1U2YA

In situ extension as an approach for identifying novel alpha-amylase inhibitors, structure containing d-gluconhydroximo-1,5-lactam
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title In Situ Extension as an Approach for Identifying Novel alpha-Amylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 179
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1u2yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1u2yA01
4N0RA 2AOSA 3CZEA 1XH0A 3PBGA 2V3FA 1E6RA 4DUWA 3MKKA 1E43A 3LPOA 4E2OA 2J7FA 3WMSA 1OIFA 3A4AA 3BLBA 1R7AA 3RPMA 3VD4A 3WDPP 3BLKA 3EDKA 2WVSA 3VGHA 4D6JA 1ZBCA 4QCEA 1HP5A 1UQZA 5HOSA 3ARVA 1JD9A 3SCVA 3N13A 1WNOA 3OBAA 1GOMA 5LA1A 3GBEA 5FKYA 3AJ7A 2DSUA 1EQCA 2DQXA 1JZ8A 1XHGA 1C91A 3ARXA 1C93A 1V6YA 2WCGA 4TOQA 2GVYA 1FH9A 1W9UA 2YLAA 2BY3A 1XCWA 3CTTA 4GKLA 1Q4NX 4TX8A 1E40A 1XYZA 1GOQA 3ZR5A 2CCRA 4U5IA 1H11A 1KWKA 3PZUA 3RILA 5D8WA 1HJVA 1ZS2A 5A94A 4AY1A 3GNOA 1EXPA 2O92A 4D6CA 3CGTA 3PN8A 1HF6A 5GQBA 1K9FA 2CERA 1GOKA 3VX0A 1GPFA 3VDBA 3ZSTA 4CD4A 5CLWA 1UH2A 4Y7EA 1V08A 1KXHA 4IUGA 3BAJA 3MS8A 4M24A 2ZXBA 4CVUA 3MU7A 4FF5A 3LPPA 1TA3A 3B8SA 3BUBA 1BGAA 3OZOA 2XM2A 4RE2A 1XSIA 2PWFA 3EJUA 1CNVA 4CD5A 5D9PA 4WLCA 2F7QA 3SUSA 2F2HA 3MO4A 1RD6A 2DSZA 4X0NA 3NYDA 4BZYA 4JHZA 2F7RA 1TMQA 3FAXA 1F4AA 1E4IA 2J7EA 3WMBA 4OBRA 1EA9C 1HNYA 5LA2A 2CBJA 4WSJA 1MFVA 4TUFA 1TR1A 2FE0A 2BXYA 1PBGA 2C0HA 4JFWA 2XIIA 3WENA 1EIBA 3PTMA 4UFKA 1C3FA 4P8VA 4AD4A 3AIRA 3AIBA 3TTSA 2BNJA 1ZJAA 2Y2WA 3PZGA 1MQRA 1GJWA 3BVXA 3MANA 2F7PA 2V3EA 3FHAA 1GHRA 3I3EA 3BSHA 1M03A 1JYXA 3H53A 2WW5A 5I0DA 5EFFA 2HVMA 5JBFA 2WXDM 2D24A 3NUKA 1JFXA 2CEQA 2J77A 2ZX9A 4FNUA 2IXUA 1V0LA 4C7FA 2X09A 1CZ1A 2PWHA 2G3MA 1HVQA 3K4DA 1J0IA 2F18A 2BY2A 4WIWA 3G6MA 4J28A 2YDSA 3E1F1 1HJQA 1KGUA 2VQTA 1XSKA 1FOBA 1S46A 1VFUA 1HKIA 4ZXLA 3AFBA 2EACA 3THDA 5F7UA 1CXLA 2DT3A 1R33A 3VGEA 3ECQA 1ISZA 3A4WA 3CMJA 4MTVA 3EMCA 4D71A 2XWDA 1KR1A 3EDFA 1H1NA 2VURA 3EYPA 2W92A 3CUGA 1J0KA 3KWXA 2VVNA 1E6XM 3VGGA 4U5KA 4TXEA 2D3NA 3S5ZA 2D23A 1ZU8A 1SYTA 3MUZ1 4UR9A 4FLRA 4ML4A 1JYNA 5CZKA 4CD6A 3OZPA 4NRRA 2W61A 4Q22A 1VBUA 4KGJA 4JKKA 1MFUA 2CXGA 1YHTA 4NXKA 4HPGA 4GZEA 3HG3A 4PBGA 3CHFA 5I3DA 2F1BA 1GHSA 1E70M 2VNCA 1XRVA 4W88A 1HN1A 1C8YA 4AD2A 1G1YA 3WKZA 3EBVA 1UD6A 3VDCA 3WUGA 1W1VA 4QLLA 1JDDA 1Z32X 1QW9A 1E56A 1M01A 3EJTA 3MMDA 2WMGA 3SEPA 2FYVA 4LQ1A 1VJSA 3CZJA 3VD9A 3SIMA 2Z1SA 1KXVA 3L4ZA 3BLPX 3WQ4A 2JEQA 1MW2A 1ZBVA 5A8OA 1WE5A 1BPLB 4GQRA 1WDPA 4D6DA 4AC1X 2OW7A 4CU8A 3VSUA 1YQ2A 1IT0A 3B9AA 3NDYA 4ZFMA 5C70A 5A8PA 2WPGA 3W25A 3AISA 1HJSA 1U30A 4UFMA 2D2OA 1V3MA 3DDFA 4JFTA 2WAGA 2XVNA 3D51A 1C90A 1JAKA 3AZSA 4PMXA 3VD3A 8A3HA 3KE0A 1JD7A 2ZWZA 3W27A 3ZOAA 4TTUA 1GOIA 1CLXA 2O9OA 2E8YA 2OYKA 3ZO9A 5M03A 1VFOA 1VENA 1B1YA 3A24A 3BXWA 1CDGA 3UR7A 3GYCA 2UY4A 4BA0A 4CVWA 3AIWA 1SMAA 4CU7A 3WN6A 1UKOA 2W5FA 4MB1A 3VUPA 3DECA 2GJPA 3T0AA 4URIA 4MJ4A 1HKMA 3ZJ7A 4F8XA 3WDQA 3F5JA 1W9DM 2WWDA 4IISA 3W29A 2ZXQA 3QHMA 5BXPA 2GDVA 3GXIA 2IXVA 2A3CA 1XD1A 3U7BA 1BQCA 2CBIA 3CV5A 5EFDA 4CKQA 2OWXA 1UYQA 1EDTA 4OOZA 4PMOA 5GNXA 1QVBA 2Y24A 2EPOA 4C7GA 4KMQA 1LWJA 1OT2A 3SUTA 4LGXA 3WIJA 4NF7A 4UFJA 3U57A 1SFSA 3QGVA 4CD8A 3SCUA 1H09A 3SUVA 4M29A 4C7DA 3CHEA 2AMGA 4KRUA 4UQEA 1D2KA 1EHNA 3WBAA 2FH8A 4UFLA 1US3A 4HMDA 4PMQA 4D6IA 4X9YA 4WJXA 5I5RA 4AD0A 4EAMA 2A3BA 3CPUA 2GDUA 2WB5A 3QR3A 3VIHA 3MSDA 4A4AA 2CPUA 5HXMA 1BG4A 1E4MM 1E0WA 3F4VA 1JZ2A 1E3XA 5DF0A 3AS3A 2DSVA 2VI0A 4FNPA 5I78A 4MNLA 5LYRA 2MANA 2J75A 1FFQA 1TE1A 4PMUA 2V3GA 3O6AA 4ATDA 5E0FA 3WH9A 1HXJA 1JYWA 3AMGA 4PCSA 3FN9A 1GONA 3HG2A 3NSNA 1OINA 3SCWA 4AD1A 2QPUA 1UWUA 1BYAA 3BUIA 1X6NA 3IJ8A 3VNYA 1LLOA 3AIVA 2RGMA 3CH9A 2X2JA 3WFZA 1PS3A 3CBWA 5ABEA 1C8QA 2J7CA 2J74A 1ZBWA 4QLKA 4FNRA 1UWIA 3MUY1 4JFSA 4MPKA 1UA7A 4FLSA 3AXIA 3EMQA 2J7BA 3HG5A 3WEZA 1AQ0A 2VRKA 3M7SA 2OLHA 3PZ9A 1GVIA 3G6LA 1K9TA 2XGBA 1UHVA 2D73A 3GXTA 3TTQA 2PC8A 3MMUA 4QLJA 1J10A 4YPJA 4PUEA 3MSGA 3A3HA 5BXTA 1W2PA 4MADA 5EBAA 4J27A 3HMCA 4WKFA 5BRQA 3WQVA 1QNOA 8CGTA 4Q7NA 2CHOA 3LPFA 4BQ3A 3U5UA 2DH2A 1DEDA 2G3JA 4AYSA 2WYSA 2F61A 3NSXA 4HA1A 1C7TA 1NARA 2XVGA 2G3NA 3WNPA 1UWRA 4KH2A 1JDAA 2E3ZA 3CO4A 2A3EA 4GXPA 3BAXA 3DX4A 2BHYA 1WO2A 2YDQA 3DYPA 1VFMA 3RM9A 1UWTA 1WZKA 4UQDA 4IM4A 3EJSA 1WDSA 1DWGM 4U2ZA 3LX9A 1E1FA 1KCKA 4BQ2A 1JF6A 5DEZA 3WUEA 2RGLA 4HTYA 4U3CA 5E6ZA 2CKSA 3B9DA 1CLVA 2QPSA 3W82A 1EDGA 3WH7A 3W81A 3AROA 1NOWA 5A6KA 3D3AA 1BVZA 4GPNA 1R46A 4M82A 1KCLA 5AYBA 3W24A 1UZ4A 1HWWA 2F1AA 2X2IA 3WMCA 4HPHA 4AYGA 2Y4SA 3ARTA 4W7VA 2FH6A 4L4PA 3N12A 3TP4A 3VSVA 3L2MA 2DH3A 3KEHA 5E0CA 1UOKA 1PPIA 2J8FA 2XGIA 1E4NA 3WD2A 3VD5A 4AZHA 5FL1A 3M6DA 1JIBA 4JCMA 2NSXA 1HP4A 5ABFA 3SUUA 1BYBA 2PF0A 1X6LA 3OGSA 3VVGA 5E9AA 2ZUVA 4P8UA 5GNYA 1M7XA 1KGXA 1NOFA 3WEOA 5D4YA 1EOKA 3GNRA 3VIFA 1UR8A 3BVWA 3VIMA 1VEOA 1RP9A 1OBAA 1SZNA 1NH6A 4CUCA 4KRTA 1WZAA 1G5AA 1KB3A 3WELA 3TV8A 1VRXA 2OSWA 4ZENA 5CQ1A 4WSKA 4P7LA 2D1ZA 4KGLA 4HZ7A 2DIEA 1E6NA 1PIGA 1Q6FA 2XPKA 4CN4A 3PTQA 1QWNA 3M07A 1OGBA 4RE3A 1KXTA 3GH4A 4HOZA 4PSRA 1FA2A 1QI2A 1M53A 4Z2HA 4MDPA 4R5EA 1V02E 3MUIA 3WF0A 1CGXA 4UQCA 1JZ7A 5A6SA 1MQPA 4NX0A 1LWHA 4U2YA 2GSJA 4LYQA 3VO0A 5A69A 4J3TA 1CENA 4AD5A 3ZJKA 3EDJA 4W8BA 3A47A 3RCNA 2GJXA 3UESA 1XV8A 3GXFA 3VOCA 1UA3A 3GZAA 2WVTA 5A1AA 3KL0A 3AIEA 4X0VA 4AD3A 1D3CA 3BVUA 1DWAM 1R47A 2D3LA 3NIYA 5D9OA 4R27A 1DHKA 2XVKA 1MVYA 2VT0A 4L4OA 3AHYA 1QW8A 2EPKX 2PWGA 1W1TA 5GPRA 1W3LA 3D4ZA 4GINA 1J0YA 1UR0A 5A6LA 4WF7A 2O9TA 3W37A 3ZJ6A 1HT6A 1PX3A 3UETA 5IFTA 3UR8A 3AZTA 3WF1A 2X0YA 2OSXA 4AZ5A 5IFPA 1UWQA 3K8LA 2CYGA 1H0GA 1WKYA 1CGUA 3WF4A 5AC4A 2WMIA 2FHCA 3QOMA 2WC3A 2ZWYA 1E72M 3VDAA 1I75A 3AHXA 1TA3B 3NJ3A 4HU8A 2J7GA 4RL3A 2OYLA 3GM8A 4CGTA 2XTKA 2EXOA 5CLTA 3ZQ9A 3T09A 3WNNA 2WMIB 1US2A 3TA9A 2BHZA 2F8QA 3PZTA 1XGZA 1ODUA 2XFYA 2WSKA 4UOJA 1TVNA 3PZQA 1B30A 3WY1A 1RH9A 1QHOA 2Q8XA 2D0HA 3IJ7A 3VU2A 4DUXA 2DT2A 4AIOA 1E3ZA 2YFNA 4W5UA 3WD1A 2XFFA 5CPTA 2CITA 5DFAA 1FH7A 2B31A 2EEXA 1ZB5A 2BVTA 3EJRA 5A6JA 4HZ8A 4TVUA 3BUQA 1UQYA 2NT0A 3SCSA 1GJUA 2W4XA 4A3YA 5JUVA 4DO5A 1O7AA 2YL8A 4FNQA 3D50A 1AVAA 4P7RA 3AXHA 1A47A 2WZHA 3A21A 1B2YA 2VZSA 1ECEA 3HU7A 4W8LA 2VJXA 3I3BA 4NZJA 1XH1A 3I3DA 4J3XA 3BMVA 1J0HA 5CGTA 1B9ZA 4HOWA 2X2HA 3QHNA 3KLLA 1ODZA 2ZX6A 5JIWA 3AMCA 4PYSA 1E6ZA 4JKMA 4JCLA 2XIBA 3W4RA 2QHAA 1VAHA 2ZOXA 4AZGA 1JXJA 2BV9A 3F5KA 4JL1A 3ALGA 5A2AA 1E71M 1H3GA 4K68A 3WH8A 4QCFA 3LRMA 2VZUA 2WKGA 4M8UA 1R8LA 5CG0A 4PMZA 1TCMA 3WEMA 3CZ8A 4MAVA 3T2OA 4DWSD 1XSJA 2XJ7A 3SCRA 3WQ8A 4M56A 3EDEA 1XH2A 1Y7VA 1V03A 3J7HA 3HJEA 1H2JA 1OCQA 1O6IA 1SMDA 1H4PA 1J12A 2HISA 1WZLA 1VEPA 1QWUA 2ZICA 3VM7A 1DWJM 4PSPA 4HA4A 2XVPA 3WDJA 3DX3A 4ZE5A 2D0FA 3VMOA 1PX8A 1VF8A 4J7RA 4WK9A 3OGVA 2J8GA 1HL8A 1GQJA 2G4FA 5HPCA 3GBDA 4AIUA 1U33A 4EK7A 3GTNA 5D9MA 3WY3A 1LF1A 2ZX5A 3UG5A 4JHOA 3WD0A 2BFGA 2XUCA 4DM1A 1ITXA 3KZSA 3PHAA 2G41A 1UD4A 2DDXA 2EJ1A 3OIHA 3M46A 1OIMA 5FIPA 3AMKA 4P7OA 4J3UA 1H49A 4Z2LA 1B3WA 4U33A 3MUAA 4E4PA 1CIUA 1J0JA 4GZIA 4PTXA 1I1WA 1E6PA 1RP8A 3WD4A 4E8CA 4B9YA 4AZ7A 5I6SA 3RIKA 3WF2A 4A3HA 4PTWA 4N42A 3LPGA 1UR1A 3HZ3A 2VR4A 4PRWA 1OM0A 3WNOA 4XZBA 4V2XA 1TVPA 1H0IA 3GXNA 3VSTA 4QP0A 3TTOA 1G01A 4H41A 2BVYA 2WMHA 2V5DA 3CZLA 2C8NA 4GZJA 2X2YA 4AIEA 4DWSC 2EAEA 3A5VA 1PEZA 1PZ2A 2V5CA 1LL6A 1AQHA 1PAMA 1W1PA 3AIQA 4Z2KA 1BFNA 4AZCA 2CIPA 5CXPA 1B3XA 3T0DA 2WMFA 1QBBA 3NCOA 4AZIA 1O7DC 3S2CA 2TAAA 4PUDA 3ZR6A 3L4YA 1BTCA 2VUYA 4WKHA 4D6EA 4DWSA 1WDQA 1PX4A 4UNIA 4AZCB 3AXXA 3K46A 2XN1A 1JI2A 1BGGA 1WB0A 2VX6A 1ITCA 4JIEA 1UR9A 3CZGA 1C8XA 3AICA 3FNDA 1UD5A 3VIIA 2VL4A 1FFRA 2DSKA 3ARYA 4W84A 2QMKA 5DT5A 1B3VA 5HBFA 3BVTA 3SCNA 2ZUNA 2XYLA 3WUBA 4J3SA 4FNTA 4PMDA 3VGFA 1ISVA 1TQVA 1TQUA 1AMYA 2O9PA 4LYPA 2WWCA 4MAZA 3VGBA 2YOCA 2J7HA 1R86A 3WSUA 3L4XA 1UWSA 4MB4A 1B0IA 1JXKA 5M3WA 2D20A 3N15A 3WQWA 1WP6A 4B9ZA 5JBEA 4BS0A 1NWTA 4LYRA 3GNPA 1ZBKA 5BYWA 4GIAA 5ABGA 4W87A 3RDKA 3DX1A 2IGTA 3PTKA 1KQYA 1EDQA 7TAAA 3DDGA 3GXDA 3A22A 5EB8A 2DPEA 4IPLA 5BXRA 2XM1A 3L4UA 1V6VA 2W67A 3CUFA 4D6FA 5IXEA 1CXIA 5M5DA 1G94A 3TTYA 3VD7A 2V38A 5BWFA 4V28A 4XV0A 2W91A 1C92A 3L4WA 1PZ3A 1TZ7A 4F9JA 3VNZA 1KXQA 1DWIM 2QF8A 2ZUWA 1HX0A 4S3JA 2GFTA 3PZNA 1LJYA 5GNZA 3K8MA 3NDZA 3NSMA 5I23A 3IJ9A 1TQTA 1BYCA 1M04A 2ZUMA 4PMYA 1W32A 3BVVA 3AYRA 3CUIA 1MWOA 3L2LA 1HJUA 4AZ6A 1JZ3A 3VIOA 2OSYA 1R34A 2BVDA 1E73M 2VCCA 3GH5A 1HTYA 5HPOA 4YN5A 4AWEA 3H55A 2PBGA 2JE8A 1V3HA 1AQMA 2WNWA 1Q6DA 4NI3A 2VZOA 1LG1A 3AMDA 1G9HA 1CGYA 2WHLA 1FP9A 3N17A 4UTFA 4NZCA 5IHRA 2WVVA 1L8NA 4E8DA 4PEEA 4ACYA 3WBEA 3EDDA 4F66A 5I2UA 1H5VA 2E8ZA 1C7SA 1LG2A 2VX5A 3LRKA 1KR0A 3SCQA 4ZEPA 2YBTA 1GW1A 2CETA 3S6TA 3WDIA 4FLQA 3AZRA 2WVVB 3A6OA 1UKQA 1EO7A 4AMXA 4B15A 3FXYA 1R7OA 1E15A 2C7FA 2X0HA 3T2QA 1EQPA 1UR4A 1MW1A 5DO8A 3SUWA 3AOFA 1DWFM 1UKSA 1TG7A 5D8ZA 4UZSA 2PBOA 1FHDA 3AI0A 4NZFA 5DMYA 2YA2A 3OLDA 4NRSA 4PN2A 3N18A 2JALA 4TVCA 2UY2A 3VM5A 4ATWA 1HXKA 1RPKA 4NXSA 1T0OA 1GQKA 2O9RA 3CMGA 4QFUA 1FHLA 1QI3A 1OSEA 1K6AA 2VZVA 3FY1A 3GH7A 2PWEA 4AEEA 3JUGA 3AS1A 3LXBA 1CGWA 3BMWA 4TX6A 5DT7A 1UR2A 1W9XA 3UEQA 2IUZA 3PZOA 3CZKA 4BF7A 5ABFB 2Y8KA 2UWFA 4J3VA 2W62A 4B16A 2YDRA 3POHA 5JBDA 5BROA 3BAWA 4W5ZA 4DM2A 3QHOA 1J0ZA 5C71A 2XG9A 2YL9A 3CUHA 3ZMRA 4LPCA 2YLLA 1QNRA 1WCGA 1I1XA 1JI1A 3K8KA 2YFOA 3VDHA 3ZT5A 3RJXA 1JDCA 2J79A 2JEPA 3MV11 4M1RA 1ISYA 5CSUA 2ZUTA 1EO5A 3TONA 1KTCA 1CYGA 1UG6A 4UOQA 3D4YA 5A3HA 1BSIA 3PZIA 3A23A 1EHAA 1HL9A 1JGIA 2YA0A 3WNLA 5E1QA 2VX7A 3VMNA 4P8WA 1BLIA 1TQWA 1QHZA 6A3HA 1VEMA 7CGTA 2WZEA 5BRPA 4U3AA 4H7VA 1QNQA 3T08A 1NQ6A 1HKKA 2X05A 5KEZA 4MB5A 4EANA 4HMEA 4RE4A 3CZNA 1R87A 1QX1A 2DGAA 4CCEA 1CXHA 4H8HA 1E4LA 1HJXA 1HVXA 3WL1A 3WNKA 4FNSA 3CLWA 1BG9A 3RM4A 3WQ6A 4JZ5A 2WCSA 2BHUA 3U7VA 3WDRA 4HZ6A 2GJXB 4CN6A 1TQSA 4OKDA 2G8ZA 3II1A 3CZSA 3D5HA 3O2LA 3OB8A 5BCAA 1GQLA 2WHJA 4S3KA 1QBAA 1CPUA 3MI6A 3WH6A 1XC6A 3W6LA 5CPSA 1TUXA 3ARPA 1E5JA 1EGZA 2CBUA 3W26A 4ZXOA 3W38A 2D0GA 3WUFA 2DIJA 3EJQA 1E6SM 4HMCA 2BY0A 4MNMA 3SCTA 4AMWA 3WH5A 1UASA 3HG4A 4LX4A 1QHPA 3FAWA 2WVUA 1OGGA 1QNSA 5FCZA 3SCPA 4ZE4A 1B3YA 4HOXA 2WC4A 3VPLA 4OBSA 3N04A 4KWUA 3LMYA 5HDRA 3WY4A 1ZL1A 1B90A 3BUPA 4PTVA 3EMZA 4H2CA 2JIEA 4AXNA 2BY1A 3ARWA 2J78A 1UD8A 3EJPA 2YA1A 2WMJA 3W6MA 2UY5A 1B3ZA 4Z2GA 4W7UA 1OD0A 1X1NA 4PMNA 2QV4A 1VB9A 4V27A 1NP2A 2OYMA 1V0KA 3WY2A 2VMFA 3A4XA 3ZIZA 2DEPA 4CCDA 2YBUA 3OLGA 1BYDA 2WLZA 2V3DA 1GCYA 2Z1KA 1H41A 1DP0A 2Y8VA 1F4HA 1JZ4A 1CBGA 2WC7A 2VOTA 2X1IA 4FMVA 2FDMA 2XN2A 1IZKA 3BGAA 1JFHA 5LA0A 2AAAA 1J18A 7A3HA 2E9MA 3DYOA 1ISWA 2WBGA 1MW0A 1LL7A 3CIVA 1QI4A 1DWHM 2XFRA 4CCCA 2DT1A 1PJ9A 4HA3A 4CD7A 3VIGA 2EABA 4J3WA 4OGZA 3DHPA 1QI0A 1KWGA 2YL6A 3BAKA 2WZIA 2PI6A 1DTUA 1NM9A 5A8QA 1JG9A 1J01A 1NP0A 2GK1A 1V3JA 2Y5EA 5JIPA 4PCTA 4CU6A 4W93A 1CXFA 4AMCA 1BAGA 3PZMA 3VKKA 4B3KA 5I24A 4PMVA 4MDOA 1JZ6A 1E5NA 5IDIA 2GK1B 1GQIA 2XHYA 3DYMA 1JL8A 3QOKA 5CPQA 5FOOA 4D72A 5AYIA 3VIJA 1VBRA 3U5YA 3WFLA 2VCBA 2VO5A 4M81A 4UZUA 4JFUA 1UKPA 3ARQA 1GORA 4YHEA 4H8UA 1GVYA 1MXGA 2J25A 3GDBA 3BAYA 2XWEA 4NSBA 2EPLX 1CXEA 5TD4A 1TFVA 2XSAA 1V6XA 2ZXDA 5A6AA 2WSPA 4AEFA 4CN1A 3T2PA 1CEOA 3T0BA 1E6QM 2PB1A 4GO8A 2ZXAA 4TVDA 2WHKA 3VINA 2WHMA 1J9YA 4MJ2A 4ATLA 1A3HA 2E40A 1CXKA 1G0CA 1EH9A 1NWRA 1WDRA 2CBVA 3AIUA 1GUVA 1KFWA 1P6WA 1GOOA 4LXFA 3BCDA 2OWWA 5ABHA 1V3IA 3CC1A 1V3KA 2VX4A 4Z2JA 5KZ6A 1MXDA 1LQ0A 4F79A 2XSBA 1QI5A 4GI9A 4P8XA 1MYRA 5CJ5A 3RJYA 3TOPA 5FL0A 3ZJ8A 1BVNP 3IAPA 3W0KA 3VGDA 2VRQA 3KLKA 3AQUA 3SURA 1FP8A 5ECUA 1UD3A 3DHUA 1HIZA 1MQQA 4OOUA 3VIPA 1W3HA 2DT0A 1KBKA 2EADA 4B3LA 3VILA 4UFHA 4GI8A 5A6MA 2FGZA 2ZIDA 1W9BM 5A2BA 4BCEA 4QAWA 3D52A 3THCA 2G3IA 5A8NA 3B9EA 4EE9A 2BXZA 1IZJA 1Q6EA 1JAEA 2PWDA 2J7DA 2E9BA 4XX6A 1LL4A 3N9KA 3OLIA 4ACZA 2FHBA 1UZ1A 1OB0A 1E9LA 1QNPA 2VC9A 1W91A 1NWSA 3IK2A 3WNMA 1XYFA 4BQ4A 1KTBA 2A3HA 1ISXA 1JNEA 2E4TA 3L4VA 2FGLA 2X8RA 2ZUUA 2VR5A 1UD2A 2ZX8A 3RMEA 4ACZB 4MNKA 1V6WA 1NOUA 4UFIA 6CGTA 3WQ5A 3ZSSA 4EKJA 3UG3A 1W2VA 4XUYA 2F7OA 3AS2A 5FD0A 2YKKA 1QOXA 2EPNA 2QLYA 4MB3A 1WZMA 4OJYA 5CGMA 3ARUA 2ALWA 2JF6A 4UOZA 4W8AA 3AHVA 4DWSB 3WDHA 1OD8A 3BAIA 1BHGA 3LXCA 3BSGA 3GXPA 1V0MA 1W3KA 2CHNA 3OGRA 1HKJA 4D6HA 3AYSA 5EMYA 4P7QA 5HNNA 3PZVA 1OWQA 4YHGA 1W9VA 1HJWA 3CHCA 4UQBA 2NT1A 5AY7A 5M17A 4W89A 1GNXA 4UCFA 1IV8A 2WCAA 1V02A 3ZT7A 4FK9A 4D1IA 1PIFA 1GZJA 3APGA 1OGSA 1KQZA 3IANA 3SCOA 3UG4A 1FH8A 1Q6GA 4AZBA 4MNJA 4PMRA 1W9PA 3AHZA 1K9EA 5A6BD 2J62A 1KBBA 1CGVA 4OIFA 1OT1A 3VTRA 4XZWA 3W28A 4DUVA 1J11A 3ZT6A 5A8MA 3AMLA 4OUEA 4AISA 3FW6A 3ZM8A 4XB3A 3W53A 3RO8A 1E0VA 4P7NA 1XD0A 4IPNB 4DO6A 2VRJA 2J4GA 1MW3A 4GO9A 4UQ9A 2CNCA 2VTFA 1V3LA 1JZ5A 9CGTA 3K4AA 1VIWA 1ZJBA 3WF3A 2D22A 3VMPA 2XVLA 1UH4A 2CESA 1UUQA 2QMJA 2E0PA 3BCFA 4DO4A 2EPMX 3LRLA 2WMKA 4PTMA 3OLEA 5D9NA 3BH4A 3N1AA 2WM0A 2GUYA 3MMWA 4W7WA 3DC0A 5CSYA 3IGUA 4JKLA 2ZUSA 1JYVA 3KL5A 4WKAA 3DX2A 5I79A 4UQAA 4D6GA 3ARRA 2CKRA 2VCAA 2WLYA 1GOWA 3K1DA 4H8VA 1W3JA 1B31A 1JNDA 6TAAA 2ZE0A 5E70A 3WD3A 1U2YA 3GXMA 1E1EA 3VIKA 2WK2A 1WPCA 2W63A 5E09A 3RM8A 3UCQA 2XN0A 1V6UA 1E0XA 2EBNA 5IHSA 2YIHA 2UY3A 4U31A 1KGWA 4Z2IA 3UERA 3KL3A 3POCA 4FLOA 1CWYA 4HU0A 3AS0A 2YL5A 3IAQA 1ESWA 3H54A 4M80A 2VQUA 3BUDA 3F5LA 5A2CA 3S5YA 5A6BA 2E9LA 1D7FA 4QDMA 4GQQA 4JL2A 2JFEX 1Q6CA 1V0NA 2FHFA 4GI6A 3ARSA 2A3AA 3ALFA 2VVSA 4TTGA 3HN3A 1E55A 2ZX7A 3N11A 3OG2A 4HP5A 1R75A 3VX1A 2W66A 2WBKA 1R85A 4JAWA 3MV01 2WKLA 2WANA 2ESCA 3O9NA 3BC9A 1K9DA 1W1YA 3WL0A 1UKTA 4OZOA 2JIWA 3AHTA 4W86A 5AC5A 2NW0A 1XCXA 2GJRA 3ARZA 3FHQA 4D1JA 2VZTA 1L0PA 2OWCA 1CGTA 3CUJA 5I77A 2OW6A 1VFFA 5C8BB 4JFVA 3CHDA 2BS9A 1SR0A 1JF5A 1CTNA 1EOMA 4W85A 3OA5A 4F9DA 1NWUA 5BXSA 1CECA 4H04A 2YJQA 4AW7A 3LXAA 1UH3A 3DX0A 1VJZA 1QPKA 2EQDA 4BQ5A 5A95A 1N82A 1BF2A 3L4TA 2EO7A 2J47A 2JF7A 2DSWA 5E6YA 1WAWA
chains in the Genus database with same CATH superfamily
4AV4A 3ZTCC 1JDFA 2WO3B 3WFAA 3TYZA 4J4KA 3VKAA 3VGHA 2BCKA 1AHKA 4MMYB 2FQIA 3FU6A 3ARXA 3ATEA 1ZP4A 1RZ7L 4WV1B 1X5IA 4LU0A 4P2YA 1ME8A 3TIDA 3G04A 4FXGC 4N9BA 4O1BA 1ZTXE 1ICPA 5AB1A 3HLKA 2EEDA 4MZ8A 4HT1L 4JPIB 4PGDA 3GLZA 5CJBA 1CICA 4PUWA 1R3WA 2FJSA 3VDBA 3NDZE 3BFOA 1TA3A 4I7ZC 3HI1B 2JNZA 5J1AA 3ZGHA 3EOTL 2ZG2A 5KSVA 1GZGA 4JO1L 4RRPG 2Y06L 1F8TL 1ZANL 1B0RA 4K9EL 2YEZB 1NEUA 1LOLA 3EYFA 4OCRL 3IMWA 3M9YA 1EA9C 2PDYA 3N44B 5FF2A 4EUPH 4LS0A 1K03A 4NQXB 3LKSA 3EX3A 2R0LL 5EOCL 2QVFB 2A9AA 4GXVL 1S39A 1XZ0B 4UTBH 3FQUA 4GYFA 3TT3L 4GJIA 4Z78B 3W00A 3CAKA 5JBFA 3B3IA 2FJGB 1XIWC 4KJQD 4TSAH 3OHIA 1A25A 1OX6A 1CFTA 3QEHB 2IG2H 1G7QA 2R51A 1EZVY 1Q9WB 5IB4A 3KH3A 2GVEA 1MY5A 3HAEG 4OLEA 5GS1C 3OAYH 5T8GA 5DXXA 3V7MA 3ABMB 1KB5B 1K4DA 3KWUA 2J1ZA 3G6AA 4G8GE 2YC1A 5IEHA 4KVCH 1MFDL 4JLRB 2WQVA 5HVWA 1P4BH 2PUQT 4FQQA 4WFGD 5FV1L 3DV6B 4IPJA 2HRPH 3EADA 1UXWA 2RDTA 3WKZA 5DDHA 4IP7A 3BFQG 2H7WA 3QUMB 1RUKL 5FHAL 2Q8LA 4JQXC 3SIMA 4YHLH 4HBCH 3GBNH 4WEMB 3L4ZA 1MW2A 4LLYA 3KBPA 2V7NB 1WE5A 3W9DB 5J3HD 3VSUA 1YQ2A 4ZFMA 4NHCH 3AISA 1J9QA 4UFMA 4QG6A 4WJG3 4AE0A 3CX2A 3QRGH 2XVNA 5C0AE 5IMOB 3LZOA 5HHPA 1IM3B 3VI3A 2GB2A 2IAMC 3FO9A 5ABTA 5KVGL 3HW7A 5BOJA 3O16A 3DFYA 3KPNB 5CJMA 1RJZA 2YWYA 4UV4H 4PRPD 1VD6A 4PY7B 1N2RA 4WUUA 4AY7A 3MGOA 5DJZB 2WWDA 3T77B 4NPYB 1M9SA 1AY1H 2DQDL 2ZXQA 4LARL 4ICXA 3W7HA 3N4EA 2R1XA 2XG5B 4AMKH 3CV5A 1J5TA 1OW0A 4LSDA 4OOZA 1TMCB 4K4KA 2OB3A 4NNAA 3B7UX 3GB6A 5MEQA 4AVOA 5EEUA 2R83A 4R96A 1IXPA 4HPOH 2AMGA 2CZFA 1LO5A 1GY1A 1PVNA 3RZCD 3DXAA 5D32A 4NU7A 1DEEB 1GL4B 1YXCA 4A39A 4WJXA 1AKJD 3MNDA 3PUDA 3OKOB 1QWGA 2PW2A 1OIOA 4YBHA 4YZWA 5AHIA 4P06A 4WI3A 3KYNB 3G6JF 5GS0C 1ZXKA 4H8WL 1FFQA 4OD1H 3NSYA 3VI4E 3NSNA 1U8HB 5IKCA 1S9VA 3SCWA 1YHPA 4FQXA 2AK4B 1XS2A 1PLBA 4QX4A 2HTKD 2OJEB 1KM4A 4M43L 4UTCA 4JM4L 4HTBA 3VWKD 3IIXA 4JN7A 1QR7A 3OR7A 3FT9A 4X0KA 5EPMA 4LRNL 3GMMA 5E7FA 3MOAH 3V52L 3NEHA 1J10A 4AQAA 1IEAA 1P4CA 4U1KA 4ZL1A 1OVDA 2DQWA 2QEJA 3EJYD 5F7DA 4WDIB 4IGBD 3N4AA 5AC6A 1X9RA 2Z1VA 1R3KB 2JJTA 2Y7QA 2PW1A 2BHYA 3FQ1A 1RD5A 1KPRA 4BI7A 4NZUH 3QFDA 2EXYC 3EGDB 3S35L 2I69A 2J1YA 2XN9B 4HHLA 3ISIX 1ZQ5A 3VFOA 4P99A 5A6KA 1BVZA 4IU2A 1T6WA 2VDKH 4YXGA 2HWZH 3LHPH 1Z5YD 3NA4A 3HAEB 3R7QA 2ICWJ 1L3WA 1E4NA 4X98A 1BFOA 5ANMB 4LEOA 4O51A 4MCYB 4M6QA 4PJ7A 5KVMC 1WHPA 3MBXL 3MCOA 5DI8A 1YE6A 4MA7L 5ELIA 1ASQA 3LKOA 4XBEL 3FTSA 5D02A 3ULUD 3X3FH 4ADTA 3V6ZA 4WSKA 4REQA 2VHLA 2AKZA 3FJ4A 3IEAA 1IBFA 5KN5A 5D7EA 1MIEH 4LAZA 5T1DH 3H2FA 3H9SB 5ECGA 4H26A 4ICWA 3EZ4A 3LGEA 1S5NA 4FKEA 3QRBA 4NQDD 2E27L 4WGVB 2Y1AA 4UV7L 3EFOA 5TQ2H 2GJXA 3NPUA 4NWTL 5A1AA 4WI0A 3MVIA 4IJBA 4XNQA 3UPAA 2XVKA 1E9IA 4DQOH 4X6DB 2NXYD 1U1HA 4PJ8D 1G69A 1R3JA 5CSZB 1UWYA 2ATSA 1U6AH 3SYCA 1HT6A 2QQNL 1NKGA 5FO8A 1VCBC 2HAZA 4ZCWA 5D7HA 1A64A 5F2LA 1WFJA 4BJHA 2JKWA 2APTA 5M2FX 1PLAA 3H1ZA 3H3PL 1F4YL 5CLTA 4JR9L 3GK0A 1IKNA 3KBFA 3QDJE 3OKEA 2BHZA 3NSDA 3PZTA 3GZQA 5KITA 2BNRA 2Q8XA 1VHNA 4A2FA 2VC7A 3CT2A 2D2CC 1W5QA 1A14H 4N2DA 5JHDE 3BANA 4ANWA 1ZB5A 2A9ML 2H0PA 1NDWA 5JUVA 5IP4A 4H88H 4ZFCA 1NSNL 4AFYA 1NCJA 3B4YA 4W8LA 3HU7A 4GRSA 4JO2L 1G6RB 1K8XA 2Z93A 1P7QD 1TX0A 3I3DA 3DX6A 3BJFA 4F3FA 5TGBA 3S4SB 1W72A 4GG6E 2QKFA 2OMTB 1E6ZA 2YSSA 3GO1L 4DAIA 1UXSA 2PPAA 4LVOB 4LSTH 1WBXB 3W71A 1A9BA 3PP7A 2VDRH 4MAVA 3JW7A 3VTTA 2G37A 2YZ1A 4ODSH 4U1NA 1M7OA 3T3MB 4KPHH 2ZYSA 1CTMA 5CIPB 4PHZA 3J7HA 3HJEA 1O6IA 1CVSC 1SMOA 2DKUA 4GHRA 1J12A 2DVTA 2F5BH 4L37A 4OE7A 3K2GA 3U25A 1F3XA 3QHZL 3V4VL 1UVQA 2N01B 3T6WA 4OZHB 1HL8A 2YCIX 3VFWB 2P8BA 2BSRA 4W9ZA 2QDVA 2UZYA 3WY3A 4AIZB 4KTEH 4V15A 3DU0A 1FQ9C 1BZ8A 4Q9QL 4NM4H 3ULVH 1JMZA 1EFXA 1U8IB 1J0JA 4LAQL 4AGNA 5IUCA 1FF5A 3W0WA 2JXMB 4ZQCA 4FXFA 3ARBD 1TMLA 3OZYA 2P24B 3WNOA 3M0JA 2IIJA 4R90L 4FXJA 1ZGDA 1VZHA 1Q0XL 1E5CA 1DBKH 4P5KA 5E9DA 2F53E 3HV8A 4CQCA 1BYOA 3VFMA 5TK4A 4K8HA 2XZQL 2NR6A 3QZMA 4NQUA 4LVFA 1JHTA 4DWSA 2XXFA 4XP5L 2EIZB 2YGVA 4JIEA 1XFCA 2A73A 3BP5A 3K2MC 4J3SA 1TIWA 4FNTA 2BGSA 1UB6B 3S37H 3HA1A 3ATFA 3QDMD 3VGBA 3E5BA 1LT7A 3W2MA 4GUJA 3V4UL 4KEMA 2F08A 3FOKA 1OK6A 3FUIA 4GFSA 3QIWB 3TO4A 2OMNA 2D20A 1UT1A 1IGTA 3KPSA 3MROA 4F0KA 1SR9A 2XFGB 4E41E 3FQ2A 1H8LA 4S38A 1FWDC 4XBGB 3HG0A 2VEMA 2A3LA 3NAAH 2ZA2A 1FYTB 2XM1A 1UJ3B 3HB9A 1WEJL 1T6MA 2HFEB 1VA9A 4D6FA 4WO4D 3CXDL 4KXAA 1ZLWK 4LYKA 5EH1A 2DTML 4IUOA 3K0WA 3VFRB 3PZNA 2GUOB 5LWYH 3CDFA 1QPQA 1XH3A 2QVKA 1ACYL 4CBZA 3D08A 3D6NA 3GH5A 3P9LB 4TSBH 3QCVH 3FVMA 2N56A 3TJEL 4OT7A 4AOFA 4MWFA 4O1DA 3TN0A 2Q6ZA 5EO0B 4GVHA 4R85A 1WFMA 1IIGA 2PZNA 3S5LG 2VUKA 2C6QA 1JGUL 4F91B 3CWGA 3A13A 2CETA 3WDIA 3JYBA 4UU9B 5IRPA 4QRRB 4ABWA 5KTEH 1VRSA 4HGMA 3QFWA 1S8DB 2BS71 3VB9A 1EFZA 1MHEA 4U0RC 4UT6L 1GGTA 2A7RA 3TL5A 3S34L 4UB0L 4ZUSA 4X6CB 2GK2A 5K9DA 2BIQA 2X4QB 4TVPD 4O58H 2K4WA 3EGSB 5ICZA 4BRVA 3BIKB 5DEGA 2YGOA 4GOAA 4UAHA 2YGYA 1FL5B 2C1OA 4KNSA 3KW3A 4ODUA 2Y8KA 2UWFA 1A4KA 1RZIB 3R5EA 1KGJA 4RFOL 1J5SA 2XG9A 3CZFA 4KCUA 3VDHA 4DAGH 2FBOJ 3L6FB 2KZWA 2WD0A 2WQ8A 1RQEA 1XR9A 4TYUA 3RN6A 1FVDB 4YWGL 3NA9L 2EG7A 4BFFA 1ELSA 3LCLA 4HWNA 4AC2A 4U1LA 4L8BB 5C6TL 3J8F7 1BG9A 1G5GA 4JZ5A 3HE6B 2YEVB 2K9FB 1T66C 3U7VA 4I85A 1ZKAA 3OW1A 4AEHH 3W6LA 3JWOL 2QSCH 5C7ZA 2D0GA 3W02A 1E6SM 3N9GH 2XWCA 1BXBA 2IKGA 3QI9A 1B4JH 3HG4A 4LNRB 2CHDA 2WVUA 4YMPA 4PRDB 3VCNA 2VLRA 3OG6B 5I76A 3LHYA 5BMFL 2FX8L 4OBSA 1YW1A 4B2DD 3ARFC 2FSEB 3QZBA 4H2CA 1OCWL 3EJPA 3T4AA 2GIYA 2WMJA 3K6SB 3N2OA 1N3NA 1TV3A 3IGSA 1RZ8A 2W88A 3QEQD 1A6ZB 4KQ4H 4JFDB 1GCYA 4KXZI 2OEKA 2BVPB 1DXFA 1OALA 3LM7A 3DHJA 7REQA 5H2ZA 1CDIA 2W07B 3LD8B 7TIMA 1BJ1H 3C2RA 2XTJB 3FH8A 5IJVB 3MACL 1G0YR 2V2WA 1IAMA 1N4XL 4MMZB 1Q94A 2FQFA 2WXIA 5IEKA 1IM9D 1WKEA 3SBWA 4U1GC 1BAGA 3BRGC 2K45A 2FZBA 5IT2H 1VF5C 4XZIA 2P7TA 1AD9A 4NFDA 4MDOA 2ZOOA 2WLLB 3ZPDA 4J2QA 2OX5B 1RK5A 3WFLA 2VO5A 2CCLA 1MI5D 3ARQA 4H8UA 1MXGA 4NUJA 5JLZA 4H7CA 1EDHA 4I2XA 4KO7A 5TF1L 3CFJA 2ZA1A 3B7RL 2DDQL 3HGJA 3JZYA 4YYFA 1JV2B 2GL5A 3MX0A 3S5LB 2Z91A 3U36B 1GPOH 2E40A 2AZUA 2CDFB 3FO1B 4Y1AE 4ZTXA 4LXFA 1WD8A 3M7FB 1HQRB 4OWGA 1G4EA 1V3KA 5KZ6A 2QDDA 2IPWA 1XR8A 3VXTA 4HK0B 5F9WC 4CNIA 1N8IA 4YSUA 3UBFA 1I8IB 2PYFA 4EAEA 4YXKL 1ZSDA 3N06B 1HHIB 1SRDA 3CVHH 3ZGIA 3VFTB 5FFLA 3CQQA 3GHBH 5C3TA 1QJWA 2PTTA 3SGEI 5AW0B 4YBQC 1JZGA 3SPCA 5F7LB 1URLA 2X8RA 1KEGH 4PJ5A 4TXVB 4NNPL 5EUKA 4C55A 4CADA 4WDXA 3P4OA 3QQ9D 2BSTB 3O0KA 1WZMA 4BSVA 4IIQC 1K8ZA 3MSPA 4Y8FA 3UZ5A 4KHXL 2Y63A 3F01A 4MY1A 2Y7LA 4LUTB 4IRJA 2WSQA 3G24A 1ZWIA 1V27A 3B0PA 3GRGA 1T2QL 3CQHA 2G9KA 3EAKA 4MMXC 1DIDA 3F7QA 2I57A 4H9TA 4IMAA 4DGIH 4J3BA 4O5LH 4LHUB 1EO8H 3U46A 1DYSA 3UOAB 3OAYK 4AG4L 1JUKA 4KNQA 2J6EH 3FW6A 3ZM8A 1TQCB 2WV8A 5J13C 1G7MB 4XSLA 3MLUH 1KYUA 1L0XA 4FOMA 4H9YA 1I3GH 1YMMA 2QZ5A 1EJOH 1HCZA 1Q1JH 2CGRL 4QTHA 2VDLH 4PAZA 1J8HE 5SWUA 3KLHC 1JK8B 4A7GF 1FORH 2OR7A 4JREC 3DC0A 4M3PA 3IGUA 5G1TA 4MZRA 3LOWA 2CIIB 2R0ZH 2CNYA 1DZBA 3R1GL 3ARRA 2X5PA 1DN0A 3G6DH 2AANA 3X14A 4Y19E 2YSWA 3NIDE 4MS8D 3INUL 5I1HH 5BZAA 5INDB 4Q32A 2ZPKL 3BPCA 5K4XA 1ZALA 2O4MA 1T7ZA 3LRHA 5KSBE 3TQ0A 1A6WH 3QW3A 1YEEH 1MZRA 3DJTA 4M80A 3GWQA 1JNJA 5JH1A 3F5LA 4MJ5B 1NDZA 1UWXH 1H7WA 3L5WB 4GI6A 4IHCA 4ZFFA 4E4FA 4TTGA 4B5VA 4XCFH 1GQNA 1GYNA 3OPZL 5FO7B 4Z7IA 2HVJB 4C83B 5H37A 2X6UA 4QOKE 3CCHB 1E4XL 4M9OA 4LMQE 2I9LB 4AQ8C 3T0EE 3BGMB 1CGTA 1LE9B 2QCDB 4YDLC 1YEKL 2X4UA 1OTSD 1FSKC 3AACA 2BP5M 5IJBC 2GGGA 5E6UB 4NGHL 4PS3A 2WB1A 1I8KB 3TC7A 2R1WA 1QPKA 3C4UA 5I02A 1TETH 5IJCC 3F7YA 5LXGL 4WOZA 5JYMA 2V7HB 3QY8A 3HMXA 3CZEA 4MA3B 3AC0A 4NAFB 5DT1H 2V17L 4XTRC 5C0CD 1MCNA 1IILE 1HFUA 3J27A 3MGTA 4MNGA 3RPMA 1Y0LA 2YLKA 3KHJA 4UUJA 3O63A 1K4HA 15C8L 1IAIL 3EUUA 2Z8VC 2DQXA 1Y5WA 3IE9A 2JIXD 3NJJA 4U4MA 4YHOH 2VFIA 3VYPA 3L16A 4HIXH 1KM3A 2J9XA 2DEWX 4LSUL 6XIMA 4TQEL 1JUEA 3ASNB 1XF0A 4JGDA 3CGTA 3PN8A 2BP8B 4LLWB 1KGCD 3I50L 1HTIA 3W70A 3L7FA 3KZPA 4RZKA 4PV9B 3TJXA 4EMZA 1BGAA 2PWFA 2Y1HA 3W57A 4E9YA 3WK3A 4BZYA 1KJMA 2F7RA 3IJHB 3O8XC 1F2XK 4IMLA 3CIXA 1VADB 2DJMA 4JFPB 6ALDA 3GGWB 4XWGL 2CBJA 4TOYL 1N2VA 1PBGA 3UC0H 2V69A 1E6JL 4I90A 2WKOA 4P8VA 3E12A 4U6VH 4WKXA 1OFOA 4AYFA 1ZJAA 2ISVA 4LRIC 2L5HA 2AKMA 3BVXA 2AEQL 2IFGA 2VW6A 2XBZA 5ID0B 3L9EA 2K0RA 1JYXA 3RWFA 1NBZB 5EFFA 2BFVH 3R0MA 3G22A 3ZE2F 1X7SA 1CZ1A 3JTTA 3C60B 5I3FA 1P5UC 3LERA 1XIJA 3WLRA 2VYRE 4F8TA 3L7EA 1U21A 1CXLA 4ZNCD 1BQHB 3BLOA 2OL3L 4P2QE 3CMJA 4M1GH 3VFNA 2B0MA 3H70A 3K71B 4DNHA 3P77B 1VKXA 1D7CA 5C0QA 3FU9A 3L66A 3EG9A 1KELH 1U8KA 1B4KA 3VTMA 4PP2B 1S78C 4HPGA 5D1ZC 2PSNA 2TPSA 1UD6A 3Q2WA 1NGPH 2ZC8A 2P3YA 1NGYB 2EYTA 1AR1C 4AEIL 1VJSA 1FWWA 1Y5XA 1KYDA 4E5TA 3WQ4A 1QSED 5IHZA 3L3GB 1DVXA 5C9KA 1BPLB 4GQRA 4L1BA 1USZA 1NCOA 3THUA 1QUNB 3H6AA 5ALCL 4AV0A 3AT9A 4O0QA 1C12A 3VWJB 3ZVHA 2I7OA 3EOYG 3VD3A 8A3HA 4LPWA 3PABB 1RZGB 2H6UA 3V6BR 1L9SA 4KTYA 5EZJB 4LVBA 1A6VH 4MJID 3H7VA 3DGDA 1WWWX 2J8HA 4IOSA 3K2UL 4GRLC 1XCQB 3KCJA 1JPGB 2HVKB 1IGIH 3WN6A 3E96A 4BV1A 5KYXB 3DECA 3SE4C 3T0AA 3O2DH 1OF6A 5A16A 2ZD0A 4F9LA 1X8FA 2G5RA 1NAML 5IM7A 2H6RA 2A6IB 3Q58A 3SFKA 4ZAKB 3QHMA 3BH9A 4RDYA 4FJYA 1J1PL 2IXVA 4P05A 1KTDA 1RVFH 3MRNA 1UYQA 4IRZH 4GMTL 5C0BA 2IANA 2ADYA 5CBAA 2G0LA 3U57A 3C9NB 1XT5A 1VCVA 3V55A 2OXHA 3OKLA 2PRHA 3FUHA 1US3A 5H94A 1QFOA 4X6BA 4XN4A 1UM6H 5I5RA 2YRZA 1BG4A 2Q6WB 1ZA3B 4JIQA 2PDGA 2YAOA 1K2DB 1DDTA 3T55A 5I78A 2GYIA 4AG0A 4FHBD 4ZPVB 2HJFB 2D7MA 4ZYKB 4PCSA 2YPLE 3T5WA 4N0CD 1ZT1A 3CH8A 4D9QE 3R94A 3UDWA 2CKBB 4NENA 2FWSA 1H1YA 2ZRYA 2OJZL 3QYQA 4PP1D 3OXSA 4POZC 4RWYL 4IM8A 3JT2A 3BZGA 2P8LA 3HG5A 2J7BA 4LBEB 3NIGF 1AQ0A 5HYFA 1FWIC 2Z34A 3BEWB 2RMNA 3STPA 4GS7B 2O5ZH 5GRUH 5CZRA 3HN5A 3MZTA 3HIJA 3QUZA 3N55A 2AS5M 3ZYJA 3R18A 3KJ4B 2A21A 1SNRA 1W1A1 3TCSA 1Q7QA 2WYSA 4N9GB 2PDXA 4JQIL 4GXPA 3ZDZB 2DIKA 1NZRA 2V9QA 1E9PB 4QYAA 2QUMA 4EDWL 1MIML 1BAFL 3TNMB 5JIKA 4NP4L 4DEWA 2QZQA 1SO6A 3R2GA 2Q0ZX 1M7IA 2FZ3A 3O11B 1W8NA 2E77A 5JXEA 1LROA 3W24A 2N7BA 4BQ6A 4W7VA 2A0LC 3RU6A 3WLKX 1RK6A 1NSJA 1OSPL 3GKFA 3PNUA 3VB8A 3U0TB 1Z2KA 3C6EA 3VA6A 1J6OA 3IRCA 3Q43A 4MCZB 1BFVL 4LBAA 4TQIA 2NY5H 2Z6IA 1G9NC 5D4YA 5FJUA 4UT7H 4P07A 3S3CB 4OSUL 2BDNH 1UQSA 4PJAE 4Y5YC 2Q3OA 4XP9L 3DSFL 4P0DA 2MTAA 5CU9A 2PWVA 2Z7UA 3OKDB 1Q8AA 4Y7OC 4MASA 2OSWA 3ONBA 4A2RA 4U7SA 1JQVA 2Z26A 4HKXA 3W1ZA 3UTSA 3BWUC 3WE6A 4NKMB 2ERJC 4N2LA 3GH4A 4C54A 1DQMH 5IMKA 2E6YA 4J12A 4KKCD 1JZ7A 4R2GD 5G4WA 5CD3B 4AI7A 4AF0A 3WV0A 1Q7MA 3IETA 2MKLC 5J7CC 3M5VA 5EZOL 2H3BA 1D9KD 1P1ZA 2BCKB 3S6OA 2CLZA 2LFGA 2WQUA 5BU6A 1SXBA 4G71B 1A0DA 3NJGA 2MNWA 1JWSA 3LA4A 4ZX3A 3TIDB 3G04B 4W9LC 1Z3GL 5DJYB 3PJNA 3VGAB 1CL7L 3MI2A 1PX3A 2IBZY 3PJLA 1U92A 5AYZA 4OCXH 4XXWA 2NTSP 2APBA 2EVHA 1F6YA 4OGAC 1IFGA 1KKRA 4HIQA 1QLEB 1RMFH 3VDAA 3WFCH 5DZPA 1TA3B 3P54A 1AJ0A 2F8IA 5KSVB 1V7NL 1BXAA 3WNNA 1B0RB 5AVZB 2V5LA 5KVEL 2GK0A 1ODUA 1FXPA 4Y2OB 4NYUA 3QQXA 1RH9A 3ANYA 3GSOB 3LVEA 2H41A 4ELKA 2XFFA 5JUEL 5FGCB 2B31A 2NY0C 3FQUB 1IX2A 2PURA 4X4XA 3VH8A 2DD8H 4CNUA 4BZ2H 3U2ZA 4Y4FD 4NILA 3D50A 3AXHA 3QH3B 2EEAA 3HR5A 5H4YA 1W8OA 3T4CA 3RFZC 1LDSA 3BVNA 3LI0A 4QQUA 2VITA 1FV1A 4JQ4A 1M7JA 1CFTB 1TJIH 5AVXB 1G7QB 4O15A 3LRGA 2QHAA 5IB4B 5CEZE 3ARGC 1ZK9A 3RDTD 4JL1A 5A2AA 4NP9A 1H3GA 2FPTA 3RJQB 2PYEE 3LRMA 3G6AB 4B96A 4FQQB 5GSVA 2A9NH 2DQEH 4NQVB 1B9BA 2IH1A 2ZICA 1UXWB 4FFZA 4RZ4A 3PBYA 4Y5VB 3HVDA 4DVRH 4J7RA 4RR4A 3MVTA 1GQJA 4LLYB 1U33A 1LDCA 4KI5C 3RYSA 3UG5A 4R6UA 5GRZA 2LTQC 1SO5A 3W01A 3SDAB 3RX4A 3AMKA 5AAPA 5DQDH 3FOLA 4U33A 3B8TA 1IT7A 2Z31C 3GS0A 5HHPB 4GAAA 3VI3B 5I6SA 3WF2A 5FJIA 1AR2A 4PTWA 1YEFL 1M3JA 3FO9B 5CP3H 4PRAA 1H0IA 3RIAK 1AH4A 1IQ8A 2Z1PA 4HWBH 2WMHA 1RJZB 4UMSA 2HLEB 4HA0A 3SPVA 3P4NA 1OZMA 5J6HA 5TF0A 1N2RB 4PJFA 1QRNE 1DVSA 1A2YA 3N85L 3U9IA 2R1LA 2A6KB 4WUUB 1H5BC 1F1AA 1GTEA 4KVNH 1H61A 3MGOB 2ZZUT 3NZ8A 1GOFA 4MWAD 2ZF8A 3S2CA 3W72A 1IGCH 4KRPC 3QG7H 4WKHA 3KR3L 4B97A 2R1XB 1GGUA 2NV2A 1C8XA 2H3KA 4YTTA 1QZNA 3AICA 2VL4A 1RV8A 1OC7A 3BVTA 4V1DE 1FO0H 4R96B 1R6WA 1W5PA 3Q0HA 1MOEA 3M1OA 1E9ZB 4KKXA 3DXAB 5A3IC 5CJOL 2QKIA 3LHTA 3G1SA 2PW2B 1NWTA 2H2SC 4HZMA 4YFLF 4BF5A 3O9WC 2X28A 4YHML 7TAAA 1RK1A 1Y8BA 4FTDA 3VYOA 1TVLA 1AYOA 1H3UA 1EJTC 3IFNL 1L9NA 3JVAA 2Z27A 2OU4A 1EAOA 3RVXC 2ALAA 2VGGA 5IKCB 5SX4I 4FQ1L 4BH8A 4FQXB 4TNVF 3SDCC 2DY3A 2OMAA 3U0WL 4C5ZA 1KXQA 5MP6L 5B3JF 1DSFH 4UBPC 2GC4C 5GNZA 3TR9A 1DFBH 3FT0A 5TE4H 1HJUA 1JZ3A 4GE8A 1PZ5B 3GMMB 4IF2A 4WK4B 5J6GA 4DKAA 1ENUA 2KMWA 3SYPA 5B38A 4LKCB 3E38A 2VZOA 3BE7A 3AMDA 1QASA 4AQAB 1IEAB 1DQJB 4DH2A 4JG5A 4GFIA 3I68A 4F66A 5CNHA 3CVIH 5F7DB 1C7SA 3B56A 4ZEPA 3IXTA 1XRSA 3H22A 3VXSE 3AZRA 3LMJH 1RIUH 2C7FA 4K15A 4ORGA 2Y7QB 2R23B 5DO8A 2CUMA 1KPRB 4JOMA 4HLZH 1EGJA 5D7IB 4HHWA 3QORC 1AHWA 4LDOB 2A2QT 1Z3RA 1DVQA 1A7PL 1C16B 1X6UA 4LCIH 3VFOB 2RJHA 5I66B 3VM5A 1L6FA 2Z7YA 1TLKA 4ISVA 4M48L 4DCQA 4KO9A 1S7XA 5DMJB 4JO4H 3NH7H 3SDOA 1EWHA 2C3HA 4GAJH 2EC8A 1BFOB 3M0MA 3MLWL 1JDEA 3OJ2C 4XMTA 1NIUA 4QY8A 4ZTPL 5LB1A 2F6UA 2GG1A 3LKOB 3NPXA 1HE8A 5E99L 4GRWB 3CZUB 4FS9A 3ABKB 1EO5A 2X4TA 3V6ZB 3WCZA 1S9KC 3QW4B 3IMVA 4X60A 3WNLA 2ONEA 4XP4L 3EBAA 1N70A 5A5WA 2ZCKH 1IBYA 2X05A 2XG4A 3TE9A 5LNGA 2Y72A 3TFCA 4H26B 2I7SA 1E9QA 4HCDA 3NMEA 1J1OL 5CD5C 4HNTA 3U2SB 4U6HA 2CWXA 3BZJA 3EFOB 4DSYA 2GJXB 3EOUA 1GG1A 3HB3C 4WI0B 1K6WA 1N8WA 3FSZA 3Q9PA 3FQTA 4XNQB 3QQ3A 3V1PA 2FX9H 4AMAA 1EUAA 3NG5A 1R3JB 4N26A 2WP3T 3TU9A 1WXJA 2QVIA 3NCFB 3OYZA 1FDLL 3F64A 5FO8B 2GSGA 3KYKL 5D8JH 1KCZA 3FQNA 3AUOA 5DWPA 1RULH 5C07D 4PMFA 5FO2A 2OS7A 2Z00A 1OTTD 3GC4A 1AE6H 1ME7A 3OKEB 3DKJA 3A6CL 4N4PA 2BNRB 4DXKA 3ZTNH 3LRSB 2BOGX 3RR4A 1JVOA 1Q6RA 1Y5VA 5LGYA 2WAHA 3MZNA 1U3NA 25C8H 1TSRA 3SO7A 1OOAA 5IOPA 1ZLSH 1H6EA 4XC1H 2DT1A 2Q8BH 1MCOL 4A6YL 1KIPB 5JHBA 2FCBA 4NZRL 5DEJA 3DETD 5IHWA 1XBYA 4XXCA 1ECYA 2JQAA 4UNUA 4XNUH 1DTUA 5AQ0A 5KSAA 2IDSA 1V7MH 2Z93B 4M93C 3CHQA 5EYWA 4F3FB 5TGBB 1W72B 3MMEB 3BSZH 1ODAA 3FFDA 1IC7L 1IE5A 3FIGA 2YSSB 1GQIA 3DYMA 3GE7A 1VBRA 2VCBA 5BMXA 4FN0A 4LEEA 1A9BB 5D1QA 5ABAA 4NUGL 1IE7C 1CUOA 4JNYA 5HY9A 1CS6A 4HKPA 3OPSA 3LEVH 1CEOA 1S9WA 4WOQA 4L37B 1P7HL 4ATLA 5MHSE 3V9FA 2UWEE 2CBVA 1UVQB 5EZIL 4PFEA 3MOBL 2BSRB 3P84A 1HWHB 4D8LA 2AEWA 3E0VA 4LSQH 5ALBH 1P0EA 3G5ZA 1PZSA 3QUXC 5FKAA 2NZLA 3SURA 4P57B 3BQUB 4NKIH 2BSSA 2DT0A 1EFXB 4JHWH 1W17A 4XB8A 3IWVA 1S2WA 3W0WB 5IFAH 2BXZA 5I74B 3LM3A 2UX6A 4XX6A 2WTOA 1HKLH 5T33H 4C6IA 1S7SA 4K0OA 3W1PA 4WUIA 4S10A 3VAEA 2P52A 4NAQA 3UG3A 4MHHG 1GEHA 2NQ5A 5FYLD 5E9DB 1UM5L 4BK5C 4FR1A 4YDJA 2JSFA 3C2FA 4JM0A 1Z66A 3A4FA 4M4RA 4AWUA 1OPGL 1JHTB 5CZVL 4DWSB 4LNVA 2VC6A 3LG3A 1INEL 1ID2A 2A73B 2P47B 3QPQC 1YA5A 4OCYH 1MHCA 3MLYL 5SV4A 1MDLA 1N7KA 4N2OA 1EHLH 3NWRA 3STZA 3TLRA 3MRLA 4ZNEE 2YARA 5D2VA 2YD6A 4X7SH 4NKQB 1W9PA 4YSDA 1X9LA 1XTLA 3TO4B 3KBSA 2FLIA 1IGTB 3VXNB 3MCLH 1W1ZA 2WLMA 2B3IA 3GDTA 1MUWA 1XD0A 3LCGA 3D2UD 1JCYA 4X61A 4X7DC 1CGSL 4QAMB 4IQEA 3KRUA 3VMPA 4CW1B 4B5EA 5DRZA 1LMIA 2J8UA 1UUQA 4NC1C 1XGUB 4PTMA 3IMSA 4C6JA 1QAPA 5CSYA 3WBXA 2GVGA 3H7LA 1SLWA 3E8VA 1UGNA 4DGYH 5JPNC 1XH3B 2JQMA 5D7KE 1L9OA 5J8LA 1EC7A 3QPXL 4WNQA 5C2XA 3H2EA 2BIMA 2E6DA 1GKQA 4XHQA 2AV7A 2GBTA 5D7JC 4MGXA 1DE6A 4MWFB 3TN0B 3JV0A 4GUQA 4DGVH 5F71A 5IQMA 1PHWA 2EBNA 5J56B 1XB6A 4Z5RA 3IAQA 3SQRA 4DN3L 4DYJA 1CD1A 3APYA 4RW5A 4G80A 3MA9H 3S3GA 4QXGH 1EX0A 2WZPA 4I0PD 3HN3A 4YVUA 1NOAA 2HKFH 4XZUA 1W54A 2INFA 5LXXA 4HP5A 3X17A 4JE0A 1FCVA 4L2LA 5ICZB 4KDTC 4W86A 5XINA 2L0DA 3CC5B 4IGSA 5DEGB 4Z77A 3MLZH 4LEFA 2OW6A 3FCTA 2Z0BA 3MV8D 2C1OB 2G5WA 4LSSL 4GKSA 2E09A 4WFGE 2HT4D 3UWZA 4IX2A 3SY0A 2OX4A 3FFCE 3R8HA 1BEYL 1E5AA 5IIEA 2EQDA 3QHTC 1DYZA 3CZFB 4XPBH 3W2JA 3RKPA 4DJFC 3BW4A 5AFDA 2PC4A 1FZOA 4E2OA 4X9GA 5TFSL 1QRKA 1H6TA 3F7VA 3ML9A 1F6AA 1G4PA 4D6JA 4Q4OA 3G9VA 5FAJA 2YXFA 5LA1A 4B9IA 4Y9MA 2E76C 1BM3L 2ZT9C 3ML8A 1IBZA 4TOQA 1W9UA 4J4PA 4U1LB 5GRWA 1RUQH 3ZR5A 4G1KA 3UPWA 4ZOCA 4JFFB 1SZEA 2GQHA 4U4IA 1OP4A 4Z1YA 3PWPA 2UZ9A 4Q14A 2ZWSA 3LKRA 1LK2B 5CLWA 5C9JA 4JK0D 3MKVA 2AEPH 4M24A 3QI9B 1QPOA 2YBVA 1EA0A 4OTXL 2VLRB 5I76B 2F2HA 2DSZA 5AVHA 1TMQA 1OTUC 3FAXA 1KV3A 2B0SL 3GSRA 4JUSA 1HNYA 5HGAA 3BE1H 1HQTA 2DW5A 5F6IC 3GRWL 4UFKA 5D1ZI 3Q05A 1N3NB 4DW2L 3TTSA 2IWFA 2N3JA 4Y9PA 3AREC 2CWRA 5DR5L 3VXMB 2YAFA 3V6FA 1FL3B 3LKNA 4U7MA 5AHLA 2YBRA 4X4YB 3TYAA 4C7FA 7REQB 2CBOA 1J0IA 4NFCA 3NFSL 4GYPC 3I4KA 2VQTA 4Z7WE 1KRCC 4RAHA 2V2WB 2FTAA 3SHSA 4F2MA 4N25A 3VGEA 4UDTA 2BG5A 1Q94B 3TYEA 2ED6A 3PWNB 5H37G 1J0KA 2R91A 3P3RA 5IEKB 4J6RL 1QXLA 1SDAB 1SYTA 5AVUB 4CD6A 3OZPA 3L45A 3NP3A 1AD9B 2ITEA 1YHTA 3CHFA 4F48A 2VNCA 2BIHA 3V4VA 1T3FA 4HWEL 1T20A 3QWOA 4NUJB 5JLZB 2CHWA 1MRFL 4LQ1A 3W7CA 3CFJB 3E2SA 3LN4B 1DXEA 4L0ZA 2CLVB 3ZO0A 2WPGA 4H1LH 3W25A 4O1CA 3T4WA 3C12A 2QCCA 1R3HB 3CD4A 5HQMA 3CMOL 3ILQD 4R9HA 4NT6A 2Z92B 3SN4A 2X40A 1XR8B 2YLHA 3PQYD 1XI3A 2HZGA 2A9DA 3VXTB 5M03A 5D2NE 3NSCA 4CNIB 3ASOB 3BDBA 2P5PA 3F6IA 2JCWA 2AQQA 1ZSDB 5HDBE 2OXGA 2EC9U 3GUWA 2XWXA 4N2NA 2FEJA 3L9YA 5LVEA 3UBGA 2MCG1 3F85A 2NW3A 4PJ5B 4JRXD 4M5ZH 3WAJA 3FU0A 3KGRA 1YPZF 3P4OB 1EDTA 4F7TA 1L8PA 2C1PA 4FMKA 1LWJA 3MBED 4BSVB 1BVKA 2VLKD 1WYIA 4G1EA 3CLFL 4JIIX 3UMNA 1RR2A 1T0PB 5EU6E 2IV9A 4IRJB 1EXUA 2XN9D 3F58L 2DIBA 3OP2A 1ZWIB 1KTNA 1GS8A 4LVEA 3MLSL 4HB7A 4YDVA 2HE8A 1U4EA 3U46B 2B5IC 3ZKMC 5LIUX 4HD5A 4B5SA 3EEZA 2CFFA 2F8XC 3JV6A 1TOXA 1CFBA 4J8QA 4XNMB 4XBPA 3SBFA 2O5NA 4YNGA 3PPFA 5BV7B 2RGMA 3HHSB 4QF1B 3QPEA 4HSAC 1B0GA 1IR2A 4Z8FH 5AW3B 4G7YL 3ZDXF 2ON3A 5CN2A 3PL6C 4QTHB 5EUOE 4FA7B 2HK0A 3ORWA 1YTEA 1KOAA 2OI9B 1ML0A 1XWVA 3AWOA 3W84A 1JN6A 5GGQL 4TSCH 3SKUD 2YN5A 4FQLL 2ZZ6A 5EU5A 1DN0B 3TBSA 3X14B 1JNNH 4PVLA 5CLXA 1BQRA 4EQ3A 5DMKA 1C7TA 4R7NB 4UT6A 1XX9C 3LS5H 3NPVA 3DX4A 1X7FA 1DQIA 3K91A 3PGFH 1WZKA 4U2ZA 1TJMA 1YAZA 3COTA 1JF6A 5C92A 2RGLA 3C8KA 3OX8A 2IO5A 1PWLA 3SY6A 3SSZA 3D3AA 4GPNA 1P6FA 4ZFFB 4JQ1A 4JZJB 2ZNXA 1WFTA 3VW3L 3WMCA 5IHHA 3TP4A 4GBUA 2BWIA 4ES8A 3TTEA 4EIBA 2NX1A 3RVWC 4P23D 4XPGL 4J8RA 3R79A 5D7SH 2RHEA 4N90D 3L95A 3X12A 3LZFL 3NO1A 4LT7A 5B8CB 4R7XA 3GG8A 1Q0YL 1RHHA 3ZZQA 2X4UB 3NPWA 3T0CA 1SZNA 5FFGA 5CKGA 1WZAA 4ES4A 3TV8A 3O6FD 4P7LA 4O1FA 1UOLA 3RZWA 2R1WB 4NN6C 4EAYA 1RAMA 4FABH 3UCCA 1BVLA 2BIPA 3B5GA 3O0RH 3T07A 4I4WB 1FA2A 5G4NA 2R9RA 4NIYE 3KYMA 2B16A 3KBNA 3MGTB 3BAEL 4MNGB 3QLLA 4IIBA 2CO2A 4HC1L 4E0RA 3DK2A 3HOGA 4HIBA 4IL2A 1UA3A 3I6EA 2AF2A 3WHE1 2VXTH 1ANUA 1W15A 4PR4A 1TZOA 4YSAA 5FF3A 4GT0A 3IRPX 1UR0A 5BUAA 5F7WC 2KZHA 4L9YA 2A6NA 2FZ9A 1QNZL 3DDMA 3UETA 2OR2A 4JGUA 1OCJA 1K4GA 1E51A 1UWQA 3SOBH 4PJCA 1KBIA 3S6DA 3S2LA 1T0NA 3L7FB 2WMIA 4S0SD 3APFA 3HQNA 3V4BA 3QPYA 1FRGH 4K1WA 3BIBX 1D5ZB 1N64L 3C5SA 1VYPX 5L6UA 4QHUB 1KJMB 1XGZA 4IMLB 3UFYA 1JFQL 2QV2A 1FQ0A 3QDME 2BMKA 3E9AA 3GLCA 5D70L 4AYFB 3WJYA 3NG3A 2DQCL 3M0HA 4YK4B 3HKFA 1G9ML 5FYLH 2ZZ4A 2ZXCA 4Q0XL 1UFUA 3C0JA 3SDYH 3DAQA 3JTTB 2VJXA 3O2WL 3BD3A 3V8OA 2GDQA 3L7EB 4H6RA 1D5IH 4KJPC 4G6AD 4BFEA 1V4YA 3FQWB 3AMCA 5HYJD 4KAQL 1OGAE 4LUSA 4MA8L 2UX7A 5H4ZA 1JXJA 5GZNA 1E71M 3WFBH 2E67A 4AQ1A 1VKXB 4Q8PA 3OJGA 1U8KB 3LIZH 3FT4A 4HJJH 2BASA 2V9RA 1KC5L 5I17A 3SKJL 2X30A 2YB4A 4HA4A 4C4KT 3N44F 1F7BA 2DQJH 2J8GA 4KQ3H 4LCCC 4EK7A 2PD5A 2V2DA 4YHNA 1KFCA 4NS0A 1LF1A 3WQDA 4ZOAA 3FSTA 4QNWA 1SO4A 1MCPL 4HJTA 2BNQA 4NO5A 1C12B 1WC7A 3ZVHB 2NDFA 4PRHE 1M68A 5DJ2B 3S8GB 4PLJC 1P0KA 1TMHA 4Q8TA 4CQ9A 4ZSTA 3FS9A 2VR4A 5T3ZE 3IK4A 4XZBA 4ELMA 5SWSE 3L5JA 4FCHA 2RAGA 1K8CA 1CU4H 2AJUH 3JWNE 5JPMC 4ZD3H 1EJ6A 4GZJA 3KS6A 3SJVD 1PE1A 5D5ME 1DOSA 4E5XA 1Q2SA 5AECA 1YQVH 2X88A 2QUTA 4UMCA 4GJ1A 4WXYA 1FLRL 4ZUVA 1O7DC 2MWCA 2EVJA 3BH9B 1IXQA 1BZEA 4AYBA 1KTDB 1NL0L 1U5JA 5KUMA 2QQLL 2ZNWA 5HHOB 5FUCE 1K8YA 1UD5A 4GUCA 5KYNA 1RQBA 5C0BB 1SFJA 5CBAB 2W81C 4YSQA 5AOJA 1TQUA 3CFKB 1NQKA 2WWCA 2OXHB 3GY1A 5HMDA 3DX8B 2VDPB 5IGXL 2Y7FA 2ZP9A 3U9WA 1AFSA 3UG8A 2X9YA 1DJGA 4X6BB 5T1LD 4BM7A 5CZXC 5HGHA 2XWJA 4Q4EA 4KXDA 2PCEA 1CI3M 3SO5A 4EI0A 1KQYA 5K69A 4EF8A 4HBKA 1YNKH 3VH8G 4CILA 1FGNL 1P6BA 5LHFA 2F58H 4NQTA 1JUBA 2ICEA 4G5ZH 3MQTA 1ZT1B 3G3DA 2Y0SA 4UNKA 3PUCA 4NENB 4F9JA 3DOIA 2WOYA 4S3JA 3H4WA 2EDQA 5CCJA 1XIIA 5I23A 2BPBA 3GYRA 1JHKL 3MP3A 2P8LB 3IFLH 5KBKA 4IL0A 3MRRB 4RNJA 2OK0H 3VU1A 1FAIL 3H55A 4X9FA 1YYLL 3RTQA 4PJBA 1F9CA 5AHNA 3I9IA 1BAWA 3V2AR 2WHLA 4A7QA 4UT9H 5JO5B 1KB5H 2DM7A 2IGFL 1CBVL 4X8JA 3STEA 3NQFA 3H21A 4HH9B 2FYYA 4DKEL 1GW1A 3Q3GA 3EKGA 5FUZH 2XIQA 1B4TA 2C9PA 2KAUC 5C0GB 1MFEH 1MFBL 3TWAA 5CGYC 4QJ3B 4XKMA 2DUXA 2NY3C 3OIXA 3KVQA 5I16A 1UZDA 3QUMH 1ME9A 4G6MH 1WZ1L 1AMKA 4PS4H 1M7IB 1DO5A 1UP3A 4XNDA 4KEVA 3QZNA 5B39G 4DBSA 3HZMA 3W1RA 2HNEA 4P9HL 1K6AA 3U9PH 3RGVC 3M7OA 2QADB 3OBEA 1ZAIA 3GIVA 4CSZA 3U1SH 1A6TA 3PY2A 4TTDD 3CFCL 3TR2A 4BF7A 1YEHL 3IU4H 3CIQA 4B95C 1H7PA 4W5ZA 1QR1A 1MI5E 3GBMH 4S11A 3BCJA 1UQSB 4JVWA 3PFRA 3K8KA 4AQZA 1S2EA 3SE8H 4OVUA 3MV11 4OHQA 3GSVB 2QLVB 2CZ5A 4QRPD 3WEAA 4LCVA 3EB4A 3IMUA 1RK7A 4JANA 4HKXB 3SQSA 1JGIA 4HFWB 3UTSB 4QWWC 4OLVH 5ITBL 2ALDA 3WJJA 3PCYA 2HROA 1A66A 1JQXA 1NQ6A 1TTGA 3P8JA 5KEZA 4RE4A 3DK0A 3LIUA 4AF0B 5EBLA 5F9AC 5HWMA 3NT0A 1HVXA 3PY9A 1OX4B 1LORA 1P1ZB 4J2XA 3TW9A 2EKSA 2QGHA 1RJPA 3ZE1E 5IQNA 3R4RA 2NNCA 2KPNA 4HXAL 5T1KB 1JTOA 5F2GA 5CHNA 4Z7UB 4PB0H 3WSQH 5DD0L 4DUOA 1VFLA 3OZLA 4OV6F 1MH5A 3FAWA 4OTKA 1KCWA 3QE5A 3OQ3B 3G1XA 1U92B 5LNVA 3ILPA 2E9JA 2CLLA 4GMSH 4I87A 4J5VA 4PRNA 2G95A 5BPPA 2J78A 3NVTA 1GPWA 5JMRA 5INCB 3B9VA 2Y23A 5B38G 4YPGA 2GK0B 3F1QA 5EPDA 2JKJA 3SCMB 3RNQA 1JZ4A 3KDMA 1RJYA 4OM1H 4ELKB 1KV7A 3H2PA 1T83C 6XIAA 4RISL 5TPWL 2OL3A 2WBGA 1OAKL 4H5SB 3VH8B 1XGDA 2H9AB 3HUJB 4LEXH 1OK8A 2NCMA 2A6JB 4UWMA 4CD7A 4OGZA 4KKZA 4UQ3A 2WZIA 4LBUA 3BVNB 4M6PA 4X6DF 4DHLA 1CXFA 1RHCA 2VITB 4AMCA 2Z7WA 2I27N 3PR2A 1JZ6A 2GK1B 3B9KD 2AERT 5FC9A 4OJFH 3C5QA 4PV8A 4TIMA 3C2VA 1YYCA 5GGRA 5CS7A 3QRLA 4AVKA 1NGZA 2WJ7A 3WGUB 4UM8A 2AAMA 5BO0D 3HAEH 3RAOA 1MQ8A 3M6YA 4ECLA 2EDDA 5GRXG 5I0ZA 4MAUL 2IH1B 2Y85A 2PF6A 4LHUD 4APQC 1Z9MA 3HPAA 1CXKA 2ZKHH 5C0NC 2FQDA 3PFQA 1WDWA 4K3DL 4PH6A 3US0A 4L1GA 1Q5MA 2CR3A 1QVOA 3FOLB 2Y25A 3LLFA 4XC3L 5IM51 3P30H 4XP1H 4JZNA 4YLWA 2CXKA 1FPTH 3THCA 3Q44A 1NAMA 4KDWA 4TQ8A 2DB8A 1WLHA 4JFHE 1Z42A 4MD4B 3D3VD 3EX4A 3QCTL 1HCVA 2QVTA 3KPMA 3PWUA 3D69A 3SPVB 5J6HB 4QSFA 1E4WH 6CGTA 4PJFB 2ZE3A 2AJSH 1A2YB 3QUKA 2C91A 2NY7L 3BKJL 2PKDA 2QLYA 1KTJA 3NZ8B 2Q76B 3QSRA 4XIAA 2I24N 3T3MF 2BOCB 3STCA 4GQBA 2E6QA 5I82A 5D05A 1HK6A 3F4NA 4K7FA 3KPRD 5LAXA 2RFGA 3LNHA 4OB5H 5L2KB 1W9VA 1UCBH 4X50A 2XSXA 4FHJA 2E5DA 2WJEA 1VRDA 5AY7A 3P6LA 4OZHF 1EAPB 4KK8D 1I1CA 5C0FA 2YD5A 5B4MD 4N0FA 3UG4A 5E23A 4JGJA 4E3TA 3ALPA 1K9EA 2OMXA 1IRAY 4YOKA 3H9HA 5ILTL 4B9FA 5EC2A 1C1EH 3L3IA 1CG9A 3VRLF 3QIBD 2Z1XA 2NWSA 4J3ZA 4P7NA 4B60A 4DO6A 1W5NA 3KGUA 1PKOA 4LLDB 5JW4M 1VIWA 3E2VA 4XOCA 4IMDA 3TYGH 1NWPA 4GFXA 3T3PB 2CLKA 5BS0A 3QG6A 4US6A 4BH8B 1G67A 1XAUA 3MY9A 4JRYD 5BRZE 3G5WA 4FE9A 4YHYC 1ZLUH 2R2HA 4BGDA 4XX1G 1JNDA 2X6BA 1RIVH 1F4XL 4JQIA 1F11A 1AMXA 1AA1B 5B38B 1T7LA 2YKLH 1QQDA 3NRFA 3M5ZA 2VGBA 2ZSWA 2C7UA 4IRSD 2UY3A 4MLRA 4PJGA 1MAMH 3K72B 3UERA 2F54D 3IXTB 3K6DA 4OD3H 5E2VL 2H1LM 3UJ2A 3DX9A 5A2CA 1PTGA 1AW5A 3NNTA 4ORGB 4QDMA 3EA1A 4YUEL 2A3AA 1SJAA 4BQCA 3SO3C 3BJLA 2X6CA 2DRUA 4HJEA 1AHWB 4S3BA 3U3HA 3FYEB 3MV01 1HIMH 1PMYA 1NU5A 1W1YA 2P3ZA 5AW9B 2ISDA 4ISVB 2G4EA 3LBMA 4ODHL 1W6TA 3BICA 1S7XB 4TS6A 2VZTA 1MEIA 4JFVA 3CHDA 4OU1A 1TTCA 3ULSB 1GJPA 2HT2D 5C2UB 4N28A 3IYLW 2VDOB 4IMKC 1BF2A 4R8WH 2EO7A 4QY8B 4LU5H 4N0RA 2AOSA 4OFKA 1I7TA 4DN4L 1GCFA 3PPSA 5I0YA 1CZ8L 1R3YA 2Y7GA 2X4TB 1I8AA 3UP8A 2ENSA 3A4AA 2NZ9C 4MSSA 3K6FA 5C97A 4BFJA 4W9IC 3SCVA 3OBAA 1FNSL 4MJIE 2XG4B 1JZ8A 1XHGA 4S3GA 1OLLA 3IFPA 1E9QB 1DQLH 4PJDE 4TX8A 4F5CA 2O1AA 4X6CF 4G2AA 5I6XB 3SKOA 1XIGA 2IQ0A 3L3HA 3GW0A 1ZSXA 3CB8A 1A6AA 1ADWA 3BP4A 1UPMB 3UWQA 2CERA 3FQTB 1Z9AA 2A4EA 3QQ3B 1G1CA 4FG6C 1LUCA 5DHMC 2WYTA 1V08A 4PGDB 2WQWA 2ZXBA 5IBLD 1CICB 4FF5A 1A6PA 1CFVH 1DVZA 4WLCA 5J89A 3EEGA 4AUUA 7XIMA 2BVEA 3NYDA 2IFFL 3FQNB 2NY2C 2J7EA 3WMBA 2BSCA 5J1AB 1CD9B 1TR1A 2C0AA 2BXYA 5F7HA 2JKEA 1AO7D 2C0HA 2ZQKA 1O6SA 3HPSA 3O4LA 2YHGA 3EYFB 3V0UA 5D93C 3IMBA 3AIBA 3SI9A 2BNJA 2Y2WA 5CN3A 5L4IA 2WQXA 1I4NA 1BWKA 1S1RA 4FQIH 3LKSB 3MC5A 2R1PA 4V2CB 5I0DA 3NUKA 3VA2C 5DRNA 4OJEH 1T5XA 1XGQA 2BRRH 2EE9A 1W37A 1KNWA 3CEUA 5CCKH 4DP4X 2BY2A 5IOPB 1WG3A 3B3IB 1N9PA 1HKIA 2I85A 1K72A 1PEWA 3CTLA 1DVFC 2A9CA 1P7KA 1KR1A 1S6NA 3S0PA 5KSAB 4Z3FA 2X0SA 5KVDL 3CUGA 3SRFA 1TDQA 4FLRA 4KKAC 1PKQA 3JSSA 4MZ2A 4J2PA 3SPIA 3FFDB 4KWOA 3GXUB 1K4DB 3FBKA 4DYKA 2I5YH 2YC1B 5IEHB 1YAIA 1TWSA 3KOFA 1XRVA 2O4QA 2W94A 3HHMA 1O5RA 1W1VA 3CSPA 3N19B 3FH5A 3VD9A 4GKTA 5HY9B 1I3UA 1XSOA 3WTVA 1KXVA 2JEQA 4FNLL 5KMYA 5DDHB 1ECZA 3PTDA 3GYEA 1F02I 1BJ1J 3RVTD 1TXKA 3EA3A 4EPSA 3OMAB 3D25A 5I1CH 3BT2H 1GGCL 2LAAA 5CJQH 1CLXA 2E8YA 2XQBL 2E7LA 5B39A 4CSPA 3IBOA 3G5ZB 5DO2D 5FKAB 3UJIL 1XEUA 2KUTA 2BSSB 3UPMA 1OSYA 4URIA 3WDQA 4ZJ9A 5FYKL 1S7SB 4DP5X 5MERA 2EIMB 1RLBA 4NRXA 2Q3XA 3GDCA 4U4BA 2VDQL 4AAJA 1TFHA 3HFML 2DYPD 4M4RB 1TCRA 1WAUA 5K93A 5DWUL 3QGVA 5HJBA 1GOHA 3U82B 1FWGC 5MEQB 1OZUA 3S46A 1MHCB 5CFAA 2AJXH 2KLTA 3U83A 5DMGC 3VIHA 1LO5B 4XNXL 5DGRA 2X38A 3STZB 1EEXA 2ZKWA 5DF0A 3ZYZA 3MRLB 2WYIA 3ERPA 1TPH1 4LCSA 1CE1L 1ORSA 5E0FA 3FN9A 2SFPA 5B7ZA 4NHVA 4BSJA 5HAOA 3GIQA 3VZYA 7FABH 2X10A 1I1AD 1IBGH 4ZTYA 1S9VB 3OHXA 3WYZA 4YDKL 3MBFA 4IK6A 3TC3A 4WWKC 4M5YH 2J8UB 4Z1PA 2GOUA 1NJJA 1AODA 3QMRA 2E75C 2W0FA 3PU7A 1DQKA 4YBLB 2XGBA 3CWHA 1RY7B 2J88H 3OR7B 4X0KB 5EPMB 2R4RH 4OZGE 3NCWA 4MSWA 3FVDA 3WLPA 2VKXA 2CIKA 4WNQB 3WL9A 1IT9H 4LRSA 1PY0A 3RA7H 4JY5H 2AV7B 2QULA 2V5KA 4U1KB 4HA1A 1SVBA 1K02A 3WNPA 3M45A 1DBAL 2Z3FA 5GJSL 1VFMA 5AAWA 3NJVA 3UXAA 2XZAL 2NTFA 1UWTA 3B06A 3X11A 1NDGA 4Z5RB 4UTTA 2PW1B 5E1AA 4YTUA 2CJUL 3JU2A 5ITFA 1CLVA 1M5WA 2F7FA 3GI9L 3QFDB 2BRQA 1ZDQA 1SFDA 4H19A 4Q8QA 4LV9A 2JB5H 1EVUA 5B1BB 3V0IA 1L7TL 4JO3H 3BPOB 4O9HH 3BP6A 4IU2B 3KP1A 4AZHA 3QJSB 1R19A 4DNLA 4E9VA 3BX7C 1XZWA 3H24A 2EH8H 3GG0A 4I13B 4I3SH 4P8UA 4Z77B 4QLRA 5M95B 3FCTB 4X98B 4MXVE 5F7EL 4LEOB 4O51B 2V9TA 1EEQA 4PJ7B 1OK0A 1KB3A 3QDGA 4GBXA 3SY0B 5DI8B 2P5WA 1SXNA 2Y07L 4B5TA 3M88A 5IIEB 2PTVA 1GG0A 3WEXA 1SBSL 2FEDC 3TZVC 3P5YA 1IC5H 4HOZA 4REQB 5BW6A 5IQ7H 1FZOB 5DD1L 1XLCA 5KN5B 2DUAA 5A6SA 1MQPA 3BTNA 5DLCA 3RKDD 2B2XL 3F7VB 1AL8A 5A69A 5DJXA 2PGWA 3F2DA 1TWIA 1MFAL 3QJRB 3RCNA 1MZYA 4P2RD 4RPPA 1EWEA 3VACA 4R27A 3AHYA 4ZXBC 4JX0A 5E6IA 1VPYA 4LVAA 2QUNA 4HEME 2TSYA 4TN9A 4LIQH 1MPAH 4R0LA 4KXCA 3PWPB 3NTCL 3LKRB 1E50A 3LQAH 2WN2A 3S3PA 4AK1A 3QOMA 3G8EA 3P9MA 4HS8H 4PC8A 1TE6A 3H4XA 5U7SA 2ZCLL 2J1XA 3MOQA 2EXOA 1NLDL 2YRBA 1MEHA 1NDYA 3P4LA 3GSRB 4FEIA 2R69H 1R3IL 1RALA 1TVNA 1UWXK 1AW2A 3SDAD 1VGAA 4PGEA 3VU2A 2YFNA </