1U30A

In situ extension as an approach for identifying novel alpha-amylase inhibitors, structure containing maltosyl-alpha (1,4)-d-gluconhydroximo-1,5-lactam
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title In Situ Extension as an Approach for Identifying Novel alpha-Amylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1u30A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1u30A01
3CHCA 2G4FA 1QBAA 3TOPA 2WMIA 3A3HA 5D8WA 1CLVA 3PZTA 3L4ZA 2DIJA 4CN6A 1BYBA 2UY4A 1GQIA 3VD3A 2VRKA 4BF7A 3ZM8A 2YA0A 1VENA 1C93A 2YL9A 1JYVA 3VILA 1OIFA 5JBEA 1BVNP 3CZ8A 1JXKA 2D73A 2VR5A 1QI0A 1UA3A 1NOWA 3EMZA 1W2VA 1KGUA 1H49A 3WH9A 4H7VA 4NZCA 3GH7A 3BSHA 1HKKA 1E5JA 3K1DA 5CJ5A 3AS3A 4F66A 4UQBA 3W37A 1HKMA 1V0LA 1H41A 1GOKA 3M7SA 2A3CA 1ISWA 2A3EA 4MJ2A 3BCDA 5DO8A 2BY0A 1EOMA 1MFVA 1HF6A 1W91A 1VFFA 2YL5A 4D6FA 4HZ8A 2EPMX 3AXXA 2OYLA 3T2OA 1JZ3A 1R7AA 2W91A 5A6JA 2C8NA 4Z2HA 3FNDA 4C7FA 4V27A 4YN5A 3WL0A 1W9PA 1E3XA 1VBRA 3G6MA 1TCMA 2VCAA 2J74A 1IV8A 3GXDA 1AMYA 3ZSTA 2ZX9A 3A4XA 2Z1SA 4F9DA 1HVQA 3VPLA 1VJSA 1CGUA 2VL4A 4WJXA 1CNVA 4EANA 2F7RA 5CPSA 1CGWA 4UTFA 3VX0A 1R46A 1UD3A 3IGUA 3MANA 2FE0A 4E2OA 2G3JA 1W9UA 1GVYA 3UETA 3LMYA 4KGJA 1WZLA 4NXKA 5A94A 3WDJA 2CKSA 1JYXA 3BVXA 3QGVA 1QBBA 2ZX7A 2ZUTA 1W9VA 5DF0A 2D2OA 4CN4A 2Y2WA 2Y4SA 4BQ4A 2OWWA 4AZCA 4H8HA 2VTFA 1NARA 2XVLA 3OG2A 2WKGA 4LQ1A 5A95A 2VZVA 1DWJM 2BY2A 2O9OA 3ARWA 1UR0A 3SCOA 4HU0A 3RJXA 2GUYA 2GJXA 3IJ8A 2XGIA 2D0FA 3HN3A 1J0HA 1WPCA 2AMGA 1CXEA 3WY1A 1E73M 2E9MA 4S3KA 2EXOA 3VDHA 2A3HA 1RPKA 3VMNA 5DEZA 4CD5A 5D4YA 1NOFA 3VSUA 3W6MA 4F8XA 2CCRA 1KTCA 4ML4A 3ECQA 5AC4A 3EDFA 3L4UA 3FHAA 3RM4A 4N42A 2DIEA 4U31A 3ARSA 3VIIA 4PMUA 3ZO9A 2WHJA 1EO5A 3MI6A 1EHAA 2DPEA 1PPIA 4PMXA 4LYRA 5HXMA 1X1NA 5JBFA 1G94A 1NWUA 4ZEPA 1ZBKA 2DDXA 2XHYA 2V38A 5IXEA 2E8ZA 3RPMA 1BPLB 4AZ6A 3WF0A 4RE2A 3W29A 4D6HA 2WHMA 3ZT7A 3POCA 1X6LA 2ZWYA 1DEDA 3AHYA 3D4YA 3KL5A 1V0NA 4CU7A 2CERA 1QNQA 2CESA 2JEPA 4GINA 1OT1A 4J3UA 1JZ4A 1FFRA 3SCUA 5CPQA 3CMJA 3CTTA 2ZXDA 4L4PA 1JI2A 3KL0A 3L2MA 1E71M 3VGEA 4LX4A 3WD1A 2WVSA 2C0HA 1WO2A 3CUGA 2VO5A 3ZR5A 3BLPX 5FIPA 4AD4A 1KQZA 3WD3A 1GJWA 3QHOA 1V6UA 5FL0A 3BAWA 1PX8A 1JYNA 2Y5EA 5A6BA 3ZQ9A 4CCCA 2XTKA 4CD4A 3A47A 4HP5A 1CXHA 2CBVA 3I3DA 1NWTA 1K9EA 4A4AA 3GBDA 2EO7A 4GI8A 4NXSA 2WANA 1V02E 1JL8A 1V08A 3WD0A 3A6OA 4MNJA 1JG9A 4XUYA 1ISZA 5JIWA 4CKQA 2YLLA 3GDBA 5FKYA 3VIPA 2ZXBA 3WQVA 1K9DA 3VDAA 1Q4NX 1ZU8A 2X09A 1KBBA 4CGTA 1E1EA 3SCTA 2VZUA 2ZX5A 4AZIA 1WAWA 3VX1A 1ZBWA 1VFUA 2WMJA 2PBOA 3GNOA 3AYRA 4PRWA 2VX7A 3HJEA 1C7TA 5LA2A 1JAKA 1RH9A 2JE8A 3EBVA 3CV5A 1E6XM 1UUQA 4CD8A 3DHUA 4LYPA 2EPOA 4AIUA 2GFTA 1DWHM 1H09A 1DHKA 4JCMA 1UH3A 4HOZA 1UYQA 2CHOA 1TA3B 2ZX6A 1I1XA 5I78A 3CC1A 3OLIA 1V0MA 1C8YA 1W3HA 2J7CA 4Q22A 2NT1A 2WHKA 5C8BB 2BHUA 1OIMA 1SMDA 2J7FA 1E40A 5GNZA 3ZJKA 1OWQA 3FN9A 1KWGA 1HP4A 1WDSA 3WEMA 1FH8A 5CSUA 7A3HA 1ZS2A 3W6LA 1WP6A 1PS3A 1GORA 3VM7A 4KGLA 1MW2A 3PZUA 4MAVA 2YL8A 1VJZA 3MUY1 4Z2GA 1BAGA 4V28A 3WELA 3RMEA 2WK2A 4XB3A 2WCGA 1OM0A 1E0VA 2VR4A 5GNXA 4E4PA 2QV4A 4GKLA 4KH2A 1BHGA 3OGSA 4GIAA 2WZHA 1AQMA 1F4AA 2E3ZA 1WB0A 3POHA 1JF6A 1KXVA 3VIMA 1H1NA 2HVMA 2W66A 2WLZA 3W24A 3AIRA 2V3EA 1CXFA 2GDVA 2OWXA 3UESA 4B3KA 2AAAA 3MKKA 3VMPA 1XGZA 3B9AA 2JFEX 4XX6A 2ZOXA 1B2YA 1UZ1A 1UR8A 4X0NA 1UKTA 3BVTA 2J47A 3MUAA 1JZ6A 1R8LA 4HA1A 5AYBA 4NZJA 4DM1A 3UCQA 1HP5A 2ZUSA 2FH6A 1JI1A 2E9LA 4QDMA 3U7BA 2YLAA 3OLGA 3NIYA 5I0DA 2VJXA 4OOUA 3RDKA 1XSKA 1GNXA 1QI5A 1NP2A 2ZXQA 3CUHA 3AIQA 2MANA 1B90A 4KWUA 3DYMA 5EFDA 1EGZA 1QHOA 1XH0A 1TFVA 3QHNA 2CBIA 3AS0A 2TAAA 1UA7A 1GQKA 1KXQA 4JHOA 3W82A 3LX9A 1YQ2A 5CPTA 4OZOA 2F8QA 4LPCA 1CGTA 1B0IA 1HJSA 3BGAA 1GOIA 1VIWA 3OGRA 1CGXA 2DSVA 3CLWA 1Q6FA 4U5IA 2WVUA 1QWNA 4EKJA 3EJUA 3ZIZA 3T08A 4BA0A 2VT0A 5E9AA 4AZ7A 2DSWA 4TVCA 3VGDA 1KGXA 3CBWA 3EDKA 1JAEA 5DMYA 1OB0A 2RGMA 4J7RA 3BAYA 3BC9A 1WZMA 1VAHA 1HIZA 4U5KA 7CGTA 5FD0A 1VEPA 1SMAA 1MW1A 4AC1X 3OBAA 4E8DA 1KCLA 3SCQA 3AXIA 3BMWA 3L4TA 2E8YA 4PMRA 3WQ5A 2Y24A 5D9MA 2W63A 1DTUA 4R27A 3JUGA 4MB1A 2VMFA 4N0RA 3A21A 3EJRA 5A6KA 4M80A 3D5HA 1PX4A 2VZTA 1NQ6A 2J75A 2J7EA 4D6CA 4UOZA 2JIEA 1RP8A 2OYMA 1G5AA 3WNNA 1DP0A 3UG3A 1GOWA 1E6SM 2O9RA 1WNOA 1W1TA 3K8MA 1HL8A 2XFYA 2W62A 5CLWA 1DWFM 1GHSA 3BLKA 3WN6A 4UQDA 1A3HA 4UQEA 1CGYA 1LWJA 4MDOA 4WSKA 3BUQA 5I3DA 3ZOAA 3FY1A 4CUCA 4D71A 2GJRA 2FHCA 1PZ3A 1SYTA 4JFWA 3WBAA 4ZXOA 3ARVA 3SIMA 3SUUA 4P8XA 3RM9A 4WKFA 4AMWA 2J7DA 1UOKA 3CUIA 6A3HA 1Q6CA 1G01A 1GOOA 1E0XA 1KGWA 3M07A 3S6TA 3MMDA 1CYGA 5C70A 4L4OA 2OYKA 3DX2A 4TTUA 3FAXA 2Q8XA 4AD5A 1UKPA 3BCFA 2ZUVA 2VX6A 2BFGA 2GVYA 3DYOA 1G1YA 1HN1A 1E6RA 2F1BA 3I3BA 3B8SA 3N13A 3T0AA 3PZ9A 1EO7A 2BVYA 2WMFA 1TZ7A 3MV01 3G6LA 3PZNA 2QPSA 1W3LA 3RJYA 1UH4A 4UQAA 1QNOA 5CQ1A 1UASA 1L8NA 3WNPA 1UG6A 1E4LA 5CLTA 2WMGA 3GNPA 3T09A 2J78A 3IAPA 3ZSSA 1BSIA 4BQ2A 1H4PA 2YL6A 3L4YA 4FNTA 4TXEA 3N11A 4FLOA 1GJUA 1V3LA 1G9HA 3AQUA 4NSBA 3NDYA 3PZGA 1BTCA 2WW5A 3O6AA 4P7RA 3LRMA 1BFNA 4JZ5A 3UR8A 2XSAA 1W3KA 3AZRA 4M29A 4HZ6A 2X0YA 1TQWA 1CLXA 4AEEA 4MPKA 4QLLA 4AY1A 2F61A 2EQDA 5I5RA 1NWRA 3ALGA 1JXJA 2D3LA 4DUWA 1E1FA 2G3IA 1KR1A 3SCWA 2VZSA 3GH5A 3VU2A 1SFSA 3GTNA 3ZT6A 4NF7A 1JD9A 2OWCA 5A8NA 2J77A 5BXTA 3W28A 1R47A 5CSYA 2F2HA 2ZUMA 2XIBA 5BXRA 2VUYA 1CTNA 2CNCA 2ZUNA 4M56A 4RL3A 3B9EA 3WY3A 1B9ZA 2Z1KA 4P8WA 2YKKA 1E4NA 2OSXA 2G3NA 3WQ8A 2V3DA 4BQ5A 4UQCA 1OD8A 5DT5A 2ZICA 1B1YA 4PMNA 4FMVA 5AYIA 3WH7A 3ARYA 4ZFMA 3VOCA 2BVTA 3D4ZA 3RM8A 3WBEA 5CXPA 5BRPA 4ATDA 2WVVB 4CCDA 1FP8A 1D3CA 4PSRA 4PTWA 1HJWA 3AHXA 1EDTA 2CHNA 1PEZA 5DT7A 1MFUA 1TA3A 4AWEA 4BS0A 1UR1A 4JFSA 3D51A 4H04A 3KEHA 1OT2A 5M17A 1LQ0A 4U3AA 1BYDA 3O2LA 3UERA 5I6SA 5LYRA 2X8RA 3KLLA 2A3BA 3EYPA 3MUIA 4GZIA 3GNRA 3LPGA 1EA9C 3MSGA 3AIEA 2OSWA 3MMWA 4YHEA 4DUXA 3VNZA 4ZE4A 5AC5A 5E0FA 1BVZA 3DX0A 3WNLA 3CUJA 1R7OA 4UOQA 1M01A 1LL7A 4FNUA 3RIKA 2PC8A 5EFFA 2VC9A 4W89A 3EJQA 3CZSA 1TQSA 1C91A 3NSMA 1GVIA 2Y8KA 2V5CA 3K46A 4Z2IA 2VX5A 4NRRA 4OBSA 2DH2A 2XUCA 1J0KA 3SCPA 5TD4A 4IM4A 1ISVA 4PTVA 3AMCA 1O7DC 4JAWA 4UFIA 3WMSA 4GPNA 4JHZA 5A8MA 4ATLA 2WVTA 1J0IA 5GPRA 1UWRA 3WMBA 3K8LA 1UQZA 1C90A 3ARPA 2QLYA 2HISA 2CKRA 4OJYA 3CHEA 3U5UA 2EJ1A 3VIGA 3SUTA 3GM8A 5FL1A 2D23A 2DH3A 1C7SA 3W26A 3AHZA 5AY7A 4Z2LA 1ESWA 1LL4A 3PZOA 2WMKA 5CGTA 3VIKA 3A22A 5JUVA 2Y8VA 1TR1A 3BUDA 3AIBA 1J9YA 4J27A 2D22A 3NCOA 2W4XA 4MJ4A 3WKZA 2WC3A 3N17A 3CZNA 1QI2A 4AZGA 1BGAA 1JDAA 4JFVA 3MO4A 5A8PA 1UWSA 1CECA 3BAJA 3W0KA 2PBGA 1CIUA 5FCZA 1ZBCA 4NRSA 4Z2KA 1E4IA 1C8XA 1DWGM 1UKQA 1HWWA 2WSKA 1H0GA 3WH8A 3WSUA 3N04A 1UD5A 3LRKA 4MNLA 1EH9A 1W2PA 4ATWA 3VSVA 4CN1A 1BLIA 3OLEA 3AYSA 3PZIA 1VFMA 1XSJA 1JZ5A 1FH7A 2XFRA 3WDRA 5A6SA 1TQTA 1EDQA 1GONA 3L2LA 1UWQA 4ZENA 4Q7NA 1HJUA 1HJXA 4PMOA 3K4DA 3UR7A 4UFMA 3GYCA 4DWSD 3AFBA 3BAXA 1KXHA 3I3EA 3T2QA 3W53A 2WC7A 3NSXA 1MW0A 3WQWA 1KXTA 1Q6EA 3HMCA 2CXGA 4J3WA 3MU7A 3AHTA 4FNPA 1JD7A 1VB9A 4FLRA 1MQQA 1BGGA 3IAQA 3S2CA 1UWTA 4W5UA 3CHDA 3W25A 3VMOA 4ACYA 5HDRA 3AZTA 3VD5A 2WZIA 5HNNA 1KWKA 1H2JA 2BVDA 2VVNA 1GUVA 2WMHA 1V0KA 4GI9A 3D52A 3AS2A 2PI6A 2J8GA 2BHZA 3DC0A 1BQCA 1J18A 2GDUA 2D1ZA 2JALA 2EACA 3VGBA 2BV9A 3AS1A 2YOCA 3AIVA 3AROA 1V3KA 3AI0A 2DT1A 3VTRA 2EPNA 3N12A 5IFTA 4D72A 1EXPA 5D9PA 4DWSC 2XVNA 1TE1A 3VKKA 1Z32X 5ABFB 2QHAA 3N18A 2NT0A 1EHNA 4HMDA 3L4WA 4J3TA 1UD8A 3WDQA 2O9PA 1KCKA 2PWDA 3QOMA 1OGBA 1XV8A 4EK7A 2XVKA 2EAEA 1LG1A 3SEPA 3EDJA 4A3YA 3W38A 3WH5A 2VQUA 4HMEA 1Q6GA 3WENA 3RCNA 2J8FA 2FDMA 1V03A 3CUFA 3AOFA 4UR9A 4D6JA 3ZJ7A 5JBDA 4H2CA 4HOWA 1J11A 1WKYA 6TAAA 1PBGA 2XN1A 2YDQA 3FW6A 3NSNA 4UFHA 3AZSA 1IZJA 4RE4A 3WNOA 4W7VA 1CXKA 1GCYA 4OGZA 2X2HA 1JFXA 3SURA 3B9DA 2WZEA 1EOKA 4AZ5A 3BUBA 2CYGA 4AMXA 3DX4A 4WKAA 4LYQA 1JIBA 1FHLA 3TTQA 2OSYA 5ECUA 2BY3A 4PSPA 2DQXA 3SCNA 1B3VA 1CWYA 3II1A 1Y7VA 3CZLA 2PWFA 1GOQA 3MV11 1T0OA 1QOXA 3A23A 1ZL1A 4CD6A 2J7BA 1EIBA 4U2ZA 3H54A 2A3AA 2GK1B 4X9YA 1J12A 1TVNA 3VIJA 1S46A 1WE5A 4CU6A 2PWGA 1U30A 1QW8A 3AXHA 3M6DA 4PCSA 3MUZ1 4W7WA 5LA0A 1MVYA 9CGTA 3NUKA 2VX4A 4B9YA 5I77A 1B31A 1UD6A 3IANA 1FHDA 1VRXA 1WDPA 3OA5A 1HXKA 5BRQA 3FXYA 3EJTA 1QHPA 5FOOA 4HPHA 1XC6A 2D3NA 1TQVA 1JDCA 4Y7EA 3EJPA 1KBKA 3WMCA 1CENA 3OB8A 4ZXLA 2NW0A 1CXLA 4MAZA 2X2JA 1ZBVA 3HZ3A 3EDDA 1HT6A 2WB5A 4M24A 2XSBA 1XHGA 2VURA 1I75A 2WNWA 1GPFA 2G41A 2G8ZA 4CVWA 1CPUA 4OBRA 3PHAA 1R85A 4AMCA 2V3GA 1UZ4A 4JIEA 5GQBA 4JL1A 1E0WA 4TX6A 2JF6A 4Z2JA 1V3JA 2IGTA 1E6QM 3WF2A 2E4TA 5JIPA 3KLKA 3ZT5A 1H0IA 1I1WA 2EABA 1MXDA 3WUEA 5KZ6A 1M7XA 5EB8A 2JIWA 1K9FA 5HOSA 3ZMRA 1CEOA 2NSXA 4XV0A 4M82A 2VCCA 3LXCA 1JNEA 3EDEA 4FNSA 3W4RA 4MTVA 2DSKA 5IDIA 1BF2A 1M53A 1QW9A 3CZJA 1E43A 4PUDA 1H11A 1HKIA 3NDZA 2CEQA 3QHMA 4GQQA 4AYSA 3GXIA 5HPCA 1O7AA 2G3MA 2XIIA 2WYSA 3CO4A 1UR9A 3WF4A 3KWXA 2OLHA 1D2KA 4CU8A 3D50A 1E4MM 3H53A 5LA1A 3UG5A 3H55A 4AD0A 5BROA 3ZJ6A 5D8ZA 1H3GA 5CG0A 3WDPP 3VIHA 2PF0A 1JDDA 3F5LA 3MMUA 4F9JA 2WWDA 4DO6A 3VDBA 2FGZA 3CIVA 5A8QA 1XCWA 3WY2A 1KTBA 4FLSA 2ZIDA 2ZX8A 2XWEA 4J28A 4AXNA 4DWSB 4UFKA 4UNIA 4GO8A 2W5FA 2WSPA 4WF7A 3WIJA 1JZ8A 2EPLX 5A6MA 5EBAA 1E56A 4DUVA 1W1YA 1HTYA 3K8KA 4PCTA 1FP9A 1US2A 3DDGA 2XVPA 4KMQA 2UY3A 1HL9A 1LL6A 2VQTA 3DX3A 4D6EA 2VZOA 2CIPA 4GZEA 3CHFA 2W92A 5D9OA 4CVUA 4HOXA 2XN0A 2F7QA 2BS9A 2J4GA 2WM0A 2C7FA 1YHTA 4UZUA 3VINA 1OINA 3BAKA 4V2XA 4C7GA 5ABEA 3T2PA 3GXTA 1OGSA 2CBJA 5A3HA 4H8VA 1H5VA 1HXJA 1UHVA 3M46A 4UQ9A 3W81A 3OZPA 1ISXA 1TUXA 4UCFA 3VO0A 1UKOA 3MS8A 4QLJA 3UG4A 3HG4A 1QHZA 3LPFA 4KRUA 3DHPA 4X0VA 4AIEA 3LXBA 4PMYA 2DGAA 3UEQA 4JFTA 3SUVA 5E6YA 1E5NA 3U57A 1CXIA 1QNSA 1UWUA 1IT0A 3BVWA 4MADA 4D1IA 1LF1A 2CBUA 1E6NA 1B30A 3VM5A 3N9KA 2YFNA 1B3WA 4UFLA 1JNDA 1GHRA 4OKDA 2DEPA 3KE0A 4U2YA 2FGLA 4QCFA 2E9BA 2BNJA 3VIFA 5HPOA 5GNYA 2IUZA 1D7FA 1F4HA 2F1AA 3BUIA 3THDA 1PIFA 2IXVA 3LRLA 4W86A 4AZHA 1L0PA 3CMGA 3F5KA 3N15A 3TV8A 2DT2A 2B31A 4AD2A 1XH2A 1V6VA 1R87A 2FYVA 3HG5A 2WWCA 3APGA 4AIOA 5IFPA 3PZQA 3GZAA 4MNKA 3WNMA 1OCQA 3ZJ8A 3VGHA 3THCA 3KL3A 1J10A 4M1RA 5KEZA 3BUPA 3S5YA 1CZ1A 3WY4A 1GQLA 1QNRA 1V3IA 1VBUA 3F4VA 4EAMA 5E6ZA 2YFOA 3L4XA 5BWFA 1AQHA 4PTMA 4TVDA 5ABGA 2UY5A 3WEOA 3EMQA 3TTYA 1AQ0A 4HZ7A 5A1AA 2VI0A 3QR3A 1VEMA 1WZKA 4JL2A 3QOKA 4M81A 4B3LA 3F5JA 4D6GA 2WBKA 1NH6A 2XYLA 4JFUA 1KB3A 1TMQA 1EDGA 1Q6DA 2J7GA 2FHFA 5M3WA 4BZYA 2GJPA 4PTXA 3VSTA 4HTYA 4ACZB 5ABFA 1ZJAA 1WCGA 4BQ3A 1EQPA 3VD9A 2OW7A 2XM2A 1N82A 5A69A 3E1F1 3BXWA 4CCEA 3LXAA 4FF5A 3VD4A 3BH4A 3GXMA 1JGIA 2PB1A 5I24A 3BVVA 4TTGA 3BSGA 4HA3A 1LG2A 2ZXAA 1W1PA 2DT3A 1E3ZA 4LXFA 3VGFA 4D6IA 2AOSA 2F7OA 3AIWA 4WKHA 1CDGA 4IPLA 3WUFA 4MDPA 2QMJA 5D9NA 4D1JA 4DO4A 1J01A 4LGXA 4PUEA 2YIHA 3T0DA 2WHLA 1FFQA 4JKLA 3VVGA 2WPGA 4W87A 2J25A 3GXPA 1K6AA 4MB5A 1R75A 3KZSA 1QI4A 1OGGA 2XJ7A 2BXZA 3WQ6A 1BYCA 2FH8A 1TQUA 3SUSA 3TONA 1M04A 4P8VA 1LJYA 4UZSA 5DFAA 2D20A 4AD3A 2ZWZA 3TTSA 2W61A 4IPNB 2WLYA 5A2CA 4GXPA 1OD0A 2J7HA 5A6BD 3PTKA 2GK1A 2V3FA 1AVAA 4B16A 2ZUUA 1R34A 2WMIB 4TX8A 3WL1A 4MB3A 1UD4A 3WF3A 3L4VA 1UD2A 1U2YA 3ARTA 2YBTA 3PZVA 4FNRA 3O9NA 4QCEA 1NOUA 1ZJBA 2XPKA 1GZJA 2F7PA 4JKMA 1O6IA 5E1QA 3A5VA 4K68A 3N1AA 2XN2A 4U3CA 2EBNA 1QWUA 2YBUA 1KR0A 4RE3A 1BG9A 2WAGA 4MNMA 3VNYA 1E70M 3WFLA 3NJ3A 4E8CA 4HMCA 5E09A 3SCVA 1XCXA 3AMLA 3MSDA 3GXFA 4UOJA 3AIUA 3VIOA 5A6LA 1PX3A 4FNQA 2ZE0A 3CZEA 4GZJA 1MQRA 4PEEA 2WCAA 3AICA 4PYSA 3GXNA 3W27A 1W9BM 1UR2A 5A8OA 2XWDA 5BCAA 1XD0A 3IK2A 1BG4A 1V02A 2X0HA 1K9TA 3ZR6A 1RP9A 4QFUA 3TP4A 3HG2A 1G0CA 1R33A 3PZMA 3CZGA 2D0HA 4NI3A 1GOMA 1E72M 3HG3A 4W93A 1CGVA 4AISA 1RD6A 4W88A 1HJQA 3SCRA 1MYRA 3PN8A 1XYFA 1XYZA 4XZBA 1X6NA 4AZBA 2VNCA 4WSJA 3DECA 3FAWA 3ARQA 2DSUA 2EEXA 3TTOA 5M5DA 2BXYA 4AYGA 3AJ7A 3PBGA 1V3HA 4W5ZA 4DO5A 1FH9A 1SZNA 2YA2A 4KRTA 4C7DA 1E6PA 5CZKA 1FOBA 2UWFA 3VDCA 1A47A 1DWAM 1ODZA 3BAIA 1B3YA 3U7VA 4WIWA 5ABHA 1U33A 5I2UA 1IZKA 3LPOA 1B3ZA 3RILA 3D3AA 4HU8A 4P7QA 1E55A 1HNYA 3WD4A 2DT0A 4TOQA 1QVBA 1W9DM 4XZWA 4PBGA 3T0BA 4H8UA 3ARUA 3K4AA 3AMKA 1HVXA 1W32A 3ALFA 1LWHA 4J3VA 5HBFA 3PTMA 1JF5A 1ZB5A 2X2IA 1WDRA 1XD1A 4OIFA 2QMKA 2IXUA 4DWSA 3LPPA 5IHSA 4AZCB 5E0CA 1JZ2A 3HU7A 2JF7A 3AMGA 1B3XA 3WDHA 3WH6A 3WD2A 2J79A 3S5ZA 4B9ZA 1NM9A 3WF1A 1NWSA 3WFZA 2GJXB 1W3JA 2ALWA 5A2BA 2QF8A 2UY2A 2ZUWA 1J0ZA 1OBAA 3SCSA 2BHYA 3A4WA 4DM2A 4QAWA 3VGGA 4B15A 1C3FA 1QNPA 4GO9A 1DWIM 3DDFA 4UFJA 1CBGA 3EMCA 2WXDM 3FHQA 1C92A 1E15A 1BYAA 2EADA 2PWEA 5BXPA 1GW1A 2CITA 3BLBA 5I23A 3RO8A 2VRQA 2XG9A 1MWOA 1OSEA 4J3SA 1UQYA 2FHBA 4FLQA 5E70A 1V3MA 4W7UA 2YDRA 1FA2A 2JEQA 4WK9A 4W8LA 4F79A 3DYPA 3WDIA 2XM1A 2W67A 3NYDA 4S3JA 2ESCA 2VCBA 3WEZA 1ISYA 4W85A 1JYWA 3U5YA 3WQ4A 4CD7A 2D24A 2X1IA 1TG7A 1WZAA 1UWIA 5BYWA 1V6WA 4NZFA 3J7HA 3BVUA 4URIA 1MQPA 4R5EA 1ECEA 4YPJA 5A6AA 6CGTA 4PN2A 3AISA 1ITCA 5F7UA 1LLOA 1V6YA 3WUGA 1UR4A 1XH1A 2X2YA 1MW3A 4JKKA 4IUGA 2WCSA 3GH4A 2DSZA 4HA4A 2D0GA 5A2AA 4AD1A 2XGBA 4M8UA 2J62A 7TAAA 3SUWA 3CZKA 1ODUA 4ZE5A 3WNKA 8A3HA 4EE9A 1EQCA 4HPGA 2YA1A 1E6ZA 1C8QA 4FK9A 1JZ7A 2PWHA 1J0YA 1XRVA 1E9LA 1HX0A 3EJSA 1GQJA 1PAMA 3CPUA 4OOZA 4W8BA 4W8AA 1US3A 4BCEA 3TA9A 3A4AA 1V6XA 1WDQA 3ARZA 1TVPA 2EPKX 4U33A 3VD7A 4MB4A 2WVVA 3IJ9A 8CGTA 1P6WA 4QP0A 1PIGA 3OLDA 4NX0A 3ARRA 2CETA 4OUEA 1VF8A 2WC4A 2YJQA 4A3HA 1KQYA 5M03A 3CGTA 4P7OA 2WBGA 4GI6A 5I79A 3PTQA 1HJVA 4H41A 4PMDA 1ITXA 2WKLA 4AW7A 2RGLA 4P7NA 2VVSA 2CPUA 1XSIA 2GSJA 4ACZA 2E40A 4PMQA 1MXGA 1JFHA 1HKJA 3AMDA 4GQRA 3DX1A 4QLKA 4J3XA 3GBEA 2V5DA 2X05A 4WLCA 1UKSA 1J0JA 4D6DA 1W1VA 3OGVA 4YHGA 1PZ2A 1R86A 1QI3A 2VOTA 2YDSA 5IHRA 2XVGA 3IJ7A 1VFOA 2QPUA 3OIHA 3WUBA 4PMVA 3OZOA 5C71A 2OW6A 1PJ9A 2XFFA 2F18A 4P8UA 4IISA 1QX1A 4TVUA 2O92A 4TUFA 3CH9A 4AEFA 1W9XA 1M03A 2E0PA 3A24A 4JCLA 4W84A 3BMVA 2VRJA 3VUPA 5CGMA 1UH2A 4P7LA 1QPKA 1SR0A 5EMYA 1NP0A 1VEOA 1KFWA 2O9TA 2BY1A 5BXSA 4PMZA 3ARXA 3AHVA
chains in the Genus database with same CATH superfamily
1KYOK 1NJ9B 2NNAB 2BZ7A 3V4UH 1LQBC 4DJFD 3X12A 5GGVH 2ICEB 3FMGL 3U2OA 4GKZA 1A7QH 4YC2C 3PABB 3IUDA 4DIAA 3ZKSD 1JYVA 3KS6A 3H9SD 1KFAH 5E8DL 4AGNA 1AQKL 4H7VA 3NJIA 4FULA 4RDVA 1W1B1 4RNJA 3L9EA 2WMPA 3KZ8A 1RQEA 4HKJB 4QRQB 3G6JB 1YPIA 4KK8D 1HF6A 1HDMA 5BMFL 1K8CA 2I9TB 1DSFL 1TVBB 3EXSA 2EH8H 5KYXA 4PRPB 4X6DA 1QWKA 1QFUL 3L2IA 4D8PB 2CJ3A 3PJSB 4LP5A 3RX4A 5AVSB 3VJ6B 1DTNA 4Z3HA 4PLOB 2XY1A 3A4XA 4CVZA 2YSSB 3UOAB 4LLQA 2OA9A 5RUBA 3R0DA 3WK3A 3RYSA 3ZZSA 4C4KO 3T3MF 5CPMA 1RD5A 3IETB 4DW2L 1TTRA 4KKAC 2CKSA 4YVXA 4W9IC 3ES6B 4KTEH 1B6UA 3C60B 3NCMA 4GIYA 1H51A 1MDRA 3SYQA 2A7RA 3QJHA 3IEBA 3P3RA 3V8CA 4GS7B 1UC6A 3LNFA 3M47A 5EIIB 2PDLA 2GGIA 3FF8A 1OAUH 1DR9A 4QWWD 5T1KB 3TA3B 3I6RA 3ZKQD 1M7OA 1ONQA 2EDYA 1LEGA 2LU7A 2XC8A 5E1AB 3RVUD 4YZWA 1RPKA 2LV4A 5F7LB 3VMNA 3V4VL 3OAUH 2OJ1A 2QR0A 1B3JA 1EEQA 3NZRA 1EFZA 3ES7A 4AV0A 1BQ5A 1QR4A 1I3GH 2J12B 1VPYA 4JPSA 4YVUA 2OYPA 3CQ0A 2OZ4L 4D0BA 3EAUA 2HPMA 1YECH 4C91A 2R9HC 4V1XA 3WLNA 4YSRA 1P4IL 1BVKA 4QTIH 3PVFA 1M3JA 4XXDB 3ULVL 4UTJA 1YC8A 3KPMB 2JCWA 5GRUH 1NCTA 1QNQA 1RZFH 4P9HH 3B8WA 1CN4A 2HSIA 1U58B 4ZX6A 3L2MA 3O2DH 2CGZA 5SWZE 3M7OA 2JXMB 1WJ3A 2AK1L 2VO5A 3TJHD 4FCHA 1VKXA 4XVJL 2PTYA 3U2JA 1FZJB 4N0UB 4KRNA 3V0WH 1Z0NA 2VC5A 4P23D 4YXLH 4WY0B 5D2LA 5DO2C 3JV4A 4XNYH 4YHPA 4NXSA 2IBZY 1O66A 3RL2B 2HNHA 2P48B 3H9SB 2OMBA 4K3HA 3UROR 4H01A 2F8OA 1Q4NX 3O4OC 4OU3A 2GZXA 5F89B 4ECNA 1JAKA 4CD8A 5AKRA 1UOLA 1XGRB 4Q6XA 4K5LA 1UH3A 3DPBA 5TQ0L 1SJHA 3TNMB 3SE9L 4PJXE 4QEEA 1OY0A 5EB9A 3COOA 2Y7EA 3BAEH 4C56E 1GL4B 1DE5A 1EFQA 1CC3A 1U2HA 1IAKA 1CDYA 5DLML 3S6CA 5FGSA 4XB3A 1MDLA 1WH0A 3LQGA 5DS8B 1M42A 3CUPA 2EDNA 2XGZA 5HP5A 5IQNA 4ZD3H 5JTWA 1VCFA 4RCXA 3BQ5A 5ILTL 4M61B 4FFWD 5D70L 1OX5A 2F54E 2OSLA 2X0SA 4Y19A 1XGZA 3MU3A 4CMMA 2QIIA 3MRIB 4MJMA 1V5XA 3T6XA 5BW7A 4OHQA 3R94A 2QR6A 4Z0XB 1EGJA 4JG9A 1A6TB 1OCBA 4PBXA 3B2DC 3B97A 3QUXD 2MANA 1YYLL 3CAFA 5LGJA 1EHKB 2LAGB 3URNA 1S7UB 1A3XA 4OZOA 4D0DB 5F6HJ 4QRFA 1KIQB 4ICXA 1U8KA 3DUHA 4NO3A 5JR1H 3DZ1A 5HWMA 5HI5C 4N0FA 3LU2A 4ELMB 4L8DA 4AZ7A 4M62H 4O9HH 1AO7E 3DBNA 2HDJA 1Q0YL 2FDSA 3BLDA 2C4FU 1MCSA 1A7RL 2FTWA 4LFHD 3VXME 2DQEH 1VS1A 1F13A 2VMJA 1XCTB 1CQKA 1VJIA 4R84A 4CCZA 1P7KB 2BIIA 1LNUA 3HC4L 3CFEA 4CNOA 1OCNA 3BD4A 3MRPB 3EJRA 2VEPA 1DFBL 2AQRA 4Q8BA 4DJED 1RP8A 2OYMA 3QCVL 4RWYL 3WNNA 2R1YA 4XXWC 4J6RL 4MJ6B 4W9LC 4DKFH 1RPQA 1DWFM 3VXUD 4XXWA 5F8QC 3I6SA 5DEGA 1XB3A 4BINA 1RVFH 1SEQL 3WQPA 2O30A 2IBBA 1UUMA 2FHCA 5C0NC 3OSVA 2YYUA 3TT3H 4AVNA 2VP8A 5C7ZA 1NBZB 4HMNA 2FX7L 1DDHA 3MJ9A 2Y5QA 4WKZB 3TVMA 1UKPA 2YGOA 2DQTH 4JDTL 3PZ9A 5ACZB 1EZ2A 4U3HA 2NDFA 5CCZA 2ROYA 2NTFB 4MWFB 2NXHA 1PMYA 2B7QA 4ILDA 3K91A 2J78A 5L4IA 3HNSL 4WFGE 5XIAA 1N8IA 4JZOA 3TH3T 4XAYA 2A4ZA 5J04A 3G6DH 3ANYA 4CVXB 5BS0E 4TRPH 3OJDB 1EHLL 4HZ6A 1TQWA 4KDWA 3GC5A 3OQEA 4RWHA 1XPYA 3UGRA 4ELKB 1IC5H 1H63A 4ENLA 2DP3A 5F1NA 3R89A 1XF2B 4UTHA 1A7BA 1NOLA 2H1PL 2X5PA 2OKMA 4R88A 2A1YA 1YJDH 4MCYA 4ETYA 5E2VH 4K9EH 1QLFA 5H91A 3KXFA 3L7RA 3WQOA 3N40P 3DOSA 1AP2A 4UILL 3U25A 5F9WC 3ILDA 1YPXA 2PP9A 5LKNA 4KI5C 2QVFB 5L6YL 3OMAB 3LKNB 1DUZA 3QUXB 2J6WA 3G5YA 3BIKA 3NAAH 4PWHA 1I4NA 5CEZE 2HRPL 1HUVA 5I1LB 5DD6B 2PYEA 3EX1A 5EZLB 2XH7A 4PJCF 2AV7B 3TEUA 4M4RB 1DORA 3VG0H 2G3XA 3TJEL 5F9JB 3MSGA 1NCBL 4JGNA 5ITFB 3VNZA 2FFIA 4XCEB 1IBFA 1R3JB 3P67A 2H26B 2QPXA 3FH5A 3TCEA 2JV6A 2ZTBA 1RV8A 3JBG7 3HBGA 3CZSA 3IDNB 3RQ3A 2G4EA 2WZ0A 2VX5A 4J4PD 1KFEA 5HYSG 3QEUA 3O6LH 1LQAA 3CB8A 3LZ5A 4ODUB 4IM4A 3NN8B 3H7BA 3RWFB 2VDHA 3AMCA 4OZHA 2QTVA 3WMSA 1KM1A 4JHZA 5AZUA 1XTMA 4WO4C 2CU0A 3BQUD 1CI1A 4JS7A 3CHEA 2BLFA 4WO4A 4ZFZA 4KPHL 2W27A 3VXUB 1EEXA 2QZ5A 1C7SA 4X42A 4QJ1A 3AHZA 3FSTA 4ZCWA 3I6LE 2WMKA 4TIMA 5J6GB 4MMZA 3R8RA 1MHHA 5FK9B 2C3HA 5IMKB 2D22A 3QV7A 4ZQKA 2QJIA 3UP8A 3DTXA 1IFGA 3H9ZA 3REQA 1QNZL 4PJEE 3US0A 2XWJA 1E4IA 1OAKL 2RHGA 3EAKA 4XMKH 4OF6A 3UTZB 1S9XA 1FLRH 3L0GA 4ZENA 2BGQA 2HT3D 2HUHA 4BDVB 1I1AA 3AFBA 1JPMA 4NRXA 3NSXA 5FGRA 1SU5A 1KXTA 5KVMC 3AHTA 4AC4A 2V82A 4BH7B 3E49A 5HNNA 3KGUA 1YMMB 2HG0A 5EMMA 5KYWB 1YYAA 1UJ3B 3CPGA 3NSYA 5LIXX 4R6UA 3G1HA 3AS2A 2PI6A 3KYMB 1RJCA 4G9DB 5T9BG 2DT1A 4FSAA 5A3ID 2VLJA 2XSKA 1GGIH 3DJRA 3MV9A 5ANHA 3SJNA 2RDTA 1PY4A 5HHNA 1DVSA 4ONOA 3IJDA 4HMEA 3TEVA 3WENA 3S1WA 4IKJA 1T1WB 1AL7A 4FJYA 1QPRA 1J11A 4RDQF 5IK3B 1H7WA 4NN5B 1YEEL 3EGSA 3NQEA 4HF5H 3ULVD 3QRHA 1I2NA 3BUBA 2DQWA 4XBJA 4Z95L 2HKFL 4WKAA 3DJ9A 3WNIA 4RLDA 1KPRB 2DQXA 1MFDL 3GSRA 1BWLA 4C6EA 1O95A 2OL3H 1ZRUA 2B59B 3RL1A 4PLNC 6FABL 2XTLA 1LP9E 5CPLA 2UBPC 4AUBA 1MCOH 3OA5A 1B4KA 2J88H 3EJTA 2GOUA 3GMLB 1NUDA 4S1RH 1XC6A 3ECWA 3IVUA 2W38A 3IV3A 2VWSA 1ZANH 2BCKA 5E94B 2WB5A 1F3DJ 4IHOA 1XHGA 1GPFA 2P52A 2VLME 1AL8A 3BQUB 4F2MB 5GQBA 4JL1A 4NKIH 1UA6L 1INDL 2ISWA 1DJYA 3EFFB 4XVUD 3TSMA 5JIPA 4HHLA 2B1HL 1I1WA 1GR7A 3LN5B 1G9NC 2NSXA 3UBXB 4UMGA 4NZDA 3FDGA 4WUUA 3RUBL 5JHBA 5GGVY 1XIHA 3CZJA 3B34A 4HHAB 2QPEB 2AI0H 3UZWA 1BECA 4OCWH 1GG0A 1KIUB 3NJGA 4IQEA 3ISRA 4JFPA 2DDQH 1R3LB 5CG0A 4AH2A 1DVYA 1P1MA 4RX4A 1JPSL 2NY3C 2ISSA 4G42A 4JW3A 2NLIA 3NIFB 1KTBA 4LCWB 4WGWB 3OM3B 1XGTA 4E42A 4AMKL 1A6VH 4GCXA 4UNIA 1XIWB 5I0XA 1W54A 1M1BA 3S97C 1WWWX 2Y5JA 3LLXA 3A6CL 1LE5A 2CZFA 2O5YH 4UMSA 2A5HA 2RKXA 4YHYC 1RHFA 3L3OA 1OE1A 5G55A 1V8HA 1YVLA 2ZOWA 2FVLA 3TW7A 5D9OA 1L6YA 5EN2A 3L5XL 3IXAB 2WM0A 4NASA 4N20A 3DO7B 3N4FA 4AWUA 2APXA 4JHAL 5C9WA 2G5BB 2ZNWA 4Q6KA 1UJTA 2ZXGA 1DFXA 3O4LB 1CICB 2V4LA 3LMJH 1O94A 4JHWL 3LPFA 3CWHA 4LANA 4DOHE 2MMXA 1HHGA 2ZKWA 4KKPA 1I3RA 1IGFL 2HT2C 3GAKA 4GRMA 2WXIA 2JFCA 5G2WA 4A2DA 5F8RC 5DN1A 3DIVA 4RISL 1PIFA 4RV8A 1XYMA 2CO4A 1FJ1A 5DHMC 4KWSA 2DKUA 1MJ8H 3B7SA 2W07B 3LSOB 1WFJA 1FYHB 3R25A 1U3YA 3DI2B 1OCQA 2YB1A 5KYYA 2N7SA 4PJAB 3NZ1A 1VBUA 2YFOA 3X11B 2F68X 5KN5B 5HK4A 5CLZA 1IEQA 3I84A 5AYTA 4D6GA 3NACH 2XYLA 4A7GF 4X7TA 1FNGB 3ZRCC 5IROC 1GTHA 3GNML 4L5FL 3VD9A 5A69A 3CEUA 1A3RL 3GE7A 3P74A 2PB1A 3WFDH 3RDJA 2F7OA 1R3RA 3WUFA 4KUCF 5GZOD 1CIDA 3EGDA 4LGXA 2YIHA 4GRWH 3USZA 2PCYA 1TPXB 1YTEA 3QYSA 3TO2A 2WLLA 4CGUB 4DCQA 5D7IE 2DPKA 1L9PA 4F37K 2B15A 3TTSA 2JKAA 5GISH 1FZOA 3SZ8A 3L4VA 1JPTL 3D3VE 1I60A 4KNQA 1GZJA 3MSYA 1F4YL 2V2DA 2C4XA 1NGQH 2P44B 3ARDC 2AJXH 1F3DH 1QWUA 2VZ3A 4RE3A 4FXGC 4QF1B 1HHKA 2X6CA 4F1SA 2GSIB 5A6LA 4B7LA 1MWAB 2X0HA 3VI3B 1G0CA 4WUKH 2P10A 4PIRF 1GGTA 4NI3A 1CD8A 4F0SA 4JFQB 5C0DB 5KAQF 4FPSA 1TNNA 4ZBJA 2R0LL 2PGEA 5HI4D 1WWAX 4IOSA 3I75A 4LZKA 1FH9A 3UL4A 4I9JA 3VDCA 4KXZH 1DWAM 3W1XA 1ZVYA 3KR3H 5F96H 5F44A 4GW1A 4G7FA 5I2UA 5E6IC 5B38B 5JXAL 2VWEE 3TT1H 4GUPA 1HNYA 4PG2A 2GSEA 5M2FX 1PUDA 4J5NA 1URZA 4PJ9A 3TCLA 1P7QD 1VFBB 4IMFA 4GC3A 3C0SA 1VZIA 4PWGA 3WS6C 4UU9A 3OXRA 1SZEA 3WS6A 1ZV5A 3VGGA 4IMAA 4WDTA 1XAKA 4K5MA 5DRWA 2EIZA 4Y2WA 3FYIB 3BPWA 1D7BA 1HH6A 2PP3A 4MDIB 4W9HC 4LLMB 3DUGA 1EJ7L 5E70A 3B83A 3NJVA 4U6HA 1QD0A 1VFAB 5KVFL 3WFAA 7ODCA 1OF0A 2QT6A 2V5BA 1CDIA 1F1AA 3GHBH 2B4CH 4LNRB 1ZEAL 1LORA 3ZZ1A 2OMNA 3LSBA 3NPUA 3SSGA 5T1DL 2FX8H 4JKKA 2DSZA 3CSYB 4JJ5B 1X5JA 1QMLA 3LV3A 4M8UA 4LY4A 3CU7A 2ITFA 2Z4QA 4ZE5A 1NAKL 1X5HA 4TQEL 4XAKE 3VI4E 5JXED 4FK9A 4KH9A 4KK9C 3KOFA 3ROLA 1HHJA 1F76A 1NEUA 2H8PA 3UAEA 4QXGL 4G6AC 3KOZA 1MSSA 4OT1L 9XIMA 1ADOA 4TL5A 4PTDA 1XLDA 5TGBA 1NIAA 4CEUC 1KCSL 5E1IA 4P7NA 1GQNA 3JWNG 3MLRL 1XSIA 4OU1A 4UB0L 4A2LA 3W9EA 4JDVB 3AMDA 1QAWA 3K2UH 3KLHD 4UC5A 3V79C 5T3ZD 5I19H 1K3UA 4C1NB 1X97A 5DQDL 4PJCA 3M17A 5D2XA 2CDEA 5J06A 3D4CA 3NIDE 2P28B 3IDJA 3QA3B 4G8TA 3GUTA 1OD9A 3HIJA 3OU8A 2DQIL 2BNQD 3BMVA 5B7FA 1LEKB 3DVGB 3ERXA 2PLTA 4MXQC 1SO5A 4D8LA 1KDJA 1IEAA 3UTQA 1Q4WA 4LL1A 4KTGA 1NANH 3UABA 2CZVA 3V5KB 5KW9L 4XN4A 1Y5WA 1E2VA 1H3XA 3OJGA 1EC8A 3OZ9H 2GJ6B 1MVUA 3OVGA 3FU3A 2R29A 3FU7B 1MDAA 2Z9TA 4MA7L 3QCUL 4F57H 4US5D 1TPUA 4OGAC 4JTJA 1ISWA 3G22A 2E47A 4FQXD 2BY0A 2ZQKA 4G8IB 3FUMA 3WIFA 4FFZL 3AXXA 2OYLA 1JZ3A 5DUJA 1WAEA 4QDPA 2PO6C 4C7FA 4ZFOA 3WLWC 5JOFA 1TX2A 4IRSC 3DX7B 2ED6A 3TH6A 3S4SA 5IF0A 2PGRA 2FJFA 3MA9H 4IRSA 5JOPE 4F9DA 3LEYL 1HSBB 2NWSA 2YGVA 4ODTH 1JUFB 2ZCLL 3VVWA 3KDMB 5DJAA 3MUHL 4YNYA 1RCQA 5C0AA 2HA1A 1WZLA 3OKEB 4KK6C 2BDQA 2X0WA 3NZHL 4H8HA 5IWLC 3KCPA 4YJZL 2GUYA 2PPAA 3GYRA 5KSVA 2K6YA 2GAZA 4B5UA 3U7WL 5KUMA 1Z44A 3C6EA 3Q1SH 1JV5B 2OMYB 5CD5D 4GFXA 4L9LC 3NRFA 5DT1L 3VSUA 3GRGA 4LAOA 1KTCA 2QQLH 1TB3A 2VSKB 6TIMA 1RZKC 3VXRA 1KW1A 4QGCA 4AKOA 4LBRA 3RGVB 3TESA 4LYRA 1NWUA 3AWFA 2AJYL 1E4WL 5KVEH 5ABDE 2MEJB 2IOIA 4JUTA 2V5KA 3MP4A 1X5AA 4D6HA 3WFCH 2WHMA 4BI5A 3KL5A 3W86A 5C2BH 5IVZA 1UWYA 5FI8A 1OF2A 4V11A 1DANT 3V7PA 1EANA 5FA3B 4AQAB 4Z1AA 4GP4B 1UJQA 4N6FA 3ZFHA 2HWZH 3A4DA 2BNQB 2E7MA 4AD4A 4OLWL 4GAYB 1JEZA 4GHRA 4XGZA 1H8SA 1OJXA 4RDYA 5D4QA 1I2PA 1XBDA 4UT7L 1SN5A 1PZUB 3QI9D 2OCJA 3F83A 5L88L 3IFPA 3GUWA 3CU2A 2CKBH 1OW0A 1YSOA 2OS7A 5IFHL 4G6CA 1P7BA 2QVNA 3JSSA 1N8WA 3SE8L 2VDNH 2E6AA 2DI9A 1ZU8A 1E1EA 5DS1A 4F93B 1VFUA 3RY6C 3F00A 5TF1L 4ONHB 1CU4L 3HUJE 3EBVA 4XO9A 4MAYD 3T7VA 1DWHM 3MNVB 1DHKA 3D08A 4NQEE 2OXGB 2VDQB 1IGIH 4KUZL 4UTAA 4PGJA 1T21B 1ONEA 3CCHA 5HYSB 3VM7A 3NL5A 2FEDD 1CLZL 2P5WE 5H6HA 4KKZA 4ZO9A 4DP0X 3U2SA 4N4PA 2BVPA 3UWEA 5FW6A 4OFCA 1AW1A 4RNIA 5FEZA 4C6NA 1HH9A 4R4BB 4IIZA 2GTZA 5MERB 4ZQCA 3VIMA 4LEQA 2OP4L 4UM8B 3AIRA 1CXFA 1SBBA 4IMKC 1GW6A 4B3KA 3TN6A 3B2UC 2Q20A 3EH5B 2QQNH 3W76A 2R0ZL 1B2YA 3CHSA 4J5VA 4B41A 4F8QA 3K0YA 1A2YA 1JI1A 2I26N 2Q2EB 2GOKA 5SX4H 1D5RA 1HNFA 1TR7A 1K2DB 1MPAL 4KPLA 4LUIA 4HYTB 1J4EA 4FFYA 2XA8L 5EY5A 4GQ9L 3FH7A 3CLMA 1UM4L 5CPTA 3ZS4A 5EO1A 2HTKD 1NDYA 4F37F 3QDMD 3OR7B 3FUEA 3O3RA 1W5QA 3SGDI 4YTQA 4WI0B 4M6NL 2CLPA 1HI6A 3RXZA 1GYCA 3VOGA 3CHXA 3Q3GA 2NY4C 5ETUA 4U5KA 4FIQA 1VBHA 5E5LA 1FNHA 4GE8A 4H6EA 4FADA 3V5CA 3RWCA 4AC7C 3WKPA 2W63A 4MX7A 5KYUB 5DI8B 3A21A 3ZTEA 3CASA 1GTFA 3NFUA 1P5VA 4DK6A 2ZBTA 4PTUA 1PD0A 2W62A 3T0EA 1XLIA 1GK8A 3BJFA 1MCNA 3Q5YA 4AX3A 2C9QA 4WSKA 2K70A 1E4XI 4ADSA 4NG3A 4Y2DC 3VTMA 5AW2B 3UWYA 3CT7A 1ES0B 3DPDA 3CUIA 4IMCA 4HU2A 3CDFA 1UOZA 2YRLA 5K9KB 3ZYIA 4ENED 4N2FA 3PP4H 3UBHA 1MRDL 2YD6A 5D7JC 5C7VA 5C0JA 3ZRSA 1NCIA 2VX6A 1XFCA 4MAYB 3U4FA 1CLKA 2BX7A 5D7JA 3LB0A 2CJUL 4M5ZL 4RAVA 1W3LA 2GUOB 1BIIA 3H2QA 1UASA 2V5SA 3T8XA 1L8NA 1CE6B 3TEYA 1ZSDB 2V0AA 3REVB 2XNAA 1TYRA 2J6XA 3KBWA 3EYFB 2XBZA 3OKOA 1A5FH 3LEVL 1OQXA 1Q6OA 1ZTXE 5EMLA 3U7AA 2EDMA 4HIIB 5ALCL 3C6CA 2QVHA 1UQSB 2FPYA 4TLKA 3GU9A 3KRSA 4ENZA 3ZE1B 4GG6E 1MI3A 1SM9A 4M9OA 4NWUH 1YEDB 4M56A 1E4NA 3OKNA 2GHZA 3QVAA 3LNHA 5JHLL 3ULAB 3D6NA 1AJZA 3ARYA 4DP1X 1QSFA 4IKKA 5TAOA 4BELD 3SGKC 2CXKA 2O5ZL 1J05A 1MNUL 4IOFC 1BDYA 1KBPA 1C9DA 3UGVA 4FQCL 1F8MA 2OSWA 4YHEA 3CN0A 5TE7H 1U8HB 1JF1B 3A3WA 3WHE0 4XT1C 3F85A 2AQNA 1C91A 4KROD 4JFFA 3SB0A 2FCBA 2IQ9H 3VWJA 1OPOA 2INZA 1J0KA 2NQ3A 2R83A 2QQKL 4I48A 3EOBB 5FA4A 1ISVA 3WGUB 4UFIA 4Y5XA 1TTAA 3CNKA 4HK3J 4X99B 2QLYA 5FYJL 1RHCA 4XAFA 4QRPA 3RYMA 3DXAE 4O2FA 2VDPL 4FR6A 4JQXA 3JZ7A 3MYJB 3MJ8A 4L4VD 5INDB 1DE4A 1T96A 2EH7H 5HHOE 2QBWA 4HWZA 5ABAA 2VDLL 4WZHA 3IJYB 4A05A 4Z7QE 4TULL 2KLSA 2VERN 2YMXL 2Y2YA 2BLEA 1CECA 4IPJA 2WZ5A 1D5XB 1FN4A 1Z66A 1UD5A 3CFCH 3GNDA 5BPPA 5K7JA 3BEWA 5I15H 3IDXH 5E9DE 3CXFA 3I02A 1U2CA 3PWAA 4H2AA 3HIZA 4ZMLA 3QPEA 3GRWA 1VESA 4GOSA 2XWTB 4I7UA 1WEJL 4G9FE 1YBQB 1BQHA 3F7PC 1I9JH 4ZZKA 1SFLA 3MDWA 2X4QA 3F7KA 2NY6D 1EXUA 5EF2A 4Y5YA 3ZTJH 5FPIA 1FNEB 4YDIH 3W84A 2VL5A 3ZTDC 5MKGA 2WOQA 4XOAA 5I1CL 4KTDH 2WMHA 3G5XB 3NPSC 4IFKB 5I82A 2J8GA 1WFUA 4X6BA 2BVOA 3KWWA 4XMXA 1GJPA 3L1GA 3UZEC 4MZ3A 5ABFB 3QPQC 1HYRC 3QQ9C 4IQDA 4XVDA 2MSPA 2ADJA 4MHHI 2EKCA 3MMTA 2XVKA 3PV6A 4JTCA 4NKCA 2W94A 3BKYL 2WUBH 4YL4A 1BREA 3NRQA 3ZU8A 3IRSA 4H2CA 2X9YA 5I8OL 1WV7T 5ESVB 1PBGA 4DP4X 5D1QE 3FW6A 5F7MC 5DQPA 1AY1L 3I6KA 4IRZA 1Q9LA 3AG1B 3GMRA 4L0YA 4N5UA 1FNAA 4BZ1A 3W85A 4C55A 3WLSA 4L37A 4UAHA 2IDSA 4WHTB 3TN0A 1AACA 4PYGA 4H0IA 4U6TA 1NFPA 3ZIMA 4E3TA 2VENA 3GD6A 1WXZA 3B0VC 4U2ZA 1EEYB 1G7IB 1QFWH 3P2DA 2GVJA 1U30A 2FQEA 1GYAA 4MYAA 1EF2A 5EPMB 4M1GL 1UB5B 3IFNL 4DHGA 2KX9A 2PRLA 3DI1A 3P02A 5LBSA 2VDGA 4HLZG 1HQ4B 1UUOA 1D7CA 3V0FA 1P1ZB 2I16A 3BDXA 3HZ3A 3BD5A 2A74B 4ZRGA 3QIBD 1R85A 5DEFB 4MD5B 3MRBB 3QZAA 4L4VB 5EZPA 3HNVL 3HB9A 4RQQB 3OC8A 4ACPA 1K9FA 2HXUA 3LIZH 1POJA 1KLGB 4HIPA 3N6HA 5IDIA 1NELA 4Y4FD 4MCZB 4RGNE 3EXTA 1L6GA 3BD3A 2IKJA 4JX0A 4Z7NB 4MWAB 4PJBE 4EXPX 3G24A 3GXIA 3MRRA 2EVJA 4QLWA 1ECYA 1UENA 2QHRL 1YXDA 5EU7C 2OLHA 1TQJA 4WSGA 4NZUH 5AALA 5PCYA 5LXEA 3I9IA 3MV7E 1FIEA 1SW7A 3ZDWA 2EUZA 3ITTA 2ZZ4A 3VQ2C 3NNTA 3B8TA 3P0XA 3WLBA 2ZD0A 4GO8A 2VLRD 2ZG1A 5DRZB 3MAWA 2GPTA 1JNHA 1E56A 4YDNA 5EA0H 2YAFA 3CNYA 5HDQH 1U3HD 2W65A 2C3ZA 1V4YA 1VLWA 2AQTA 4L1BA 4F27A 3ZYJA 4WEEA 3N2BA 4PRHA 2IG2L 4MJZA 1P1VA 1LO2L 3PL6D 4HBCL 4K8HA 3UVIA 3C5SA 1CCZA 1XC4A 1HXJA 2ZRXA 4AQOA 4BSVA 4D9LL 1DXFA 2Q02A 1HILA 4JFYB 4X7DC 4W9GC 4WWOA 3NZGA 1I4FB 4Z7OF 3ZY7A 2E5DA 1IGJA 4JFTA 4FX8A 4ANWA 2DD8L 4DNHA 3M44A 2E28A 2DLFH 3GHUA 3SJVE 3RPBA 3EKLA 1JHKL 2CHZA 2JKIS 2BNJA 1NQBA 3KP0A 1D7FA 5I8CA 3IYLW 1TQBC 1OL0A 3ZDZB 1SGJA 3F03K 2VABA 1SHSA 3B0XA 2JQAA 1OFAA 3WJJA 3A4FA 3MRJA 4XG1A 3GFUA 1PU0A 1E50A 2AF2A 4DZBA 3WSQL 2GIXA 2CM5A 1FKWA 4W4OA 5K9JL 4HD9A 1NDGA 1GS8A 1HOCA 2XBDA 3BUPA 3F4VA 4A66A 1V3IA 4WHBA 3G08B 3FQ2A 1XF0A 4GG9A 5JIMA 3F5JA 3KPLB 4HV8A 4P2RE 5ACLA 2VXSL 5M3WA 4AXKA 5J4MA 4RZ6A 4YN3A 3VOJA 2XTJC 3CDGB 4G1KA 2BP0B 1TTJA 4Y9OA 4LSSH 4FF5A 1JGIA 1NWPA 5I76B 3N41F 1NIBA 2ZXAA 3LNEA 1BVNT 3D25B 4IJBA 5IG7A 1PZDA 1IKFL 2YAEA 1BQSA 1T0MA 3QJTB 3UZQA 2XJ7A 2BXZA 2ZOLA 3FYEB 2DM4A 4WWKB 4DZIA 3LNPA 4H25B 3OC5A 4X4YB 2ENQA 5CAYB 4LGRB 2GK1A 2OELA 4GACA 1PDKA 2CIKB 1O7DE 3VH8G 3F4CA 2P80D 1IQWL 1NOUA 2M26A 5F88B 1UW9A 4KDVA 3L0KA 1ILUA 1XR8A 1F02I 1XL6A 1A0DA 2PDYA 4UIMB 1CDHA 1U3HB 3QNYA 1IEBB 1KT2A 3W3OA 4MS8C 2ZG3A 4ODSL 3SCVA 4UOJA 2CLZB 3VIOA 4OD3H 4R7XA 2RACA 4KKLC 3WYRA 4PYSA 3GXNA 1XD0A 2XT1B 1INEL 4XODA 1ODAA 2W9DH 3DX8B 5DVNA 4J39A 3PL6B 1RD6A 1J6OA 3QAQA 4H20L 2ASHA 1T6VN 4ZTXA 1YEKL 2E7HA 4HJUA 4LRSA 1DJWA 1LBLA 4RMQA 3ABKB 2I25N 4HVBA 4JFDD 5G4MA 1D9KA 1HSAB 4NGHH 3BWUF 1BZ8A 2IDTA 3U7VA 5ABHA 1B3ZA 2FQDA 3SSZA 1MMFA 4A63A 1F6PA 4XBEH 1D6EB 5HBFA 4XPAL 1JF5A 3ZXAC 1WC7A 1JTOA 3UZJA 3HPJB 5G5DA 2EYRA 3CJPA 3WF1A 1C5CL 2WNGA 43C9A 3BP5B 3T77B 2DWEB 2WW8A 3MCLL 3BLFA 4YGAB 5FYJD 3U36B 4LSVH 3S83A 4UT6L 1QNPA 1A4KB 5K9QI 5L2KD 3DDFA 4Z0BH 4FEZA 3FHQA 3TYZA 4N6QA 3LIUA 4RRPG 2EKGA 2Z7ZA 4L64A 2Q3RA 2YDRA 1FA2A 3TMLA 3FFCD 2TRSA 1R1CA 4FA3A 1RBLA 4JO1H 2FT7A 5BW7C 2QV2A 4GAFB 3U5YA 5H37H 1MXSA 4PTTA 1YPZE 5E4IA 4GW4B 1UWIA 4R7DB 2H32B 3J7HA 3O7UA 4ZOEA 1DZ0A 5CN1A 3BHBB 5FYKH 4O14A 2WCSA 4HA4A 1I9RL 4MYWB 4HN8A 4TNGA 1BRLB 3E2HC 4GJ1A 1ODUA 4OZIA 5IGXH 1QQDB 4N0CD 1JZ7A 4M6ML 1A21A 4GAJL 3WU1A 3AB0B 3TA9A 1VBJA 5DFVC 4BFAA 1KLYA 3KM2A 4G6JH 4XNUH 1M6UA 3RDTA 2P43B 1KIPB 3KLAB 4DERA 2GGHA 1KBGH 3DROA 5A2KH 5C9KA 4A6YA 3GI8H 4CEXC 4KOBA 2QZQA 1UB3A 4X83A 2K78A 2IDFA 2WKLA 3MOBH 1RA5A 1TZHA 4YYFA 3LM3A 2VVSA 2P26A 2GSJA 3IVKB 1G4EA 3DUUB 4KQNA 3OKDB 2K8QA 4R8WH 4MNQA 4NDMB 1P7HL 4WLCA 1E65A 1ML1A 1T3FB 4P23B 2NXZC 2QJDA 5MP6L 4FL4C 1I7ZB 5JHDE 3IKKA 3FIGA 1NCDH 2YCEA 2ILLA 4OFIA 2I60H 3CFJA 3NSJA 1UC4A 4TOYL 1ID5I 1NL0H 4TLUA 2A38A 4LSQL 2BP3A 5FGCE 3TVMC 1VHCA 3LYRA 1ZS8A 4PMZA 2DL9A 3D7PA 3ARXA 4BFIB 3MRCA 5DTFA 4H0GA 3WJWA 4X9GA 4KXDA 1NAML 4PFMA 2ZDSA 1TU2A 5EOQH 1PLBA 3VILA 1TCRB 1MWAH 1U8LA 4HEME 3MKCA 3DFYA 1N10A 4OJEH 3UC0H 1TZIA 3BWAA 4DBDA 5C6WH 3EO1A 5LGHL 3NTCH 5F72S 1OAYL 1MHEA 4YXKH 4F7CA 3IU3B 3M7SA 5KSAD 1CL7I 1X7TA 4HIXL 4QNPE 1RFDL 4IBTA 3MSPA 2K0RA 4HWBH 4PMJA 3R1ZA 3EWYA 2VEIA 3TQVA 1EV2E 2ZOKA 4MZ2A 5CWSA 5EYWA 1L0YA 1S5HB 2IH3A 5E6RB 3U3HA 4HCIA 4ZUWB 4U1SA 4IICA 4NM8L 1QPPA 4QHNA 5BUAA 2HX7A 2KQNA 4NQDE 1PBYA 4P46D 1HVQA 2F9RA 4AYFA 43CAA 1CNVA 4DZHA 4HGXA 1HL2A 4DZ8A 3TWYA 2GFBA 5JW3H 5FGBA 5J1SC 5D9SB 2Z0IA 2YAHA 4MMXA 4F2TA 4G3YL 2A4EA 1HL4A 1Z3NA 3CV1A 3K3QA 4JY4A 3LJ3A 3URQA 3BDBA 1QJWA 6REQB 4WNQA 5GSVB 5JUEH 3DGCR 2XGIA 1N6UA 2NNRA 3HGRA 4KTYA 4HS3B 4FHKA 2AMGA 2OU4A 3A12A 5MHSD 1JPST 5DEZA 3H0TB 1NOFA 1FAIL 1VCGA 1GS7A 3L4UA 3FHAA 3P11H 2IAND 4QOKA 3QUZC 1KIRA 3HPSA 4UV4H 5JBFA 4OCYL 3QO1B 4XVOA 4NFBA 3QUZA 5GJMA 1OZTG 4NP4H 1CD1A 2FL5B 4N2CA 3W9DA 4M7ZC 3N2MA 4X8XA 3FN0L 5DC2A 4MMZC 4MNGB 3T9PA 4IBZA 5CN2A 1B0RB 5I1HL 5E4EC 4TTDD 2FZNA 3GFYA 3D46A 3MRQA 2G0KA 3MRGB 4ZTPL 3NZUA 5HYJD 1KQZA 2EJAA 3QHOA 3SFWA 4EN3C 1G4PA 4G80A 5ID0A 4B5TA 4NENA 2WXJA 1E27B 4IDLA 4NQCA 2WNZA 5BZAA 5J9PB 4EN3A 3FT3A 2YBRA 1OB1A 5CHNA 3PBUA 1R5WB 4K23H 4OZFA 5C0RH 1NTHA 4A4AA 3MNDA 3UU0A 1I1AC 1BXAA 1JL8A 3Q6FA 3CG8A 3DFOA 1JG9A 2QGYA 1M57B 3EX2A 3ULUF 2I1OA 3L21A 1FDYA 5IFAL 2H1LM 3WQVA 2NW3B 3IE4A 4FGMA 1F1GA 5J13B 4EUPA 3HJEA 2GEEA 2ZUQB 3QEQD 3H56A 1GVQA 4TS6A 3OG6B 1W3HA 2J7CA 2DWDA 4OE7A 3HMXA 5J0BA 3RLUA 1FNLA 3W6LA 1PKNA 5FF0A 3SD2A 1PS3A 3PZUA 1E9QB 4P46B 1KCVH 3O15A 1UXSB 2OJZL 3RURA 1N8ZB 4GXFA 1EEUA 1T6BX 2KERA 3IDGB 3OGSA 4PJIA 2AL2A 4GIAA 3D85A 3B2VL 3QV9A 4YX2L 4C58B 5KETA 4K71C 3GS7A 3TZFA 1WBJA 3VYLA 4OWGA 2J1YA 4I9TA 4S2BA 5DHYA 1WTLA 5EEVA 3CVHB 5B3JE 3G0XA 4L2YA 3MNWA 4GKOA 5EFIB 1VCBC 4DM1A 2E9LA 4MZYA 1I3UA 4P04A 3Q8FA 3B04A 2DUXA 1SF5A 1J7VR 1F07A 1CF1A 2VDML 4EDWH 3HC0B 2JBMA 2OR2A 5CLXA 2BOGX 3QHNA 5DDHB 4JTEA 4UINL 4OZ4B 3NCCB 4DVOA 5HHVH 2IANB 1B0IA 3MLZH 1SY6A 2ZCHH 4ISVA 4MD4A 3DVNA 1IM9D 1VACA 5ERWB 2E67A 2XFXB 1KGXA 3WLRA 4PUMA 3HV9A 5T5FA 4FXKB 4PJGE 3TN4A 1WS8A 2BHFA 3RB7A 2NYYD 1CD0A 4PWFA 3C5ZD 3FTUA 5F2MA 4L8CA 5JOEA 1RZMA 4Q2ZA 3MKGA 4J8QA 4EN2A 3WQ5A 4JFHE 1YA5A 3MLUH 1QFWM 4NNPH 4XVTL 3BW9A 3GMMB 2FNBA 1BLNB 4N0RA 4AXWA 4UTUA 4XP1H 5F2GA 1BVLA 3ETSA 7FABL 2XZQH 3O0KA 3UX9B 4ALAL 4B9GA 2PPEA 4NRZB 2DZBA 4AL8L 1GOWA 3LS5L 4QS5A 4POYA 4UQDA 1F6YA 3S48A 3BUQA 3GIPA 2AMXA 3KOXA 3WFHB 2YWYA 3W1PA 4AYEC 1A6PA 1XRTA 4PBWD 3G3MA 3QIWD 3T2LA 4YOKA 6A3HA 1Q6CA 4FTVE 1HIMH 2JCCE 3M07A 3L3OC 3V6OE 1GVSA 5AZ1A 3VRJA 1AAJA 1JZJA 2HS6A 3MNZB 1AKJD 4P0DA 2HT4D 2ZUVA 4BCYA 4O00A 4XAWL 3VFGL 3FQUB 4PW4A 3X1GA 3GKWH 3K80A 1HZHH 1IIIA 3EB3A 1JXGA 3R4RA 1TJHL 4G43A 3MZNA 4UT9A 3WQCA 5CQ1A 3WNPA 1N12A 3BSZL 3IAPA 1FL3B 1JCVA 3V4VB 2Y9RT 1H4PA 1OALA 3LY0A 3W71A 3SKOA 1D5ZB 4PJ6A 5EBMB 3ZKMC 5E5MA 5IVXF 2P9RA 3BZEA 1AFVH 4LVGA 3PY9A 1OD7A 4RMUA 3AZRA 3RUGB 1G1CA 2X0YA 4JN1H 1P4LA 4HSQA 2F61A 2EQDA 5I5RA 4OUUA 3LK6A 1UG9A 2Y7GA 4AFYA 2VXQH 1AFSA 4KO6A 2J5LC 1OC7A 5LNSA 5CJQH 4YHNB 4LVOC 2J6EA 3EFDL 4P57A 2H9GB 4GGHA 3NP4A 3WQ8A 3ZDXB 4UQCA 4XZ4A 1G69A 2VDQH 2GDQA 4B60A 3VXSE 3ILQD 3M7WA 1NDTA 4W9CC 2WVVB 4K1WA 1VIZA 2BP8A 4WI4A 3BWUC 3HAEG 3RNKA 4NQ1A 2DKMA 1A1NA 3TBSA 4DH2A 1A3LL 1L5GB 4YMZA 4NJ9H 3GMOA 3MUIA 3DX0A 3CUJA 5AOZA 1OGAE 3EJQA 1JCTA 2WLNA 3GLZA 4Q8UA 4LCYA 1JGUH 3WG7B 3C5ZB 2BDNH 2X53A 2XUCA 3QPXH 1U22A 3H42H 3W5MA 4JJOA 2PDWA 2Y0FA 4IZGA 4PCFA 4GLRI 2FMNA 4AM0B 3QZWG 1XHHA 5JA9A 4KO9A 1QK0A 3D69A 1NINA 3DK0A 5ICYB 2R8SH 2HJKA 2Y1HA 1J9SA 4F1ZA 1A6ZA 1T1XB 3W72A 4X80H 1N4XH 1QPNA 1DXEA 4QCIB 2AXFB 1OG0A 1AZCA 5IHZA 1KTKE 4IHCA 2OX5B 1E6JL 4J27A 1J9YA 3LDVA 4CILA 4E41A 3S5LA 3DMMA 3NYKA 3I7QA 3CZNA 1Q9WB 1SO4A 1JNNH 3BP6B 5J12B 4GBUA 1YAZA 2GT9A 4GKTA 1FL5B 2CGRH 2R0KL 5D7LD 1FZMA 1N3NA 3DGBA 1OAZL 5HY9B 2AVFA 4HPYL 5CD3A 3F01A 4W9TA 5HVHB 4DVBA 4Q7NA 4HUWA 4L1DA 3K4DA 4JGJA 4D9RE 4R96B 4GI4A 3IFLL 4OLUH 2X38A 3FX4A 3GTTA 5ITBH 3MV8D 4AJYV 3U46A 1AZBA 1MQQA 4YK4B 3IN2A 4EZKA 3UTSD 4LVNB 5D6DA 4IBVA 4S23A 4P5MA 4IIDA 1V0KA 5C1MB 3N3TA 1RK0A 4PG2C 3D52A 4AV5A 1TTBA 2GDUA 1G1KA 4PJ9C 4XBSA 4GO6B 4EXBA 5MEPB 1ZV9A 4L3AA 4X2RA 1FHGA 4AVIA 4JMXA 5ICZB 5SWUA 1A4JA 4UMAA 3PWNB 4OD1H 2VSMB 4JM4H 4M7TA 2J8FA 2FNWA 3ZJ7A 5K2ZA 1D5BB 4S0TD 3O2WH 5E1HB 1NUFA 4GQ0A 3HI6L 2CO2A 2BW5A 5DC4B 5GRZA 2EDBA 4AMXA 3CSBA 2C9PA 5JDSA 3H4GA 3VH8B 2OSYA 5IFJA 5BZDA 3FXIC 1GOQA 3A23A 3IPBA 1MHCB 4UTBA 1Z5HA 1S8DA 5JPMA 2YCJA 4H8PA 3MUZ1 4LQFL 1E9OB 1DJQA 4Z76A 4Z0SA 2Q6WB 3BW2A 3V5FA 3LNGA 5B3NA 5HAOA 3DFPA 1EJOH 1DE6A 5FOOA 4HPHA 4NAEB 4K94C 4JIRA 3WMLA 1OE3A 3CXDL 1CFTA 3FJLA 4WDIB 1CPUA 2ORBL 4WJG3 3A6BH 1OZUA 3EYOB 5FECA 2OEMA 4EF9A 4YR6A 4Y4KD 2O72A 4JAMA 1IBGH 1RUKL 3GSNH 3LLFA 3WEXB 4UYPA 4R7VA 2X0UA 3CN4A 1CEOA 3U6WA 2XX0A 5I74C 2NMSA 5I1DA 5F7WC 5JO5A 4XBPA 4YBHA 2D7OA 3ZE0E 2WWMD 2CA3A 2P7TB 5D5MB 5T5NF 3KPSE 2VYOA 2X6VA 4D0CA 3BO8A 3CO4A 4S1SL 1ETJA 1JWSA 3UG5A 5D7LB 3RO6A 4XO7A 1UWAA 2R1MA 2B08A 1UCBH 2HRHA 4RW5A 5IIEA 3V52L 3T6WA 3GSWB 4DO6A 3BE1L 2OT1A 1RK1B 4X63A 3ITVA 1F97A 2ZIDA 3MYPA 4RBPH 1YTDA 3ARBA 1WCBA 5G4NA 1YNLH 3DRQA 2ZCKH 4XN1A 3D0VA 3MV8B 4X6EB 1TUFA 3WD5H 1T1ZB 3FPXA 4MAUH 2V9DA 4XMPH 3UTSB 1ILSA 3L67A 3VYPA 8FABA 2IQ0A 5ECJE 4BKLB 2J5WA 2KH2B 4QSHA 1DO5A 1A1OB 4HU3A 1H3VA 1LJMA 1UHVA 3NQKA 2FIKB 1P7QB 2OZ0A 4L2LA 4QY8A 2AL1A 4YYCA 4X7SH 2Q10A 5FCUL 2GQ9A 4ZOCA 1UWUA 1IT0A 1ZLVH 3JU2A 3L3KB 5I3KA 2CBUA 4OIAA 1B30A 2FO4A 4Z77B 4DELA 3BVDB 4JEQA 4YHIB 4W9KC 3KE0A 4QCFA 1EYEA 1RJZA 3W7KA 4ZPVB 3CMGA 4JANB 2DS4A 3IEAA 4PP2A 1Q6QA 2HH0H 2YX0A 2WWCA 4AIOA 4KKQA 3PZQA 2TMDA 4O52A 2BSBA 3KCJA 3ZJ8A 1QUPA 5BRZD 3BEVA 4UANA 3GVVA 1GQLA 5KANI 4PTMA 3MJ6A 4J1UB 3KBJA 1M71B 2LE9A 4HLJA 2F6KA 2DIAA 1F8TL 1UPMB 2A9AA 4FZ8H 2HPIA 1W8NA 3VFTB 2XQBL 4PTXA 2I9LA 3CDZB 1IGMH 4Y4KB 1A0QH 2P5EA 2WXQA 3BZFA 1UP2A 1TYJA 2WBWB 4RFEB 3BSGA 2VM3A 3M0XA 2GG1A 4PLKC 1DJHA 1CDGA 4N8VA 3D39A 1YEJH 5C0CA 3P77B 1U91B 3EBIA 3HZVA 3E2QA 1GS6X 4JTHA 4I5BB 5BWAA 4PJHA 2A9NL 4PB0H 4JD4A 2DY3A 1GG1A 1RSFA 2PCEA 3KJ4C 2YRZA 2UXVA 4AD3A 2C7UA 2UWEF 3HMWH 1PKQB 1WHPA 1V8EA 2YBVA 1A8JH 2I7GA 5AKTA 1DLHA 3PZVA 4EDXB 1FWSA 2DM7A 1WD8A 2F7PA 2ICWB 3KDOA 1R17A 3TUUA 5F2LA 4FQIH 4PR5A 4G9PA 3PSVA 2MHAA 2ED7A 4K5PA 5XIMA 4J3OF 1RV6X 2CLEA 4DGYH 1E5AA 1BWWA 2P24A 5BCAA 1DQTA 2H6PA 5GS0L 3HE7C 3S96A 4AF0B 1OW0C 3FAWA 3ARQA 1SDDB 5AD0A 3HE7A 5I2IA 4PJ5A 1JDFA 5FFOA 1OTSD 2LTQC 2R2CA 5IOBA 25C8H 3P14A 4DVRH 2FVMA 3P40A 4NKDB 1RU9L 3BAIA 3FT2B 1BFOA 3QZMA 3HA0A 3MA7A 1PG7X 3C8KB 4P7QA 1LMKA 12E8L 1QO5A 2NZLA 4XZWA 2AEQL 4H8UA 4FQXB 5SWSA 5ADOL 3EWWA 1LRNA 3CL7A 3B03A 4MJIA 4YH6A 3HU7A 3WD2A 5B1BB 4RXFA 2N1TE 1JN6A 1V7NL 2A6DA 2GJXB 4Y89A 2QF8A 2WJDA 5DMIH 2KC0A 3S0PA 3N14A 1X5LA 2EVGA 4AWTA 4ABQA 1RUAH 4WI9A 1FZKA 2VAAB 3CLFL 2VEKA 4DGIH 2EG7A 4JYEA 5M7QA 4LLAA 3QZPA 1FBAA 3RMJA 4KO7A 3RO8A 2VRQA 4C83B 5T8IA 1S38A 5FLUA 1I7UB 4BWWA 2BODX 1K4CB 3T0CA 3DIFB 4JDEB 3V95A 2O4QA 2X1PA 2FD6L 5A2FA 4CC0A 4JY6A 1L2QA 2BC4A 4Z78A 2WIIA 2QCDB 2B1OA 4DSYA 2CLMA 5G4HC 1A53A 3EZJB 2KBGA 4ETQA 4U28A 2UXFA 2OK0H 2OLAA 4LOEA 4QXUL 5TDOB 3U30B 3T6CA 3N42F 5EMUA 1UM6L 4WU5B 1PWLA 4IUGA 4RPPA 1YQVL 2XGBA 5IVXA 1IAOB 1YUHA 3WIHA 1P69B 3TNNA 2GGGA 1WKDA 1XGEA 4JTKA 3H2EA 1UURA 3QXAB 5D1XD 5HNUA 4LE8A 3W23A 1U8PB 2IPGA 1GA2A 1VP5A 3ZTNH 1X39A 4W8BA 2A79A 1WDQA 4LVEA 4IMEA 4PREA 1QRNA 4FEIA 4HJGB 4Y1AE 4KX8A 2ADFH 2VISA 3U9UB 2YEZB 3QXUA 4H41A 1VHPA 1BGXH 1UUNA 5CSBA 4EQ3A 4OLZL 3EYQD 1CZ8L 4C65A 5DQJA 3T0EC 4FG0A 2ESVE 2B0MA 5CPNA 1UWXH 3OGVA 1DYSA 2ALRA 1R86A 3QI9B 4CC1A 1RZJH 2WWKT 5D04C 4ONFL 3OIHA 3GKAA 2J71A 1XCQB 1YW1A 2ENJA 1OEPA 2P0OA 4TUOA 1W9XA 2K6ZA 5EHFA 3M8OH 1THAA 5CGMA 1TPEA 4DJDD 1A49A 1HXMA 3JRKA 4KK5D 3FB8B 2A6KA 5C55A 3A0OA 4DZAA 4RZCB 3USBA 3T1FB 2EF9A 5AB9A 1ORSB 1AGCB 1BQKA 3RGBA 2QF7A 4I1PA 4U3SB 4OFPA 1TTGA 4GW5B 1LYQA 1DQWA 3F6LA 5TJWK 3VCRA 3FRPG 4BRVA 2PD9A 4OZIF 4JM2F 1CK0H 3HGOA 3KHDA 6ALDA 2YGNA 4CSZA 1BEUA 2YL5A 4Q3MA 5CEWA 2VRAA 4Y7MA 3W39A 1XL9A 2ODHA 5AOLA 1I8AA 5E6UB 4WEBH 5HQEA 2QCCA 4Z7UB 1K3IA 1FDLH 2NX5E 3FQWA 1XBXA 2B0SL 3SKMA 4BXSV 3MR9B 1B4LA 3E6FB 1RA0A 3HR5B 4JRWA 4PVNA 3UXIA 1AKPA 4JFOB 1DQQA 4JVUA 4E2OA 3UJ2A 4CKVX 1NGPH 3BH8A 4RFNB 1DJSA 3VFRA 5A94A 4N1EA 4XPBH 3AAZB 2MWCA 4HFUL 1BF8A 2WBJD 5D1XB 1NARA 1FH2A 3QDMB 3RWJA 4ZMYA 3Q0HA 2OMXA 2FBRA 4QO1B 2X6UA 2R23A 5GS2D 3VWJC 1GC1L 4OZGE 4PG9A 3KDNA 4P2QE 3VDHA 3L4CA 4LYKA 2BSRA 3Q2DA 1J5OL 7PTDA 4MQXC 5IEKB 3GC3A 4Y5XC 1UWGL 2J8UB 2TSAA 5DJZB 3HLKA 1HHHB 4OKVA 4JQ4A 2DPEA 2AMUA 4WJEA 5HUPA 4YXGA 1N7KA 2HX9A 4I90A 4JQXC 3GMQB 3NJLA 1MCPH 3R8BB 4LU5L 3ZT7A 3DKLA 4QI3A 3ILPA 2CXEA 1BWVA 1W16A 4CSPA 1MEIA 1BJ1J 3V7MA 4KHTL 3TX4A 3HO8A 4PGZA 2YKLH 2E7BA 3FKRA 4LASH 3SD5A 4N9DA 3BW4A 2X89A 3PXJA 2OMAA 4TSBL 4X9FA 1NIDA 2KKQA 4ZTOH 2AKRA 2IDCA 5HHQA 2QKIA 1Z7AA 3Q37A 2J24A 2YDAA 2C3VB 5DHXB 4NN6B 4FG6C 2B7PA 3ERPA 4IBWA 3OJMB 3VNJA 2D69A 1PG7L 5DRNA 1VZGA 4Y5YC 3VDAA 2X09A 1TVDA 3W7OA 1NWOA 3HAEB 1NFDB 1T20B 4JUSA 4R4ND 1GY1A 3VCLA 1E9PB 4QRUA 2Z0BA 3ZHDA 1KM5A 1CLOL 3V75A 3AXKA 1CGSL 1NLDH 1IGYB 3DHUA 3IDIB 3FSWA 5KSBE 4XPTH 1H09A 2Y7MA 4LVHB 4NNYB 1IVLA 1LO0L 4KX9A 3COTA 4Q22A 2IS7A 1X5GA 1SPDA 1FYTA 2GJZA 7A3HA 4ODWB 1NEZG 3LA4A 1WP6A 1UVQA 1IE5A 4NZTL 1VJZA 1S78C 2APWA 2OZ3A 2EXSA 3N91A 3TDFA 2UZYB 5EORH 5J56B 2WK2A 1CWVA 3QZWB 2CSPA 2VR4A 3BUTA 1IZCA 3IRCA 1ED3B 2ENPA 1WXYA 2TRHA 2W59A 5HDBF 3T0WA 3FB5B 2EZ0D 5C3TA 3POHA 3RWDA 3U2EA 4S3CA 5CGYD 1J9RA 1K6QH 3TN0C 3QQ4A 4HW6A 2WBJB 3B9AA 2JFEX 3MC0A 3AQXA 4FCAA 3IJLA 3CJJA 4F80A 1S9WB 1QSEA 1MF2L 5I07A 3MUAA 1PL9A 5AVVB 3UCQA 2C4FT 3U7BA 5CJXA 4G6FD 5FEWA 2QSQA 3FJNA 1DBJL 3GO1L 4KROB 5EFDA 1BFVH 5GS0D 1F41A 4K6AA 3SY0B 3ISYA 4E68A 3AT9A 5FX3A 2YPVL 2DN7A 2F8QA 1HJSA 3OGRA 4MKVA 3O2VH 4YSEA 3SW6A 4JK0D 1XISA 2VT0A 1ORQB 2OB3A 3O41A 2AQ1A 3ESVF 3W5NA 1K8IA 4K07A 3N1GC 2PLMA 3K72B 2E8YA 1IARB 1KM2A 3NPVA 4G5ZL 2RDUA 4JRXA 5I16B 2AXWA 3TBYB 1C08A 5A6KA 3GYEA 2F15A 5T1MB 4M7JL 2EAWA 1FXQA 1I1RA 4ICNA 4FX7A 3ZLQC 2IPKB 1MZHA 4M1CC 3K8MA 4OD2A 4AY0A 5DSCA 4GQZA 5EU7E 2LU4A 5CCGE 3C52A 3PP7A 3OP2A 2Q76A 1MCIA 4ABWA 5DUPH 4PJIF 3PG2A 3MFFA 4BV1A 2NY6B 3MMDA 1FQ9C 2OYKA 1WDWA 4LKCA 2WQSA 2AJZB 3AW5A 3O3BB 5EH1A 3QC6X 3MRFB 5J11B 4HUUA 2E9WA 1GIGL 4AY7A 1XGDA 3GNPA 3DBSA 2F74A 4BK4A 3CT2A 4YHOH 4ICCX 1S2CA 2UWEA 3OJ2C 3AQUA 2JLPA 3GHPA 1OCWL 4E9QA 5CS7A 4RFOH 5GS1A 4K15A 3WFBH 1JFQL 1UJPA 2L3BA 3E5PA 3W1TA 2EPHA 1FPTH 1M3IA 2AJSH 1E1FA 4O19A 3GJFB 4TLTA 3VU2A 1K70A 1MDTA 1LO5A 1U95A 4J3OC 5A8NA 4DEPC 1R47A 3O6FA 2ZUMA 3WJJC 4CQAA 4Y2LA 4GD0A 1KJ2A 1NKOA 4YAQB 3R1GH 2K8MA 2VUYA 2PURA 4RL3A 3X17A 3CMOH 2AEPH 2J44A 4W4OC 2XJLA 4X6DE 4IWWA 8PAZA 3BP4B 4X5LA 4G6FB 5DRXA 4NVTA 2NXIA 4ZFMA 2XH2A 3RM8A 1S9VA 3RLGA 3W88A 1EPFA 1A5KC 4PUBL 4XWGL 4I9XA 1U8QB 5AWNL 3CBRA 4UR8A 2A6JA 4HWEL 4BFJA 3MI2A 4QGYA 1FXPA 3WO3B 4H04A 4H26B 3KEHA 5DWPA 4LCCC 1SQ7A 1Y65A 5I6SA 3NFNA 4A04A 4LCCA 2WOYA 3QIBB 3CN1A 4ZE4A 2PC8A 2AGJH 3GI9H 2NNXA 1G7QA 5AVYB 5LQBL 2XTJE 1RMFH 1R6VA 2V5CA 1WV2A 4LV4A 5EU6D 4PJ7B 5CP7A 4F24A 1SSDA 5LXGH 1TIUA 3CVHH 4Y4FB 3CL8A 5D1ZD 1C12B 2RHEA 4JAWA 4PRIA 4ATLA 1UQZA 1C90A 2K4AA 2HISA 4AQEB 3EG9B 1L9RA 2CKRA 3UC2A 5FF3A 3VYOA 3MLTA 3S37X 4DKDC 3ITOA 5AY7A 4S1DD 3FMGH 4AJWA 3LKSB 5C0FA 2QDHA 5CJMA 5JUVA 2Y8VA 3GF8A 3W0WD 2X4OB<