1U2YA

In situ extension as an approach for identifying novel alpha-amylase inhibitors, structure containing d-gluconhydroximo-1,5-lactam
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title In Situ Extension as an Approach for Identifying Novel alpha-Amylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 179
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1u2yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1u2yA01
3D51A 2X2JA 2XVPA 3AICA 1EHAA 2AOSA 4AZIA 3O9NA 2BHYA 3VIGA 1PX4A 3AIRA 3EYPA 5HOSA 4H8HA 4WJXA 3SUVA 3M07A 3AIUA 1JFXA 2ZWYA 1E71M 2IXUA 1TMQA 2Y4SA 2DDXA 2G41A 3WUGA 3WH6A 1QOXA 3G6LA 4BQ3A 1HP5A 3GNOA 4B3LA 4GZJA 4F8XA 1PEZA 1V3KA 4H41A 3MSGA 2GSJA 1DP0A 4OBSA 2XSAA 2UY2A 1E73M 1UOKA 4LYRA 2V3GA 2VRKA 3ZJ6A 3OG2A 2BY0A 4UQEA 3AZTA 3ZJ8A 2J4GA 1RP9A 3WDHA 3CHFA 2XYLA 4AY1A 2YL5A 2XN2A 3OGRA 1UQYA 4AZHA 3PZTA 5CLWA 4Z2LA 1QHZA 5GQBA 3VGDA 3BC9A 3UG5A 1OD0A 3WNMA 1XV8A 3CMGA 2C7FA 3ARXA 3AYSA 4UFHA 1F4AA 2WHJA 3U5UA 1K9FA 3THDA 3II1A 5A6JA 3H53A 2V5DA 1QNOA 3NDYA 3CMJA 3ZJKA 4WKAA 3RCNA 1AMYA 3MUY1 3GXTA 1WZKA 4RE2A 3WNNA 1DWJM 3L4YA 3U7BA 1JXJA 4BF7A 3WDIA 2ZUWA 2E4TA 4HA3A 1M53A 2YFOA 1WPCA 4UFIA 3HG2A 1GOQA 4BA0A 2WCAA 4BZYA 3BAWA 2YDSA 4E8DA 3RILA 4W8LA 3AIEA 1WE5A 1CXKA 5A6SA 1V3LA 2ZUNA 1R8LA 1KTBA 1HT6A 3VGBA 3ZMRA 2D22A 1D7FA 1C8QA 1JIBA 1UD3A 1GOKA 1V0KA 1ESWA 3WNKA 4M56A 2J7GA 1K9TA 3NDZA 3PHAA 2PWGA 3AMDA 5I5RA 3WDQA 3U7VA 1R86A 4OJYA 2WAGA 2WANA 4CD7A 2XFFA 2ZWZA 5IDIA 3AHTA 3CZJA 4UQBA 3ARZA 2GJXB 2YDRA 1TFVA 4D6HA 2GDVA 4UFKA 2OWWA 4TX6A 4OOUA 1IT0A 1ZS2A 2ZUVA 4FNQA 1E5NA 3GH5A 2F7OA 2J8FA 3GTNA 5CGMA 3UG4A 5D9OA 4AD5A 5BXSA 4PMYA 1W2VA 2WVVB 4Z2KA 1JZ7A 3SCOA 5EBAA 4QFUA 3W6MA 4DM1A 4N0RA 4L4PA 7A3HA 4UOQA 3KLLA 2CXGA 3IANA 1NM9A 3MV11 1CXFA 3OB8A 1CGTA 3IJ7A 3WY4A 1UR8A 4PUEA 3K8MA 4UNIA 4QCFA 5ABGA 1ISYA 1VJSA 4PRWA 3ARSA 2J62A 3BSGA 1KGXA 5HNNA 1BG4A 3TA9A 5LA0A 3HJEA 1M04A 3ZM8A 1OGGA 1ZJBA 1JL8A 1XCXA 2F7RA 2NSXA 3VGEA 5IFPA 3MMWA 4FK9A 3CV5A 1JZ4A 3RM8A 1GVIA 4FLRA 1V6YA 1VEPA 4AZCB 3MS8A 4QLLA 3AOFA 4HP5A 1CEOA 3WD4A 1HKJA 1OM0A 3AFBA 4D71A 1CZ1A 4MJ2A 4DUVA 3F5JA 1KQZA 3FHAA 4RL3A 3RPMA 1TA3B 2ZIDA 1V0LA 3EBVA 4W5UA 4W85A 5I0DA 2F2HA 3KL3A 4W84A 6A3HA 1XH0A 1H4PA 4U33A 3A21A 2JALA 1H49A 3EMZA 5I78A 1WO2A 1I1WA 3GH4A 3PTKA 2VZVA 3WDPP 4GQQA 4HMCA 3GXIA 3LPGA 1DWGM 1XH1A 1U30A 3AIBA 2FHBA 2OSXA 4DWSC 2JFEX 3SUSA 1WZMA 2G3JA 3GXFA 1G9HA 3BUDA 2F7QA 3CUIA 1V0NA 1L8NA 1OGSA 3CHCA 5CLTA 4IISA 1EQPA 3LPFA 1G94A 1W1TA 1YQ2A 3N04A 2XTKA 2VVNA 2D1ZA 4P7LA 5A6BD 2XJ7A 1G1YA 1U33A 1KR1A 3EDKA 4M24A 3DHPA 1GONA 2YFNA 1V6VA 2VCAA 4A4AA 3M46A 1BAGA 1UWTA 2VC9A 4PMUA 3WBAA 3CZEA 3FY1A 3VPLA 2ZX7A 1FH8A 1X6LA 1MFUA 3ARTA 2WZIA 2VRJA 2YLLA 4M82A 2GK1A 4X0VA 5CGTA 1GOIA 4PTWA 1A47A 2W92A 3SIMA 1H09A 1BG9A 2VX7A 1GHRA 4WF7A 3WQ8A 1IV8A 3VM5A 3OA5A 2XFYA 3AXHA 4LYQA 2XN0A 1C7SA 4BQ5A 1E1EA 1KWKA 2Y8KA 3AS1A 3WEMA 3AXXA 1CXEA 2E40A 3TTOA 1C7TA 2J75A 2XGIA 1W32A 3WH7A 4PMDA 1B9ZA 3SCWA 3VX0A 3D4ZA 1HNYA 4GI9A 4UOZA 2WVTA 2Z1KA 2WBKA 3VDHA 3FXYA 5E0CA 1QVBA 4FNRA 2J47A 1DEDA 3EJPA 2OYLA 3BAXA 1MQPA 2ZUMA 3UR8A 3N18A 3SEPA 4W8AA 2UY5A 4UCFA 3AQUA 1ODUA 1CYGA 4D6GA 2O9OA 4QLJA 2XN1A 2OSYA 3BAYA 1WCGA 3WFZA 2CIPA 5BCAA 4JFWA 1V02A 4J3UA 2F61A 4AYSA 4D6IA 2WVUA 2DT0A 1PBGA 3VINA 1CDGA 3ARVA 1J10A 3DECA 1FFQA 2X2IA 3NYDA 1XC6A 1UA7A 3U57A 2QMJA 3L2LA 2RGLA 3BH4A 4P7QA 3VIJA 3ZQ9A 1QI4A 4HA4A 3WD3A 4PSRA 3CC1A 2VRQA 5C70A 2OW6A 5M17A 1E4LA 1V3JA 3VM7A 1C8YA 2W67A 3EDDA 3ZO9A 1H0IA 3BVXA 2XSBA 3OZOA 1UH3A 4MDOA 1TQWA 4E8CA 3WFLA 2YBTA 3AMCA 3MMDA 2O9RA 2BHZA 2VJXA 3VU2A 1R46A 4GINA 3BCFA 4R27A 1QWNA 3CUFA 1R47A 3GXNA 1VBUA 4UTFA 3K8KA 5BRQA 3NJ3A 1JI1A 3W26A 3ZOAA 1GQLA 1HJXA 1MXGA 1VB9A 1QX1A 2DEPA 1J12A 5ABEA 3BAIA 2WK2A 5CG0A 1UD2A 3AXIA 2MANA 2EADA 4W93A 3AMLA 3OLEA 3B8SA 1MWOA 1ECEA 4DO6A 1WNOA 3H55A 2QPSA 4J28A 2CBJA 4W5ZA 4JFTA 1R34A 4CCDA 3W27A 1QPKA 2XG9A 1UD4A 1C3FA 4D6EA 3W53A 2B31A 4B9YA 3EJTA 1UKQA 3A47A 1EOMA 4BS0A 5AYBA 5D8ZA 3N17A 3VNZA 2EPLX 2ZUSA 4J3SA 4J7RA 4MB3A 1OBAA 3EJQA 2WC4A 3ZT7A 3CZLA 3KLKA 4JKMA 3UCQA 1K9DA 1RD6A 3OGVA 1OT1A 1JZ2A 3F5KA 4JFSA 4MNKA 4LXFA 4MADA 2QMKA 2DT1A 4AXNA 4W88A 8CGTA 1V03A 3UG3A 3CH9A 3MANA 3W29A 5HBFA 2W91A 3FN9A 4MB5A 3WBEA 4B9ZA 1EXPA 4GO9A 4PMOA 2HVMA 4DWSD 5A6MA 5HDRA 3RDKA 4CD4A 1ZJAA 3VIIA 1E6XM 3BVVA 4KGLA 1VFOA 4CU8A 4TTGA 4S3KA 3EMQA 4NSBA 2D0HA 4QLKA 4OKDA 1C90A 4HZ8A 3WQVA 3EMCA 5D8WA 4WKHA 3GM8A 1XYZA 1O7DC 3EDJA 1LLOA 2GK1B 4PTXA 1ZBCA 1RP8A 4AD2A 1R33A 4JCMA 2GVYA 1HVXA 5I23A 5ECUA 1B30A 4H8VA 3SCTA 3LXAA 2CBIA 3TONA 1V0MA 2W61A 3SCNA 3VDBA 1LF1A 3GDBA 5FD0A 5IFTA 3W25A 3NSNA 3PZUA 2Y24A 1OWQA 4NI3A 4KWUA 4HZ6A 2FE0A 1EDQA 3A4AA 1GNXA 1J9YA 2EBNA 1NP0A 4R5EA 1GHSA 1NWRA 3VILA 4ATLA 1HTYA 2NT1A 4DO4A 3BMVA 2WZEA 4MAVA 1W1PA 2YA0A 3S5YA 3WNLA 3IGUA 3L4UA 2VX4A 2BS9A 3WSUA 2ZUTA 2D0FA 1GUVA 1C91A 1QNPA 3RM4A 1BPLB 1B2YA 1JYWA 4FLSA 1EOKA 4W7WA 4PTVA 5DT5A 1TA3A 3CZKA 4PEEA 3WF0A 4P8WA 3MUZ1 3OBAA 1W1YA 1MXDA 4MJ4A 3VMOA 3BXWA 4Y7EA 3WUFA 3KEHA 4B15A 4WSJA 1TVNA 4JKKA 2OWXA 3VD3A 5A1AA 3EJSA 1KGWA 2BY1A 4DUWA 1IZKA 1UYQA 5I2UA 5E0FA 1OGBA 2UY4A 4LX4A 1CLXA 4H04A 3L4TA 2ZUUA 5BWFA 4PMZA 1W9XA 3HG5A 2PBGA 3W37A 4FNPA 1LG1A 3I3EA 8A3HA 1Y7VA 5DMYA 1UWQA 1UKSA 1TUXA 2G3NA 5D4YA 1OIMA 3I3DA 2F7PA 2G3IA 2BY2A 4M80A 4GI8A 1BTCA 3KWXA 1TE1A 1E0XA 1BQCA 1GOWA 3K4DA 2X09A 3AHXA 3IJ8A 1CBGA 3WKZA 4HOWA 3W82A 4JFUA 1H1NA 1WDSA 4X0NA 5A69A 1JNEA 2FH6A 3THCA 2FH8A 3PZNA 2BXZA 1QI2A 2J7CA 1E43A 4PMQA 3CIVA 3VGGA 3AS2A 3HU7A 4M8UA 4OOZA 1RH9A 1UD8A 1TG7A 2XHYA 3UR7A 1M7XA 3VNYA 1DWAM 3FAXA 2BV9A 4GZIA 1GPFA 3M7SA 5DO8A 5BXRA 1AQMA 3DC0A 5GNZA 4CCEA 2DT3A 3HN3A 3AI0A 3QHMA 2X1IA 3LRMA 2Y2WA 1R85A 4FNTA 2ZICA 3WENA 1CWYA 2VZOA 1JF5A 4JKLA 4V2XA 2EO7A 4UR9A 1E0WA 3NSMA 1XGZA 4CN6A 4TUFA 3BGAA 1ZBVA 2BFGA 4H7VA 1U2YA 4CVUA 4JL1A 2X0YA 2DSVA 2C0HA 3HG4A 3VSTA 2XPKA 3D5HA 4PYSA 4MNLA 2J7BA 2TAAA 3D52A 4ZXOA 1R75A 5ABFB 2DH2A 1W9DM 3DYOA 3QOKA 4CCCA 3BAKA 4HOXA 1NOWA 1R87A 3VIOA 1HJSA 1WZLA 5CPTA 4CN1A 4MPKA 3MU7A 1M03A 5A94A 2YKKA 2WZHA 5I6SA 1HP4A 5E70A 1PZ3A 4TXEA 3OLIA 3VDAA 3CGTA 5A6BA 2VURA 3BVWA 3F4VA 2PF0A 1HXKA 1H11A 4UQAA 1UKOA 1FH9A 5ABHA 1HL8A 4UOJA 2CEQA 1WP6A 1BYCA 3K4AA 4GZEA 4W8BA 1CXLA 5FKYA 3QGVA 4PMNA 3OIHA 2OLHA 1GCYA 2ZX8A 1J0YA 1B3YA 2XIIA 2CITA 1KXQA 4YHEA 1MVYA 1B3VA 5BYWA 1JDAA 1ITXA 2IXVA 1V3MA 3PTMA 4QAWA 1P6WA 3WUEA 1E9LA 2QHAA 2WW5A 1LJYA 4U31A 1WDQA 1JZ6A 5D9NA 3WNPA 1VFFA 1JZ3A 1SZNA 1VFUA 3GBEA 1ZL1A 1WZAA 1CGYA 1BYAA 2YL8A 1OB0A 2WMFA 3PZMA 4PCTA 1XSJA 5JIPA 2XFRA 3QHNA 4BQ4A 1WDPA 3VIHA 2WM0A 1E4NA 3WUBA 5JIWA 6CGTA 2VVSA 2OW7A 3OLGA 3A3HA 4M29A 1QBBA 3AIVA 3DHUA 2QLYA 1WKYA 3AHYA 3HMCA 3NUKA 2V3EA 1C8XA 4JHOA 1ISZA 3WEOA 3H54A 4FLQA 4U2ZA 3AMGA 3N9KA 4A3YA 2PWFA 1E4MM 3QR3A 1OD8A 3DX1A 1HKMA 5E1QA 2X2YA 1EDGA 4IUGA 2OYMA 3AIWA 1VRXA 4S3JA 5BXPA 4P8XA 3RM9A 4JZ5A 1V02E 2VO5A 1XH2A 2YA1A 3TV8A 4TVDA 3VX1A 5CPSA 2CYGA 4NZFA 1CPUA 2D3NA 3T0AA 3WN6A 3VVGA 4ZFMA 4UZSA 1JYVA 1PAMA 2A3CA 2EPNA 5FOOA 4NZCA 1JI2A 3PN8A 5CSUA 1DTUA 2WBGA 1W9BM 1UH2A 1JZ5A 4N42A 5A2CA 1XSIA 2WHKA 2X0HA 1PX3A 1V6WA 1EQCA 2IUZA 1E1FA 1B90A 1PZ2A 4DO5A 2Q8XA 2XVNA 3QOMA 1VBRA 4NRRA 2J7DA 4W87A 1VEMA 4J3VA 3HZ3A 1W3HA 1CGUA 3AHZA 3AROA 1UH4A 3WY1A 3HG3A 1EHNA 1DWIM 1HJWA 1HKKA 3GYCA 2EAEA 2F8QA 2EJ1A 1HL9A 1ZU8A 3TTSA 3PTQA 1SMDA 1EH9A 3MUAA 5I79A 2O9TA 1E0VA 5BXTA 3GNRA 1JDCA 2V3FA 1E70M 4V27A 1UWRA 4CD5A 4IM4A 1PS3A 2E3ZA 4JIEA 2JIEA 1I1XA 4D6JA 4FLOA 2WWDA 3CUHA 1E4IA 1N82A 4URIA 2CETA 7CGTA 1BVNP 3WH5A 4P7NA 2D0GA 2X2HA 5D9MA 4OZOA 1Q6GA 4BQ2A 4P7RA 3ARWA 1MW0A 5KZ6A 1UHVA 5A6KA 2W63A 1B3WA 1LQ0A 2BY3A 4H8UA 1V3IA 1W91A 3RJYA 1XD1A 1JXKA 1QI0A 3ALGA 4W7UA 2G4FA 3BMWA 4TVUA 4P8VA 1J0ZA 1FFRA 2WXDM 3O6AA 2D73A 3SUUA 3N1AA 3CZNA 3RO8A 3GXPA 3AJ7A 5A2BA 3LX9A 2VT0A 1LL6A 4U5KA 1TQTA 4HOZA 3DYMA 4ATDA 2YIHA 1XYFA 2VZSA 3IK2A 4D1IA 1HX0A 3CLWA 4D6DA 5GPRA 1EO5A 1UZ4A 1XSKA 3VD9A 4YN5A 4KGJA 4WLCA 2XVLA 3L4XA 1J0HA 1GQKA 3D50A 4WK9A 2D24A 5JBDA 3ZR6A 1XHGA 1TZ7A 5LA1A 3WH8A 1FP9A 1KR0A 1KXHA 2YJQA 1HXJA 4ML4A 3PZQA 2GUYA 2XVKA 4PUDA 1ISXA 1M01A 1Q6DA 1SYTA 1GVYA 5EFFA 2OYKA 3B9EA 3WMCA 1E5JA 1J01A 2CERA 5DFAA 5FL0A 3VSVA 2WMHA 3AYRA 3NCOA 3VMNA 4QDMA 5A3HA 2DT2A 1VENA 2ZX5A 3WNOA 1TQSA 4AZBA 1US2A 3DX4A 2E9MA 1BYBA 2ZOXA 1F4HA 3RMEA 2PBOA 1UUQA 5EFDA 1MQQA 1E6ZA 5A8OA 2D2OA 5A8NA 1UKPA 1UKTA 2PC8A 4Q7NA 3CZGA 3MI6A 4CGTA 4UFLA 4M1RA 1X1NA 3WD1A 1GORA 2NT0A 2PB1A 2DPEA 3KE0A 4AW7A 2VTFA 3CHEA 4KRTA 3PZ9A 3O2LA 3TOPA 3DDGA 4MB4A 4MB1A 2VQTA 2VCBA 5GNYA 3L4VA 3VMPA 1NARA 2F1AA 5ABFA 2XGBA 5TD4A 1GQIA 1KXTA 1NWTA 4Z2GA 5HPOA 4UQDA 1G01A 1C92A 3AZSA 1MW3A 1HJUA 2EPKX 1E6RA 2ESCA 1I75A 4KH2A 3A22A 1W9VA 3WH9A 5A6LA 2J74A 1XCWA 3AMKA 3RIKA 2E8ZA 5AC4A 1W9PA 4EE9A 4EK7A 1JD9A 3IAQA 2V38A 3ARUA 3WDRA 4MTVA 2AMGA 1PX8A 1CXIA 1Q4NX 1QW8A 1NH6A 3KZSA 3SCSA 1AQHA 3WF1A 2BNJA 4WSKA 2PWHA 2WNWA 3T2OA 4NX0A 2VUYA 3VD5A 2J8GA 4TVCA 1V08A 1VEOA 4JHZA 1Q6CA 4AZ6A 5FIPA 3ARQA 3PZIA 3A23A 3WY2A 3WQWA 3L2MA 3WDJA 1W1VA 1JDDA 3VGFA 1CTNA 3CZSA 1RPKA 2J7HA 1UASA 4H2CA 5LYRA 4W86A 3CBWA 2NW0A 2ALWA 3ARPA 3OLDA 3D3AA 3ZR5A 1PPIA 4GPNA 5D9PA 3OZPA 2FDMA 4AEFA 4NF7A 4DM2A 1TVPA 2WVSA 1H3GA 4JCLA 1UG6A 1H2JA 2J77A 3VGHA 1K9EA 3T2QA 1PIGA 5JBEA 1TQUA 3WMSA 4PCSA 2ZX9A 1GJWA 1NWUA 2EPOA 1E6SM 3GNPA 2BHUA 4GO8A 1TR1A 1J0JA 4F9DA 3LXBA 3PZVA 1UWUA 2OSWA 1J0IA 5A6AA 2XIBA 4NRSA 4AD0A 4DWSB 1JYXA 4PBGA 3GXDA 1JD7A 1UD5A 1FOBA 2CBUA 3FHQA 3S2CA 1E55A 3WQ5A 3DYPA 1B3ZA 3BLKA 3AISA 4NZJA 3WL1A 2VR4A 3OGSA 3WIJA 1KGUA 4GKLA 1VIWA 2QPUA 2CPUA 3BAJA 2JF7A 7TAAA 3N13A 1YHTA 3W81A 2FHCA 1OCQA 1US3A 4LGXA 3CTTA 1UWSA 3SCRA 2WKGA 2JIWA 1JAEA 1DWFM 1ISWA 2CHOA 2VQUA 2YL6A 1WDRA 4E4PA 2XWDA 5I24A 1EGZA 4AZ7A 2DIEA 4F9JA 1R7OA 3E1F1 3T08A 5E9AA 6TAAA 2BVTA 2WYSA 4HMDA 2WLYA 3SUTA 1PJ9A 3ARRA 1T0OA 4AMCA 3I3BA 4D6CA 4JFVA 3VIFA 4XZBA 3CZ8A 1CECA 1UA3A 3DX2A 2FYVA 3WEZA 4U3CA 3JUGA 1ISVA 1MW1A 2BVDA 4AD1A 1BLIA 2J7FA 3S5ZA 3VD4A 2WPGA 4WKFA 3L4ZA 3EJUA 1K6AA 1VAHA 3WY3A 9CGTA 1V6XA 3W6LA 4W89A 1BVZA 3POHA 3UETA 1W3LA 2JEPA 3UEQA 3K1DA 1LWJA 4ZE4A 1IZJA 1DHKA 2D20A 3MMUA 2XWEA 5A8MA 5M3WA 3CPUA 1L0PA 2EXOA 3IJ9A 5I3DA 1O6IA 3POCA 3J7HA 1XRVA 1KBBA 3FW6A 2FGLA 1BGAA 1GW1A 2GDUA 4CUCA 4MNJA 2DSWA 5JBFA 1TQVA 3VO0A 1V6UA 4ZEPA 4Z2JA 1PIFA 4D6FA 5C71A 4MDPA 4XV0A 1QI3A 5CXPA 2D23A 1O7AA 1QBAA 4MNMA 2EQDA 2PWEA 3CUJA 4CU6A 3ARYA 2VNCA 3IAPA 5E6ZA 1DWHM 1MYRA 2V5CA 4IPLA 5A95A 1LWHA 1E56A 2WC7A 1QWUA 4CN4A 4KRUA 1G5AA 4ZE5A 2WC3A 2Z1SA 1WB0A 1FH7A 2D3LA 3WQ4A 3VKKA 1KFWA 2EEXA 3WELA 2XM2A 1E40A 2VCCA 2E0PA 3WF3A 3A5VA 3LPOA 4CKQA 3LMYA 2J79A 3VTRA 2Y5EA 2DGAA 1XD0A 1BGGA 2BXYA 4AYGA 5A8QA 2JE8A 4J27A 1MQRA 2WCSA 2WLZA 1UR9A 1HJQA 2DQXA 3BUPA 1ODZA 2J25A 3L4WA 1AQ0A 1BSIA 4F66A 3NIYA 3UESA 5HPCA 2ZXAA 4J3TA 5DEZA 2EACA 2CCRA 2DSZA 3LPPA 3A4XA 1LG2A 1OIFA 1OSEA 1HF6A 1QI5A 3LXCA 2VZUA 5FL1A 3KL5A 2W62A 1UR2A 3ZT6A 4ACYA 1B1YA 2VMFA 1BFNA 1KWGA 4QCEA 4U2YA 1G0CA 3AS3A 4AWEA 4B16A 1HWWA 2WWCA 3FNDA 5LA2A 3AZRA 3SCUA 1SMAA 2V3DA 5HXMA 3WL0A 2YDQA 4OGZA 3U5YA 2VOTA 2A3AA 3W0KA 1C93A 1W2PA 4HPGA 1UQZA 3ZSTA 3SCVA 4UFJA 3WQ6A 3BLPX 2O9PA 1QNQA 3G6MA 1KQYA 2ZXQA 4MAZA 2VI0A 1KXVA 3LRLA 1EO7A 2CKRA 2XUCA 4U3AA 2J7EA 5I77A 1E3XA 2C8NA 1GOMA 3EDEA 5CZKA 2FHFA 4OBRA 3VSUA 1FHDA 1JG9A 1TCMA 5JUVA 1LL7A 3DDFA 4AISA 1OINA 1OT2A 1UR0A 5AY7A 4CD6A 2EPMX 5DT7A 4EAMA 1X6NA 2WHLA 4UZUA 1BHGA 4AIUA 3T0DA 3CO4A 4HU8A 3D4YA 1QNSA 4XX6A 3S6TA 2ZX6A 4AIOA 4B3KA 1S46A 2WSPA 3TP4A 2GJRA 4BCEA 1UR4A 2A3EA 3W38A 1H41A 4WIWA 1BYDA 1NOUA 4L4OA 3W28A 5CSYA 1QHPA 5CQ1A 3ZJ7A 4HPHA 4C7DA 1GJUA 1UZ1A 3QHOA 2E9BA 1CENA 4CD8A 4PSPA 4D1JA 1QHOA 4HMEA 2IGTA 1EDTA 1ZBWA 1H0GA 3K8LA 4FMVA 2J78A 2WKLA 1CIUA 4PN2A 2XVGA 3VIPA 5KEZA 3A24A 4GXPA 4D72A 3W4RA 3GXMA 2DH3A 2YOCA 2RGMA 2WB5A 3B9AA 4NXKA 4EKJA 4UQ9A 5M5DA 3B9DA 4C7GA 2WMIA 3N15A 1AVAA 1KBKA 2YBUA 2QV4A 1VFMA 3MUIA 1J0KA 4K68A 1E6PA 4AD3A 4ACZA 4YPJA 4AIEA 4OUEA 1B0IA 4JL2A 4UQCA 1HN1A 3N11A 1GQJA 1J11A 3VOCA 4LQ1A 1D2KA 2FGZA 4LPCA 5EMYA 2PI6A 3PBGA 4RE4A 3WF2A 1UWIA 4ATWA 3SURA 1KCLA 2YA2A 1CLVA 4ZENA 3PZOA 2OWCA 5A2AA 1MW2A 4Z2IA 1JFHA 3W24A 1W3JA 5BRPA 1V3HA 3TTQA 3EJRA 2Y8VA 4DWSA 2VR5A 3UERA 1E3ZA 4CVWA 2WMKA 1NP2A 3WMBA 1E6QM 3M6DA 1E15A 4X9YA 5A8PA 1KCKA 2O92A 4U5IA 1JGIA 1HJVA 4FNUA 4TX8A 4KMQA 4EANA 4NXSA 3BLBA 1UR1A 4HU0A 1CGWA 1JYNA 2ZE0A 5DF0A 4AZGA 2F18A 3GH7A 3MV01 2X8RA 3SUWA 2CKSA 5FCZA 4HA1A 1Z32X 3N12A 3BUQA 2HISA 3NSXA 5IHRA 3WD0A 4HZ7A 3VD7A 4PTMA 3SCQA 4DUXA 4ZXLA 1FA2A 4A3HA 5E09A 1H5VA 1HKIA 2E8YA 5BROA 1VJZA 3BUBA 2WCGA 3FAWA 2CHNA 2DSKA 3KL0A 2VZTA 3CUGA 1QW9A 1CGVA 3CHDA 2E9LA 2DSUA 4JAWA 2YL9A 5AC5A 2AAAA 2GJPA 4CU7A 4E2OA 4Z2HA 1UD6A 4J3XA 1JZ8A 2UY3A 3DX3A 1ZB5A 4PMXA 2GFTA 1B31A 1JF6A 1A3HA 2G3MA 3F5LA 3SCPA 1JNDA 1CNVA 3LRKA 1WAWA 1NQ6A 3WF4A 4C7FA 1HVQA 2WHMA 3ZT5A 3VIKA 2CNCA 5IHSA 4M81A 2PWDA 1R7AA 2YLAA 1E6NA 3ZSSA 2VL4A 4FF5A 4XZWA 3EDFA 2W66A 3RJXA 4QP0A 2XM1A 4Q22A 1GOOA 3BVTA 5E6YA 2W4XA 1CGXA 2DIJA 2ZXDA 4UFMA 5AYIA 1KB3A 4AC1X 3BSHA 1EA9C 1NWSA 2EABA 2UWFA 3BUIA 4OIFA 4P7OA 5GNXA 2F1BA 1J18A 4W7VA 3AIQA 3GBDA 4GIAA 4F79A 5CPQA 2GJXA 2X05A 2CESA 1E72M 4RE3A 4AEEA 3VUPA 3ZIZA 1FP8A 2A3HA 5C8BB 3TTYA 3MSDA 4GQRA 4IPNB 3T0BA 4AZ5A 3WD2A 3BCDA 4TTUA 1W9UA 5F7UA 4HTYA 1BF2A 1JAKA 2JEQA 2A3BA 3K46A 4AMXA 4FNSA 1EIBA 3AHVA 2WMGA 1NOFA 1W3KA 4V28A 1Q6EA 1B3XA 2WVVA 1Q6FA 3APGA 5M03A 1ITCA 4XB3A 4AD4A 5IXEA 1LL4A 1D3CA 3AS0A 1QNRA 4P8UA 2ZXBA 1KTCA 1CXHA 2CBVA 3PZGA 3DX0A 3VDCA 4TOQA 4PMVA 3T09A 4GI6A 2G8ZA 2WMIB 3A6OA 4J3WA 2VX6A 3T2PA 3A4WA 4XUYA 2JF6A 1HIZA 2BVYA 3VIMA 2VX5A 3ECQA 1SR0A 5EB8A 4ACZB 1FHLA 2QF8A 1GZJA 3MKKA 4AMWA 4PMRA 4LYPA 3ALFA 3BVUA 2WMJA 3MO4A 1VF8A 1MFVA 4AZCA 2WSKA 1SFSA 4YHGA 1ZBKA 2W5FA 5CJ5A 3GZAA
chains in the Genus database with same CATH superfamily
1C8PA 4NKDB 5D1QE 3E9UA 1OCOB 1EA0A 3SUVA 1TJRA 1JFXA 3ARDC 2EF9A 2IXUA 4ETYA 2G41A 2R1NA 3WUGA 4ZMQA 5CCKH 4W9FC 3VJ6B 4DKFL 1S5TA 3ZHKA 4QF1B 2YQ3A 5EPMB 4H41A 1HIMH 4GFIA 1WIOA 5EWIL 3TF7C 3LK6A 5ICXB 5I19H 5DD0H 3B0XA 4IG2B 3PWVA 3QZPA 2BOGX 1YIXA 2QCFA 3OKOB 4FULA 4X6EA 3NJNA 1W5OA 3BJTA 1NBVH 5IQ7H 5AC8A 4JN7A 1XMEB 1XFCA 5T3XE 4UNTA 4PJDB 3CXFA 4GXWA 4PGEB 4R0LA 3L7FB 3AZUA 3LEYL 1S7TA 3MUY1 2PD9A 5JPNA 1UJQA 5IJVA 5IJCC 3SGDH 5KVDE 1M53A 4A7SA 2YFOA 4BEQA 3T0EE 2G30A 3AIEA 5A6SA 1F42A 1KTBA 2Y2TA 1AZRA 2H32H 1C8QA 5HVFB 3KBEA 4BH8B 3OXSA 1ZRQA 3IETB 1ESWA 3WNKA 4WTWA 4KHXL 3W9DB 1YNQA 3W7CA 3WV0A 2CGYA 2XFFA 1S3KL 1RUPH 2OGYA 3KCOA 3D08A 1T2XA 4UFKA 4BKLA 1BJ8A 1L6ZA 1AFSA 1ZS2A 5HJXA 3D39B 3W0WB 3ZYZA 4LNRA 3UG4A 3KXFD 3WFCH 3QRLA 3V0TA 4A2MA 4LASL 2K4WA 2APXA 1SHXA 2PLMA 3B8DA 1GYCA 5DA0B 3QQNA 4B96A 4BWTA 3JTTA 3MACH 4Q4RA 4QCFA 3X13A 3ARSA 3QFDB 3LIZL 2LHAA 1QZ1A 3BSGA 4Z1DA 4JQXC 2GJZB 4UTAL 2F7RA 1V79A 1R5WB 5E8EA 3QUYC 1RZFL 1KBWA 1CFQA 4P2RE 4DUVA 1KQZA 4RIRB 5HHVH 5B8CB 2RHGA 2X6MA 4AHQA 1LYQA 3MLTB 4ADIA 2AK1L 3HZMB 1T4KA 3JVFC 3F2BA 3AY4A 4WFEE 4GQQA 3G5ZB 4HMCA 1ZTXL 3GPSA 3DGRA 4V2CB 1N2RB 1IL1B 5ANME 1N68A 2Y1AA 3CUIA 5TH2B 3TBVA 1M1XB 3UZVB 2I85A 4A1RA 4G7FA 2N7BA 3DHPA 1EHKB 4FZ8H 3C5SB 5E1IA 4PIBA 2VC9A 1E9QB 3WBAA 4G7VL 4N8CL 4O2CA 3V0JA 2REQA 1U3HD 3OBKA 1KPVB 5FA3A 4GRWE 3FTZA 1QOQA 2QAPA 5FF3A 2BC4B 3HBPA 4OM0H 4ANVA 3ZGIA 3QQWA 4LDOB 1DDHB 2K0RA 1RV6X 4KK6D 4XGZA 2J75A 5C0BA 4KKCC 1CICD 4ZTPL 4PJ8D 2X1SA 5DJXA 5E0CA 3L45A 5I0ZA 3K2IA 2POZA 4GXUM 2X41A 3S37H 3F4WA 1AODA 2QCCA 3D5OF 4ZFZA 1FIGH 1NBVL 2NLJA 5IQ7L 4GBUA 3QJFB 3AO0A 4JQVC 3L2NA 2VLKA 2Y5QA 3GDRA 4DEFA 3IMBA 3ZQ9A 2Q71A 2INFA 2HNHA 4L1GA 1XC4A 4Q32A 1C8YA 4BFIB 5D8JH 3PAUA 4X6CB 4Q74A 3G6JE 4XE5B 3AMCA 1I2NA 4QRPD 3SGKA 4KUZL 5HGAA 5FJUA 5IREA 2BNRD 1WBYA 1F6FB 3DROB 3PWJB 4NAJA 3E2HC 3IGHX 4HIXH 4B3EA 2ZZUT 3CDZA 5SWQB 5BMFH 5JHLH 1RD5A 2Z65C 1YHPA 2V67A 3BIBX 4OWGA 3QTPA 1XFBA 1RUPL 5AOJA 1HHIB 5B39A 5IIEB 4L1SA 1XIBA 3OP2A 4JY8A 4WWKC 1QPKA 4N86A 1FH5L 1SLVA 1UD4A 4JZJC 3NOEA 2AGKA 4PLJC 3L9BA 3EO1A 4HD5A 5JIIA 4LLMA 3VNZA 2EPLX 4ELMA 2AQ1A 4OU1A 4LUJA 1OBAA 2ZA1A 3CZLA 2L0DA 2AQ2A 4WHTA 4AM0A 4AXNA 4HLEA 4J3ZA 5EU9A 4EPBC 1UMLA 5I3JA 2PDUA 5CO1A 5CZXC 1JERA 1FWEC 4QLKA 1KLGB 4HZ8A 3NPVA 3SDCD 1GY2A 3ZVVA 3EWUA 3EDJA 43C9B 2GVYA 4RX0A 3HNTL 2NLIA 3N0PB 4K8RC 5BPPA 1QPNA 4NQEB 1JHTA 3QQ9D 4NI3A 4IQHA 1GNXA 1HSAB 5KYUA 3RWCB 4XNBA 4WFHD 2NT1A 1IQDB 3MA7A 3WQCA 2CWNA 2NX9A 1NKGA 1QO3B 4PBVC 4LLDA 1WT5C 4GRLD 3P0WA 2IAND 1B0GA 2WQUA 2ZRXA 3BQVA 2DQUL 3FB7A 4UT7H 1OAUL 1N7ML 4LC8A 4P8WA 1LK3L 1LBLA 3TEVA 1K8DB 4NNPL 4M8QA 2Y7EA 4RZKA 3NIGF 2MPAL 4N22A 3WLWD 2G9HA 2MUCA 4M9OA 3R10A 2G3NA 2IPKB 2G3IA 2R6OA 4LBSA 1EJOL 4UM9D 1E0XA 4L3CB 3TBTB 4NOBA 1TPUA 3O2WL 4EEEA 2UXGA 2ZNXA 1E43A 2Y5JA 1FIGL 2Z7WA 3FQRB 3NZ8B 3BI9X 4GW4A 1RH9A 3LM3A 4GGHA 1RUKH 3G04B 2AKRA 5C0CD 3NPSC 3UVIA 1HUVA 4HS6A 3CPGA 5BXRA 1XCQB 2E75C 5F3BB 1W3IA 4ACPA 1V27A 2ZICA 4N2EA 4WR3A 1CWYA 2P46B 4Y4FA 5D8JL 4WGWB 1EGVA 4OF3A 1M3UA 1XGZA 1Y0LB 2GW5A 1HYSD 4M3PA 4CVUA 1WBZA 4LPVA 4FI7A 3Q5TA 3L1FA 4AH7A 3B9KD 4MVAA 1J9CT 3WHXA 3RVTD 3D52A 5BOOA 1KXTB 1FWIC 4HHHA 3RAOA 4MHHI 4Y7OC 1A6TA 5BMFL 4L37B 4HETA 4HFWB 3BVWA 4QE5A 3CC5B 3ZUNC 5FEBA 1L9MA 5D7IA 5CJXA 3QGVA 4RVBA 4HZLA 3CZUB 5E2VL 3TE9A 5I1CL 3WKQA 1BMWA 2BVQA 2MMXA 1UZGA 4P5MB 3FVDA 2IH3B 1ZHBA 3AFLA 2CCWA 2ARJA 3KW3A 1ZVNA 3BG5A 4YSRA 2XQYK 1MNUH 3WUBA 3D0VB 2QCDA 1XX1A 3DHUA 4G2AA 4J23A 3NZHL 2FB4H 4U2ZA 1FL6A 5E4AA 1T8QA 3GU2A 2A9BA 2X2YA 2Y07H 4NVTA 1R9FA 3QPQD 3AIWA 4TMPA 3BD4A 2W0PA 3RM9A 2H1LM 3GLDA 4HWBL 1QVOA 2D3NA 3T0AA 1X38A 4NQDE 1JI2A 3C3UA 3RWDB 1H63A 3ILQD 5GIRB 4N42A 3CFNA 1T83A 3K6OA 4JNYA 5I6KA 2DIAA 3SO5A 3F4DA 4XPGH 3MUXA 2E68A 4W87A 3OHXA 3EYQC 2YAEA 4FX6M 3P80A 2CUAA 1KTJA 2W88A 3PTQA 5EU6E 4PRTA 5ITFA 4YBHA 2O7SA 4AENA 4JQ2A 1AD1A 1ZLSH 2VR9A 2V3FA 3SYOA 2P76A 4JGMA 5CILL 2CR6A 3APMA 1AGEA 4J8RB 4ZW3A 4K5NA 3V5HA 5ESQB 3GUFA 5I75B 1ZHKB 3M16A 3E38A 4P7NA 4BDVB 2P5WD 2O0TA 3A6BH 3M1CA 4KUCF 2FGBA 2A9NL 4PV8A 1W91A 1H19A 1EX1A 1HK6A 5E8OB 3G0SA 1YBQB 5EC1A 3TKFA 2X5PA 4P8VA 3NURA 5REQA 3SUUA 3T44A 3OG4B 1XLJA 3BSZH 1QLFA 2BRQA 4WI4A 2CRIA 5E0QA 3FN0L 3VD9A 3KCLA 5CLYA 5H2BB 4JNXA 4LVNB 2OMUA 4IKLA 5HI5D 3PTDA 2I25N 4EI6B 1LNUA 2A83A 3G1AA 1SW0A 3PG2A 1Q9LB 2OKTA 5F1SA 2P26A 4NY2A 1W0WA 4RETB 5H37H 2X4RA 2Y7GA 1EXBA 1F4HA 1EGJH 4RMUA 2K78A 1CB7B 2YUVA 5ACMA 2ZKMX 1WHPA 1EF2A 2AEIT 3LYRA 1UKPA 1FGNL 4NO0A 5JPMA 4UFLA 3AREB 3B2DC 5SWUA 4OZFH 3N3MA 1ZHNB 2VQTA 4WUUA 3QHZH 1TCRB 1AO7D 3GK8L 2HPIA 4Z7UA 1R2SA 1A64A 2ADFL 2VR8A 1DVJA 4B41A 3DGGB 4HIBA 1ML0A 1YX1A 5CIPB 5F1KC 3JVGA 3AMKA 4F7MB 3FU5A 4Z7WB 1JN6B 1W9PA 3VZXA 2E77A 4I8YA 3ARUA 3GSVA 1Q9OA 1XIWD 3AU6A 3BP6A 4PUJA 4ZQMA 4EACA 3CFTA 4NRYB 2VGLM 2AJXH 4X6BA 3OXRB 1R3IL 3IIOA 1M7IB 3X11A 2OG9A 2HWZH 3CBKB 5LYRA 4P04A 1MRDH 5D9PA 1LUCA 1Z48A 3NSCA 5HNUA 4ZBCA 4FTVB 5A5WA 3RUGB 4J35A 4IW4C 3UWYA 3V35A 2GCYB 1FQ0A 5FGBA 1NIUA 4LAUA 2ZX9A 2XZAH 1SOSA 2XV0A 4NQXA 3PZVA 3MUGB 4MCZB 1UWUA 1IM9D 4D9QE 4NQCE 3T78A 1U3ZA 3BLKA 2I07B 3WIJA 1KNOA 4E4FA 1ECQA 4G80B 4XP9H 1A14L 2D7TH 3MFFB 2P0IA 2FHCA 4AYDC 4LGXA 5EIIA 2D4DA 1ZLSL 2YBVA 2X9YA 1IE7C 4DP2X 3PL6D 2ED9A 3BRGC 1SJEB 1UZ6E 2QUVA 4Q0XH 4D6CA 5HHMD 3LTYA 4BK5A 1OTUD 4M7KH 1PJWA 4WXZA 4PBWD 1TJHL 2XETA 5C2BH 4QRTA 2XU9A 1UACL 4PGCA 1IZJA 3UJFA 3P74A 4AQEB 1QSFB 4LUYA 4F0HA 4GRWF 3W84A 2W9EL 3V0VA 3J7HA 2V9DA 1O7SA 3BW3A 3VXGA 3NGBB 1T96A 5FKPA 1QK2A 1LD9B 4RGNE 4N2CA 3F7JA 3N43B 3W70A 1U8IA 4JPIA 1HAUA 2X4NA 3ILEA 3BZ4A 3W7MA 3JWNG 1RFDH 3WELA 3PBWA 3W1MA 4TPRH 4RDBA 2QVNA 1A6PA 2AXJA 3V52L 3FSVA 4HPYL 4PTUB 4HBQA 5HHOE 1G7HA 1BSIA 1SM9A 2V2TB 3HFYA 5DT1H 1LEIA 3M44A 3OHIA 3MRLA 1TKKA 2WYTA 4EQ3A 1EEZB 2EXWD 1GYWA 3G6JF 5IGXL 3KL5A 3COTA 5ID0A 4A2HA 4IRSA 2ILLA 3WLKX 4LS2A 3H24A 1EPVA 2D7OA 2LE9A 4YLWA 1U41A 3UBGA 5LIYX 4EXPX 1VFBA 2QS8A 4UQ3A 2CIIA 4Y9AA 1MCNA 4G72B 3BLPX 4PRHA 1XICA 3WQPA 3G6MA 5BU6A 2J13A 3TT1L 4OLYL 4AF0B 4LKXB 4O16A 2FHFA 4PB4A 1CJYA 4P46A 2BRRL 2FEDD 4IZGA 4OLVL 1G84A 5GRUL 5I1LA 3THAA 2AK4A 3RIFF 4FF7A 2NXZD 1S46A 3ULVD 3E0LA 3SO3B 1IT9L 1G6RL 5I74B 4F4RA 1E9IA 2IXQA 3MLVH 4WIWA 4L0PB 1URLA 1KZQA 4EN3D 1SVDA 3ALWA 3LVTA 2X70B 3IS1X 3FO1A 4OGAD 1ZKAA 5GXBB 4H01A 5HHNA 1WXJA 2QADD 5EZPA 1N19A 1C5CH 4YMZA 3GD6A 3BYYA 2GHZA 4QQ3A 2DM7A 4FG6C 3LU2A 4JQXA 2J78A 1QFUH 1CIUA 2PLTA 5TDOB 4NQQA 3NEHA 4LCWB 5CEXB 4HAKA 2EDTA 3QUYA 5B1CA 2DD8L 4KX9A 2OQLA 1GH7A 3IGXA 3UWZA 5F7KC 3AACA 1JVNA 1UIOA 1M71A 5F88A 1E6PA 1D7DA 2PTZA 5TE7L 4UQCA 1OEZW 4PJHE 1FBIH 3SRDA 5HDQL 4PJCA 1JZFA 3QDMA 2BP1A 3WIFB 1AFVH 4DBEA 3PZOA 4JO3H 5ISZE 1Z89A 3LHPL 4RWHA 4HB7A 2Q02A 2NUPA 4PRDB 5LXXA 2YPLA 2MCMA 3TTQA 1A7BA 1TVBA 3LKRA 1YNKH 3J2PA 1B2WL 5KS9A 2Z27A 2D2CC 3DX6A 5C2BL 2OT1A 2P47B 2YPIA 1YC7A 3BLBA 2PDBA 3PS6A 2ZE0A 1NEZB 3WD0A 1MHPH 2P0OA 1I4FB 4U0RC 1DANT 1WWCA 3MNDA 3VI3A 4RXFA 4LLUB 3FYEB 1MI3A 5JORB 4IQEA 3PHQB 2OSLB 4LF3B 3TPKA 4J1OA 1WUNT 3FYYA 3HB3D 1KIRB 3NJXA 1A3HA 4PJFA 2IBZY 1I1YB 2W27A 3WF4A 3NZGA 3VOGA 4I5BA 4OBTA 2YLAA 4HA0A 1ADOA 1UQSA 3HGSA 3GIVA 1P6AB 3KVDD 4K71C 4LCUA 1T1XA 4JDEA 2OOGA 4ALAC 2QPXA 2CW6A 2V7HA 5GNXA 5DT1L 2IQ0A 4PG2C 1A7PH 3CH8A 3WFDH 4ETQB 4Y19A 5DEJA 3LEPA 4F57H 2QZRA 1XGUA 3DIFB 3K2MC 1PKQA 4RMWA 4R96A 3WK0A 4AVIA 1Y18B 4MYPA 2OMZA 3OJDB 5I07A 3QSTA 1NFIA 4P23D 1LL4A 1QNRA 3AUVA 1U3NA 4X0KB 4HPXA 2J20A 4QRSB 2DLGA 3FTYA 3UTTE 2Y36H 1RURL 1N8ZA 2ZUQB 1IM3D 4NAEA 1S7WA 3BVDB 4B5NA 3ECQA 4I1NB 4WWKA 2IFGA 4F2ME 2BP8B 3PWGA 4JZJA 1MFVA 3SY6A 3USBA 3S4SB 5AVNA 1QKZH 2NW3B 4O00A 1NGWA 3ZRFC 3FO2A 2X89A 2VW7A 2XQYA 3BMXA 4JJ5A 1AXIB 3U79A 3VFRA 3SKMA 2V5BA 4DXKA 1DVZA 3GDKA 1KEMH 4LSRH 4HVXA 4WVRA 1GGCL 1QFUL 1IBYA 1IGYB 4F8XA 3ME0B 4OBSA 1O12A 1KGCE 1K4DA 4LYRA 2A38A 1P1MA 1IEWA 4I8DA 4PEKA 4JRLA 1W0VB 2NY6B 3TVMD 1X1ZA 3O6FB 2DYRB 5D1XE 3C08H 3IU3B 1F4AA 3UYCA 3MBEB 3THDA 3ULVH 1T7WA 3CMJA 3C5ZA 2WWKO 4F0KA 2AV1B 2GJNA 3UTPD 4W4OC 4JFXB 4OCYL 1KY6A 1N0XH 3O8XB 4N8VG 3O3DB 3FJNA 1XYLA 3FB5A 2PKDA 1MUWA 4JPWH 3IIPA 2D22A 3VFMB 3LKPA 2WTRB 1BD2B 2EKCA 2XTLA 3GZOA 4ZQOA 1JPGB 2X4QA 3FYPA 2EIKB 1MHPL 5SWZE 3MV7D 1HEZB 5DEGB 1KULA 5KG9A 1FX6A 2F6AA 2WN3A 1RZQA 3QARA 2Q7NA 4BF9A 2ZUVA 5CAKA 3KD4A 2FR4B 5L0QC 4O02L 1RY8A 2NXGA 4XAGA 3RTQB 4ORGA 1W54A 3IDGB 4PV9B 4IRJB 4NP4L 2W95A 3OWEA 4QYOB 4B2DD 4PR5A 3JWNE 3CIQA 1BZ9B 3B2PA 5F9WC 5AYXA 2TMDA 1TJGH 4BSWA 4PUBL 3T5WA 1IILE 3CV5A 3EKGA 3BQUC 5KJRH 4NJAL 1A7PL 1AW1A 1IIHA 1OP3H 5I1AB 3N6QA 3WFDL 4WEMB 3MNWB 4CLMA 4LVGA 3PGDB 1K7FA 4KIEA 4K55A 5IMOB 4M6VA 5ENWB 2WLLA 4ZTOH 4ZDHB 3GH4A 3WLMA 3UROR 4WXYA 4C1NA 1SLXA 1G1CA 1Y1DA 3MLPA 1TPB1 4OCRL 4HQQL 4NUPA 1IGTA 4A29A 3N6JA 1INEH 2A4EA 3GWJA 5BU9A 4BELD 3SN0A 1L8NA 1P4BL 5IDZA 3LPFA 2Z4GA 4I1RA 4GMSL 3L7EA 5IB4B 4PWJA 1R3JA 3I50H 3RIAF 1EPXA 1LILA 2GVLA 4PTDA 4F3FB 4IJ3B 1YZZA 2FZMA 3KPQB 3DXAB 5E6IB 4J3OG 5C6PB 4U1MB 3Q3GA 2UY6A 5IFHL 2VX7A 4IGBA 2AJUH 2NW2B 2NX5E 4E5XG 3OA5A 2XN0A 3S5SA 4LSRL 4N20A 2FTAA 3SCWA 1A66A 3W1XA 5J9PB 1GC1H 1HNYA 3VXRA 3MO1A 1TRIA 3M1BB 3OAZH 1EJWC 5ERWA 3WL9B 5GJNA 3BAXA 3MUHL 2UY5A 4XVSL 4EMZA 3U3HA 5HGGS 3WN5C 2V9TA 2I26N 3C08L 4XWGH 2JB6A 3OKDB 5J3HD 2FFIA 3EX1A 5AOMA 1TQBB 3MRMB 2JQZA 4IGSA 4UBDC 5DMNA 3NESA 4PFEA 2OTDA 3CV2A 5TGBA 2WM1A 3NFSH 2LTQC 2YD8A 1NMAL 4B5VA 3C8KA 3ES6B 4ZYKA 1OFOA 1H50A 1MZRA 1U8NA 3D9AH 3MAWA 4GINA 1JCKA 5B4MD 1JQVA 3NCEB 1G7JA 1ZD6A 1XLFA 4D8OA 2TSAA 2FPYA 4BCYA 2BSSA 4HG4K 5DQJB 5DUJA 4UWMA 2Z91A 1A1NB 3V0WL 1UZ6F 1RIHH 2FO4B 4WD0A 4GBDA 5KVFE 1YLVA 4X7TB 5AZ2L 4J28A 1PE1A 4CCDA 2AC0A 4PJAE 4X22A 3K2GA 3LMJL 4B9YA 3KFTA 4OCLC 4H00A 1G7PB 3IK4A 1BPVA 5AUMA 1A3RH 3C0QA 3E2SA 5HPMB 3QMSA 4E9LA 3CSTA 2AJVH 3H3PL 2BOBA 4KKLD 1HG3A 1CGSL 4MMXB 2X6BA 1WQ5A 2O61A 4XXDB 1K03A 3GSNH 3GMPB 4DWDA 4Y89A 5LWYH 2XNAB 5LAPA 1TJGL 4MB5A 3REQA 4WUKL 3QG6B 4W81A 1UWAA 3FZUD 2J2ZA 3O3AA 5T5FA 2EO1A 1YECL 2YAOA 1E6XM 4TTGA 3MLRH 4U1IB 2D31B 5BZDA 2QVIA 3W3OA 1ZV5A 1RP8A 3UTZA 4R97B 1XINA 3UPMA 5BW7C 1VQTA 2CBIA 4KRPD 1KPRA 5K9KB 3DGCR 1FLRH 4HUCA 4Q4QA 4O19A 2Z35B 3OG6B 4C6CA 1GHSA 4TUOB 2OLSA 5A2KH 3P02A 1NJJA 2WZEA 2VN3A 4D0BB 8FABA 1BAFH 2VDPH 1OP5K 4IGHA 1CLYL 4WWOA 3HC0A 5T1LD 3CVDA 2ZUTA 1C91A 1P7HL 4FLSA 3TYDA 1JV2B 4YVPA 5B3NA 3AU2A 3MUZ1 2F54A 5T1KA 1DQIA 1G7QB 4PRID 2A6KA 1VYPX 5FA5A 1BD0A 4YHNA 5AHLA 2OWXA 5D2NE 1LZOA 1MCWW 3PQYB 1HKVA 3UZQB 4BQ6A 1J5OL 4M3JA 1OGBA 4I3SL 1CLXA 1YUKB 4TVPD 3T3MB 4UOW0 5LCVA 5BV7H 3JQOB 3I3EA 4N6RB 1Y7VA 1UKSA 3CIXA 2DWTA 2OQJA 2CUIA 3MO7A 1AJZA 3FJTA 2QIIA 3K4DA 5E8NA 3C2SA 1X7QB 1I53A 5KSBA 5DJZA 5TQ2H 2R14A 4P9ML 4OGQC 5IV2B 3PZNA 3O2VL 3EF4A 4FXJA 4F92B 3HU7A 4XWGL 4TTDD 3RTLA 3LENA 3SDOA 4LS1A 2QQNH 4ZMTA 2BSEA 4YDMA 5E0KA 4XZHA 1AQMA 3V6OC 2B0MA 2XFGB 4FQHB 2OZ3A 3STPA 2ZRYA 3BGGA 3WLOA 2Z1XA 1ZBVA 2H1XA 4M8RA 5G5IA 3NA9H 3U25A 5AVSB 3V4VB 4H8PA 4F93B 5K93A 3DURB 1R75A 1MHCB 3DUSA 4HOXA 4YX2H 2OJPA 4OH2A 1ONXA 4P2AA 4PJHF 5E70A 4HLZG 3MB9A 4DTGH 2ACRA 3S36L 1RIHL 3CDCA 1H11A 2EEAA 2C9AA 4IDLA 1RY7B 1M68A 4AX7A 3FS2A 2PDPA 4K3EH 4YDIL 2IQAA 4NPYA 3FTGA 4L1HA 1YAIA 4GKNA 2ZX8A 4U6TA 2MWCA 4JGNA 2AJVL 2UZYA 1WA0X 3I6TA 1SGKA 2QJIA 4F7EA 1WDQA 3WNPA 1VFFA 1DORA 2J6EA 3GSNL 4IHBA 1LO2L 1XLDA 4Y2DD 1TV4A 1EDHA 3GTVA 5LWYL 2XFRA 5FHBH 3VIHA 3ZVHA 4IFOA 3JV4B 1QBBA 3KNBB 3CQJA 4DQAA 2YPVL 3OWRA 1QRNA 3DTXB 2VW4A 3H2FA 4EIGB 3BUYB 2V5SA 4ZMWA 3FSTA 4JFFA 3VC6A 4GH1A 4XPTH 4IUGA 3RMJA 5I0VA 1A6AA 3CDGB 4I18C 1QABA 3D3VD 1V02E 3RVUD 4FQJH 3TX4A 4G8FA 2NXIA 2PTXA 4FYTA 4PJXB 2F74B 1AH1A 4JR5A 4A8IA 3OB0K 3UXIA 5D2LE 4XN9A 1A5CA 2XFXA 1BAFL 1E1FA 5C0IA 3MRNB 3MRDA 5F97E 1T20B 2VISB 4ZUSB 1W3HA 3MSPA 5DHMC 4MMWA 4U6XB 4NDMB 4DKFH 1U8QB 1SMDA 3LCGA 3PWUB 2QGBA 5EWIH 3C2AL 3QFJB 4PVMA 3UAEA 1UWRA 4NN7B 2VFFA 1OYCA 4HEPG 1AY1L 2P5EE 5MERA 3KS0H 1BVNP 1E9YB 3M45A 3HFML 2P24B 1OT4A 3RDTD 4QNWA 1J1XH 2GGIA 2I56A 1HINL 1ACZA 4PW9A 3AQZA 3LEYH 1S7QB 2EDXA 4KROC 4NNXB 4Z77B 2XTJB 2X4OB 3KYNA 1M9WA 1LHZA 2XWBB 2XBDA 4YFDB 4WW2F 1UZ4A 4NBZB 5RUBA 2XVLA 3L4XA 4TVPH 1J0HA 5JR1L 4JM4L 4I7ZC 2OEKA 4KHXH 5ADOL 5IKCB 3FCPA 2WQVA 1S3KH 3PV7A 3C0LA 4X8CA 2XVKA 3KYOA 2L4OA 2EHHA 1UEMA 1QR7A 3AQXA 1JSYA 5FAJA 3Q6FA 4K8GA 4LOUD 3EH4B 1KCWA 5BS0E 4RFEB 4AZBA 5HHQA 2AS5M 5BRBA 1MFDL 2Y7NA 5D1ZC 4FA6A 1MSSA 4DTGL 4ZUWA 1EJFA 5CGQA 1MQQA 1A1MA 4ODTL 3FFCD 4PUWA 4U3XA 3PJLA 1VH7A 3WD1A 1RK5A 3S5LG 4AYEC 4LW7A 3LIZH 1EYWA 3W1AA 1EAOA 3TOPA 1U8MB 4NKOA 3QXAA 3H3BC 4UTAH 3MGOB 2BPBA 2I57A 1RJZB 3DFQA 2E5DA 1NWTA 3KOFA 1K4HA 5K39B 2KS0A 1TO3A 3P9LA 3GKFA 1J05B 3IJYA 1F1GA 2DZSA 1RZFH 2AZAA 4YNYA 4RNRB 4L3AA 1NUGA 5EZLA 2B1AL 3GC4A 3QUMB 1XCWA 3EW3B 2AK1H 3TWCL 1T1YB 2F7FA 2J8UB 5DX7A 2DJSA 3NACL 5GGRY 5HYSB 4Z0SA 1RLDA 1ZTXH 3X12A 2FBJL 2AF2A 5FB8B 5HGBA 3H9SD 4HJIA 4FQJL 2BNQD 3VFTB 3VGFA 1NGZB 1CTNA 3GHTA 1XCFA 4XI5C 5EU5B 1YN6B 4XD4A 1AIFA 3ATFA 1PL3A 4RX4A 4XMWA 4G7VH 2R82A 4N8CH 2H8PB 1R6WA 4E9RA 1Q4WA 3ZKQD 1G4MA 1J0JA 3HGJA 2F53E 1XDJA 2X3BA 3GXDA 4IOIA 3DYPA 4XPHL 4PG2A 1SJHA 1XGRA 2QR0B 3APNA 2Y3NA 1E4XI 4LPUA 1BQGA 4AEIL 1NFPA 2Y9RT 1CFSB 3P1VA 4ZTPH 1YKWA 1PG7L 2IOMA 2CHOA 2AEOA 3QQXA 1WDRA 1CWVA 3PPFA 2CCLA 2DIEA 1ORSB 2PYEA 2P7TB 1FDLL 2WLIB 1W5QA 3QSKB 3DX2A 4GW1B 4U3CA 1KXQE 4X7CC 1D5BB 1J1XL 3DSNB 4P4KC 3VCRA 3EHBC 5IF0B 1G67A 3TEYA 3WQEA 4IIDA 2OL3B 5IJBC 1DHKA 1WFNA 2FQFA 3NM1A 4GC4A 3U1PA 4V1DB 1XRVA 4KUZH 4KNUA 1GHFL 5E24E 3PPCA 3QUXB 4MNJA 1YY8B 3GJFK 1VLWA 1IAOA 1EAPA 4TVPL 1ES0B 3CQQA 2AGJH 5DJ6A 4WU7B 1XIJA 5B80A 1ETB1 5CXPA 2HX7A 4L9LC 2IAMD 3EG9A 2IWGA 2V5CA 4C6QA 4HUXA 3PWPE 1G5AA 1LORA 5H91A 4D94A 1AGDB 4QRUB 4DELA 4P4RA 4JTGA 2TRHA 4OQVA 4TNFA 1FH5H 1T5AA 1R3QA 3HE7D 1JWMA 3UR2A 3QP3A 4IP5A 3ZUCA 1LDSA 1S78D 3OKYA 1J79A 4JNMA 5FSEC 3H7UA 4XD3A 1SHMA 5K3VA 1E9ZB 2VITA 1P43A 2QL1A 3LXCA 4OV6F 5BRZB 1IC5L 3QZLA 2HTLC 3QC6X 3K6NA 3E0WA 1PD6A 4W4OA 1AR2A 1LMIA 2QF7A 1QBML 3RYSA 3ZJAA 3FNDA 2WIIA 4N0UB 4Q6IA 4OGZA 4XAFA 2VOTA 1N6VA 3W88A 3MROB 1IARB 3HNTH 5E51A 4O2FB 2Q76B 4U3AA 1NAL1 2YKLL 4PJAF 3GK0A 1NWOA 1CYWA 1JG9A 2FX9L 3MI2A 3QDJA 3IDXL 1OSPH 4GQZA 1O9WA 2EPMX 2FECI 3KGRA 2MOGA 3ULUC 4AIUA 2DYPB 3CO4A 3RPKA 1WIUA 4ZNCD 3TVAA 2GDQA 4HNOA 2DQUH 1H41A 1PZAA 1OAUH 1N7MH 3SDDD 3ZJ7A 3PJXA 1LK3H 2ITDB 4MA3B 1LE5B 5ITBL 5L9DL 1GJUA 4RNFA 5D2TA 5I5MA 3N1QC 4NNPH 3K8LA 1V05A 2MPAH 5DJYA 3Q37A 5D5MA 2J71A 3CD4A 2Z7GA 4GXMA 1QAPA 1OVZA 3BQUA 3B9AA 5C7XL 1TPH1 5ESVB 1D5MA 1OHZA 1I7RB 3IGAB 3FSWA 3KRUA 2EJAA 5HVWA 1EJOH 3TA3C 1ZP4A 3R4IA 4JL2A 3K6FA 1GQJA 4ODVL 2HROA 4V2BA 5CINL 3PBGA 2Y7LA 4PJEE 1S9WA 3O2WH 1ZS8B 4ZR8A 3P4MB 1EXUB 1JFHA 3H2MA 2DMKA 4MGXA 3N19B 2MRYA 4LL9A 3PNRB 5ECJE 4JEJA 4MAYD 4XR8C 4GG6A 1LT8A 4KJQC 1JGIA 3WIAA 3PIQA 4XNUL 3DSFL 1KTDB 4G8IA 5HP5A 4GE8A 4LAKA 1BDYA 1PTAA 3N12A 3BUQA 4FX8A 2JJSC 5GGRB 1P0KA 3QO0A 2GTQA 2YN3A 4L1XA 1JZJA 1HKIA 5AVWB 3LB6C 4JY4A 2VZTA 1QW9A 2Z6JA 2AGJL 1Y07A 1RHHB 4NERA 1MH5A 2YL9A 1G7MB 3BOXA 2P3EA 3IRPX 1MCHA 2Q8ZA 3EYSL 3U7WL 3UMNA 4NKMB 2BCKA 4W9EC 4ZMXA 4Y1AB 2Q3OA 2CNCA 4KKQA 5JMOC 5T9CE 3X3FH 1A5AA 3LN9A 4CKVX 2VL4A 1I8JA 4CMMA 2K9UA 5E2VH 5I1CH 2H45A 3WN5A 4JQAA 1YEDB 2GWNA 1SU5A 4E6MA 2YZ5A 1LM8V 4AJYV 3QNYB 1FWJC 4HK6A 3TFKD 2YEQA 4TLUA 1A4MA 2GJXA 3ZZSA 3CAWA 1KBVA 2QKIB 4ANUA 1GZHC 3EOBB 1UGKA 4GQRA 3NZHH 4KW2A 1M3IA 4HTYA 1BF2A 1JAKA 1OIOA 3AHVA 2P45B 3RJOA 1B4LA 3B3IA 5LN4A 4L4TE 3W01A 5E8PA 1SLUA 4HKXA 2WYHA 3HURA 4L9DA 3LV5A 1HZKA 4HWBH 5MEQB 1BZOA 3FJ6A 4MDJB 2YC1B 3TIEB 1OSPL 3MKKA 5CP7A 4LYPA 1E7VA 2C7UB 3IMTA 3SB0A 3S97C 4GIYA 5B3SB 2PDMA 4HSOA 1ID2A 2X1RA 3AICA 5L8LB 1INDH 3M0ZA 1PX4A 2CLOA 5ICYA 1Z5YD 3EH5B 4HJEA 3LKOA 1FN4A 5FYJE 4JPGA 2XSAA 4ZPVB 1UOKA 3C09B 5CILH 1DOSA 1MVUA 4XD6A 2EYRB 2XYLA 3B0PA 1AS6A 3WAKA 4IX2A 1FZKA 2OTUA 2D7MA 1GS8A 3TZVD 1E0TA 2C7FA 2ADJA 4Q8WA 2A9NH 3O3UN 1UT2A 2X9XA 5D2LF 1Z9MA 3MV9B 4O4WA 4HSNA 2HZGA 1F5WA 1FL5A 3LQLA 4NLAA 3WDIA 5E1AB 4RDZA 1WPCA 3U2CA 2CSPA 3HG2A 2RFGA 4YHOL 1GYVA 3N06B 5AW9B 1XWYA 4W8LA 5LDSA 1HL4A 3IPFA 5JHDB 5GRYA 1VHPA 2F8XC 3FN0H 2VWSA 2WD0A 3SBRA 2HJLA 2J7GA 3SQRA 5I5RA 4J3OF 5T1MB 4G1KA 1ZT1B 4LEOB 2A0LD 2GJ6A 1TFPA 4FXLA 4BKTC 3MNVB 3S98A 1D5XB 3KZPA 1YNTA 3TC7A 3PHSA 32C2B 5AHFA 4OCXL 5CGYC 4H1ZA 4PMYA 1TU2A 4QRPE 3UJIL 4N2MA 2JF1A 4WTZA 3BH9A 3NP3A 4DM1A 1SO3A 1FGNH 5CJMA 4NO5A 2ZOKA 4MNGA 2H7WA 2FJSA 3X3FL 3PABB 1HILB 3XISA 3QY7A 1R3HA 4HHAA 5DVNA 1BG4A 1M04A 3GK8H 2BZCA 1YPZE 2VRAA 4Y1TA 1V6YA 4R2GD 2ADFH 5A6IA 3AFBA 4D71A 1K6QL 1CZ1A 3TR2A 3U9UA 3V6OA 1PDKA 4INFA 4R9OA 1TA3B 1HCFX 4AT6A 4JM2C 2K4AA 3DESA 1F6PA 3QI9D 2F5AH 1NOLA 4N4YB 1F3DH 5I78A 1A7NL 2ODOA 3SRHA 4R7NA 3L3JA 5C9RA 4CNUA 5K9CA 3F85A 2HBVA 4O0ZA 3SUSA 1WZMA 1E5UI 4KTYA 1ERNA 4GSQA 1R3IH 3PWVB 1E51A 3D3FA 3HOJA 3CHCA 1MCLA 4O4YL 4YDJA 3UGEA 3DFOA 4X6EB 2O4QA 2ZCKL 2FNWA 4AVOA 1DBBL 3MJ9A 4LCSA 4IOFD 5C2UB 3C86A 4R0LB 3MLXH 2OQYA 1ZDSA 5GHWL 4QHRA 2WZIA 1A80A 2VQ4A 2FIQA 3PFQA 3B03A 1INDL 1A47A 3P5ZA 5IJVB 1XVSA 3BEVA 4OU3A 4QEHA 1GK8A 4MMYA 4JN2A 2ATPA 1A14H 4OIAA 2XIQA 5HWNA 4JIPA 3FU0A 4JMXA 4PMDA 1J8HA 3OXSB 3NCWA 1HL2A 1XBZA 5DRXA 3CAVA 2WBKA 3VDHA 2HVKA 1UEYA 2J47A 3MRKA 3TWBA 3UR8A 3HCVA 1UZDA 3KAAA 4B0MM 3TL5A 1KV8A 1CYGA 1RIVL 3KGUA 4BKLB 3KVLA 4I18A 4J3UA 4X5XA 4AYSA 3GZPA 1GYNA 4LNRB 1FFQA 1TJHH 1NCWL 2XV6B 1UACH 4D2NA 3CHVA 4J4PD 2D9CA 3CC1A 4WEBL 2B20A 4ZG1A 2W9EH 1WWBX 4JTSA 4Y6GA 1OTSD 3JTTB 1N8IA 3PV6A 2O9RA 4QBXA 3IS0X 1I8LC 3X13B 1GWJA 3TCTA 2IH1B 2MKLC 4HN4A 2HKAA 5E8EB 3ZYOA 1N4XL 2EDJA 2ZAHA 1VB9A 4XN2A 1CFQB 3U30C 3T0CA 3BGFB 1GGBH 2J8HA 4N0CD 4ERAA 4C5ZA 3H55A 2QPSA 1TPFA 1T4KB 3CV7A 3BPOB 4AGQA 5CPNA 2XWZA 3V52H 4DAFA 1BF6A 4HPYH 2RCSL 3N17A 3MN8A 5H8PA 1IAKA 1ZVSA 2IPTL 4HUVA 3OHMB 3TC6A 1K4CA 5IGXH 1JZ2A 3F5KA 2A7RA 5EYWA 2Y8UA 2YXVA 4NWTH 3FEMA 1X5IA 1RJCA 4HMNA 2M1KA 4JB9L 5I73B 5DEFA 4RESB 3FQWA 3MYPA 1TZOA 3B97A 1W0YT 1XF4A 3V7MA 1JUKA 1VFOA 2I17A 4NSBA 1C90A 3EMCA 2REQB 1RK0A 3NGFA 1F90H 5DXXA 2ADIB 1LLOA 5D2VA 4GQBA 1R33A 1A4BA 4L5FE 3TT1H 4OLYH 3ZN6A 2WKOA 4CJ0A 2F5AL 1LF1A 4H44C 1O1ZA 3Q9QA 4CDHA 1DO6A 2APBA 5IFTA 3W25A 3NDYE 5I26A 2BRRH 5LG1A 4XGZB 1X5FA 4KWUA 2A6NA 5C0BB 3S0PA 4C90A 1ZA6B 4OLVH 5GRUH 3HQPA 5DJXB 2CXEA 4R9XA 4X4ZA 4AQOA 2FJFA 1Q63A 3CBJB 1XRFA 5EUOE 4MWAB 2D0FA 1T4WA 1IT9H 1G6RH 4ZFZB 2NLJB 4XB7A 2WXOA 4M03A 2VLKB 3QO1A 4CBPA 3B2MA 3MLXL 4RFOL 2C91A 1XYAA 5A1AA 1O95A 1KGWA 4L29A 1ZNNA 4LX4A 2DD8H 4DI9A 1AMXA 1W9XA 4Q3MA 4KTEL 5EUKA 5HGAB 5I0WA 1I8AA 4G8GD 4R4NC 3O06A 1DL7H 1WBYB 4M80A 5TE7H 1F61A 4ZMGA 5MI0C 3U2OA 5HDQH 4C8XA 3IF1A 3DV4A 4GNVA 5D09A 4A66A 4JRYB 5A69A 2FH6A 3LHPH 2R4SL 3PUGA 5B39B 4Z3FA 1KM2A 1B2WH 3ARBD 1OP9A 5EN2A 2ZWSA 1GPFA 3M7SA 4AGLA 2NY1B 4JK0D 2YD1A 5HDOA 1BYNA 3EO1B 2XZ7A 3AI0A 1YNLL 4M6PA 4LLMB 4YSDA 4ELMB 1VZGA 2IF7A 1M4KA 1VR6A 2GSEA 5BJTA 2OMBA 2DORA 2Q7YB 1YXCA 4H7VA 1U2YA 1ZT4A 4UMGA 3O0LA 1T03L 4AM0B 2XPKA 3D5HA 1TQCC 3LHTA 1VCGA 3ARDA 4KCVA 1R87A 4P5KA 1GTEA 4CN1A 4N9BA 4Z7VE 2PDIA 4UAHA 2FWOA 3L3DA 4OGYH 4PJEF 1GGBL 2ZUXA 3HVNA 3OSVA 2E67A 1RXLA 3MFGB 3SFKA 5AFDA 4WI0A 1L9TA 3DDMA 3V0FA 4CVZA 5KYUB 1B3VA 4HJSA 1JDAA 1P84K 2ZT9C 5TPWL 4P4KA 3EOAA 1M7PA 3MA7B 4PRPA 4U31A 4J1UA 2PYFA 3GI9L 1G7LA 3TQVA 4UMBA 4NWTL 4LLDB 3L21A 3KX6A 1TJ2A 3MLWH 3FQXA 3AIVA 3S9DB 3HMCA 5FWRA 2CJTA 4NI6A 2FQEA 1CBVL 2VLRA 1F90L 1OD8A 1MSPA 4R34A 3CWNA 4JHVA 2FB2A 2HPOA 1SOKA 2E59A 5DMKA 4S3JA 1KLZA 3W22A 4QY8A 4P8XA 3UC0H 1Q0EA 3HA1A 4JZ5A 3T9WA 3VX1A 1RURH 4RBPK 4UZSA 1KB5A 4XNQA 2HEJA 3UP6A 5KN5A 3G5EA 5C92A 3GTXA 5FEXA 1XSIA 2DQGH 2V5JA 3BP5B 4XE0A 4HJGA 5CBBA 5E9DE 5C08D 4IF2A 4P99A 2HTMA 1A50A 4NS0A 3UJJL 4NUJA 2QSTA 3ASOB 1VPYA 3K30A 5D4IA 3TYAA 3E6FA 5F7HA 3ME3A 3MP3A 2AKRB 2H41A 2XY2A 1GGCH 4HS6B 1CFNB 1IC0A 1O0VA 2VMEA 4D7PA 5LN8A 3CSFA 4XX1G 1D8WA 4Y4FB 1G9NC 3C60B 1SVCP 1DL3A 1RMFL 1QTWA 2WXFA 3PXJA 1WBZB 2PPEA 4G9FE 1DL7L 1K8ZA 3WHXB 5GS1C 1SXCA 2ASHA 2IPWA 1LQ0A 1YMMA 3VQ2C 1MG2C 4LBRA 4UTBA 4OCYH 2VC2B 3AG4B 1UWXK 2D73A 5AHMA 3MLZL 3RO8A 3HG1A 5D7IB 4QTGA 3DYMA 3LM7A 3CLWA 3LGGA 1R3YA 4HZLB 3URQA 2AFNA 1XF3A 5KYYA 1ZHLB 1FFNA 1OCJA 1ZHBB 2ARJB 1KXHA 3PZQA 1FFOB 5F7EL 3LRHA 1MNSA 2EE3A 4Z08A 2OYKA 3B9EA 3L7RA 1MCBA 2CERA 1P5VA 1PU0A 1L0YA 3W56A 4O02H 3VSQA 4DN3L 1LJMA 5AYYA 5HK4A 3QEZA 1A0QL 3RMEA 4OGYL 1BTMA 3TA3A 4NP4H 1T04A 1LP9A 2QNEA 2PC8A 3CJJA 4JFED 1KM0A 2GITB 1MEXL 1HHJA 1QVOB 4C6IA 3N44B 3VFNA 5BOZG 2GSHA 3BRDA 2DQDL 1PKMA 1Z5HA 5CZVL 2NR6D 4PUBH 4B5TA 5DLLA 3RX2A 1ZK5A 4XVTH 2POTA 2YGQA 2F1AA 5TD4A 4JQVA 3UQNA 3WO8A 4QITA 4NJAH 1G01A 3S83A 3W2LA 3BO8A 2EKJA 4KH2A 4GB9A 2VP8A 4K7FA 5CGBA 4DPCX 3MLWL 4L1BA 1I9IL 2PCXA 3VU1A 2JJSA 2X4SA 2DBLL 1YRRA 5ITFB 1U8KB 2W38A 1B54A 4OCRH 4HQQH 1Z6JT 3GW0A 3QVQA 4ICMA 3TNOA 3UC0L 2YGOA 1P4BH 1AGEB 4GMSH 3V5HB 3WQWA 5DDHB 4H2CA 3BXNA 2ZXWB 5C9XA 3SGEI 3RL1A 3N3TA 2DQGL 4MWFA 1G9MC 4PV8B 4JCLA 4I0KA 3VGHA 1K9EA 4ZMNA 1NFGA 1YPZF 4Q8BA 2DQWA 1H15A 1E6SM 1BBDH 5REQB 5IFHH 1AD4A 4DWSB 2J7LA 1FCGA 2Z8VC 5DBTA 2QVKA 1AS7A 2VR4A 3BPLC 3SJVE 1QLFB 2H0FA 1NCCH 3OC5A 1GZHA 3SCRA 2OMUB 4K3DL 2TPSA 3R13A 3QRBA 3D39D 2PCEA 3W0WD 4K3JH 4C55A 2AVGA 7PTDA 2FLRT 4XVSH 2A83B 6ALDA 5MENA 1NSNL 4DP7X 2V9UA 2WOQA 2DQIH 1UXSA 3S35L 2D7PA 3O6DA 3MJGX 1W0WB 4OHQA 3KTXA 3WY3A 2X4RB 3L3IB 3L5HA 2OJZL 3TIMA 2DW7A 1W3LA 4AZUA 1LWJA 5BOJA 2EUZA 3CEPA 3IFNL 4RGMB 1NMAH 4O52A 2VYRE 5LGXA 4NO0B 4PWIA 2E28A 3V4VL 5LXGL 1MLBA 1WT5A 3KS5A 3R5EA 4WUUB 5I1JL 5CWSA 4EI5B 5C71A 1A25A 4L3EA 4YSPA 4Z7UB 3ARYA 2R29A 4LWWA 2F6KA 5G4EA 5IHBA 3V0WH 4CN4A 3MP5A 2ISFA 2Z1SA 3SSZA 1UP3A 2BSBA 5AZ2H 1E40A 1W16A 3GSVB 4WO4C 3LMYA 1Q9OB 4GSRA 3LMJH 2X2GA 1CF8L 1A6ZA 3BP6B 1YTDA 5CR8A 4XAPA 1T7XA 1UW9A 3LD8B 1AXSB 2DM3A 3H3PH 3THQA 1RKRA 1CGSH 4ADGA 4X6BB 2VO8A 3CUXA 8PAZA 3X11B 3WTWA 5I1GH 4NT0A 4WUKH 5SWSE 4BF5A 4XVTL 1NOAA 3QJTB 2EE9A 1LUCB 1YECH 2V3DA 3IMSA 9XIMA 3GG1A 3C52A 4NQXB 2EDEA 1KJ2A 4PRAA 3R94A 2Q3AA 2GKIA 1W1B1 3N6HA 4ABWA 4TQHA 4NYUA 4CQCA 4H20L 4NIRA 1KNOB 1SF5A 1GKPA 5DWPA 3VSUA 1PWLA 1LL7A 3B4UA 1A9VA 2LU5A 2R39A 4CD6A 1MIMH 3ISIX 4S38A 4YHMH 1KFLA 1ZXQA 4O1AA 1CLYH 3QK0A 4JQIH 4CDGC 4XX6A 3W7LA 2VWEE 2FPTA 1LQSR 3HV9A 3DLQR 3W28A 1A5FL 2B7QA 4M5ZL 2VN5A 3CVIL 2OO6A 1NICA 3VKAA 1NGQL 4PSPA 1YO4A 3VW3H 2FJHA 1RCYA 4FFZA 1BBDL 5J12C 4PGCB 3PLYA 2OR7A 3KPOA 4MZ1A 5FLUA 5HTSA 1J5OH 5L2KE 1WAAA 2BERA 2YAMA 4I3SH 3V0VB 2CAKA 1Y6KR 3GC3A 5I2IA 2WMIA 1GGYA 1VFMA 1SOXA 1TZGL 1NCCL 5AKQA 1D7CA 1J0KA 2QELA 1FKWA 5FKPB 2QCNA 5IBXC 2YN5A 4TLTA 5I8KL 1GTFA 4K3JL 4XX1E 1KJVA 1XBDA 4P9MH 3O2VH 2GI7A 3QUZC 3CHQA 5EUOF 4JS7A 3W24A 1U8IB 4JPIB 3G1FA 2X4NB 4H8WL 3BZ4B 2E5EA 5INDA 2DQIL 4K73A 4NJKA 1PWMA 1X4ZA 3DIVA 5KITA 3ARFC 1KKOA 2WNKA 1F05A 5F1OB 4F91B 4H9VA 1G7HB 1SDAB 4UAOB 3MV01 1LEIB 1AHKA 3MRLB 3WIIL 3ZIYA 3UGRA 2VM3A 2DRUA 2VR3A 4X4ME 3X1EA 5ID0B 2LT9A 4IRSB 5CM1A 3RHWK 1QAWA 3CHDA 4YE4L 1F3JA 4JX4A 3T4AC 3OYZA 3QYSA 1XM3A 4NQED 1VFBB 3QR2A 4QRRE 1FUNA 3MV8A 4UQ3B 2CIIB 3Q58A 1HFUA 3S36H 1QSEB 1JNDA 3UTSE 4AGNA 2GL5A 4PRHB 2NQJA 4C7FA 4YDIH 1V4YA 1E6NA 4P46B 5G4OA 2ALRA 3S5NA 3UAFA 1B4RA 3GZQA 1CGXA 4JLRA 1IEBA 5I1LB 4Z8FL 5CN2A 1LO2H 3CMOL 3B8TA 3LOTA 4LNCA 3QIBC 1OF2A 5I1GL 1MG3C 2IXQB 2UZXA 5IHZA 2YPVH 4S1SL 3ITVA 1DBAH 3FO1B 4KFMA 4B90A 1NOFA 2DTSA 1Z2KA 4K07A 4Z7VF 3APGA 3L3OC 4DZBA 1Z66A 5HQLA 4P8UA 3QUYB 4ORZC 1BEUA 3RY4A 5D96C 8XIAA 3W57A 3LIUA 3I6GA 1M71B 5F88B 1UC5A 1MIML 1X7FA 1KC5L 4YHML 4UF7C 5LO7A 4TU1A 3DMMC 3QDMB 4JQIL 1ZBKA 3CIAA 1F6LL 3D51A 2YPKA 1EHAA 4LDEB 4P5TC 2NUPB 2YPLB 1TVBB 3LKRB 2BW4A 3KDNA 4NRZB 1QNZL 1F5ZA 1L9QA 4DGIL 2FMNA 2QPFA 3DX6B 3VW3L 3L3GA 1U83A 1LROA 3C2AH 2GYSA 4G2DA 2TRYA 5KBDA 1AY1H 2WWNA 4UIOA 3EXRA 4AY1A 4KXDA 3HFMH 1JBJA 4FL4C 3M64A 3VI3B 1JQXA 1ML1A 1HINH 1I8KA 3GO2A 3BICA 2BVEA 2OL3L 3VXMA 2EKSB 1VZIA 2EC8A 3N41B 4GOSA 4PJFB 2Y6ZA 5JIDA 3WTXA 4JIIX 1L3WA 1S2VA 4XISA 2HYMA 2WCAA 4GOAA 1I1FA 4I5BB 3GHRA 3STFA 2BW5A 3RGVC 2INEA 1UQSB 1W8NA 3GIVB 4NFBA 1NBZA 2L7QA 2Q5BA 1GOKA 3MCYA 1V6TA 4LCUB 1R3VA 3ZKNC 1T1XB 2NSOA 5JR1H 4JM4H 4LCIH 4JDEB 5ADOH 3LNGA 2JKIS 2V7HB 3S3GA 3U7VA 4DPAX 1UC4A 3UXDA 5IDIA 1CQYA 1EUUA 4Y19B 3LCYA 1MCOH 4RPPA 2OWWA 1XGUB 1UUSA 2DMBA 4JFQB 4FNQA 1G0YR 2J8FA 3GTNA 2OZ8A 1PKQB 4PBXA 4CQBA 1ZAJA 4PP1C 2CDFA 4R96B 2UYLA 1MFDH 3SY0B 4LHUA 3PR2A 2OMZB 2OMVA 3OODA 4DYJA 1HQ4A 4ODTH 4N0RA 2O7QA 3H4HA 1S2AA 3MV11 4EOWL 3DO4A 5ABGA 1N8ZB 3U2JA 5DZLA 4NAEB 1S7WB 2J62A 1NCNA 2WQPA 2X30A 3PGFL 4LVHC 2Z1BA 2IWEA 1Q9KB 3CVHA 4YDLC 2YDAA 5DQ9B 4N6EA 2J4WH 2HTKD 1NGWB 1CEOA 3OZLA 1NDGA 2B1AH 3FO2B 3PJTA 4Y16C 4OFYD 2ZVRA 1JGEA 4QG9A 3RPMA 3TWCH 1A4AA 3HZYA 4JJ5B 3QUGA 1VGEL 3VFRB 4U1LA 3SKMB 1DBAL 2E7CA 3NACH 2VN6A 2FWUA 5F3FA 2MH4A 4AXWA 2FBJH 2AQSA 1K4DB 1G4EA 3NABL 1PZ1A 4DBSA 4W9CC 2FO1A 3VXSA 4MD4A 4BXVA 1EQPA 1GW6A 5A6BD 1U33A 3DO7A 3EDKA 4M24A 2G4GA 3RPIA 1V6VA 4KEMA 3SECA 5DJCA 4PMUA 4EWJA 5D9SA 4ES8A 3AQYA 3CQFA 4RMBA 1FH8A 1SFLA 3C5ZB 1R2TA 3GRIA 3ARTA 3APDA 1K4GA 5HJBA 2GOKA 3T6VA 2UV3A 4LLQA 4PTWA 4BINA 4Z17A 4XPHH 5ID1B 3FB5B 4QGTA 1VHCA 3CU2A 2RJMA 4PCNA 4AEIH 1YYAA 3LKPB 1MI5A 1A2YA 4N4PA 3K2UL 4Z7AA 1PG7H 4YSSA 3DUGA 2X4QB 2XI9A 3SEPA 1FDLH 4OZIE 5KG9B 1FDJA 3KBMA 2VE6A 4X6FA 3FKKA 4QGCA 4QO1A 4WGKA 4D6IA 4XZIA 1BGXL 1AANA 1DLFL 9PCYA 4HHGA 3CXDL 4Q6XA 3ARED 4KBPA 4ORGB 1K02A 1RZKC 4FZEH 3EAUA 5M17A 3BZ5A 2G50A 2YYUA 3V6FA 3QYNA 3PY2A 2VM9A 1GHFH 1VGKB 2Q8BH 3H4FA 1F73A 3RK8A 1Q6RA 3R6IA 4A04A 2PLCA 4BSWB 4JREC 4UTFA 3ESMA 4LCIL 1FF5A 1JI1A 3FDGA 2C9PA 2XXFA 4E8GA 4GEIA 4N9GA 1H3XA 4I9AA 2ED6A 2VQ1A 3GMNA 3IE4A 1Z8AA 2WBJC 1O5QA 2EADA 4PJ9C 3N42F 1MCOL 1DFBL 2GLKA 2X9WA 2JLLA 2WNGA 3HMXL 1R34A 2I9EA 2WLLB 4LNVA 2ABAA 1VPXA 3TJHD 2G5RA 5DMMA 3QZMA 4C1NB 1UC6A 2OFQA 1W6TA 1LO3L 1BG1A 3GHEL 3BURA 2LV4A 5GS1A 1IGTB 2CBPA 4J3SA 2WC4A 4HALA 4FTVD 3VNDA 1IC5H 1JMZA 4MNKA 4MFEA 4MADA 4I48A 1R3JB 3CH9A 4X80H 2EVJA 4YDNA 4B5UA 2FSEA 3WBEA 1QBMH 4HD9A 3RZCB 3OEXA 4ODHL 2J4WL 5KVEH 5BMWA 1XLEA 3VIIA 4P2QA 1S5IL 2EH8H 5LHDA 4J2XA 1RZ8A 4XXWC 5HATA 1C16A 1H3PL 2VLJA 3Q3GB 2UY6B 1NELA 3PPHA 5I23A 2XPGA 4KPLA 4IGBB 5J5RA 2YKLH 3S3PA 4J5VA 2FX9H 3NPWA 5J57B 4KBXA 3A4AA 3IDXH 4ZX3A 4NKCA 4I0PC 1N18A 2OR9L 4R5EA 2W1NA 3V95A 1HTYA 2YZ8A 3VXRB 3MO1B 2NZ1A 5DI8A 1PAZA 2Z93A 2EO9A 5ERWB 3GC5A 5HINA 4CNNA 7ENLA 4F9LC 3RM4A 3IIVA 2V2WA 1I2QA 3KDMA 1P7TA 4KITB 2JB6B 1QSFD 5ITBH 5L9DH 5IVOA 1ELSA 3TBBA 1RI8A 2HT3D 5DJ0A 1XR8A 3IRCA 4BRJA 4DIAA 4G6FB 1X5HA 5TGBB 3EJSA 3VGAC 3L9RA 1KD0A 3C8KB 3L12A 5C7XH 3TO4C 4ZYKB 1A0DA 1OFPA 4QS5A 1U8NB 4FNPA 3B2UD 1J5HA 4XCNA 2Q3RA 1G7JB 3WX7A 2WJ5A 1GPOL 4ODVH 1Y5XA 5CINH 2BSSB 3JZEA 1OG0A 1WDSA 5DD5L 4ZUUB 3THCA 2Z91B 3V36A 3CSPA 4UTWC 3WYRA 1ZLVH