1DQML 3PHAA 4F2ME 1O9WA 4PJIE 4UTBH 4UQIM 1KM4A 3DHPA 3CX2A 4OGYH 4ZAKA 1HL2A 1KBLA 1R5WA 3CAFA 3VIHA 1D5IH 5T5FA 2DDXA 4PBGA 3HGOA 3GKFA 3GTNA 4BF7A 1X9LA 2G3MA 1B0GB 3L5XL 3BWZA 2IWKA 4F8TA 1Y5XA 4WSHA 4EWND 4OGXH 4MJ5A 5E51A 3WXWL 2FATH 1VKXB 1KM3A 2MPAL 3W88A 2W38A 1G4RA 4PJBF 2PC8A 3ZLHA 1WDRA 5FUZH 3KBWA 3TF7C 3MP5A 2M83A 1YJDL 3IJYA 4H6EA 2NOYA 4PEEA 3EA2A 4LB3A 1HWHB 3D69B 1ISWA 4GXWA 5E5LA 1DJQA 3RX3A 1VAHA 2ERJC 1E56A 2X8RA 4M6QA 4UTJA 4NQED 1ZWIB 3SBPA 3ULSB 4JY9A 4MA3B 1KM1A 4ZBCA 1EWHA 2NTSP 4N2AA 1J79A 4GKTA 4RMBA 4X4ME 1ICSA 3GMRB 4YSQA 5HYJD 2ADAA 3WKPA 1HFUA 2VD9A 3EX2A 3DJ9A 3W0WB 1P53A 2RD0A 4IS6A 4EIGB 2X4QA 3CFBB 3VDBA 4W8LA 4FQXB 5FUOL 1DLHA 1KIRA 1XLKA 2ZZ6A 1BGXH 4LLWB 2WZAA 3KPRE 1WFOA 4ZUWB 4X6CA 1Z0MA 1QWKA 1RJYA 2O6CA 4YGVB 1QSED 1JBJA 5IB3B 4P9HL 5E6YA 3HE7D 4MWAD 4RDZA 1EC8A 4X83A 4TPRL 5J12B 3C8FA 2HT3C 1ICPA 5H94A 2OELA 2K8MA 4IOSA 3SURA 4GUHA 3SI9A 5K9CA 3GMOB 3FGCA 5B39A 2HLFD 5EA0L 2OX4A 4G7EA 3OXRA 3QHMA 3TJIA 3U0WL 1HKMA 5FJOA 3A47A 1ZLUH 4B92A 2ZONA 2VZVA 3KM1A 1EUAA 3WXVL 1RY8A 3IU3A 5IF0B 4P3CH 1IGTA 2A6KB 4J3SA 2G96A 1AH0A 1X5LA 3QORB 3UPRA 4E9VA 3GTIA 4PJCA 2NY1C 4OUUB 5D1XC 3RIFK 5LKNA 5CP7B 1SVCP 1CFNA 3C08L 4GQQA 3KUMA 3W74A 3EWZA 4IBZA 3P8IA 3BHBB 2YAFA 4K7FA 4L3EA 4LGSB 4CN6A 4TV6A 5FA4B 4AIOA 3SE9H 3GTXA 1S7VA 2A1WH 3K81A 1HEJC 4KGLA 3TJ4A 3W2LA 4XBGB 1UZ1A 2DYSB 4N20A 3BFWA 1D9KC 2R51A 3LKRA 5DHVH 4GG6B 2A3EA 1U91A 1KV7A 1K6QH 1XSJA 1NBQA 5AOLA 2W3ZA 3CUFA 5E93A 2SEBA 3SYOA 4G9PA 1V0NA 5BRQA 2HT2D 3N1GC 2D20A 3VKDA 1GOKA 2ENSA 4NRYA 2JKPA 3EBIA 3MRGA 4N2EA 1DYSA 1K6AA 4QQUA 2A7PA 4NGHH 4S39A 5GRJL 4AQ1A 1EERB 4NP7A 1RVFL 1OSZB 2VLJA 4HJ1A 1IR1A 4ZXBB 1MCDA 5KZCB 3BDBA 1QRQA 4LL4A 1E6SM 3PNZA 1AQKL 3FHQA 3SKMA 5T5FL 2Z92B 3MCMA 5CIPH 1RAMA 4OBTA 1J8SA 5DR5H 1PKLA 2PN5A 1XIHA 3CSYA 3NM1A 3ZZSA 2GSMB 2P24A 1NL0L 1GA2A 4HHHA 4O00A 3P73A 4PJXF 1KV8A 1NCNA 1JK9B 3HA0A 4JN1H 2EIKB 4D7BA 2DZPA 3BPCB 4FQHB 4G70B 2F9RA 1L6SA 2UWEA 5D7LA 4POUB 5EZOL 4PL1A 3B06A 4OM1H 1OP4A 3WXVH 3GLEA 3MLZL 4RZCB 1WBZB 4FULA 1ZLSL 4R4BB 3S37X 2C34A 3IM1A 1VJSA 3UYRH 2CHRA 2YDAA 1TV3A 1M6JA 3D85D 4ZYKB 5KYUB 1WDWA 3EADA 5F1UA 2V7NA 2NY3C 4I7WA 4DJED 3CZEA 4KGJA 5C3LD 4OKVA 1KTCA 1OGPA 3UPAA 5CPLA 2NSQA 2BNUB 4R96A 3VXPA 5D1ZD 1HYRC 1U8KA 2ENYA 4LH8A 2EXSA 4BFAA 2E27H 2QMKA 3VX1A 3GSVB 9PCYA 5LYRA 1TJRA 2G2RB 2P5ED 4JW3A 4QEHA 5C2UB 3WN6A 3SBFA 4JFUA 5IMMB 4XRCB 4R8WL 5LNEA 3S4SG 4M6OL 1Q6GA 4QHNB 3F7RA 4UDTB 3CHEA 5HAOA 2BP0B 2XBDA 3QDJE 4IOFC 3D39E 2A9ML 2NMSA 3MACL 2HPOA 5FO7A 5DMNA 3PPGA 4AD5A 4DF2A 3Q7JA 3K5SA 4O9HL 3O4LE 2OBGA 3QNFA 4PWIA 3ZTDC 4UNLA 2TRYA 4D9RD 4R90H 5I1DB 2ZE3A 3ARVA 3EH2A 4GAYB 4L1HA 4DIXA 4JFQB 2XH7A 2WMJA 1BD2A 4ABQA 3D6GA 3VWKC 3QQ4B 2AV7A 2AITA 4JNZA 3US9A 4F33B 2VX4A 4EDWH 1J10A 2J2ZB 2QQKH 1PBYA 4Z5RA 5KAQF 4LALA 3V36A 3ECBA 5TIMA 2IKIA 5IOPA 2E1DA 2GSIA 5GS1C 2OZ3A 4PCPA 1H09A 3K2MC 1I9EA 1E4JA 3CH9A 4BQ2A 3H56A 3ZDXE 1NM4A 5KG9B 2WIIA 3DROA 3O8XA 4LCCB 2HPMA 1SJXA 2YEZA 5DHVA 1KFKA 2NZ1A 4NN7C 3QHNA 4N0FA 1CENA 3F4DA 3BCDA 3PWPA 3EPNA 2WKOF 1PDYA 4QBXA 4OZIA 3MRQB 3ZZQA 1B4KA 4L8BA 4WNQB 4FERA 4EI5B 2W9DL 3GBNL 1CUOA 4UT6A 1DQMH 3D4GA 4FEMA 4ZUTB 1TWWA 4PJ7F 1JYNA 1AGDB 2CLHA 4FSAA 1EEZA 4Y9MA 5HJDA 4HS8H 4FEIA 5T3XL 5BRPA 5EL1A 1SHXA 5HBFA 2JK5A 2X9ZA 1FHUA 1A22B 3E1ZA 3PRZA 1ZLWK 4PQXA 3LKSA 1J96A 5A2AA 1JF6A 5I1JH 4YSRA 1AQFA 4XNMA 4YL2A 1L5GB 3GIVA 2O6DA 4UOZA 4AYFB 3NSFA 4FQLH 3B9KA 4M7JL 2YZRA 4GYBA 1XC4A 1HNYA 2Y5TB 1BA9A 3QHOA 4HNTA 1T5XB 1AR2A 1VGEH 3RWJA 4PRTA 5M2FX 3HLAA 4MX7B 2F8OA 2CHDA 4QCIA 4ATTA 2F84A 4AH7A 3T3ME 1JHLL 3CDGA 1D5ZB 3FFDB 1FO0L 2EIMB 3L66A 1WWCA 4IHOA 4MXVE 3WIHH 4XXDA 3WQWA 2WHLA 3QMRA 3Q48A 4JHUA 3M8OL 1IEIA 3S6OA 3MI2A 3SAZA 5T1DL 1LNUA 3NPZB 4HXBH 1AG1O 1YN6B 3F7QA 1BW8A 3NPUA 1KIQB 4OOZA 3FFCB 1A7OL 1SY6L 4JRYD 1NGWB 4JKWA 5DYOB 2ZVRA 3DFOA 2EC8A 4KVCH 4K9EH 3NYZA 1A9EA 3QKEA 3T04D 3UY7A 3GS7A 3S2AA 4MMXA 3AWGA 5ITBL 1OCBA 1MFMA 2ZUSA 1A3QA 1IFHH 4PRDB 5EPMB 1LILA 1A1OB 1FWSA 2Y89A 5DMLA 1A6ZB 2PTZA 5CPOA 4EXAA 4CNIB 4HK0A 5FHAH 2OQJA 3BJFA 4V1DB 2EH7L 1JIBA 2B1AH 4GSRA 4RWYL 3H2MA 5HHOD 3N15A 3SDAC 2RDTA 1AZZC 4AI7A 3VILA 4DHGA 1CWVA 3V6FA 3KG5A 4H6KA 1LQ2A 5L9FA 3BUIA 5IQMA 2WWMC 1U8QA 2APWA 5DZOA 3RCMA 3LCXA 2X1WL 1DEDA 1I53A 1KXHA 2WP3T 2DDQH 2EO7A 4HHGA 4NO0D 1JPDX 1V5XA 2DSWA 2PDNA 2YBTA 3X11B 4Y5XB 4G56A 4JHMA 1R5VA 1BAWA 1ZV5A 2O6EA 3PP3K 4K5NA 2YPLA 1D7DA 1KCSL 1WBHA 5A8NA 3A4AA 2PDCA 1OD9A 4NCDA 3UBXA 2ZIDA 5E00B 1TF4A 5IDZA 3R89A 3B2VL 4Y2NA 4HUVA 1DQDH 2I24N 3UG3A 1JWMB 3CFMA 1NDVA 2F74A 5IUSA 3E2VA 3G5VB 3VXSA 2Q8LA 4PPTA 3CASA 2OMTB 4S1DC 3B7TA 4OW6A 2E46A 2NW3B 2HTLC 1AACA 4YBHA 1ZT1B 1BM3H 1NGXB 3GMNA 1IGYB 1A5FH 4U1HB 3RDTD 3K2UH 3VDCA 4NC0B 5DQ9A 5HP5A 3E5PA 3P0XA 4L9DA 4DGIH 1WS8A 4ANVA 4L3FA 3WUGA 1HHIA 3RRAA 4G6FB 3BIKB 5AOKA 3MV8B 1RULL 1FF5A 3TYGH 2CGRH 4DN4L 2PLJA 5FL0A 3N73A 1AIZA 1JYXA 4AZBA 5EC1B 3V0JA 3QY7A 3ZDZB 2PF6A 2X09A 3EGSA 3KEHA 4AYGA 1SRDA 1UMYA 3DOSB 3MMEA 3CFNA 5FR3A 4E5TA 4WFFD 3B2MA 4WY0A 5CJXA 2V2WB 4G1MB 2RQ8A 3KVQA 4PW9A 3K6IA 5F0MB 2ZF9A 1RXOB 4XNYH 4WDIA 1E8ZA 5CG0A 4REQB 4CEUC 1NOAA 2Z31D 1ZSXA 4M7SA 4LPXA 5IFHL 4CVXA 4GXMA 3V5OA 2CHOA 1AQDB 3EO9L 3AABA 3SY0A 4AT6A 3OC5A 5EIQA 4ZMOA 4ZMYA 3TH6A 4IX2A 5E1QA 2HLAA 1ZANL 1KRAC 3DX6A 1E9ZB 1P9MC 2PO6C 3UZEC 4DKFL 1OX4B 3ZZ1A 3MLXL 1U8PA 4PY7B 4D6JA 4Q6IC 4QXUL 4QXUH 3WD5H 1TO5A 2JKWA 5DVOA 3WD5L 5IWLC 5I15H 1Z42A 5DJZA 3D4ZA 3LSOA 4TUKH 1AHKA 1IEBA 2MCG1 3PJSB 3UMTA 1OJXA 2KI6A 1V6UA 5MI0B 3WMCA 3PU7A 2VMDA 5I6PA 4N87A 5JQ6L 2J1XA 3VD5A 1U8HB 4OTXL 1OC7A 2ATAA 2WVUA 1UQYA 3MSPA 3F58L 3AXHA 3T05A 1Q38A 3LKOA 3Q13A 5T91A 2UY5A 3T4YA 1U3JA 1ACCA 2EXTA 3DX0A 3LN4B 5F2GA 3S35H 5AAMA 4FABH 1MFAH 4HVXA 3KOZA 2FEJA 4M93B 1ZU8A 3FA5A 3NA8A 4JQIL 4DAGH 3VUPA 2BNRE 3VFSA 2BO0A 1R7OA 2ODOA 1PO9A 5I8EA 4BQ8A 3IAPA 4NAFB 3SB0A 3L8QA 1JI1A 1K5WA 4JY5H 1OB1B 1WVZA 4IIFA 4QXTA 2ICWB 1EZVY 3MI6A 2YQBA 1I2QA 1ACYL 1VESA 1H6TA 5D2NE 4XAGA 4K9JA 4F2UA 1I1AC 1P84J 2AI0H 4H88L 4US5A 3MCKA 4YYCA 1F6AA 4S2BA 3PUDA 1P7QD 1NIBA 1UW9A 5C1MB 4PB9L 5DWPA 3MUJA 3QKZA 1FFNB 3PR2A 4GFSA 4E41A 5JZ7C 1TWDA 1YEEH 4G8GA 1ENUA 1TJGL 5DA4A 4UOJA 1VKFA 3N6JA 2XNAA 2E9MA 4FXRA 3OAWA 4CC1A 1LOSA 3ULUD 4XBMA 2VYRE 2YKLH 3M1ZA 1E4NA 3IDUA 3MLTA 3QCVL 4WJG3 5C55A 1HO1A 1FA2A 4X6FB 1SJVA 1MEWA 3QO0B 1HL5A 4TVPE 4F91B 3KTXA 3FQTB 1XM3A 5AW6B 5AYQA 5L0QC 5A8GA 3RJQB 3SKOB 4G6AC 3VSVA 3WN5A 2VW6A 5BO1L 2QQ6A 3F03K 2C4FU 1FV1A 2IBZX 1JAEA 3VTMA 1A0QL 3H9SD 3HI1A 5EOCL 1KJMA 2J1ZA 3SDAD 1EOMA 2ZOXA 1WDAA 4M51A 5CZTA 1U2CA 2DFAA 4XSMA 2UY4A 2QXWA 1N3NB 3TWAA 2E6JA 3N0PB 4JGJA 5LBSA 1FKXA 2CLEA 3MKVA 3MUGB 3KZPA 2F7RA 3WD3A 3KOWA 1Q9WB 3Q2DA 4JFDB 2AKRB 4TSAH 1HSBA 4U0RC 3RIKA 5A2BA 1TZ9A 2XJLA 3S96A 1O95A 2DMGA 4B53A 3WQVA 1WCBB 3N85L 4QRQA 3RIAF 3MDWA 4HOMA 3TBCA 2DW6A 4Q4EA 4DNLA 2WKOA 4HZ7A 2OJEA 2AQPA 1FBIL 4AITA 3GYRA 3WFBL 4WRHA 1UXSA 4C90A 3UYOD 3L3OB 3D39D 1N5YH 2WBWB 2Y1AA 1FRGH 3FT2A 3ZDXF 4IISA 3TFBA 4G6CA 1NFGA 6XIMA 3R8BB 3G3DA 2NY0C 1WT5C 4AV5A 4P5UA 3MLPA 2YAPA 2EIEA 2VDOL 3MJ9H 3PWUB 4HKZA 1NCCL 3KPSB 4KJWD 1PSKL 4DZBB 4HHWA 3GXFA 3PZGA 4WD0A 4PTUA 3TR9A 4ODVL 3V7AG 1DSFH 4PCYA 3QIUA 2I9LA 1MIMH 3H6OA 4WJ5A 3WMBA 3HGRA 2D69A 2FRGP 1OANA 2Y85A 3RUGF 3XIMA 5I3GA 3VFMA 4QRFA 3TT1H 4QQ3A 3B5HA 1ZLSH 4U1JA 5K9QG 3R4IA 5GGQL 3EKGA 1HINH 2HFTA 3ZTJG 5SWZE 1B0RA 1TR1A 1LYQA 2I26N 1D5MA 1KRMA 5E9DD 4Y4KD 2YUWA 2WXIA 2XVKA 3NIGB 3IJHA 3FSUA 4NFDA 5I1JL 1DFBH 3QHZH 5BQDA 3EGJA 4AC1X 1ISXA 2FHFA 3L4VA 1TYRA 1EH9A 2ZT9C 4Y8DC 2J7FA 2ODIA 4HP5A 3ABOA 5DJ0B 3SD2A 1CECA 3LHZA 3IGAA 3RM9A 3EJYD 2YX0A 2B0SH 2N0KA 2Y1VA 3MV9E 1TSIA 3WL9A 1XLBA 1KYDA 5AFAA 5BJTA 3CNYA 3ARQA 2DUZA 4NO2A 4HLJA 5LNVA 2G60H 3GSRA 3VNLA 4G11A 1JG9A 4CC4A 3PHOA 2XXMB 4QTHA 4M43H 2WO4A 5JDJA 3BG3A 1VIZA 3A64A 2EZ0D 2VDNB 3QUZA 1QTWA 2YPLD 4X6DF 3U4EA 3HQNA 4LYRA 4XZNX 5I2UA 1UKOA 4KQNA 1GZHA 5KW9L 4GYFA 4DJFA 1Q94A 5EU5A 2CNYA 3AJXA 3GJFK 3PV6A 3SE3A 3LN5B 1QFWM 3E49A 3OBKA 4NJIA 4PJGB 4WEBL 3RDKA 1MUWA 3K3QA 2UX6A 3SIZA 2XYCA 3K8MA 4BHUA 3SE3C 4EDWL 5HVHC 2HG5B 4R4NC 3O45A 3SCNA 4OCRL 1AMYA 5D9SA 2VLJD 3LNHA 3BP6B 1G69A 4N2YA 4XMKH 3LZFH 4Z1PA 1S2VA 1JNLL 3QUKA 3Q67A 1A6TA 1Z7JA 4Q52A 4FKEA 5EF0A 5ISZB 3TNOA 2VRKA 2YPVH 3SDDC 4Y4FC 5IEKA 5FECA 2AGTA 4N0YH 1B88A 3KDPB 4RFEB 1BBJB 4AVIA 2HJLB 1I4NA 3U9IA 4W8BA 3OZ9L 4PHZA 2WOBA 3GSMA 4MY1A 4XVDA 4W9CC 3TZVD 3SZ8A 4CSPA 1PE1A 2FGBA 5LN8A 4UM9A 5EA0H 3ZUCA 1N7MH 2Z24A 1NMAH 4LVHB 4YDNA 1JVOA 3BEVB 2H0FA 3ZKQD 3APCA 4EZKA 1PZUB 2FVNA 1E0XA 4MUPA 3II2A 3STEA 4F7CA 3KVLA 5B7YA 3BE1H 3EBAA 1OX6A 4C4KO 4GG8A 4YVVA 4UR7A 3NZSA 1URLA 2X3CA 3QSKB 4YC2B 4WI4A 4R5XA 3VFWB 1S9XA 4ZNCD 1GPWA 1VLIA 4U2YA 1EHLL 5FGCE 2ZAGA 4AE1A 4E41D 5JO5B 5B38G 1T1WB 4LBEB 3GE7A 4EXBA 3ZZLA 1XFPA 3CUZA 1PHWA 3F7LA 4ZFMA 1A5OC 1FFOA 3CFEB 4MRCA 2J5LB 2NZIA 3NRQA 5DZLA 4J1OA 1CR9L 2BSED 3CO4A 5JW4R 4WOZA 1QO2A 3WO4B 1IEAB 3RGVB 1BYBA 3MYOA 2IAND 4OE7A 3ISWA 3DO3A 3P6LA 4MJ6B 3QGVA 1BGGA 3OKYA 3PY9A 4QHUB 3B9EA 1H5YA 3SKJH 2GJ6B 5FIPA 4P3DB 3TO4A 3W7KA 3V0VB 3AQUA 1JQVA 1BM3L 2GIXA 1KEML 1OVZA 3AFLA 4XNXH 1IFRA 2FATL 4UNVA 4B9YA 5M95B 4FEZA 4EE2A 1W2PA 4OCWL 1S78C 4B9GA 2WWKO 4KUCD 1US3A 1NDMA 2XZ9A 5T1MA 1XLJA 5C0BB 3QLLA 3G8RA 4LB4A 4NQCA 4OU3A 4XX1E 4ALAH 2XFYA 4XZLX 3ZQXA 2G3IA 1K7EA 3DETC 1UH4A 2OMWB 4CVUA 2BINA 2DZBA 4XKYB 2X4UB 4MXWH 3D07A 5D2NB 4IXXA 1OQFA 4GW5A 4YVNA 2QVHA 4BDVB 2ZUQC 4MHHG 5BVPH 1P4CA 2PF8A 2PRHA 5DUBB 1NGYA 4U7SA 4W6YB 5TPWL 3IAGC 1UBSA 4O16A 1GOQA 4YDIL 4PJAE 2ZX5A 1K9FA 2FYMA 1QKZL 2NY4D 4JM2A 2Y5SA 3TURA 3S42A 1JWSA 2H1XA 43C9B 5ID0B 2QCGA 1C5CL 1T0NA 1FL5B 1OC6A 2NUTB 1H8LA 1EJ7L 1QUPA 2BS9A 1MFBL 1XGQA 5FD0A 2V2HA 1E1CA 4OUEA 5F0JB 1JHTA 1DLFH 1I9RH 1T99A 4HCRL 5B1BB 1CE1H 3VOFA 4KMTH 2ZUVA 3VCLB 3WHXA 4XVTH 5E6IB 2OPCA 5KVFE 3EGXB 3GINA 4FQJL 4HIXH 1K5NB 5D5MF 3W7LA 2AZUA 1KBGH 4XO8A 2OM5A 1ZTXE 1XWYA 1YRRA 2CZFA 1PAZA 4MNQB 1WGOA 1ADQL 2PRMA 3LGDA 5ERWB 1OF2A 4EIUA 3L7EA 3LH8A 4YJZL 1SGJA 2BLFA 2DU2A 2KLRA 5EIIG 1P7KA 1W17A 1SMDA 3IFPB 4ODXA 4K38A 2E86A 3MVSA 3RB5A 2JCCB 3V5KB 1AKJD 1UM4H 4MDJB 2Q71A 3DBXA 2CBMA 3AMCA 3AREC 1NCUA 4JFFB 3VXME 2KZBA 1YMMD 5LB1A 2KPNA 2WSQA 2F54A 4K5PA 5CWSB 3RBGA 3WLBB 3HG1E 5D5MB 4CADB 1TUPA 3UZ5A 1RUML 3WH6A 4C6QA 1LMKA 3V0WL 2DSZA 3VDHA 1CLCA 4RMQA 4XPHH 3ITGA 3W2JA 4JIPA 1K9EA 3H0TA 3T77B 5TDOB 4Z7QE 3D30A 4U1SB 3D08A 7TIMA 1UADC 1ZHAA 4FF9A 3A12A 2E6DA 1JMXA 3N1MC 3NIFB 4ZS7L 3LCGA 5CPSA 1IC5L 1YNPA 3SN1A 5PTDA 1YPZB 2IXQA 4XR8C 5C7VA 4X4MA 4K8RC 1ETZA 3QS2A 2RCSL 3QUMB 4RNJA 3UQNA 3QVQA 3HV9A 3RQ3A 2P5WE 3LCYA 4L4JA 1MUMA 5JORA 4GXUN 4KQ4H 2BSTB 3CO8A 2DSKA 1JR1A 3MA8A 2YD6A 5E2UH 1XGEA 4I9JA 2PZ0A 4R5EA 1XH2A 3C6LD 1YBQA 2B1HL 4HNLA 3ESNA 4FHJA 1MLBB 5JU6A 3MR9B 4A66A 2X0YA 5HDBF 1P4UA 4QY8B 4XWGL 4OIBA 5HDBB 1A5KC 4Q7IA 4MJIA 4PRIA 1XF5B 2B20A 3I6TA 3F05A 2P8LA 5ESQB 2R0LH 1DQKA 2OXGB 1NFAA 3EW3B 3LXAA 5AZ2L 4QITA 5DJXA 3I02A 1JNHA 4OCNC 1RIUH 2PWUA 1HZKA 5BZZA 1IGFH 1AGCA 2GITA 3GR7A 3DGDA 1E7UA 4W9IC 3RU8H 1MCEA 3QJXA 3CHPA 4MMZA 3ITYA 1XR8B 4RISH 3TA3B 5AC8A 4HH8A 3ZL2A 2XQYG 2ZXGA 4GGHA 1ZPLA 3FSWA 3BZFB 3WLRA 5EGRA 3WJZA 2ZXCA 4YTRA 2DVXA 4UQDA 5TF0A 4ZO9A 3W76A 4KT2A 4AWJC 1EAQA 1KB5A 3ARFC 5EU6B 5SWZA 4JDBA 4NZ3A 3VRLF 3SJ3A 4A3HA 5ICXA 4B6ZA 4LOVA 1HT6A 5XIAA 4NT6A 3UFYA 2BIQA 4FGMA 2H45A 4FCHA 4NJ9H 3FO1A 5KYNA 3KFTA 1FVEB 1AR1D 3GYCA 5A8MA 3PWAA 3HPFA 4ANXA 3P4NB 1P84K 2QDHA 2HUHA 1DANU 4NQXA 1BZ9B 2JCCF 4XP4L 1W5NA 4GRWF 1VADA 2YB4A 3CZLA 5JOFB 3I7RA 4J2PA 4H26B 1YY8A 1MJUL 4PYGA 3TBVB 2HMCA 2HN7A 5DSCA 2IWGA 3EKLA 1V3MA 1Y0LA 4HUUB 1O6VA 4RRPM 3VSUA 2WZHA 2CW6A 2P5EB 1T5KA 5IBUG 3Q94A 4TNVF 2DTML 3FU6A 1PZ5A 2QAPA 4IGBD 3G9AB 4JIHA 4YX2H 1RK5A 1E9QA 2ITFA 3F2LA 3D3VA 2KS0A 1EEUA 3LKQB 4HK3N 1JN6A 4AIUA 1MFBH 4MKVA 3TC7A 3ZL4L 3ESMA 1ZIAA 3O1NA 2ZFAA 4R7XA 1L0XA 3MOBL 3QRFM 3K6OA 3BUQA 3GSUA 4H2AA 4IQEA 1KBKA 2BCKB 1I7RA 2A99A 2DZEA 2FQGA 2HH0H 3HPLB 2UWEE 4K94L 4PCKA 5D7LE 2VN7A 3CVIL 5FF6A 1VR6A 4OJFL 1BKHA 1YYLH 3W2NA 2PYEA 2XWZA 1O1HA 2GOUA 2X28A 3HRZB 3ALFA 3C09C 5ILTH 1UQSA 3FT4B 4ZTXA 3BLBA 5CGTA 1U3HA 3IV3A 3PTKA 2E40A 3VIKA 1WCQA 1GW6A 3PZIA 4KU1A 3BLPX 2JKRM 2WINA 4BY3A 4Z0XA 1BOGB 1QPPA 1MCKA 3W11D 1L9MA 3DPBB 3FUNA 4LASH 2B7OA 4KIEA 1MELA 3GSNB 3TBWB 3OJMB 4G6JL 1Q85A 2QQQA 4AYID 2VM8A 5IHBA 3DIFB 3A4JA 1AXTL 3JV0A 3PGFH 3O0KA 3R7RA 2IANA 2CZVA 1DWFM 3FYOA 5AYZA 2JB6A 4PRPD 2BVDA 3V79C 3MP4A 3GI8H 1I8LC 2X10A 4FF7A 4JPWH 3TYFA 4BZ2L 3RFRA 1XGDA 2XGZA 4ERIA 1G6RA 3C2OA 3LKNA 1C3FA 1ZEAL 1ANUA 1Q8MA 3HQ1A 3MRFA 5AOZA 3WNIA 5IT2L 3BVXA 3A0OA 4XZ4A 2QUMA 1ONRA 1L8NA 1BVLB 1OHZA 4MNGB 3RL2B 3TJPA 3O0RL 5IM51 3NFPA 1KXTB 3CCHA 3S37L 1XLLA 3WELA 1ZQ5A 4ZA0A 1A21A 3P4MA 3VWKB 1Z1WA 2CK2A 2R69A 4HGMA 4Q9BA 1NGQL 3BAEH 5HGHA 1IVTA 2AQVA 3FK4A 4ZW3A 4ICNA 2CZEA 2BP8A 1NPJA 3ZHNA 3EXJA 3Q2LA 1IM3A 4BKLB 2ZRZA 2PW2A 4GZ7A 3VC6A 4CNOA 4AFYA 3TIMA 5IVZA 1HEZA 1XF4A 3AXLB 4Y1AE 3MJWA 5L2KA 1JZJA 1JZ6A 3BT0A 1X38A 4XX1G 4L4MA 3S9ZA 1HX0A 5FJPA 4GZJA 2NUPB 3WDJA 2X4SA 3IARA 2G0KA 2FL5B 1XXDC 5HYJA 4I5XA 5EH1A 3HURA 4UFJA 1HHHA 4ZFOL 4PGEB 1NH6A 1PD6A 2VZSA 5DMGD 2X1SA 4LFHG 3QNXB 3NGJA 3OZPA 2OMUA 3OZYA 3HC3H 5CN1A 2UV3A 3TROA 2RKXA 4D8ZA 1YEFL 2VM9A 3RL1B 3P14A 5EO0B 2AK4B 1MVUA 4JX6A 2Q01A 1F3WA 1KC5L 1S2UA 4ELMB 1QLFA 3DHJA 3GSWA 1DQJB 4UT9A 5ACLA 5ADPL 3Q8AA 2R0ZL 2E7LC 1MCRA 3SD5A 5CBBA 2XWTA 1U22A 5ACZB 4NO0B 2DY3A 1W3HA 1YEIL 4LSRH 4UAOB 5C0DB 4CDGC 1EWDA 3DUGA 1A5AA 5GJMA 4JFFE 3MZGB 4AIEA 2X53A 5H6HA 1ISVA 4WJXA 3US1A 3LI1A 1A6AB 1KLFA 4DGYL 3WFHB 1RZGA 1Y6MR 3WTUA 4OQVA 3GFUA 3SJNA 5JUEH 4YPJA 1MXSA 3ATYA 2Q3AA 5T3XE 4ZQKA 4K3DL 3QUXA 1FDLL 3GRWL 1JQXA 4ZTPL 1AXTH 3OHXB 3N19B 1Z5HA 3IFLH 2G5UA 3T4AA 3EO0A 1TQUA 1MQKH 1FWFC 2JF6A 4JZOB 2P9RA 3PJLA 4LHJB 4PTTB 4F2MB 1RQBA 2YSWA 1DJYA 1KB9K 3P0YL 2ZRWA 3RTLA 1BD0A 3F4WA 3QDMB 3MWCA 3CQQA 1I75A 1LVEA 3BQUD 4HKBB 3K4AA 3IJLA 4PB9H 3P5ZA 2B4CC 2J47A 4D72A 2EDTA 1DJGA 4GP8B 5HGDA 3TYUA 3VNKA 2JALA 3CU7A 3LRKA 2VLKE 4AC2A 1MH5B 2CD0A 3G6DL 2X0SA 1W1IE 3MYZA 4FZ8L 3TWCL 3WQ4A 4JY5L 4IGSA 4AWTA 3I10A 4JPGA 4FPSA 4XIMA 1BWLA 4HG4K 1XYCA 5D8WA 4YPGA 3CN2A 4KXCA 7FABL 3BP4A 5MEOB 3UR2A 2EP6A 3Q1EA 2R69H 4W9ZA 5MEPB 4AEEA 3TYBA 4DPBX 4PJIB 4DJFD 4XOAA 2R1WB 3I9GL 2APVA 4PJ5D 3GJFA 4MHBA 3QI9D 2APTA 2VABB 5I1EL 1N67A 3OKOA 3GC4A 3OZOA 4PCFA 4Z1CA 5AOJA 3RG6A 2BX7A 4AZHA 2PZNA 1HKKA 1FRGL 3H8NA 2E68A 3DJRA 3QT2A 3NZHL 5FW7A 2W0KA 3HAEG 4UCGA 3RWCB 3GFZA 3PUUA 4OQTL 3VFCA 4XB7A 1H63A 3MODH 1MFDH 1N70A 1QO3A 2R2HA 3QDHA 4WUKH 1Y8BA 2IDFA 4KWVA 5LDUA 1KGWA 4LVFA 2GJRA 5C71A 2QCEA 3VRJB 1JVKA 4HH9B 4UTAL 3VUSA 3PL6B 3MO1A 1ZHKB 4NZRL 2MCAA 3WFDH 1A3ZA 2Q8AL 3S7GA 2F7FA 1QPQA 3W7EA 4E42B 4O1EA 4ODSH 2QVTA 3HS0A 4HIEA 3QEUB 1BVOA 5TGBB 1HXJA 3JWNG 2OQLA 2HXUA 4W7UA 1MREH 3IS1X 2EQDA 2JELH 1XGRB 2UZYA 5EOCH 1IM9D 4CD6A 5A6BD 3SADA 4MKMA 4Q8NA 4B9CA 3H2NA 4X5WB 3SCTA 4YSAA 2DW5A 3QORD 4M1CC 4TSCL 4UF7C 5D2TA 2F6AA 3HS0C 3ETBF 3KXFA 2VEGA 2J20A 3QXTA 2YL6A 3DYOA 4F1ZA 1QAWA 3KPNA 2JJTA 4JCWA 4CNNA 3BKYH 4AGMA 3N2CA 3H4FA 1I3VA 5CFHA 5I66B 1K70A 3FOLA 3IDMA 3O3AB 4QR7A 2VITB 4UNUA 4XNUL 3FTWA 4KMQA 4MA8H 4OJCA 5FWRA 5JZ7D 1YG9A 2R23A 3I6GB 4HDIA 3QIUC 4JREC 5E99H 5TQ0H 1FNSL 3EUDA 3MBED 1GKRA 1UWUA 5MHBA 2P43B 1NWRA 4Y88A 2VC2H 4JDVB 4Z7OE 1ALDA 4ZFCA 3NRPA 4KJYA 3VRLE 2NXIA 3MZNA 2DQFB 4AG4H 2Y8UA 2Z7KA 5JOEA 2AJVL 3THDA 2QKIB 1CL7H 1A4JB 2VH5L 4GQRA 5JNYB 3HCVB 2MCPH 5I71C 3W39B 1HO4A 1IM3D 3SN4A 4BWLC 3VFPB 1IGIL 4BH8B 5JHLL 3BD4A 1W0WA 2MFNA 2J8TA 3DFTA 2PXYA 3ILPB 1FUNA 4UINL 3OHXC 3QYQA 4FIRA 1OTSD 3PN8A 5GJSH 4RDVA 1GHRA 5L8JB 1XYFA 1VFUA 3IDGB 1RZIA 4TN9A 1NINA 5A3IC 4B9PA 3RWDA 4ZMLA 1HHGA 1S46A 5CZXC 3EXTA 1R6VA 2G75B 2IAMB 2Z93B 4ZO6A 4UC5A 4I3GA 4J1UA 1VP5A 2HCZX 1ZLEA 1BPVA 4AL8L 3M0IA 4E4PA 3VIPA 4WDXA 5CQ1A 3AU0A 1WITA 3QCTL 4N2OA 5D8JH 4IMFA 5CN3A 1NCWH 6FABH 4WI0A 2XY1A 2EKSB 1BQHG 2IFGA 2ZP0T 3AWFA 2QQLL 2WM0A 4YDZA 1J9YA 1QUMA 2WQ8A 3VJ6A 5LGZA 2FJHA 1FCBA 5EMYA 2R2EB 1KCVL 3ITCA 4L1WA 1N10A 3T2PA 4JMNA 1SEQH 2Q09A 3UTQB 1TQSA 2DJ4A 3K2IA 2V63A 3EJCA 2WSYA 2JXMA 1K4DA 3CVCA 4XCEB 4OGAD 3MSGA 4Y9NA 5KBDA 3GS6A 3MPGA 2K3TA 3GJEA 3SBRA 5C0JA 1R3IL 1AL7A 3MRDB 1S7QB 3KL0A 3GRWA 4WY7L 1IE7C 1PJ9A 5EFFA 4XGZB 3A67L 3TIDA 1SFHA 3GHBH 4W9LC 3VI4B 3NSCA 1TTJA 1XYZA 2V17H 1G4SA 2BFGA 3QIBA 4ICMA 4X2RA 5I19H 1HI6A 2HMIC 1L2QA 2X87A 4HHAB 5IHZA 4KZEL 2Q3XA 2J25A 1KCVH 1XIWD 3AITA 3KNBA 1WA3A 2NR6C 4MLIA 2GWNA 3M0KA 3OVGA 4PYHA 3WTXA 1AW1A 5TE7L 1E4LA 3A3YB 4LSTL 3CTLA 1YAZA 3O6ML 1HXMB 4X61A 2OLDA 3L4WA 4S0SD 4BD4A 3LSCA 5I28A 2WUBH 3BVWA 3LS4H 2N1TE 2CKRA 2FZ8A 1FG2B 1GGIL 4PIBA 3AIEA 3NCYS 1T83C 2GK0B 2YZ8A 4LLVA 5EZIH 4W85A 3WIHA 2IJ0C 4HZ1A 2WYZA 4UM8B 1IRAY 4A7VA 3HFFA 3G22A 4JN7A 3BGMA 3I9AA 2ZXDA 2IDSA 5TK4A 4XN9A 2VISA 4QE4A 1FVDA 2NY2B 3MRLA 3UZVA 2C71A 4RZ5A 4XAPA 4DCQB 1MAJA 2D7PA 2ICEA 4HS8L 1NBZA 4BFKA 3IE4A 4FTVA 4NC1E 4URTB 3QV6A 4QE1A 4IGBC 5E6SB 2AXFA 1A6UL 2OTWA 3QDAA 1C1EH 4JFPB 4X6EB 3MRJA 4CU8A 2AOSA 3UEZA 2DQJL 3U2SB 5CLXA 1D6VL 1E27A 2ODHA 5D2WA 1JDAA 2NY5L 4JFOB 1W5PA 3VD2A 4XP6L 1P1XA 3HZVB 4OCWH 1TO4A 4MA7L 2PDBA 2Y24A 4YWSA 3URAA 3IYLW 5C07E 1ZBKA 1F0LA 3MKGA 5DK0B 3GH4A 3RY4A 4KXBA 2V8MA 3CWOX 4OIAA 4P2OB 4PB0L 4KNUA 2QJNA 4RMTA 3MCLL 3TLRA 3UR5A 3ABKB 2WMFA 1MNUL 3FKKA 2PA6A 4XO7A 4IFOA 2I25N 5AVXB 5CC6A 2FX8L 3NSYA 5LSMA 2G9HA 2VR5A 3PYCA 5HGGS 3VFTA 1MCPL 2XZ7A 3CC1A 2YR1A 3CSFA 3R4RA 2XFXA 3W37A 2VGGA 1RJLA 3LN9A 4K4KA 1W37A 2EBNA 2QGHA 3O0FA 1XTLA 3BWSA 1HQ4B 5CJXC 3EEGA 4QJ3B 2OMZB 1UACH 5DJDA 1MI5B 1CLXA 1WUEA 5FO2A 1XGZA 4C6KA 3MJ9A 2C1OA 2J8FA 2GAZA 2IAMC 1EF3A 3UCCA 3G7TA 4ORGB 1Y65A 4TV5A 1I85C 3N9KA 3R0DA 1QQDA 2ZWNA 3NXLA 3ZT7A 2F61A 1UEMA 1KKRA 1B6UA 5BOPA 3IRDA 3IUHA 3L3HB 4R6UA 4WY7H 5F4SA 4Q9QL 1U5VA 3AUJA 1YEDB 2W9MA 4BSWA 2RUSA 2WOQA 3EJZD 1C9WA 4ODUB 5ESVB 4FXGC 3MDJA 3FHAA 5EDSA 5JMOC 1VCFA 4X2PA 2FVMA 4HUWB 5TF1H 3WSUA 5DANA 1F4XL 1NARA 2BMBA 3FOKA 4G8IA 4FG0A 4CCCA 4HBCL 3RX8A 5J11C 4XBEL 1PCWA 1ZVHA 4J4PD 1B4JH 3BH8A 4MGXA 4NUQA 3SCMA 2VYOA 3L4TA 3GZQA 4Q9RL 4WAFA 4PJ8D 2VC5A 3RP1A 1NAKH 5SX5H 4N68A 1OGAA 1W0VB 1WAPA 1FCCA 1JNLH 1GUVA 3P3RA 2MCMA 3TZNA 4ZL1A 4NO3A 3QXUA 2J6VA 5G4OA 5BS0B 1W72H 1MQ8A 2KZHA 3O6AA 2MUCA 4B41A 2A3TA 4OB5H 5IHUL 3BG5A 3QFJA 2C18A 4QRTA 1E9PB 1YEYA 3K72B 1EA0A 5DR5L 2KDGA 1QYGH 3D3VD 3B8TA 2ORBL 4QG8A 2WVVB 4EDXB 1Q7QA 3VXMA 3WUZA 1GYWA 5LO7A 4Z3FA 5C8JA 3KAOA 4JO4L 2BG5A 2FVLA 2VSKB 4QXVA 1XLMA 1S78D 2OR7A 1LE9A 4OJYA 2IH3A 3GF8A 3ULUF 3FTYA 3VFUB 3TYAA 2X2JA 3HZ3A 4PGJA 2AANA 2WANA 4ZPTB 3S6CA 2YZ5A 3KE0A 2PPFA 2Z7GA 2A83B 4IMCA 1RV8A 3CLWA 2UUDK 4G80B 1O7VA 4KRMB 3SKNA 3NQIA 3GRIA 4L2LA 3SGJA 4C4UA 3H7RA 4BK8A 3IN0A 1JV5B 2GSEA 5I1AA 4E38A 4X7EC 3ZDYF 1GOOA 4HZ6A 3V4PA 2CXEA 4MIMA 32C2A 2FLBT 1W5QA 1V3LA 4FKHA 2J12B 3L7FB 3O3BB 3SW6A 2CSPA 3ZE2E 2AJ3B 1I2OA 1T21B 3CZ8A 3P9WB 4NJAH 2QZRA 2HKHH 2XTLA 3QG6A 2Z8SA 4CVZA 1AZNA 3MY9A 3TC6A 3Q44A 2WPGA 2JQZA 3RVVD 1B3YA 1KG0A 5D4JA 1V03A 2ZJSL 1INQA 4E8GA 5LIYX 1EP1A 2IKGA 4JY4A 5EORL 3ALWA 1JRBA 2LQRA 1SOSA 5TQLA 3G1RA 2Q3RA 5LQBL 2YQ2A 2YL9A 5JHAA 1NPUA 4XWOD 1AD4A 2FFCA 5IV2B 3E9AA 1WA1X 4N9GB 2BOCA 4HLEA 2H9GA 2R4SL 2RFGA 4Z7VB 1N5AB 3AZSA 3ID7A 4G6FD 5LNGA 2GEQA 4RSYA 5I1LA 5AHEA 1SFLA 2VDOH 3MJ9L 1BFOB 1ONQB 4S10A 5DS1A 2VRJA 1DBBH 1CTOA 2E27L 2X4NA 1XYMA 1A5MC 3FCTB 5EUOA 1W31A 3OWEA 2F6KA 4ABWA 4NP4L 4O15A 4MNQD 4Q56A 4JRYA 5JR1H 5CZRA 4ZAKB 5HHXL 5BCAA 3LQZB 5AW3B 4LNRB 3ESOA 1ZCCA 1L6PA 5HHVH 5CSSA 4FJZA 3C0LA 4O54A 3H42L 4O18A 5E5UB 3PWNA 3CFIC 3QJSB 3UOAB 2VDKH 4XNZB 2CO7A 3QZWG 3ABXA 4MCZB 4MJ5B 2WQVA 1VKXA 1FCGA 4XMPL 1E5UI 2XHNA 2GVLA 1WYJA 4QSFA 3L5WA 2Y88A 2W5FA 1KT2A 3BVUA 5T1LB 3AIWA 2OWCA 5CZJA 4LW7A 3DUSB 1AS8A 1I3UA 4X0NA 3NABH 3I9GH 2J7GA 5AG8A 5BZXA 1E70M 1KNOA 2PDXA 3M5XA 2OFQA 1IBZA 1CU4H 2Z35A 4OKDA 4UI2A 1G4TA 1HZYA 3V4VL 1OWQA 1XR2A 2PTDA 3UJEA 2PYFA 4HJUA 5JDSB 4HKPA 2FO8A 1NEZA 5CILL 1RZPA 5FUZL 1VPOH 3F4CA 3DX4A 4JK0D 1R0AL 4OGXL 1SO4A 3VZYA 1OE3A 1DLHB 5J1SC 4LLWA 4JQVA 1CDGA 1Q3NA 5HMSA 3QFDB 3RZCA 4P2RB 1VC4A 1GH7A 5EU7C 3V4BA 4C1NB 1WZMA 5IB3A 2VGBA 1ADDA 2YKLL 5E2WL 2A9CA 4HIJA 4F27A 2QV5A 2J4GA 1OF6A 2X4OB 4OFIA 2FWUA 1W0MA 3F7VA 1R2SA 4P5KA 3EHBD 3FMGH 1OCNA 3LQAC 4DVOA 2J6EA 5EIIB 1HDMB 1Z5LB 4BF9A 4DPQA 1FL3A 3T0EE 3WEBA 1EFQA 2B59A 4AJWA 3R0UA 3HHSA 1UWIA 4WGHA 1OD0A 4KKXA 3VTRA 2WLZA 4BA8A 3VC5A 3WJYA 3GNML 5IF0A 4YNYB 4WCJA 5DJ8B 3ZKND 1FG9C 5I74C 3VVVA 2ZZ7A 2Q87A 3VE9A 2IG2L 2VR9A 2DPEA 3FYIB 1K03A 4X60A 5CP7A 3HB3B 3QWRD 3K6FA 2ZX9A 4MYWB 1W3IA 5KVFL 4K7FB 3CYVA 5I0XA 4G9FB 1XIFA 2FSEB 2VDRL 1AHMA 2FPYA 3EWYA 5DFAA 2EKJA 4M48L 2RACA 5F1NA 1G0XA 3M64A 2PKDA 1GIGL 3SBWA 5D7JC 2LT9A 3ORWA 2BSLA 2GBVA 3ARBC 2NXYC 2OW7A 1CX9A 2Z4GA 2DZTA 4PJAF 4GMTL 5EO1A 3L1FA 1S9YB 4JUTA 4DT2A 2J66A 3W0WE 4IJRA 1H5BA 4D3CL 4Y5YC 1GMEA 4S3CA 3JV6A 4YX2L 4U1MA 4Y16D 3PPCA 1R30A 3H22A 4HWEL 5GSRB 2YRLA 4L1BA 4B5TA 3PP4L 4AQ1B 2QKSA 3MLVH 3F62A 3VDAA 1K8ZA 3ZTCC 1TIWA 2HVBA 4G8TA 1RK1A 3DRTA 4MDIA 2AK1L 5JYLA 1X5JA 2XQBH 2WLIA 2FGZA 1TV4A 3VZZA 5IMLA 5DRZB 3SKMB 2VC2B 3V9EA 3UYPB 4JRXA 4U6HB 1MCOH 3G3LA 1FN4B 1B9KA 2YD1A 3N2JA 3H2CA 3ARYA 4Q6JA 3WLTA 3WTSA 1Z2KA 2OJ1A 1CFMA 3FW6A 1DJHA 15C8L 4P9ML 5DMYA 3VCRA 1ND0B 2PGRA 3S37H 5E94B 3DJTA 4Z7WE 4WHTB 1NFBA 2EXOA 4IOFD 1UB3A 3URNA 3BC9A 1BGAA 4NSBA 1TVHA 5D7IB 2E3ZA 3WFLA 3WE6A 3UD6A 3FTSA 3SN0A 4TTDC 1SYVB 3FT9A 4WGKA 2E7DA 2WW8A 3SGJC 4A6YL 5JXED 5A2CA 1YDYA 4CQAA 4WJKB 3VGBA 2WLYA 2KT6A 3EJSA 3SCMD 3NT0A 4HX1B 1SBSH 4KRUA 3GSVA 3UXFA 3NH7L 2FEEL 1DVFA 3FF7A 5MEND 1IEHA 2J74A 3L3GA 4J8QA 3MNVB 4HPYL 5IMMA 4R0LB 4JM4H 3X14B 2ZOTA 3DV6A 4UDTA 3VGDA 4PP2B 2QAFA 4ODTL 2BWGA 1UCWA 1X8FA 4ESKA 2E25A 1Q6QA 1T0MB 1MCHA 4NQDB 5E4EB 3NZGA 1MFEH 1CTNA 1L6FA 4D6IA 4NYLB 5G2HA 1UKPA 4JFQA 1YEGH 3HAEB 4XO9A 4XN4A 4LOEA 1HL8A 3DFHA 2DH2A 3W7QA 2E7MA 4PGBA 1GVFA 4U6TA 5HDBE 2AV7B 1E3FA 3D05A 1YYLL 2W91A 4R4FL 4WU7B 2IOMA 1J05B 1MQPA 1UXLA 2HH0L 2YD4A 1DQQB 5BS0E 4HZLA 4QG9A 5FI8A 2PYEE 2YXWA 2OT0A 1RSCA 3TCEA 4KVNH 2IPFA 3BQ6A 1MRFH 1OBAA 3SOBL 1JUFA 3M1OA 2ZDRA 4JAMA 3FUJA 4W9KC 4LVBA 2OL3B 4FQQB 1B0IA 2LAGB 2FBRA 1VA9A 2QV2A 1OG6A 3B83A 2DM2A 4HW6A 3PF3A 3E9UA 5DJ2B 1EJXC 2W81C 3MRNA 3SGKA 1MJJB 1R3HB 4LCWA 3AYVA 4L3AA 3ZVHA 4OCYL 4Z7VF 1J1XH 4EI5A 1NP2A 2AK1H 1I9IH 3ZSSA 4PCNA 1AGDA 3DVGB 4IHCA 3HNSL 1KTDA 1A14L 4X6CF 3DC8A 1RA5A 2HFGH 3UBPC 2FNBA 1X7SA 2DLEA 4WO4B 3RAJL 4XUYA 3O6FA 1MSSA 3LKSB 1M3JA 5HGAB 1I1FA 1EP3A 4L37B 2QVNA 1L5GA 4FP8H 4ZW7A 4OY9A 2JKLA 3ARFA 5CKAA 2H8XA 4RZ6A 3JTSB 4BUHA 2NUYA 1T5XA 1ZJBA 1BJ1J 5J56B 4KERA 3F1QA 2WKLA 1JOIA 4JEGB 4MX7A 3SPGA 5I5RA 2H32A 2AGJH 4TULL 1FHDA 2JLPA 2DZXA 1KCUL 1RCOB 2Y7EA 5KINA 3F3HA 3O3DA 4PD4J 2FAUA 4MQ7A 2P47B 2JEPA 3GC2A 3JQOB 4ATDA 3DTXB 3ZE2F 2A3LA 4EVZA 2XC8A 3WUWA 5LAXB 4M7JH 2VERN 2BVWA 3B7UX 4NC2B 5DVNA 5LBVA 4Q33A 2P76A 4PJGF 3IEBA 4BINA 2P53A 1YQVL 1JCYA 2RFXA 3L7RA 1E4KA 4HPYH 2EC9U 4FLSA 1QT1A 4WW2B 4ZX6A 2Y07L 1US2A 1E6XM 4WDWA 4Y16B 1JZHA 1F41A 2WP3O 1SBSL 3HTLX 2XTSA 4UB0H 2WBJB 2WBKA 3GBNH 1QNQA 1DBJL 2Q2EB 3RTQA 1D5XB 4A04A 1GYVA 3DIPA 4JQAA 2YAHA 1GQNA 2C1IA 4L4OA 4KZDH 3ZLFA 3G5YA 4F7TB 4AY8A 3GKAA 2X70B 3FVDA 3W71A 2X1XR 4FQXD 4MVBC 1G4PA 1XLEA 4M8RA 5C0QA 1XGPB 2WV8A 3L23A 3RWIB 2QADB 3LTVA 3HNVH 3FQWB 3MRMB 4L4TE 3AM8A 3QISA 3V5HA 3V6FB 3L3JB 4ELDA 3NVTA 3H4GA 2ITDA 1A5BA 3HM7A 2CJSA 3WS3A 2JIXD 4AUUA 5HNTA 2BRRL 4MM1A 3W9EB 1ZA3B 3UP6A 2J7HA 1RMFH 3KLLA 3FSTA 3AXMA 3MV9B 2X1PA 6XIAA 4ZI8A 4BJHA 1NA8A 3JSSA 1H0GA 1JUEA 3M88A 4N86A 3W85A 1RY0A 1TTRA 4PY8J 4FA8A 1O60A 1S2AA 2WC3A 1MJ8L 4D71A 1H15B 3F04A 3VWJD 5IW6A 3BAKA 4YSPA 4DBDA 4RMSA 4R7JA 1JWUB 1TJXA 1TT6A 2QBWA 4IL0A 4UFMA 2EGZA 1PYWA 2Y7FA 3VOCA 1UM4L 1GZPA 1YC8A 1BPLB 1R38A 1UA3A 2HJPA 1JDEA 1B3WA 1TPC1 3AQDA 2NY0D 3T6XA 3AO0A 2FSDA 4AF0A 3HGSA 4XN5A 1IIKA 4U1HA 4LTSA 5F7KC 4FQPA 1TPXB 2ICWI 5CINH 4YGAB 5DQ9B 3TO2B 2O1AA 4F8OA 3IDIA 5JIPA 3PJXA 4K6AA 4AGQA 2PURA 2XDFA 4IQDA 3EYVA 3FCBA 4LCVA 3R1GH 5G5IA 4X0KB 3S9IA 2NQHA 4QLJA 3WLWD 3JVGA 3MOAL 2JMRA 3WLLA 3BIKA 3OAYH 2OYMA 3QR0A 5FGBA 4GO6B 4EVNB 5HK4A 4P5TA 4IJCA 3SCWA 3W1TA 3MLSH 3EHBC 1WBXB 3QEGH 1ORSA 4OM1L 2B3IA 2G8ZA 1S5TA 3UO8B 3DOSA 3NFUA 3MMEB 3ARGD 3UPCA 3PZUA 4OM0L 5AW9B 4PGCB 1NWPA 1X5FA 2J7LA 1MF2L 3BW9B 2V2WA 4NQCE 4DUXA 1M7DA 3S5SA 2VN6A 4Z76A 1LJYA 5EBMA 1TE6A 2NXGA 4WDIB 1RUQH 3BKJL 1C16B 4HEPG 4YDIH 5IR1B 3WE1A 1QR7A 1QHOA 3BQVA 1FJ1A 3U4AA 5J5EA 1EMTH 3ZYJA 4KKLC 2Y1ZA 4M5YH 4MKSA 4IIDA 1FOBA 4HNUA 5JPMC 4H13C 4APQD 1E65A 3THAA 5JBEA 2FGLA 1XH3B 3DX6B 3IGUA 1CVRA 2WJ7A 2BHZA 2FQFA 3CUPA 4KK9D 2FZDA 2HWZH 1J0IA 1U8PB 2QZ5A 1PX8A 4WTQA 4ZAKD 4TLSA 5C0CD 1ZY9A 1AE6L 1F8TL 2Y5QA 3R2GA 1CL7I 3VXQA 1LO5A 1J8KA 3H12A 4P8XA 5FPIA 2DN7A 1DUYA 4EAMA 3ZY7A 3GHEH 3VXMD 4WDTA 3QEZA 4ERSH 3U82B 2NT0A 2AEPH 2HTKD 3EDJA 3OQ8A 3DIVA 1EYWA 2P52A 1LL1A 3D2UD 4E8CA 3OL2A 3NTCH 3KYOB 1HKWA 5AKRA 4Z23A 4KPHL 1M7IA 3C5ZB 3PJTA 1QLEB 2QZQA 3PNWB 2DT3A 2QDWA 2YGVA 1WFJA 1R7AA 5K7JA 4DN1A 4W87A 3FU7A 2CNCA 2H7WA 3MXWH 3R1ZA 3MTXA 3B4NA 5FS5A 1B1YA 5D1ZI 3VXOB 1EF2A 2OO0A 3GB7A 4JM2D 3NCWA 4OZ4A 2GCYB 3AC0A 3DGGB 3P11L 5CR8A 4PUUA 1KCRH 4B3KA 1GS7A 2R9HD 3ZIYA 4TYUA 4UFLA 3QEGL 3ABZA 3ABGA 3NA4A 2V9UA 3PS6A 1KFGA 3TT1L 1P4IH 1A49A 1WFIA 5LG1A 1OYCA 3P2BA 4UDUB 3T09A 3PQYB 2PCFB 5BO0D 3L45A 3WLSA 4NENB 3GBEA 4FMFA 4PJEF 4QRPB 4E41B 2GSGB 4H4NA 4W9EC 1XAUA 3O4LA 3NSDA 1VBRA 3KL5A 1TA3A 3ITXA 4WDUA 4Z7QB 2XNAB 1Q9KB 3CZJA 3HR5A 3BE1L 3QC0A 4G2AA 1Z9NA 3VA6A 4C54A 2I07A 5D96C 5BRZB 2OR2A 3IJ6A 1QSFE 3G1XA 1DBBL 2WXQA 4XC1L 3BGGA 4X7TB 4Y2WA 3QO0A 4PJIF 4MDPA 4PODA 3HUJF 4Q8TA 3T9WA 3MLRH 4UWQB 1DE4A 3BN9C 1BEYH 4IJTA 1RP9A 4ONGL 4ZUUA 2Z4TA 3LPPA 3SDDA 1JTOA 2ATMA 4YTQA 3IGXA 3OZLA 2BIHA 2BVOB 1IBBA 3QJFA 4JZJB 3G6MA 1YNLH 4Q8UA 5FSEC 2YPVL 2PCQA 5AC6A 3WNPA 2Q6WB 1X4ZA 1JL8A 4FN0A 4TRPL 3IMBA 1BZDA 4L0PB 1EEPA 5AHLA 4NILA 3QIWD 3O6CA 4ZR8A 3TYDA 3GSXB 4JO1H 4Y96A 2PU1A 1Q9WA 3C0JA 4JHOA 1CIUA 1QX1A 3V0UA 3PUEA 2WXKA 3S96B 5IBXA 2BDQA 3TVMB 1H7XA 4D0CA