1U2YA

In situ extension as an approach for identifying novel alpha-amylase inhibitors, structure containing d-gluconhydroximo-1,5-lactam
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title In Situ Extension as an Approach for Identifying Novel alpha-Amylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 179
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1u2yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1u2yA01
5A6BA 1H41A 1GVIA 2E40A 3OGVA 1H09A 1MW0A 1Q4NX 2WHLA 2C0HA 1RH9A 1OB0A 8A3HA 1HJUA 3K46A 3T2PA 1G1YA 2XYLA 4AZ7A 1ZJAA 2OW7A 2F7QA 1SYTA 2WBKA 2XVNA 4UFLA 3WD3A 4B16A 3BVVA 2WKLA 3VVGA 2EAEA 1D7FA 4AZIA 3W81A 3AJ7A 3CGTA 3PZTA 1NOWA 3K1DA 2VZVA 5LA2A 1HP5A 3WMSA 1BYDA 1K6AA 5I5RA 4ACZB 1YQ2A 5D8ZA 1C8YA 1FHLA 2VCCA 3QGVA 1CGTA 2X2IA 1E4MM 1EDGA 2D1ZA 4NZJA 3ZMRA 5A8QA 3CHFA 1GJUA 1BSIA 3ALFA 1C8XA 3EMQA 2VR4A 4NRRA 1JXKA 2XN0A 3IGUA 3OLDA 4YHGA 4W5UA 1D3CA 2EJ1A 2QMKA 1TCMA 5HPOA 3DYMA 1Q6CA 1KR0A 3KLLA 2PWFA 2J25A 1UD4A 3UEQA 2CHOA 3EBVA 2WHMA 4URIA 3RJXA 3GXIA 3LX9A 4J7RA 4P7QA 2G3JA 2YA0A 1OBAA 1BPLB 2QLYA 4AXNA 1CWYA 4X9YA 1CYGA 1Y7VA 3AZTA 2EPKX 4FNTA 1R8LA 1LL4A 1US2A 3PZMA 3U7BA 4D6IA 1J0YA 3WQVA 1XYZA 3WH9A 2CKRA 2FHCA 3F5LA 2ZUTA 2WLYA 1XSJA 4L4PA 4MNLA 3SCRA 4CD4A 5A6BD 1SFSA 1ZBKA 2YL6A 3NDYA 3HN3A 3HG4A 3CZGA 4PBGA 4HMCA 1C3FA 3PHAA 4UFJA 3U7VA 4WLCA 4ZXLA 3CZJA 1TUXA 3BGAA 1EHAA 3GH5A 4W5ZA 4LYPA 5I24A 2DEPA 3VIJA 4E4PA 1JGIA 4UQEA 3ZJ6A 1CGUA 4NZFA 2Z1SA 2CNCA 1W9VA 1K9TA 3MSGA 5EMYA 1MW2A 3VOCA 4H41A 2UY5A 2DT1A 3VM7A 4J28A 3L4VA 3WD0A 3OLGA 1OD8A 1JD9A 3HG5A 2JALA 5FOOA 3WH7A 1ZBCA 4MDPA 4W8AA 3CBWA 1UUQA 3UG5A 1E71M 2WVVA 2PBGA 3GH4A 2WW5A 4QP0A 1GONA 2JEPA 2F18A 3VSVA 4M24A 1W2PA 1C90A 4Z2GA 3LPFA 3NJ3A 1EOKA 3ZJ8A 1KXTA 3W25A 3ARPA 1RD6A 2ZXAA 2NSXA 5DO8A 3APGA 1HT6A 2OWCA 4GI9A 1TQVA 2ZX5A 2V3DA 1LWJA 2ZUNA 2G3MA 5C70A 3FN9A 1U2YA 2YDSA 1PIGA 5HDRA 1CEOA 4E8CA 3EJPA 3MSDA 2A3BA 3VGFA 4Z2JA 3KE0A 4B3KA 4BZYA 3WD2A 2E9BA 1PIFA 2XSBA 2W62A 1OSEA 1GOMA 2BVTA 5BCAA 3NYDA 4UZSA 2IXVA 2OYMA 1AVAA 4JL1A 3ZT6A 2J77A 3W6MA 2G4FA 3N04A 4U5IA 1UD8A 1GQJA 1OGBA 3WH5A 1US3A 3NSMA 4E2OA 3MU7A 1SZNA 2ZXDA 3NCOA 1UKTA 2XN1A 3WMCA 3GXDA 4JHOA 3IAQA 4UOJA 2VZSA 1VB9A 1XD0A 3BAKA 3RCNA 5I79A 2JFEX 1WDPA 3SUVA 4BA0A 5A69A 2OSYA 1QWUA 4PTWA 4NZCA 1RP8A 4GO9A 4CCCA 1EGZA 5CSUA 1ZS2A 3WNMA 4HTYA 4QLJA 1QNRA 1KXHA 1EXPA 3I3DA 3IJ8A 2OLHA 2YKKA 4D1IA 1MXDA 3W38A 1WB0A 3SCPA 1DWJM 4NXKA 3WY3A 5FD0A 2VX6A 1W1VA 1VBRA 1XH1A 4C7FA 3ZR6A 4JHZA 2Y8KA 4L4OA 4AYSA 2OW6A 5M03A 4DO6A 4AD5A 2ZXQA 4UQAA 1CXHA 1UWRA 5E70A 2PWEA 2WMIB 3A4XA 4RL3A 3TTQA 4M8UA 2W92A 2VMFA 3D52A 5I23A 5ABFA 2JIEA 4W7VA 5IHRA 3A3HA 2G3NA 1E4IA 3M46A 4H04A 5HOSA 3VD7A 2VOTA 1QWNA 3AQUA 4GZJA 3WY4A 1UH2A 3ZSTA 3W29A 3BSHA 1CIUA 4PCTA 3AI0A 4WJXA 2W5FA 4W84A 3GXPA 1XC6A 2FE0A 2E9LA 1V0KA 1KCKA 5CLTA 5A2CA 3AIEA 2EPLX 4EAMA 1CXKA 2D73A 2J7EA 2YA2A 3VD9A 3A24A 5BRPA 1UWSA 3MUAA 3T09A 1UG6A 1MW3A 4QDMA 1TQTA 1GW1A 2GVYA 4MNJA 4BF7A 5JBEA 1QI0A 1B9ZA 1JFHA 1H2JA 4Y7EA 3WEOA 1VAHA 1EQCA 1IZJA 1WZLA 3EJTA 1UR9A 3B9AA 2BHZA 2CHNA 1E6PA 1G0CA 2EEXA 1QBBA 1DWIM 3VSUA 2WAGA 4W87A 3EYPA 4MDOA 3UERA 2ESCA 5D9PA 3DX0A 1ISXA 2C7FA 1FFRA 4TVDA 2GJXA 5ABHA 1AQHA 3VILA 2O92A 5CPQA 1R47A 4D6JA 4UR9A 1OT2A 3WF0A 1GOWA 3WN6A 3BAWA 4BS0A 1PZ2A 2B31A 3D4ZA 4TVUA 3VGGA 1XH2A 2ZIDA 4AYGA 3SIMA 2XJ7A 2OYLA 2ZE0A 1V0NA 3AMDA 3WSUA 4D6EA 3IAPA 3PZIA 1JNEA 4V28A 3UESA 4AW7A 1W1PA 1CENA 4PUEA 3RMEA 4BCEA 2F7PA 1E4LA 1JZ8A 1MFVA 3AFBA 1TR1A 2YDRA 4HP5A 1E3ZA 3CHCA 4UFKA 3WKZA 2DH3A 4QAWA 1DEDA 4PTXA 1CNVA 3IANA 1K9DA 1U30A 1E43A 3OGRA 1UYQA 1H11A 1BAGA 2WB5A 3IK2A 1GHSA 3AISA 3WQ6A 1HTYA 3N1AA 2WCSA 4AZ5A 3ZO9A 4D6FA 2WMJA 2YLLA 1ISZA 5FL0A 1BYAA 3BUBA 1A3HA 1WAWA 1V6YA 2VNCA 1VENA 2JF6A 1VJZA 2WC4A 3AIBA 3ZJKA 1V3MA 1QI4A 4R27A 1NP0A 4HZ7A 3UETA 2X2JA 1NM9A 2EPOA 1R34A 1B3ZA 3BLPX 1CGWA 1C91A 1ESWA 5DT7A 2ZX9A 3L4ZA 5JBDA 3AMLA 1HWWA 2D0FA 3ARYA 2FH8A 1B3WA 2DSKA 2BY1A 2JEQA 2F7OA 3MANA 5I0DA 2WWDA 4PMDA 4U31A 3LXBA 4U33A 5A6KA 1J9YA 2ZX8A 2BFGA 3DHPA 3VDCA 3DC0A 3NDZA 1NWUA 1KBBA 4AD4A 2AOSA 1GPFA 4HA1A 3WDQA 4UQDA 2F1BA 3SUSA 3BMWA 4EE9A 4CN6A 4MB4A 3VIFA 1E6XM 1JXJA 1CGYA 1J0IA 2YJQA 2J7HA 3B9DA 2VURA 3AHYA 1VFMA 1XH0A 5DT5A 4CUCA 3BUPA 1Q6EA 2EO7A 1TE1A 4MTVA 3QR3A 1H0GA 1LJYA 2WZIA 2VQTA 1CXFA 1F4HA 2W66A 3JUGA 1LG2A 1VEOA 3ZM8A 3VKKA 2NT0A 1EO5A 1HKIA 1V03A 3U5YA 2CBJA 1QOXA 1PBGA 4MNMA 2IXUA 1M03A 4C7GA 3WNKA 1HP4A 6A3HA 4GKLA 1R85A 2VX4A 4FLSA 2XVPA 4B15A 2O9TA 4ZXOA 4AISA 2CCRA 1NWSA 3I3BA 1LG1A 3MMDA 1UKPA 2AAAA 4CU6A 3W53A 4P7LA 3W37A 3WEMA 2X09A 5E9AA 3SUWA 4CCEA 1JYVA 1T0OA 1B31A 4EK7A 1VEPA 1EH9A 1MYRA 1W3JA 5BROA 1NOFA 5GNZA 2GK1B 5AC4A 1MW1A 3G6MA 5HPCA 4AD2A 1GORA 4AZ6A 1JFXA 4RE2A 3ZJ7A 3UG4A 2DT2A 5M3WA 1BVNP 1W9XA 4JKKA 1FP9A 1E0VA 1OIMA 4V27A 3W27A 5A8PA 1CGXA 2DSZA 2VI0A 2WMFA 3BMVA 2ZX6A 2PB1A 1KQZA 1TVPA 1W3HA 1WDSA 1E56A 4FLOA 2E3ZA 4HMDA 1X1NA 3OZPA 3WF3A 3CUJA 3O2LA 7CGTA 1KWKA 1B3XA 4ZFMA 1V3LA 3N15A 3WH6A 4M29A 2GSJA 4PMUA 3A4WA 2D0HA 3L2LA 2VZTA 1VBUA 1JYNA 1S46A 4S3JA 3WIJA 1TFVA 3GDBA 3VIPA 4PTVA 4UFIA 3K8MA 4PSPA 3T0AA 1V6XA 2EADA 3MKKA 4DM2A 1LQ0A 3ZQ9A 2OWWA 3VUPA 2GJPA 1W9PA 1WE5A 1HKKA 3ARRA 1KCLA 1CDGA 4XUYA 1XGZA 1ODUA 1UWTA 2VCBA 4UQBA 5FIPA 3EDEA 2QPUA 3OG2A 3QHOA 4FNSA 3WBAA 4XX6A 3RPMA 4FNRA 4CD5A 4PUDA 1CLVA 3SCTA 3UCQA 3D50A 2VQUA 3PN8A 4H2CA 4MPKA 4UCFA 5JIPA 2VO5A 4PMNA 1ODZA 1ZBWA 2WZEA 3AS0A 2ZWZA 4PMRA 1GCYA 4KWUA 1E55A 1JDAA 3F5KA 4X0NA 1MQRA 5JIWA 1CXIA 1DWHM 3PZVA 1HNYA 2VL4A 1VFUA 4A3YA 1V6WA 1UR8A 1PX3A 2DSUA 3WENA 3VU2A 3NIYA 1XSIA 1UWQA 3LPOA 4UNIA 2W91A 4UOQA 4QLLA 3WFLA 3BCFA 3GXMA 4PMQA 1D2KA 1O6IA 3ZIZA 1KGWA 3RDKA 4B9ZA 3N12A 5DEZA 3VGBA 1PJ9A 1J0JA 4P8UA 3BLKA 3SCOA 1WKYA 2WZHA 1R87A 1C8QA 3RJYA 3W82A 3CMJA 2XFFA 3CV5A 5E0CA 4AZCA 1UD6A 3I3EA 3VGHA 2J8FA 4DO4A 5KEZA 1HX0A 3THCA 2D3NA 4HPGA 2BY0A 2UY4A 2OSWA 3MO4A 5I77A 4RE4A 3OIHA 2J62A 3CZKA 2DQXA 3VD5A 3TTSA 2WMKA 1QNPA 1PX8A 1V6VA 3W4RA 1HKMA 1X6NA 3EJSA 4AMCA 4Q7NA 3DX3A 2V3EA 1O7AA 2J4GA 3ARWA 5IHSA 4ZENA 1Q6DA 1FFQA 3LMYA 5CSYA 1CXLA 3HU7A 3VSTA 1WDQA 5I6SA 1M53A 1K9FA 4QFUA 3W24A 3FAXA 2WVTA 3WQWA 4IPLA 4YHEA 4DWSA 1ITCA 3BVWA 5GPRA 2BVYA 2O9OA 3A23A 1TQUA 5CQ1A 1OCQA 3ARZA 3ECQA 1BTCA 1GHRA 5F7UA 5BXSA 5EBAA 1I1WA 2O9PA 1UWIA 2Q8XA 3WF1A 1BG4A 4KRTA 5FL1A 3O9NA 2J47A 4CD8A 2CXGA 3AICA 4XV0A 2BHYA 4GXPA 3LRLA 2YL8A 5CGTA 1UA3A 5M17A 2EXOA 4NF7A 4MB1A 1I1XA 1G94A 4N42A 4W8BA 1GVYA 4A3HA 1JYWA 1IV8A 4ZE4A 1ZBVA 4RE3A 3T08A 3LXCA 1JF5A 3AMCA 5I2UA 2WVVB 3F5JA 2VRKA 5KZ6A 3MMUA 5BXTA 4TUFA 4PMVA 3WNOA 3VD4A 2ZWYA 3SEPA 2QMJA 2QF8A 3OLIA 2EQDA 1KXVA 3TTYA 4LX4A 5D8WA 3H54A 3ARQA 1W2VA 1BG9A 2Z1KA 1Q6GA 4V2XA 3AHXA 3VIHA 4ATLA 3CUIA 1W9UA 4HU8A 1CXEA 1CZ1A 3U57A 2JE8A 1DWAM 3T2QA 2WVSA 1V3HA 3CUFA 5D4YA 1JZ5A 2CIPA 3AYRA 5JBFA 1CTNA 1WZKA 3SUUA 1QNQA 3VIKA 2CBIA 3DYPA 1EA9C 2XPKA 4D6GA 2VJXA 4GI6A 5CPSA 4DUXA 3VX0A 4DWSD 4W93A 3NSXA 5BWFA 2VRJA 1MQQA 4IUGA 5CGMA 5E0FA 4JFUA 1E0XA 2WSPA 4DUWA 1VEMA 1SMDA 1UQZA 4GI8A 4OOUA 2WM0A 3WY1A 2ZUVA 1UHVA 2WC7A 3VMOA 1MXGA 2XHYA 1WP6A 1NOUA 1IT0A 5CG0A 1TA3A 3N17A 3ZT5A 1FH8A 2F2HA 3BUQA 2J7BA 3WF4A 4DWSC 2GFTA 5GNXA 2DDXA 2Y8VA 1C93A 1UA7A 2YOCA 3DYOA 3MS8A 4LQ1A 3A21A 4CGTA 2J7CA 3VMPA 2UY3A 5I3DA 1ZL1A 1NP2A 3HMCA 4AIOA 2V3FA 3CH9A 4M1RA 1HIZA 3TV8A 1CECA 2D22A 3DECA 2WCAA 1OGGA 4AD1A 3EJUA 3AXHA 3VDAA 3WNLA 5I78A 2XVKA 4R5EA 3WD4A 4U2YA 3POHA 3HG3A 1KBKA 1QVBA 5AYBA 4LXFA 4MAZA 3VMNA 1XV8A 1UKSA 1NH6A 2E8YA 3OA5A 5ABFB 3RM8A 5AY7A 2ZOXA 2CERA 3S6TA 3ZR5A 1WCGA 4H8HA 1PX4A 4F8XA 1DWGM 4FK9A 3AS3A 3D4YA 4U3AA 5A95A 1LLOA 4CN1A 3WFZA 4NSBA 5DMYA 4UOZA 4YPJA 2J79A 2O9RA 1I75A 3GM8A 3PZ9A 3GXFA 4AIUA 3BUIA 4ZE5A 1J10A 2F1AA 1WPCA 1OGSA 1R46A 1A47A 3BH4A 2RGLA 2UY2A 2X8RA 2JF7A 3VIGA 2BVDA 3PBGA 4JIEA 3RO8A 4J3WA 3H53A 1HJVA 4OZOA 2F61A 1BHGA 5HBFA 2XFYA 1UH4A 1E1EA 1HXKA 4AZBA 2IGTA 3GTNA 1E1FA 4GZIA 4GINA 3PTQA 3A22A 4Z2LA 3VX1A 2DT3A 3WEZA 4W85A 9CGTA 1EQPA 5E6ZA 1E0WA 5A6MA 3K8LA 3CZLA 3CUGA 2BY2A 2DGAA 2YL5A 1VIWA 3TTOA 1VRXA 4FLQA 1C7SA 2GJXB 2PWGA 3W26A 1EIBA 7TAAA 2WXDM 2W61A 3LPGA 4WKAA 3D5HA 2CETA 1KTBA 4MB3A 4B9YA 2HISA 1E6QM 3GXTA 2X0YA 3E1F1 5A1AA 4J3SA 1PPIA 1DWFM 1E6ZA 3MMWA 1BFNA 2VZUA 2FYVA 2WKGA 5A6JA 7A3HA 3MV01 4PMXA 4A4AA 3SUTA 3SURA 2YFOA 4W88A 1R7OA 2PC8A 2CITA 3RM9A 1ISVA 1XCXA 1B2YA 3WNNA 3WDRA 3VNZA 1GOKA 3GNOA 3EDKA 2VC9A 4CU7A 5E6YA 4HZ6A 2J7GA 3FNDA 3M6DA 1QNOA 3NUKA 5JUVA 4CN4A 3BCDA 4KGJA 4KGLA 3PZQA 1UASA 1H0IA 3BVXA 3PTMA 2VCAA 2CYGA 1VJSA 1VFOA 3BAJA 1JAKA 2WMGA 4OJYA 3FHAA 3EJQA 2E8ZA 3BAIA 6TAAA 3WQ8A 4D1JA 4J3UA 5EB8A 2ZUMA 1G9HA 1H3GA 1UH3A 3A4AA 1CLXA 3DX2A 1JIBA 1QX1A 4TOQA 4W7UA 2DIEA 3L2MA 3S5YA 1B3VA 5LA0A 3ARVA 2EACA 2VR5A 4AMWA 4ZEPA 1B1YA 2VX7A 4F79A 1MWOA 1E40A 4X0VA 4P8WA 1J0KA 2V5DA 3VINA 2VUYA 2F8QA 4Z2IA 1HL8A 3CMGA 1JNDA 3WUGA 1KTCA 3KWXA 3WUFA 4H8VA 4FF5A 1NQ6A 3VIOA 4OIFA 2CKSA 1NARA 4U5KA 3POCA 1LWHA 4TX6A 3OB8A 1GOOA 4EKJA 5IXEA 2X0HA 4KRUA 1Z32X 3WDIA 4HZ8A 1TZ7A 1OIFA 5GNYA 2PF0A 3WNPA 2D2OA 1UD5A 1N82A 5ABGA 2ZUWA 3AXXA 4JKLA 5HNNA 3IJ7A 1QPKA 2WYSA 3M7SA 1HVXA 1H5VA 3AMGA 1H49A 3AXIA 1BF2A 3WELA 1CGVA 4IISA 1JYXA 3FHQA 2XN2A 2WK2A 4WK9A 3ARSA 4Z2HA 2BXYA 4ACZA 3QOKA 1R75A 4HOWA 2PWDA 3WH8A 4S3KA 3AIWA 1J18A 1E72M 2CPUA 3D3AA 1OM0A 5D9MA 3GBDA 1KR1A 2VVSA 1JZ2A 4FNQA 5D9NA 1JI2A 3QHNA 3FW6A 1UD2A 2WPGA 1BYBA 1PZ3A 3TONA 1FH7A 2XWDA 3KL0A 3S2CA 4OOZA 1FP8A 3W0KA 2W63A 1PAMA 4H7VA 1B30A 2V5CA 1QI2A 1HVQA 1ZJBA 4UQCA 5A8OA 4TXEA 8CGTA 2EABA 1XYFA 1OINA 2ZUUA 3THDA 3DDFA 3EJRA 1TQSA 1E70M 2XTKA 1EOMA 2VX5A 3N9KA 2X05A 2DT0A 1L0PA 2PWHA 3BUDA 1R86A 1PS3A 3KL3A 2D20A 4AMXA 5LYRA 4BQ5A 2Y5EA 4FNPA 3CPUA 1GOIA 3F4VA 4PSRA 4XB3A 1X6LA 1E6SM 2YLAA 5A6SA 3MUY1 4JZ5A 2WBGA 2E0PA 1E15A 2EPMX 4AWEA 3KZSA 4B3LA 1QNSA 3TA9A 4ATWA 3L4WA 3AZRA 1QW8A 2D23A 2BV9A 4J3TA 3PTKA 3AHTA 1E6NA 4IPNB 4D71A 1B3YA 4AIEA 3ALGA 2D3LA 2J7FA 1UR0A 2XWEA 4HA3A 5FKYA 4D6CA 3KL5A 2YIHA 4AZHA 3MUZ1 1CPUA 2F7RA 4AY1A 3GYCA 3PZGA 4PTMA 3K8KA 3A6OA 1FA2A 1B0IA 2QHAA 2A3AA 1V0LA 4LGXA 3SCVA 1HJSA 5IDIA 2GUYA 1TMQA 1WDRA 1HJQA 4DO5A 3AIQA 4C7DA 2E9MA 5BXRA 3HJEA 5IFPA 1NWRA 1LL7A 1HXJA 5ECUA 1BGAA 1JZ4A 4MADA 4PMZA 4TX8A 4HPHA 1J01A 4TTUA 4J3XA 1TVNA 3H55A 1E4NA 4FMVA 4PMOA 5A3HA 4NI3A 1BLIA 1W3LA 4P8VA 4P7NA 1E5JA 4IM4A 3EDFA 1KB3A 1XHGA 2FDMA 5TD4A 3BC9A 4TVCA 1JI1A 1W1YA 2VZOA 4ATDA 4UQ9A 3KEHA 3IJ9A 5LA1A 1NWTA 4UTFA 5A94A 3CZEA 3B9EA 1JG9A 5E09A 4OKDA 2CESA 4JFSA 1AQ0A 3AS2A 3AHZA 5DF0A 3ARXA 1QI5A 1GJWA 4JCLA 3GNRA 4GPNA 2X2HA 5CXPA 4XZWA 1PEZA 1Q6FA 5ABEA 4CD7A 1LL6A 1W91A 4M80A 4P8XA 4LPCA 2Y4SA 1R7AA 3N11A 3UG3A 4JKMA 2J7DA 4AZCB 3KLKA 1LF1A 3SCUA 4GO8A 2XGBA 3WD1A 1ISYA 3BVUA 1XSKA 2BXZA 2FHBA 1QW9A 2XVLA 2ZUSA 1GQKA 2GDVA 2DSVA 4WSJA 1GQIA 1QBAA 3AIUA 2C8NA 5GQBA 3CZ8A 2VVNA 3BSGA 3EDJA 2XM1A 3CTTA 1EHNA 3OZOA 3SCNA 1JZ3A 3O6AA 3VDBA 1G5AA 4AD0A 3CIVA 2EPNA 3M07A 1GZJA 1MVYA 4KMQA 3ZSSA 3K4AA 3WQ5A 5A8NA 1J12A 3QHMA 4MAVA 3SCWA 1C92A 1OD0A 1TQWA 3VNYA 1GUVA 2WMIA 1UKOA 4OBRA 2Y2WA 3WDHA 3FAWA 4WIWA 4E8DA 4DWSB 2X1IA 4DM1A 3N13A 4QLKA 3GNPA 2ZX7A 5A6LA 1KXQA 4GQRA 2YFNA 2BY3A 5A2BA 3CO4A 5BRQA 5HXMA 3LPPA 4JFWA 2Y24A 1V02E 3SCSA 3CUHA 5FCZA 3DX1A 4N0RA 1QHPA 2TAAA 1R33A 2GDUA 1O7DC 5EFDA 4OUEA 2FH6A 1MFUA 1QI3A 1JL8A 2WMHA 3T0DA 3DDGA 3W6LA 5M5DA 2CEQA 5IFTA 5A2AA 1BGGA 3L4TA 3VDHA 3VD3A 4M56A 4MJ2A 4J3VA 1HJXA 3LRKA 2WANA 2XIBA 3VPLA 4YN5A 1KGUA 1VFFA 2QPSA 3U5UA 4U2ZA 1XRVA 3HZ3A 1KQYA 1JDCA 3TP4A 1U33A 4PMYA 1V3KA 5AC5A 3DX4A 3RIKA 1BQCA 4JFVA 3CC1A 1SMAA 1HJWA 4MNKA 3MI6A 4JL2A 3II1A 4WF7A 2W67A 4TTGA 2J74A 2CBVA 3WMBA 4NXSA 3T2OA 1IZKA 1ECEA 4DUVA 3LRMA 3B8SA 3HG2A 1JDDA 4AZGA 1GOQA 1M7XA 1UZ4A 3CHDA 1HF6A 2FHFA 4GQQA 3CLWA 1GNXA 4WSKA 1J0ZA 4HU0A 2XFRA 3PZOA 1UR4A 4W8LA 3CZNA 2YL9A 1K9EA 2VRQA 3MV11 4K68A 1EDTA 2D0GA 3WY2A 2W4XA 4U3CA 1XD1A 1G01A 4PYSA 3A5VA 4W89A 3TOPA 2BS9A 1E6RA 2DSWA 1E9LA 1EO7A 3AIRA 5C8BB 2DH2A 3W28A 4JFTA 2D24A 3WDJA 1W3KA 1TA3B 3GBEA 1QHZA 3GXNA 4QCEA 2RGMA 3CZSA 2J75A 4GIAA 3ZT7A 1M04A 4PRWA 3CHEA 3LXAA 1L8NA 2A3CA 3GZAA 3A47A 1JAEA 1HL9A 1WO2A 1UR2A 4Z2KA 3WUEA 2J8GA 4JAWA 1P6WA 1BYCA 2XGIA 1UWUA 5BYWA 4PCSA 2UWFA 5CJ5A 3BVTA 3GH7A 4P7RA 1UZ1A 1E5NA 1W9BM 4HOXA 2ALWA 1V0MA 2AMGA 1OWQA 3WDPP 2WNWA 3UR8A 1C7TA 3FY1A 4M81A 1FH9A 3AIVA 3UR7A 2CBUA 4AC1X 4JCMA 1ZB5A 4ML4A 2BNJA 5CLWA 2OSXA 1OT1A 3MUIA 2VTFA 4LYQA 1RPKA 5CPTA 4UZUA 2E4TA 1EDQA 3AZSA 2EBNA 3PZNA 3ARUA 3VIMA 2PI6A 4D72A 4CVWA 4BQ2A 2OYKA 1H4PA 2V3GA 3BAXA 6CGTA 1FOBA 4FNUA 1WZMA 1KWGA 1J11A 4GZEA 3OGSA 4D6DA 2JIWA 3WUBA 3FXYA 3EMZA 1JZ6A 2WCGA 1RP9A 2IUZA 4XZBA 2X2YA 3AS1A 2XSAA 4MJ4A 2FGZA 3J7HA 2DPEA 2YDQA 4HA4A 4EANA 4CCDA 2YA1A 1FHDA 1F4AA 2XG9A 2ZICA 1UKQA 1GQLA 4WKFA 2G41A 4Q22A 2J78A 4AD3A 4HMEA 1ITXA 3OLEA 1J0HA 3SCQA 1DHKA 3L4UA 3ARTA 1VF8A 4QCFA 4CD6A 3AHVA 3RM4A 2PBOA 1XCWA 3T0BA 2GK1A 1QHOA 5DFAA 1HN1A 3WBEA 1YHTA 3WF2A 1W9DM 4CVUA 3WL1A 1JF6A 2WVUA 4HOZA 2WHJA 4MB5A 3AROA 1W1TA 3WQ4A 2ZXBA 3BAYA 5CZKA 2WC3A 5EFFA 4PN2A 1DP0A 4PEEA 2XVGA 1V3IA 2FGLA 1HKJA 4M82A 2WLZA 2XM2A 1JZ7A 2WSKA 1MQPA 4BQ4A 2HVMA 3VO0A 5C71A 3NSNA 1WNOA 1M01A 4ACYA 4P7OA 4FLRA 5A8MA 1UQYA 5AYIA 4OGZA 3WL0A 2DIJA 4CU8A 3L4YA 3K4DA 4F9JA 3AMKA 4CKQA 2OWXA 1UR1A 1W32A 3S5ZA 3AOFA 2G8ZA 3QOMA 3AYSA 4AEFA 2V38A 4AEEA 2QV4A 1KGXA 4OBSA 1V6UA 4WKHA 3VGDA 3PZUA 1BVZA 4BQ3A 1V02A 2A3HA 2XIIA 4F66A 2XUCA 3N18A 1E73M 4F9DA 1CBGA 2YBUA 3BXWA 3VIIA 3EMCA 1DTUA 1V08A 2NW0A 1WZAA 3EDDA 2YBTA 4NRSA 3OBAA 3VGEA 4LYRA 4W7WA 3ZOAA 1H1NA 3G6LA 1E3XA 1JD7A 3D51A 2NT1A 4NX0A 1B90A 3DHUA 1UOKA 3BLBA 3RILA 1ZU8A 4KH2A 5D9OA 2A3EA 2WHKA 1V3JA 2BHUA 2MANA 5BXPA 1TG7A 2WWCA 5E1QA 1ISWA 2VT0A 1AMYA 3VTRA 5A6AA 4H8UA 4W86A 4J27A 2G3IA 3VM5A 4UFMA 4UFHA 3L4XA 4D6HA 1AQMA 1SR0A 1UD3A 2GJRA 1KFWA
chains in the Genus database with same CATH superfamily
5IQ9B 5FEPA 1R5IA 3LSCA 1THFD 3SKMA 2IANE 1ZLVK 1ZE3H 4LCCA 5IBXC 1JNHB 1BVNT 3BURA 2E9JA 3ARBC 4AZIA 3V6FB 3S2LA 1A6VL 1M2VA 4F9LA 2H2SC 5DO2C 3FYPA 2D1ZA 6PAZA 2AERT 2FD6H 3W7LA 4DN4H 4PLJC 1P7QB 5E4OA 1A5FH 1QFHA 4EN2A 2Q10A 1KEMH 4JQ3A 3CQKA 2J25A 1ZPTA 4F4RA 1FJ1A 1P9MA 4LFYA 3NA4A 4DFHA 4JE4B 1S78C 1Q0XH 2HWGA 2YQGA 4FAAB 5AVVB 1QJWA 4N28A 2C9QA 4RVBA 4X4XA 2LW3A 1R8LA 5FKAB 1WBXB 3A9IA 4N9GB 1RK0B 3FN0H 4IJTA 4Q9CA 4E68A 4DPRA 5M7QA 1VBJA 2DBLH 3GR7A 4Y4HB 1Y18B 4KCTA 2J1XA 3PB2A 4UQEA 3ZJ6A 5J1TC 4WWKB 4ZFZA 1E6JL 5F6IC 4EUPG 5EMYA 3IDGA 3UZYA 3UJFA 4M3JA 4NQVA 2H3BA 4G59C 3T3PE 2XH0A 3Q1SH 3UZJA 4K15A 4WKXA 4I0KA 4AV5A 2E5CA 3MO7A 2ZYRA 1T3FA 1YC7A 1OM9A 1KLUB 4M24A 3F00A 2CIIB 4ZMOA 2YD3A 4XSLA 4JKPH 3V4VL 3ZJ8A 4AGQA 2ZXAA 3WEXA 5D7LB 5CH9A 1PAZA 5F3BB 4Q4MA 4CMHB 4HCDA 4GUCA 3S9IA 3DOSA 4Z2JA 5D9SB 5I8EB 3BOFA 4EUPH 1DE4B 1E8ZA 5FCUL 2OXHA 4U5IA 4YHYB 1YPZB 4BGDA 4PJBA 4UOJA 3TWCH 4E3TA 4CNUA 4BA0A 4PS4L 3ZDYF 4NZCA 1NTDA 3GHTA 3D3VD 1KJ2H 1YYAA 3VXRB 4I5UA 3FDGA 4GS7B 4MMYA 1HAUA 4ADTA 3OD3A 4P5KA 3F03K 3SCPA 4UC5A 4H9MA 2X1UA 3KVKA 5FYLD 2ZC8A 4YHMH 3B2VL 4OKVB 4YVPA 4OZFH 4ZUSA 3UWEA 4NRXB 3QFEA 2BWQA 4NKDA 4EWND 4P46A 3NAAH 2VDRH 4OIIL 3O07A 3V0WL 3NURA 1HZLA 3N73A 5C2UB 3ZSTA 3W29A 3GXPA 3S8WA 4EPSA 4MX7B 5CLTA 3U9PH 3E2VA 1JGDB 5A2CA 2A3LA 1OGAB 1CXKA 4AG4L 1QQDB 3QUZB 1ORSA 2VAAB 3S36H 3S1VA 4DGIL 3EWXA 4C65A 3GRWA 5J12C 3FUEA 3G77A 2CHNA 3FU8A 5D8JH 1AD9B 4IKJA 2ALRA 3TFKC 2F19L 5D9PA 1ISXA 4NUPA 1FFRA 1ZJIA 1YRRA 2PLKA 1AZUA 3GU1A 2P24B 1OT2A 3RVTC 3WF0A 3VI3E 5EO1B 5IEHA 1C1EL 3GNMH 1TZ8A 2JFCA 4LAJH 3H2WA 5GSVB 5IOKA 3U83A 4BSWB 4NX5A 4GIPD 4IHBA 4EQ3A 5XINA 4IRSA 3SZ8A 3VW3H 1U8MA 4AJ0A 3KWWB 2GVEA 3SY8A 3S37H 3NQ8A 3QO0A 3UESA 4IXHA 3C5XA 2B39A 3HLKA 4F15C 3NGBB 5HJXA 3IF1A 4BZ2A 5I66B 5DYFA 3ARGB 1YN7B 3II3A 2YXWA 5SWSA 3FQ4A 4FFWD 4I3SH 3JWNE 1WFMA 4DKTA 2WB5A 3A6CH 2OI9B 2V2DA 1GHSA 3WQ6A 1WZ1L 3CFBA 3LYRA 3NQKA 1LO5A 2FZ8A 3DKJA 4PV9A 1UVQA 4PJ5D 4F20A 1QI4A 2AVFA 2DJMA 5IHLB 1BWMA 1NM9A 3BLPX 4NNPL 5F3HA 3W1NA 1CD1B 3BO8A 1TPDA 2OGYA 2TSYA 5H94A 4WRLA 3NFSL 4O53A 2JSFA 4W9ZA 3DVGB 4G8EB 1R3JA 4NKOA 3LD8B 4LASL 3M1BB 1UADC 4UANA 4CNIB 1OFOA 5TJWK 4IMFA 4N6RA 4B97A 3VIFA 2R7EB 3DXAD 2K8MA 4QNWA 3Q9PA 5CN3A 1DQQA 2JB6A 4PG9B 2B15A 3PGCB 2C7UB 3TYAA 1QOXA 2ZOWA 4G5AA 5I19H 2VX4A 2CCVA 4LW7A 2XYBA 3UPMA 4P8QA 1F07A 4PD4K 4GRWH 5D2LE 3EXLA 2FO4B 2C0AA 5C3LD 4FYSA 3W37A 2VGIA 3ZK0A 1B31A 3UBXA 2EKGA 4KI5F 5IWLA 1X9UA 4OGAC 1RV6X 4GXUN 3ZKXC 1T1YB 2DT2A 3MOAH 4YIQA 3TH4T 1UB6A 4P2QB 4ZSOE 5I73C 2ZX6A 3V4UL 2CD0A 4NJAH 5TTRA 3ZKSD 3L95A 2JNZA 3OZPA 1NICA 4JFQB 1LP9B 2ATMA 1JV5B 1KC5H 4PRHB 3M1ZA 5B1AB 3NQ2A 4WTXA 3FUIA 1VBUA 5DWUH 5DC0A 5DANA 3ROLA 3RUGE 5KJRH 4JRYD 2V5TA 4QY8A 1JRHI 5DUPL 2JKXA 1RUAL 1BBDL 2FBJH 5KYYA 1B4RA 4ZDHB 1ASOA 4PBVC 2B1AH 1XWYA 3QIBB 5CSGA 1TPB1 1CFMA 5DK2B 1DJQA 3WBAA 1WFNA 3K80A 1I8JA 3PN8A 2PP8A 2YXVA 1BAFL 5L6YL 4CVZA 2WZEA 5LBSH 3A4EA 4KWUA 1XBDA 3F5KA 5FM4A 5BOJA 4YOKA 1MVUA 1UR8A 1T20A 1M9WA 1PX3A 3KPOB 4XNQA 5LG6A 3K91A 4UOQA 4ZO7A 2DB8A 5I8KH 4C6QA 5AVXB 2PLJA 2G9KA 1RH8A 2WQUA 1URZA 1VP5A 1H8LA 5TE7H 3RFRA 3VOIA 1DBAL 1HNFA 2DZWA 1I7TA 4GY7A 3I3EA 5F4XA 4HFWB 4LU5L 2G5RA 4D9PA 4ENED 4DO4A 3CHXA 4KTEH 2HXAA 3QO1B 4ODVH 2H0FA 3CQ0A 2J62A 3RNQB 2W8CA 4TV6A 2VEKA 1BD0A 1KLYA 1MNZA 3CEUA 4C6BA 5A5WA 3FZUC 2KAUC 4WI5A 5FM8A 3QHFH 1FFQA 1FKXA 1J8HE 1YEHL 4MHHI 1N7ML 4U3SB 2J20A 4G7EA 4CRPA 3GSVA 4F8QA 2AJ3A 1OCQA 2R1NA 3QC0A 5EBAA 2XWTB 2UX7A 2FYMA 1BFVH 5EPMA 2LU4A 4MASA 1OPGH 3GSWB 5IP4A 1KBVA 3ZL4L 3F4WA 1XAUA 4OE7A 4LCVA 5F7AA 1DXIA 1I1XA 4QRUA 2AJXL 3Q5OA 4QJ5B 1GR7A 3RXZA 1QR1A 4JY4B 2AQSA 3U4AA 1TJGL 5IFJA 1MHPH 1U8QB 4PJ7B 2GLKA 4B53A 1D9KA 2EPHA 3E2HC 1I2NA 2ZYHA 1WFUA 2NX5A 3D0LB 1K4GA 2NY3D 4V2XA 1A50A 3AT9A 3SYPA 1CXEA 4GMSL 1QFUL 1A5BA 3MZ2A 4PVNA 4IIQC 4Y5XB 2PLMA 1KYOK 1SUHA 5GSRB 3OWEA 2V5MA 5AD0B 4OJFL 1POJA 5EFIB 4DUXA 3GMPA 3L3DB 2XKUA 1ZKAA 1BFSA 3FT2A 4WJ8A 2APSA 1LNUA 3BD4A 1AXSB 5IQLA 4E41B 5L4IA 1RK7A 4YN3A 1PZUB 3N17A 1CX9A 4NC1C 3MJ6A 3QJZA 4PGCA 1EC9A 4DERA 4YSPA 3ATBA 2ZVIA 2X4NA 3NVQA 1C5CH 4JTHA 1KGIA 3S3CB 2YDAA 4KW2A 4AD1A 4UIMA 3C60B 3JTTB 3QSRA 2FWOB 2VE6A 3JSSA 1X97A 1TQCB 4KY2A 2YO3A 3U25A 4XPAL 3OHXB 1OF8A 3OJMB 4HA0A 5U4NA 1GW0A 1IL1B 4BWLC 2QDVA 4YPJA 2A83A 4HIPA 1JXFA 2F8VA 5CP3H 4M5TA 2ISVA 2NLJB 2FPTA 3HN8A 5IUSA 3ZRCC 2ADJB 2D4FA 2UY2A 4J3OD 3II2A 2IANB 4JFFA 4K7PH 4KVPA 4OZOA 1E1EA 3GB7B 2DYPA 1E1FA 3RNKB 2OMVB 4TQEL 3IWUA 2DT3A 5ILTH 2H0PA 3QUHA 3N6QA 3QW9A 3EGJA 1GZPA 1C7SA 4G6ML 2E7FA 3W26A 1HC1A 4RAHA 4PL1A 4H9YA 5J06A 3QEQA 3ZVIA 3QJOA 3GJEB 4OGXH 4JLRB 3HE6D 1WAEA 2YD2A 2XY1A 2Q20A 2XBTA 4N0FB 4NZRL 4JTSA 3RM9A 3PANA 2PN5A 5E2VL 4H1ZA 2X44D 4Y1AE 2CJSA 3E0WA 1TYRA 5FF7A 3VFPB 3BVXA 1RPXA 4O54A 4TN9A 1R0MA 1Q9OB 1HXYA 4W9TA 4Q89A 2NW3A 5JDJA 2ICWJ 4W7UA 2DIEA 2UZIH 4QHMB 5GS0C 1S2WA 3KBNA 2EYTA 3VI4E 3NZRA 3S5OA 2X70B 3IWVA 3QUYA 1G9ML 3EYFA 4H8VA 3DHMA 3VIOA 4HDIA 4OCYL 4U5KA 3T3PB 3O3UN 3ME0B 3TCLA 3HZMB 3O8XB 2PTWA 3ITVA 4B2DD 2OQYA 3D1MC 2GDQA 3NCYS 3VRLE 3I6LD 3RHWF 2PF0A 3BPLB 3IKKA 4R8WL 1N82A 4IFOA 5H1WA 3IJ7A 1QPKA 4KVCL 1X4XA 5JPNC 1RUPL 3MRKB 4KJWC 4PRBB 2HVBA 1UOLA 5JHDE 2ZAGA 2JQXA 2AABH 2I5YL 4BZ1A 3K2IA 4QQUA 3QHZL 3L9EA 3O2DL 4GQ0A 3EUUA 2CUIA 2V5CA 4TQPA 3IEAA 1RI8A 1HVQA 2VISA 4X7EC 4EWJA 4FRWA 4RFOL 3MI3A 4GQ9L 4WFHE 5CCZA 1RQBA 4IU3A 4K7YA 1E4WL 1P6FA 1P0KA 4HT3A 1PS3A 3WLRA 1I85C 3G18A 1GOIA 4PSRA 3S88H 1UPMB 1EGJH 5DZAA 2ATKA 4E42A 1MOEA 1VCGA 1H3PH 4JZ5A 5I1HL 1U3YA 3SODB 3V0JA 3LDBB 3MNWB 4JFPA 1FDJA 5HDQH 4BHUA 3L4WA 4DJFA 3X3GL 1GC1H 3MLUL 4J3TA 2CBOA 5DZJA 4DN3H 2D3LA 1EZWA 4ONOA 1PY4A 3K4WA 1NFAA 1WBYB 2VRAA 4KI5C 4OIBA 2EKSB 4OFYD 1C1EH 3TNNB 1XLHA 2PYED 5CHNB 3VQ2C 3QUKB 3HJEA 5D96C 2FVKA 1LL7A 1HXJA 4TX8A 4QRBA 3HRZA 3UMNA 3LKRB 2K3HA 1M6OB 1RUML 4MKSA 2Z91A 2VFHA 3N2JA 1DEEB 4WJ5B 2P46B 4PG2C 1UWYA 5EA0H 3UXKA 3K71B 1JI1A 3VI3B 3RP1A 3D07A 2DQTH 3BLOA 1XLLA 4NZ8A 1YPZF 4JIHA 5E09A 3TEVA 2CESA 2O56A 4GGHA 4LBEB 2Y85A 3MMEA 3C6LA 1S9XA 1XLDA 1WTLA 4M43H 5ABDE 3CT2A 1F8TL 1CVRA 4XZWA 4RMQA 2NTFA 2O72A 4P8XA 2X0WA 3QCVH 1SVBA 2DQFB 2DLHA 4PRTA 4TU1A 5EMKA 1LO0L 1P5UA 5E93A 2HEJA 1FWNA 1ZHLB 2R2EA 4PS3A 2ZUSA 2C14A 4KKLD 2YD8A 4HBQA 3O6AA 5D1XC 2OOFA 1SM9A 3GVVA 2W79A 4G8TA 1H5BC 4O1BA 3C5SB 4RR4A 2EG6A 2YR3A 4WIWA 1BVKA 4HBCH 2XN9A 1O5PA 5BRZE 4QLKA 2BNRD 2C19A 3CQFA 3VNIA 2BZNA 3L7RA 3FKUS 2P8LB 3CVHA 5H8MA 4K2UL 4U49A 4KWOA 3NQCA 2WCPA 2Z4QB 1B88A 2ED8A 4R97C 5EU6A 2PR4L 4MAYD 1JCKA 4JGDA 4G5ZL 3FCPA 3SGDI 5DHMC 1XPGA 4KK6C 3T0WA 1NCHA 1UZ8A 3VXMA 4V15A 4IRZA 1PUDA 3IGLA 5IM51 2HVNA 3TK7A 1B6UA 1R3KB 3GHUA 4HKBA 3ECBA 1YCSA 4JQVA 3U0TA 5D2LB 3VD2A 1DQIA 2P26A 4KH9A 1G6RH 3AABA 2FHFA 4RX0A 1JV2B 3B3IA 3BPNB 1CF8H 3RWHB 3DCPA 4HU0A 2VH5L 2VEPA 1MZHA 3P4NB 4B91A 2J1KA 3O11A 1G7LB 4PYSA 4HX1B 4PJAA 4XO7A 3IFOA 1SF5A 1BBDH 5FWRA 1KM5A 4ZSOB 5DS2A 2JLLA 2WTOA 4JX5A 3W9EB 3UH8A 3C2RA 1AQDA 4NKIL 4FX8A 4A6GA 2ZG3A 2IAAC 3LXAA 2MFNA 1YQVH 5AUMB 4CQAA 1FWJC 1P6WA 5CKGA 1X5FA 2WBWB 2NYKA 2QVHA 3RUGB 1E5NA 3TIMA 4YXHL 3ZZLA 3FPXA 3IKCB 5EUOA 2NUWA 2OZNA 1MUJB 5AB2A 4OLWL 3O9WB 1IGCH 5GZOA 4K8RL 2EZ0D 4P46D 3PV7A 3E8UL 1PG7W 1DQUA 3BZEB 3DMMD 5KSAA 3MUIA 1OF2A 3B05A 1QD0A 1KD0A 3N19B 3THAA 4O14A 4P2RD 4LL1A 2H26A 1LBFA 4FXKC 1X5ZA 1FG9C 4XVJL 1T2QH 3CLEL 1UENA 3SPJA 4QXVA 1T1WA 3KOXA 3LKPA 5BRBA 4PJFA 4XZBA 1CC3A 2HWZL 3R8BB 3KCWA 4GEJA 2YDQA 2Z26A 3PWLA 3BDBA 3VJ6A 1T21A 4FTDA 5DMLA 2G41A 1N7MH 2O26U 1ITXA 4ZNEE 3U9WA 1KFAH 1PV8A 3GZ3A 4PB0H 4E2VA 1LYQA 4LLMA 3UDWC 2ZPKL 1E27A 1HN1A 4B27A 4I7WA 3WBEA 4N2CA 4XPHL 3DETC 3AROA 2P8PB 1U8LA 3Q8CA 3DX6B 1S3KL 4RDBA 2WSKA 4XVUD 4BQ4A 5C71A 1J8HB 3VG0H 1OZUA 4IIBA 2QKFA 2EVIA 3T0CA 2UZYA 3GS0A 2XV6B 3WL0A 2XPGB 2C3ZA 5D1QD 1KTRL 1EXBA 5H2BB 2R29H 2V38A 3EH2A 4HEPA 4HIHA 4JFYB 4CVXB 3E49A 3KS6A 1AE6H 1Q9LA 1K8IB 4HUWA 4F66A 1U6AL 3BIBX 1A4JA 5IJVB 2F9RA 2R9HD 3EMCA 3DX7B 3DFTA 3NOEA 1NWOA 3H4FA 4I9WE 3LMJL 4NRSA 4XNUL 1PDKB 2DW5A 3FCSB 4LLUA 3TXVA 2FAUA 1WD9A 5TDNB 3SDXE 4R6UA 4MAUH 3TZVC 5HD8D 1C5BH 4C4KT 2Y5JA 3EO1B 3W71A 1AHWB 4D6HA 2M1KA 4QAMB 1OB0A 2Q8AL 3K46A 2VDPL 5LWYH 3SSGA 4L1XA 1EXUA 1BZDA 5HI4D 1FNGA 4TSCL 4FADA 1TPC1 2BLEA 2NY0C 4LUIA 4V1DD 4JPQA 1HP5A 2ZADA 2HCVA 1ZAJA 1XF4B 4PCNA 4OF6A 5ESQB 3S4SA 2RDTA 3MRHA 3ZMRA 3CHFA 4LSRH 5GGTL 3MRNA 3SGDH 3TC9A 5E4AA 4GP4B 3P0XA 2GQAA 3KHOA 3ABGA 1T5WB 2NVAA 4URIA 4M9OA 5JIMA 1CE6A 3BQUC 2VLJB 1D5MB 1O5KA 4LC8A 4H19A 3PZMA 3NSJA 3CC5B 4KKCD 3D2UB 4XUGA 3ATFA 2CKRA 1ZOXA 3BZFB 4XP4H 5JZ7D 3NN8B 2R1WA 4LH8A 2P3EA 1TJHH 4LBRA 1HE8A 4PBGA 3CZJA 4TQEH 3VXUE 3TMLA 2CO2A 1W72A 2Y6TE 4J35A 4ZYKB 3D3VA 4H4NA 3TN5A 2Q02A 2Y7FA 2ZXWB 3WJMB 4ELMA 4O1DA 3DFQA 3QNYB 3QIWD 2I7SA 2XA8H 3CDGB 1QW7A 2OJEB 3DG6A 4X8JA 1J6PA 4JO1L 3NJ3A 1KCUH 1KN4H 5AW1B 1JGUL 3PCYA 3MLRL 1IC4H 4NPJA 1UFGA 2Y72A 2V3DA 2VXNA 3MYOA 3EHBC 2GGHA 1MMFA 3IN2A 1PCKA 4HUUA 3W1UA 3L5JA 2AJYH 4OLYL 3WD2A 2W62A 5FDYA 4UZSA 4JL1A 1P0DA 1KTDB 1A7BA 1K7EA 1UD8A 1ONEA 1Y65A 3C8HA 1I60A 3JV4B 4EDWL 1F1GA 4Y1AB 3N42F 2HJKB 3ZYIA 4R4BA 1YYML 3EXTA 3NPVA 5HDBF 3GX9A 2F5AL 4XBKA 1JWUA 2WY3B 5C3IA 3P4MB 4J9JA 2Y88A 4R5VA 1MXDA 3WSQH 3TXAA 4MXWH 4MYWB 4P5TB 1FBAA 3B40A 5JXEC 1H7NA 3HMWL 4AYSA 2CLOA 3VI4B 2KZWA 2WBJC 4HD5A 1CXHA 3TTQA 5EOCL 3Q6FB 4KQ4L 1FO0B 4H04A 3O3BA 1DPMA 1HHGA 4LSBA 3BSHA 4WJXA 5GRUH 3V16A 1EAOA 5JQ6H 4OJEH 1CL7I 4XZNX 4R0LA 1VAHA 4ZB2A 2EDYA 5I16A 1N9PA 1QBBA 1G7UA 3G1YA 2FD6L 2BSTB 3VSUA 4DN4L 2WJ5A 5JUEH 5E5MB 4PJ5A 5JHDB 1A5FL 4LVOB 3SE8H 2J21A 1KEML 4FG2A 3UJRA 3VILA 1P2CB 4IGBD 4NN5C 4YHNB 5IVXA 1Q0XL 4X5WB 5HDOA 2P5WE 1GGIH 1EJSC 4IJ3B 1WT5C 3DXAA 3JYBA 2BS71 3PZIA 3FN0L 3MACH 1K8DA 3EA2A 2FL5A 1FG2B 4XNMA 5KBMA 4XOCA 5C09D 5ITFB 2DBLL 3HNSH 2Z29A 3N85H 3APFA 5IBUB 1K9DA 4J2PA 2R2BB 1XGEA 3OGRA 3IK2A 1HTYA 3IDNB 5DVMA 4D6FA 1A1OB 1DO6A 5ACLA 3Q1SL 3S98A 3UBHA 5LHFA 3T3PF 3RTQC 3ZJKA 4O2EA 5FW6A 4PTTB 1XVSA 1CGWA 3MRBA 4JKPL 3ARYA 1S9VA 2F74B 2W65A 4DNHA 2AXJA 4F0SA 2ZYSA 3Q5YA 4Z6AT 3MVTA 3WAJA 1QASA 2FTAA 3AREB 2LVCA 3C56A 1K7FA 4UQDA 4IPIA 3IXTB 4HZAA 1JRCA 1E6XM 4TNVK 1OL0A 4EJ1C 1VFMA 5HNRA 4CUCA 3EA3A 4UUJA 4XN7A 5EMLA 1PO9A 4JFOB 1W37A 1CDJA 1A9BB 3SY5A 3CN1A 4JRYA 3M88A 3TWCL 1S2VA 3FK3A 3TVMB 3TQPA 1HHJB 4K5LA 5JVLA 5ID0B 1BVLB 1TMCB 1KJ2L 3I3BA 1WK0A 3TA4D 4KV5E 4ZX5A 3PDGA 2CLLA 1U3HC 1EP3A 4GK8A 3OHIA 3CCHB 5ESVB 3WQGA 3QAQA 2HVJB 2HJFB 3M0XA 4Z7WF 4EIGB 3I68A 3PWNA 3H85A 4YHML 1IUZA 5FOJA 4QHNA 4DP4X 4YHKH 5IUCA 4RGNE 2VI0A 4ZTPL 3N9GH 3NAAL 2VDRL 4FLOA 4ODHH 4TV3A 4KEUA 1S5MA 4S2BA 3CUJA 3B2XA 2C9RA 4M6QA 4AQZA 3U9PL 2F5BH 3A4WA 1XRFA 4XO9A 1UATA 4FTVD 5BRZB 2BVQA 1TX0A 1NLBH 1M3IA 1TFVA 4PFMA 2DTMH 4E9WA 3S36L 2HT2D 1I7UA 2LU5A 1FL5A 5D8JL 4HJFA 4DM2A 4G8GD 5D7IE 4ZZKA 3UXAA 1PLCA 4Z1YA 3PBYA 3BGFB 3KPPA 4MPKA 1HQTA 5CAYB 1F7BA 1ODZA 3VI3F 3GNML 4F7PA 1U22A 4POUB 2ZAHA 3UPRB 3S3GA 3VW3L 3S37L 4IQDA 3U0PB 3GXMA 1PL3A 1IM9B 1FWHC 3L5MA 4ERAA 3AU1A 2CHZA 3G6AB 4I3SL 4MNQD 5LQBH 4ZMGA 1MFMA 3SBFA 5F1KC 1D5IH 1IBZA 3A6CL 4HPYH 3H7LA 4F0HA 3OZKA 3LZNA 2CSPA 3B43A 1PF3A 3S5LA 5H91A 3W4RA 4DF0A 3U2JA 5DMKA 3F62A 1NDMA 1ZWIA 1P4BH 3ARWA 5LNGA 2CIKA 2A7PA 3LRHA 3OAYH 2VWSA 3HU7A 4XAZA 3B34A 4Q4RA 3W24A 5C0DA 4JEGB 2Q87A 3BVWA 1TQUA 3ARZA 4APXA 3PGDA 4PRPE 4N6EA 4JQIH 3WTTA 5F89A 3WBXA 4PGEA 2J47A 1RHCA 2WQSA 4FXLA 2BHYA 4BM7A 3NZQA 3VXTA 4MMZB 4CGUB 2KZ1B 4FFVC 3FSOA 2Y7LA 4BF9A 1OCRB 2X5PA 3UO1H 1UQSA 4B7LA 5I19L 3TA3D 4XQ6A 1IV8A 4UQ2B 1U91A 3MRQA 4U10A 4WJEA 3EXSA 5MHBA 5IMKB 3DLQR 3QF0A 2ZWYA 1SJEB 5DJ6B 3A4DA 2Z3FA 3HC4H 1KLGB 1F3EA 1MHEA 3PHQA 4U7MA 1MI5D 3KW7A 5FV1L 5DK3A 4BFIA 4FQPA 5JBFA 3DTXB 1UP3A 4L3CA 4ISVA 2VJXA 3PLYA 4NJAL 3P3RA 4IIFA 4NG3A 1C5DB 5SWZD 1E0XA 4PS7A 4D9LH 1KC5L 2H8PA 3BUYB 3LEVH 1OT4A 4GIYA 5DWUL 3ILPB 2OXGA 1NAMA 5KJRL 2G37A 1OTTD 3MS8A 1KOAA 3T04D 3IS4A 2DIBA 3I10A 2Z9TA 2FBJL 1D7DA 3HE6A 3PDOB 4JYFA 5EO0B 1MO0A 1Q63A 1ZVHA 3EJUA 3AXHA 3E0FA 1S4IA 1NAKH 3K72A 2OFQA 2HMIC 1A1MB 4OFKA 4N2LA 1JCYA 5AYBA 4MMWA 5LBSL 4H8HA 1A8ZA 4JTAA 4C6FA 3U1PA 3NXFA 3SDXB 1PZSA 4AT6B 4U6HB 4AX6A 1S9WB 3AFLA 4ZMYA 5I8KL 5DZPA 1AP2B 3M5VA 1WHPA 4KT2A 1ONQA 4CKVX 3L3GA 4CNNA 5KYXB 5TE7L 4F57H 1CJYA 4MCMA 4AU0A 3IU3B 3N0AA 1UH4A 5DMJB 4HK5A 4Z2LA 3VX1A 1A02N 4U1NA 3NJMA 4KTEL 4I5XA 4ODVL 1VRXA 3MV7E 2Q2LA 3NZ8A 1KTBA 2J88H 4EZLA 4DWHA 1E6QM 3E1F1 3R89A 1YBQA 3BDXA 1N70A 4B2DA 2FYVA 2WKGA 5A6JA 2DI7A 6PCYA 4Y8DC 5M94B 4A4AA 1A64A 3QHFL 5I5IA 3TGXA 2AXGB 4X6BB 1X7QA 1ISVA 1GOKA 4N5ED 2J7GA 4WK0B 1QNOA 1AKJB 3GMOA 2H8ZA 2E7MA 4PJ7E 4KGLA 3BD5A 1H0IA 3H6JA 3BAJA 3F7LA 1JAKA 3WZ0E 1KF9B 1XB6A 1BFVL 1OPGL 1ASPA 1I4FB 4DVBB 4IMKC 3IM1A 5FYKH 2XJKA 3GFYA 3GMMA 1ZGLP 2F0CA 1DVFD 3OJDA 4GXMA 5C9XA 1ZNNA 5EBWA 4OD1H 4MPQA 3OKLA 4HWBA 3RHGA 2VR5A 3TSMA 3VXUB 3QAZB 5AW2B 1SY6A 1NQBA 4X0VA 4MBOA 4MM1A 1MHPL 3QXAB 1QNIA 3ARFB 1NQ6A 2CKSA 2J1WA 4N9CA 3QQWA 3WHXA 5C54A 4S1SH 5EUKA 4OLZH 1NIUA 1GH7A 3FOLA 4R7DA 3HG1B 1T0MA 5IXEA 2P44B 4S3GA 3FGCA 1XYMA 3D0CA 3H3BC 5DELA 3WNPA 1PNDA 4PY7B 1W3TA 4CMMA 4Y2LA 3WELA 5FYJD 1FHUA 3AYVA 3LTSA 1TTAA 5J13C 3QRGH 2BXYA 3FK4A 1OVDA 2X1OA 3T65B 1BW8A 3WIAA 3FQNB 4OCWH 2FT8A 4OFYA 1QMLA 2PYEA 5D9NA 3KOWA 1JI2A 4LAMA 1MG3C 3GW0A 1FH7A 1MCQA 2WLLA 1K2DB 1C5CL 1B30A 5EOCH 1KPUA 4YFLI 2NY4D 4PJHA 3CFDA 2FJKA 5DZLA 4JCWA 2YUWA 3QBUA 4HKXA 3N9KA 3QUMA 3SKOB 3LN3A 2Y5EA 1MJ7H 4UNTA 3F4VA 1N64H 3B5HA 5A6SA 3LLFA 4U1MA 4ZFCA 3QK0A 4F7MA 3ESMA 4E9XA 1HOCB 2ZRYA 3ONCA 3TA9A 3SY0A 3OC8A 7XIMA 4KDVA 4NQSA 4K7PL 1HXMA 3ZRSA 1DBJH 5I3GA 3BANA 3KDOA 1GRWA 3HB9A 1R9ZA 4GNVA 5ILTL 4JEQA 2HJPA 2RQ8A 3DFHA 4PMFA 3HIZA 3AIQA 3AO0A 3KAAA 3P40A 1S5IH 1GYWA 3JT2A 4OGXL 3DSNA 3V0VB 4PQXA 3KPSD 2PP9A 5A3HA 3PJSB 4P8VA 2BNRA 3BHBB 2BK8A 3RU8H 2DZPA 4C56D 2FJFA 1W1YA 1OCCB 2EDNA 2P5WB 1HSAB 4JFSA 1G7PA 1ZLDA 3HRPA 3OPSA 1UFUA 4ELKA 1KBWA 1GJWA 3CN2A 5C2BH 4MAYA 1W91A 1WAPA 1YMYA 4B9PA 2UZIL 3FTGB 1W5MA 3SCUA 4LC6A 3QA3B 1R9XA 4ZQOA 4DBDA 2I17A 1FL3A 1ZT1B 4BXSV 1O68A 2XVLA 3C0SA 1XMEB 1OLLA 2J5LC 4HGKC 4ZSTA 4M5PA 1N6QH 3CU1A 3EKZA 4WI0B 3MI2A 5EBUA 1T0PB 1J12A 1WV2A 3SCWA 1EPXA 3HHSA 1R5WB 5HR6A 3MFFB 3WDHA 3VI2A 4OZFG 2PP1A 5G5DB 1A5LC 3MGOB 2IH3A 1LM8V 4LUTB 4LY4A 3TQ0A 3VRLF 1PVHA 3K5SA 1Q7ZA 3NO3A 4RNJA 3BKJH 1F4WH 1ZEAH 1O7DC 1LE9A 3NEOA 3VYPA 4NFCA 1N2RB 3LXUX 4XC3H 2AABL 1ND0A 2XTSA 4UU9B 4LLVA 3VFOA 1P7HL 4YN5A 4LB3A 4U2ZA 2ITEA 2V9UA 2OX5A 4OBTA 3CPGA 5HUOA 3KYNA 1GXEA 3GNXA 3BXNA 3CQHA 2W67A 1DVTA 3OZMA 1XCTB 4EF3A 4ZTPH 1K4CA 1HOEA 4H40A 3T4CA 4DUVA 4AZGA 2EUVA 3DMMA 2Z8SA 3HVNA 4LPTA 2YAEA 3SDCD 4P2RA 4FQCH 1X5KA 3LN4B 3S88L 1K9EA 1EGJL 1SW0A 1H3PL 3VAVA 4DP6X 4P23B 4RGNB 4R7VA 1JZDC 2DSWA 5HDQL 3OX8B 4HGWA 1EJRC 4QHKJ 3WIFA 3BP4A 1GC1L 3GBEA 3NSDA 4YJZL 4ZRGA 4AUYA 2BJMH 4DN3L 4MBRA 3KYOB 5HGBB 4PRWA 1MY7A 3FFCD 5IM7A 4MYXA 3WUEA 3N1FC 4XMXA 5CC6A 1J1OH 3TBVA 3MGTA 3HR5A 5D7IB 4Z7AA 5C8JB 3LB6C 4M00A 1SUXA 3IAGC 4DPQA 3WLQA 5EA0L 1CFTA 3IJQA 2ZOOA 5DS1A 2DQTL 4IT1A 5C0AA 6CGTA 5D1QA 5MHSE 2YZ1A 2A2IA 1X9LA 4DAFA 4M43L 5D32A 4FL4B 4WO4C 2XQYG 2O55A 4OVXA 3FRPG 1WKDA 2GAZA 3QCVL 5AOJA 1HJBC 1BQHA 3Q8BA 1CDCA 4GBXB 1GQLA 1VFAB 3WO4B 2VC5A 5CBJA 3GTVA 4WKFA 4BEIA 3TZNA 3VWJB 4ZOEA 3NDOA 4RZ4A 4G7YH 2AANA 1NBYA 3MYJA 4GKZA 1N18A 4N2GA 2PDMA 1SLXA 5HYIA 4PR5A 1AS6A 4FPSA 4HBCL 5F7FA 1MQPA 1M9SA 3I6GA 4F40A 4KIEA 4V1DA 2V5YA 1UQYA 2AEWA 1T89A 1UMYA 1Y0LB 4H9ZA 4PRPB 2PD9A 3PZUA 5CPNA 2A3HA 2FB3A 4ECLA 3F6JA 3D30A 4BKLA 4R2GD 4Q2ZA 4YSEA 1QUNB 2DJLA 4KO7A 2BVUA 4NNAA 5AC6A 4QI3A 4M8QA 5BOFA 3ZZ1A 3NJLA 2IAMD 4GB9A 1AMYA 5A6AA 4ANKA 3FQUB 1G6RL 3H2AA 1AQMA 2VDQH 1H41A 4FN0A 2O61A 5EC1B 5GS1C 1L2UA 1CF8L 3LKSA 1CB4A 3F2CA 4AZ7A 3KCJA 3HC3H 2WQVA 1D7FA 3MKCA 3ESUF 4LCUB 5CIPA 4ZUTB 2ITDB 4GFXA 2LE9A 3UGUA 1EDGA 2Z31C 4OVVA 5T9BG 3TX4A 3X14A 1C8XA 1O5RA 3QIWA 5GGRA 3R4IA 2C3WA 1YQVL 5E0KA 3DYMA 1EXHA 2AITA 3EF7A 4R96B 3HHMA 1S7UA 4CNOA 2IDSA 1DL3A 3CPRA 2UXVA 1CT8B 4OV4A 4U1SB 2MCG1 4RXGA 1SNRA 1IGCL 4C90A 1Y7VA 5JPMB 5ANMA 3WQVA 3V7PA 3SADA 4FC3E 4CD4A 2YL6A 3WK0A 1QVOB 1T2QL 2ZCGA 4EPDC 3KCPA 3E6FA 1QNZH 4KK8C 3CPLA 2GT9B 5B1BB 5BV7B 4H7CA 1SO5A 2DDQH 3MBED 3H7RA 3Q45A 4LGPB 3TFXA 3OW1A 4XIMA 3CN0A 2VN6A 1E71M 3DUGA 3U9UB 4QP0A 3CUZA 2AQQA 1KFAL 4YGVB 4PB0L 5ESAB 3WLSA 2C1HA 1ZSXA 3MV7B 4XCNA 5EG6C 5J6HB 4QRRD 4E8CA 2X2UA 5EC2B 1FWGC 2BDQA 1QOPA 2OK0H 5BCAA 4UQIM 3QH3A 3F4CA 4XWOC 3VG0L 2CPCA 4YTUA 5CM1A 2IWEA 1RZGA 1US3A 1YJDH 3FT0A 3TT3H 1VESA 3HMJG 5AHLA 1QRKA 5HHOD 2R29L 1V05A 3VFMA 1U93A 5KJ7E 1AE6L 1ZS2A 3T2NH 2B7DT 3HJZA 1F9CA 2WSRA 4IGBA 4KIRA 1U4EA 1KYAA 3TW6A 1N5YH 4KJYA 1QTWA 2OMAA 3MCYA 3V55A 3VVWA 2VB5A 1AR2A 3NJGA 1K3ZA 1CO1A 3FMGL 4MAUL 5GGRY 1SDAB 4HIXH 1BYOA 3SDXF 3LS5H 4ZAKB 2C3VB 1C5BL 3BOVA 5KG9A 4DESA 2BOEX 2RH9A 2ZNXA 1MZYA 3CFJB 4B9FA 4AQ8C 2VGFA 1PCWA 2RGSA 1TLMA 4NN7B 4X6DA 5LNDA 5LWYL 5C09A 2VLJE 4GC3A 4W4OA 2WGXA 1ETA1 4O8AA 4HNUA 2I14A 3KYMB 4JQ4A 1SGKA 1URLA 3TBSA 1H61A 4G56A 4LSRL 3G1AA 4W87A 2WNGA 4O2CA 1BOYA 4BQ8A 1HYSC 3F2BA 4ANWA 1J9QA 2UZ9A 2V9QA 3DOIA 2EF9A 3C61A 1MFAH 2PGEA 4IRJD 3V7AE 4AM0Q 4H5SB 1IEQA 3VGGA 5EU9A 3QJSB 4MD4A 2OYLA 1DV7A 2GJZA 4GOSA 3L3HA 4XP4L 4JPGA 3Q8FA 5I8OH 5DUBA 4LHJB 4JS7A 1TJHL 5KVGE 2IS7A 2UXTA 3RDTD 1F3RB 1JRHH 3NZGA 1FZKA 1E43A 5B8CA 1QSVA 4TLTA 3D25A 1SW7A 3HE7B 2YGNA 1AGEB 3GW3A 3B7UX 3QMTA 5D02A 3DGBA 1PQZB 4Z7IA 2Y7GA 2QPXA 1WAWA 3BZ4B 2CLFA 5J5EA 1J05B 2XA8L 3U2SA 1E2WA 3VYOA 1B3ZA 3WQCA 1FIEA 4BA8A 1KCUL 1R5YA 4QMEA 1KN4L 2DSKA 1IC4L 5D7KD 3EW3B 4YFEA 5A6KA 4JB9H 2Y5QA 3FQ1A 3GG1A 3GFZA 1N8WA 1XBZA 4MHHG 2AJYL 3FJLA 2Y1YA 1E4KC 1JXJA 3KLSA 4NQCD 2V81A 1CGYA 2VMEA 3L48A 2I5IA 1T5XB 1T4KB 1ZCCA 4E0RB 4FTVA 4CBZA 1S8DA 1MCRA 3ITXA 4W9FC 3R8GA 4D0DA 1GG0A 3U5YA 4D9RD 4V1XA 3GNDA 1AL8A 2IXQA 2FJHA 3JW7A 4G8GA 4EKXA 1NWSA 2VSKB 4XMWA 4AYID 4NRYA 5GGTA 3CBJB 3WEMA 4BK5C 5E95B 3FJNA 1JYVA 3CQIA 2OODA 4ABQA 3WSQL 4MXWL 3QIUD 1P1ZB 5J04A 3L13A 3VXGA 4URKA 1S7QB 4AK2A 4X6CE 5C0EB 1KJVA 3VUAA 2QKSA 1OIMA 4ORGB 1RIVH 3FV9A 3M41A 3DZ1A 3SW6A 2V6HA 3LRSB 2HSAA 3Q4DA 1DIDA 1X1NA 3PWGA 2V5RA 3SYOA 5GRUL 4LLWA 5JQ6L 4MNQA 3GSRA 1I8IA 1RZPA 5FF3A 2A9DA 5I82A 4LEBA 4C4KO 1ICSA 4XSMA 3FDWA 4DZ8A 2K6YA 1TJMA 4HLZH 3F12B 4UFIA 5KS9E 1JHTA 1WJ3A 2EDRA 4PUNA 1LQ0A 5JUEL 1DN0A 4LARH 5U7SA 4F8NA 3ARRA 1NCCH 2WMPA 3SE8L 3DUUB 1EFQA 3V10A 1RZIA 3VCLA 4CD5A 5MERB 1SQ2N 1AGCB 2WZAA 4LGRB 5B4MC 4G83A 1YEDB 1GGIL 2ZWZA 4GJ1A 4X0NA 2ADGB 3DI3B 3B7TA 2IPTH 4Y2WA 3GXUB 3EX1A 2FCBA 5A2IH 3VU2A 1XSIA 3LPOA 4UNIA 5CPOA 3MACL 4L8BA 4QD2E 1O6IA 5EIVA 3P0YH 4M4RB 5KBKA 3HZYA 3L1OH 2X4QA 3HNSL 3N85L 1DUYB 1OE3A 4WFED 3CUXA 3M0ZA 3CMJA 3TA3A 4HJ0C 1BBJA 2DY2A 4Q74A 1Z66A 1EDHA 3KLHC 4C1NB 5F97E 1QPXA 4X83A 3MO4A 2CJTA 5I77A 4PJ8B 3OIHA 5I03A 3PYCA 3VD5A 3S9ZA 1R38A 4IMDA 5ICUA 3MNZB 1R24B 3RB7A 1BAWA 1MI5A 5IHSA 1EBHA 2NX3A 1EZVY 2LOEA 4KPHH 1MQ8A 4HHAB 1HFBA 1SQMA 3KPLB 3ALPA 1XIMA 4DY1A 4GQGA 5CQ1A 3JVAA 5SWZA 2HRPH 3L21A 1GHRA 3H6OA 5T1DH 5TH2B 4FA3A 5DJYB 4U6YB 2V7NB 3O9NA 1NDYA 3QQ9C 1QYGH 4BI7A 3UGVA 4QPEA 3P9LA 3LN5A 1OFBA 1JYWA 2J6VA 2ICEB 1HCYA 2IBBA 5CP7B 3KPMA 2QZQA 3NVTA 4JFXB 2CWXA 1ZVYA 5BXTA 3EF4A 4KV5F 2DUXA 3PFRA 2QGDA 2DVTA 4H3DA 1KXTB 2F08A 3WE6A 4LX4A 3PJNA 1PZ5B 3FC8A 3WIIH 2OAAA 2BSSA 3CUIA 1PYMA 3CUFA 2Z4GA 4HVBA 3I4EA 4YHKL 2CBIA 3C2FA 3N9GL 3PUCA 5HGHB 4XHJC 4ODHL 1G0YR 3AXLA 2EXTA 4NPYB 4FEZA 3RLSA 4LPUA 4B5NA 2F5BL 1RURH 1MXGA 3NEHA 5TIMA 3FO2A 4UTTC 1NLBL 2PYFB 5AVQB 2DTML 4IUOA 5EEZA 2BSRA 1QZNA 4A3QA 4DI9A 3VMPA 4U1IA 2A6JA 1DR9A 1YIXA 4XZUA 4AGLA 1N3NB 3SKNA 4GSUA 4YC2B 2XVKA 5FF2A 3ECWA 1FWCC 1J5SA 4QM1A 4CQ9A 4LXFA 3VMNA 8FABA 4MJ6A 3WLPA 2DKUA 2G75B 3B2UC 2E7BA 3V5KB 2VFEA 1OGTA 4LB8A 3TASA 1U3ZA 2BNUB 3ASNB 1LUCB 4MA3A 5AZ0A 3SJVE 4EUPA 3B2DC 2NWSA 4RPPA 1FRBA 4AH2A 2HT3D 3MLYH 2UXFA 1DVFA 2VXQA 5DRWB 3G04B 3VNLA 4LGSB 5F96H 5AW6B 5LQBL 3PQYD 1CL7L 4KROD 1D5IL 1E9OA 3PV6A 4HPYL 3G22A 4MWAC 3HZVB 3F2LA 2A6LA 4W85A 4XN2A 1ONRA 2X1XR 2VC2B 5F1IB 4LKXA 4DKAA 1KJ2A 4E9RA 4QRTB 2FZ3B 1VIWA 4PV8A 1H50A 3D5HA 5AW0B 3D9AH 3PY9A 4D94A 1NCAH 1X5AA 1DWFM 3GSNA 3E7JA 1QLRA 1P4BL 3APYA 5DDHA 4PMXA 3OO2A 1WCQA 2BOBB 3AWFA 5MEQB 1G69A 2I32A 4HIBA 1W16A 3SIZA 4B5EA 2B3IA 2OFJA 4DQOH 5A3ID 4JQIL 1LYXA 5I75B 3O41A 4US6A 2VC7A 4DRSA 2WXOA 3DWTA 1FXPA 3S5YA 1O4UA 3S0CA 2YMTA 1QU4A 2HS8A 4KJQD 3QMRA 3UO1L 5C9JB 4AQEA 3OKKB 5FB8B 1A9VA 1X7FA 2R24A 1HL8A 3WJJC 3DPBB 3REWA 5HDLA 2ZZ6A 3TH6A 3WLMA 1LP9F 3HC4L 4TX6A 3WUWB 3QC6X 4N7QA 4DGWC 3WKNA 3LENA 2NNAB 5C0AD 3WDIA 2YYUA 1GGCH 1E5CA 5DRXB 1RZJC 4JKLA 4PBWD 2A9AA 4W4NA 4FP1A 3G6JE 4TNWK 4PJGE 2XH7A 3WBDA 4GLEA 4D9LL 3OAZH 1WKFA 4DVOA 2PWDA 3LEVL 2B4CC 4QOKD 3TBYA 2OTWA 4WDUA 2CPUA 3LY0A 3ZDZB 4LUSB 1JNJA 1O94A 4LVGA 1O7SA 2KQMA 1ZLWH 3FMGH 3TT1H 1MNUH 5JU6A 1Q94A 1BXAA 4L9LA 4JANB 5GXBB 4G6AD 3HPLA 3L3IA 5EOQH 1N12A 5DX7A 1WV7T 3KPSA 5ACZA 5IW3A 2FIKB 4M1GH 3DDFA 1NAKL 4BBWA 2Z25A 4WUUE 2E6QA 4C56A 6ALDA 1Q65A 2CWRA 2OP4H 3CPUA 5D6CB 4YHPA 1D6VH 1X6LA 2HBXA 4FZEH 4GSXA 3DV4A 4ONFH 1T22A 4DJDD 4DFIA 4B3LA 4Y6GA 4ZMAT 4ATWA 4J23A 1N8ZB 3AU6A 3I6EA 3UPWA 3C2YA 1HL5A 2XQYA 2NMSA 1JZJA 4F57L 3KBPA 5LDSA 1KIRB 3EOLA 1FX6A 2WUBH 3C0JA 1F2QA 4KTYA 5E2UH 2PNDA 1GA2A 3RRQA 2CHDA 4C7DA 4NYLB 2F38A 4N2IA 2J88L 4LOUC 3B6SA 2BOGX 2ARJQ 1TREA 5PCYA 2UY7B 1NFDA 4AZ8B 2K1MA 5ECVA 4EZKA 1BQRA 3QZBA 1CVSC 3GZPA 1KBGH 4P7NA 4L64A 1KB3A 1XF2B 4H8PA 3DENA 4DP0X 4KRPD 3BC9A 2XV3A 2YBRB 1T83A 2Z6IA 1FZJA 1NWTA 4WKZA 2WYIA 2NXYB 4PJ7F 6TIMA 5G4WA 3ZL1A 1AJZA 4GAJH 2R15A 2V33A 5FYKL 4ZODA 4M80A 4LPCA 3N11A 3TU6A 3HG1E 1IB5A 4YPGB 4G1MB 1OP3H 4OD1L 3W1ZA 4C6LA 3R06B 1D7KA 3PUDA 1EBGA 3FULA 2OL3A 3BVUA 5TQLA 5AFAA 3AAZA 2BXZA 1E6OH 4A6YA 1K6WA 4E9VA 4AENB 1D6EA 5FGBC 4KZDH 2C8NA 3CZ8A 2B3RA 1YNTB 3Q2VA 4Y4HC 1C16A 1HHHA 4FXGB 2GK0B 2P5EE 4HHGA 3VDBA 5EB9A 4WWKC 5CD3A 3GUTB 2PS2A 5KYUB 1WG3A 2UY6B 3WQ5A 4S1SL 4OLZL 1OD0A 3PWPB 4X8GA 4AYMC 1GUVA 3SDCA 4YS1A 4DWSB 1QUPA 5GRVL 2WQAA 5HXMA 2JJUA 3W70A 3BE7A 3DX1A 2TAAA 2J44A 4IFRA 5EFDA 1OGPA 1ZDSA 5BZWB 1MHCB 3GTXA 4CMHC 3QRGL 1QAWA 5A2AA 3FFCA 4QR6A 3NIGE 3UWZA 4OCWL 2Q7AA 1XR8A 3U5UA 1XRVA 3T9WA 1F3XA 4YHYC 4S2SB 1KSRA 1I4NA 5HQLA 3ZIMA 2KZHA 4W1TA 2WW8A 3NO5A 3PRZA 3D0VB 2YGQA 1ILSA 4NXSA 4J40A 5AAMA 3K6SA 3JYCA 3W1RA 1XBRA 2WXNA 4GS7C 1YYCA 3CLWA 2CZVA 3CH8A 5IB4A 1MJ7L 3C6SB 1UR4A 5FO8B 1N64L 1WBZA 4TNWF 4WSGA 4X6CB 2W4XA 5D4JA 2OGJA 3L5XL 1ZT4A 5HYFA 2OMZB 4X4ME 4YBQD 3TOPA 4H1LB 1NGXB 4TV5A 4JFTA 2PDHA 3WDJA 1W3KA 4PP2B 1MXSA 3HPJB 3DBNA 4RSYA 4G6FB 1MDAA 4NQQA 1ME8A 1DBJL 4IJBA 3B4UA 4XN5A 2JKTM 2JKRM 2Z8RA 3KS5A 2COQA 2OSLA 3QUZC 2W1NA 4A39A 4K8RD 1OQXA 1S5IL 2AMGA 1HH6A 5KS9B 1M6UA 4MZ8A 4O8RA 2GHWB 1PNCA 4G42B 1P84K 5CLWA 6REQA 4K9JA 5T3ZH 3G5YA 2H9AA 3FTYA 3RU8L 4QG9A 1ZA3B 2H8XA 2CO6B 4IMGA 1P5VB 3QJVB 3B9KA 4GC4A 2HG5B 2CK0H 4DF2A 3G7TA 5IR1A 3WUBA 1BPVA 1JPHA 3N4FA 5C2BL 4NRZA 5IB5B 3NACH 2DPEA 2L04A 2GGJA 4YDZA 1UKQA 3NGBC 2H3NA 1AXTH 4N0UA 4EVNA 1NIFA 1DYZA 3UMTA 4Q22A 3ARGC 2F7FA 2Y6SD 4G1EB 3X3FH 5FEWA 1DHKA 2VKXA 3O1NA 5AQ0A 1N6QL 1XLBA 2IAMA 4TUKL 4R9OA 3FOMA 4OM1H 3BP6B 2OI9C 2YAMA 4HOZA 2KDGA 3ZL2A 5L9DH 3P30H 2ZZUT 2H1XA 1SF3A 2HVMA 4E2DA 4E5TA 3FQRA 2QHLA 4PM1A 4S2CA 3BKJL 1W5QA 1F4WL 1ZEAL 4N90E 3WBWA 1S9KC 2OWXA 3LD8C 1W32A 2WZ6A 4AEFA 2PFHA 4AEEA 3KZPA 3V36A 5CP3A 2QV4A 1VKXB 2XXMB 4XC3L 5C6MA 2R39A 2WXIA 1DLFH 2CLRB 2XUCA 4AWUA 2ITFA 1GZQB 1WAAA 2VKWA 1KM2A 4GVHA 2GGEA 3VGEA 1BCIA 3PFQA 3ZOAA 2GEQA 2K4WA 2NT1A 4RGMB 4KH2A 1M1XB 3Q7JA 4U1LA 2FEDC 1TG7A 5EZOH 2VT0A 3GSXA 4I9JA 1ACXA 5C0IA 2V8LA 5DHYA 4BIKA 1L2QA 3PNWB 1KFWA 3M17B 2J6WA 4FQCL 2QIIA 5J6GA 1BZ7B 3H9SD 2OW7A 4UFLA 2HXTA 2CE6A 4M0XA 2NUYA 3U4FA 4MVBD 1SJBA 1IEBB 3UTQB 2A6KA 5I8CB 2Y5SA 2R0KH 1LE5A 2YPKB 5D2YA 1OARH 1FFPA 4NBZB 1P5BA 3RVWC 2BJML 3MBEA 2GTZA 4HJTA 2VR4A 2JCCE 1D7CA 3OLDA 4KFPA 5HPOA 3V4VA 3H7UA 1YRKA 3W11D 3Q2DA 2XTJE 3HS0B 1IMHC 4BFBD 4WEMB 3QRLA 3LX9A 4JTUA 2EC9T 1J1OL 3L9RB 3DRQB 1FPTH 4QRRA 4XZ9A 2VZ3A 3QVAA 3MT1A 2ZF9A 2NQHA 2GI0A 2NX9A 2CUAA 2FHCA 2XG4A 3NK4A 3FH5A 3HAEH 3QIBC 5FO9A 1CL7H 1HKFA 5I26A 4RK8A 3CZGA 3MDUA 2NXIA 2B0MA 4ZXLA 4NKCA 2ZZ7A 1S7SA 4ECNA 3GZQA 1GS8A 5CU5A 1SQ7A 2DEPA 1A4CA 3VIJA 4E4PA 5HHOA 3VZYA 5CFAA 3O8AA 1LO4H 5E8EB 3N91A 5LIYX 1S7VA 1CTMA 3SJVB 3P93A 1ZBCA 4NHUB 4UCGA 2PBGA 3GH4A 2PTYA 2EO9A 1ZHBB 2C1PA 4XH2A 5AAWA 3NDZE 4G7YL 1C90A 2XUWA 1E30A 2WO3B 3IXAA 4ZQMA 4TIMA 4GI9A 4ZW8A 4ODWB 5EZLB 3SR7A 2YZ5A 3UBPC 2DMBA 5GS0H 2V6AA 4H6KA 5I0ZA 3NIFE 4MJ5B 3CN4A 4RFEB 3Q06A 1UGNA 4HIJB 4PRNB 2NY6B 3ULSB 1G9EA 4UIOA 2A0LD 4NP9A 4WEVX 5I28A 4C4UA 2J9YA 2NLIA 5HNUA 4OTXH 1FHVA 4B92A 1ZLVH 5ERWB 1U95B 1EL3A 4JTKA 5B39G 3OZ9H 2EDQA 1XH3B 1M7IA 4R7XA 5D2LF 5BVJA 4O2FA 5FECA 1HZKA 4X5XA 1OC5A 3QWOA 1VFLA 4U1GB 1VRDA 2ZDSA 1LORA 1ONXA 1U58A 2VX6A 1E0OB 4MLJA 4C7FA 4IRJA 4TNVF 5H4YA 2P1FA 3LQLA 3VFUA 4AD5A 2PU0A 4G1KA 4DW2H 5ABFA 5DCDA 3GPEA 1RSCA 1L9RA 1NLDH 5C3TA 5DD3H 2VDQL 2H6RA 2FTYA 3WY4A 4GQZA 3QXDB 3DX9A 3KD4A 3IJYA 5E24E 1TV2A 1J6OA 4K07A 4KNUA 3RDTA 1JBJA 3HC3L 1RJZA 2HVKA 1BGXH 4XD6A 3RUGF 4H4IA 3ETBJ 1M7DA 1TQTA 1LK2B 3T3ME 3JTBA 4Y5XC 5JBEA 3Q2WA 3WEOA 3TEWA 1SSDA 3NK3A 2FVLA 3D7PA 3G6JB 1G0CA 4PJGB 4FXRA 3V79C 2H2PD 4MSSA 5MEPA 3KGUA 5CEZH 4O5LH 1INQA 2HNEA 3FYYA 1XM3A 2OPCA 4OW6A 1DL7H 3EYOA 4QEGA 5D1ZD 4TULH 3TH2T 1WFJA 4JZJA 3V5HA 1Q2SA 3MR9B 5DEFB 3AACA 4NQCA 5J9PA 1JNEA 4OTKA 2C1OA 2QGBA 4WUUB 3C60C 1E3ZA 3CHCA 3K6DA 4HIIB 1TQCC 4IMCA 4YVVA 2VDMH 4O11A 2B14A 1QNZL 2V0AA 3QV7A 4U4MA 5AVRB 2YLLA 3VKCA 3OHXC 5FL0A 4LEXH 3CHPA 4JOMA 1KJMB 3BOXA 2DDQL 2ICCA 3TC3A 2OMNA 1VENA 4BXVA 4A68A 3WJSA 3QIUA 1V3MA 5DI8B 1BQUA 5JHBA 1CZ8H 5L2JB 2FZ9A 1XLKA 5JBDA 1B5TA 4JZOB 4JTDA 3BEVB 2FH8A 3CQQA 3TQKA 2JEQA 4PJDE 4U31A 2F15A 4Y4KB 1IARB 5K1NA 4AD4A 1CU4H 4QAIA 4L1BA 4XAKD 5KN5A 1Q66A 2Q9OA 2OK0L 1J0IA 1YW1A 2XWXA 2ACRA 2SEBA 4JXCA 3LHAA 1YJDL 3JUGA 4PU2A 3TT3L 5T1KD 2IXUA 2NQJA 3WNKA 3EJCA 2Y5TB 3HR6A 3T2NL 4O4VA 2OQLA 3SD2A 1MFEH 1UKPA 1RHHA 3W53A 3R1GL 2EDBA 4CCEA 4MDJB 3DO7B 4HUNB 1XIJA 2PGFA 1N5YL 1NOFA 4M51A 3OR6B 3GAYA 3RZCD 4NAEA 1VLWA 3K30A 4O4WA 4HIXL 3HFFA 2XY2A 3LS5L 3LCHA 2P5EB 2H32H 3LQZA 2E67A 1TYJA 3GS7A 2MNJB 3O2LA 5IV2B 4O00A 3O8XC 5HYSB 4S1DD 4K8EA 1EAPA 5D4QA 4X2RA 4PTVA 2BIIA 5DFWH 1TZIB 3BPLC 4ZUUA 3JV0A 2EADA 3QUXD 3G5ZA 4NQUA 2DEYX 4IHCA 2MPVA 3HOGA 4HAKA 1CDGA 4XUYA 3KDPB 1CD0A 2K4AA 4Q8BA 1BRLA 3H2PA 2E6AA 1CBVH 3QHOA 3NIGB 3KDMB 3D50A 4ODSH 2EKCA 1MFAL 3BICA 2FJGA 4L4JA 1GTNA 1GCYA 3L5XH 5IB3A 3GBMH 3MRRB 4WNQA 4YTTA 2Y69B 5I6NA 1FVDA 3NG3A 5I8OL 4DNMA 3LTVA 3VRIB 1XS2A 1ZD6A 1KGWA 3V4PB 1KELH 4YMPA 2WAQA 3RPIA 4KITB 1JRHL 4UI2A 2NYYD 2A74A 2HTKC 1SJVA 4PRID