1U2YA

In situ extension as an approach for identifying novel alpha-amylase inhibitors, structure containing d-gluconhydroximo-1,5-lactam
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Situ Extension as an Approach for Identifying Novel alpha-Amylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 179
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1u2yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1u2yA01
2VZOA 3MUZ1 3WDHA 4UFIA 4F9JA 4NF7A 3CBWA 2B31A 2YDRA 2V3DA 3M46A 4OIFA 2VURA 1FP8A 4W5UA 5CQ1A 3CGTA 1B3ZA 3WFZA 5I5RA 4K68A 3SUUA 5DFAA 1UD8A 4P7OA 4ZXLA 4YHEA 2UY2A 3RM4A 4UZUA 4CD7A 1PX8A 3VDBA 1JFXA 3EDFA 1G9HA 1L0PA 1BYAA 5CSYA 4FLRA 1QBBA 2XN1A 1QWUA 5I2UA 3WH7A 4GI6A 1H4PA 2IUZA 2CBUA 2ZWYA 3AICA 4JHOA 4V27A 2CCRA 1GOMA 2VQUA 4PUDA 1XD0A 3RPMA 1J0IA 1R85A 1V08A 1C7SA 3J7HA 4A4AA 1GQKA 2VRJA 2J8FA 3WDRA 2WBGA 3U5YA 1E5NA 2CPUA 2HISA 1EQPA 5HPCA 4GKLA 4LGXA 3ZT5A 5HXMA 4FMVA 4W89A 4PCSA 1GOWA 3GNPA 3EMZA 5A1AA 2WYSA 4QDMA 1J9YA 4AD5A 1J0ZA 4AYGA 1SR0A 4LYRA 3L4UA 2G4FA 1CZ1A 2PC8A 1JYXA 4U5KA 3ECQA 1UKTA 3DECA 1K9FA 5FCZA 1CLXA 4EANA 3WF3A 1H49A 1VEOA 4CU8A 1E4NA 3BCDA 1JZ3A 4GIAA 1WZMA 4D6HA 1CLVA 1H2JA 2A3CA 3BAJA 4EKJA 4M1RA 1JXJA 5ABGA 4AY1A 4ZENA 4U5IA 3OG2A 5HDRA 3WEOA 3H55A 3AJ7A 2WXDM 3MV11 2VT0A 4V28A 1WDPA 3OLDA 2J79A 1F4HA 3D5HA 1UR8A 4UQ9A 4AD0A 3N13A 1J0KA 3HG4A 1L8NA 3WUGA 1AVAA 1BTCA 5HNNA 3OGRA 3AMLA 1EDQA 3FW6A 3PN8A 2OSWA 1DWAM 4PMYA 3EYPA 3K4DA 1UQZA 1FHLA 3VGHA 3VDAA 3RM9A 3PBGA 4D6GA 1FHDA 4GINA 2A3HA 3GXNA 4MTVA 4BQ2A 6TAAA 3F5JA 1VEPA 1WZLA 1EQCA 3TTSA 1W91A 4PRWA 4E8CA 4DO6A 1J10A 3MS8A 2GDUA 2XWEA 5C8BB 5EMYA 2DH2A 4KH2A 5E70A 1CXLA 1OD8A 3O6AA 3LRLA 2F7RA 5E1QA 3VPLA 1CGVA 2VO5A 4CD6A 1EHAA 5A95A 4KMQA 3WL1A 2BVDA 1LG1A 3AHVA 1BYCA 1Q4NX 2O92A 1MYRA 1V6XA 4NSBA 4MB1A 4W7UA 1R7OA 3HG5A 4Z2LA 2CHNA 1OGGA 3KWXA 1IZJA 1MW1A 3GXTA 1TMQA 2WM0A 4M8UA 3MANA 2WAGA 4H8UA 1K6AA 1UUQA 1KBKA 4UTFA 1UKOA 4W85A 3W27A 1A47A 5AY7A 4FNTA 1J01A 1Z32X 4MNMA 2WVTA 1UZ1A 4WKFA 2ZOXA 4P8XA 1PZ3A 3WUEA 1JZ2A 1R7AA 3VGFA 2W91A 3ZQ9A 3VUPA 4CD5A 1PJ9A 3CZJA 5IHRA 1V6UA 4WIWA 5A6BA 5ABFB 2YIHA 4JFTA 3GXFA 1UR2A 1BF2A 2D0FA 1JGIA 3BSHA 3POHA 3L2MA 1E6SM 1HIZA 4DWSA 4ATDA 3S5ZA 2EPOA 2VR5A 3N9KA 2NT1A 2D3NA 3W4RA 3BAWA 3UETA 1GJWA 2VCBA 1WDRA 1RP9A 2IXUA 5I0DA 3CLWA 8CGTA 3HG3A 1A3HA 1CGUA 2WMFA 1JZ7A 2Q8XA 2ALWA 2X8RA 1OIMA 5BXRA 1XSIA 4DUVA 1OD0A 1G0CA 3WF1A 3SCSA 1JD7A 2ZE0A 4DWSC 3GM8A 2Y8VA 5A2AA 2A3AA 4JFWA 3PZOA 4ZFMA 3BUPA 1W1VA 2J47A 1HJWA 3ZT6A 1NARA 3PZQA 3VIHA 3QHNA 3MKKA 3PTQA 4M29A 3KLLA 3BUBA 2WC4A 3KL3A 4B16A 1H3GA 1J0JA 2QMKA 1E4MM 1GORA 1XSKA 3ALFA 3D4ZA 1GNXA 2W4XA 4JKMA 3D52A 3GXDA 2WBKA 1MXGA 4AD2A 3BH4A 3UCQA 4MNLA 4MNKA 4HU8A 3F4VA 1ZJBA 2WPGA 2XSBA 2EXOA 5A6SA 3VIIA 2V3EA 2JALA 3NSNA 1CXFA 3H53A 4UQDA 2NSXA 3RO8A 2AMGA 5CLWA 3WF4A 1VBUA 4X0VA 4IPNB 4P8WA 5A6JA 3VILA 3ZJ7A 3VINA 3WDPP 3WNMA 4GZJA 3MV01 2CEQA 2D0GA 1WZKA 2J7HA 2OYKA 3DX2A 4MB3A 1JZ6A 3APGA 4ZE5A 3WEZA 1CGYA 1PEZA 4BQ3A 1MFVA 1BGAA 4H8HA 1NP0A 1BVZA 1VJZA 3OGSA 3WDIA 3CHCA 3MO4A 2E0PA 1R75A 2JEPA 1KR1A 5IXEA 2D2OA 4AC1X 2FDMA 4Z2IA 1Q6DA 1CDGA 2WCAA 2XUCA 3U5UA 4X0NA 4MDPA 2G3JA 2XM1A 4GO8A 1TFVA 3K46A 4UOZA 1E15A 1V3HA 2YFNA 3VIGA 4TUFA 2BVTA 4TVUA 4LYQA 1GQJA 2ZXDA 4WLCA 3II1A 3SUSA 2Y4SA 3VU2A 4AZBA 3BCFA 3PZ9A 4CN4A 2G8ZA 5CJ5A 3H54A 1AMYA 2X2YA 3CZGA 1C8XA 2YJQA 3EDKA 4PCTA 1V02E 1QNRA 1VF8A 3T08A 1ITCA 2WLYA 3RCNA 1JYVA 4UQEA 2J78A 2GJRA 5CG0A 3UR8A 5FL1A 1GVYA 4CU6A 1US2A 3EJRA 1FH7A 5JIPA 3KZSA 1W32A 1UWTA 4GXPA 4ML4A 3IJ7A 9CGTA 1TQUA 1F4AA 5ABFA 3BLKA 4AEFA 3ZR6A 2V38A 3UG3A 4DWSD 1E1EA 2F61A 4FLSA 5A6MA 1DWIM 1PZ2A 3KL0A 2E9LA 1QI0A 3AYSA 5BRQA 5E6YA 2WMJA 3EMQA 5JIWA 2DIEA 1KXVA 2YL6A 4WSJA 1V0MA 3A3HA 3N15A 1JF6A 2JEQA 3WMCA 1KGUA 6A3HA 3L4YA 4FF5A 1JD9A 2PBGA 1QHPA 1QWNA 3S2CA 2VOTA 3T0BA 3AS1A 2PWFA 1JNDA 1WZAA 5I78A 3A4AA 5A6LA 3PZUA 4OOUA 1NWTA 3RJYA 2CYGA 1VIWA 2YOCA 2DSVA 1IV8A 1B3XA 1NP2A 3N17A 2EADA 4KRTA 4W93A 1X1NA 1TCMA 1JDAA 1NM9A 1WDSA 1UKSA 1OINA 2O9PA 1NQ6A 4UQCA 4JCLA 1LG2A 1HVXA 1E0WA 1B31A 2PF0A 3SCPA 1NOUA 2GJXA 5IHSA 3SEPA 3WY2A 3I3BA 2WLZA 1XRVA 3ARRA 4UFMA 1BHGA 3EBVA 1GHRA 2J25A 2EPLX 3A47A 1DWFM 5I77A 4HA3A 5M5DA 3WH9A 3BLBA 2WCSA 1W3LA 1U30A 5DEZA 3A5VA 2V5CA 3WBEA 5I79A 5A6BD 1UWSA 2XIIA 1H5VA 4WJXA 4DUXA 3WY4A 4P7RA 3EJSA 3WH5A 5A8OA 1K9TA 2WMGA 2DEPA 2VRKA 3G6MA 1B30A 4D71A 3CUGA 3CC1A 1UZ4A 4EAMA 1TQVA 1B3YA 4PMVA 3W24A 4JFVA 1UASA 3K8LA 4W8LA 3GDBA 1V03A 3N12A 3ZOAA 1US3A 3GXIA 4WSKA 1KQZA 4OKDA 1WKYA 4U31A 1Q6CA 4AIEA 2YL8A 4OBSA 3BC9A 1K9EA 2FHCA 3OZPA 3D50A 2XM2A 3RMEA 2QMJA 1GPFA 1O7AA 1V3KA 4UFHA 1TZ7A 1XSJA 2CBIA 2X2IA 3L4TA 1QW8A 2RGMA 3ARQA 3T2PA 2C8NA 2FGLA 3VDHA 2XIBA 5C71A 7TAAA 5HPOA 5A8NA 4ZXOA 3NSMA 3FNDA 3DX3A 2YFOA 4MB4A 3KLKA 5EB8A 4JFSA 1SYTA 3DX0A 4GQQA 2BHUA 1ISWA 3WDJA 1J18A 4GPNA 1CWYA 4D1JA 2EBNA 3CPUA 3AZTA 1OSEA 2V3FA 1B0IA 2J77A 2VC9A 2G41A 1MWOA 4BQ5A 1EO7A 1SMDA 1HKKA 1HKIA 3A21A 1JZ8A 2BHZA 4RE4A 4Q22A 1WE5A 2O9RA 1HXJA 2WNWA 2Z1KA 4DM2A 3BMWA 2FH8A 2ZUTA 2OSYA 4F66A 4Q7NA 4MB5A 1E40A 3ZO9A 4WF7A 4B9ZA 2FE0A 1CIUA 4JFUA 3ZSTA 1H1NA 1XHGA 1D3CA 3L4WA 3LPGA 3E1F1 1KCLA 1QHZA 3VD7A 1TUXA 2OW7A 1HP5A 3GXMA 2VX6A 5A3HA 3IJ9A 3U57A 3B9AA 3FXYA 3UERA 2DGAA 4J3UA 4W86A 3D3AA 4AISA 4IPLA 2NW0A 1LLOA 3OLEA 1ZBCA 2UY3A 3OLIA 3UR7A 1UG6A 3OZOA 1HJUA 1RP8A 2WMKA 5BXPA 3CIVA 1EOKA 4E4PA 1E6XM 4UR9A 1W3JA 3MUAA 4TX6A 3VVGA 1NOWA 3VSVA 3AHZA 2DT2A 3I3EA 1KXHA 3DX1A 1HJVA 4NZJA 1BLIA 4P7NA 2WHLA 3VM5A 3BVTA 5TD4A 1JAEA 4AMWA 2Z1SA 4DO4A 1TQTA 5FD0A 2BS9A 3FHQA 5IFTA 3UG4A 4PMDA 4FNQA 3EDJA 3L4ZA 3EJUA 5FIPA 4JKKA 1HX0A 3BVXA 2PB1A 3SUWA 4CU7A 4AZCA 2V5DA 4P7QA 1JYWA 1V6YA 2XVPA 3VOCA 3A22A 1B9ZA 4WK9A 1QNSA 4XV0A 3VSTA 4UZSA 3AHTA 1JXKA 5A94A 4HZ7A 1MW3A 1UR9A 1HJQA 2CHOA 4JHZA 3WD4A 3MUY1 1X6LA 4H04A 1GVIA 1LWJA 5LA0A 4LPCA 2X2HA 3AIEA 1E6ZA 1ZU8A 1JI2A 3DDGA 3VX0A 4YPJA 2J4GA 1HJXA 1C91A 2J75A 4ACYA 3OB8A 4IUGA 2OSXA 3CHFA 5BXTA 3NDZA 1UOKA 3S6TA 5EBAA 4PMZA 3A4WA 3A6OA 3TV8A 5BYWA 4JIEA 2ZUUA 1KTCA 4DM1A 1VB9A 3VM7A 1UR4A 1RPKA 1ZL1A 4JL2A 3WNOA 3CHEA 2F7PA 3CZLA 3WSUA 4HTYA 1MFUA 4W88A 4M56A 3CUFA 5CGTA 1YHTA 5F7UA 2GSJA 1Y7VA 1KB3A 4YHGA 4W5ZA 3GH5A 3WNLA 3VMOA 4RE3A 3AIWA 3LPFA 1CNVA 4AWEA 2WVUA 5LYRA 1ZBWA 2BXZA 4QLLA 3AFBA 5CXPA 1E55A 3AS0A 3BUIA 3ARTA 1J11A 2EPKX 6CGTA 1IZKA 2WMIB 2WHKA 1R33A 3MU7A 1E4IA 4QFUA 4XB3A 1PPIA 1J0HA 4KWUA 1BG4A 1CGXA 3HJEA 3QHMA 2WK2A 2PI6A 2WWDA 4Z2HA 2EPMX 3VIFA 4TTUA 1ZBKA 1E70M 1KXQA 2CIPA 3EMCA 2WVVA 2X1IA 1BVNP 3ZJ6A 1VEMA 3WL0A 1ISYA 2F8QA 3PZMA 1QX1A 2YA0A 4N0RA 4J3WA 1IT0A 4C7FA 4PSPA 3W53A 2E9MA 1UR0A 3DC0A 3CH9A 4AZ7A 2ZX9A 4NZCA 3ZIZA 1D7FA 4S3JA 3CZNA 4UFLA 4J3SA 1HTYA 5GNXA 5E6ZA 4R5EA 2E9BA 1W9XA 5A8PA 4JL1A 1OT1A 2AAAA 1FH8A 3WIJA 3N04A 4HP5A 4U2ZA 1W2PA 4HMDA 1E72M 5M17A 3CTTA 5FL0A 1V0NA 4D72A 3FAWA 3EDEA 4E2OA 5GPRA 3VD3A 2XGBA 3FAXA 4PTVA 1OIFA 2WMIA 1TA3A 1GOQA 1XYZA 2ZXQA 1DHKA 3GBDA 1ITXA 1D2KA 1HN1A 2WKGA 2D22A 4LQ1A 1V0KA 2VL4A 4XZWA 3N18A 4L4PA 3ARYA 4PBGA 1E43A 4AZ6A 4V2XA 5BROA 3ARXA 3BVWA 1M7XA 3W37A 3AIQA 2IXVA 2O9OA 4PYSA 5DT7A 2YA2A 4DO5A 8A3HA 2UY5A 4ACZB 1W1PA 3WH8A 3ARVA 3WQWA 3LXCA 2F18A 4URIA 4CGTA 2X09A 4AIUA 1Q6FA 3WNKA 1V3IA 5CGMA 4CCEA 3VNYA 2VNCA 3FY1A 3T2OA 2XVKA 4UFJA 5D8ZA 4BF7A 4W7WA 3AISA 3AS3A 3AIVA 4R27A 2A3EA 3WEMA 1CENA 3PZNA 3WNPA 2CESA 1OWQA 3TTOA 4B3LA 2WKLA 3K1DA 2VZSA 1XH1A 1J0YA 4A3HA 1TG7A 1HL8A 2WC7A 1JIBA 1TA3B 3IAPA 1QNPA 3AIRA 1R47A 4W84A 1JAKA 1UH3A 2X2JA 3BLPX 1TVNA 1ISVA 2D73A 4D6EA 3AIUA 4CUCA 1HKJA 2X0YA 3POCA 1CBGA 3SCOA 2GJXB 3A24A 4CN1A 4MAZA 1GQLA 1AQMA 2D1ZA 4W87A 3T0AA 1XCWA 3SCUA 4D6IA 2VZVA 4ACZA 4M80A 2BV9A 3VTRA 3U7VA 2J7GA 2PWGA 4AMCA 4AZHA 1QBAA 3AMDA 3CV5A 1B2YA 1V3JA 1GJUA 3LX9A 2YL9A 1G5AA 1EO5A 4FLOA 4B15A 4M82A 1Q6EA 2X05A 4WKAA 3OIHA 4BQ4A 2EO7A 4GO9A 2XJ7A 2AOSA 1JZ5A 3MMWA 1B3VA 1BFNA 4JAWA 2DSKA 3DYPA 1C7TA 1EH9A 1HP4A 2VX4A 4AD3A 2XVLA 4ATWA 1DEDA 2WSKA 5CZKA 5HOSA 3FHAA 5BCAA 3LXAA 2WWCA 4H2CA 2WANA 1RD6A 4HZ8A 3VIPA 3A23A 5HBFA 4HPHA 4AW7A 3PTKA 5AYIA 1KTBA 3WFLA 2YDQA 3VD4A 5DT5A 4MPKA 3PHAA 4HZ6A 2F7OA 3THDA 1I1WA 2FYVA 1ISXA 5AYBA 2JF7A 1P6WA 1OM0A 3CZ8A 4PEEA 1TR1A 4CN6A 1UKPA 4PMQA 5D9PA 2ZIDA 1U2YA 2DT1A 1VENA 2EPNA 2PBOA 4UCFA 4QP0A 3LMYA 4TXEA 2BHYA 2Y2WA 4BA0A 4FK9A 1KFWA 1E71M 1FFQA 2PWDA 2VR4A 3HU7A 4J28A 3L4VA 1FOBA 4LX4A 2F1BA 2FH6A 4P8UA 1QNQA 5E0CA 3W6MA 3AMGA 4U3CA 3IANA 1B3WA 5BWFA 4MADA 1G01A 5M3WA 2YKKA 2W67A 1UQYA 3CO4A 4D6DA 1BYBA 2W62A 1BYDA 3NYDA 3VIJA 2X0HA 2WSPA 3VMPA 1H0GA 1VBRA 4W8AA 2GVYA 2DSWA 2JFEX 3WQ4A 3SCRA 2XFRA 2VX5A 4HA1A 1TQWA 1E6PA 1FA2A 2W63A 1UHVA 1EHNA 1R87A 1VFOA 2GDVA 1V3LA 1BG9A 3SUVA 2OW6A 3QR3A 1UA3A 2JF6A 1ESWA 3SCQA 5E0FA 4YN5A 2D23A 1G1YA 1M53A 2YL5A 1W2VA 3ARPA 4W7VA 3CZKA 1TE1A 3PZTA 2ZUWA 4X9YA 1EXPA 1UD5A 1SZNA 3D4YA 2BY0A 4HA4A 3NUKA 1S46A 1EDTA 2BY3A 3W26A 1UR1A 3WQ8A 2OWCA 3N11A 1LL7A 5BRPA 2DH3A 3JUGA 3BGAA 5KEZA 5JBDA 3F5LA 3LRKA 2DDXA 2VCCA 1R8LA 1E5JA 3TOPA 2YBUA 1BGGA 2W66A 1Q6GA 2VUYA 2C7FA 1KR0A 1HNYA 2E40A 1PIGA 3EJTA 3VD9A 2PWHA 3AYRA 4FNPA 2G3NA 3SUTA 3ZJKA 3CUIA 4MAVA 4UOQA 3BAIA 3GZAA 2XYLA 1I1XA 1CGTA 3BUQA 1KWGA 1EDGA 3BVVA 4AZ5A 3WY3A 2GUYA 1DP0A 3GNRA 3A4XA 4GZIA 5EFDA 3DYMA 1VJSA 4A3YA 1YQ2A 4PTWA 3EJQA 3UESA 3WUBA 2FHBA 3RDKA 1UD3A 2ESCA 1JNEA 1M04A 4Z2GA 2VQTA 1ODUA 3ZSSA 3RJXA 3MUIA 3W25A 3WY1A 3CUJA 3T2QA 4DWSB 4Z2KA 2JIEA 5CSUA 1ECEA 1OCQA 1V6WA 3TP4A 1H09A 3VGBA 4C7GA 3BAXA 4XX6A 5CPTA 2NT0A 4UOJA 3M7SA 3WF2A 1ZBVA 3CMJA 3GH4A 4MDOA 3SCVA 4Y7EA 3QOKA 1W9DM 2YDSA 2OWXA 4AD1A 5A69A 4D1IA 3VIOA 3CHDA 3KL5A 1XCXA 5BXSA 2WC3A 4HOZA 3WMBA 4M24A 4MJ4A 1XC6A 1H11A 4AEEA 3GTNA 1JG9A 1PBGA 3GXPA 2QF8A 2QLYA 2WMHA 3NDYA 4UQBA 3SURA 4F79A 4PMXA 4U3AA 1QW9A 3AXHA 4QCFA 1G94A 3MMDA 2WHMA 4AZGA 7CGTA 3WMSA 5EFFA 2VJXA 3D51A 3WELA 3BSGA 1QNOA 2OWWA 4EE9A 3WUFA 2CXGA 1WPCA 2Y5EA 3K8MA 3OA5A 1NWSA 4CCCA 4AZCB 1UD4A 1CYGA 2BY1A 4AIOA 3B9DA 3WDQA 5E9AA 4B3KA 3WD2A 4L4OA 1XH0A 1HJSA 3DHPA 2VVNA 2XVNA 3VMNA 2OLHA 4OBRA 4C7DA 4QLJA 3GNOA 4TTGA 4J7RA 1E3ZA 3GYCA 3SCNA 4JKLA 5I24A 4WKHA 4CVWA 2JE8A 4QCEA 3VDCA 1KBBA 1B1YA 1PIFA 3WKZA 2QPSA 1MW0A 3DX4A 5LA2A 4HMEA 1E0VA 2D3LA 1I75A 2VCAA 2F2HA 1MQRA 3W29A 1GONA 2XGIA 1HF6A 4U2YA 1C92A 2UY4A 3AZRA 3VO0A 2XFYA 4AD4A 1KGWA 3WH6A 2GK1A 2D20A 3O9NA 4TX8A 2J74A 2ZWZA 3GBEA 1UWQA 5A8QA 1HL9A 1NOFA 1NH6A 1LL4A 3DHUA 3IJ8A 4IISA 3DYOA 1HKMA 1UWIA 1B90A 4PTXA 2E8ZA 1C93A 1E6RA 5E09A 1C8YA 2GFTA 2CKSA 4GQRA 1UWUA 4JZ5A 2UWFA 4XZBA 4GZEA 1DTUA 1ODZA 1CXKA 1OB0A 4NRSA 2VMFA 2BNJA 2J7EA 4OUEA 1V3MA 5DO8A 4B9YA 4J27A 1W3KA 2OYLA 2J7BA 2XN2A 1UWRA 1OT2A 3WF0A 4HU0A 1C8QA 3CZEA 2DQXA 2VZUA 1E6QM 1XV8A 4J3VA 1GOIA 2QPUA 1UD6A 1KCKA 5CPSA 1JFHA 1JYNA 3AIBA 1MVYA 1O6IA 4JCMA 4NI3A 1BSIA 4P8VA 4PMRA 2EACA 3TA9A 1VFMA 4Z2JA 2ZUMA 4D6FA 3AZSA 4FNRA 3RM8A 2VZTA 2WZHA 4HOWA 1H0IA 2YA1A 2GJPA 1WO2A 1KXTA 2IGTA 2G3MA 5DF0A 3KE0A 3HN3A 1GCYA 2BY2A 2J7FA 4BZYA 2VVSA 3VNZA 3BVUA 1QI4A 3LPPA 1GHSA 3IK2A 1QOXA 3WNNA 2QHAA 1FFRA 2XFFA 2WVVB 1W9VA 1EGZA 1PAMA 2OYMA 1QI5A 2EJ1A 2WZEA 3PTMA 1CXIA 3AS2A 2HVMA 4H8VA 3WD1A 3L4XA 1N82A 1CECA 1WP6A 2J7DA 1HWWA 1QHOA 4HMCA 3THCA 2XVGA 4PMUA 4OZOA 4NXSA 1E3XA 3ZJ8A 1C3FA 4F8XA 1GZJA 4UNIA 1TQSA 2DPEA 5I23A 2F7QA 1OGSA 3AXXA 3RILA 3ARZA 1CTNA 3K8KA 3RIKA 3MI6A 4IM4A 1E0XA 4LYPA 4ZEPA 4OJYA 3NSXA 3VIMA 3CUHA 1CGWA 5A8MA 3DDFA 4UFKA 3W38A 5JBFA 3ZM8A 4RL3A 1LL6A 1W1TA 4CD8A 2WVSA 5IDIA 3QGVA 5A2BA 2CETA 2W92A 4F9DA 2FHFA 2ZICA 1AQHA 3PZVA 1LWHA 2YBTA 1J12A 3VIKA 4N42A 3ZR5A 5I3DA 5C70A 1HT6A 5D8WA 2ZUSA 3TTQA 3NCOA 4PUEA 3T09A 3ARSA 3N1AA 4PTMA 3BAKA 1XGZA 4LXFA 1XD1A 2RGLA 1E73M 1FP9A 1GUVA 2QV4A 1R34A 1FH9A 5D9NA 1MXDA 1CXEA 5FKYA 4FNSA 3AHYA 1QVBA 1NWRA 2XG9A 1BQCA 3K4AA 2ZX5A 2J7CA 4KRUA 2WW5A 2PWEA 5JBEA 2Y24A 4DUWA 4GI9A 1W9BM 7A3HA 3LRMA 3BXWA 2WZIA 2CBJA 3AXIA 3G6LA 3MMUA 4HPGA 3AQUA 1KGXA 2DT0A 1HXKA 1WB0A 2O9TA 2YLAA 1V6VA 3WQ5A 1RH9A 2XWDA 5GQBA 1ZS2A 2CKRA 1NWUA 3LXBA 1JL8A 1SMAA 1E1FA 2GK1B 5ABEA 4AXNA 1E6NA 2WCGA 2YLLA 4XUYA 3WQ6A 3BMVA 1W9PA 1VRXA 1ZJAA 3HZ3A 3W82A 4D6JA 3M6DA 3GH7A 1DWJM 4NRRA 4HOXA 1VFUA 2F1AA 4H41A 1E4LA 3L2LA 1GW1A 4NXKA 1V0LA 1UYQA 1BPLB 4NZFA 1UD2A 3VX1A 5FOOA 1W9UA 4CD4A 1DWGM 1R46A 5GNYA 3SIMA 2J62A 2XPKA 3QHOA 1LJYA 3QOMA 5AC5A 1R86A 2WB5A 3IAQA 3UEQA 1ZB5A 1WCGA 3SCWA 4PSRA 3UG5A 1LF1A 3AROA 1EIBA 1QPKA 1W1YA 2BXYA 4FNUA 2W61A 3VKKA 1CEOA 1T0OA 1UA7A 3AHXA 3HG2A 2VRQA 4FLQA 3AOFA 5IFPA 3ARWA 4BS0A 3CMGA 3TONA 3ZT7A 3S5YA 1EOMA 2D24A 1VFFA 2WHJA 3AMKA 3BUDA 3MSGA 3MSDA 3M07A 4RE2A 5CLTA 3B9EA 4PMNA 3W0KA 4CVUA 2W5FA 1JDCA 2ZXAA 3OGVA 4W8BA 5CPQA 2ZX8A 4EK7A 1SFSA 3B8SA 4QAWA 2DT3A 1W3HA 4H7VA 3FN9A 1UH4A 2EAEA 4OOZA 5M03A 5JUVA 4KGJA 2ZXBA 4S3KA 3WQVA 5ABHA 2ZX6A 2XN0A 5D4YA 3EDDA 5A2CA 2VTFA 4BCEA 4CCDA 3W81A 1CPUA 2E3ZA 3I3DA 1MW2A 4CKQA 2Y8KA 3ALGA 1PX4A 3KEHA 3F5KA 1UH2A 4P7LA 4OGZA 2D0HA 2EEXA 5D9OA 2BVYA 5KZ6A 1V02A 1X6NA 1XYFA 1PX3A 1DWHM 2CITA 3VGDA 1OBAA 1KWKA 1GOKA 3T0DA 4PN2A 1UKQA 1QI2A 2XSAA 1E56A 4J3XA 1QI3A 4AMXA 3SCTA 3VGGA 3W28A 1U33A 3AI0A 4TVDA 4MNJA 2DSUA 5D9MA 5A6AA 3U7BA 4AZIA 2EABA 3ZMRA 4NX0A 4GI8A 1JDDA 1MQQA 4QLKA 1GQIA 3TTYA 2TAAA 3BAYA 2DIJA 2A3BA 2VI0A 3NIYA 3VSUA 1JF5A 5ECUA 1M03A 1OGBA 2CERA 1C90A 3NJ3A 4TVCA 3AMCA 1JI1A 2J8GA 3VGEA 5LA1A 2G3IA 2XHYA 3PZGA 4J3TA 4M81A 5GNZA 1CXHA 5A6KA 2MANA 2ZX7A 3WENA 1O7DC 1WNOA 4ZE4A 3PZIA 1LQ0A 4ATLA 1K9DA 1PS3A 4U33A 3HMCA 2ZUVA 1KQYA 5AC4A 3VD5A 1AQ0A 5DMYA 3LPOA 2V3GA 5I6SA 4PMOA 2E8YA 1MQPA 3WD0A 1JZ4A 3O2LA 3EJPA 3W6LA 1XH2A 2C0HA 2CNCA 1H41A 2DSZA 1VAHA 4AYSA 4TOQA 2VX7A 2BFGA 4UQAA 1EA9C 1TVPA 3OLGA 1WDQA 2XTKA 2FGZA 3OBAA 4KGLA 3CZSA 2E4TA 4MJ2A 2CBVA 2JIWA 2ZUNA 2EQDA 3WBAA 4D6CA 1WAWA 4E8DA 1GOOA 3IGUA 1M01A 3WD3A 1ISZA 1HVQA 3ARUA 1BAGA 3WN6A 1E9LA
chains in the Genus database with same CATH superfamily
3FTGA 3ZW3A 3WDHA 1JZ3A 1EZUA 4QEGA 2B31A 2YDRA 3JWNH 3M46A 5I5IA 5SX5H 3ZIYA 3BX7C 4PD4J 4GD0A 4QRTB 1J5OL 3N6QA 4HK0B 5MENE 5KVGL 4I3SL 2PGEA 2H45A 1NUDA 4ODXB 2I9UA 3CGTA 1NVMA 4Y1SA 2PP3A 3ITLA 3WFZA 2AXGB 2YPLA 4N2LA 1URIA 3L7EA 1FYTA 5L4MA 3LGEA 2XZAH 1Y5VA 3NZSA 2GFBB 4X4YA 1LRQA 1Q63A 3F03K 3EO9L 3VC5A 2PC4A 2ZXWB 2JKPA 1MRCH 4UZUA 3GPSA 4FEIA 1GKEA 5CEZD 4G83A 2ZONA 3VDBA 4XP4L 1I2PA 2QUVA 1OTUC 1I3RA 4NZRH 1NL0L 3RVVC 4JR5A 1JPIA 1AG6A 3B2XA 4LB3A 3IJEA 4LRNH 1JFXA 5HHOE 4A7TA 3RAJL 1G9HA 3OXSB 4GEJA 5C0NC 2DVXA 1YPZB 2EG7A 1L0PA 3GVRA 3T44A 4G7YL 1F3WA 3D33A 4MD5A 2SFPA 1D6VH 1QBBA 3V4BA 4PJ7B 3CFJA 4PWJA 4Y4FC 3N43B 4HFUH 2JJWA 4NO5B 1KD0A 1U2CA 4YHYB 4QBXA 1DJWA 3WLNA 1N6UA 4XBGB 5I2UA 4FADA 1XLEA 4MAYC 4GJIA 4GI6A 3UYIA 4AVJA 4R5TA 4GBXB 4D6CA 5H94B 2DTML 3AICA 2HJLA 4Z7OF 5C7VA 2B0SL 2Q7YB 5DJ6B 1R3YA 4HJWA 1I0BA 2CCRA 1VJIA 3S4TA 4A05A 1GOMA 1TTCA 2VQUA 3F2CA 1XD0A 3P9MA 3R0NA 4ZXBC 5IFAL 1TT6A 3TT3H 5FCSH 1XUUA 4FR1A 1U42A 1KRBC 4N0UA 1TKWB 4A4AA 2W38A 2X0VA 4ZFFA 1GQKA 2V9UA 2J8FA 3L7FA 2BWIA 2CCWA 3WH6A 3QDGE 4ZTOL 3C6SA 3GRBA 4WFHD 1E5NA 1MFBH 4CQDA 4FLHA 3NTCL 2YUZA 4GKLA 4PTTB 3ZQXA 4LGXA 3CFBA 5FKAB 2XKSA 3ZT5A 5HXMA 2HQAA 4MMZB 4W89A 3TJ4A 2ATPA 1RZFL 3NP3A 3JT0A 4K07A 4ACPA 1EK3A 4Y1AA 3EMZA 1F6YA 5LN4A 4UWQB 3JSSA 1XIWC 4YBQD 1DQTA 3DRTB 1U1UA 3LV3A 2WYSA 1UZ6E 5ID1A 5JUEH 4XZ4A 2NY5L 3FB6A 2CNZA 4AD5A 1J0ZA 1Q7QA 3M0IA 1N19A 3SDAB 2WQUA 5G4OA 2TRHA 1A6ZB 1NCDH 4GIRA 2WMPB 1AD9A 1N2RA 3HB3D 3N1FC 4JY5L 4HPYH 4M6NL 4F37K 5F0PB 2QJJA 4MLSA 4Z7AA 2ILLA 3CDCA 3S37L 2ED7A 2LTQC 3ECQA 4N5ED 2ZCHL 4QJ4B 1F7BA 2R14A 1CLXA 4EANA 1E9IA 3MYPA 1BQ5A 4NUJA 3QDHA 2AXFA 1IEQA 1WK0A 2APVA 5JQ6L 3F7VA 5EU6A 2EEFA 3MOQA 1MRFL 4Y89A 4OI9A 2VDPL 5DK2B 4D6HA 5HDOA 1TQXA 4GRMB 4M93C 1NGQL 3NQ2A 5E5UB 3QN3A 3ALWA 5GRWA 3V4VA 3BL3A 4EKJA 1WVZA 1NANI 3C2AL 1YNYA 4FDWA 5BUAA 3GUFA 2EVJA 4K39A 3CN3A 3MCYA 3DG6A 2BX5A 2DQMA 1EHXA 1DZ0A 2FIKB 2WTRB 1ADQA 3QW9A 3CHOA 4U5IA 2QNEA 2X4UA 1JZJA 2JVUA 3GHEL 5E9DD 2FPYA 3BPLB 4ZUTA 4GA8A 1GS6X 2JQZA 4QM1A 2E7BA 2ZCLH 1DJXA 4HB7A 3ULUL 1BREA 2PDWA 3MBFA 3AJ7A 5INCA 4U1HB 3LH9A 2BIOA 3MV11 2G3ZA 2PPAA 3ZKXC 3ZDYB 1IL1A 1IQWL 2CZFA 2R8SH 3K30A 3E3QE 1WDPA 2X9YA 4MQXD 3ZDZE 2GC4C 2J79A 2V5JA 4FXFA 1E6JH 2VM9A 1HC1A 4ZI8A 4PH6A 3UPMA 2ZPKH 5T8IA 3VNJA 1V8EA 3PPEA 4TR9A 3IEBA 1DVYA 3OZ9L 1UR8A 4UQ9A 3WO8A 2AVFA 4UMSA 3HG4A 3N13A 2EDKA 1IGMH 3V4LA 1X5ZA 4NC1C 3WUGA 4LSVL 4NUQA 3P2VA 3OGRA 4OE7A 1QSEA 3FN3A 3O6KH 2L3BA 2OMUA 3AMLA 3DBSA 2J88L 3IVTA 2VR9A 5I16B 1XLBA 2NX3A 3EGDB 5DJ2B 3BKYL 4HIEB 4X7CC 4ZQKB 3WLLA 2J27A 1RMFH 3SY8A 2KX9A 5D93B 15C8H 1POJA 1KXTB 2IV8A 2OMBA 2OSWA 1DQQA 2DLEA 3K4DA 3L54A 4MA8L 4MBRA 2NUYA 4BQ8A 4P2YA 4R4FL 2QSCH 3BMXA 1I1AC 3WJJA 1JGDA 4PG2C 1TV4A 2V82A 35C8H 3JVGC 4GINA 4QRUA 2A3HA 3H70A 3U9UA 1K6WA 5D2TA 2VXTH 1NIAA 5FW7A 1RLWA 3BKMH 4I18B 3U0PB 3I4KA 2H8PA 6TAAA 5SWUA 3CZUB 1EPVA 5A7EA 3Q8EA 1EFZA 3D3VB 5A8NA 1C9DA 4Z78A 4XR8C 5DK0A 1WZLA 2AQSA 2WNZA 3BD5A 3N6YA 3HRZB 1CCWB 3C60C 4OFCA 1ECYA 4W6XB 5C0JA 2IF7A 3LKOB 4E8CA 4DO6A 1U8CA 1YEKL 4BHUI 4EDWL 1WZ1H 4QPEA 5I8KL 3ULVL 2E9GA 3RY4A 2QDGA 3ORWA 1CXLA 1AG1O 4HYTB 4LVHC 3S3SA 4LH8A 5BXTA 5I0ZA 3BEWA 1U8IA 1A6TA 3UZXA 1WWBX 3LCWA 1FNSL 3O6AA 2F7RA 1KIRA 5E1QA 3CN0A 5EUOF 4F1ZA 5H4YA 4QDGA 3QH3A 1OYAA 1Q2RA 5A95A 1U8HA 1ZA6B 2F5AL 3V0AC 4ZUSA 1TPDA 1DUZB 1INDL 1G7JB 3EJZD 1CBVL 1LG1A 3BH8B 4PVNA 3EGSA 1N8FA 1R3IH 4A68A 3MJGX 3MLWL 4FABH 1AY1L 1OANA 1WUZA 3T04D 4AXWA 1E9YB 3C09B 4QHUA 1JUEA 5C2GA 1OF0A 3P9LB 3EWZA 5I9QC 3NQ7A 3E8UL 5AAWC 4G80A 3HG5A 4FJ6A 1K8ZA 3G5XB 5E24E 1PV8A 5HUOA 1DBJH 5HYSB 3GGWA 5EBMB 4Z2LA 2FMNA 2V9DA 3VGAB 4IDJH 1NUFA 1FL3A 2G0WA 1BX2B 3MLXL 4AUJA 1ADOA 1R5VB 2P5NA 3NABL 2Y8UA 4L4VD 3GXTA 4A6GA 3CDZA 2YQBA 2XH7A 4EXBA 2WM0A 5AVQB 3VFOA 4Z76B 4ZZ9A 1EGJL 3HZKB 3MRBB 5BZWB 1KFJA 2VKXA 5LBSH 1BW8A 5DD1H 4XH2B 3SCMD 4UTAL 1OCWH 3BT2H 1TFHA 3NH7L 2D2HA 3W27A 1A47A 3ELAT 4JB9H 5B38A 1LO2L 1XGPB 5AY7A 3BG3A 2I24N 1MI5E 4WDTA 3SQSA 4ORGA 2C7UA 2E7DA 3FT4A 4Y1AE 4Y4FB 3VFPB 3HE6B 4EKXA 3VXUB 3CVHH 3WXWH 4P8XA 4EMZA 3LS4L 1IMHC 1I9EA 2A4AA 1SPDA 5IHUL 3W75A 2D2CC 3OAYH 2OMTB 3VGFA 3ROOA 4CD5A 3IDJB 4E41E 4U1NB 4GSDL 3CZJA 4A8NA 4EN3C 4NHCH 5ABFB 3WNJA 3MUXA 2YIHA 1SVZA 1YPZA 2FEDD 3OYZA 1U4EA 1JGIA 3OWEA 3SDCC 5CN1A 4Z7OB 1ACZA 5EMJA 5FF6B 5MKGA 2BJMH 1I45A 1EEUA 4D3CH 1E6SM 1NFPA 2QW5A 2W5PA 1Y0EA 2SEBB 5IQ7L 2O5YH 3BKJH 3COTA 4ATDA 4DWSA 3L23A 4JRYA 3MVTA 4D0DB 2HFTA 2GSGB 3NP4A 4AY8A 4LKXB 4Z0XA 2MTAA 2N56A 3P11L 4XNZC 3U2SB 5FW8A 1WAAF 3BAWA 4NQSB 3BARA 2CHWA 2ZKXA 4OQTA 3VRJA 3KVLA 2F74B 3UETA 4HVXA 1B88A 4JGUA 2QCDB 1AH1A 4HAKA 2V5LA 2EE2A 3E6FB 3PWLB 3TJEL 3Q6GL 1R0AL 2NQHA 2ZRWA 1QK2A 5L2KA 2Z29A 2V33A 1OHZA 4I0PB 1X6UA 4ZFFB 1LEGB 1XF0A 4F4RA 1NIFA 4E9WA 4XNYL 3DX9A 1LORA 8CGTA 1DR9A 1TWDA 4GYPC 4D9LH 1KIQA 4OD1L 1CGUA 4ODTH 4JO4H 3QSKB 2YAOA 1FPTL 4H40A 1NBCA 3JV4B 4PTTA 5IEKB 5IMLA 2YS4A 4C58B 1CR9H 4DP9X 2FCBA 2HT3D 4FJYA 3ZWSA 5E1AA 2B5IC 4IBWA 2QCMA 3CL8A 3PAVA 3AXKA 5C0IB 4CNOA 1JD7A 3HI6H 3KXFB 4OF7A 4FOUA 3W7KA 2VFDA 1A7OL 3KYOB 3TMQA 4MA8H 2A3AA 2Y5QA 3BP4B 5GGRA 3EOEA 4GUOA 4Q4KA 4ZFMA 4NJAH 1AHWA 4ODSH 2V69A 2W0UA 1T04A 1RZ7H 4KVNL 1CI1A 3VIHA 2N0KA 4ADTA 3PTQA 4FA7B 3VXMA 3KLLA 3O0LA 1XC4A 2XETA 1U95A 2C6QA 2ZA1A 3PJNA 3QE5A 4D72A 3PY2A 1ASOA 1ALDA 4P5KB 3B0VC 3LV6A 1E2ZA 2Y2TA 2WQSA 2EH8L 1TV5A 4DNHA 3GUGA 2YB1A 3GDCA 3F6IA 4AYID 2EVIA 2TPSA 4HNVA 3E96A 1J0JA 2QMKA 3ZGHA 2BSTB 5KSAD 1GORA 1XSKA 3ALFA 4JKMA 4PJDB 3EFFA 4V33A 3REVA 1FYHB 1U5VA 3I68A 1AGDA 5D4HA 3UD6A 2BVQA 3V5CA 1N7ML 2P1FA 4AD2A 4F9PA 1JGVH 1PSKH 1VFAA 4B27A 5CEZE 5CWSB 1CURA 1FJ1A 2VDQB 3UCQA 2M8XA 4QCIA 5CZXC 4BSWB 3K2GA 1RK0B 4RBPK 3RVTD 4MNKA 1HHGA 5DHYA 3H56A 2L5HA 2WYIA 4DK6A 2P5WD 2WPGA 3ZDXB 5A6SA 1EUUA 2JALA 5K39B 3RPIA 2EDQA 4LLQA 4WO4C 4X8CA 4HS6A 3EOYG 3IJSB 4I77L 4OT1L 4EI5A 3KOWA 3WSUA 2WZ5A 4R4FH 1XIJA 4FX6M 3WF4A 1VBUA 3QZPA 4PRTA 2DW5A 1FDLH 1GZQB 3L4CA 4M7LL 4N2EA 2R94A 2H2SC 1A21A 4KROC 3GO2A 4IYKA 3QZAA 1ZPTA 4HJ1A 1TKKA 3UYPA 1OAXH 3VINA 4DJED 4MNHB 1NGZB 1NGYB 4G6AD 1IJ9A 2APXA 2V2DA 3MV01 1F5ZA 1QLEL 4FULA 1XW8A 1SVDA 2CEQA 3GW0A 1T5WA 2OP4L 3ATAA 1DQDH 3MRFA 3OSVA 3LRGA 4MB3A 3PP3H 4H2HA 1WAEA 1A9EA 3T2LA 1C1EL 5CBJA 5B3JE 1VCFA 2XOTA 1BDYA 4MA3B 5L0QC 1TPUA 4ZE5A 4Z7UB 2DQGH 4GAGH 3KYMA 4BQ3A 1BGAA 4V2CB 1KLYA 1VJZA 2BWQA 4PB0L 4W6YB 4OZGA 5E8PB 1FYTE 3BI9X 1INEL 5A2FA 2VN3A 3FU8A 1MIMH 2JEPA 4DXKA 4PY7A 1KR1A 4WV1C 4DBSA 3Q2NA 4KQ4L 1UCBH 1Z9OA 4LFHG 4DEWA 5TTRA 4EZKA 2NW3B 3HRZA 2OX5B 3O3EB 1OP3H 4O8RA 4Q9CA 3VFCA 2QS8A 2GPTA 3HURA 2CKBH 3CUPA 3EYFA 4IM8A 1L8PA 1W8EA 2H3BA 3P0YH 2LAAA 2OLDA 5HULA 1EFXA 4K8RL 3HIJA 1F58L 1TZZA 4HZAA 4LEXL 3UWQA 2C15A 1YA5A 3QQDA 3M64A 3SDXF 1T21B 2MUCA 3ML9A 3QW4B 1QBML 1PUDA 2PW2A 4HGWB 1EGJH 4L8SC 5E2VH 2G3JA 3SBFA 3X13B 2VWSA 2BIPA 1JSYA 3HHSA 2CBTA 4HS3B 3PXJA 2OU4A 3UXDA 3BH8A 5T1DH 1JV2A 1U21A 5T26A 5AW5B 3BGFC 2OXGB 2B7PA 3B03A 5LIUX 2R0KL 1MCDA 3NPZB 5K9XA 1MCJA 3MW7A 3LNDA 1AUSL 2VDKL 4WV1A 1OKEA 3NL3A 2OTWB 2AQ3A 3KDMB 5LCVL 1UZGA 4N3TA 5ALBH 3AT0A 3CFMA 4XVUC 3SUSA 2Y4SA 3URBA 1DQVA 3QUGA 5CPMA 4WKXA 1NCWH 5TH2A 3B8DA 2DUZA 4TX9A 2X53A 1SW3A 1WJ3A 2ZZ7A 3QDJB 4OZIF 5EU9A 2G5BB 4J39A 1A5NC 4DNMA 3M88A 2OMYA 3DSNB 4YVVA 2QJHA 2I14A 3EDKA 2WN2A 3MN8A 4H20H 5ECJE 5A16A 1SYVA 1P7KB 1JPDX 1BFOB 1DN0A 1Z66A 2OTUB 3I6KA 3GJEA 3INOA 5DRWA 1VF8A 3KR3L 3QRFM 1Z69A 1JYVA 2XWJB 1AANA 2EIBA 3JUYA 3D46A 3UCDA 4LNVA 3DOHA 4O2FB 4QY8B 3ONBA 2IPTH 1SLXA 4QRRE 1SQ7A 1O12A 4XNZB 1B4JH 2CRZA 5C0AA 5CG0A 1HUVA 1R5YA 4M1DH 2C4FT 3OKMB 2XZQL 3VZYA 4UTUA 3VXUA 2FLBT 1IJNA 2ENJA 4LF1A 4ML4A 1Q94B 4LSSH 3I6LD 1KELL 4IQHA 3QYNA 1Z9MA 2I9TA 3L95B 1IAKA 1TQUA 3EO0B 4BGLA 4H2AA 3H4XA 5IB3B 2VEPA 3O11B 3EXTA 3NQGA 4K1WA 4P23D 3BLKA 3G0SA 5ABFA 3F85A 3CLEH 5ACLA 1CFTB 2V38A 2X2GA 2IMMA 4KJQC 5ID0A 2WO3B 3L65A 2R2HA 1SUJA 3GSXB 4NRXB 2RAGA 2F61A 3IS1X 3LD8B 1QR1A 2CKBB 2AQWA 1EBPA 2PD5A 2E9LA 4LMQE 1QI0A 1LJMA 4WI0B 5BRQA 3AYSA 3RGTA 1EJSC 5E6YA 2IWKA 2WMJA 1WV2A 2DIEA 2EG6A 1AO7A 3KYNA 4RFOL 5EF1A 3KWVA 3AWNA 3N19B 4HNUA 3GS6A 2YAEA 4LHUA 5M7QA 4AQAB 1AAJA 2H0FA 5L6UA 1JNHB 3W5NA 2YL6A 4WSJA 4AAJA 4MJIB 4HHGA 1WCQA 5D2NA 1YNTF 3Q05A 1JF6A 2V30A 3N15A 5CP7A 4J40A 2VMEA 1F97A 4HUXA 3GKFA 4OD3H 3TNMB 3TCEA 1KEML 1NA8A 1T1XA 1YJDC 2GIMA 5F9WC 3WLWD 1BF8A 1J8VA 2Z2UA 1CICB 3AVEA 3G9AB 4NPKA 3IGXA 1R17A 3BPOB 3CFUA 4PVBA 5F1VA 4B60A 3T0BA 4RFEA 1BMWA 2JQXA 3BRDA 3U83A 5I15H 3PL6D 4ZTPH 3SDDC 1R6WA 4QE4A 2NUTA 3WK0A 4URTB 4UTWC 5ICXA 1XDTT 4P9MH 1XIGA 3LBMA 1IAII 1VIWA 4HOMA 2COQA 2NNRA 4LCIH 2Y36H 2WWKO 3BP4A 5ERWB 3OJ2C 3GSQB 4WO4D 1X1NA 4R83A 4JIQA 1MAKA 2FIRT 3MPGA 3TA3C 1WDSA 2WBWB 2WLLA 3ULUE 1LEIA 2ZYRA 2GOUA 2KZHA 3SYCA 4UMBA 2UXTA 2NLIA 2AKRB 5E4OA 1HOCB 2O9PA 3T05A 3CK5A 4UQCA 3WE6A 3DMMB 1X5IA 2X7LB 4JCLA 3WUWA 4M9OA 5IG7A 4M1CD 3P82A 2F58L 3TPKA 5CS7A 4M51A 1V55B 1LG2A 1WLHA 1MY7A 3M86A 5D1XE 2QCHA 1B31A 2PF0A 4E3TA 2ZC8A 4X60A 2LU5A 3LRHA 1ZGLP 5IHSA 3SEPA 4YO0A 3BZEB 2IQDA 4TVSa 3O4LE 3WY2A 1YTEA 1GAFL 3ETTA 2RDUA 3H2NA 4ZOCA 1LO0L 1NQBA 1WCBB 2Z1BA 2OQJB 4QWWD 1GHRA 2J1XA 1GPOH 2J25A 2PN5A 2Y6TE 4PS3A 1CT5A 3CAVA 4GY1A 4ODUA 4DP2X 3HC3H 2N4IA 3HPAA 3QUXA 1W3LA 1VZGA 4P2RB 3S0CA 2WZ6A 4OGAD 4A55A 4HBKA 4HIHA 1HHGB 3QAQA 3ARBD 2MEJB 5DEZA 1IVTA 3QXAA 3A5VA 4WWOA 2YYTA 1OHQA 3OJGA 2GSHA 4Q7IA 2HVJB 2WQAA 4ELDA 1UWSA 2XIIA 5TF1L 2GK2A 2VDKH 1O95A 1AZUA 2IOMA 4M43H 4AMKH 2Y7FA 1MMFA 2CIKA 3TN5A 3EJSA 3MTRA 2ZG2A 3MRMA 1X3DA 2B0MA 4NC1E 2DEPA 2JCWA 2PXYB 5IB4A 1ENUA 3DN5A 4GUHA 3X14B 4L3FA 3RLGA 1B30A 2QQNH 4NZTL 3UTTB 2W0FB 2YPLD 3GKZA 4LU5L 3CUGA 1W37A 2H6PA 5GGTL 1Z2KA 3PG2A 1DQLL 2E47A 2NQ3A 5AUMA 1UZ4A 4X4ZA 1KKRA 1TFPA 3S1GA 4PMVA 1QYGH 3W24A 4JFVA 3HN5A 3GG7A 4FERA 4FL4C 3HZVB 5D2LE 5HSFA 3P0YL 2LGNA 3QNXA 4FYRA 4R90L 3NESA 3HLAB 4TNWK 4L3ED 3GMOA 4MA3A 4U31A 1I7TA 3RITA 4OBSA 4NRYB 4ZSTA 2HRHA 4K5NA 1K9EA 1XDMA 3HGOA 3NGBB 2ZC1A 4KKQA 3OZPA 3O16A 3IXAA 2JKWA 3A3YB 5JA8B 2V2HA 4HEME 3TC9A 3PJUA 5C0DA 5HYJE 1GPFA 3DEQA 1V3KA 4YHPB 4KTDH 4HCLA 1TZ7A 3OX8B 2X2IA 4XAWH 5FM5M 4J3ZA 3KX6A 3L4TA 2ZUQB 3MJ8B 4G6KL 4YBLB 5KYNA 4MKTA 1LOQA 2BVOA 3BGMA 1KY6A 1P84J 3ARQA 4NAJA 2ONEA 2J8TA 2C8NA 4FMKA 4IMDA 4RJEA 4EP8C 4JFEE 4KK8D 5FCUL 3H21A 3FUDA 5F72S 1MCWW 4XXCA 1ITBB 4U6HA 4LU0A 3M5YA 3NVDA 1JNNH 2C1HA 5AG8A 2VDNL 3QQDB 4X83A 1DQUA 3T3MF 3FNDA 5JNYB 4MB4A 3KLKA 4XCEB 5F3HA 3RFAA 1SYTA 1C5BL 4LSVH 4GQQA 2N7BA 2OTPA 4HBQA 3X13A 1YMYA 2OMWB 3N2TA 3TQ0A 3HZYB 3GTXA 3TBVB 4MAUH 3UTQB 3QDMB 2IPGA 3DTXA 4KTGA 3FGCA 1MCPH 4YHYC 3OAZK 4JDZA 2OQHA 3DBPA 2ITDA 5EOQH 4QG8A 2WOQA 1U3ZA 2EBNA 4DAFA 3SN0A 1ZDQA 1HEZA 3R19A 4PRHB 4KT2A 2J6EL 3VG0L 1JWMA 2ZOLA 5HPMB 1JPFB 3NL6A 1MFEL 5CF3A 2J77A 2DQUL 3Q9QA 3R1GL 4N0YH 1MHPL 5T33H 2HRLA 3L9RA 4M03A 3WIFB 4DVBA 4HKJB 5LB1A 5DHMC 1CE1H 5C0GB 3CU2A 1E0OB 1HKIA 5CJMA 3MA9H 2UYLA 4HIXL 1GW0A 2D7TL 3Q2VA 2YLKA 4RGNE 3BE7A 2PR4L 3NXLA 3S6DA 1T0NA 3IYLW 1XGYL 3MX0B 4P8QA 4HIIA 1QR7A 1F00I 4XNMB 2WNWA 3BO8B 2VW7A 4IXHA 2IBBA 5KSUB 4FMFA 3EGXA 1MRFH 3QARA 2YWZA 4JHVA 5T1LB 2ZAHA 4UR7A 1IAIM 3C9NA 2O6EA 3HUJE 5B1KA 4A7UA 2H90A 2OSYA 1CBVH 4YVNA 4D94A 5FJRA 1S9VA 1FYTD 3ABGA 4M3HA 1CJYA 4EI6B 5D7JA 1BVLA 2VIRB 1DCEA 1O7VA 4YWGH 3RRQA 5EU7E 5DCEA 5G4MA 4B9ZA 3LK6A 5T3XD 3PB2A 3SDXE 5IQLA 1XHGA 3V79C 3L4WA 1GJPA 1AO7D 1W3TA 4F8NA 3PTDA 2ZCLL 1KCLA 1UFGA 2NY1D 4QNPF 3RAJH 3VD7A 1TUXA 3DFTA 3KRZA 3FJLA 2AEIT 2VX6A 1QPRA 4G5DA 3JTSB 2Y5TB 3UWUA 4PW9A 4LAQL 1AJ7H 4KPHL 2DUAA 1LBLA 3SGGA 1M71B 1O66A 3QC6X 1E4KA 3T6CA 4PWKA 4YEEA 4R7NB 5CPOA 1RUMH 3KCPA 3CN2A 1QJWA 3D3AA 5K9JH 1Y6KR 5CP7B 1MHHB 2H6OA 3PNZA 1OAQL 4HG4J 1YMHA 4RWYH 4YVUA 5AYUL 5HHOA 2NW0A 3TNMA 4AISA 3OLEA 3S36X 1ZBCA 1Q8MA 3FF7A 3EZ4A 5I2IB 1NFDF 3PPSA 3P8IA 5C7XL 2G5UA 2HNHA 1KIPB 3TYZA 1UG6A 2HLAB 5FECB 4R26L 2QV2A 4WU5A 4BEIA 3URQA 2I7SA 5T5FA 4O57A 1EOKA 1FIGL 1CK0H 3CFEB 2DZEA 3KJ4C 4R90H 3V6OA 1JK9A 1BZ7B 1TVBB 3M44A 3MUAA 4C5ZA 3TNBA 5DHVA 3IFPB 4MASA 3W7MA 4FYTA 5GSRB 2LVCA 5I06A 1RSCA 1OADA 4Y4KB 1KCRH 2DD8L 4OFYD 5ERWA 4NQVB 5MI0B 3DX1A 4YX2L 2EXYD 4HCFA 4KWSA 1G84A 1ME7A 1SNRA 2OMXA 5IF0B 4H7ZA 1HOCA 1MVUB 2FB2A 1JAEA 4WNQB 3GY1A 3G9VA 5IG7B 4PS8A 1T83C 1P6FA 2PPEA 4ZAKB 1DHPA 1NAMH 3D2TA 4O1AA 3CAWA 4YIWA 1BBDL 2BS9A 2FYMA 4BFRA 4G6FB 1EUTA 2EYSA 2X88A 3FSAA 2YUVA 3BVNB 4JDTL 3UG4A 3ZYZA 2QZRA 4PMDA 1GW6A 3H4FA 1KN2L 3EDJA 2G5RA 8TIMA 4G8IA 4R0LB 1DJIA 2DMCA 1KTLB 4KC3B 5TK2A 3TF7C 3A0OA 1MQ8A 1HX0A 4F8LA 2PB1A 4QRPB 4TSBH 3SUWA 4JE4B 4CU7A 4B4HA 4C6CA 4G8AC 3HGRA 4AZCA 1KFGA 2HRPL 1CU4L 2H2SD 2IH3B 1QDSA 3EO1A 1MREH 4P2OA 2GI7A 3ECUA 4HV8A 5CNHA 4PTDA 1BZOA 3TWBA 3ZL1A 1EDHA 3DUUB 3SQLA 1LM1A 3L13A 4ZX3A 2LLGA 5L2KD 2CA4A 1NDYA 4U7SA 5K9CA 5L8LB 4UZSA 5FV2A 3AHTA 3RCMA 4TUKH 3WLTA 1FFOA 3GB7A 3MRMB 5CEYA 1F8IA 5C9JB 4XAZA 4Z3TA 4FI6A 1MHCA 1TOXA 3EFDL 4MA7L 2Q2EB 4MJHA 4PGZA 4WWKD 4JHZA 2CHOA 3PJSA 3QRHA 4X9SA 3UTTA 3MZGB 3R4IA 4K7PX 4JPWL 3H9SA 2VITB 3VB9A 3WHE1 1DQXA 2H3NA 4HT3A 2IAND 3SZ8A 5AUMB 4AU0A 3FOLB 5I03A 3QEHB 2NX5A 2VH5L 4IHBA 4UTAH 4KV5F 4HJJL 5AVNA 3OHXB 3WTYA 4X6BA 2QV5A 4AGLA 2OJEA 4FQ1L 4JKPL 1E6ZA 1JI2A 1VS1A 2AEOA 2YSSA 3VX0A 3HMXL 4Z95H 1C5CL 1JZIA 1WWAX 4YPJA 4JDYA 4ZDHA 2HKHH 3LKNB 5KANG 5EC2A 4RBPH 2XLLA 2ZUXA 4Q6IB 1HJXA 4NBZB 2VGGA 5DS8B 2INEA 5AOKA 2WWMD 1C91A 4GBDA 3X3GH 3OB8A 1VFTA 3VI4E 3C0SA 1OT4A 1UOZA 2D31A 4IRSD 2DM4A 1MLBA 3AAZB 3MMEA 4MS8C 4ZS6C 1I4FB 1YC8A 1V08A 4NJAL 2C9SA 3IRPX 5LNDA 3WTTA 1FX6A 1V7YA 4L4JA 3ZZSA 3DH7A 1KFBA 1R3JA 5EBAA 5HJYA 3KLHC 4US6A 4HJUA 4N7QA 4DXXA 2ZUUA 4IOFC 5FFGA 1L9QA 3FUNA 1KTCA 5JW5B 4ZMYA 3E3HA 1ANUA 3WFDL 5JW4R 1I8UA 4P61A 2HKFL 2OOFA 5HR6A 1NCJA 4GT0A 1JPTH 2NSQA 4KNUA 2F84A 3NZQA 5D7LE 1Y1DA 4PGDA 32C2A 3BP5A 3NFNB 5AW3B 2HX9A 3UTSE 1M05A 1RPKA 4YDIL 1MHPH 1UIOA 1D5RA 3I84A 4X6DF 4JL2A 3WNOA 4O2CB 1ZL1A 3U3HA 4NQEB 3CZLA 1GG0A 5GZOC 4HTYA 1MFUA 4X4KA 4W88A 4M56A 2D7TH 1TMCB 5K69A 7REQB 5DC0A 3FB5A 3ZY7A 2C9AA 2O61B 1ICSA 2GSJA 3FPYA 3FKRA 1Y7VA 2YPVA 3M4HA 3TKFA 1TJIL 3WN5C 3DHFA 1I6NA 1BXAA 4IK6A 4YHGA 3AAMA 3NJVA 3REWB 5LYRA 1S2AA 3VW3H 1I8KA 2O6FA 2PLKA 3WLIA 3C5ZD 1N6QH 3MNMA 3H26A 3LB0A 3VOFA 1IAIL 3A6BL 3TA4D 2WSRA 2X89A 5CXPA 4KROB 2Y07L 4PJEF 3E8UH 2FB4L 3GMLB 5GXBB 4O18A 1H3PH 3AS0A 2AXJA 3BUIA 3L9RB 3P9WB 5KSBA 1IBGH 4P3WA 2QGDA 3EXJA 1YTKA 6CGTA 3EOUA 5D93C 2Q8AH 3S3CB 1Q9LB 3USBA 3MLXH 4WEMB 4QQ3A 2WHKA 4DP5X 1MRDL 1PY9A 3SJVE 2NQDA 3TW9A 1PYWB 4HIIB 1DLHA 1KZQA 1E4IA 4KFPA 4GXVL 3DSFL 4HCGA 3TYAA 4NQUA 2C9RA 3V9CA 3ZPDA 4QIRA 1A14H 1J0HA 5TFSH 3EWBX 2APFA 4KWUA 3GC4A 5CPNA 2ESVD 1CGXA 3CLFL 3H6AA 4UV7L 5D4IA 3QHMA 2K6WA 2PI6A 2VB5A 4OLXL 2GVLA 2NXYC 3O2WH 1ZHBB 3V7AE 2EPMX 1BBDH 5FGCB 2DLGA 1YY9C 4OFDA 3VFWB 5E51A 1D5ZB 5LN8A 1TENA 3ML8A 5D7SL 4ALAH 5A3ID 5H2BA 1E70M 5AN7A 3L1GA 1YEJH 2N1TE 2EG8A 3UBGA 5BVPH 4IJCA 4BZ2A 2FYYA 4PW4A 1E2VA 1O1HA 5LG6A 1BVNP 1QTYT 3G6AB 4PR5B 4M3KB 3WL0A 1VADA 3SE4A 5DHDA 2F8QA 2YA0A 3HS0A 1F02I 4IBUA 3G08A 3QHZL 4J3WA 12E8L 4GT7A 1IT0A 1UM6L 2Z8WC 1T1YB 3KH3A 3QORB 5CH9A 4L1HA 4PSPA 4JPIB 1I2RA 4PAZA 4Y9AA 3EUDA 4IOTA 2ED8A 2ZJSL 5BQ7B 1U0QA 3P93A 3EWCA 2IC2A 4Y7OC 1TVHA 3T1WA 1K6QH 4LY4A 2G4GA 1ZHKB 5HHQA 5GRVK 4LAJH 4IGSA 4J3SA 5EB9A 3V8CA 4EPDC 1ZPUA 2G75A 1FNGB 4NM8H 1W9XA 4UANA 5EUKA 4AQOA 5AHMA 1BWWA 3HE7D 4X6CE 4Z7VB 4YPGB 3VQMA 5FEBA 1KM1A 1L2QA 2R27A 3WIJA 1RSYA 1VSCA 1IGCL 1AFSA 4U2ZA 3P40A 1YAIA 2FL5B 4ELKA 1PB0A 4YSDA 1W2PA 3ZYJA 4Z1CA 4N22A 3QF0A 2AL1A 1HQRA 1RFDH 2GB2A 3D2UA 2IKJA 2ZQ0A 3FVMA 3CFBB 2VLJA 5FKAA 3EXLA 3EDEA 4E2OA 4MHHG 2OULB 4L37B 1FPTH 1B4RA 1E4WH 4ZBJA 1VYPX 2XGBA 1JNLL 1LNUB 1NMCC 2YPVH 3PL6C 5JQHC 1LBMA 1OIFA 3B2UC 3QISA 2WMIA 3FK4A 3UW6A 5EG6C 3HPJB 3GRWA 3Q94A 1B2WH 3TZVD 2HJKB 3FQWA 1XYZA 2OKMA 3WG6A 1DHKA 5JYMA 4YTQA 2OL3B 5EU6D 2XICA 4JW3A 3QA3A 2D22A 4MJ5B 1S7RA 3CPLA 4EXKA 4XZWA 2FQEA 2OMXB 2VL4A 1P0KA 2AAMA 3BJTA 1H1ZA 4JFQB 3ZDZF 3QC3A 4PBGA 1AD9B 1N2RB 4KFMA 2VDRL 3ZYIA 3WJMB 2VL5B 3N4AA 3FYOA 2BSRB 2ICWI 1G9EA 4F91B 3IDXH 1IGTA 3RUGE 2R1NA 4L9LB 1LTXA 4LRSA 2J24A 3F7VB 3SZ6A 5EU6B 4DPBX 2EYSB 1M7XA 3W37A 5IVNA 4KUZL 1NTDA 5DK2A 3L1OL 1LGVA 4HIQA 1OP3K 2IXVA 3DJZA 1FBIL 4UNTA 2YA2A 4GRMA 4WEBL 4DO5A 5DT7A 8A3HA 1G7QA 1S9WA 1ZGLA 4AEIH 3C2YA 4XCCH 1D7CA 2BERA 3ALXA 7TIMA 4P2VA 3MLYL 5B8CA 4BXSV 3B9KC 1E9PA 5LDSA 1W1PA 1XYAA 3QDME 1YPFA 2JK2A 3MSRA 1WXZA 5FM5O 3GB6A 1IBBA 2X09A 1KCXA 1RUPH 5KETA 4QRPE 3S5LG 3WNKA 3SYQA 5CGMA 2E6DA 4H9TA 3HI5L 1F86A 1YCSA 2VNCA 4Z8FH 3FY1A 3T2OA 3DUUA 1CQKA 1RIVL 1GVRA 3BWWA 4MS8D 4QDPA 4UFJA 5C0RH 5LLIC 2EDDA 4ERSL 4BF7A 2OV0A 1BLNB 3SKMA 2DWTA 1G5GA 3T3MB 2E7LC 3DVIA 2H3DA 4C60A 5L2JB 4JFEB 4JLRA 3AIVA 1WHPA 3ZKQD 2Z4TA 3QV8A 2A3EA 4TVPD 5I3FA 3AXMA 1H0DB 4WUKL 1PZ0A 1OFQA 3WEMA 1VGAA 1A53A 3PZNA 3WE1A 4E9SA 4A7GF 1A1NA 4B3LA 1OWQA 2WKLA 2EVHA 4OM1L 5C6TL 3HR5B 3J2PA 2Y7OA 1GGBL 1B4TA 3WIHA 1QOQA 3VXSA 1HL8A 4F7MB 4F15B 1QNVA 1RQBA 4NKMB 4LGRB 4G7EA 4LFHD 3IAPA 2CDGB 1H3WM 1QACA 2GTQA 4M4RA 1S2WA 3WMLA 1KLGB 2QQKL 4WFFE 4L3EE 4S0SD 1M5WA 3V9EA 4HZMA 2GGEA 4ZQCA 1P6CA 3MCMA 4WW2F 3GQFA 5GRUL 2XH0A 1N59B 3BLPX 1ISVA 3C56A 2D73A 4UQ2B 3RFZC 4L9ZA 4ALAL 4P5UA 3FTUA 5IEHA 4JYFA 2AVGA 3APNA 5TDPA 3PE9A 2N7AA 1HHKB 1OAZH 5EN3A 5LBVA 2ESVB 2EDMA 1IF2A 3ILPB 3LTPA 5C9RA 4XIAA 2GJ6D 4Z7WA 2GJXB 4DX3A 1KYFA 3D3VA 2AJYL 1SBSL 3P02A 3PG9A 3SO7A 1U6AH 2ZCZA 2FEEL 4OI7A 2BVUA 5FO7B 2DKSA 3NEXA 4G6JH 5C0JB 1AI1H 5M94B 1XIIA 4W87A 5J04A 4PWEA 3NIDF 4GKZA 3C2FA 4OLVH 3FN0L 2D7PA 3H6OA 3FOKA 4OCWL 1ZALA 4M80A 1XR8B 2UZIH 1Y6NR 5I1HL 1FZMA 2BV9A 3VTRA 3I74A 4FXSA 1I9IL 1QABA 3G5ZA 3TN0A 2NZ9C 4N68A 1THCA 3U7VA 2ZA2A 3HFTA 4XVTH 4AE0A 1F61A 4KFNA 5IFJB 4E8GA 1QBAA 3AMDA 1B2YA 3KRSA 3MBEA 3LX9A 2YRPA 4L4TB 1G5AA 1EO5A 4ELME 1WC7B 4OCYH 1GKQA 4B15A 4ZPVB 1Q9KB 1K7XA 1EEYB 1AZVA 3SGUA 1T3FB 4INFA 4XP1H 2YXGA 3ZZ1A 3OIHA 1IQDA 4IP4A 3VJ6A 2HH0L 3P3RA 3W7QA 3AACA 5FDYA 4JPQA 1C7TA 2CK2A 1B4KA 3QPEA 1UZ6F 2Y3NA 2YPVL 4XOBA 1EH9A 3UPRA 3B04A 4AD3A 1BV8A 1OAJA 4LPWA 1IM3D 2XVLA 1HGWA 4ROQA 3I6RA 5G4EA 3TN6A 1KJMA 1IQ8A 5CZKA 5HOSA 4PJIB 2WXGA 3GZ3A 1AOHA 2VDLB 3FHAA 1NFDB 4P3DB 3SD5A 3WHXA 5BCAA 5G1TA 3VXGA 1YYLL 1P48A 1TTRA 1UM6H 4IMKA 2ISDA 5SX5K 4JHWL 4DJMA 4NCC2 2ZBTA 4HZ8A 5G1YA 3VIPA 3A23A 3BD4A 4OB5H 3LQAL 4AW7A 3PTKA 5AYIA 5C0EB 5GS0H 4EF9A 1LDPL 2X6MA 5DT5A 1DBJL 3AYTA 4ORGB 4S1QH 3THDA 1I1WA 1SY6L 2CLZB 4JPVL 2QJNA 1ISXA 3ABLB 1B0WA 3MDJA 2OG9A 2R4RH 4GQPH 5H2BB 1OM0A 4N6FA 3TFKD 1VH7A 1UKPA 5D9PA 3GX9A 1SMOA 3GMMB 4OZHB 3WSQL 1E27B 2P80D 3QJXA 4HS8H 1A3RL 4NNBA 4YLCA 3HMWH 4MQSB 3NCJL 1OAKL 2C1PA 5DFTA 2EVFA 2EPNA 1OP4A 3S4SG 3QNYA 1P5BA 4XB7A 3HQ1A 3RGVB 1EJTC 1KFWA 1LVEA 1FFQA 1Z9SA 2VLJD 1VGEH 4L4VA 3UTSD 1GZ1A 3S48A 4DPCX 5J4MA 4MPQA 1F5WA 3HNVL 4KO6A 5GIRB 4LX4A 3L4VA 1FOBA 6PAZA 1P1ZB 1YQVL 2GSGA 3VQLA 4BUQA 1GY1A 4H6KA 1QRNB 4C83A 2P53A 3JZEA 4KIRA 4AX6A 1N3NB 2GKIA 1A6VH 3W6MA 4G42A 1Q9WA 3MYJB 5AG9A 4XNXL 4WD0A 4FFVD 1TTUA 4NKCA 3OF6A 4U3CA 5L2KB 5LQBH 4BFKA 1XZ0B 4PJCA 1ZAIA 3KS0J 1IO4C 3QIBC 3DX9B 4O58H 3FCPA 3X3FH 4MADA 4LOFA 1G01A 5M3WA 1A6PA 5JR1H 1CI3M 1HQRB 3QR0A 4MY8A 4X4ME 1GC1C 4OJDH 1PZ5B 2XPGB 3OB0H 3EOAB 2V0AA 3NSJA 3MLPA 1PKYA 1QQDA 5J3HD 4XHQA 2DQIL 5EO0B 2W67A 3D07A 3NQKA 4D6DA 2VLME 2YEZA 4L8SB 3PIQB 4UIOA 3IKCA 4WEBH 3CCHA 4K8EA 1BYBA 3PQYA 1A0QL 3L9EA 3VRLF 3B9KB 3V52H 1BAFH 1JGUL 1BYDA 2X0HA 3TJEH 3KYOA 4TOYH 1XIDA 2GVYA 4X42A 3UNDA 3UPWA 4KF1A 3WQ4A 3HV9A 4GRLA 1ZHLA 2F54B 4LOVA 5JW4M 2XFRA 2Y36L 2D3VA 4AYEC 1LROA 3TYCA 5MEPA 1PAZA 1ZSHA 4I1PA 2O1AA 2PPCA 1HE8A 2W63A 1DUYA 4PJAE 3ZLHA 1UGKA 4OQTH 3ESNA 1EHNA 2OQLA 2RFGA 1JGLL 1ICPA 1WBYA 1TPWA 3T78A 3GFXA 4P5KA 3O07A 5B7FA 2AV7B 4NPYB 4PULA 1F3XA 3SUVA 2ICWB 2OW6A 4X4MA 2V9QA 1BTMA 4EVNB 1G7QB 3E3QC 3I6GB 4YWIA 1J86A 4AGMA 3QG7H 3IDNA 3IRZA 1SZEA 1IVLA 1HDMA 1Q38A 3EFFB 4PJCE 2K8QA 5I1GH 3TEZA 1FCQA 4YN5A 2PD9A 1G1YA 4UOW1 1UT1A 4XE0A 1PTGA 3B7YA 3F5WA 3ARPA 1VRDA 1DJSA 2YL5A 3CZKA 4W7VA 3B0UX 3PZTA 1JNJA 5LNVA 2NY2D 4OZ4B 5EO9B 4CLMA 4JFYB 4JREC 2J2ZB 4RW5A 2NZIA 2VN5A 5CSZB 5F88B 5I0YA 4HA4A 3WFBL 3O4LB 1B0GA 4BM7A 3EHBB 2GGGA 4KWOA 5I8EA 5GRUH 4E9XA 4JKWA 2OZ8A 2R2CA 1W2KT 1FVPA 3P84A 1R3SA 4FX8A 2IDSA 2IFGA 4AGOA 4N1HB 5AQ0A 5MEQA 1LL7A 2CDEB 3NN8A 4NI6A 4OM0H 1FA4A 2QIIA 3ZHKA 2VDQL 1URZA 4XNQA 4ZFZA 1T83A 1R8LA 3LZNA 1N68A 4WI3A 2NQCA 3AREB 5ETUA 3RWEA 4E41D 2NY1B 1BGGA 2R51A 1T8QA 1POKA 2HLFC 5DXWA 3IXTB 1FWJC 4OFYA 1R9YA 1L7IH 3QV7A 3W7EA 4PLKC 1ZVSA 1HNYA 2VUOA 4YL4A 3MLTB 3TA3D 2E40A 4WGHA 1F1AA 3NGBC 4IFKA 4IHCA 3N1QC 3BGGA 1K02A 1O6SA 4Z7UA 3P1VA 4YMZA 3NRFA 4N8VB 1HSAB 1HL4A 3GBNL 4Q3MA 4UOQA 2Y7QA 3LHYA 1CGTA 2X3AA 1AQDB 3QIUA 4ZW5A 2HVKB 3CQFA 4NSKA 1R2TA 3RIAK 4UMCA 4Z3JA 2RCSH 1UOLA 4PJIF 2WXRA 1MG2C 5C09B 3FCBA 3B9NA 1UB5B 4CGUB 4A3YA 1CZ8H 1TYEB 2PUQT 1U58B 4S1SH 1QZ1A 4PJIE 1I8MA 4PTWA 1G0DA 3EFDH 1RQ5A 1UD3A 5ESAB 3IDMA 2EILB 4HSCX 4PH8A 2ESCA 2Q71A 3RDKA 4EPBC 3UTPD 3ZSSA 3RXZA 5IOPA 1U3HA 3W25A 1FZMB 4XPAL 5FYKE 2HWZH 3EXRA 2WKOA 2C5DC 4LUJA 3WLHA 1OD9A 3RYMA 3U7AA 1N70A 3GC2A 5KAQF 3DV6B 2FX8H 3CHQA 4XBEH 2PW2B 1JVLA 4HGWA 3HHMA 3QBUA 4JTLA 1I7RB 5F6IC 4Z2KA 8PAZA 1MIML 4M5ZL 4N3UA 5DUJA 4LPUA 2FNWA 3HHSB 1H09A 4HS3A 3MBEB 5KYWA 4HJSA 4PGJA 5C7XH 1D5MB 3ULVC 1IKNC 4OB5L 4LTSA 3HMXH 3DHMA 4NN7C 4XX6A 2OR8A 1E90A 3DVGA 2EKGA 2PDHA 3HNSH 4B3VA 2UUDK 3M7SA 5F3FA 3QY6A 1W56A 3OR7A 3LTSA 3ZL4H 2J6EA 1MCPL 4NZUH 3OU8A 2BP5M 2P42B 2B8OT 4PBXA 3VNKA 5AHIA 2ZKHL 4ZW7A 2P28B 4Y7EA 2VERA 1MAML 3FDWA 4ISVB 4XP5H 3UJIH 1X9UA 4D1IA 2XG5B 4OJFH 4H4NA 2RJHA 1A0QH 2O6CA 4MA7H 3TJHC 4HOZA 4LRNL 3ULSB 3CAFA 3GLCA 3SQMA 3O8XA 4YSEA 1CLYH 4AEEA 1NFDA 4P3DA 5FOBA 3B8TA 3N29A 2CO7A 2EIZA 2ENYA 3KLAA 4HK0A 3UAAA 1X5MA 3UROR 1JG9A 1VR6A 2XFWA 1TTQA 2VRAA 2PTVA 2X1RA 3FU7A 5F7EL 5K9OB 3QDJE 5EPMA 3SDCB 4O2FA 3KXFE 4S3AA 1UVQB 1DQJA 4WI2A 2EJAA 2GFBA 4ICMA 2N7SA 3GUWA 2GY5A 2X42A 4Q89A 5TQ2H 4C7FA 4AF0B 4MY9A 5I5JA 1GGIL 3AXHA 4FTVA 1IGWA 3MV9E 2FTWA 4BFAA 3FQNB 1G94A 2OBGA 3B43A 5E2JA 4TQEL 4XPBL 2DM7A 2WHMA 3MMDA 5DMMA 7CGTA 4L3EB 2OR9L 4GAAA 4ZQTA 4YYCA 3FUFA 2X9XA 3D51A 2QVIA 2GTWA 2R1YB 1ETJA 1QRND 2MNJB 5GJTH 4EIZC 1FH5L 4MQ7A 5F89B 4BD4A 1CFTA 1QNOA 2FO1A 3TYFB 3FEMA 1YEDA 4ENZA 4MFDA 3QZWG 4JO3H 4JDBA 3IGSA 5FA3B 4A22A 3L3GB 3LN4B 5HGBB 3VFMB 1UD4A 1I1RA 1BWKA 1N55A 5BMWA 3SODB 1CYGA 1SJVA 5GIRA 3UTTD 1MUCA 3B9DA 4QRQB 4W4OC 3WDQA 1PCKA 1J48A 2PXYD 3CFKA 4IPJA 4L4OA 4HAGA 4LAQH 3GSVA 5E95B 4PRIA 1HHHB 2XVNA 4UT6H 3G8RA 3D69A 4JRLA 3VMNA 4GKSB 1EJXC 2VXSH 3MYJA 2VSCA 4HJIA 4NKIL 2QVFB 3VU1A 2OT0A 4QLJA 3ZGIA 2AJVL 3FSOA 3UNTA 3LD8C 4BHYA 1Z9PA 1E3ZA 4NQXA 2DLTA 1V8HA 3HFFA 4UDUA 1Z41A 4WKHA 3QHFL 5ISZA 2PTYA 1UWFA 5L6YL 1EAJA 2W94A 2PKDA 2AW2A 4KK5C 1EYEA 1OZTG 4IIQB 1EBAA 3QWNA 2EECA 2QPSA 3IIZA 3FH7A 1MW0A 2CIIA 1EZVY 4Y1AB 3K2KA 3P0VH 2FJKA 2G5WA 1I1YA 3FB8A 4DQOL 3OAZH 5FX3A 3TH6A 3S0PA 1J6OA 1ZA3B 2F2HA 1MQRA 4TNVK 1CB2A 1W31A 4IPIA 2XGIA 1UWAA 3W29A 4U2YA 3WS3B 3SGKA 1FNFA 4PP2A 3BICA 4IF2A 1Y07A 1GVQA 1NC2D 1RBAA 3GM0A 3PHOB 4Y90A 3V5DA 2WLLB 1ZLSL 5IBUB 4FI4A 4FFZA 5DGQA 1GPWA 3FL7A 2ZRXA 2HKFH 2QSVA 4BCYA 3P5ZA 5HHMB 4WWID 4REQB 1E42A 2QHRL 2XZCL 5INDB 5CSSA 3T8VA 2DS4A 1D6VL 1NOFA 4JX5A 3PNUA 2AV7A 2WN3A 3QCTH 2I5YL 3LRSB 3QULA 1PEWA 5EA0L 1XLAA 3AQDA 3DHUA 4AV5A 3KBWA 4IISA 3QSTA 3ARFC 1BRLA 3W7CA 4K9EL 4Z3GA 1JERA 1UPPA 3M7FB 1NCNA 1X39A 1UP2A 3BFWA 4KKRA 3VFRA 2W60B 4W9KC 3HNTL 2WO2B 1JVOA 5E09A 2WJ5A 3F5WB 3L5XH 4NCDA 3ARED 4TSAL 4JZ5A 5KUKA 4GZEA 4JFYA 5BWFA 1PJWA 4NRSA 2J7EA 3CEUA 1FAKT 2J3SA 5FO8B 3THML 2WTPA 4AB4A 2HVJA 1AACA 1JR1A 3QORC 3N43F 5C8JA 4I48B 3OG4B 3FONB 4FPSA 4JX4A 2A7NA 4U6TA 2PP9A 5D7EA 5F7DA 4PI2A 5AOIA 2ITCB 3LZQA 2XG4B 3U4EB 2XN2A 3AQYA 1OT2A 3IDIA 3O4LD 2HMID 4IGBD 1OG0A 4N1CA 1NCOA 1XEUA 4PJGE 5F9JA 4TSCH 4HXAH 1PMYA 3PABA 3OJDA 1OM3H 3RDTA 5EU4A 3UTPE 2DQXA 2VZUA 1XGDA 1A2YA 3T4WA 4FQHA 1JMXA 4JJOA 3ROLB 1WWWX 4Q9QL 1GOIA 1JQXA 1GYUA 3MCG1 3G24A 2I27N 3WK2A 2J1YA 5CBEA 1KCKA 5CPSA 1JFHA 3CC5B 5LBSA 3U82B 1JYNA 3A3XA 1MVYA 2NY4C 4JCMA 1JTPA 3FQ2A 4PMRA 1J1PL 3ECWA 1PG7H 4E5XG 4OT7A 1VFMA 3HZVA 3ZR4A 2W0LA 5RUBA 5F0JB 3K6DA 4D6FA 3DLQR 4JB9L 3RM8A 3U6XS 1U3JA 1H0IA 1TTJA 2WZHA 2YA1A 3VXQB 3EXSA 1KXTA 2G3MA 5DF0A 1AW1A 4N8VA 3MAWA 4YDJA 2XIJA 3V4UL 3N85H 3NCFB 4YHLH 5FGCE 4B9IA 2J7FA 3LLXA 4NAFA 4XCNB 5J7CC 1J8HE 1KFCA 1F4YL 3UZ5A 1AQDA 1JGEB 3QIUB 2ATKB 2E74C 4TVPL 5F21B 5FA5A 1GHSA 4KI5C 3IK2A 1QOXA 1KBWA 4JTIA 1FC2D 4EBQL 5T3ZD 5ICYB 4J35A 2XFXA 3U9PH 3TPUA 4NZUL 1FFRA 4TPRH 3C8DA 4UM9A 2WVVB 3BGMB 4ZS7H 3V0EA 2BOCA 5HVHC 4BKLA 2OYMA 4F58H 5ESQB 2VDMH 4R2GC 1OX5A 2EJ1A 3P77B 4IU2A 4O00A 1M65A 1UEYA 4WUKH 2YRBA 3PTMA 1OYCA 4GNVA 3RWHA 2EIMB 1NCBH 2VAAA 3AS2A 4U0RC 2PF8A 2PLJA 4G1EA 4U49A 3S42A 1GGCH 4UIKH 2DDQH 4YGVB 3QFJE 5LAXB 4H01A 1UJQA 3BP7A 4UUJA 3UY7A 5CCJA 3QH3B 4YDIH 3UGEA 4AGQA 1I7RA 3FMGH 4G6CA 3UVAA 4WEEA 2JCCA 4FZEH 2FZ3B 4G9FE 4ZUSB 3UBFA 4ZB2A 5JW3H 1W8SA 3WAKA 4K7FA 3SB0A 1EXGA 1JXDA 4HMCA 3TF4A 1EDYA 3THCA 4OZOA 2CCVA 5HYIA 3M17A 1E3XA 3ICJA 4UNKA 2FEDC 1THAA 5LCVA 1RIHL 4M8VA 3GNML 4D8PB 3MBDA 3N2CA 2DKUA 5BZDB 1RUAH 4HN4A 5D03A 2VC2H 3LY0A 4UDTB 4GK8A 1E5UI 3AXXA 1AKPA 1CFSB 3UACA 3DV4B 3GIZL 2XDFA 5DS2A 3RIKA 1AZZC 1BX2A 1MI5B 1E0XA 4L6DA 4LYPA 5AOUA 3NSXA 4AENB 5HUPA 3STCA 3UTSB 2CRMA 3A6BH 3LHAA 3WIFA 4BWUA 1A6AA 5C0GA 1AL8A 1NSJA 1SW7A 3W38A 3CUHA 4JD4A 1FWXA 1UEMA 3F62A 4XP6L 2BSDA 4Z76A 4ZMXA 1LL6A 3R5EA 4NILA 4RL3A 4CD8A 2E59A 2E6AA 1EC8A 3ITVA 4LF3A 5BZWA 5A2BA 3STZB 4F9DA 1AYOA 4ZTXA 1A4JB 43CAA 1AQHA 5DWUL 2ZZ2A 5F8QC 3R8QA 5K9OA 1BD2A 3LZFL 3UWWA 3OKKB 1JCJA 2Y69B 1UVQA 2X12A 2A6LA 1AHKA 3IKKA 1R19A 4I1RA 1MEHA 2Q02A 3N3MA 4HPNA 5I1CH 5J57B 4NJKA 5C70A 4DPPA 4Q4RA 3C9NB 4MZ3A 3RIFF 1PLAA 4DIXA 3LGGA 3QWOA 3PQYE 3GIQA 2B59A 1OCOB 2N0MA 3BUYA 2VIRA 3AY4C 4H6RA 4QROA 2R1YA 2QHAA 1A49A 4FG0A 3ARSA 1DPMA 3PK7A 3RBGA 3TYFA 3II3A 3GMQB 4LXFA 4OD1H 3K6IA 5ABTA 4JICA 4RETB 4G6MH 1T4WA 2DQJH 4Z7QF 2RGLA 4F8TA 1QLEB 1GUVA 1TZAA 2QV4A 1R34A 1F90L 1KDIA 1MJ8H 6TIMA 1BM7A 3LNMA 3TYGH 3GMNB 4W4QA 3STLA 4D0CB 1JZFA 1MXDA 1CXEA 3THMH 2QDEA 1X5KA 1N8OE 5F3BA 2A3LA 3A6CH 1MNNA 4NQSA 4FNSA 4ZQMA 1T03L 9XIMA 3UXLA 3P73B 2JGYA 2QCDA 3BWUF 4LNRB 3AADB 4UB0L 1BQCA 4IU3A 3VOIA 4KNTA 4PJXF 1YPZE 4QEHA 4R0LC 2J7CA 1GZGA 2BSLA 2GLKA 2WW5A 1GGBH 3MOBL 5JBEA 3K6SB 2Y24A 3EH2A 2BNUA 3TASA 4L4TD 4DUWA 1FGVH 4YHOH 4HSQA 5IR1B 3CXDH 1GYMA 2FECI 2QHRH 3E2HB 5IMLB 4GG6A 2ZFAA 3NZ1A 4XO4A 2EGZA 2GG1A 4MYXA 3ZVHB 1CLZH 3NIFF 1FL5A 4YE4H 3VVWA 2R0ZL 1FGNH 1YDPB 1NFIA 4XTRC 2XRAH 1NCTA 1KGXA 4IFRA 3FNKA 3QPQD 2WQPA 3NGJA 3MV8E 2QEZA 3ULUC 1MHEB 3FFDA 3JTTA 1QUNA 2PPFA 2XWDA