1U30A

In situ extension as an approach for identifying novel alpha-amylase inhibitors, structure containing maltosyl-alpha (1,4)-d-gluconhydroximo-1,5-lactam
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title In Situ Extension as an Approach for Identifying Novel alpha-Amylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1u30A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1u30A01
2VQUA 3MANA 4ZXLA 3VMOA 3WL0A 3D51A 1E73M 3FXYA 1OWQA 1TCMA 3CZGA 4MB1A 3VGDA 1E6PA 3W28A 1H09A 4RE2A 4NZCA 4CD5A 1RPKA 1LL4A 2JALA 1JAEA 4E8CA 2YL5A 2IGTA 4PUDA 1KTCA 4X0NA 1JYNA 1CIUA 4GI6A 5FKYA 2PWEA 4ACYA 3ZMRA 4D6DA 3BCDA 1OBAA 2EADA 4AZCA 3WQ5A 2VZSA 1TA3A 3SUTA 3PZMA 1WAWA 4ACZB 1W3HA 2CIPA 4TOQA 4YN5A 1MW0A 1G0CA 2J8GA 1CLVA 2ZX9A 4MAVA 1JGIA 3BUPA 1JDDA 4MTVA 4JAWA 4K68A 2D73A 1XYZA 1U30A 4GIAA 4HU0A 2ESCA 3MS8A 4HZ8A 1FFRA 3LMYA 2WANA 4CVWA 3WMCA 1RH9A 2QMKA 1WZMA 2WLYA 4B3LA 1EOMA 3B9AA 3ARYA 6A3HA 2XVKA 4FLQA 1HJWA 1FP9A 2FE0A 4HZ7A 2VJXA 2CPUA 1PX4A 1XSIA 1HXJA 4HPHA 3MV01 2ZOXA 4JFWA 1HKMA 6TAAA 1DWAM 2V5CA 3WDHA 3CZNA 2QHAA 4PMXA 3FHAA 4P7NA 3PN8A 1BVZA 4GKLA 4ZXOA 1EO7A 4U5KA 1ITXA 2IXUA 4JFSA 4W8LA 3U5UA 3M07A 1UR0A 4CU6A 5D9PA 1LL7A 1TQVA 5A69A 1IT0A 4DWSA 7CGTA 2UY5A 1EQPA 5D8ZA 3UR7A 3ARQA 2DT2A 4FNUA 1GZJA 2Z1SA 5A6MA 3UETA 3W26A 4CCDA 2IXVA 2O9OA 2CXGA 3NIYA 5EMYA 4JKKA 3ZJKA 2XFFA 4HMEA 1EDQA 5D9NA 3WUFA 1CGWA 5TD4A 2FH8A 2Q8XA 4PMOA 4PMQA 3PZNA 1SYTA 2BNJA 1PIFA 3OLIA 2J7CA 2BY0A 1B3YA 4W8AA 1K6AA 1VAHA 3PZ9A 3MSDA 4EE9A 4D6IA 2E9LA 1YQ2A 2Y5EA 3IAPA 1GW1A 1FP8A 3BAKA 3U57A 3EDKA 4H2CA 3W37A 2E0PA 4EKJA 2W4XA 5JBDA 2EPKX 1XH2A 4BS0A 2FH6A 3DX4A 3QR3A 3LPGA 2VX5A 1C92A 3PZOA 3HN3A 1R75A 3KLLA 1KXQA 1LQ0A 2WXDM 2ZUWA 4DUWA 1LLOA 3POHA 2WBGA 2BHYA 1OM0A 4RL3A 2VCCA 4F9JA 1JF6A 2CKSA 1W2PA 5DO8A 1R87A 3GH4A 2Y8VA 4J3VA 4W87A 9CGTA 1V0LA 4W5ZA 4A3YA 1DWHM 2Z1KA 3K8KA 1BVNP 1DWFM 1JFXA 1OB0A 3F5LA 1XV8A 1UUQA 1GONA 1W3KA 3IGUA 3B8SA 1BQCA 1YHTA 4BA0A 3CHCA 3GNOA 2YA1A 2ZWZA 1QPKA 2XVPA 3KL0A 5AYBA 3SCVA 1B3ZA 4PUEA 2DEPA 3A23A 1V6UA 2DPEA 2BY3A 3AS3A 3IANA 4ACZA 2CBVA 4UQEA 1JZ2A 4QCFA 4OZOA 1QNRA 2YJQA 2ZUTA 5HOSA 3GH7A 5E6YA 3EMCA 5AC4A 1V6WA 3CLWA 3K4DA 4Z2KA 3THCA 2ZUSA 2PWDA 1H41A 4BZYA 1VEPA 3GXNA 3WD2A 2J78A 1SZNA 1BTCA 2ZIDA 1BF2A 4U31A 5JIPA 4HOXA 3AIEA 3KZSA 1KXTA 3TTSA 2EPOA 1HXKA 1ISXA 2W62A 2O9RA 4GZEA 3SUSA 1E6NA 5IFPA 3HU7A 2XFRA 4D6JA 1SFSA 1QVBA 1Z32X 4QLLA 2V38A 3IAQA 3WDJA 5A6KA 4W5UA 1KBBA 3ARRA 1LF1A 3TP4A 4MNJA 3MMWA 2UY2A 3RPMA 7TAAA 3WFZA 1UASA 3W38A 1XD0A 4PTVA 2WK2A 4GI9A 4AY1A 3W82A 4U3AA 3WD0A 1E40A 1J9YA 1UA3A 3VSVA 1VENA 2VZUA 1E6XM 4FNQA 1VFFA 3VGFA 3HJEA 2JEPA 1TFVA 2A3BA 3OB8A 4OIFA 3WDQA 3NSMA 4JKMA 2A3CA 1MW3A 5D8WA 3AXHA 1BGGA 3G6LA 1ZJAA 1KB3A 3UCQA 5EFFA 1KR1A 2CESA 4AYSA 1V08A 4DUVA 3CUFA 4ZE5A 3WBAA 1JZ8A 2GFTA 5A8MA 2ALWA 1GHSA 4NRSA 1L8NA 5CSUA 3WEZA 3DYOA 5CSYA 2ZXAA 5E1QA 4MB4A 1W1VA 3WKZA 1MQRA 3BLKA 3MI6A 2O92A 4J3WA 5M5DA 4U5IA 2XG9A 3GBDA 2X8RA 2WVUA 1PZ2A 2D20A 3BAJA 3UERA 2DT1A 2F7QA 1WKYA 4D1IA 3VKKA 3GTNA 3SCWA 4AD4A 3DYPA 1W91A 3WELA 1BYBA 5GNXA 3CZ8A 1ITCA 1V3HA 1XCXA 3WH5A 1JYXA 3H55A 1R7OA 1W1PA 1CXLA 2XVLA 4P8VA 3GXIA 4X9YA 2J4GA 1WPCA 2J74A 4Q22A 4B16A 2F2HA 1JNEA 4TXEA 5CPQA 3DX3A 2D0HA 2UY4A 3LPOA 5GNYA 4JFVA 5IDIA 4QDMA 2A3EA 1R34A 4NSBA 3L4TA 3VD3A 2F1BA 1UKQA 2C7FA 3VDAA 1WZKA 1SR0A 2PWHA 3D52A 4M24A 2EQDA 1V02E 1GJWA 1WDSA 5I6SA 2VVSA 3OA5A 5E0CA 4XUYA 1J18A 1OSEA 2J62A 3WNNA 4GINA 2VVNA 3NYDA 5FL0A 1PX3A 1BHGA 2WMHA 1XGZA 5LYRA 2OYKA 1C8XA 1OT2A 4M29A 4PTMA 2BFGA 3ZJ6A 4CD8A 5BRPA 1C7SA 3VIGA 3FAXA 3ZJ8A 4L4OA 5BROA 3T08A 3CPUA 2YDSA 2F18A 4ATWA 2PI6A 1JL8A 3AMCA 2CBJA 1V0MA 3UR8A 1DEDA 1EOKA 1E5JA 2WMGA 1OT1A 3AMLA 2YOCA 1OD8A 4PTXA 4LYPA 1ESWA 4URIA 1HN1A 1WZLA 3AFBA 2UWFA 4WKAA 3W4RA 1VJSA 4FNTA 2BHZA 4BQ2A 1DWGM 1E3ZA 4J7RA 1HF6A 1KQYA 1QNSA 4TVUA 2XSBA 1QWUA 4MB5A 2FGZA 4GI8A 1U33A 3N12A 3WMSA 3DDFA 3WN6A 1D7FA 5LA0A 2D22A 5E9AA 1TZ7A 1KFWA 3HG3A 3EMQA 5DT7A 1W9VA 1XSJA 4J3XA 3AS0A 4PYSA 3T2QA 2DSWA 1TVNA 2EJ1A 2JIEA 1K9FA 4AD2A 1KGXA 1E15A 1VB9A 1JYVA 1N82A 1EO5A 4QP0A 1PX8A 2WCSA 3ARSA 4W89A 1H4PA 2E3ZA 3N9KA 4OBRA 3NDYA 1ZB5A 2BY1A 1G01A 2VCAA 3ARVA 3M6DA 1PEZA 2J7GA 1FH8A 1BYAA 2ZXBA 3WQVA 3KL5A 1R8LA 3SUUA 3WUGA 1R86A 1H1NA 2F1AA 4HA4A 1W9UA 3MKKA 4AZ5A 3PZQA 4FLSA 5A6LA 1QOXA 2X0YA 3VO0A 4HOZA 2TAAA 1J01A 2J47A 2WKGA 3SUVA 1QNPA 3GXPA 2BV9A 3TV8A 2WCGA 2CKRA 3HG2A 2CBIA 1CLXA 4PEEA 2ZX7A 3ZR6A 3WIJA 1CPUA 1JZ3A 1XD1A 1W32A 3BGAA 1CGTA 3QHMA 2WWCA 4AD0A 1VIWA 1XH0A 4FNRA 3WQ4A 4WJXA 1GNXA 4UZSA 4PMYA 2WHMA 5CZKA 2QF8A 1QHZA 3BVVA 3N15A 1PJ9A 4J27A 3T0AA 1F4AA 1V3KA 4WKFA 1Q4NX 1UKOA 3WNOA 2EPNA 5C8BB 3WY3A 1UWRA 1UZ4A 2X1IA 1JD9A 3VIIA 3AICA 5BCAA 1ISZA 3ZR5A 3MO4A 4WK9A 4JCMA 2E8YA 2J77A 3AZSA 2FHFA 4QCEA 3GZAA 3W81A 2E9MA 1M01A 1OINA 2OSYA 1MXDA 1B31A 3A24A 4BQ5A 3MMUA 3HMCA 5CLWA 3GBEA 3IJ8A 1UR4A 2G3IA 2OWCA 1OD0A 4PCTA 3II1A 1M03A 5BXTA 1KBKA 3BAWA 2FGLA 2AAAA 2OWWA 1WDRA 4FLRA 2CBUA 4GQQA 3EYPA 2J79A 4XV0A 3A6OA 4OOZA 5DF0A 1JDCA 3VD7A 4V2XA 4DO6A 3A4WA 4XZWA 3WDIA 3QHNA 2GJPA 4AMCA 4KRUA 1J0ZA 3WH8A 3WY4A 3BAYA 2F8QA 3FN9A 1ECEA 3WF1A 3TOPA 2JEQA 1W9BM 3VM5A 3L2MA 2G41A 3OZPA 1KGUA 2VZVA 5A6SA 4WF7A 3DHUA 5A8OA 3BVUA 4UFLA 4TVDA 2A3HA 3A4XA 1NWTA 3ARZA 3OLEA 4QFUA 3WBEA 1WCGA 3CIVA 1Y7VA 1GORA 1UWUA 1UHVA 3PZUA 4PBGA 3VM7A 4L4PA 5AC5A 2WM0A 1VEMA 4DM1A 5A6JA 3AXIA 1UWQA 1W1YA 1WO2A 2ZUMA 3AYSA 4H41A 5A2AA 5DFAA 1AQMA 4GQRA 4HZ6A 1S46A 2C0HA 4PSRA 2WSKA 3WEOA 3A21A 1H11A 5ABFB 1JD7A 3GXFA 1MWOA 5GNZA 1CECA 2BVYA 5BXSA 2WMFA 2J7BA 1B9ZA 3W27A 3W25A 1K9DA 4P7QA 3PTKA 1DP0A 1PAMA 1TVPA 2YBUA 1EHAA 1NOWA 4JHOA 2D1ZA 2XM2A 1TG7A 1KXHA 4AEFA 1W3JA 3KEHA 1VBUA 3VIFA 3ZIZA 2DSZA 1H3GA 2PWFA 3B9EA 1VJZA 3BH4A 1QI2A 3WNMA 5C70A 1GOMA 1CNVA 3CHFA 1E70M 4BCEA 5DMYA 3NDZA 2V3DA 1KCKA 2C8NA 1W1TA 1WDPA 2EACA 3U5YA 5A6BD 1WNOA 2V5DA 2VI0A 5A8QA 2WAGA 3D4ZA 2WHKA 3VGBA 3PTMA 2CNCA 1HJVA 1HWWA 2XM1A 3PZGA 1VEOA 3SCRA 3HZ3A 2NT0A 3AS2A 2V3GA 2WZEA 1GOIA 3WD1A 4LYRA 3A3HA 3CHDA 3ZM8A 2OWXA 3KLKA 1KR0A 2XTKA 2HVMA 4W7UA 3VX1A 4PCSA 2WLZA 2BY2A 3T2OA 1E4LA 3SCSA 4Z2HA 4IISA 1VF8A 2W61A 2X2IA 4F79A 3ZSSA 1HVQA 2W66A 4B9YA 1ODUA 1QBAA 2D3NA 2Y24A 3OLGA 2Y4SA 2YFNA 5KZ6A 1JZ6A 3BMWA 2YL8A 2D24A 3EJPA 3D5HA 5ECUA 1JZ7A 3FHQA 2VTFA 1ISVA 5ABEA 3NUKA 4TTGA 3TTYA 4KWUA 1EXPA 4E2OA 2RGLA 2QV4A 4R27A 1LWJA 2YLAA 2J7HA 1BLIA 1OIFA 3VMNA 2J7EA 3ZOAA 1CWYA 1H5VA 3W6MA 1Q6CA 3EJTA 4P7OA 3A4AA 3VGHA 1UR2A 1H0IA 3WL1A 3LXCA 1M7XA 1A47A 1CEOA 4B9ZA 2E4TA 4GZIA 3IK2A 2XN2A 5E6ZA 3SURA 1X1NA 1UKSA 1EA9C 1W3LA 1E0XA 1KTBA 3BAIA 3CGTA 2DDXA 3I3BA 5JIWA 5IXEA 3VTRA 1FOBA 4UTFA 2NT1A 3LXBA 4UR9A 2OW6A 1PBGA 4GZJA 1JNDA 1E72M 3ZQ9A 3VUPA 1EIBA 4JCLA 3W53A 1E6ZA 4U2YA 3MMDA 5ABGA 3SIMA 5ABFA 4CVUA 2CHNA 3MUZ1 4HA3A 1XH1A 2WWDA 1NM9A 4N0RA 1PIGA 4AC1X 4AXNA 5I79A 4W84A 1TR1A 1UD2A 4DO4A 1R7AA 3BVTA 5KEZA 2D0FA 1EH9A 3N1AA 2EAEA 3LX9A 2OYLA 2VX4A 2ZX8A 3L4ZA 2YBTA 5IHSA 4CUCA 3ARXA 3T2PA 2WVSA 1E56A 3CO4A 4AZGA 4TTUA 3PHAA 1CYGA 3WDPP 2BXZA 4AYGA 2WB5A 3IJ9A 3K8LA 1E3XA 3DHPA 3WUEA 1HKJA 2EO7A 4OJYA 3G6MA 2WZIA 4C7GA 3WY1A 1E1EA 3WH7A 3WQWA 2WC7A 2W91A 3ECQA 1UZ1A 1I75A 4CD4A 5IFTA 3A47A 4B15A 4V28A 4C7FA 3OIHA 1Q6GA 1FH9A 3RO8A 1CXKA 1TQTA 1E4NA 5FCZA 4RE3A 4AIOA 4MNKA 2XN1A 3PZIA 1QX1A 5FL1A 1KQZA 1J0YA 1VFUA 3L2LA 2VUYA 4AWEA 4IM4A 4UFKA 3BUBA 1UWIA 2WMIB 4H8VA 5CJ5A 3NSXA 1TQWA 1K9TA 3D4YA 3EJUA 1NWSA 4W7VA 2EPMX 1QHOA 5A95A 1MXGA 1GQLA 3QOMA 5D4YA 4HMDA 4U2ZA 1HJUA 3RILA 3DYMA 1EGZA 2WC3A 1NOUA 3RJXA 1UD8A 1J0IA 2XJ7A 3EDJA 1FH7A 2GDVA 3WMBA 1MQQA 3HG4A 4HU8A 1BGAA 2F7RA 3DC0A 2E9BA 2E8ZA 2EPLX 4MJ4A 1MFUA 1AVAA 4S3KA 5CG0A 1HX0A 3THDA 5AYIA 3U7BA 4AEEA 3K46A 1JI2A 1H49A 4P7RA 5AY7A 3RM8A 2BS9A 1NWUA 4PMRA 3SEPA 3SCTA 4EAMA 3VIHA 2VO5A 2EEXA 2XWDA 1V6XA 1GOKA 1UWTA 3BXWA 2J7DA 3SUWA 2DSKA 3VIMA 4A3HA 1GVIA 3VDBA 1V6YA 1HVXA 2WVTA 2VMFA 1TQSA 3EMZA 1G94A 4A4AA 2JE8A 3ARUA 2GVYA 1VFMA 3T09A 3N13A 4M1RA 2FYVA 2RGMA 2J7FA 2XGBA 4PTWA 3BVXA 3GXMA 1GQIA 1QBBA 3L4XA 1NP2A 5HNNA 1HKKA 5BRQA 1SMAA 3WDRA 1E5NA 1E6SM 3BSHA 5EBAA 1X6NA 4AMXA 3AZRA 1DTUA 3CHEA 4JIEA 2ZXQA 3RM9A 1E43A 2DH2A 4M82A 4OOUA 4W8BA 3SCQA 1GOWA 4GPNA 4NXKA 2VURA 2QPSA 3BAXA 2ZX6A 2WSPA 2VR5A 3VIOA 3AMGA 4YHEA 4IPLA 3VSTA 2F61A 2XVGA 4W86A 3NJ3A 3AISA 4M80A 1HT6A 4MNMA 4AD5A 5CPTA 4D6CA 1PS3A 1EDTA 3W0KA 3GDBA 1C90A 1DWJM 4CU8A 3QOKA 5GPRA 3ARPA 3CZSA 3A5VA 1EQCA 3WD3A 2G4FA 3LPPA 3AIQA 3OGRA 3BCFA 2B31A 5HPCA 2X09A 1C91A 1J0HA 1US2A 2X05A 4JZ5A 2YA0A 1HP5A 5I77A 4NF7A 2WKLA 1M53A 2FHCA 1NWRA 3I3EA 4JFTA 2IUZA 5A2BA 1RP8A 2GDUA 2VOTA 4D1JA 3WD4A 1QI5A 1OCQA 1O7AA 1C8YA 1EDGA 2ZE0A 4PRWA 1LWHA 4CD6A 3FY1A 1J0KA 5I5RA 3VIKA 3CUGA 4U33A 5CGTA 2WMIA 3GM8A 1ZBCA 4DUXA 1B3XA 2YL6A 2FHBA 1KGWA 3ARWA 4DWSD 3N04A 3BSGA 4UZUA 4D6FA 1W2VA 1OGBA 3N11A 1MFVA 4AIUA 4ZFMA 3B9DA 1IV8A 3J7HA 3VOCA 3AIRA 1FHDA 1US3A 4EK7A 1MW1A 4BQ4A 1VFOA 2VZTA 4FK9A 4WIWA 1KWKA 1B1YA 1UYQA 1BFNA 1AMYA 2GUYA 5A1AA 3AHVA 4TVCA 1GQKA 4UQDA 2GK1B 2VRKA 3VILA 4ZENA 1XCWA 5CPSA 3D50A 4NZJA 3AROA 2VRJA 4AZHA 4EANA 1QW8A 5I3DA 5BXPA 2X2JA 2PBOA 1R46A 3M46A 3SCOA 3PTQA 3RMEA 1GPFA 1TQUA 5JBEA 3TTQA 1PPIA 4UOJA 3CZEA 3GXTA 4PMVA 3POCA 3K8MA 3GYCA 2DH3A 3N18A 3CZJA 3SCNA 2VQTA 1JXKA 2XIBA 2OSWA 4CGTA 1SMDA 3W29A 5C71A 1QI0A 4CD7A 3AOFA 1L0PA 5M03A 3ZT7A 1D2KA 4MADA 1UQYA 4IUGA 1W9XA 2VR4A 3CMGA 4OKDA 5HBFA 4P8UA 3VMPA 1C3FA 2AMGA 1U2YA 3EDEA 4M56A 5D9MA 4KGLA 3CBWA 4DWSC 1AQHA 1UG6A 2D3LA 5A8NA 1GVYA 4V27A 2VNCA 1M04A 2YDRA 5FOOA 4TX8A 4QAWA 3BLPX 2E40A 1I1XA 1ZBWA 3PZVA 4M81A 2CCRA 4MDOA 3ARTA 1WDQA 1OGSA 3CV5A 3EJRA 3APGA 1QI3A 3MV11 2QLYA 3OGVA 3BVWA 3A22A 1CENA 4DO5A 2MANA 2VZOA 3F5JA 1G5AA 2F7OA 1UR9A 4F66A 8A3HA 1TE1A 1LJYA 3UESA 2ZICA 4AW7A 1MYRA 3WNKA 2QMJA 1R47A 2JF6A 1T0OA 2OLHA 4UFIA 5FIPA 3OZOA 2PWGA 2XIIA 2F7PA 1CXFA 1BYCA 3CH9A 4R5EA 1QWNA 4FNPA 3K4AA 3VD5A 3CTTA 1EHNA 1V0KA 1H2JA 1J11A 1ISYA 1IZKA 3RDKA 1HJSA 5HDRA 1QNOA 4YPJA 3IJ7A 4N42A 2YKKA 1C93A 3BUDA 4AZBA 5CGMA 5IHRA 2W5FA 1UD4A 2V3FA 1UOKA 2Y8KA 1JFHA 2DGAA 4NZFA 4FLOA 1E9LA 1GJUA 3BC9A 3JUGA 1E71M 3RM4A 3BUQA 3HG5A 5CLTA 3MUAA 4XB3A 1HNYA 3K1DA 3WQ6A 1E0WA 1JAKA 2WMKA 4ML4A 2ZXDA 2X0HA 5F7UA 4U3CA 4LX4A 3DDGA 1DWIM 1X6LA 4BF7A 4J3SA 1HL8A 3AIUA 1XC6A 5DEZA 4HPGA 4DM2A 2CYGA 2DSVA 3LRLA 2GK1A 4KGJA 3EJSA 1IZJA 2D2OA 2VT0A 3UEQA 4Y7EA 4KRTA 4NX0A 3VNZA 3MUY1 5I23A 4QLKA 4HMCA 5LA2A 3PBGA 2G8ZA 4MPKA 2BXYA 4J28A 3WUBA 1MW2A 4H7VA 4FNSA 1Q6FA 3UG3A 2W67A 2VL4A 1V6VA 3DX0A 2DIJA 3E1F1 2W63A 1AQ0A 1V3IA 1RD6A 4J3TA 1MQPA 4CN6A 3D3AA 3KE0A 1QI4A 3MSGA 2V3EA 2CHOA 5DT5A 4ATLA 2WW5A 1CGXA 2XN0A 3FNDA 1C7TA 1B3VA 5GQBA 3TTOA 4CKQA 1HJXA 3RCNA 3WY2A 1TMQA 4HOWA 3WF2A 2PB1A 3WSUA 3H54A 3ZJ7A 1ZBVA 4H8HA 1LG2A 1CBGA 2YIHA 4WSJA 3GNRA 3M7SA 1JXJA 2GJRA 1FA2A 1OIMA 4MDPA 4D6EA 1CGUA 2JF7A 1UA7A 4XZBA 2XGIA 1ZL1A 1CDGA 3CZLA 1HKIA 4UQAA 1BSIA 5A94A 1ODZA 3AQUA 3AJ7A 3VDCA 3AZTA 3S6TA 4LPCA 1TUXA 1UD3A 3VPLA 4BQ3A 2BHUA 1BAGA 2VCBA 3UG4A 5EFDA 5HXMA 3VDHA 2NSXA 2CITA 3T0BA 4ZEPA 1VBRA 2XPKA 4CCEA 1UH3A 1NQ6A 1CTNA 1WP6A 1XYFA 4AISA 2CETA 1J10A 3AS1A 4JHZA 3VD4A 2PBGA 3EDFA 4AZIA 5ABHA 4PN2A 2X2YA 3AHXA 3WF4A 4UQCA 3VIJA 3AMDA 3ZSTA 2AOSA 2OSXA 3VX0A 3AHYA 3QGVA 4CN4A 1QHPA 4MB3A 4HP5A 1E4IA 4HTYA 2FDMA 1Q6EA 3WNPA 4IPNB 3EJQA 4GO8A 4LGXA 2G3MA 1RP9A 3CZKA 4YHGA 3S5YA 2EXOA 5A6BA 4Z2JA 3MU7A 4OBSA 1ZS2A 3QHOA 1V3MA 1KXVA 3VD9A 4ATDA 4JL2A 1E6QM 1NARA 1JZ4A 4PMDA 3AIWA 1CGYA 1LL6A 4X0VA 1NH6A 3W6LA 4D71A 3GH5A 4AIEA 1UH4A 4RE4A 5JBFA 4PMUA 3L4YA 2GSJA 1OGGA 3PZTA 1C8QA 2O9TA 1DHKA 2Y2WA 4TUFA 2WBKA 1I1WA 2YLLA 4AZ7A 4UFHA 4MJ2A 3ZT6A 1CZ1A 1B3WA 5HPOA 3ALFA 2YA2A 3I3DA 4W88A 3AMKA 1G9HA 3EBVA 3VINA 4GO9A 4PSPA 5A3HA 1UD6A 4OUEA 2WNWA 3CMJA 2A3AA 1JG9A 1E4MM 2J25A 2DT0A 2XFYA 2J8FA 5CXPA 1E6RA 1UD5A 1LG1A 2YDQA 1V0NA 2YL9A 5I0DA 2HISA 3WNLA 4P8WA 2WVVB 3RIKA 4WLCA 1XSKA 1V03A 5E70A 4FF5A 2VX6A 5BYWA 2G3NA 1WZAA 5M17A 3LRKA 4C7DA 2QPUA 3SCUA 4WKHA 2D23A 3DX1A 1UR1A 5CQ1A 3GXDA 3L4UA 3MUIA 1PZ3A 4QLJA 2W92A 2GJXB 1HTYA 4J3UA 4MNLA 4E4PA 1FFQA 1KWGA 4AMWA 3WH6A 5BWFA 5A6AA 3CC1A 2J75A 3AHTA 2BVDA 1ISWA 5D9OA 5BXRA 4PMZA 4D6HA 2JFEX 4AD3A 3UG5A 4LYQA 3VNYA 1UWSA 3LPFA 3FW6A 2ZUVA 4W7WA 4HA1A 3S5ZA 4P7LA 4F9DA 3KWXA 1W9DM 1ZJBA 1E1FA 4UCFA 3DECA 4FMVA 1J12A 4D72A 3BUIA 3L4VA 2DQXA 3AIBA 4UOZA 2WHLA 2XUCA 3FAWA 3NSNA 1KCLA 3WFLA 3OLDA 5LA1A 3BLBA 5EB8A 2PC8A 3EDDA 4WSKA 4P8XA 1JYWA 1HIZA 1QW9A 4UQ9A 4W93A 3TONA 4AZCB 4UNIA 4M8UA 1TA3B 4NXSA 3VVGA 1D3CA 3O6AA 3ALGA 2OW7A 1HL9A 1MVYA 5A8PA 2NW0A 1R33A 1GUVA 2BVTA 4OGZA 3O9NA 2DIEA 1ZU8A 4F8XA 2XSAA 2DT3A 1B0IA 3DX2A 4LXFA 3AYRA 1J0JA 1W9PA 4TX6A 1ZBKA 3CUIA 1V3JA 1FHLA 1V3LA 5I78A 3OG2A 3T0DA 2D0GA 4UFMA 4H04A 4Z2LA 1P6WA 7A3HA 4MAZA 2O9PA 1XHGA 1HP4A 2OYMA 1GOOA 4UFJA 3U7VA 4NRRA 1Q6DA 4CN1A 3VGGA 1JF5A 4Z2GA 2WC4A 4AD1A 1BPLB 4UOQA 3KL3A 3S2CA 5A2CA 5I2UA 3SCPA 2XHYA 3CUHA 2EABA 1JDAA 2UY3A 2XVNA 3OGSA 3VU2A 1NOFA 2VX7A 2PF0A 1H0GA 4E8DA 1O7DC 3AXXA 1JI1A 1UH2A 2YFOA 1K9EA 3CUJA 5M3WA 4D6GA 3O2LA 1WE5A 1XRVA 4UQBA 4AZ6A 2JIWA 3NCOA 1E55A 3AHZA 2VC9A 3OBAA 1B2YA 2WPGA 2WYSA 1GOQA 4DWSB 3TA9A 4JFUA 3L4WA 3WEMA 1BG4A 3RJYA 4Z2IA 5E0FA 1GCYA 2ZUUA 1GHRA 2CEQA 1QNQA 1GQJA 4KH2A 4ZE4A 1UR8A 4W85A 3WF3A 4NI3A 2ZWYA 6CGTA 3VIPA 2CERA 1CXIA 2WCAA 1CGVA 3WH9A 1JIBA 2XYLA 4KMQA 1BG9A 1G1YA 2WZHA 3ZO9A 8CGTA 4GXPA 1CXHA 1BYDA 3F5KA 3LXAA 2WVVA 5JUVA 1UQZA 3VGEA 5E09A 3WF0A 1R85A 1HJQA 4B3KA 4JL1A 1V02A 3H53A 5FD0A 1UKTA 4LQ1A 1B90A 2G3JA 3WENA 1E0VA 1WB0A 2WHJA 3WQ8A 2WMJA 1NP0A 4CU7A 2XWEA 4PMNA 3N17A 2GJXA 5I24A 2DSUA 1JZ5A 4Q7NA 2EBNA 1CXEA 4XX6A 3BMVA 4H8UA 1VRXA 3LRMA 1F4HA 4JKLA 3W24A 3GNPA 3AI0A 1O6IA 1UKPA 2VRQA 3F4VA 3ZT5A 2ZX5A 3VSUA 4S3JA 4CCCA 1A3HA 2ZUNA 3AIVA 1B30A 2X2HA
chains in the Genus database with same CATH superfamily
5J6GA 2VSKB 3B04A 2AABL 4HS3B 4C4KO 1AI1H 3FB6A 3EJZD 3F05A 1BDYA 1QFWL 1E65A 5I15L 3R8GA 1B4RA 2V9RA 4D6DA 4X5XB 4UF7C 3UCRA 1SDYA 2F84A 2JKEA 2FT8A 4MD0B 5MKGB 2FNWA 2I9TA 4C6MA 2D73A 1U30A 1NFIA 3V0FA 2E6YA 1FFRA 3DVNA 2BRRH 1NEYA 2DI8A 1RU9H 3TESA 3UQNA 1HJWA 5TK4A 2XZ9A 3GMOA 5JHLA 1S7TA 2XBDA 5ITFB 5AW7B 4MAYA 3NFSL 5T1DH 4JDVB 4NQEA 5GS0D 5G5DA 5FEBA 4BA8A 5F9OH 4CLMA 3ZDXE 4RRPA 5TK2A 2OMXB 3MA9H 5LIUX 4CNIA 1N0XH 1C5BL 5JVLA 2AJUH 3VCNA 4WFEE 4DGVL 3Q9PA 2Z0BA 3LIZA 2E9LA 4JFQB 4GAFB 3MKGA 3OJVC 3HPAA 3L2NA 4H2CA 2OK0L 4P9MH 3N3MA 3U9PH 1GTFA 2W65B 1MFDH 1G7QA 3IRPX 2WXDM 4PRID 4RX4D 3UTSB 4HC1A 4WCYL 4HSHA 5FYLD 4J6IA 4J8RA 4W87A 1UB3A 9CGTA 4HS6B 1IAMA 3OKOA 5IB5A 2JBMA 4Y9GA 1NPJA 5F8RC 2NX9A 3QVAA 4ZMPA 5EMKA 2LABA 4H9XA 3QXUA 2IPTL 4NRZA 4IOSD 1WBXA 3VQ1C 4RKAA 1M9WA 3A23A 4P5TA 1KYAA 5IQNA 3P30H 1ZIAA 4OZOA 2YJQA 3ELFA 5E24E 1V6WA 3BQUD 1TJPA 4BFFA 1VPOH 4MMZA 3D69B 3FO0L 2J78A 5EEXA 3S96A 4DZAA 2C4FT 3PGCB 3V7AG 2ZZ3A 1FBIL 1KPRA 5CR8A 2V38A 4MNGA 3CX2A 3GC2A 2R9RA 1LF1A 2CKBH 1CX9A 3FQRB 2YHGA 2X6CA 4LARL 2OP4H 2MNJB 3ZUCA 4HSAC 1XRSA 2ZA2A 1QKZH 3AWEA 1J9YA 2ATKB 4R9HA 1MFAH 1TFVA 2GGHA 1Q13A 3W1AA 4C4BA 1VF5C 3CX5K 2AVGA 1L7IL 3SJVA 2YCEA 5CF3A 2NY6B 3NL3A 1J48A 2ABBA 2GTZA 2GT9A 3DYOA 4AL8L 5H94B 1JMZA 1KYOJ 4JTEA 4FJZA 3GBNL 5FUZH 2DT1A 2AI0L 5AN7A 4UR7A 5ABAA 4OZGE 1A7OL 2X1OA 4QRFA 4K39A 1KKRA 3KVJA 4L6HA 2EDQA 3F7KA 5MHSD 1W1PA 3NFNB 2X1RA 2PRMA 1TR9A 5E6UB 2EYSA 4LY4A 5GJMA 2NV9A 2ZZUT 1RZIB 1KNOA 1O12A 1IXNA 3S2MA 4YO0B 2WWKO 5JZ7C 3BDKA 5GNYA 4A7UA 1RMFH 4HH8A 4N5ED 2X1TA 1OD9A 5C07B 1I9IL 4F37F 2ENJA 4FKEA 4LAKA 3FTSA 4JHAL 1QXLA 2LOEA 5FV2A 2R91A 4KVCL 4LHUD 1PS9A 4CBPA 3PXHA 3L7FA 1AKPA 7PCYA 1UG9A 2JB5L 2AXGA 2CZFA 5I1KH 2V2DA 1ED3B 3ILQD 1GHFL 2E7DA 1OZQA 2YDSA 2HPOA 5KUMA 3CQPA 3EB4A 1DUYA 1YMMB 2BZDA 2JJTA 5C0RH 3VXPB 4URIA 4X7DC 3A4JA 4JPKH 1TYEB 4S11A 4WKAA 1Q9KA 3EW3B 2CJUL 2XU9A 4ZMNA 3TM6A 5T9BG 3O0RL 4ZUTA 2D22A 4NYUA 1XGRB 1P84K 4DP5X 4F7CA 2A0LD 3HC4H 1K9FA 3DOPA 4G9PA 3UNTA 3ZDXF 5KVDH 4W89A 3FH5A 4XBEL 2EDNA 3S9IA 3P0YL 3C12A 1A4JB 1ZB5A 4V11A 3CH1A 3EKLA 1PEZA 5C0CB 1CI3M 3GVGA 5I1HH 1IKFL 2YUZA 4FHAA 4FFYH 4PJ8A 3WI9A 3T0TA 1W9UA 1GKOA 5LHDA 1BVLB 4HOZA 3PSVA 3VA6A 1HU8A 5HD8D 4HK3J 2VR9A 5DUPL 1CPUA 3IDIB 1J5OL 3SBFA 3RPKA 1VIWA 2PW2A 2VDHA 4A29A 3WQ4A 2D4DA 4ADSA 4MQ7B 1XUZA 5J12C 4XCEB 1LK2A 5HDBE 3CDZB 3T0EB 4BDVA 2E28A 1H3WM 3TBTB 3ZR5A 4JCMA 3R8BB 1GEHA 2BB0A 4NKCA 4RISL 2Y61A 3HUJB 3GZAA 2QKIB 2OSYA 1UB6B 3A24A 3JVGC 1M7IB 4Y6GA 3FXIC 3WS6C 4M19A 1YEJH 3GTIA 4X61A 3RX3A 1SLXA 2XWTB 4AU0A 4QXIA 3GG1A 5I3KA 1MOEA 3ARGC 1OAZL 1IIIA 4LV9A 4HHGA 1YEDB 4OD1L 1XIJA 3LGGA 1AGDA 1QMLA 1I2RA 2GJPA 1J0ZA 1I85C 1PJWA 2NY5L 3EOAA 3BAYA 4BK4A 1KGCE 1AE6L 4GOAA 4FERA 5EWIH 1T0PB 2N56A 1S8DA 2ZXWB 1DN2A 1FHGA 5DK2B 1FGVL 3ARDB 1FWCC 1Y7VA 3OL2A 15C8L 3STBA 1XB8A 3UTZB 3PBUA 2FO4B 3UJRA 3EO0A 3E6FA 4OZHB 1O75A 1S46A 2H1LM 1HIML 4N1CA 5ABFB 1T7YA 2P42B 4JY6B 2WMFA 2PTXA 1TV5A 1TUPA 2LLLA 3T6XA 2ERJC 3MLWL 1MSPA 3CT7A 5A8GA 2B9BA 3C0QA 2PWFA 3WNMA 3FK4A 1GYMA 3FJLA 2ZT9C 1CNVA 4GRMB 1ZTXE 2QVKA 4OZGF 3QZNA 5HGDA 2WAGA 3IRCA 3FFCD 3D4ZA 4FNLH 2EUWA 3PRZA 2DYPA 2F15A 3DX9B 4HEPA 2OGJA 1Q2RA 4E3TA 3LH8A 1DVQA 5MI0C 2NQZA 1HQ4B 5EOTA 3VX1A 3BLEA 3DHJA 2BOFX 4QRTB 5I6XB 4MVBD 4V1DE 4WTZG 4FXSA 3BKJL 5FYKE 4LLQB 4AIZA 1A5CA 3NJNA 3HZYA 5J1AB 5XINA 3MR9B 4KWUA 5C0GB 1SEQL 1QZNA 2VDRH 4NERA 2RJMA 3EH3B 2QV4A 4BXVA 3XINA 5ACMA 4N8CL 2ZAGA 3KVKA 3ZOAA 3STZA 1ADQA 1R6VA 1A9EA 3EWCA 5FM8A 3RYSA 2CZEA 2VMJA 4L9LB 2E4TA 3PXJA 1A4KB 5DK0A 2DZAA 4BGLA 2XH0A 4F2TA 1CT8A 4PP2A 5CZVH 1BEUA 4O1DA 1GGCL 3M8OL 1MRQA 3QZWG 2OOFA 5IJKC 2ZJSH 2H32B 3ML8A 3SIMA 5FDWA 3CVCA 4GYPC 4ZFCA 3LCHA 3HR6A 2A6NA 5I1GL 5J1TC 4EKXA 1GYCA 5AVYB 4UNUA 1W72H 5F1OB 3A4DA 4L29B 2GJ6D 2E67A 3FKUS 4TTUA 4YSEA 4HTBA 5DS8B 1R3RA 3O45B 2FL5A 3N6JA 3APFA 2OV0A 1KLGA 3SDYL 3HPJA 3K6FA 3KPRB 3BGMA 4UQ3B 3PZIA 4W9ZA 4QF1B 1TPEA 4CEXC 1QVOA 3BV7A 3MUGB 2BODX 2GPTA 2ZCHH 2H9AA 1LYQA 3MBDA 3QC3A 2GIYA 4TKWA 4JO2H 1M2OA 1GQLA 5HDBF 3VG9B 2VC6A 3RUGE 4L9YA 3R06B 1R3HA 1FYTA 5GGUB 2NY1B 3RA7L 1QO5A 3RHWF 2ARJQ 1NSNH 5E4EC 2GDVA 4PJ7B 3T3ME 2C3WA 4KK5C 4LS0A 2QCHA 3SQBA 3Q48A 2V5KA 2PLJA 3BH8B 5E8EA 1NWUA 1AH3A 3MLPA 3VIHA 2QDHA 4G7EA 4D3CH 1SZFA 4GXVL 1I7RB 3PP4L 2BOCA 2Q9OA 43C9B 4P2YA 1HE7A 4R9XA 3FB7B 4G8AC 1GQIA 1JGMA 3BP5B 3IIOA 2XQYA 5GRVL 1OFOA 2CNZA 4HEMA 3BLDA 1X6NA 2YPVH 2BWDA 3MXVH 1TWWA 2GVEA 3BZEA 4NYLB 1XR2A 1YADA 3O2DA 1FWNA 3QKZA 4QE4A 5ICUA 1GW9A 1XDTT 2IAMD 5D1XC 3MRNA 2DQJH 1SM9A 4LF3A 3NCYP 2CO7B 4GJJA 1ITBB 7ENLA 3CVIL 4DN3L 5GPRA 4H00A 4NM8L 2Y89A 1EQCA 1DE4A 3TWAA 2CCVA 5C0AD 3OA3A 2VLRD 1TT6A 3GJFK 2AABH 4UWQB 4Q8QA 2AZAA 3LQGA 5CEZL 4D8LA 5A2BA 5I15H 4PJAA 5I8EA 2BX7A 1O7AA 3Q5TA 5ILTH 2N7AA 3CWGA 4NENB 3TBSB 2FHBA 2E6QA 5C9WA 2G4JA 5ANHA 4P2RB 3ILPA 4PV9B 4N6FA 1FJ1B 3ME0A 2VFGA 4I18B 3IU3B 5HSFA 1BAWA 2VZTA 1AUSL 4TSCH 2VRKA 3MYZA 3NVTA 3QMTA 1Z9MA 4IOFD 4WZHA 4HVBA 5K9XA 1S2TA 1NCWL 1XGTA 5I28A 4BQ9A 4OHQA 3SCOA 3CV2A 1TQUA 2V2CA 3SDAC 3KWVA 1ZLVH 3GYCA 3N18A 4LOVA 2I24N 3GU9A 3CLEL 4XZUB 3GFYA 3W29A 4NQVB 4J3OC 3S5LB 4JIPA 1WZ1L 4QD2E 5B1JA 2X4OA 2Y25A 3GKWL 5EB9A 3CMGA 1C5BH 3BFWA 3N1MC 1W1IE 4J4PA 4DGVH 4KQ3L 2R27A 2DN7A 3G5ZB 5L2JA 1F5WA 5A8NA 3X1FA 3NBNA 2ZSWA 3ZZSA 2OK0H 4F7MA 1YECH 4PREA 5ALCL 1B4LA 2AKRA 3VFWA 3FU5A 5D4QA 4Y4KC 3A22A 1D5RA 3FT3B 1S7XB 2R6OA 1EJFA 2E7LA 4NO5A 3UZEA 2GK0B 3DDMA 3QGKC 4YU1A 1K4DA 5C2CA 1HUVA 2IKJA 1R47A 4TQEL 3BPNB 3EBHA 4EBQL 6REQB 1BYCA 5KSVA 5HI4D 4MKNA 5CBAB 2IPTH 3MRPB 2WZ0A 3SDDB 2YKKA 1C93A 3CS2A 5D1QD 1UOKA 3R7RA 1LLWA 1WAPA 4FLOA 3LZ5A 1JHKL 4AQ1B 1DQXA 4DUOA 4GJIA 3LKQA 4B3ZA 4WHYG 1PQZB 2IBGA 3KTSA 4U3CA 2MRYA 3FO0H 5ID0B 1HL8A 5DEZA 4JQ3A 2OZNA 2FX8L 5E51A 2CYGA 4LVDA 4DM2A 3LRLA 4DJDC 3JZ7A 3HN8A 4MLJA 4YX2L 1FBIH 3RUGF 4YGVA 3G6JE 4HMCA 2X4QA 5IHZB 3CHSA 4XB7A 1QSFE 4H8QA 4F3HA 2O6FA 1IKNA 1KIRA 1RD6A 4OZ4B 3NTCH 4LARH 3FCUB 3HE7A 4X7EC 4QG8A 1IU1A 3ABZA 3ETBJ 2ICSA 4XO4A 4WVRA 4Z7VF 1Q5MA 1A5MC 3A12A 3FNDA 5I71B 2A83A 3QXAA 1KENL 2YSWA 3GT6A 3S37L 1L7IH 1UQSB 4NN5C 5FGRA 4M5ZL 1AC6A 2GJRA 4NPKA 4AL8H 2XN9B 5G4EA 3M17B 1W5QA 2ZXGA 2DPKA 1HQRA 1MG2C 2WJFA 1UIPA 2PP1A 3LV6A 4ZXBA 3DIPA 5FO8A 3GBNH 2C9VA 5HXMA 4QRSA 4E9LA 5D93C 3ZKXC 3JQOB 1NQ6A 1QDSA 3KAOA 1WGOA 3N14A 1TO4A 4N90D 1J10A 1YEYA 2VO8A 1OB1A 3RWGA 1BZDA 2O5XH 3VX0A 1HILA 4Q4PA 2KHAA 1EEPA 5JORA 5ESQA 2BGQA 4PG9B 4U1GB 2QUVA 3ESMA 1L7TH 1KTLB 2G3MA 1X1OA 5IFHH 2YUXA 1BYNA 1V3MA 1F61A 4JL2A 3Q6GL 2VEGA 3M0LA 4KVCH 1KG0A 5K9OB 3RU8X 4EN3D 1W6WA 5DEJA 4PJBB 2WBKA 4XCFL 3KCPB 3B7SA 4FS9A 1YEGL 1Z5LB 1GHFH 4KUZL 1BMWA 3NAAL 2OJEB 3KPTA 3FTXA 1CE1H 3KP0A 1D5MA 1TLKA 1R4XA 1H5BB 3OAZK 2VKXA 1JVLA 2VEFA 1HZHL 3CUZA 5ID1A 2HTLC 2D23A 3ZE1E 3O0RH 3ULVE 3T4WA 3RL1A 3WLBA 3L4UA 4N0UE 1M65A 4JTRA 4OM0H 2ODHA 5EFIB 5AC7A 3QTGA 3X1BA 4HPJA 1GOXA 5HANA 3MRKA 2YEVB 3RX5A 2G4EA 3HFFA 1E1FA 3RRXA 3DECA 4FMVA 3RVXD 4KCTA 3CDCA 4TMPA 5C0IB 4RK8A 3M6YA 4L8SB 4L18A 3LG3A 1EAPA 1O6SA 3EH2A 1IKFH 3MROA 3EBAA 5EOCL 2DJXA 4X2PA 4P8XA 3QORC 3TONA 3G1FA 5BS0B 4AV4A 4PJ9D 2IV8A 5DUPH 1QEWA 1QAWA 1CUOA 4F3FB 4BY3A 3TYCA 2FJGA 2DT3A 3IWPA 4O2FB 2PCPA 3DKJA 2UBPC 4W9IC 4Z2LA 1W17A 4P5KA 1K8DA 2J88A 6TIMA 1J05B 1JWMB 4MM1A 5CJBA 1UGKA 1Y07A 5A2CA 4J1UB 4JEJA 1BRLB 1S9VA 4OZGA 3IAGC 3N6YA 3H4XA 1UPPA 2OL3L 4RISH 3C09C 3CUJA 3X13A 2ED7A 1M6JA 3AC0A 4B2DD 3QK0A 1B2YA 2AP2A 4DWSB 4QTGA 1ETB1 4XN2A 3HG0A 1OAZH 4Z2IA 2AQWA 3BUYA 4ZE4A 5I03A 4KZCA 3EPOA 3P9MB 4OD1H 3WH9A 1G6RL 2DQEL 4FYQA 3HFTA 1I1AA 4FQXD 4FALA 3KS0J 1CXHA 3F5KA 2VLJA 2EXWC 4RMRA 3V4LA 1POKA 1VH7A 2GSIB 4JFFB 3NZ8A 3W1RA 4W9DC 3JTSA 1U8OA 4CU7A 2D2HA 1I9JL 4GIEA 1FGVH 4R4FL 1AOZA 1DN0B 1JZ5A 3PL6B 3WLSA 4EVZA 7ODCA 15C8H 3AABA 3F58L 1O6IA 4CEUC 3W9DA 8PAZA 3NOYA 2JXMA 1NCDL 3E6HB 4ODWB 4GKZA 1C16A 1QWKA 4G1MA 3EZ8A 3AIVA 5T3XL 2VQUA 3GBLA 2WJ5A 1HIMH 2UYLA 4A7VA 3K71B 1IIHA 3WLJA 3LKNA 3OC5A 2P0IA 6FABL 3CXHJ 1TLMA 1OP4A 4HJFA 5E4OA 1KY6A 5KN5A 4N02A 2X1WL 1B88A 3G08B 5ITBL 4ZAKB 4JANB 1A7BA 1T22B 3MS8A 2JGQA 3WMCA 2Y5QA 3SE4C 4S1FA 2K8MA 1JCTA 5DCBA 3VXME 3QUMH 2R8SH 1A7RL 3Q8AA 1TPUA 2V5CA 1MHCB 4JFEB 2IDQA 5DYOA 3MP4A 3V4PH 1K2DA 4FFZL 2WXIA 5LBGA 2ZYRA 1MI5D 4UIKH 2AXJA 1P5VA 1P2CB 1AZVA 3QZEA 4PGCB 4LPUA 4MWAD 5TD4A 1P0BA 1SEQH 1PIFA 1B3YA 2DV0A 3PZ9A 3QIWB 4FRWA 4PGDB 1CCZA 1AZBA 2BIOA 4Z0XB 1PCWA 3HPZA 4OFDA 4RDQF 1A6PA 1QHQA 3ILDA 3SGUA 2RDUA 1C92A 2BRRL 5E9DE 1A7PH 4PGEA 1VFLA 5D09A 4NLAA 4RXFA 5KZMA 1AG6A 4NB7A 1GGCH 3ZE1F 3ULVF 1W2PA 2DS4A 2C4XA 4YLQT 3IPFA 3WQDA 3RX8A 5LZLA 3TVMD 4W5ZA 3V0UA 4PW9A 5I1GH 5F9OL 1TSIA 1YHTA 1LBLA 3DI2B 3FTGB 3E2HC 2Q01A 1IL1B 5KUKA 1QNIA 4MQXD 3MA9L 1P0DA 2CQVA 4MCNA 4HUMB 2AJUL 4KWSA 3SY0A 3EMCA 5C2BL 3GUTB 3HKFA 3TXAA 1WWWX 1W54A 2BC4B 2DZXA 4LCWA 4J5VA 2HFEA 1T1YA 4JREB 1W2KT 4P9ML 6PCYA 1Z0NA 4N6QA 3RWHA 5C9KA 1L6ZA 3MODH 4Q4QA 1MFDL 3SIKA 3NRQA 1EPXA 3ZHNA 3RPMA 3UZYA 3NP4A 4IJ3B 4IQHA 4K3HA 2XOTA 3QZLA 2R9HC 3NACH 5C7ZA 3TIDB 3VSVA 1IQDA 4CQ9A 4G1NA 4NZDA 4RJEA 4JRWA 5E9XA 3MCLH 3GG7A 2CESA 1SXBA 3S2JA 2PR4H 4F8PA 1OV8A 4YIWA 4APQC 3BJSA 1U0QA 3V18A 1U21A 4UYPA 4UUIA 3NP3A 3SPGA 3NJMA 3PP4H 1EA0A 4HDIA 1USZA 2P76A 3QUKA 5EDXA 1FNEA 3FU8A 1UT9A 4V1DA 3P74A 3HMXA 3GBDA 1I6NA 1PZ2A 3BAJA 1WKYA 4PRTA 3KPQA 2J13A 3QAZC 3D0VB 3G77A 2PCYA 3M0JA 1JV2A 1SQ7A 2VLKA 3WH5A 5HYSB 3HF3A 4I5BA 3CHPA 5DJAA 4X9YA 1D2OA 2W59A 3UJEA 2CKBL 2XV3A 3WN5C 3U4BL 3E12A 2NX5D 3AREA 5I1LA 1A66A 3B8TA 3B8WA 1MFAL 3U1SH 5CP7B 4JFVA 3CVIH 4YQXL 4NSBA 3L4TA 4NM8H 1ZV2A 3O63A 3VDAA 4IBYA 5IVXF 1GJWA 3AUWB 1Z9AA 1EJWC 2EXTA 3GDCA 4JW3A 5CEZH 2QV5A 3SDXB 5D2LE 3APMA 4C6BA 4HUUA 3QYCA 1OCOB 4IRSB 1KGYE 1HSBB 1MDLA 5BROA 4W70A 1O1ZA 5FUZL 1II4E 5GHWH 1OD8A 4LC8A 3D48R 1TTQA 3GG0A 3MB9A 2ICEA 5HGBA 1QPOA 5AENA 1YC8A 2VE6A 3TJLA 1MWAA 1HF6A 2A74C 2OBGA 3SQMA 2BNQE 3PV7A 2ADIA 3AQYA 4GI8A 4IOIB 2BGSA 2VMEA 5D30A 1QK0A 5FYJE 3QIUA 4L4VB 4UTAA 1KTJA 1WXJA 1XXXA 5DD6A 2NZLA 3UP6A 3EKGA 1TVNA 4JIHA 1E30A 2HJLB 1VB9A 4N5EC 1RMFL 3MBWA 1JBJA 1H4PA 1BZ9B 1XAUA 5CBIA 5DMLA 2CNYA 4XOEA 2KPNA 4Y16D 1CICB 1NBYA 4PB0H 3RTLA 3GKWH 3RWIB 1AL8A 3ILQC 5I1KL 4YYFA 5TNVA 1HE8A 3L5XL 4GQZA 3E2QA 1LILA 3NFUA 1XD1A 2WWCA 2Y9RT 3MV7B 1VQTA 1XGYH 1GNXA 3LB6C 1V4YA 2W07B 4JPKL 3C61A 1F3RB 5ALCH 1QHZA 2EP6A 3QUYB 2VITB 1AS7A 5G2WA 4WKFA 1Q4NX 1UKOA 1L3WA 3WNOA 4AV0A 4NAEB 4CILA 2A0LC 2ZQKA 4UM9A 5C08E 3RRAA 4IP7A 3AICA 1FO0A 1Y0EA 2CBQA 1W0VB 4C59B 3AAZA 3HC4L 3FUJA 1FY6A 2PDLA 3NGBB 3FFOA 2M2DA 1X5MA 1H3XA 1MCNA 4JG9A 5B7ZA 2WGNB 4A2RA 4FFWC 3BAWA 3QY8A 2QGDA 1GZQB 4JM4H 3FRUA 3VNLA 5IK3B 3OPUA 2Y5JA 4KXZH 4AQEB 2Y7FA 1JHKH 3O4OB 4WFHE 4E9RA 3TV3H 3T1FB 3HO8A 3QTPA 1A5SA 1BQUA 3VXRE 4S1QL 1UBPC 4M4PA 3WS3A 1Z89A 2G41A 4H25B 4AWUA 2A3HA 2HMCA 4KNQA 1CO1A 4YX2H 4LUTB 4HSNA 4PCPA 1UWQA 4GY7A 4A3QA 5FCUH 3LEPA 1RR2A 1UJ3A 3OGOE 1RIVH 3KCOA 3T0XA 1B9ZA 2VWTA 1DANT 3NXFA 1YEJL 5I8CB 1OGAD 1GT8A 4MZ3A 3CL7A 1LVEA 4KBPA 4KBXA 3B9EA 3NFPB 3BH4A 5JPMB 3I68A 3MMEB 5JDSA 4Y1AA 1WDPA 4P46C 1X4XA 3TA3D 1JQVA 5DS1A 2PPAA 2P5EE 3PZGA 3NABH 5IWLC 1IGYB 3NIGB 4GUFA 3F04A 1ECQA 5CWSA 3J2PA 4X63A 2ISFA 4EXAA 4NKDA 1FWEC 2ITDB 4HCRH 2OULB 3C2AL 3RGVB 2W61A 5LNRA 2CLRA 4IGNA 3IE4A 4ORMA 1EEYB 1PF3A 1YYLH 4MQSB 1TVLA 2OMZA 4AQZA 2DYSB 5DZ9A 5ABEA 3D9AH 3TTYA 1A6VH 3OR6B 5D2LF 3ZYZA 2BZ7A 4LAJH 2W9MA 3GR4A 1OIFA 3XISA 5E8PA 1CWYA 1VYSX 2OMVA 3BGGA 3MJ7B 5J3HD 5AZ2L 4PY8J 3CFMA 3JZEA 1EXUA 3K4ZA 1A7NH 4OZFA 2W60A 1I4NA 2Y6SC 3QRGL 3DFPA 1YEGH 5DHVB 1JJUA 3WD5H 4FNLL 5JIWA 2FQGA 5T91A 2C7UB 3IGKA 4QRPD 5AW6B 3QEUB 3D2TA 5AHFA 4IICA 5H8MA 1MELA 1KF9B 1XTMA 4F0SA 2HE8A 4G7FA 5SWSE 1MN4A 2ZG2A 2IQ9H 1HJBC 1KC5H 3UP1A 4CVXA 2WMPA 1X7QA 4W84A 5IKCB 5A40E 2WY3B 4QKTA 1XAKA 2CDGB 3TU6A 3G6JA 5BV7L 1TV8A 4ENEC 3IDGA 4WKXA 3PHAA 1I0BA 3P7YA 4BK9A 2VDRL 3CHOA 1QSFA 2DLTA 4WENB 4XMLH 4MBOA 4FYTA 1JMXA 4KCWA 5EF2A 3IFOA 3EFFA 5LNSA 5MEND 4F8OA 1EEZA 3ZJAA 2WXMA 3TJ4A 5FL1A 4R53A 1JV5A 4ZQNA 2VUYA 4P4KB 1R5VB 3LTSA 3QFJD 1T4KB 4DNMA 4D2NA 4IQEA 1H8OA 4LB3A 3D07A 1QHOA 4X8JB 2AL2B 1J5HA 4HMDA 1HJUA 3U30B 2X42A 1MHEA 4IJBA 3FSTA 4OCYL 1ME9A 3HG4A 1QRNE 1SFHA 1JHTA 2MNWA 2XA3A 1MFUA 4JDZA 2EC8A 3MC0A 1YYMH 3V7AE 4XCYB 4YS1A 1W72L 4JQIA 4L1TA 4UINL 1H49A 3B97A 2OL3H 4BSVA 4PMRA 5IBUB 1DQMH 4H6EA 4LDCA 1XIDA 2E5EA 4AH2A 4LKCB 1OM3L 4GUCA 4P2QD 4A3HA 3ATEA 1G94A 4ZO9A 3B9KB 1T89C 3N13A 3ZW3A 4JYFA 2QCCA 4M1RA 2RGMA 4IU3B 2Z34A 3PHOB 3GXMA 4K5MA 1NGPL 3O6FA 2DQEH 1QPNA 3CN1A 2ZCHL 2ZXQA 3FUEA 4QGYA 2OMUA 2W95A 1UFUA 2XZQH 3IXAA 5L88L 4OV4A 1I9JH 1ESOA 1F5ZA 1UVQB 4A05A 2XVGA 4J40A 5CKAA 2WQUA 1CU4L 3FQTA 1NSNL 3F58H 1NUNB 3F4CA 2ZP0T 1TZHB 2NLJA 3Q05A 1NCDH 2Z31B 5T3XH 3L3HA 1OX5A 2OZ3A 2ODOA 2HJKB 3SDOA 4DELA 2X09A 2VKWA 4B5WA 1KYOK 3U6XS 2TRSA 1M53A 2FHCA 3E49A 4H9UA 5FA4B 4D3CL 3QNZA 2Q8ZA 3DGGB 1U1HA 3WD4A 4XN9A 5D7LD 6FABH 1R3QA 4IHOB 3N4EA 1IT9L 1EDGA 4N0UA 2GTQA 2VAAB 2ADAA 4F58L 1B54A 4ZB0A 2VWEC 1KLFA 2XZ7A 3KCLA 1TTIA 3GSRA 1FHDA 1N6QH 1CFSA 3H2OA 1SN2A 4XX5A 1MFNA 1KWKA 3T6VA 4APXA 4NDMA 3TTEA 3OQ3B 3VILA 4PWGA 2VRJA 4DO7A 3MBED 4MGGA 2XWZA 4RWYL 2OLSA 3NDZE 2PDKA 2X9YA 1XJBA 4ACPA 3PJSB 2Y2YA 3W1NA 1TCDA 3SCNA 4FFZH 3OKKB 1KPUB 3UYPB 2XIBA 2BWQA 3HFML 5FUCC 3BP4A 1XLFA 1UQYA 3CFEA 4QRAA 5DMJB 1KO0A 1C3FA 4I5UA 2AMGA 5F1NA 1S7QA 2V5RA 4M56A 5ILTL 1PZAA 2GBTA 5KZDA 3O05A 3MLXH 3KRSA 1V7MH 3UMNA 1KEML 3ROOB 5J8OA 3EJRA 3LS9A 4K2SA 5AW2B 3MV9E 4TSCL 2NTFA 3UABA 4IOFC 3HAEH 1IBYA 8A3HA 5B7YA 2HAZA 3C0LA 2IH9A 3VWJA 3PUOA 4UFIA 4I48B 2EZ0D 4B9GA 2OSLB 1G43A 2A38A 2CDEB 3Q4DA 4M3HA 2IFFH 1HJSA 3IRSA 1WA0X 2B59A 3WIFB 4UB9A 3KDNA 3BUDA 3TC6A 2D03L 2W5FA 4QRRA 2DGAA 1JNNL 2D31B 3AT9A 1I0DA 3RM4A 3BUQA 5C2BH 5SWZD 4Q6JA 3KNBA 4R7VA 4P2CG 2NVCA 2WQVA 2W80C 5DGQA 3Q1EA 1KBGH 3KXFD 1YECL 3QZMA 4JJOA 2VT0A 5HHPB 2ZZ2A 2R0KL 1Q0YH 2G8ZA 4HUKB 4LBSA 3F4WA 1FDJA 2B7OA 4KJPC 1Q1PA 4YSUA 1R5WA 5HI4C 3H3PH 4OLUL 3UWWA 2CLHA 4WU5A 3RCNA 1WXZA 3VXMA 5F71A 4M6PA 3NCXA 3TL5A 1IC5L 5L0QB 3ZTEA 2PDUA 2WN3A 1OIMA 4MDPA 2EXYC 4KROD 1CDGA 4XNMB 5D2VA 3EF7A 3AQDA 2PU0A 5D6CB 2PPDA 3TNOA 2WBJC 4FG6D 1X8FA 4K2UH 4MZ2A 3VDHA 4HIIB 2COVD 1IGJA 2P0OA 3KPMA 3ZXAC 2J20A 3LKPB 1WP6A 4H20H 3V0GA 1I8LA 3CIWA 3LN3A 3WF4A 3H7RA 3AMDA 5K1VA 4NRYA 2J6EA 3OSKA 3NTCL 4POZD 3U4BH 3WTSA 4Q8NA 3MJWA 1ZCCA 1XF5B 1Q6EA 1RULH 4WX2A 3NT0A 1X6UA 4GO8A 2R23A 1RP9A 2NY7L 3WJJC 3S5YA 3P0VL 4YQXH 2VC2B 4ATTA 2G9HA 3PJLA 3EAUA 4X0VA 3GH5A 4BF5A 2EDLA 3UAJA 4HKXA 4H7CA 1DEEA 4O00A 4DK6A 4AJWA 4KU1A 1CIDA 2Q3RA 1NPNA 3N2OA 1HXYB 4PSPA 5GZOA 1XUUA 2J8FA 5FJPA 1HWHB 1UCWA 3GS7A 3I65A 4M1BA 1SVBA 3DSNB 1BG1A 2J9YA 2F2KA 2F54D 1PE1A 4WJ8A 1UWAA 1NMCB 2O5XL 1WX0A 3UGVA 1HH9A 1M4KA 3MUIA 2W92A 4U7MA 4PFEA 3IIZA 4HKPA 1L7TL 5F7LB 4B9FA 3GMPA 5IFHL 1PY4A 2YPLA 3QJFA 4IPJA 5J6GB 4K8RC 1NEZG 2WXHA 3RDTC 4P9HC 3MOBH 3R8QA 1NCBL 2WP3T 3FB6B 2W0LA 3APYA 2XUCA 2KZHA 4JN1H 5LNGA 3NEEA 3KM2A 5E5MA 3L5XH 3PG8A 3GFZA 3VVGA 3NQIA 5A8PA 2AJXL 4MKTA 1QO2A 1YUHA 2XSAA 3PWGA 3UFYA 1KFEA 2I9TB 2F5BL 4ZPVA 1ELSA 2CRIA 1CE1L 3M44A 1NFIB 4ELDA 1OYAA 4PLJD 2O9PA 3UWUA 3DVNB 2X53A 2FJHA 2DI7A 4AKQA 2GI7A 3MZNA 2UY7A 1ZHBB 4JN8A 3FC8A 1BPLB 3EJCA 3GMOB 3UBXG 4OM0L 1S7TB 2Z4QA 2X41A 4JPQA 3D18A 1OCNA 2VAJA 3MI2A 2VXQH 1N70A 4MAYB 1JCYA 3ZQWA 2YFOA 4QR7A 4QXWA 2TMDA 4NQEB 2X4RA 5G5DB 4M9OA 4PG2C 3RVXC 1E55A 1AJ2A 2VC9A 1OF0A 1GOQA 4PP1C 4O2CA 1P7HL 3SYQA 4ZYKA 3OMIB 4CNIB 3QJTB 1T99A 1UP2A 4X4ZA 4Q4RA 3LXAA 1GAFH 2WVVA 2W0KA 5FGSA 4S1QH 2G3JA 2IH3A 4QOKD 1G84A 3VXUE 1G7QB 3W24A 4XAYA 1F3JA 3QQWA 3C5ZA 1KJVA 3DJZA 4J8RB 4ZXLA 3VMOA 4WW2C 1OWQA 2XV2A 1LL4A 3OKOB 5IB5B 4AC2A 4AWSA 1RY0A 2BNQA 4HJJH 5J13C 1I8KA 3BCDA 3UXDA 4NRZB 5F70A 1WBXB 3VUAA 4P5TB 2APBA 4ZTXA 2ISSA 5E08L 4FQHA 4M7SA 2ZX9A 1O9ZA 2OMWA 1XLLA 2FB2A 2F5AL 2WWMD 4HU0A 4MMZB 3S96B 3S7GA 3PAJA 3B8DA 1PL9A 3T7VA 2PWVA 2IS7A 2G2RA 4HPHA 4LANA 1KPRB 2PDBA 1RK5A 4NJ9H 9PCYA 1IRAY 4MNGB 1EC8A 1MI3A 3KLAA 4P7NA 3C2AH 3LKSA 4XQ6A 5CZXC 1ITXA 3EO9L 1X8CA 2AGKA 1MDRA 2XXGA 5AAPA 1T3FA 5D9PA 4M5YL 1MAJA 3FCBA 2Z1SA 1GZ1A 3BPLB 3NVDA 3PM6A 5J4MA 4A7GF 2H4EA 3R10A 3SJVB 4ZRGA 3PZNA 5DZNA 5ESAA 5CJ8A 2FYYA 2GTZB 2GT9B 4X8CA 3LD8C 2NRDA 3IAPA 1JNHB 5HWMA 5AZ2H 2EDFA 3F7JA 3T6CA 3HLAB 3QRGH 1DSYA 4EKJA 3FO1A 1R5IA 1BOGB 3KPSD 1IILE 2PNDA 2PSNA 3PHSA 4DNHA 1TVBA 5F6IC 4ZZFA 3QUML 3VNDA 2R8SL 2YXOA 1SM3H 4I7UA 1TE6A 1XEDA 1FX6A 1B4EA 2AK4E 2EYSB 1BV8A 3VXRA 1N8ZA 1KNOB 3ATAA 3IF1A 3LHVA 3V4PL 2QCGA 3KPNA 3CFTA 2NY3C 3KHDA 3GO2A 4UIKL 5BV7H 4MWAC 4PJGA 4L8CA 3M0MA 4XRCA 5FOJA 5U7SA 5HOSA 1WDDA 4NKMA 4FF9A 4JGNA 4Z76B 3L7FB 5IEKA 2H0EA 4U7KA 3RUBL 5JIPA 2AXGB 2GOUA 2P80D 4MNQE 3TTSA 2BP3A 1ZXQA 4PCYA 5CD5C 3BT2L 3KEDA 4QNWA 4BK8A 4WHDA 4G7RB 1A7PL 1DUYB 2IAND 1KBBA 4MNJA 1R2RA 3GINA 3AUJA 4PTVA 4WGXA 4QEGA 5DEFA 4FADA 4B7IA 3EYQC 4OCYH 1SW7A 4O02A 5KYXA 5M95B 4ZUTB 2P5EA 5FJIA 3LH2H 4F7CB 3D2UA 1KR1A 1TJ2A 3QJQB 4UINH 3WBAA 4WEMB 4Z7NB 3PBVA 4MQXC 3DBSA 1BFVH 3QXWA 1GZHC 1OM3H 4XOCA 3CH1B 3N2TA 4X42A 2QVMA 3PNUA 5HINA 4PJ8B 1NGPH 3IARA 2WQWA 4D1IA 1FAIL 3RFAA 3FPYA 5GGTA 2P28B 3WELA 4OF7A 4JQ1A 3CZ8A 3NZSA 5AVXB 3MODL 5FA3A 1BWVA 2PW2B 2O6DA 5L88H 1UZ8A 3JT2A 2YD6A 1JNEA 3RWJA 5B3NA 5CPQA 2DD8H 3NACL 1CU4H 4DZBA 4ASTA 1M71A 3QLDA 3QW3A 3ULSA 5EA9A 4BDVB 1LP9E 3C2RA 3MCLL 2HT3D 4O5LL 2H2PD 1SSDA 3HZVA 2PR4L 3WGUB 4UM8A 4Z7VE 2VDKB 4E0CA 1ZOXA 5E0CA 4GINA 1BHGA 2WMHA 3MCKA 2OYKA 4YHIA 1BXBA 1VZGA 1IT9H 5BRPA 3HBPA 3X17A 2YD9A 4I0CC 4L4TB 4F58H 1JZEA 4Y5YA 3IVKA 1AGDB 1MCHA 2LVCA 3WJYA 2GL5A 3IWVA 3K5XA 2ZUQC 4FNTA 3EOAB 4JRYD 4PLKD 4RBPK 1TWDA 1MCBA 3DFSA 1VACA 2G60H 3GB7A 3HQNA 1FVEA 1S8DB 4QBXA 4DP0X 3CMOL 3AITA 3ZGHA 4QS5A 5ABDE 3TJPA 4RWYH 3U1SL 3ZHLA 2JIXA 3EO0B 3E6FB 3H0TB 3M47A 1ZCOA 3H2QA 3E1ZA 1TZ9A 3EKZA 2J7GA 1FH8A 3RVWD 2J24A 4F48A 5CIPA 2FTPA 2GQ8A 1OTTD 2C1PA 3HFMH 2F1AA 4X6DE 4A6YA 4OKVA 1QRNA 4WXZA 1QNPA 4KVPA 2WCGA 4X5WA 2CKRA 1CLXA 4HPOL 2JKNA 3QRBA 5GHWL 3SJ3A 3J8F7 2Z9TA 3WLIA 1KJMA 3W70A 3NQFA 4GXUN 5HGDB 3NURA 1S1RA 1KEMH 4F92B 5KVEE 2GG1A 3TZNA 4X4KA 2EPNA 2DYPB 2OZTA 3PGDB 4ZDHA 4GOSA 3IGXA 2J8OA 3QUZD 4YHPB 2X38A 5EOTB 5T1KD 3W81A 1VLWA 4HMNA 1S2AA 5D4IA 2C9RA 2W5PA 5BXTA 2AAAA 3PFQA 1A49A 3EYPA 4AIZB 4PB0L 3HZYB 4Z3GA 2JKAA 4OQ1A 2D03H 1JNNH 4OUOA 1RUQH 4F9LA 4IBWA 3L5MA 4LNCA 1FCUA 3LAFA 4YDIL 2PTYA 3STZB 2K3TA 2IGLA 3TOPA 4UTTC 2FJSA 1IM9A 1OALA 1A9EB 1XGYL 1K5WA 2ZDSA 3OLEA 4KJWD 3OKNA 2D69A 1FFTB 4IWWA 1YE6A 1WCGA 5DK0B 5HYJB 2R0KH 3FSAA 1CT8B 4PP2B 1R5YA 1WO2A 3RU8H 4EWND 3EWDA 3QG6A 1WSST 1O60A 4M5SA 2WSKA 3W1MA 2WXPA 5FDWB 5E00A 3FQ2A 3O0FA 1T7LA 4XTRC 1R30A 1BFOA 3R5EA 4OLUH 1N2VA 1XQKA 4YSCA 1MF2L 2QJJA 2BM3A 2PO6D 1F00I 2CHWA 2B7QA 3LSBA 3KEHA 4EMZA 1HEJC 3UZQA 4JM4L 4WW1A 1H3GA 1IC5H 2VR2A 4XMVA 3TN3A 4LCUA 2N0MA 3WQGA 2YB1A 5C70A 2DWYA 3NDZA 4DJFD 3OXSA 5HI5C 1QPPA 2FL5B 3TV3L 1UWEL 4XSLA 3ZIYA 1KLGB 2OT0A 1HJVA 3HPJB 3BGMB 5LCVA 3EXTA 1KTRL 4DAFA 1X9UA 1Q8JA 1QVOB 1JK8A 2CJTA 1JK9A 1Z69A 2PKDA 2OWXA 2H9AB 2HVMA 3T3PE 3VXQA 4YDLB 4IIBA 3VXNA 3CXHK 1EFXD 1JRBA 1R3HB 1LP9F 1ODUA 5FCUL 1FYTB 1OZTG 2XWBA 3H2AA 3EF4A 1RIVL 1JZ7A 2NY7H 2NY2B 1C08A 3P0VH 2NX1A 4W9JC 5D1ZI 1W0WA 4FFVC 3SQBB 4IUOA 5EPDA 5E6ID 5FW7A 5E8EB 4G7EB 4XVUD 4EP8C 5I3FA 5TFSL 5EUOE 4KTYA 1UOVA 3ZO0A 2BOCB 4M6UA 1QMUA 2ODIA 1P6AB 1E8WA 1CFTA 3NABL 3UACA 1IVTA 4F15B 4XOBA 1BYPA 5FFLA 1YRKA 3MRJA 3C56A 2V6HA 3ZS4A 5HY9A 4U2YA 3BZEB 1E7UA 2HS6A 1HW6A 3MUZ1 4HCRL 5AOJA 4ICXA 4XO7A 2R15A 4X9BA 1LWRA 4ES8A 1YYLL 3MRNB 3KPPA 4LF3B 1E7VA 2DZUA 5DCDA 5C0EA 4JRXD 4AZGA 3D9AL 1A6VL 4F33A 2BXZA 1DE4B 4X6DF 2EH7L 4KW2A 2DQIH 1NCBH 3FT9A 1Z9SA 5JXED 4AVFA 2W6RA 3NQGA 3Q94A 5IFTA 3WLWD 4B15A 2BGNE 4YTRA 4PJAB 1TQTA 4RE3A 5I8EB 5J56B 1BQKA 3NG5A 3MNWA 1A7NL 1M3UA 3V0HA 4AWEA 2F9BT 1EMTL 4A8RA 3WD5L 3V55A 1EZVX 3GRGA 2J6WA 1TKWB 4OF8A 3TCLA 2PP8A 2AJXH 3QPKA 4MY1A 3L3KA 1K8IB 1XF1A 3FF8A 3ILPB 1WLHA 2F5BH 4U2ZA 2HTKC 3ME0B 4OECA 2IQ9L 2NZIA 1KC5L 5E0QA 3P2VA 3NOIA 1ODAA 1N64H 5IDZA 2E8ZA 4HWZA 3WUWA 2YUWA 4S3KA 4D9QE 2WTRA 1TEYA 5E5RB 1XGTB 3OMAB 4PJ5D 1QUNA 5AY7A 2YARA 4IRJC 2VGIA 4YHZL 3PP7A 3Q37A 3LYEA 1H62A 2HVKA 2LU4A 2DSKA 1OVDA 1HSAA 2Q8LA 4LO9A 4XMLL 5FF7A 3NIDF 1DORA 2VD9A 5HGHA 3S1UA 2X4OB 3SBWA 3HRZC 4Q74A 3AZRA 2WZ6A 2G0KA 5BRZD 2DI9A 2CBTA 2JKPA 4JM0A 5L2JB 2PDMA 1ET5A 2DH2A 3QDHA 5FK9A 5DUBA 1NELA 2EILB 2ZSWB 4O4YH 4F7MB 3OB0H 2WSPA 4PREB 4C1KA 1FZKA 3RWFA 2AKRB 3VFWB 2R2BA 2QJMA 4HK0A 4WTZA 2INFA 3V0EA 4XMPL 1YYML 4NO5B 5HPCA 1K4DB 4RZ5A 4JZ5A 2GKIA 4Z23A 1DQML 1J87A 3VQ2C 1N18A 3U36A 5H37G 1H8LA 5AUMA 5KSVB 3WLQA 1HCVA 3BESR 2J6XA 2GQ9A 4H7ZA 4F2FA 1ONEA 5E08H 3LEXA 1BXUA 4ZL1A 1IB5A 2H9GA 3RY6A 3B6SA 1RZ7L 2F5AH 3LKQB 3QZWA 3W3BA 3H2MA 1PV8A 1US3A 1TEGA 4JEQA 4Z78A 2XZQL 3T3PF 4TVCA 1GQKA 4Y4FA 3BHBA 5CJXC 4UTWC 1P7KA 2YWZA 4EANA 4YGVB 2X4QB 4ZFQA 1ZV9A 1FLRH 4S3EA 5JBEA 2WB7A 4L5FL 4UOJA 3MBXH 3EO9H 1KIRB 3K8MA 1NIDA 4WOZA 3HE7B 4XAKD 4M5YH 2Z6FA 1L0PA 2A83B 2ALRA 1BXAA 3QXAB 5IVXE 5EUOF 4P2OD 5J6HA 1VFAA 3G8RA 2FIRT 1N6UA 2YXFA 2YDRA 2J43A 4LEFA 1ZBWA 1HQRB 1N6QL 1ZY9A 3OM3B 1X5GA 4ZXBB 1P1ZA 1GMEA 5F9JA 5FO8B 1F9CA 5ECVA 4K4KA 3VKDA 3ZDXB 4QRSB 1MCCA 2W9LA 2XUWA 3B4NA 9XIMA 3PDOA 1QO3A 2J55A 4NKOA 1UPMB 2AAVA 1MYRA 2QMJA 5KVGL 3GIQA 1OB1B 3RWGB 5ANME 4JUSA 4MZYA 4PH6A 1HILB 1MVFA 1DTNA 3OG3A 5JORB 5ESQB 3EJZC 3VXUA 2QBWA 3RDKA 4US5D 3IJ7A 3NA4A 4LDLB 5PTDA 4HLZH 5FC9A 3T65A 2VFIA 3Q8BA 2BHFA 4KO5A 3TEUA 1YAIA 5EO1A 1KG0B 5IT2H 3HE6D 3OD3A 3IMVA 1RCOB 4TMCA 3MLXL 3W2UA 4L8BA 3WOVA 1V7ML 1Q6QA 1XDJA 4NS0A 1MREL 5AL0A 5I23A 3BT2H 3N9GH 4O13A 5HMSA 2YLHA 3LV5A 2W63A 3DZ1A 2A5UA 1D5MB 4TNEA 4RMUA 4LVOB 4NO0A 2V3EA 1TQBC 2CHOA 1SXCA 2BINA 5GS0C 3M0XA 3Q06A 3RL1B 4OF5A 3WLBB 4LEBA 4LSBA 4MD5A 3WF2A 4X98B 2IFFL 3MRKB 5KTEH 2J72A 3R79A 1JN6A 5DBTA 3L48A 5F7YC 1IWAA 2HSIA 4XZBA 2QGHA 2WV3A 3FVMA 5FYKU 3WNIA 4XKYA 1EAPB 1O6SB 3MROB 4BQ3A 1TIWA 3EX4A 1FAIH 2DJLA 1KBGL 2HBVA 3MA8A 3DJTA 5D2NC 2INZA 3QEQE 1PZ1A 4MFDA 3TBCA 1QEWB 4MA8L 5EEZA 5DEGA 4JHZA 1Q0YL 2X2YA 2FJGB 4TQ8A 2PCPB 4AG4L 3F83A 2RHGA 2WXJA 4FLHA 3QWQB 4CGUB 5JUEL 4ZQMA 4P5KB 3UPRA 1K8DB 1ME7A 3NCCB 3R4RA 3DPDA 3AUVA 4YN3A 4UU9A 3H3PL 3N3TA 5H2BA 2NUPA 1E6QM 1S9VB 4O5LH 4LS1A 4OZGB 4J3OF 1HDMA 4LUYA 4QQ3A 5HVHC 4AIEA 3X13B 2GSJA 4Y0GA 4YDMA 1CZ1A 3BGFB 2AK4A 3GRWH 3FRPA 1Z7JA 3BQUC 3I3DA 1M7UA 1UD6A 3BUYB 5C97A 2J25A 2DT0A 4K2UL 4DSYA 1QUPA 1I1AB 1WC7A 1BW8A 1JRHH 2VLJB 5L8LB 4H20L 1XSKA 1XBVA 3NZ8B 4YDVA 4G1EA 2VX6A 1NAL1 3OJDA 4E5TA 4HGWA 1ZT7A 4QT5A 3JTSB 1U8OB 4J3OG 4X6BA 1OC6A 4FD0A 4ODXA 3EGJA 4IFRA 3CMOH 4X7TA 3QGAC 2J75A 1RULL 3W9DB 2JXMB 1F3DH 5LIXX 4B41A 4GKZB 2NLYA 4BFAA 1C16B 4G1MB 3FW6A 4P7LA 4RMSA 1RJRA 4G6CA 5AKVA 4QITA 3AIBA 3WFBH 2UYLB 3M0HA 1KCLA 2IQ0A 3LKNB 1KM2A 4CJ1A 2DQGL 4NXSA 4B9PA 2L3BA 5KN5B 4HPOH 4IZGA 3C6LA 3DX2A 3NESA 4FYRA 2FLBT 5FAJA 3CUIA 4ESKA 4I1NB 1L6GA 3O3AA 4RRPM 2LW3A 3ULAB 1Q6DA 1OGPA 2GABA 1J9RA 5I07A 4F91B 2WOBA 3GC3A 2XX0A 4UOQA 4MY8A 5F0PB 3ZVHA 1SLUA 5LNWA 3THAA 3P93A 4BD4A 4U7SA 3LHZA 5DYOB 4S2CA 1SF3A 2Y85A 1U8JA 4QHKI 2CRMA 1SUJA 3UAEA 5FHAL 1K2DB 3MOBL 2WPGA 4P5SA 2J57A 2V7NA 2HZGA 4FGMA 3RUGA 1F42A 3RJYA 4BZ1H 1P5VB 1GQJA 4JN1L 3WF3A 4DP7X 4UTJA 3CU7A 1JIBA 5TQ2H 1BG9A 5IB1A 1K8YA 1AGEA 1BYDA 4YDIH 4NBZB 1R85A 3SZKC 2FGWL 3FO9A 1UKTA 4Z7VA 1FWAC 4AVKA 1G6VK 3DUUA 1JJKA 1NP0A 3N17A 2AITA 3C86A 1FVCA 3TYZA 1YDYA 1MQ8A 3MCYA 1F4HA 4PGEB 4I9TA 4YFLF 2Z25A 4NGHH 2X44D 1B30A 4RPQA 2QR0A 3GIVA 1EP1A 1EEQA 3W0WD 2VXQL 2JALA 3UTQA 5C9UA 4PUDA 3OIXA 2VDIA 1ZGLA 4DY1A 4TM9A 1MF2H 3SUTA 1J6PA 1LRNA 1ADSA 2CO6A 1F8IA 4WO4D 1CLVA 2COQA 2MTPA 3FOMA 2A2IA 3BUPA 3SY0B 5HD8C 5EA0H 1GAFL 1UWEH 4EZLA 1LLAA 3C2VA 2QMKA 4LCWB 4FXGC 2HFEB 5B38A 2FQEA 4NZUH 1T1YB 2NLIA 5E2UL 4ZFOA 3RWHB 3QA3A 1TTRA 4U28A 2W0UA 4UTBA 5CZTA 1ICPA 2QSQA 1PMYA 2ZKYA 4YVUA 4F0RA 1TFHA 4YSSA 2PCEA 2EE0A 2UY5A 1IQDB 2XISA 5A6MA 2E9JA 2OG9A 1ONWA 1JRHI 3CDYA 4HJJL 4KTGA 3RNQA 2N0KA 4LASH 4P07A 3LHTA 4IU2A 5LGHL 5JPNA 1YMYA 4EE9A 3DETD 4D6IA 3N1QC 5TFSH 1KN4H 3DOIA 3HB3D 4HDIB 4AGLA 5F9AC 3QUKB 1FNEB 1S7RA 2FH6A 5T5FA 4V1DB 4A1RA 4EE2A 3KPQB 1Z66A 3QWOA 2C9XA 4F9JA 2KLSA 3HW7A 5IV2A 1JV2B 2VLKB 1NGWA 3AT0A 4I5BB 4M51A 4NJ9L 2KZBA 3RCYA 5DJAB 2CSPA 3L13A 3K8KA 4P23D 1H8NA 1OT4A 1CLCA 1SJXA 3AREB 5AVTB 5I1LB 4E9VA 6XIAA 4F7PA 2DKSA 3WMPA 5DJ8A 4Y7OC 4RCAA 4NNYA 5D7JD 1JR1A 1BF8A 1ROCA 2CBVA 2X89D 5DVMA 1QNRA 1ZP4A 5AZUA 1DHPA 1YQVL 3L95A 4MG4A 3UMTA 2EH7H 1L9PA 4A35A 3F64A 2P8CA 1MCKA 2YYUA 1AFSA 2PWDA 1VEPA 1GKRA 4ADUA 1VPYA 3C60D 4KO6A 1SRDA 1KXVC 3V9EA 3V6OC 2E25A 4D8AA 1EMTH 4PRRA 5IFPA 1EJ8A 5D8JL 1QVBA 3EEZA 3DGCR 4M6VA 4Z1DA 2ICEB 5HGBB 4W6XB 3REQB 1SM3L 2VE6B 1MWAB 2V30A 2Y7OA 3NPUA 2ADIB 3L1OH 4WHCA 4JKMA 3CN3A 4MVBC 2BOGX 3QIUB 3OKDA 2F6UA 5DD6B 2K4AA 1V08A 1NSJA 1J9SA 4QSFA 2FDSA 3NPSC 4YHZH 4FA8A 3QJZA 3MBWB 2RKXA 3DC8A 3IDMA 2ZXAA 4NC2B 2X4SA 4RESB 1W1VA 2BOBA 4FOJA 1NBYB 3RCMA 2ZRXA 1JVKA 1TTCA 2E6DA 2WVUA 2D20A 3G1HA 2HSAA 4PRPE 4U1HA 1FAKT 1Y65A 4LSSH 3T3MB 1Z9LA 4AD4A 3V0TA 2ATSA 1I1FA 4P8VA 3ELQA 5EU6E 4KO9A 4B16A 1JPKA 3BPWA 4TXEA 4N2DA 1KY7A 1GXEA 3VACA 1XLBA 5IDIA 2JQXA 4QDMA 3H23A 4XMPH 3S35H 3LH2L 1WZKA 1FWTA 3AAZB 1QR1A 2P5PA 2VDNL 4HPNA 3H4WA 3OA5A 1BFVL 4Q97A 2G0WA 1WWBX 1BXNA 3RIAK 2AS5M 1IKOP 5IB2A 2BFGA 1JTOA 4KJYA 3FRUB 1AQFA 2HCVA 4Y2NA 4R0LC 3NO5A 4U6TA 3SRDA 3SE3A 3T8VA 1CL7H 2H26A 1T21A 1N2RA 1RZ7H 2NVAA 4XZNX 4LVHC 1E1CA 1KBLA 5IM7A 2F8OA 2HPIA 1U33A 1MRCL 3CQHA 1TZ7A 1XSJA 2DD8L 3H8NA 1JUBA 4L5FH 4AQ8C 4ELKA 1GK8A 2HT3C 4PY7A 4XO9A 2CO3A 4PUWA 2VEMA 1M1XA 3VNKA 1UJ3B 3WU1A 1T8QA 3HI1A 4GYBA 3IGLA 5G5IA 1P6CA 5B39G 4AZ5A 3PZQA 3ZHKA 3GXPA 4Z77A 1O5QA 1OQFA 4L9DA 5EGRA 3B83A 5JDSB 4FXKC 1Q9OA 1GGYA 3B2PA 5PAZA 4Y1AB 1F6LL 3DVIA 4PLKC 3GZOA 1GKQA 4H8WC 1INQA 4HQQL 2G60L 3ZDWA 2X1IA 2IAMC 1HGWA 4FTVE 4QHPA 4QSHA 5BCAA 2FZBA 3UTTD 2GOKA 5CWSB 3ZTNL 3NG3A 4NKDB 3S83A 5KVGH 1H3UA 2WSRA 3AAMA 3ISWA 3MRMA 4XNZB 2CLRB 4KNUA 1UYWL 3N41B 1KXQE 3HZKA 3F7PC 2OMZB 4BGDA 1S7WA 4C91A 1AZRA 3W02A 1VJIA 1A7QL 1RVKA 5F0JB 1TSRA 1MJJA 2OQHA 4Q56A 4UTMA 2IV9A 3S35X 1CLKA 5E8PB 3H56A 4EZMA 3UTPE 1W9BM 2OMVB 4MX7A 2A4EA 3QQ0A 4FB7A 3NH7H 3Q7JA 1EXUB 3ETBF 4DPQA 4OZFB 2W60B 5KZEA 3A4XA 1JXDA 1MREH 5TF0A 3SY8A 5IJVA 5EU9A 3C9NA 2QJDA 4DOHE 2YXXA 1RQEA 3KD4A 4CSZA 3V4VA 3CU2A 2AQ3A 1QATA 4ZOAA 5GNZA 1HESA 4CVXB 5KVFE 3ZRSA 2WMPB 3NQVA 1X7QB 2I60H 4OZIE 5HK4A 1KCZA 1DP0A 1DFBL 3C0SA 5CEZD 1NOWA 4I89A 2JKXA 3KRUA 4DIAA 3OJ2C 2DSZA 1CT5A 3G6JB 3TFKD 3VZXA 4QO1A 4GUGA 5H8PA 3IDGB 2FQFA 2ATAA 1CN4A 1MZYA 1RUQL 2DQCL 5E99H 4NL1A 1QSFB 4E41B 2DMCA 3WJWA 3LHAA 3IFOB 2CNCA 3UROR 3EFFB 4AUJA 3ASNB 1CBVH 4FIRA