1U30A

In situ extension as an approach for identifying novel alpha-amylase inhibitors, structure containing maltosyl-alpha (1,4)-d-gluconhydroximo-1,5-lactam
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title In Situ Extension as an Approach for Identifying Novel alpha-Amylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1u30A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1u30A01
2OYMA 3VSUA 3WF3A 3CZGA 3ZM8A 1JNDA 1UD5A 4AZCB 3RMEA 4NI3A 2X09A 1IZKA 2G3IA 3OGVA 1R46A 3WBAA 1J0IA 1DWIM 3EMZA 1ISWA 1E6NA 1E6SM 1RH9A 2J79A 2E8ZA 4LYRA 4M80A 1E5NA 3EBVA 1JYWA 2F7OA 2X0YA 1E70M 2HVMA 4W8LA 3SCUA 4U2YA 1EO5A 1BYCA 2DDXA 2YJQA 1NQ6A 6CGTA 2O92A 3HZ3A 3AHZA 2CCRA 2G3NA 4JCMA 4YHGA 1ZBWA 1PX3A 2B31A 2YDSA 3W81A 1HJQA 3AOFA 1E4IA 3VIHA 5EBAA 2WNWA 4AIEA 4GINA 1NWSA 1HXJA 3TONA 4JL1A 1V0MA 4R27A 4FLQA 4W7WA 1KQZA 4OGZA 2VT0A 3AYSA 1E0WA 3AS3A 4P7RA 5IXEA 3FAXA 3AZRA 2VRKA 1KQYA 2D3LA 3L4VA 1CXKA 4A3YA 4MJ2A 1UWSA 1NWRA 2JIWA 3W6MA 3FY1A 1UA7A 5ECUA 1EDQA 2WVSA 2JF7A 3VGDA 4WKFA 3AS1A 4AYGA 3VUPA 2V5CA 4BQ3A 2FHBA 3CUFA 4W7UA 3VIMA 5BRQA 2DSVA 1JD7A 1E3XA 1IV8A 1UKQA 4JL2A 4W85A 1UH3A 1CYGA 2F7RA 3W25A 1H0IA 1JAKA 4GPNA 1BG9A 1CGTA 2WZHA 1E1EA 3ZQ9A 3UESA 3WF0A 2MANA 3SCPA 1GOKA 3SCQA 3VIOA 1E6XM 1QNOA 1CIUA 3G6MA 2W91A 3HJEA 1GQJA 5IDIA 3WD4A 2BNJA 2CYGA 3EJPA 4JFTA 1BLIA 1KBBA 4CD6A 3EMQA 4JFUA 4D6IA 2JALA 3D4ZA 1V6VA 2WMFA 5I6SA 1JF5A 1JZ5A 2WCGA 2VCBA 3NUKA 4LYQA 3QOKA 1V3KA 3SCOA 2DIJA 3ZSTA 2PWHA 3BUIA 4YHEA 1UA3A 2XN0A 1MQPA 4ACYA 2DH2A 4TXEA 3BSHA 3SCTA 3NSXA 1HVXA 5M5DA 4P7LA 2OWCA 4OIFA 2VR5A 3WH6A 1VENA 5BCAA 1GOOA 2VMFA 3N17A 2VX4A 5EB8A 1V0NA 5CSUA 2Q8XA 1I75A 5D9OA 2BY1A 3LPFA 1DP0A 1WB0A 1E0XA 4FLRA 3AMDA 2EACA 3N18A 1WO2A 4P8XA 2YDRA 3DX3A 4E4PA 1JFHA 5I2UA 3LXAA 3WKZA 1US3A 2EXOA 4OUEA 4CVWA 3RDKA 1PAMA 5LA2A 4AD4A 1UWUA 1O7DC 2WMIA 2XYLA 3GM8A 3TV8A 2YL9A 4MPKA 1RP8A 1JF6A 3OLEA 2ZE0A 1TFVA 3AHXA 3ALFA 1KR1A 3ARVA 2QV4A 4HMCA 3PZNA 1TUXA 1Y7VA 3AS0A 1E1FA 1KGUA 3VPLA 5AYBA 4JKMA 1BF2A 3WFZA 2FGZA 3VU2A 1M03A 3LXCA 1E40A 3ARXA 3AIWA 1XC6A 2XSBA 3LRLA 4HPGA 1PX4A 6A3HA 2DT3A 4PTXA 3A4XA 3A22A 1E3ZA 4W8BA 3LPOA 1XHGA 3FNDA 3L4ZA 2CBIA 5JUVA 4ZENA 3WQVA 1E9LA 2J78A 2DH3A 4Z2JA 3OLGA 3HG4A 3IAPA 2WWCA 3ZR6A 3IGUA 1Q6CA 2CERA 4M81A 3MUIA 4W8AA 3PZOA 4H8HA 1R87A 1CLVA 4W5ZA 1CENA 1OWQA 1A47A 4P8VA 2QPSA 4RE4A 3A6OA 2EJ1A 3POHA 4Z2GA 2AOSA 1E71M 4DM1A 1W1PA 1LF1A 5D9PA 1R8LA 3WN6A 1DHKA 2XIIA 3VIGA 3BCDA 3U5UA 3ZJKA 4KGLA 2VZVA 1GOQA 1M53A 4PEEA 1HKJA 3ZSSA 3POCA 1TMQA 2VZUA 3N12A 2NW0A 2J8GA 1C8XA 1DWAM 5CGMA 1QNSA 1HJVA 3MMUA 3WQ6A 3EDJA 1CWYA 1W9XA 4UOZA 4TVDA 4HZ6A 4CN1A 1TZ7A 1AQMA 3OGRA 2CHNA 1ISXA 3VX1A 1D2KA 1I1WA 1E6RA 2V3DA 3MUAA 1GQLA 3MS8A 8CGTA 3BLBA 2EBNA 3VD3A 3WFLA 4UZSA 2PWGA 1MQRA 2XFRA 4WIWA 2FE0A 4EKJA 1CTNA 5BROA 2E40A 3BAIA 1VFUA 2XIBA 4L4OA 2YBTA 1JZ2A 1U30A 4GZEA 1JG9A 3K8KA 5CSYA 3L4YA 1FP8A 1J0KA 3AIEA 4AMWA 2EPNA 4BZYA 3BAWA 4UOQA 5CXPA 4H8VA 2XN2A 1GVYA 4CN6A 3CZJA 1TQWA 2NT1A 4V2XA 2WM0A 4QP0A 4U31A 4UFJA 4D71A 2Y8KA 3D50A 4W86A 1UKOA 4MTVA 4PUEA 5CLWA 4NXSA 3CMGA 1M04A 4HP5A 2A3AA 3A47A 3AFBA 3AQUA 1W3HA 1NWUA 1CXFA 3CZNA 2CIPA 3PZTA 5D9MA 5LA0A 3H53A 2V3FA 3NYDA 1HWWA 5JBEA 3VMNA 4E2OA 4EK7A 2F1AA 4UFMA 4HTYA 2QPUA 3PZUA 5A3HA 1NARA 1KTCA 2EPMX 5AY7A 2CETA 1UG6A 2XPKA 5LYRA 1E72M 3KE0A 2NSXA 3F4VA 1E43A 1HF6A 2WHKA 2D22A 3GXFA 3CHFA 2ZUWA 4CGTA 1SR0A 1HIZA 1WZAA 1CGYA 4WSJA 4AY1A 1V3LA 2J8FA 2J4GA 4W87A 1N82A 1PJ9A 4JIEA 1H3GA 1W2PA 3OIHA 1BTCA 4YN5A 4M82A 2G3JA 4X0NA 4AMXA 4PMYA 3QHOA 4TTGA 2ZX9A 3OLIA 3ZJ7A 3S5ZA 1TVPA 2OLHA 2XN1A 3F5KA 5E09A 4Q22A 2VURA 1GQIA 2GFTA 3VSTA 1HKKA 1KB3A 2CITA 3SCVA 5CLTA 1WZLA 4PMOA 1XH0A 2QF8A 4H8UA 1PEZA 3VSVA 2XFYA 1JI2A 2EPKX 4GI6A 1SMDA 2J7EA 3VGHA 4AEEA 3KEHA 1TCMA 2WC7A 3MKKA 4C7FA 1QNPA 1XH1A 3TTOA 1GW1A 3WUBA 3ALGA 1KXTA 1ISZA 3WMBA 3SUWA 1O7AA 3F5JA 7TAAA 2Z1KA 4QLLA 3EJRA 2EABA 4J27A 2XVLA 4KWUA 1ECEA 4PN2A 4MB3A 5F7UA 4PMRA 2Y24A 2XUCA 2OSYA 3CV5A 1ZBVA 5A6MA 2W61A 3TOPA 1G9HA 2WSKA 3DX1A 4PSRA 1RPKA 3RJXA 5GNYA 1W9PA 1E6QM 1GPFA 4HA1A 3FAWA 2W62A 1UR9A 1HNYA 4CN4A 2FH8A 2F18A 1V3MA 1DWJM 3CGTA 4DUXA 4W84A 2PWFA 2A3EA 1X6NA 3I3BA 3SCNA 1U2YA 4V27A 4DUWA 2VQUA 1CBGA 3K4DA 5GPRA 1OCQA 3CHCA 2OSWA 1VEOA 2VOTA 3K4AA 3T2OA 3ARTA 1KGXA 1VAHA 2CEQA 2J7FA 2WHMA 3SUSA 5HXMA 3NIYA 3PZIA 4CU6A 3BVWA 1FH8A 4PUDA 4F66A 1CPUA 5GNZA 2CXGA 2FHCA 1GCYA 3SEPA 1QW9A 4WLCA 3PZMA 3KLLA 4BS0A 1MW2A 3BUBA 1PZ3A 2DIEA 2W5FA 1J0YA 1GZJA 3THCA 3UR7A 3UETA 3TP4A 4H2CA 4UFHA 3VIJA 2WMGA 1KCLA 1NH6A 2XM1A 1YQ2A 4QLJA 4H7VA 3WIJA 1GQKA 4CUCA 3WD3A 1BVNP 3HG3A 2E9BA 3DX2A 2X2JA 1J01A 3SCWA 1XD1A 1HVQA 3H55A 2IXVA 4C7GA 2WZIA 3WEMA 2WC4A 4BQ5A 1UWQA 1VRXA 1B0IA 2WMJA 5GQBA 1TA3A 3SUVA 4Z2HA 3AIBA 3AMGA 1W1VA 4Z2LA 4UQBA 1QI3A 3TA9A 1K9TA 1LG2A 5A2BA 3DC0A 3MSDA 1T0OA 1JYNA 3O2LA 2WZEA 1EOKA 5AYIA 4CVUA 4AD0A 4D6GA 5I5RA 3QR3A 2WWDA 3M6DA 2YIHA 1CZ1A 1XYZA 3VX0A 4HA3A 1QI5A 2PI6A 2ZUMA 5JBDA 3TTQA 1AVAA 1X6LA 3EJTA 2FHFA 2WHJA 3PN8A 1HP4A 2AMGA 3WH8A 4M8UA 3VTRA 4ZFMA 4UFIA 4M24A 5BXPA 3VILA 2J7GA 4KH2A 3RIKA 4FF5A 5DFAA 5A8NA 1VIWA 3MO4A 4BQ4A 3GTNA 1FA2A 2WMHA 2DSZA 2ZXDA 2GJXA 3BUDA 3VDBA 4AZ7A 3WL0A 2PB1A 2BHUA 1JI1A 3EMCA 4ACZA 3BH4A 3BAKA 3DECA 4BF7A 4M1RA 3U7VA 4J3VA 1LLOA 1D7FA 3ARQA 1MW1A 4QAWA 1OD0A 4LYPA 4NX0A 4NXKA 4IPNB 2UY3A 3L4UA 4AW7A 4RL3A 1UKPA 3EYPA 1V0LA 1OGSA 2J77A 3PTKA 1JL8A 1V6YA 4DM2A 2O9PA 4ATDA 3BAXA 5ABHA 2ZOXA 1UYQA 1QHZA 2FGLA 3N11A 2D2OA 3EJUA 4CU8A 3GXMA 2F7QA 1JZ8A 4PTWA 3BXWA 4AC1X 4K68A 1HX0A 3ARYA 4CU7A 4AMCA 1C8QA 1QW8A 4JFWA 1J12A 3VGEA 1KWGA 2C8NA 5I23A 4PBGA 1KR0A 5A94A 4NF7A 1CGWA 3HMCA 3MV11 4AZIA 3NCOA 1H1NA 3KZSA 1V0KA 4IPLA 3EDKA 2DSKA 4HMEA 3WDHA 4AZBA 3WDJA 1EO7A 1HJWA 2ZX7A 3FHQA 1E4NA 1AMYA 3VMPA 3KLKA 2E9LA 4DWSA 2J7DA 4TVCA 4C7DA 4J3WA 2VUYA 3GXNA 3FN9A 1H41A 1WDSA 3ZJ6A 3WNLA 2HISA 3WDRA 4D72A 4W93A 1VEMA 1ZJBA 2CHOA 3T08A 1WAWA 1TE1A 2RGMA 1J10A 1HJXA 3AICA 4UTFA 2O9RA 4D6HA 3UG3A 2J7HA 2VX6A 1WE5A 4XB3A 5BWFA 1BGAA 4B9YA 3MUY1 4NRRA 1P6WA 3WNMA 3TTSA 1XV8A 3QGVA 3EDDA 3CMJA 1C3FA 2VX5A 5C70A 4PTMA 4DWSD 3GBDA 1CEOA 2YLLA 3BC9A 1R7OA 3J7HA 3OLDA 2XWDA 1TQTA 5EFFA 1KWKA 4JFVA 1JGIA 4S3KA 5A8MA 3ZJ8A 4PCSA 4HZ8A 2VC9A 1H2JA 1UR4A 2WK2A 5ABFB 1K9DA 4P7QA 3A24A 2WVVB 1B30A 3DYMA 3VDCA 3LMYA 1WNOA 2ZUSA 3RPMA 2IGTA 1WKYA 2YL5A 3S5YA 4B9ZA 3VD4A 1E4LA 2QMKA 4KMQA 4ATWA 1VJSA 3CHEA 4F9JA 1XGZA 3RM9A 3WY1A 3N1AA 1UHVA 4P7OA 1SZNA 7CGTA 2CBVA 3DX4A 4MB5A 2JFEX 3AHVA 2D0GA 3HG5A 2YOCA 3WD1A 2V3GA 5E1QA 3PZVA 4MJ4A 2WB5A 3BUQA 4PCTA 3W26A 4JKLA 4WJXA 5D8ZA 4AD2A 2Y4SA 3L4TA 3WUEA 2ZIDA 1XH2A 1MWOA 2YBUA 4B16A 1M01A 1W1TA 2XGIA 1Q6DA 1QX1A 1GNXA 2J74A 3WELA 1YHTA 4E8DA 3VNZA 2BVTA 4TUFA 4MAVA 2GVYA 3WF2A 4CCEA 3EDEA 3NDYA 1W9DM 1EHNA 1Q6GA 1B9ZA 4GO9A 1CGXA 1HJSA 2D24A 4XX6A 3W4RA 1PIFA 3A21A 3TTYA 1CGUA 1B3XA 5D4YA 1BSIA 3AMKA 4WKAA 2OWWA 3BVXA 1TQVA 4U3CA 3NDZA 3BVTA 2X2YA 3FXYA 1HL9A 1XYFA 2Y2WA 1ZBKA 4UCFA 3UG5A 3AIRA 1EOMA 3GBEA 4BCEA 2XG9A 2GJPA 2DGAA 1EGZA 5FOOA 5IHSA 5IFPA 1PPIA 4LPCA 5A6BA 1XSIA 8A3HA 1F4AA 1SYTA 1B2YA 4MDOA 1SMAA 2VCCA 4UQEA 4KRTA 3PTMA 3N04A 3GZAA 4JHZA 3K46A 3AJ7A 2XGBA 1UASA 3WQ4A 5DT5A 1JYVA 4TOQA 2PC8A 1C90A 4D6DA 4CCCA 4AWEA 3OG2A 1U33A 3GXIA 1GVIA 5CPSA 2ALWA 1HKIA 2BVDA 3VIPA 5DEZA 1GOIA 4DWSB 2GDVA 1I1XA 5A6BD 2RGLA 4FNTA 2VRQA 4WSKA 5C71A 2Y8VA 4GKLA 1PZ2A 1IZJA 2F8QA 1C91A 2YA2A 4W7VA 2GK1A 4HA4A 5I77A 2WANA 3IJ9A 3T0BA 1Q6EA 4CD5A 2ZXBA 1VFOA 1MFVA 2W4XA 2X05A 2WMIB 3U57A 2YLAA 3RCNA 4GIAA 3L4XA 4IISA 2OW6A 3LRKA 4AYSA 3WNPA 3O9NA 4AZCA 2BY2A 2WSPA 1UR2A 3T0DA 1NP2A 3OA5A 3BUPA 3MMDA 4QFUA 1EQPA 3IANA 3CZEA 3DX0A 3WDIA 2UWFA 4QCFA 5A8QA 1BPLB 1FFQA 2Z1SA 1H09A 3GNOA 4D6JA 1W9UA 1QHPA 4D1JA 1G01A 3GH5A 1C8YA 5A2AA 1Z32X 2YA0A 2G8ZA 3KWXA 2X1IA 2JF6A 4FMVA 2W92A 3GNRA 5E0FA 5HBFA 1EH9A 1VBRA 3B8SA 4QLKA 5FCZA 1JFXA 5I78A 5DO8A 1WPCA 3LX9A 5I24A 1XSJA 4B3KA 4DO5A 2O9TA 4JKKA 1BHGA 1AQ0A 1TVNA 5TD4A 4XUYA 3GXPA 3VIIA 3T2QA 5DMYA 4P8WA 1HXKA 2WC3A 1B90A 2WXDM 2D23A 1GUVA 1OM0A 5I0DA 1UZ4A 1OIMA 2X2IA 5A6LA 4OOUA 5BRPA 1GONA 4FNPA 4MAZA 4MB1A 1FH9A 3SCRA 1FP9A 3QHNA 3VM5A 2E4TA 5HPOA 1V02A 3RO8A 4F9DA 4UQAA 3BSGA 3M46A 2XM2A 1CXEA 2A3BA 3LPPA 1R75A 1W2VA 2OYLA 5E0CA 4U33A 4HPHA 4DO6A 3BMVA 1ZU8A 3AMLA 1W9VA 3BCFA 1DWGM 1C7SA 2UY5A 2VO5A 3AIQA 2DSWA 3CZSA 1UKSA 3VGFA 3W6LA 3KL3A 6TAAA 1UQZA 3IAQA 1MW0A 2G41A 1NWTA 1OGGA 2W66A 3CTTA 3OZOA 2BY0A 3LXBA 4NZFA 2BXZA 3ARSA 3ARWA 2VI0A 4V28A 4MB4A 5E6ZA 2JE8A 2D0HA 3CZKA 1FOBA 3UERA 1KFWA 4JCLA 1W91A 1QNQA 1W9BM 1TR1A 1V6WA 3AROA 3M7SA 2CNCA 3AMCA 2XHYA 3ZT5A 1QWUA 4AXNA 2VL4A 4FNUA 5JIWA 3BVVA 2X8RA 4GXPA 4AZHA 4ATLA 1X1NA 1J0HA 2BHZA 3I3DA 5E70A 4J3TA 2WVTA 4DO4A 1HL8A 1UKTA 3RILA 3B9AA 3F5LA 3PZ9A 4AZ5A 3GYCA 5E6YA 4DUVA 1L0PA 4PSPA 3S2CA 3MSGA 4GI9A 3B9EA 3W24A 2F1BA 3ECQA 4MNLA 2XTKA 3B9DA 1W3JA 4A4AA 2ZUTA 3UEQA 5I3DA 2CBUA 2VVNA 2JIEA 1IT0A 2C0HA 1W3LA 5LA1A 4N0RA 3BVUA 1BYAA 1UR8A 5EMYA 2VR4A 4CD4A 3VINA 9CGTA 3W0KA 2CBJA 3MI6A 2YFNA 1E6PA 5CPTA 1V3IA 4XZWA 2CESA 3T2PA 3RJYA 4HOZA 3SIMA 1FHDA 1CGVA 1B3VA 5EFDA 4LXFA 4M56A 2EQDA 4HU8A 1H5VA 1V03A 3ZMRA 3THDA 1SFSA 4ML4A 5E9AA 3WL1A 3WMSA 3M07A 2GUYA 1L8NA 4D6EA 4UR9A 1QVBA 1KXQA 3APGA 1AQHA 2GSJA 1NOUA 4W88A 3VIFA 1CXHA 3ZO9A 2YL6A 1WDRA 1B1YA 3RM8A 3WY3A 4FLOA 2WBGA 3S6TA 1JXJA 1UR0A 2WYSA 4J28A 4B15A 1LJYA 1CXLA 4F8XA 4XV0A 2D20A 5IHRA 2UY2A 4LX4A 3CH9A 3GXTA 2UY4A 1NP0A 4GQRA 1OT1A 4HZ7A 1O6IA 2OYKA 3I3EA 2E8YA 2J75A 2D1ZA 3RM4A 1G1YA 1R85A 3AHTA 4NRSA 3MUZ1 2WLYA 3AZTA 5A8PA 1JXKA 4FLSA 1RP9A 3IJ8A 3QHMA 1FHLA 3W29A 2VZOA 3L2LA 1R86A 1WDPA 3PBGA 4OZOA 3EDFA 4EAMA 1ITCA 5A6SA 3EJQA 4LGXA 2ZX6A 4HMDA 3WH9A 3PZGA 2WW5A 1W32A 2DQXA 4PMZA 2WVUA 1BVZA 3SCSA 1H49A 4HU0A 2XVPA 3JUGA 4PTVA 1V3HA 1UD8A 1JZ4A 1XSKA 1DWHM 4NSBA 3CPUA 3WNNA 4Z2KA 1E4MM 1V6XA 1GJWA 1GOMA 3EJSA 4DWSC 3A4WA 3DYOA 4ZEPA 1A3HA 1UD4A 5A1AA 1JD9A 2YA1A 5AC5A 4U5IA 3WF4A 2WPGA 4AEFA 3CUIA 3MMWA 4FNQA 2VCAA 3DDGA 5HDRA 4AIOA 2C7FA 1HP5A 4AD3A 4P7NA 3MU7A 4PRWA 2ZICA 1E6ZA 3ZT6A 4EE9A 3CZLA 2BHYA 4U5KA 1OIFA 3CC1A 2EPLX 3D5HA 2VX7A 4A3HA 3DHPA 1ITXA 1ZBCA 3BLKA 4FK9A 3NSNA 1KGWA 3W28A 3OZPA 2QHAA 3MV01 1HTYA 1E55A 5A6AA 5M3WA 1UUQA 4RE3A 1BYBA 1LL7A 1QPKA 4QCEA 3BAYA 4X0VA 4J7RA 1VFFA 5CGTA 4AD1A 2J7BA 3GNPA 4HOWA 4UFKA 1HKMA 5A6JA 1TA3B 4TX6A 3VVGA 2XWEA 3WY2A 5A6KA 2WCSA 4KGJA 1BG4A 4OBRA 3WD0A 1ODUA 3A4AA 4OBSA 4B3LA 5KZ6A 4GI8A 2X0HA 3OBAA 2WKLA 3GH7A 1ESWA 1MYRA 2VZTA 1VFMA 5A69A 4TX8A 1B3WA 1ISYA 2PWDA 1EDGA 1QBBA 2A3CA 1B31A 2J7CA 5D8WA 3HU7A 1BYDA 3N15A 3N13A 1OT2A 4OKDA 2F7PA 3PHAA 4F79A 1UD2A 1GJUA 3CIVA 4AZ6A 4D1IA 4H41A 4MADA 4E8CA 1H0GA 1B3ZA 3WEOA 4URIA 4S3JA 4WKHA 2DSUA 4M29A 3L2MA 1CNVA 2V38A 5A95A 4WK9A 3CUJA 3SURA 4JAWA 1OBAA 2ZWYA 1FFRA 2YDQA 4RE2A 2EAEA 1QHOA 3WDPP 1KCKA 1HT6A 1EDTA 1E56A 2VVSA 2GJXB 2E9MA 4R5EA 4UFLA 1BFNA 3WNOA 4FNSA 2PF0A 1V3JA 3CLWA 2CKSA 1DEDA 3D51A 2DT0A 3NJ3A 1VB9A 5D9NA 3KL5A 4ACZB 2D73A 1EA9C 2J25A 5CQ1A 3LRMA 1OINA 1KXHA 3FHAA 4H04A 4PYSA 4ZXLA 1GHSA 2QLYA 5GNXA 1LG1A 2EEXA 2OSXA 1ZS2A 2F2HA 1K6AA 1QI2A 3NSMA 5I79A 1WZKA 1UD6A 5A2CA 1JAEA 1XRVA 1UWRA 2DEPA 3AYRA 5JIPA 5DF0A 4UNIA 4CD8A 1J9YA 2ZWZA 2XSAA 3GH4A 1LWJA 3D4YA 4UOJA 4CD7A 4HOXA 4JFSA 5IFTA 1JDDA 2AAAA 1HN1A 5C8BB 3WMCA 1MFUA 3BMWA 1LWHA 1E73M 3WH7A 2DT2A 3K8LA 1QNRA 5FD0A 4J3XA 3A23A 2YKKA 1KXVA 1UWTA 4X9YA 3CHDA 2ZXQA 2TAAA 2PBGA 4MNKA 1JZ3A 1E0VA 1H4PA 4Y7EA 2XJ7A 3WH5A 3W38A 4PMVA 3VM7A 2GJRA 1F4HA 1QOXA 1PS3A 3VMOA 5M17A 3VOCA 3BLPX 3E1F1 3PTQA 1EHAA 4KRUA 2X2HA 3CUHA 3ZR5A 1H11A 3LPGA 4IM4A 2EADA 1UOKA 4P8UA 1KTBA 1E15A 3T09A 5FKYA 1QI0A 2PBOA 3A3HA 5KEZA 7A3HA 4AZGA 4OJYA 1C92A 1XCXA 1JIBA 1MXDA 4Q7NA 1K9EA 3DHUA 3SUTA 2OWXA 1JNEA 1J18A 5FL0A 1FH7A 3IJ7A 2VZSA 1MW3A 1KBKA 1WZMA 4GQQA 3AHYA 1PBGA 2YFOA 4PMXA 1GORA 1US2A 2Y5EA 1LQ0A 1OGBA 3AXHA 3WENA 1CXIA 1V02E 4J3UA 1UD3A 2J62A 5DT7A 2V3EA 1G0CA 3L4WA 1VJZA 4TVUA 3IK2A 2WMKA 1V08A 1NOWA 3ARPA 2BY3A 3K8MA 1JZ7A 4WF7A 3ARRA 4YPJA 3AIVA 1W3KA 4Z2IA 3AZSA 3ARZA 1ZL1A 2IXUA 3AI0A 4D6FA 1S46A 2JEQA 1BGGA 2XVGA 2VNCA 3MANA 1K9FA 4D6CA 1JDCA 3ARUA 5HPCA 3ZT7A 3GDBA 3WNKA 4AIUA 2ZX8A 2WBKA 3W82A 2D3NA 4MNJA 1C7TA 2W67A 4IUGA 3U7BA 2WHLA 1WCGA 3AS2A 5CPQA 1DWFM 1B3YA 1LL4A 3WDQA 3VNYA 5CJ5A 3AXXA 4NZCA 1QBAA 5AC4A 3GXDA 4PMUA 1WP6A 3VD5A 4LQ1A 3OB8A 2CKRA 4QDMA 2F61A 3HG2A 3WBEA 3VGGA 1QI4A 2WCAA 3WY4A 3WD2A 5BXTA 3H54A 1MXGA 4JHOA 2VRJA 2ZUUA 1DTUA 4MDPA 2ZXAA 2W63A 3CUGA 2BVYA 2ZUVA 1ZJAA 1XD0A 1J0ZA 3W27A 1TG7A 1GOWA 5JBFA 2VJXA 4W89A 1GHRA 2ESCA 2ZX5A 2G4FA 4GZJA 1LL6A 2VQTA 2FH6A 2XVKA 2XVNA 3WQ5A 2BS9A 4MNMA 2DPEA 4PMQA 2YL8A 4PMDA 3G6LA 1JDAA 4UQCA 5BXSA 3D3AA 3SUUA 1ZB5A 1PIGA 3UCQA 1E5JA 1R33A 3VDAA 3DYPA 4UQ9A 1V6UA 1CDGA 4UZUA 1EXPA 1UQYA 1NOFA 3AISA 3KL0A 4CKQA 1W1YA 1QWNA 3ZOAA 3QOMA 4BA0A 1ODZA 1EQCA 3VDHA 1OD8A 1JYXA 5FIPA 3N9KA 2CPUA 1BAGA 1UR1A 3CZ8A 4ZXOA 4J3SA 2BXYA 3W37A 1VEPA 2V5DA 2WAGA 4NZJA 1M7XA 3WQWA 3VD9A 2D0FA 3VD7A 1J11A 5FL1A 1CLXA 4CCDA 2G3MA 3CBWA 3VKKA 3D52A 3BGAA 2E0PA 5BXRA 1R7AA 3ZIZA 2GDUA 1RD6A 3DDFA 1OB0A 2PWEA 1BQCA 3AIUA 4TTUA 2IUZA 1VBUA 1TQUA 4GZIA 3II1A 4ZE5A 3W53A 5HNNA 3WUFA 5ABEA 4UQDA 1D3CA 3K1DA 2A3HA 2ZUNA 3T0AA 4GO8A 1R34A 1UZ1A 4FNRA 5HOSA 2XFFA 4JZ5A 2E3ZA 1G94A 1JZ6A 3WSUA 1OSEA 3OGSA 3VIKA 4AISA 2WLZA 3WEZA 3WF1A 3PZQA 3WUGA 2EO7A 5CG0A 3O6AA 2NT0A 1J0JA 1UH2A 2BFGA 4OOZA 1WDQA 2WKGA 2JEPA 4EANA 4U2ZA 1UH4A 3VO0A 4L4PA 1Q6FA 3AXIA 3FW6A 4PMNA 4W5UA 1ISVA 3BAJA 4U3AA 1G5AA 5M03A 1VF8A 1C93A 2BV9A 2O9OA 1MVYA 3U5YA 1NM9A 2DT1A 1TQSA 5CZKA 3HN3A 4XZBA 4BQ2A 1HJUA 2J47A 2GK1B 3WQ8A 4AD5A 3UR8A 4ZE4A 5ABFA 1CECA 1R47A 2WVVA 2FDMA 5ABGA 2VTFA 1PX8A 2OW7A 1XCWA 5BYWA 1Q4NX 2QMJA 3UG4A 1EIBA 2EPOA 3CO4A 3VGBA 1UWIA 3A5VA 5A8OA 1MQQA 4N42A 2FYVA
chains in the Genus database with same CATH superfamily
3L7EA 2G0WA 4AH2B 5AYYA 1Q9LA 1CMOA 1LO2H 2HROA 5TE6L 3EBVA 4TM9A 4OVXA 3FQNA 2DTMH 1BYCA 4RQQB 4YX2L 3QIUB 5KMYA 1ECYA 3WJLC 3V4UL 2D9QB 3DXIA 4A63A 1L9PA 4X6BB 2WQAA 2E86A 5H35B 2IANA 4G7RB 3FCGA 4CJ1A 3QNXB 1QPOA 2BOEX 4W7WA 4U1HA 4PJ8C 4UUIA 4GNVA 3HR5A 3BW3A 3N85H 3FAXA 1U91A 4X4MA 1KQYA 3LGDA 2KHAA 2WXNA 2PCPB 4MM1A 4JQ1A 2DB8A 3NIFE 3DI0A 1KFAH 1AO7A 4FQIH 3UT0A 4W9ZA 3UZJA 3KPMA 5BOJA 4HPNA 4JL2A 1OLLA 4GPNA 1ML1A 2W0KA 1EXBA 25C8H 4EDWL 5IF0B 1CDUA 2F9RA 2XPYA 1AHWC 4IRSB 1HKVA 1KBBA 1HI6A 2R24A 4QR7A 2RFXB 4D6IA 2YD1A 3EFDL 2ZXCA 1O7SA 4YE4L 2VXSH 3KWUA 2DL2A 4KJYA 4F0KA 2Y85A 3BSHA 1R2SA 3I85A 5GGSY 5KSBF 1VENA 3LRHA 3ULVC 1T20B 3T7VA 3PJXA 3MRIA 3V5KA 2R1XA 3DVIA 1I9JL 4HUWA 2EACA 3N18A 4WJEA 3TV3H 1US3A 1KTDA 1SGKA 4JFEE 5EOQH 3TV8A 2VDGA 3QGAC 5BMXA 4I9WE 4E0RB 3HE7C 2NXZD 2ZE0A 3H2EA 3LNDA 2QV4A 1LROA 2VB5A 1BQLL 3BPLB 3KBMA 5C92A 4OT1L 3DG7A 3OKNA 1E40A 3MLVH 5DQ9B 3AIWA 5I1JL 2BBFA 1QFUL 4ETQA 3W39A 3DUUB 4P5RA 2OG9A 1NBYB 3LPOA 3VNDA 3O07A 1S7UB 3QDJB 1ZVSA 2WWCA 5AZ2L 4I2XE 3MRJA 1PD6A 4Z7UE 3WIFB 3N6YA 4H2AA 4ODVL 3HUJA 2VLKD 3U46B 4F40A 3F83A 3SGKA 2R0KL 2VLLB 5F3FA 1H3PL 2YGPA 3RB7A 2FKPA 5D9PA 4AEHH 4P46B 4PUBH 3QUYB 1Y6NR 4Z7QE 1MRFH 4PJGB 1UP2A 4C6DA 3NCJH 1G7VA 1DWAM 3OEXA 4UOZA 4F2FA 2JKJA 3EOYG 1LOQA 1TZ7A 2CHNA 1ZHAA 3BLBA 3CAKA 3WFLA 2XFRA 2G5RA 3HQOA 3BAIA 4YCOA 1ZGLM 4OV4A 1O12A 1JULA 3T3PF 1FP8A 2VWSA 3FXGA 2AI0H 2XN2A 4URTB 2V5SA 3JV6B 4F0SA 4P57B 3OKKA 2TRYA 5HDWA 2Y8KA 5CC5A 4U4BA 1DIOA 4HWEL 1TTCA 4TSCH 2Q7YB 3E8UH 4ASTA 1FAIH 3SSGA 4F2TA 4IIHA 1D9KC 4MX7A 3ZPDA 3D4GA 2I9LB 2VAAB 5FGCB 2C19A 4MYWB 2O26U 2NPLX 3L0NA 4Y4HC 4E2OA 3CK5A 4UFMA 3BOLA 5ESAB 3KGUA 1YEIL 4GY0A 1WGVA 1DFBL 5AOZA 3F4VA 1E43A 4X7SH 2CZFA 3UZVB 4RNJA 1TTAA 3HBGA 3O3RA 3FBKA 1TLMA 2WIIB 4LIQE 4XNYL 1HYSD 3CFBA 4RGMB 1MCSA 4LBAA 1RLWA 4Q22A 3IDXH 4F7TA 5KJRL 5BZXA 2FEJA 1A1NA 2DWSA 3S35X 5CIPB 2CITA 3VRJA 5LN8A 1JNLH 4QD2E 3B3BA 3CDZA 4KFNA 2H6PA 3R0MA 2J88H 5C5YA 4BE5A 4ZMWA 2WC7A 3DVGA 3FQTB 5IY5B 2Z64C 1W5PA 4XVJL 4FZIA 2A9NL 1B0GB 1HZKA 3QO0A 3F5JA 2QCMA 3UIYA 1CF1A 2JKLA 4J27A 1P1VA 3L5WA 3F12A 1NFAA 3IETB 4PMRA 5F7KC 4CVZA 4HZLB 3A3WA 4GUHA 2OSYA 3KFTA 5TK4A 5EZOH 4NJIA 4TULH 2J2ZA 2CLLA 1WXZA 1YEHH 1NDZA 2Z65C 2X7LB 1VFHA 3UJIL 3FB5A 1HNGA 2BASA 2J8OA 4KWVA 4V27A 4GMSL 1NFGA 4IX2A 2AK1L 4ZQKA 1LBFA 3NSDA 4IWWA 3GFZA 1DBML 2H3XC 3A4FA 1UZ6F 4Y19B 4XK2A 4W4NA 2VWTA 5TQLA 1TRDA 2EF9A 2Q76B 3RIAF 4DEFA 4HETA 1GCYA 1QW9A 4WLCA 4GYPC 3BUBA 3THCA 3FUKA 5KBLA 2R15A 1QTPA 1GQKA 3MNZB 4RGNE 1EHXA 2X44D 2IXVA 2H32H 5C0JA 4QRRA 2XYCA 1BQRA 1OK6A 2Q2LA 3IGSA 4GKNB 3LNFA 4YO0A 1U58B 5ENLA 4JFYB 1ZSDB 5D1ZD 1X5KA 3O2LA 4FFYH 1BJ1H 4ZYKA 1T7VA 2YXFA 2F15A 2PDWA 3BW4A 1QI5A 2JIXB 1E9YB 1AVAA 4MD0B 1C5DB 2PGEA 3PN8A 1WTLA 5F6HJ 3F05A 2UBPC 2J7GA 1A5SA 3QORC 3GRWA 5A8NA 2OQJA 2GJXA 4JM2D 3F7VB 2Y1AA 4KXZH 4HCLA 3DECA 1T3FA 3IBOA 4O51B 1FXQA 1J5OH 4O16A 1F18A 3WLBA 4HHWA 2AW2A 3DVNB 3V0VB 3LKRB 3MR9B 2OLSA 3GS6A 4JM0A 3HHMA 2JB6B 2V2DA 5AB9A 1ZLWK 2V67A 1CICA 4O00A 1B0RB 3DX6B 1FLTX 3ARYA 4N26A 2GWGA 4LEXL 2ZRWA 2BLFA 3GZKA 3LTVA 4C4UA 2X4UB 3QYQA 1DQUA 4UTAH 1DJSA 4NQDD 4AZIA 3NCOA 1OAJA 2WTRA 4I5BB 4A39A 2XQYG 1TEFA 3WDJA 1I8IB 2DMCA 3BG5A 3UA4A 2EXYD 4HXBL 1IAIM 3UGUA 4C6MA 2A9BA 2V5RA 3FFCB 4H9YA 5BJTA 1VEMA 2CHOA 2AXWA 2J21A 5IKCB 3AICA 5HYQB 1U8LB 1JGEB 1DN0A 3TPUA 1GGBL 5L2KA 1EZVY 2VX5A 5DUPL 1W6WA 4GJJA 1CEOA 4KAQL 4RMTA 4I3GA 4NQED 1VH7A 3OLDA 4AQ8C 1Y5XA 1PLGH 1MLCA 1RA0A 5E1AB 4GH3A 1N0XH 2VC9A 2KPWA 1UWXH 3TBWB 4FJYA 4JNYA 4PJ9A 3KNBA 1X5AA 2CJSA 3GZQA 3AAZB 3C8NA 4ZW6A 4AX7A 1E4LA 4U0QB 1TZIA 3QAQA 3FZUC 4K2UH 1R3IH 3D69B 3CAQA 4WD0A 2F54A 3T77B 1TKWB 4ZNEA 1X44A 4JO3H 2FVMA 1YSOA 3QWRA 3WD1A 2AABH 4FD0A 5KVDL 2CLEA 2V7HA 5KW9H 5I7GA 4DAIA 1ONEA 3O06A 1MDRA 4EMZA 1ANUA 1L2QA 1JGUL 5AKQA 3L3GA 2EXWD 5DEFA 4M43H 4NO2B 3C0QA 5LCVH 4YGVB 2YZ5A 1XDLA 1R3VA 4JFOA 1XM3A 3BT2L 3ZO0A 4YWGL 1HKFA 4JVWA 4JO4L 4IGBC 1D5XB 2XKNB 5CN2A 3UG5A 2FBJH 5DVPA 1F2JA 5GJPA 4BFOA 5IHSA 3NVTA 2R91A 3KLAA 1JTPA 2MQCA 4JFFB 3ZTCC 1XLFA 4KRTA 1X4YA 1I60A 2KMWA 4OU1A 3T0XA 4U1SA 5BUGA 4PJHE 1SW0A 4KKAC 5D7SH 1KEGH 2X9XA 1RVFH 1GT8A 5DEZA 1NANI 5I3FA 5FJRA 1INEH 2F6UA 2XTJC 4O02H 4PRRA 5D8JL 4I1NB 1AZUA 1UB6B 4Y7MA 3IJ9A 4LVNC 1Q6EA 3ML8A 4ENZA 1VFOA 1MFVA 3RVTD 4LPTA 4G5DA 5I2IB 3O6FB 2W07B 1Z7AA 1JNJA 3II3A 3QXDB 2BY2A 2DZUA 1F1DA 4URKA 2SFPA 3HLKA 5I74B 1T0MB 1IGFL 3B0PA 1WAAA 1ZCOA 5A8QA 1TRIA 2Z1XA 2P8PB 3AREA 3MT1A 4LCWB 3P11L 3P3RA 5FGBC 4LF2A 4ZSOE 4W9GC 2QQKH 5LGHH 5EFIB 4DN4H 5B1JC 4DQAA 5DO8A 1XSJA 4X7TA 1G9NH 1KLYA 2HNEA 4IIDA 4LVGA 1EKOA 1ZT1A 3EA2A 4PR4A 1BZOA 1P4LB 3V1HA 2QQ6A 2WXDM 4DGYL 1TCDA 1QPRA 3QZEA 1WIPA 3EYSH 3SPGA 4J1UA 5E00A 3LY6A 5RUBA 2H47C 4MB1A 1FH9A 1E8YA 1GS7A 4I7WA 3FYYA 2BK8A 3QRLA 2QJGA 3B9KD 3RIFF 1G7LA 3SDDB 3DGGA 2X12A 2NQ9A 2Y0FA 2G37A 1M6OB 3WBXA 2OTWA 5JMRA 1DWGM 2DVXA 4FQ1L 2AF2A 1A6ZA 2JKRM 4IEFA 5A6IA 6TAAA 4CSZA 3MDWA 3VNLA 1E6JL 3KPQB 3IFPA 4BSVB 2ZONA 4ZFGH 4MB4A 1SHMA 1QSED 4CDGC 4LNVA 1T1ZA 4PPTA 4XVDA 1WFTA 3M0MA 3JWDH 1PNCA 2X8RA 5MEQA 4L64A 4ZW5A 5T9CE 1JCVA 2BHZA 1VYRA 2EVJA 5KYXB 1AQDA 4WV1A 4F2UA 5E8OA 2VKXA 4UAOB 3BD5A 1CL7I 1IT7A 4LQFH 2LVCA 5BOEA 1FVPA 3DFYA 4GXMA 1NCDH 4X2PA 4F57H 3UEQA 3CCHA 3FH7A 1VHCA 4X0KA 3ZS4A 3QZNA 4EDXA 3U4FA 4PP1C 1ZANH 4TL5A 3BVUA 1E7VA 4IK7A 1A9VA 4QRPA 9CGTA 1J6OA 2YFNA 3L1FA 1LLWA 4KQ0A 3SIMA 4ABQA 4DBUA 2P50A 5EUOB 1ZCCA 5EEUA 3PUUA 4Q4OA 3H12A 2CKNA 3EX2A 3LDBB 3P81A 1MY5A 3UZZA 3WMSA 4PJ7F 1UA6L 1L8NA 3NQVA 5J0BA 4KUCD 4QHNB 2GSJA 1CXHA 5D6CA 2H2SD 2YL6A 5G1MA 3CXHK 5GJSL 1EANA 3R1ZA 3WY3A 5LAPA 4LEQA 2HSAA 3U2IA 1CXLA 3SY6A 3GXTA 1FPTH 2UY4A 5GGRY 3S8FB 3TN4A 1OT1A 1H1ZA 1MJUL 4OFPA 4ZQNA 4EXQA 1GS8A 1JZEA 1JXKA 3FTGA 4LVHC 5E2JA 3HE6A 2DJ4A 4MXQC 1W32A 3QC3A 4GXFA 4KIEA 2D7TL 1W5QA 4PMZA 3L9YA 2GQAA 1BVZA 4O11A 1JWUB 1WS7A 1U2CA 4FXSA 3DV4B 3N40F 5ID0B 5JA8B 1XLMA 1XR2A 4D3CH 1MQ8A 3IDNA 3DDGA 1IGTA 2QVFB 4DFHA 2FEEI 3DHPA 2VDQL 4QWWC 5K39A 3OZPA 2FB4H 5EC1A 1O4UA 3EBAA 4K3EL 4ZX5A 2V37A 3HN5A 1XWYA 43C9B 5L9FA 4X0VA 2H26A 1MI5B 4AD1A 1G4SA 1DE5A 2YAQA 5A6JA 4GXUN 5LGJB 1VF5C 2CRIA 2Y3AA 3MB9A 2CZDA 3UZQB 4MD4A 2OK0H 4Q8UA 2BVEA 1QBBA 2QADB 2A3CA 2J7CA 5EY5A 3N13A 2EIDA 3CPLB 2JQZA 3GUWA 5K2ZA 5JR1L 4URIA 3HC4H 3N9GL 3TA4D 3UBXG 4AUUA 4KXDA 3HG1D 1FYHB 1M41A 1AGDA 3ILQD 2E59A 3WU1A 1XH3A 5I30L 5D7LE 3D51A 2VLMD 4ACZB 4NZRH 4AYFA 2JI3A 4FCAA 3SN1A 5I09A 3O81A 1JWMB 3PDGA 5I1GL 1ZS2A 5GIRB 2H41A 1WZKA 3BGFC 1F00I 3VFNA 4UNIA 4XNUL 3NIDB 1T2JA 3WMCA 1OTSD 1OV8A 3BP6B 2WSYA 3N9SA 3EFOB 4GUOA 2AGJH 2YKKA 4MJ6A 2A21A 5DCBA 4MDJB 4NQCE 4ES4A 4ZFCA 3OQEA 3LIZL 3V7PA 1F4HA 4JPIB 3HIJA 4GG6A 3HI5L 4OD2B 3I6LD 3QEZA 1UOKA 3QVAA 5D2LF 2EDJA 5LNGA 5FO7A 3RWGA 4QS6A 4NNXA 4FIRA 2A7NA 3VGAB 4CQCA 4Y19D 4R8WL 4IBZA 1FH7A 3AHYA 5KJ4A 1US2A 5DK0B 4NO5B 3B3IB 4JFDD 3MA7A 1PDKB 2NTFB 1NCTA 1XRSA 3KTCA 4NLHA 1ZLVK 4B5SA 4Z2IA 3AZSA 5HYIA 2K78A 1RUMH 1ZL1A 3OPUA 3N34A 2PW2B 4G1KA 4FN0A 1GR7A 4EPKA 2QIIA 4G8EB 5IMKB 4B7LA 1C7TA 1B2WH 4LAQH 1G6CA 1A8JH 4MWFA 1TWSA 1DWFM 3SDOA 3V5CA 3AXXA 1P6AB 3JTSA 3GXDA 4PMUA 4P4KA 4X4YB 3C2EA 4OFVA 3U2EA 4OFQA 3KYNB 2M2DA 4JTEA 1LEGB 2CCWA 2WCAA 3WY4A 4KNSA 4NRXB 2RHEA 5DD3L 1YYLL 4AQAA 4QJ4B 4S3DA 4JAMB 4XZIA 4LCCC 4AYDC 1DXIA 2WYHA 3SUUA 2B2XL 3UCQA 4F7PA 2E7DA 3HO8A 2CIKB 2YAOA 5GS1C 2EDEA 2H2PD 1MH5A 1EQCA 4OJEH 4KY2A 3OXSA 4O0ZA 1GK8A 2FO4B 4FULA 3RGBA 4ZXOA 2WO5A 3OAUH 4GRWE 3T65A 4MJID 1U8MB 2ZRVA 5DHYB 1VBGA 1SXCA 1MPAH 1F6KA 5IOPA 1TO4A 4C5ZA 2A6KB 3TO2A 1EUAA 4H88H 2ZVIA 3PAOA 5HOSA 2XFFA 1BFSA 2E3ZA 3IPWA 3WSUA 2B81A 2WLZA 1VCVA 4TVPH 2OVLA 3PZQA 4L9YA 4L65A 1CT8A 2WKGA 4EANA 4EEEA 3VO0A 4YJ5A 4GKSB 4Q4IA 4L4PA 4ONGL 1XF5B 1ONXA 4U3AA 4NT6B 3FFCD 1SZFA 5MP6H 4XO6A 3H9YA 3EG9B 3VXOB 3CSYA 1NEPA 1UJTA 2J6XA 2BLEA 1ZWIA 4LLDB 2PDFA 1JXDA 2OW7A 1TTJA 4LVBA 3Q1EA 2EPOA 4MMZA 4H26A 3BDYL 3Q45A 3IMTA 3LQZA 1CD9B 3ZWSA 3O11B 2OM5A 3KBNA 4DAGH 2NNCA 2E8ZA 3GJFK 3DSFL 3VI3A 2X0YA 5F9WC 3PPGA 4AYID 3GI9L 1Q94A 3OKEA 4G7SB 3IDGB 4EI5C 4C56B 1C1EH 2O92A 1Z9OA 1JK8B 3APDA 1TPWA 5DRWB 1TQCB 4EPSA 4DVOA 3KXFD 1UUMA 3H0TA 4RSYA 4NAFA 3PAZA 1PYMA 4F0RA 1W1IE 4TNGA 3U9UB 5GGVL 1JUBA 4I1RA 1CI1A 4P5TD 3UDWA 1PKMA 3AZRA 2WZTA 4LT9A 4UWMA 2ZD0A 2X70B 1LXMA 5GGUA 4Q7IA 1M57B 4F0MA 2BSSA 1GYCA 3UYPB 4HCIA 2YPIA 4I4WA 5EN2B 5EO0B 3REVA 2C9RA 4W85A 4MLJA 3ZDXF 1VC4A 3LH2L 1CYGA 1H0IA 2NX5D 4E9SA 4JTIA 1E1EA 1G5GA 3ARDA 3VIOA 1E6XM 2ZYIA 1CU4H 1TZOA 3K6SB 3HJEA 2R4RH 1SYSA 2MKLC 2MCMA 1W72L 4Y5VB 1HEZA 4NSKB 3WXWH 2VFHA 3H9ZA 5I6SA 5JHAA 4MNQA 2WCGA 3LKPA 1U3YA 2QDHA 3WN5C 1SJDA 4J6IA 4GBUA 5FYJE 3NZRA 4JFFD 1KG0B 2OWCA 1X5MA 1GOOA 2XN9E 4JZOA 3LNIA 2OELA 3MRPA 4IIGA 1U41A 2O6PA 3BEVA 4GZ7A 3QM3A 4UILL 4US6A 2IIJA 3VWKA 1UWUA 2WMIA 1YY9C 1URLA 4K94H 3DX8B 3SJVB 1UENA 2Q8AH 3RWIB 1ETB1 1DVUA 4C1KA 2GJZA 1TFVA 3ALFA 3H21A 2Z1PA 4PRAA 2MWCA 4J3OH 3ATZA 1Y7VA 1E1FA 3TO4C 1KGUA 2CLHA 2NW2B 3URAA 3SDAC 3GHTA 4Y2DC 1KPRB 1EGJA 1EHLL 3O6KL 1FIGH 3A4XA 3QFGA 4ZSUA 4G9FE 2Q02A 4FFVC 1AD0A 3FNDA 3H9HB 2XWBA 2ESVD 3CQPA 4FHJA 3QI9D 4H6KA 4ZOEA 4JIHA 3BW9B 4Z2JA 3HG4A 4QE5A 3IGUA 4W8AA 4GVFA 3PZOA 1IEIA 1I4FA 4JEQA 5IB4A 2HJFB 4DCQA 3N4EA 4WUUA 3CT7A 1P5UA 3PP4L 5D4QA 4KI5F 3IPEA 3FCSB 1ZTXL 2Z35A 3C0SA 4NJAL 3LZRA 5C08A 4XCFL 4OFDA 1KN4H 4EACA 4GAAA 2X4NB 1HJCA 4XXCC 3WLTA 3VQ2C 3ORWA 2Z92B 4AITA 1XMEB 3SDDD 3ZZ1A 1CTNA 1S7QA 3CXFA 4XSLA 3AXMA 3TUUA 4Z9KB 4AY8A 1IEAB 3V5DB 1HH6B 2IOMA 5E4AA 5EL1A 3BAWA 2GGEA 2VL5B 5KYWB 3M9YA 4H8VA 2YD6A 3GYRA 2X30A 2ZAIA 3NACL 5KBDA 4HN8A 4R83A 3BVNB 2KZWA 4N8VG 4AHQA 4Q4EA 3RJDA 1DBJL 3C2AL 2AQ2A 3CFQA 2QSCL 1P53A 1NWUA 1CXFA 3BUYB 5JDSB 4RDZA 3H53A 2NXZB 2ZAGA 3CX5K 5I6LA 3HNSL 3AWOA 1HHGA 2QPUA 5LIKX 1KTCA 4PGCA 2X28A 5F96L 3BPOB 1OF8A 2R0ZL 3P3UA 1YNKH 4OFYA 4L0PB 5CSSA 4HBQA 4BKTC 1OQXA 4OLXH 3HPZA 2ABBA 3F58H 4Z1PA 5GISH 2P5WB 2GFTA 2PR9A 4Q6KA 4WEBL 1AR2A 2BVPB 5TDPB 1U8IB 2WLIA 4D9QD 3SGJC 5JW4N 2D03L 1BF8A 3H2WA 3VGHA 2VLKB 4WFHE 4QHRA 5FYLE 1KXTA 4LRNL 1ISZA 3WL9A 1O7AA 1T21A 2ZT9C 3H2OA 2Z1KA 1FNLA 2I5YH 1HILA 5EUKB 4WDXA 4MB3A 4TRPL 2Y24A 1R0MA 5GSRB 3QJHA 1QJWA 3DX5A 4N9CA 4HUNB 1UXWA 2QGCA 4E9LA 3GMQA 3O4LE 5IG7B 4P5KA 3IN0A 4DUXA 5I73C 3GUFA 1E0TA 4BH8A 1JCNA 2Z91B 1MFEH 2VQUA 1EX5A 2OSWA 3RVVD 1A80A 1T5AA 4RK8A 3MLZL 3NABH 2CLZA 5MERA 1EAPB 5D7JD 3KBHE 5FM4A 2CKBL 4MKTA 1MW2A 4FL4C 1W15A 1O1HA 4O57A 1K3UA 4H2CA 3DIPA 1MCFA 4JKWA 4CUCA 1E6OH 3IWUA 3K6IA 3HG3A 3NJVA 1N8OE 2E9BA 1P4IH 1H19A 1IXNA 3TIDB 1NBZB 2WZIA 1VRXA 1B0IA 2E47A 4XP6H 2FIQA 2RJHA 2Y63A 4IL0A 1MJ7H 1E28B 4Y4KB 4HZAA 1XPYA 2EP6A 3LTYA 4O8AA 3VX0A 1BEXA 4JG0H 3ZYJA 5C0IB 2C3HA 3B8YA 4MA7L 1IR1A 4B0MM 4YWSA 1RZMA 3T2LA 2Z93A 1OANA 1UPMB 3VTMA 3MO4A 1QU4A 2QADD 4RESB 4EKXA 4NC1C 4PG9B 3ETBF 1MAJA 1A7BA 4GEIA 2X89A 3VDBA 1RLCL 1YLVA 1IILE 3OHXC 2BIMA 2Q3RA 3CVCA 3PWJB 1FGVL 4C90A 1V55B 3CVIL 2VXQL 4QAWA 1OFPA 1IHIA 3F7YA 2ASHA 4AW7A 3CDCA 5EU5B 1GEHA 2FATH 4OECA 1TX2A 1V6YA 3B37A 4ZOAA 3MP4A 3H3BC 3OB0H 2QPDB 4X6CB 2AQQA 2F5BH 1JZ8A 1G9MH 4GKZB 1MHEA 4MLRA 4OLVH 1TCRA 4AOFA 4HIHB 4S3BA 5D32A 1SLVA 2B1AL 4Z78A 2B3IA 1LNUB 4AW4A 3MV11 3ZWTA 1CQYA 1JPTH 5IFHL 4Q58C 3IARA 1X96A 2GKIA 3RUGB 4AL8L 1PG7L 3JQOB 2H3NA 1I1FA 1SOKA 3BOVA 5D1QD 4ZTOH 3X1BA 4FAMA 5ICXA 1AOZA 3WDRA 4NT0A 1SDAB 2VDQB 5DEGB 3O63A 3ASNB 3QLLA 3EA1A 2FJFA 2ZYHA 4YL4A 4PRPE 2OTPA 1KB5L 5CZRA 3OJGA 1S5IL 3TLLA 5AENA 3FUEA 5CP3H 4U49A 4BKLB 1FA4A 5D1ZB 5C8JB 5ABFB 3BP4A 4JDTL 4J8RA 4R7XA 5E51A 1EJSC 4IP4A 3X3FL 1NAML 4WSHA 4NQ1A 2BIQA 5BS0D 5DD6B 4OCRL 1XGZA 2D7MA 2GQ3A 1Q8JA 4YSAA 3PPEA 4DKDC 4HU3A 4QOKA 2QR0B 3WJZA 1JPSH 4JM2B 3RU6A 2JFEX 5FB8A 2UWEA 4PP2B 1ET8A 5SWUA 3HG5A 2YOCA 2Z4GA 2GITA 4PJAE 2XTJE 1N5AA 3W07A 2DORA 3FT0A 2BSLA 4MD5B 5HYSB 4Y89A 4YK4C 4K8HA 5BU9A 1F61A 1Q6DA 3S1XA 1BOGB 1F45A 2Z27A 2R4SH 1EHNA 1SY6A 5IQMA 3ZKMD 5CBEB 4FKHA 2ED7A 1HJSA 3MRRB 1FL6A 3ZXWA 3AUJA 3DSNB 1DJYA 1U92B 4NQDB 4KW2A 1NVMA 4QXUL 3G6DL 2P45B 4FRWA 4XTRC 5EV7A 5BVJB 5E6UB 3QVQA 2GTWA 4GP8B 2RH0A 3O3AB 3P74A 1FVEA 5EBUA 4RFEA 8A3HA 2C4FT 2PPDA 3V5HA 3PTMA 5G4OA 4K7PL 3FQUB 4I8YA 4KRZA 3U3HA 1CLOH 4APXB 3R2GA 3NVDA 1VD6A 1O5QA 5CC7A 4OGAD 3SIZA 3D34A 5F6IB 4ZNCD 2FBOJ 2GGHA 1EYEA 2Y8VA 4NQEB 1E4KC 1C91A 3EHBC 3C6SA 2R29L 1T5KA 4MNGA 2DJMA 2UYLA 3T0BA 2W60A 5JXAH 2Y61A 2FYMA 3L5XH 3ZUNC 1TB3A 2X87A 1US0A 3LRKA 2AGKA 4KEUA 1I0DA 4H2HA 2ZOWA 1UR2A 4IIQC 3C09C 2E76C 1KTKE 2JB5L 4UU9A 5I8EB 3QDGD 1BPLB 4GYKA 4I0PA 5AHMA 4K71B 3GG7A 1MZZA 4TUOA 2ZOUA 4O28A 5BVPL 4Y4FB 4LRIC 2YA0A 2J6EL 2MTPA 1AXTL 4F93B 3VKJA 5T3ZH 4ODXB 3RF9A 5E0FA 3QHFL 2J6WA 5H2BA 3MX0B 4RIRA 3LX9A 2GAZB 3IS1X 2E09A 2PDPA 4G1EA 3QUXD 1OFRA 6PAZA 1HINL 2Y9RT 3HBQA 1SFLA 1NGZB 3S1UA 1SM3H 5I5IA 1GUVA 1RUSA 3LKOA 2NR6D 3FFSA 3L6FB 1DUYA 4X60A 3FA4A 1L6YA 4Q3MA 3PF3A 5ECVA 4FQHB 2ICEA 1NCIA 3PJNA 2Q6WA 3IVKB 4N0CD 3B8WA 3SZ8A 1ZU8A 2VOMA 1W9VA 4DKEL 4W70A 2GGJA 3TYDA 1IGIL 4PHXA 3LSBA 3ARFC 2NUPA 1A8ZA 1OAXL 4G7VH 4MLSA 3CZKA 4Z7WB 3R10A 1UM5H 4YBLC 1JERA 4D9LL 1V6WA 3BWUF 4JQVC 5I1EH 3F4CA 3ULUH 5C1MB 3PNZA 5JHMA 5EBMA 2AJ3A 2E28A 4WWKA 1WBZB 2NNAB 2DI9A 2FVNA 3FQXB 4K1WA 2V2XB 1Z9AA 4LZKA 1BWKA 2E67A 3LRSB 1YNYA 5IZ7A 5DDHB 4LVDA 3KBEA 5FDWA 5C0FA 3V10A 1FRGH 3TMQA 3WIIL 4AUJA 4OF3A 2M83A 1BYOA 4QXTA 3LMJL 4ATTA 2LAAA 4OQVA 1A2YB 1Q65A 1W3LA 3SJVD 5TPWL 1LUCB 1FWIC 2J55A 1AD4A 1BRLB 3VINA 4FP1A 1LVEA 2DMBA 5CPTA 3GMRB 2ITCB 1WT5C 3X12B 1W2KT 2NUYA 4TR9A 4N3TA 5AYUL 5F3HB 4Y1AE 5SX5K 2ZP8A 4NASA 3WK2A 3ID7A 4A6YL 1SFSA 4X5QA 1MCEA 2E7FA 3A5FA 3DIFB 5CR8A 4N20A 3IJHA 4JN7A 4BUHA 4GBXA 4QRNA 3FYOA 3DHJA 4PS4L 1ZJHA 1NGXB 2PCFB 2Y3NA 3B9KB 2FGWL 1FWJC 3F7QA 4Q8NA 1OG6A 2C3ZA 3BPCB 1PZ5A 4L4MA 3Q4DA 1HHHA 4EUPG 1X98A 3SI9A 1RZIB 4MGXA 5G5DB 2B4CC 4NZUH 5BUPA 1OGAE 2X4PB 2ZUQB 3PUOA 2QHRL 4JIPA 2CBQA 3RX9A 3JW7A 5TE7L 1W72B 3NRQA 1QSEB 2GUBA 5H8MA 3BSMA 4NRZB 4WAFA 3CFCH 3QJUB 1V6XA 1GJWA 5J6HA 3WHXB 4AENA 1VS1A 1A0DA 3CUIA 2VMDA 1XYBA 4FNQA 4BINA 1LO2L 5AHIA 3VFUB 3TN0A 4PRWA 1AKJA 2DTML 3UNTA 2JCCA 5IHZB 2GI0A 1ZBCA 1QQDB 4JREC 1IWBA 3US1A 4U10A 1TV2A 3N6QA 3T71A 1LL7A 2I9EA 2CDGA 2BSCA 2WW8A 4AI7A 1DSFH 1I7ZA 12E8H 3E38A 5AEAA 1BZEA 1RSYA 3JWOL 1MCQA 1TREA 2NQ3A 3VVGA 2XWEA 1TLKA 1A9EB 3N85L 3BJLA 2CJTA 2MPAH 4Q32A 2X0HA 1URZA 3CLEH 5JPMA 4FQIL 2PWDA 3QBTB 4N87A 3ARGC 5CSZA 1G7HA 1XXDC 2E9WA 1G43A 4F79A 1YEKH 4YR6B 2FSEB 4K38A 4QDWA 2R2EB 3D6GA 1NC2A 4WK9A 3U6WA 1DSWA 1K8IB 1FFRA 2EAEA 3CN3A 1AJ0A 4A8IA 9PCYA 2P5WD 2X9YA 2E9MA 2PE4A 3FA5A 3WNOA 1RZ8A 3UPBA 4OFKA 3NJ3A 1M05B 4G1MB 2VXSL 2CK2A 4G9DA 1MRDH 1KJMA 5EIIB 3RIAK 4BJHA 5FM5M 2QQLH 2EEXA 1JHTA 4DP0X 1N3NB 2G2RB 3DO3A 2HP4A 4CD8A 4LLAA 5H1WA 1AXSA 1T96A 1MUJB 4YE0A 4UOJA 5B22A 3TV3L 8FABB 4XODA 3CC5A 1CFSB 1HOCB 1M6JA 1A65A 4IJ3C 4KX7A 5EOQL 2HS8A 4M00A 4QRBA 1BXNA 2ZXQA 3DNKA 3I9IA 2L3BA 3ATFA 3K30A 3VMOA 4Z7VA 1EJTC 4GIRA 3CL7A 3SM0A 1N4XH 1H11A 3UZXA 4JY6A 5H8PA 1GG1A 1HXMB 4UB9A 3R7RA 2YEQA 1P0EA 1LLZA 3FL7A 2FZNA 2P24B 1GOHA 4PJFA 2Z6FA 2VZSA 5EG6C 3FN0H 4OKVB 4H3DA 2R0LH 1LQ0A 2XQYA 4DVBB 2JKEA 5ISZA 3PTDA 3R1GH 5D7LA 4YPJA 5E9DE 3DHMA 3C60C 1I85C 4FEZA 2FQGA 3E9TA 1MLBB 5AL0A 2EE0A 1IAIH 4HCHA 3GEWB 4XBSA 4UBPC 3U7BA 2Z26A 1QSFE 3PRZA 4PUBL 3TASA 1MRFL 2FTWA 2VD8A 3UAFA 1QMUA 2XINA 4Y4KD 3DUGA 1D2OA 2CKRA 3UROR 3HG1B 3RMJA 4NQVA 4DJMA 3VGGA 32C2B 1Q9OA 3BVDB 4KJQD 1IAOB 4IXXA 3QDMD 3R8GA 2ZXAA 4OV5A 3QEHA 2K6YA 4PGDB 4NUPA 1ZAIA 2AI0L 1TFPA 3AZUA 4I0KA 4PMQA 3M64A 4HAGA 4ODWB 5IROC 4AIXA 5C07E 4PGZA 3MYPA 1CDBA 3VFOA 3TBBA 3LZLA 1NLDH 5KS9F 4J3SA 2J8UF 2W27A 2ZCZA 4JX4A 5BO1H 1BD0A 2N01B 2J24A 3HGJA 4M93C 4PY7B 4IPIA 2RH9A 2PKDA 2X10A 4JEGB 4NG3A 3STZB 2J8TA 2O1AA 5DK2A 4X7SL 3O8XA 3M0LA 4F4RA 2XIMA 3EH5B 4W6WB 2ZUNA 4FNRA 4QKXB 5BRBA 1JZ6A 3AACA 2CKBB 2XBDA 5I1DB 1JRHL 1GA2A 4FF7A 3K2UH 4ZAKD 4BFJA 2BFGA 2JEPA 3KPSA 4JFDB 3IDXL 3TVMA 2RDUA 3N73A 1IAII 2O9OA 4XNDA 3I6GA 4HZ1A 1KIPA 1SEBB 3FJLA 4UTTC 4WZHA 2J88L 4QTHA 1JPHA 5LXGH 1NBQA 4PR5B 2AK4B 2NY3C 3DESA 1Q90A 2F1EA 5ABGA 1CZ8L 3A5VA 1P0NA 1OARH 1AQ8A 4LSRH 4H0IA 2Z2BA 3FTWA 2X09A 3BFOA 3OC5A 3P3BA 5EZOL 3CU7A 1WXJA 1UACH 1YEHL 4ZTXA 3KYKH 2ACQA 2CW6A 1WLHA 2E9GA 4LHQB 4JR5A 1ECQA 3LS9A 2AKRA 4XOCA 1SVCP 2GCYA 2BVOA 2G3NA 4JCMA 3L1OH 5HHMB 1SJHA 4OJCA 5JYMA 1WVZA 4JTCA 4XCCL 1S7VA 3V0EA 2NQLA 3G5VA 5I0ZA 2DBLH 3EOAB 2IPWA 2D3LA 1QVOB 3QPEA 4CQ9A 3M4HA 3JR2A 3DXAE 5I16A 2WVSA 2IPGA 4EX4A 4MJIB 4NUQA 3FQRB 2WLMA 3BOFA 4ZMZA 1INDL 3MODH 4C4KO 3KLHC 2YGQA 2MANA 4E9YA 3G6MA 2W91A 3AT8A 4WO4C 2CYGA 4JQAA 1A4CA 5K59E 4LBEB 3EMQA 4FFYL 3ME0B 1M1XB 2VCBA 3QW9A 4F5CE 3F5WA 2PWHA 3TEXA 1FI8C 1FNGB 4BQBA 1F73A 2G50A 1KB5B 4NYLA 1DP0A 3CVHH 5KZDA 1X5XA 3DX3A 5DFVC 3LHZA 1UBSA 3LXAA 4GUQA 4CVWA 3LCGA 2DZXA 4F9PC 5C6PB 3MFGB 4HU2A 3EPNA 3BKMH 1TTUA 2NY6C 1FQ0A 3UTSE 5CH9A 1NANH 3EYVA 4XGZB 1NAMB 3VFGH 1F97A 3WKQA 5C86A 2VABA 3AVEA 3W5NA 2NX9A 4G9PA 3EZJB 3RKDD 4HHHA 4POZD 1DQWA 3VU2A 1M03A 5T8GA 4MMYA 5F7FA 4Y5XB 2IAMA 1K3IA 3RIFK 2XSBA 1U3ZA 4PLJC 5I3GA 4UTAL 5FA5A 3KXFB 4TNFA 4XMUA 1R5YA 1J5IA 3BQUC 4Y4FD 2VIRA 1Q3NA 4GRLC 3RJOA 4P5TB 4EVNB 2W94A 4WVXA 4XPBH 1CLVA 4WCYH 2GYSA 1CENA 2XN9A 2NVCA 1U8JB 1R24B 3BHBB 1VIZA 3LNPA 1W0VA 3IGFA 5E2TL 1G84A 3IFNH 4E9VA 3ZJKA 3FJ4A 3DENA 2NX5B 3ZTNL 3CH1B 3PQYE 3RL2B 3FO9A 2GT9A 3EDJA 1PLGL 2BP0A 4HOMA 1TU2B 1TYEB 4H0GA 3DOSB 4CBZA 1N0XL 4Q8VA 1A7OL 1JCLA 3EXJA 1F8TH 1A6VH 1GIGH 5B38B 2QJIA 4HWNA 1HHKB 3SDCD 4L4OA 3G5ZB 3MO1B 2PXYD 4HJIA 4JO1H 1R3TA 4A3QA 4W9TA 3ABLB 1HKLH 3CYJA 5GGTH 5EIVA 4K2UL 1R3IL 1JPEA 3II2A 5BUAA 4S1DC 4U31A 2C1OB 2W79A 4JO3L 1BKHA 3WZ0E 1A4LA 5CLWA 3KR3H 1OK8A 4LDLB 5LVEA 4JHAH 3FEMA 5KW9L 3D2UB 3I6EA 4OCSH 3PZTA 5JBEA 4EK7A 4U7MA 1NSJA 5A3HA 5AY7A 4M43L 2XPKA 5LCVL 5I6XB 1HQRB 4XC1L 4BQCA 4QCIB 4JY5H 3L68A 5FSDC 1YEYA 3B4UA 3RNQB 1TPUA 4YC2B 4YN5A 3UEZA 1Y8BA 4Z0XA 2A1WL 2XZCL 1BVWA 3TYAA 2KLSA 1CL7H 2XN1A 3QXVA 4M03A 2ESVB 1I1YA 1NC4A 4AWJC 3QI9B 3M6YA 4LB3A 4WW2A 3RTLA 4LAMA 1U3JA 4PJDE 1JI2A 2EUVA 2PCEA 3HLAA 3TSMA 5D7SL 5F9DC 1KEGL 2BNQD 2PETA 2HPTA 4LVAA 4TVPD 2YRZA 3OWRA 4M3JA 2QKFA 1E5BA 1INEL 1VHNA 3PFMA 1T6VN 4HEPA 3RX5A 5D38A 1S9VB 2QCNA 1J05A 4O02L 3TOPA 2HE8A 2YZRA 4AQ1B 4UT6A 1XX1A 4WI0A 5IHWA 1SW7A 4NKCA 4NB7A 4NIKB 3STLB 1TZHB 1K5NA 4BFGA 1UR9A 1W56A 1XRFA 2F9BT 1V3MA 4HIIB 2ZZ4A 4DUWA 3QEUB 3CHCA 1T66D 5G1TA 4GXUM 3ARTA 4NC1E 3BZ4A 4XNZB 3C6LA 3QHZL 5IVXB 5KG9A 3QIWB 3GTVA 4NNCA 5GNZA 3L54A 3ZMNA 2XG4A 3VFLA 3KLLA 5EZLB 1XF2A 3JUZA 4N5UA 1NPNA 2QQKL 4DERA 1YCSA 4HNVA 5LGHL 2YUXA 1OY3B 1O9WA 2HN7B 4JRYA 3X13B 4XBPA 1G9NL 3DWTA 3H55A 3W7IA 1MHCA 4Z7OF 3WEMA 4B9GA 4BQ5A 3TC6A 4TQEH 5ICYA 3UJRA 5HI3C 3OIXA 4WNQA 5AKRA 3USBA 4G43B 3GMNA 1L4IA 3EYSL 4JVUA 3IGXA 5JOFA 4NJGA 3GSWB 4X3ZA 4MMWA 4ECLA 4HUKB 1RUAH 4LRSA 1MVUB 1CZ1A 4WU5A 3Q0HA 3QNYB 3PWPA 3S2NA 1F11A 4S1QH 4KH2A 4FF5A 5DFAA 4GXVH 4A6YB 4AJWA 4ADJA 1FZOB 4YPGA 3QZMA 2DSZA 3G3MA 3IJIA 2HTLC 4J4PA 4ZFGL 5D1XC 5FA4B 1NFKA 2RQ8A 4M1RA 4PJ6A 3VTTA 4GG9A 5EO9A 4UM9B 4L9XA 1MVFA 3JWDL 4N28A 1QLRB 5B8CC 5AOUA 1U8OB 1U8HA 4DM2A 4K73A 3GU2A 4S3GA 2FGLA 3U7WH 1I3RB 5DD1L 3BXWA 1OHLA 1BG1A 1YBQA 4AMCA 1WQVT 4LQFL 1UUSA 1P6BA 3HMCA 5AD0A 2VENA 3S9DB 2BNRA 4WGVB 1QNZL 3EGDA 3S96A 4F57L 4HWUA 5D7JB 1ZENA 3I9AA 3K2KA 5CZ0A 5DHVA 2HKFH 4MSWA 2QCHA 3A64A 3SDXF 3U2SB 1XF3B 1G6RH 1YXYA 3S98A 4E6MA 4U0RB 1LZOA 4W93A 2RBLA 4W9IC 2I25N 1P4BH 5AW1B 3PJSB 2IFGA 4LUJA 1FG9C 4C57C 3TWAA 3GBDA 1ADQH 1DQVA 3RWCB 1D7CA 3CN4A 1DVFA 4XOBA 3DV6B 5A8MA 5TDNA 5T91A 4YU1A 2QVIA 4DI8A 1NGQH 4ZB0A 2FUQA 4G80A 3RPMA 2UXTA 1WKYA 4QRQB 2ZRYA 5C0BA 1EJ8A 1YJDH 1FPTL 3LS5H 4IBLT 3N1AA 4H1LH 5U7SA 1Y18A 1MFBL 5D2YA 4QNEA 3VXUE 3DROB 4OW6A 3OZMA 3NYKA 3WJYA 4MAYA 4WJXA 4K5LA 3ZTEA 2Y4SA 1QTWA 2ZIDA 5JHBA 4GBDA 2WKOA 3WYZA 1Q66A 4PW4A 4R4NC 5F7LB 3CUPB 2J7LA 5KYYB 1OFAA 4TUKH 4D3CL 1YHTA 1AY1H 3WF2A 1ORQB 3FK4A 1GC1L 3SQBA 4Y16D 3E80A 3VZXA 2H0JA 4XX6A 4HDIB 2FB4L 4XNAA 1PCWA 1O6TA 1TQVA 4R26H 3BVTA 3FTVA 3U8GA 5DZLA 5I17A 5MKGB 1LK3H 2WBJC 5D6DC 2KPNA 3AB0B 5D1QB 2OMTA 1SYTA 2HQAA 5ABDE 4D94A 4DGIH 2RMNA 1CD0A 3DJ9A 3L5HA 3HB3C 4NU7A 1CF8L 2J73A 2Y1HA 5HDQH 3V2AR 1GVIA 4PJIB 2VYOA 2GDVA 4JZJA 1XTLA 1JF1B 4PTDA 3HC4L 2N0MA 2MSPA 4OAWB 1XZ0A 2YA2A 1SO6A 3DI3B 3O6YX 3DBNA 2WLNA 1BQ5A 3BAEH 4C47A 1F6PA 1ME7A 1KGCD 1TPEA 2ZSWB 1JVLA 5ABZA 4JZNA 4NZRL 3AITA 5BS0B 2NXHA 5G2NA 3ARBA 3O9NA 1KYUA 2AEWA 2E75C 3HV9A 4XZ9A 4HQQL 2AK4D 4L0ZA 2CLRA 3MMDA 3HHSA 3VH8B 2VN5A 5DJ8A 3SJNA 5D7HA 2QV2A 3GNOA 3DIDA 3GH5A 1KBWA 5LBVA 1PVNA 2H6RA 2OGJA 1ORSA 1EH9A 3I4EA 3B8SA 1V10A 1NICA 3ZE0E 5TGBB 4FI7A 3HV8A 1KCSH 4AKPA 4G59C 1UVQB 2POTA 5HHMD 1FWWA 4OOUA 3CWGA 3WCYA 3TH6A 2AVGA 1X1OA 4XP9H 1ZPUA 4IQJA 3ILEA 2V8ZA 3GGWB 3SE6A 43CAA 1RUML 1OFDA 2G96A 3KRZA 3BE7A 2BODX 3RDTC 3OXRA 1NWTA 3DGDA 1YEJL 5F9JB 4A2SA 3BWUC 2NXGA 2NXYD 3TJIA 3GZ3A 1IEVA 3FTZA 4FHBD 1QPNA 3UERA 4LLMB 4WWNA 2Q01A 3DPBA 3KRUA 3NK4A 4AT6A 5GRWA 3CQ0A 3K5RA 5CEZE 3COTA 2A6DB 3VKCA 1P7QD 5D9SA 4B9CA 4KX8A 2CZEA 4DN1A 3EGJA 3LCYA 3U25A 3TFKD 3GNXA 4ODBD 3F84A 4AF0A 1ET7A 2RA1A 4DO4A 1IXOA 4OM1H 3PZ9A 4ERAA 4L5FH 3TBYA 1E4HA 4P59L 4JFQB 2VEMA 4Y5YB 3VYPA 4FXGC 4FERA 3GHUA 5LGZA 5IQ7H 4E38A 3QDGB 4M4RB 1RKRA 2QCDB 1H61A 4B95C 2C0HA 1OCRB 2OKTA 3OAUL 5CCKH 4XZWA 2IG2H 4KNTA 5LHEA 3OJDB 5EFDA 3QUXB 4M56A 3KPPA 1MPAL 2BOBA 3ZMRA 4O1FA 3ULVE 1OTTC 2XFXB 3IWPA 4DEPB 4H88L 1ZV9A 2W6RA 1NAKH 4BV1A 4HD9A 5FUZH 4KWOA 5IMLA 1GVSA 4W88A 4TSBH 2QLVB 4P2CG 5HJ3B 4PB9H 4IL2A 4TVPL 2CWRA 2IMMA 4M5YH 5I5JA 3HS0B 4I48A 5D7KD 1PCSA 4XB8A 1U6AH 5AZEH 3PWUA 2R94A 4PJBE 2H32B 1O6IA 2X38A 1BD2D 4U1GC 1DJNA 1RP9A 3ZDYE 3OR6A 5IB2A 5IW1A 3L2LA 4K3DH 3G1AA 3DJTA 4CNIB 3PBGA 3S3CB 5AFAA 1REQB 1KKRA 3PL6A 3T1FA 1NSNH 4Q6IA 1H49A 2F2KA 3NM3A 2WTPA 2Q7NA 4AGMA 4HULB 4U5IA 5F70A 1R2TA 5J13C 2C7UB 3MMWA 4DAGL 3QAZB 3H26A 2YYUA 2C7FA 3A9IA 3N3EA 1C1EL 2OPJA 2GSGB 3W28A 3QO1B 4L3CB 3I75A 4QR6A 4UIKL 1RLDA 4JNXA 4MDRA 4HX1A 1O6SA 5IJVB 4IP5A 3T55A 1HYRC 2PCQA 4WKXA 3LQMA 3D2UD 2FLMA 5DZ9A 3MCNA 5F21B 2YCLB 5D2LE 1IBBA 3TCTA 2W8CA 1CE6A 5AVXB 3INPA 2VMEA 3EW3B 4OR1A 1V27A 2MIZA 3H7BA 4CNSA 4KEMA 4OKDA 2GFBA 3KPRB 3GX9A 1BP3B 1DN2A 4BFNA 4E8CA 4RZ5A 3RPTA 5J6GA 1CU4L 3ZU8A 3Q2VA 2E3VA 2OEJA 3HJ0A 1QASA 3NCYP 3WXWL 3FQWB 4QHLB 3HI1B 1WUNT 3PCYA 1RUPH 3BLFA 1RY8A 4REQB 4OZFH 2B3RA 4QRUB 3B7YA 5CZXD 3GBLA 1W80A 1EL3A 2OMZA 4G70B 4CD7A 2BP8A 2WQRA 4BWUA 4MA1C 4JFEA 4NAEB 1DANU 3G08B 1EC7A 2EECA 1RJCA 1AANA 1KXVA 3U6RA 4HCDA 3MLTA 2Q8AL 4MNKA 1H4PA 2W0FA 2XJ7A 1EF3A 4M8QB 5M17A 4NKIH 5IMMB 1F74A 5AOMA 2XRAL 3CT2A 3QRHA 2DIKA 3PUEA 1QI0A 3V6FA 4OJYA 5J1TC 4M3PA 2UZIH 1TJ2A 3TW6A 1JNEA 1YXDA 3QIWD 1FIGL 4FZ8H 2PRLA 1H8SA 3HQNA 1KZQA 4YMPA 3P1VA 2AKZA 2QBWA 1FFTB 3B0XA 4I2XA 1PYWB 2ZP9A 5SWZE 1TJIL 5D2VA 4Z7UA 5EF2A 3RX7A 1Q7MA 3QUZA 2JI1A 3LHTA 4ZL1A 1JDCA 3ARUA 4G7YL 5J8LA 4HV8A 1XLGA 1CIDA 3RO6A 1R3QA 3SKOA 4NZCA 3QF0A 1BLNA 3T78A 2PDCA 2DJXA 1WP6A 5I0VA 1KN4L 2OMUA 2ICWA 4YHLL 4NKQB 3RVUD 3AG1B 3H2QA 1WUZA 3LKQA 4BFFA 2VSMB 4HIXH 1QNIA 2ATAA 3PFQA 1K02A 3RFZA 2YBRB 3QS2A 4IRZA 3R7MA 2NY0D 2ZZ2A 4DYKA 3B2UD 5AAMA 1QFHA 3HRZB 2VW7A 4HKPA 3Q3GB 2OAAA 2XVKA 2XVNA 3FT2B 4BI6A 3EO9L 4TQ8A 1FCBA 1ZB5A 1PIGA 4X8CA 1S5NA 4KS0A 3S3PA 1EXPA 3FH8A 3WEBA 4O02B 4TLSA 4NBXB 2P26A 1XGYH 1W1YA 2B08A 2E7LC 4UM9D 1NDGA 1JYXA 1SUHA 3ALPA 1UIPA 1S7WB 3ETBJ 1CD1B 1T83C 3ATYA 3GYEA 5TF1H 1I7UA 1OB0A 1YW1A 1J8SA 3EGSA 5BNXD 4FQXC 3WUFA 3BVJA 1YNKL 2ZXEB 1HEJC 3UWWA 5DUML 1KXQE 2VDOH 1FKXA 1OSEA 4OLXL 4AQEA 2WLHA 5HDOA 1TPXC 3F58L 2VEKA 5GISL 4ZFOA 3BSZH 4W5UA 5DO2C 2GHZA 2QDDA 5ENWB 1DXEA 5BPPA 4KXBA 2IGFH 1H3TA 2ADJB 5CZKA 3HN3A 5BU6A 3RCYA 1VFAB 3UR8A 3B34A 4OZIF 2EDDA 4OUUB 2WVVA 3KM1A 3GSNA 5REQA 1DV7A 4OLYH 2I5YL 2OYMA 2YD4A 1JJKA 9RUBA 2OCZA 5E8EB 5JHDD 3GHBL 1RPQA 5HGGS 4PWJA 4NI3A 3KCJA 5AVHA 1NFIB 1RH9A 3CE1A 3NIGF 4YXLH 1VYPX 3QDMB 5B3NA 4AH7A 3E2HB 3IIPA 3HZ3A 3N43F 3NAVA 5DJCA 4JRWA 1A6PA 4K7YA 2Y89A 1FN4A 5IB3B 1X8CA 3IJ6A 4DJEA 5C3IA 1AR1D 3LNHA 3L4VA 4M62H 4A3YA 4R96B 1BW8A 4C65A 3O0RH 1KJ3L 5F1SA 1E6OL 1NA8A 4F92B 1GVQA 3NL5A 3LV3A 2O5NA 1FCVA 3NVQA 1I9CB 1MDTA 3D85B 4MXVF 1BLIA 1OSPH 1TTQA 3Q8CA 2AC0A 4PLNC 4ZAKB 3LYEA 3JU2A 4JG0L 2VDLH 3S35H 4PJ5B 4RBPK 3AC0A 2VITB 3W9EA 3SCTA 4MDIB 1GYMA 4M8RA 4OIFA 5D96C 1AAJA 1EVTC 3N17A 3MXWH 3M8OH 1I75A 1ODAA 4LKXB 3DVFA 4Y2OA 4A55A 1T1XA 4HCRA 3RRXA 1X5GA 3TOYA 4ZBCA 3UIZA 3RDKA 4BDVA 4F33A 3N42B 3SBWA 1F5WA 4UQ3A 2VC5A 4X5PA 3RTQA 4GT7A 2VE6B 1OC5A 3FTUA 3DEQA 5C9JA 4MWAC 4W9FC 2FATL 2FZMA 4PJEB 1TUXA 2XZAL 2D69A 4IXHA 1VPOH 3S4SG 1QACA 1DBTA 2F5BL 4BWWA 4JHBA 5B3SB 2WHVA 5DUJA 4OLVL 2BW5A 3TZVC 3QEQE 5LAXB 3OVUB 1AGFB 3BXNA 4WFFE 1JPTL 1O60A 4WI4A 3R4RA 3PDOA 3WTTA 1JZIA 3DDMA 4O4YH 3IAPA 3T6CA 5CCJA 1SVZA 1HG3A 3FULA 1Z0NA 4ZTOL 1A9BA 2YDAA 2K45A 5FUOH 4L8BA 1L0QA 4DJDA 4J6RH 1CDIA 3V3WA 4DM1A 3NK3A 4ZVJA 1KO0A 1DHKA 1REIA 5DRZB 2QGEA 5E5LA 4Y9OA 1TE6A 4WTWA 2NW0A 3W7KA 2E5BA 3W56A 1RZ7L 3L3JA 3FUIA 3TFCA 3O3UN 3PUCA 1ME8A 2VQ1B 4KROC 4S1RH 2JKWA 4UIMA 1WV7T 2H8XA 1ZVNA 4X99B 4IJRA 4YNYA 3VXNA 4P2AA 1UFUA 4EUPA 2YSWA 3GSOA 3CZJA 3UO8B 4RWHA 5A6TC 5HNRA 2WZ0A 1WCBB 1JPSL 3WOVA 1YMHB 4D71A 3RE0A 4PZVA 3W1ZA 3JXAA 4OQTH 3V95A 4BWLC 4NPYB 1UYWL 5JOEA 3S37L 1K5WA 3T1GA 3BKYL 1SLWA 3NYDA 3UABA 1FO0H 5F7EL 5IM51 4ZZ9A 1A1MA 5DYOA 2CETA 4ODHH 1UG6A 2IDFA 5FW6A 2NSXA 4TLTA 1NEZG 2R4SL 3C8KB 1J8KA 1HIZA 1KFEA 4P2OA 5FXCH 4W87A 4JIEA 1H3GA 4DZBA 1R3LA 5FJIA 4ZO8A 3QWOB 1Y0LA 4KWSA 5I3KA 4NKDA 2BWGA 5FJUA 5KSAD 4KRPB 2J56A 1EMTH 1YE6A 4DAFA 3LI0A 4XD3A 3GW3A 4XZUA 4YDJA 3P9LA 2XFYA 3ZIYA 1GYUA 1WC7A 4PJHA 3H23A 2PC4A 1QNPA 3WUBA 1J9TA 1FBIH 3NCBB 2NOYA 3WMBA 3L67A 1WF5A 5J1AA 4I3RH 1NFDE 4U1LB 4F3FA 3I10A 4E9RA 2X6AA 1OXYA 4M7ZB 3HS8A 4PSRA 5FO8B 1J5SA 2W38A 4XN7A 4RFNC 1GPFA 4E42B 3NCFB 3NTCH 2EKSB 4GGHA 2CLVB 4GQ9H 5JXAL 3G1SA 3SDCB 3L5XL 1VP5A 4JRFA 2PXYB 5JNYB 4OZHB 2OMXA 2IKGA 3T0EC 1RK1B 3GSXB 3G6AA 1Q9WA 3G1FA 3PHOA 4P5SA 5D1XE 1RJQA 3T9WA 3OJVC 2OR8A 2D2HA 4ORZC 4ZSOA 2OMVA 3QMTA 4TUJA 4JN1L 4FTVD 5T3ZL 3OKDB 5CGYD 4IMAA 4C7GA 2CBMA 1LP6A 4JFXB 1MNNA 3TC3A 4UQBA 4CW1A 2DQEH 3TA9A 5K4XA 1SM3L 1IC1A 3P4LA 4IDJH 3EFFA 3IFLL 4CVUA 3B8IA 1G0XA 3DX9A 4EOWH 2B0MA 2PI6A 1TEYA 5JBDA 2C3WA 1HP4A 2CWNA 5DMIH 2ZRUA 4UFIA 3IJDA 2KQMA 3RIKA 3EYQD 3DJRA 4YSUA 2O56A 3MYJA 1MCLA 2XY2A 2WJDA 3R7QA 3BRGC 3MVTA 3KPRD 2BNQB 2QQQA 3WIHA 4G7VL 2BHUA 1JHLH 3B2MA 3BISA 1UM5L 4LMQI 3FO0L 1CFNA 3QIBA 3ULUL 2AQVA 1A25A 1NKOA 1Y0EA 1OGSA 1UBPC 3TW9A 2HEJA 3N11A 3KBSA 2D2OA 3DU0A 5HGDB 3WK3A 4X4ZA 4C83B 4B91A 4XZ4A 1QWHA 4RFOH 2C9UA 3OKMB 1KR0A 5A94A 3Q6GL 4FFTA 1V0KA 1RIVH 1FRGL 5I1IH 4L3FA 5H94B 1U8KB 2GW5A 3GRWH 2V7NA 5IJBC<