1U30A

In situ extension as an approach for identifying novel alpha-amylase inhibitors, structure containing maltosyl-alpha (1,4)-d-gluconhydroximo-1,5-lactam
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Situ Extension as an Approach for Identifying Novel alpha-Amylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1u30A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1u30A01
2CERA 4X0NA 4W93A 3AXXA 1UOKA 1LWHA 4ZXOA 1NARA 3L2LA 3S5ZA 4HU8A 3D3AA 2BV9A 3AMGA 4PTVA 4UQDA 3MMUA 1E9LA 1VFUA 3AFBA 1HKMA 2JIEA 5A6LA 4GPNA 3UG3A 3WL1A 5JIWA 5EBAA 1I1WA 2FH6A 1JF6A 1E3XA 4RE4A 4MNMA 3AICA 3EYPA 5A94A 1UZ4A 1UHVA 3O2LA 1W2VA 1KR0A 1W1PA 3WEZA 3BAJA 4P7RA 1DEDA 4F79A 4UFLA 4CU7A 1CECA 4AZ7A 2ZXDA 2F7PA 5D4YA 4UOQA 2WYSA 2YFOA 3VDCA 2DT1A 4W89A 2PBOA 2C0HA 2ZOXA 3LXCA 4HP5A 1T0OA 1JD7A 1LL6A 1JNDA 1E6RA 3EDDA 4D6CA 2W61A 3B9DA 4PMDA 2VTFA 3G6MA 2FHCA 3HG2A 4IUGA 2VRJA 4F8XA 3BUBA 2XFYA 4UFMA 3N11A 2EPLX 3OIHA 3RO8A 4YHGA 2XM2A 2XUCA 4EAMA 1NP0A 3ZSTA 4MAVA 3CHFA 1CPUA 1DWAM 1JZ2A 5DT5A 2EPNA 1QW9A 4D72A 2C7FA 1QHZA 1B90A 2W92A 1QNRA 4AD5A 2F1BA 3D4ZA 2J77A 1V0KA 1HP4A 3CPUA 2XN1A 3PZMA 4NZJA 2VVSA 4FNUA 1GHRA 5GNZA 1CXLA 2EAEA 3BSGA 3OLIA 1UWSA 1UD6A 4UQEA 5F7UA 2VQUA 1MW0A 1AMYA 1EH9A 4N0RA 3H54A 2XSAA 3N13A 1JDAA 4JCLA 3VUPA 4KMQA 2IUZA 2E4TA 2G3MA 2BY1A 4PMOA 3EJSA 1FHLA 1OGGA 5DFAA 1W3LA 4H41A 1ZL1A 3DX1A 2V3EA 4AXNA 3ZO9A 3WIJA 1HKKA 3AMLA 2IXUA 3ARTA 3PZNA 3D4YA 2VI0A 2J25A 4E2OA 1JFXA 2X09A 4PMRA 1K9DA 4QLJA 4F9DA 1QNPA 1ZBCA 3EMCA 5ECUA 4DUWA 1DTUA 3ARRA 3QHOA 4EANA 1CGVA 3RCNA 4WJXA 3ZIZA 2O92A 5I5RA 3AXHA 1QPKA 1UQYA 2B31A 2BXYA 2NW0A 1UWRA 2WZEA 3WH8A 3DECA 1KQYA 2VVNA 3N1AA 5ABGA 4Z2IA 3DDGA 5FKYA 2V3DA 2VMFA 4CD8A 3F5JA 1KB3A 2YFNA 5A3HA 1Q6GA 2RGMA 4ZXLA 2X1IA 5IXEA 3WFLA 2O9PA 4EK7A 2PB1A 2WMHA 3AZTA 5DF0A 1AQ0A 4GQRA 4P7LA 4CU8A 2D24A 1GOWA 4UQ9A 3L4VA 1LL4A 1PZ3A 2VL4A 5I3DA 3WUEA 5AY7A 8A3HA 5HXMA 2EPKX 4ACZA 5DEZA 3BVVA 2CITA 1HVXA 1W3JA 2Y8VA 4HMEA 4OOZA 3GNRA 1C8YA 2VT0A 2WKLA 2PWEA 3WH6A 3KLLA 3QGVA 1XD0A 2CHOA 4PMVA 1G0CA 1TVNA 3AHXA 5E6YA 5CQ1A 3DX4A 1GOMA 5BRPA 1IZJA 1QI5A 1TUXA 1PJ9A 3AS3A 3UG4A 1KFWA 2ZX7A 1TA3A 1BHGA 4DO5A 4LYQA 1JI2A 1WZKA 3JUGA 2WSPA 1HIZA 2UWFA 3ZJKA 1HT6A 3OZOA 3M6DA 1NOFA 3VDBA 1W9VA 4LXFA 4CUCA 2DT0A 2UY2A 1CENA 3LPOA 2WKGA 3WEMA 1TQVA 1WZAA 3T08A 2V3FA 4OGZA 3VKKA 1UWQA 2OSYA 2QMJA 3VIHA 1JYNA 3GBDA 2D0HA 4AIOA 3WDRA 5CGMA 1ISXA 1DWFM 1B3ZA 3VIKA 2WPGA 4NRSA 4FK9A 6CGTA 3VSUA 3AIWA 1B3XA 3AIVA 3A23A 1GHSA 2X8RA 4UQAA 2W66A 1TFVA 3L4ZA 2WCAA 4FNQA 3MUIA 2ZICA 4HOXA 2G3IA 4Z2JA 3GM8A 3OB8A 4D6DA 1JZ5A 1BGGA 4AY1A 5AC5A 5BXRA 3II1A 4AISA 1QHPA 2BFGA 1VJZA 2VRKA 2F2HA 2DH3A 4QCEA 3DHPA 4CCEA 3UEQA 3WQWA 3AMKA 3PHAA 5JIPA 3EJTA 4LQ1A 5ABFB 2E0PA 4CN4A 5CPQA 3A5VA 3U7BA 2CCRA 5HNNA 5ABFA 2WANA 3VD4A 3S5YA 1VEOA 1O6IA 3K4DA 3NSXA 3WD1A 4D71A 1EIBA 2DDXA 3W28A 3EJRA 1UR1A 3EDEA 4X0VA 1TQSA 3GXDA 5A8PA 1GQJA 6A3HA 4R5EA 1CLVA 2QF8A 1V6XA 4AC1X 5C70A 2OSXA 3BVUA 3WF2A 4FLRA 4U3CA 2O9OA 3FY1A 1KXHA 1XSKA 4GIAA 4QP0A 3AIUA 1ZBKA 3ALFA 4U5IA 5E70A 5IFTA 2ZIDA 2ZX5A 2ZUMA 2DSWA 3BAWA 4MB1A 4W87A 3VGGA 4TX6A 2F7QA 3OGRA 3WN6A 1NWSA 1CXEA 1RPKA 4AZHA 2BY3A 2DH2A 3L4WA 1BVNP 4RE2A 3NYDA 1GOOA 2Y8KA 3DX2A 2WXDM 3WQ5A 2TAAA 5E09A 1XH2A 3VIIA 3WBEA 1UH3A 4HU0A 4FNTA 1PBGA 1WZMA 1PAMA 2OYKA 3CUIA 1HJVA 3KZSA 4UR9A 1US2A 3DC0A 3IJ9A 2YDQA 1VBUA 3AOFA 4AMXA 2D22A 5FD0A 3WD3A 1V02E 2PWHA 1HKIA 1FFRA 3WQ6A 3ZT7A 1OSEA 3ZT6A 5BXPA 1VJSA 2WC4A 5BYWA 4XX6A 1HXKA 2VQTA 1VAHA 3ARWA 3AIEA 3WL0A 2XVKA 1V3KA 1UR0A 3VD9A 1AVAA 4J3VA 1H1NA 2F8QA 4D6EA 1SR0A 1XYZA 4HA4A 1W9XA 4CKQA 3LX9A 1X6LA 1HJQA 2Y5EA 2WLYA 4AIUA 1J10A 3GXNA 3HMCA 4Q7NA 3LXAA 1Y7VA 3A21A 1CXKA 3AJ7A 4XB3A 4AD0A 3KWXA 1X1NA 3QHNA 4P8UA 3VSTA 4M24A 2WVUA 1ODUA 3APGA 1UUQA 2WK2A 1NQ6A 3U57A 2OLHA 4KRUA 3BLPX 4F9JA 1OGSA 1WPCA 3WDQA 3WD4A 5E0FA 3VTRA 3U5YA 1OWQA 3D5HA 5C8BB 4JFSA 5I6SA 3BCDA 1ISWA 5IHSA 4AYSA 4W5ZA 3FNDA 2VC9A 5I79A 4PBGA 2WBGA 3GYCA 4DM1A 1QWUA 4AMWA 3O9NA 1JL8A 3WY4A 4OUEA 2ZXBA 4C7DA 3TOPA 2XM1A 1WDQA 1OB0A 3EMQA 1E73M 3CMGA 3IAPA 4AMCA 4P8VA 1JYWA 3AHYA 4H2CA 3I3EA 1DWHM 2HVMA 1D3CA 2VX4A 3AQUA 1J0ZA 4KRTA 3RJXA 3W24A 2VZSA 4U3AA 2VUYA 3W38A 1YHTA 2JE8A 2YL8A 1LQ0A 5JBFA 2VRQA 2CPUA 3LPPA 4PUDA 4H8VA 3K4AA 4MTVA 4E8CA 3DX3A 2WW5A 2YDRA 3AROA 4B3KA 4DO4A 3FAXA 7TAAA 3PZTA 4H8UA 1C92A 1M04A 2CHNA 3MV11 2J7GA 1E56A 1H09A 3GH5A 2Z1SA 4ZENA 1V02A 4YHEA 1E0WA 1W91A 2Y2WA 4H8HA 1TVPA 2GSJA 2G8ZA 1XCWA 2FDMA 5A6BD 3D52A 1NP2A 1CYGA 3L4YA 1EDQA 2DSKA 2O9RA 4FLOA 2QPSA 1LL7A 4WSKA 2CBVA 5A69A 1FH7A 2VCBA 1UR8A 4JFVA 1C8XA 1LF1A 2E3ZA 4MB3A 4HOZA 4ZE4A 3WQ4A 1US3A 1FOBA 3AYRA 4AWEA 2ZX6A 4UNIA 1W2PA 1EO5A 3BCFA 2G3JA 1U33A 1BSIA 3N17A 3WF4A 4R27A 4QAWA 4CVWA 4BS0A 4GQQA 3K8LA 2RGLA 2ZX9A 5LA0A 3VX0A 3RM9A 3AMDA 5I24A 5CSYA 3OGVA 1QI4A 1UWUA 1QI3A 1V0NA 3MANA 5A8NA 4AD4A 1CXIA 4DO6A 1KCKA 2WMFA 3MUAA 1H4PA 4P7OA 4HMDA 4HZ6A 3CTTA 1W9BM 2YL9A 3HG3A 3RIKA 3KL3A 4A3YA 4ZFMA 1E4IA 3J7HA 4TXEA 1J0JA 1TQWA 1GUVA 2BNJA 2E9BA 1R34A 3VIFA 2XIBA 3F5LA 3WD2A 4S3JA 3ZOAA 1D7FA 3EDKA 1ZU8A 2E9LA 5ABHA 4PSRA 5BRQA 3ZM8A 1MYRA 2EADA 4HOWA 2XGIA 1QBAA 5AYBA 5CZKA 5CPSA 2IGTA 1WNOA 3M46A 4W8LA 1U2YA 3WQ8A 3GBEA 2BHYA 2YKKA 1W1TA 3W27A 3BLBA 1UH4A 3VDHA 1O7AA 1CDGA 1A3HA 3NCOA 3ZJ8A 3VGHA 2DIJA 4N42A 3AYSA 2XVPA 2X2YA 1H0GA 2JF6A 3T2QA 3UETA 1P6WA 4UFIA 1E55A 1CGUA 2BHZA 3CO4A 2CYGA 1HP5A 1MW1A 2A3HA 3K8MA 1IV8A 3VGBA 1ISZA 3AHVA 4TVUA 4CN6A 3MO4A 1VRXA 3THDA 1ITXA 3BSHA 3VO0A 1B3VA 4U31A 1J9YA 2VCCA 1BQCA 4JKLA 3VD3A 4W5UA 2XJ7A 1FA2A 3OLGA 3WDIA 2J8GA 3BH4A 1FHDA 4AZBA 2CEQA 3SCWA 1QHOA 3MUZ1 1MFVA 2ZE0A 3OZPA 1QI0A 4PTMA 3BAIA 3N18A 5LA1A 3HG4A 3AXIA 1KGXA 1KXTA 1TQTA 4LPCA 4CD6A 5A6JA 1M01A 2FHFA 1JZ8A 3MUY1 4C7GA 2WZHA 2F61A 1E1FA 1RD6A 1GPFA 4L4PA 3PZIA 2XYLA 1TG7A 3GXMA 2WCGA 2WVSA 1E15A 4K68A 5A6SA 4P7QA 4FNPA 5M03A 4JKKA 4L4OA 1XSJA 1B3YA 3PTMA 3DYOA 4NSBA 5E0CA 5FOOA 2PWDA 1DWIM 4B3LA 3HG5A 2XHYA 3BXWA 1N82A 3A4AA 2MANA 2F18A 4TVCA 4BQ4A 3BC9A 4JZ5A 2VOTA 4V27A 4GKLA 4MJ2A 2D0FA 1L0PA 1EXPA 2DPEA 3EBVA 2J7EA 3ZT5A 3F5KA 3CHDA 3GDBA 5A95A 2WMGA 3MMDA 1W1YA 1ESWA 2ZXQA 2WWCA 1JGIA 2W5FA 3H55A 3WMBA 5A8QA 4HA1A 1H3GA 2J7DA 2J62A 2HISA 1FP8A 2QHAA 2D3NA 1W9PA 3GXTA 3VM5A 4FLSA 1V3HA 3VGDA 1ZB5A 1K9FA 1TCMA 4QCFA 3KL0A 1BTCA 3A3HA 4PMYA 1TZ7A 3WDJA 2D2OA 5JBEA 2PF0A 1XRVA 1CBGA 3QOKA 5D9OA 5FL1A 2PWFA 4PMUA 5HDRA 1OBAA 4OBSA 4J3WA 5CJ5A 3CZLA 1J01A 1VBRA 5A8OA 4D6IA 3N9KA 1NH6A 4J28A 2ZXAA 2E8YA 5HPOA 2QMKA 3PTQA 2CKSA 4BQ2A 3VINA 3PZOA 1CXHA 4V28A 4WKHA 4OIFA 3WUGA 1VF8A 4IM4A 1CEOA 2XWDA 3T2PA 1ODZA 2VJXA 2ZUWA 1Q6CA 1PIFA 1GOIA 5GQBA 1LLOA 3SEPA 4PTXA 3VD7A 4MB5A 1BF2A 1V08A 1CNVA 2V3GA 1HTYA 1EOKA 4CD5A 1R46A 3WH7A 5KZ6A 1G1YA 3CZJA 3AZSA 3WNMA 3VIGA 3OBAA 2WVVB 4JHZA 1BFNA 3LRMA 4H7VA 4HZ8A 4GXPA 1ZBVA 3I3DA 4B16A 1W32A 4AZIA 1OD0A 3KLKA 1EA9C 3KE0A 2AMGA 2BS9A 1I1XA 3OLEA 3HJEA 2A3EA 4J3XA 1M7XA 1K9TA 1R7OA 2XIIA 5CGTA 1EO7A 1BYBA 3WMCA 1UKSA 5GPRA 2XVLA 4W8AA 4OOUA 1NM9A 1DP0A 3RM8A 2XWEA 4TVDA 1EQCA 4AD3A 2J75A 3S2CA 1CGYA 5I23A 4GINA 1HN1A 2J47A 4IPNB 2XN2A 2AAAA 2WWDA 3AIQA 3L4TA 1E6QM 4ATWA 2Y24A 3M7SA 1DHKA 4NF7A 4ACZB 3GNPA 4BCEA 2W4XA 5DMYA 1CIUA 3WY2A 3IK2A 2YLAA 4ZEPA 4AZGA 2JFEX 3WH5A 1GVIA 1JDDA 1UKQA 3POHA 1K6AA 4PTWA 1CGWA 1IT0A 1OT2A 1WO2A 3W6MA 1ZBWA 4UZSA 1UKOA 1E40A 4C7FA 3MU7A 2A3CA 5HBFA 4IPLA 2ZUVA 4W7UA 1C7TA 1UR4A 2WMIB 3QR3A 2VURA 4H04A 4J27A 4YN5A 2EABA 3I3BA 2Q8XA 5D9MA 2E40A 1S46A 2ZUNA 1AQMA 3W26A 2BVTA 2X2IA 5A6KA 3B9AA 1D2KA 2WBKA 1MQPA 5I2UA 5BWFA 4PCSA 4J7RA 1QNQA 1JD9A 3NDZA 2GVYA 3WH9A 3SUWA 2ZX8A 2WM0A 3WDHA 3PZ9A 1HJXA 1UKTA 3W25A 3UG5A 1XYFA 2VCAA 3RPMA 1UD5A 3TP4A 2BHUA 3W4RA 1NWUA 4BQ5A 3DYPA 3UR8A 5D8ZA 3A22A 3CV5A 4U2YA 3H53A 4AZCA 1UD8A 3ALGA 1E6SM 3CZEA 1HJWA 2FH8A 1UH2A 4MJ4A 4MAZA 1EGZA 2GUYA 1DWJM 3FW6A 1V6YA 1KQZA 2X05A 3MS8A 1HX0A 4JAWA 2CBIA 3ARZA 3D50A 4PUEA 1OD8A 3SUVA 2EJ1A 1O7DC 1LJYA 4WSJA 2FE0A 2NSXA 3GXIA 4B9ZA 2OSWA 3O6AA 3ARSA 1FH8A 1WDSA 2VZUA 1KXVA 1KBKA 1ZS2A 4NI3A 4IISA 2YOCA 2G41A 3QHMA 4BQ3A 4ATLA 1JAKA 1PIGA 3G6LA 2GK1B 1J0IA 3AIRA 1G01A 4OZOA 1R33A 3SCRA 2DSVA 1WCGA 2VX6A 5FCZA 1HL8A 2W67A 3B8SA 3W37A 3ARQA 1J0YA 1XD1A 1VFFA 1CZ1A 2OWCA 4EKJA 2J7FA 2FYVA 1WP6A 5A2BA 1V6WA 1QBBA 1E0XA 3VIMA 1A47A 3A24A 3ZR6A 1RH9A 1J18A 2QLYA 3SCNA 3VU2A 3DYMA 2WVTA 1B30A 5AYIA 2XSBA 5C71A 3CZKA 2EACA 2WMJA 1JYVA 1H2JA 4WIWA 2YA1A 3ZSSA 1BYAA 3EMZA 3EJUA 4HA3A 3WF1A 4TX8A 3PBGA 1PPIA 1W9UA 3AZRA 3NJ3A 4FF5A 1JZ6A 5ABEA 4QLKA 4TTGA 2X0YA 4W88A 1R85A 2BY0A 4TOQA 2WSKA 4UQBA 1PEZA 1Q6DA 3L4UA 1SMAA 1C93A 3SUUA 2X2HA 2CBUA 3BLKA 1JAEA 3VILA 4S3KA 1QOXA 3WKZA 1CXFA 2DIEA 3IAQA 2AOSA 2J74A 1HKJA 1E4NA 1UWIA 3VPLA 2CBJA 1JF5A 2O9TA 3OA5A 3BUPA 1JZ4A 1W1VA 1KWKA 3BVXA 5D9NA 2W62A 2ZUTA 1BLIA 1J12A 2WHMA 3AMCA 3OGSA 3CBWA 4PRWA 3WY3A 4KWUA 3TTQA 1ITCA 1XGZA 4U33A 3WUFA 4E4PA 2A3AA 3VGFA 1QNOA 3WENA 1G94A 1RP9A 3D51A 4Y7EA 4GO9A 4W8BA 1CWYA 3KL5A 3CC1A 5E6ZA 1NWRA 2GK1A 2Y4SA 2VO5A 2PBGA 5CLTA 5LYRA 3DX0A 1EHNA 3CGTA 4UFKA 5JUVA 2EQDA 1GORA 1C91A 1Q4NX 3CUJA 4GI6A 3AHZA 2DEPA 3E1F1 1BG4A 4AZCB 3CHCA 2BVYA 4CGTA 5A2AA 4D6GA 4P7NA 1GJUA 1E71M 2EBNA 3IJ8A 5IHRA 1MQQA 3F4VA 3MKKA 4GI8A 1OM0A 5A6AA 3CZSA 3GH4A 1J11A 2J78A 1KGUA 1KWGA 3W0KA 2W91A 4NXKA 1R87A 7CGTA 3BAKA 3SIMA 3WNKA 1V03A 3BUIA 4OJYA 4A4AA 6TAAA 4W86A 3SCQA 4CD4A 3CZNA 2JEPA 4TTUA 3LPFA 3PZGA 2BVDA 4D1IA 4U2ZA 1H0IA 4B15A 1G9HA 3ECQA 2CKRA 3PZUA 3AI0A 1B31A 3ARVA 5CSUA 4AIEA 4FNRA 1J0KA 1CGTA 1E6NA 3NUKA 3DHUA 1MVYA 4HMCA 1QNSA 4P8XA 4WKFA 3FHAA 4BF7A 1QVBA 3CUFA 4UCFA 5KEZA 5M5DA 1UQZA 3WQVA 2DQXA 3HN3A 2YBTA 3VGEA 2G3NA 4MDPA 3UCQA 4CU6A 1GQLA 1JZ7A 3AS2A 5IDIA 2J79A 2F7RA 1VENA 4PMXA 4XZBA 2WMKA 1JXJA 1UYQA 1QX1A 3MI6A 3AS0A 3VX1A 1WZLA 4PMNA 4W85A 3WMSA 2A3BA 4JFTA 4PN2A 1GCYA 3SCOA 3WUBA 3U7VA 3VMPA 3NSMA 1E4MM 1ECEA 5I78A 3PZQA 4XZWA 4UOJA 5I77A 4DM2A 3T09A 4CN1A 5EFFA 2QPUA 3HU7A 3CH9A 1Q6FA 4WF7A 3L2MA 4MB4A 3W81A 1OCQA 3WNLA 2XG9A 1NOUA 3IANA 4CCDA 2EEXA 3GXPA 5GNXA 3VNZA 3CZ8A 3CZGA 1R8LA 4AD2A 3VIPA 1X6NA 1UWTA 1MXGA 2YA0A 3TONA 1EDTA 5A1AA 2WC7A 1RP8A 1JI1A 1XH0A 1DWGM 2DSUA 3MMWA 4AEEA 2YJQA 1E6PA 1OT1A 4J3UA 4AEFA 1SFSA 4HPGA 5BXSA 3RM4A 5EB8A 2VZTA 2XN0A 3TV8A 1G5AA 4BA0A 2EO7A 2V5DA 1WE5A 1BAGA 3ZJ7A 2OYLA 3ARYA 3CUHA 3CLWA 4GZIA 4EE9A 3SCPA 2XGBA 1E3ZA 1B3WA 4PEEA 3WNOA 4JIEA 1EQPA 2J4GA 1E1EA 1R7AA 3WELA 4HZ7A 4KH2A 2ZWZA 1C8QA 1H49A 4GZJA 4NZCA 1PS3A 2J7BA 4KGLA 2WC3A 1Q6EA 1MWOA 1HJSA 3PZVA 4AZ6A 2VR4A 2PWGA 1BG9A 1Z32X 4PYSA 4MPKA 1UA3A 2F1AA 4MNKA 5IFPA 2XPKA 4AZ5A 1MW2A 3KEHA 1TQUA 2D0GA 2GDUA 3RMEA 1KGWA 2VR5A 3VIOA 4AD1A 5AC4A 2ALWA 2PI6A 1KTBA 4A3HA 1W9DM 4CD7A 4MNLA 3GXFA 2IXVA 2XFFA 3ZR5A 1LWJA 2ZWYA 1C90A 2D23A 3RJYA 8CGTA 4AW7A 3EJQA 2Z1KA 2W63A 5D9PA 2CIPA 5A6BA 3THCA 3ARXA 4JL2A 3L4XA 4W7WA 4CVUA 4ATDA 4YPJA 4U5KA 3LRLA 4GO8A 1H11A 3A4WA 4OBRA 4M8UA 3OLDA 3LRKA 3T0AA 4Z2HA 1V3MA 4QDMA 3AS1A 2WLZA 1UASA 9CGTA 3VM7A 2YL6A 2QV4A 2F7OA 2YL5A 4RL3A 5GNYA 4XV0A 1HVQA 4Q22A 3WNPA 1JZ3A 3BVTA 3W53A 3POCA 4NZFA 1W3KA 2DSZA 1E43A 3WF0A 3BVWA 3A6OA 1ISVA 3SCTA 1KXQA 3WY1A 2CXGA 1OIMA 1V3IA 2ZUUA 1UD4A 1NWTA 3FN9A 2BXZA 1C3FA 1TMQA 1HXJA 1KBBA 1MFUA 4BZYA 5BROA 2YA2A 2YLLA 3UR7A 3LPGA 3SUSA 2V5CA 4DWSA 4UZUA 4UOZA 4D6JA 2DT3A 3VMOA 2NT0A 1QI2A 2D73A 3MSGA 1NOWA 3RDKA 1E5NA 2VX5A 4B9YA 3BGAA 1E6XM 1JDCA 1M03A 1ZJAA 3BAXA 3K8KA 2WMIA 2PC8A 3PN8A 4JFWA 3ZJ6A 1U30A 4E8DA 3VVGA 1GW1A 2XVNA 1I75A 1J0HA 2GJXB 3UESA 4FNSA 1BYCA 1VEMA 1VIWA 5A8MA 2WB5A 1UR9A 4JHOA 4XUYA 1E5JA 1YQ2A 1GVYA 1TR1A 1R86A 4UFHA 4X9YA 2D1ZA 4CCCA 2GFTA 2G4FA 1GONA 1JG9A 1V3JA 1JNEA 1WKYA 4HPHA 2GDVA 4RE3A 2E9MA 2GJPA 2E8ZA 3EDJA 2JIWA 1OINA 5A2CA 1UR2A 3GNOA 3M07A 1JFHA 1HF6A 3K46A 3PTKA 4KGJA 1WDRA 2JEQA 1PX4A 3GZAA 1ISYA 5CLWA 4Z2GA 3BAYA 2DT2A 1AQHA 4ZE5A 3T0DA 1PX3A 1KTCA 1V6UA 3T2OA 2FGZA 4JL1A 2WNWA 3BUDA 2WCSA 3HZ3A 4M80A 1BVZA 2ZUSA 3WSUA 3WF3A 2OWXA 1GOKA 4QFUA 5DT7A 5CPTA 2X0HA 1B9ZA 1QWNA 2OW7A 4D1JA 4FMVA 2J7CA 1V6VA 4D6FA 1L8NA 1MQRA 1CLXA 3N04A 2J7HA 4DUVA 1UA7A 4UQCA 5E9AA 3LMYA 1PZ2A 4P8WA 2YBUA 1H41A 1GQIA 1XHGA 3ZQ9A 2V38A 3SCVA 2VNCA 4WLCA 1MXDA 2CESA 3CIVA 1TE1A 1WDPA 4J3TA 3U5UA 5CXPA 3WBAA 1H5VA 1M53A 2YDSA 4M1RA 3LXBA 3FXYA 4URIA 3NDYA 2X2JA 1BYDA 1UD3A 2D3LA 1HNYA 2CNCA 2VZVA 3GH7A 3VNYA 1K9EA 3FHQA 3RILA 1E0VA 1OIFA 2XFRA 4OKDA 5TD4A 3VIJA 3WFZA 5EMYA 1B1YA 4JKMA 1C7SA 2YIHA 2BY2A 2WHJA 2JALA 2UY3A 2WAGA 2NT1A 4PCTA 1SZNA 4WKAA 4NX0A 4PMQA 4DWSC 1WAWA 1HJUA 2VZOA 1GOQA 5D8WA 5A6MA 1UZ1A 5JBDA 3AIBA 3ZMRA 3OG2A 1FP9A 3WD0A 4D6HA 3TTOA 1BPLB 3VOCA 3TTSA 1UG6A 4MDOA 4DWSD 2JF7A 4J3SA 3CUGA 1CTNA 3WEOA 1CGXA 1EHAA 2EPOA 1V3LA 3VSVA 1VB9A 1GJWA 1V0LA 2WZIA 4F66A 1F4HA 3SCSA 3WDPP 4M29A 3TA9A 1TA3B 3AHTA 1GQKA 4NRRA 2UY4A 1JIBA 2EXOA 1KCLA 2GJRA 5BXTA 3S6TA 4JCMA 1HL9A 5M17A 2EPMX 5EFDA 2OYMA 1UKPA 4ML4A 1VFOA 1BGAA 1SYTA 4LYPA 1R47A 1XCXA 5DO8A 1UD2A 4GI9A 4AYGA 1V0MA 2XTKA 4QLLA 4M81A 3EDFA 1FFQA 1XSIA 4LX4A 3GTNA 4MNJA 1GZJA 3SUTA 5HPCA 3IGUA 1JYXA 3VD5A 1FH9A 2D20A 1E6ZA 1MW3A 1E72M 2CETA 2FGLA 1IZKA 4HTYA 3BMVA 3ARUA 4PSPA 4WK9A 3W6LA 4W7VA 1VFMA 3W82A 3TTYA 4UFJA 4PMZA 3N15A 2OWWA 5E1QA 2WVVA 1F4AA 5CG0A 4M82A 4LGXA 2FHBA 1PX8A 3MV01 1WB0A 4DUXA 4DWSB 1OGBA 4MADA 1JXKA 1XV8A 4ACYA 5I0DA 2J8FA 1E4LA 3EJPA 4NXSA 4JFUA 1W3HA 3A47A 1EOMA 2WHLA 5LA2A 3A4XA 2VX7A 1XH1A 3QOMA 4FLQA 3N12A 1EDGA 4V2XA 1SMDA 3BUQA 5BCAA 1HWWA 1QW8A 4Z2KA 3WNNA 4TUFA 5FIPA 2DGAA 2GJXA 2OW6A 4W84A 3SURA 1ZJBA 1LG1A 3K1DA 1E70M 4GZEA 5M3WA 2C8NA 1B0IA 2WHKA 3AISA 1B2YA 1R75A 4UTFA 3DDFA 3BMWA 3W29A 3CMJA 3IJ7A 1KR1A 1VEPA 2XVGA 3CHEA 3NIYA 5FL0A 3T0BA 3VDAA 3ARPA 3VMNA 3FAWA 3UERA 1XC6A 2ESCA 1GNXA 4Z2LA 3SCUA 3MSDA 3NSNA 1LG2A 5HOSA 4M56A 4LYRA 7A3HA 3B9EA 2UY5A
chains in the Genus database with same CATH superfamily
2FB4H 3NJVA 5JZ7D 5A43C 2CERA 3BO8A 3WE6A 1EAPA 3AXXA 1SHSA 2K9UA 5ENWA 3ME0B 3WE6B 1LWHA 4M7LT 4I3RH 4ZMLA 1SYSA 1KN2L 1S9YB 1HQTA 4Q7BA 3CDGB 2DQDH 5JVLA 3L3GB 4BEUA 1JWSB 3NPSC 4Q4OA 2NY2D 1BBDH 4WTZG 2VD9A 3AFBA 3LYEA 5FUZH 2JIEA 4ENZA 5DRCA 1INDL 4D9LL 3S2MA 1SHXA 3UPAA 4NPYA 2ZP0T 1ID5I 3QJHA 2ZZ7A 4GYFA 1CURA 4OUIA 3W2MA 2OX5B 4HU2A 4PRPD 1XDLA 4GPNA 4AZ8A 3CU1A 4R9HA 5HPMB 2Y8UA 1OFBA 3LHAA 5CN2A 1XXXA 4G2DA 1T1YB 3I6TA 3BP4A 2A85A 4NUWA 3HE7C 4QHUA 5EGRA 2ZRVA 4GFXA 1X5HA 3ZHDA 4NQSB 3F1QA 4O2EB 4Q89A 2WLHA 4BV1A 1GZHA 5A7EA 2GL5A 2WUCH 4BI6A 2HVJB 1AR1B 2L7UA 5E4AA 5C0CA 5A94A 3RAJH 1OSZB 4ZUUA 5BUAA 1FZKB 2WWKT 3DHJA 4QGTA 8FABA 2XA8H 4P7RA 2FX9H 2HEJA 2WXFA 4OF3A 1ZT4A 3WMQA 3HS9A 4CU7A 3HQNA 4TSAH 4Z3IA 1DVXA 4L4VB 3MB9A 2OXGA 4X2PA 1FLRL 3O8XC 4GP5B 4O02B 3CPLB 4ONGL 4FXGA 1T8XA 4AVHA 5KANI 2DQHL 1EX1A 2OJPA 2OXGB 4Z7NF 1VBHA 2YO3A 4AY8A 4AUYA 4NRYB 4GE8A 5I00A 1XMWA 4L5FH 2QLVB 1PKQA 5T5FA 3TSBA 4K2UH 4L3EB 4M1GH 4HG4J 2CBPA 1LNUB 5F7HA 1JRHL 2Q3OA 2CSPA 2C1IA 2YXOA 4YSRA 4Q14A 1NIUA 5FAGA 5A3ID 1P4LB 4TM9A 5IB2B 2QDGA 3G5ZA 3KVKA 3C6LB 5EOQL 2VJ8A 3GO1L 2XWZA 3HUJA 5ICUA 2PDFA 4N9OB 4MPQA 2CGRH 3VXSD 1LL6A 3AUOA 3VXMB 3BQUC 5FA4B 1OYBA 3W5MA 2HJLA 4D6CA 3MBEA 2FR4A 4Y9NA 5IHZA 4L0ZA 1OY0A 5AFAA 1L9RA 1SYVB 2BIPA 4IUGA 4L4MA 3TN6A 1IGMH 2L7EA 1I7RB 2CA3A 2D3JA 4XP1L 3BUBA 3N06B 4GX8A 1M56B 4M5ZL 2H5UA 3NL3A 4UFMA 3N11A 2Z24A 3HUJF 4PHXA 3LTYA 4RAUA 4DUOA 2EE3A 1UT1A 2J1WA 2VLKE 1FN4B 1N3NB 1X4XA 4HOMA 1LO2H 2EDJA 3LTVA 1X8CA 1ZLWH 2DZSA 3VYOA 4BZ2L 1POKA 1Q8MA 4L8SB 2VEMA 3JRKA 5GSVB 4PRHD 3BP6B 4IGBC 4Y2DC 5GS3A 2DWEA 4YHZL 4MAVA 1DWAM 1S7QA 3P9WB 4I8DA 3OV6A 4UMBA 1NCBL 4WW2C 4YUEL 1T03H 3IJEA 3ENEA 1TV2A 3QWNA 1VPOH 2CDEB 2YAFA 4APQC 2Z29A 3TZVC 4L8CA 1L7IL 1B90A 3SKUD 3ARFD 2A5HA 1U42A 4N9GB 5TDNA 1S9KC 2ORBH 4L37B 1G7HA 4NFCA 1AG1O 2ZWSA 4GW4B 4IL0A 3MV8A 1K8DA 1BBJA 4ORMA 1EFXA 2FGWL 3RLGA 3H23A 4KRMB 1MY5A 3BP5A 1KLZA 4XISA 4NYLB 4EAEA 3RL2A 1GPWA 3U3HA 4W9DC 4IJ3B 3PZMA 3QXDB 1NMCB 2XXFA 4ABQA 1BRLA 1YYMH 4JTIA 1SRDA 3NEXA 5GS0H 1URZA 2GY5A 4K2SA 1GHRA 2JIXA 2DBJA 4HWEH 4YS4A 1K6WA 4C65A 1JWUB 4JFOA 4JHUA 1UD6A 2WBWB 3IJYB 4UQEA 4AUBA 1DEEA 2VQUA 2EIKB 3AY4A 4S1SL 2OZ0A 3CT2A 1AMYA 3O16A 5DRIA 3W7KA 3V8CA 2XSAA 1PKNA 4NO2B 5KJRH 5AC8A 4KMQA 5G5IA 4I6KA 5GJSH 1ZLWK 2DTMH 4QRPE 4GBDA 5D7SH 4PMOA 1CGSH 2WBJC 1FHLA 1DDHB 1IHIA 3LEXB 5LB1A 3M5VA 1QLEB 5E23A 1NJJA 1OGGA 1QFWI 1W3LA 2CHRA 3QQ3A 4H41A 3RDKA 3DX1A 4KY1H 4JICA 4LHUA 2Q02A 3MV7E 3N85L 1P5BA 1S7WA 3FDGA 3F2DA 4MUPA 3KXFE 4DGIH 5JIIA 1XBRA 2IXUA 1SEBA 1XIIA 3JV4B 1BEYL 3DH7A 4FHAA 3TX9A 4PV9B 4QXTB 2VEKA 4ZS6D 4PMRA 3D09A 3BOXA 3NQAA 2ZTKA 4NO0B 4KIEA 5D7KE 1YXCA 4DUWA 1DBMH 1DTUA 2ZZ1A 3HCVA 4M5YL 4QCIB 5I17A 5BOEA 2EDYA 5FO9A 1J87A 2O72A 1B3IA 2FEEI 2YN3A 5I5RA 4UM8B 5RUBA 4HFUH 3IKKA 4Z3TA 1YMMD 2O6CA 2V8LA 1O9VA 2WO4A 3VFSB 1LWRA 1TQCB 2VLKB 2R1YB 3MO1A 1A4JA 4FXKB 1WUEA 4MJ6A 4IWWA 2NW0A 4OKVA 2AF2A 1A9BA 1KEGH 4UTHA 1TLKA 1KY7A 3SE3A 5FEXA 5JQ6L 3GKZA 3N1AA 3RVUD 1QR4A 3NZPA 1U8OA 4Z2IA 4LLVA 5FKYA 5M1TA 1QATA 2J72A 2VMFA 1ZLEA 3VFMA 1BG1A 4GQGA 1MFNA 4K39A 4WWOA 3HQ1A 4CD8A 5EN3A 5L0QB 3E49A 1FG2A 2EDFA 4HJ0C 4PRPE 4UV7H 3HZKB 4EZJA 5I19L 4UYPA 3WKPA 3QIUA 1YDVA 1KTDB 1XGQB 5EZLA 1JPFA 1ZXKA 4WI8A 3EAUA 3HB9A 3L67A 5IXEA 3WFLA 4DP0X 3FFCD 5AAMA 1TJHH 3QZWA 4YXKL 4OZFG 3C2YA 3CS2A 3EWWA 4CU8A 3UW6A 3OKDA 3WKYA 1GOWA 2J1YA 4M7KL 4P46C 4QF1A 1N7ML 2VL4A 3GLEA 3LXUX 1U4EA 1KV8A 5AY7A 3UY7A 3H9SE 1ORSB 1EO8L 5HGBB 3VWKD 4QR7A 5HXMA 4ACZA 2X42A 3GMNB 4DVBA 3BVVA 2YK1H 3PFUA 5HD8D 2CITA 4A2HA 3I6GA 4NRZB 1XX1A 4XAZA 3PWUA 1BLNB 1G7PB 1W3JA 2VXSH 4K94H 4KI5D 2D2GA 1EEZB 4F33B 1VFBB 1K02A 2WKLA 4YSDA 4RISL 5AVTB 4KTDL 1ZD6A 1L9MA 2ED6A 1A4LA 3MJ8B 3OIXA 1RZPA 4IIHA 4XZMX 3S47A 3KPLA 5FK9B 1TVNA 2G4EA 1AO7B 3MLXL 5E6YA 4PMFA 5CQ1A 3GIQA 1VYPX 2E47A 1IAII 1INQB 3CSPA 3W1UA 3EO0A 3PS6A 2D7PA 4BQ8A 2I17A 4LY4A 1XZ0B 3B9KC 3ZYIA 3TSMA 4LAQH 1IC4L 1OTUD 1BHGA 1BF5A 1XFCA 3Q1SL 1EZWA 4QNPF 5B3NA 4JIPA 2LGNA 1TJHL 2WSPA 1ML1A 2EG6A 1NM4A 4LCIH 3S36H 2VC7A 1HT6A 3CFCH 3FKUS 2Z2AA 4IFOA 5JW3L 3CSGA 1RH8A 2D7TH 3MJ9A 3OZOA 5FF7A 2ZVIA 4NO0D 3VRJA 2BCKA 1S5NA 3H2AA 2IOIA 3E6FB 4LXFA 4PJ5E 4BE5A 5JYLA 2CGRL 3CAQA 5E03A 4IOIB 1ZJHA 4GAGH 3LPOA 4WFGD 3ZKMD 2GCYB 4C4UA 2WKGA 4H7ZA 1TQVA 3IFNH 1WZAA 4QIUA 3T08A 2V3FA 1I60A 2XY2A 5IHUL 2JI3A 1UWQA 3VKKA 4RGNB 3MCNA 2OSYA 2QMJA 3RJDA 1V55B 1JYNA 3VIHA 5BJTB 3RI5F 5REQB 2DIAA 4PTDA 4DBEA 4AIOA 1YC8A 4NLHA 5CGMA 2EXWC 2A74C 4Q8PA 4N0UA 3GTHA 4OSUH 1B3ZA 5E2VH 5KSVA 1DWFM 2UZXA 3VIKA 1IE4A 1RZ8B 3TV3L 2OLDA 2QCLA 1N68A 5KZCD 3M0VA 4HULB 4HHLA 4FI7A 2HYMA 3AIWA 2ZUXA 3P77A 4WV1A 3BT2L 4O4YL 4TQPA 4F5CE 4UQAA 4DJEC 4L8DB 4N2LA 4CSSA 1MCKA 1CLZL 3S88L 4HK0A 4DGYH 1TJ1A 4I7VA 1JFQH 2A83A 1QAWA 5CD5D 2DVUA 4RX4D 2A5UA 3CUZA 4Q4SA 5AHLA 2QTEA 2QJGA 2G3IA 1BKSA 4E9SA 3OB8A 2IBZY 5FSDC 2NY5C 5SX5K 4Y2OB 2PPEA 1TREA 5FYJD 4Q52A 2J6WA 5LLIC 4MLJA 4AY1A 1BZQK 1BOGA 4QX4A 1TZGH 3MRDA 3GMRB 4ZTPH 3SODB 5HYJD 4GUQA 5H2ZA 1EWHA 2C3WA 4H40A 1J5HA 2F6XA 3A3XA 4Z5RA 2YZRA 2DH3A 1YYML 1LTXA 2GTWB 3DHPA 1P4IL 2W9DH 1OQOA 2XETA 4GSDL 3OKYA 4GBXA 4IOFC 4QRUB 1RUAH 3UEQA 5JOPE 3PHAA 3WQWA 1XICA 4H0IA 4ADTA 2WLKA 4GKNA 4L1HA 5F6HI 3V0IA 3OKMA 1XTMA 2IADA 3THML 4M02A 5T1JA 3UAJC 1OC6A 3SDAD 1LOSA 4XXWA 1JZGA 4JM2A 3CSYA 1J5IA 3TKFA 1T2JA 4HIIB 3A5VA 2CCRA 5HNNA 5GGQH 4BFBD 2IH9A 2IDTA 4HIIA 4AGOA 3LRSA 1XAUA 4ZFGL 2YCIX 4I9AA 3ZDYF 3S5YA 3WLWD 5E9NA 1RD5A 5LHEA 2FL5B 3EOYG 2AKRB 5JXEA 1W1A1 4QR6A 3NSXA 3CQJA 3WD1A 4F3FA 1ZPTA 5EO9A 4FQJL 2J71A 4OE7A 5D6CB 5FYLD 5JNYB 5DUBA 4X2RA 2V17H 1UR1A 4E8GA 1DXEA 4M3HA 3VACA 3EWZA 1GQJA 3V1PA 1KO0A 1MPAH 3W9ZA 5E6IC 1G7JB 2DJXA 1NCIA 4PRIB 3UH8A 3IARA 1Q1JL 4MAUH 4FQHB 4FLHA 3SRKA 5HDLA 1FWTA 4U3CA 5AZEH 5F2GA 3BOFA 3TS8A 1RFDH 1THFD 1LILA 2Y7FA 3MOBH 2ZDRA 3KCLA 5EMMA 5H94B 1DVFA 3D07A 2OAAA 2W9DL 3L2NA 4XCYB 3S96B 4PJIB 3D39A 1BWVA 4ENED 5I15L 4DYEA 4DFIA 1KXHA 3GS4A 1T1ZA 1XSKA 2LTQB 4GIAA 4A35A 3O6ML 1PLGL 4L1BA 4XPTL 4A7UA 3T8QA 4POZC 3OO2A 1YAZA 3CUPA 2BNQD 4FQ2L 3WUWB 3TO2A 5KZCB 2ZIDA 1YG9A 2ZX5A 4XWGH 4LRIC 3VGGA 1M2OA 3BPCB 4N8UA 2KZHA 3EH3B 4HV8B 2F7QA 3FO1B 4WEUD 3BDXA 2APWA 4OV5A 2BFVL 3CAVA 3MKCA 4L5ZA 2B9BA 2NXZD 3W85A 4Q6YA 4U3SB 5FW7A 1C9SA 3HAEH 3I6KA 4I5BB 5TH2B 4HLJA 2OX5A 2ODIA 5I8OH 1J8HA 1EC8A 4I5BA 5TH2A 2FZMA 2DH2A 4P2RA 1V54B 5IHZB 3L4WA 2XH4A 1NGPL 1BVNP 1HSBA 5AWNH 5L2JA 2WAHA 4RMQA 1GOOA 1HKLH 2AAMA 3QPEA 2QKIB 4HJEA 3W23A 3WQ5A 1GH7A 3TPKA 3BRDA 4IXXA 1NIEA 4ZDHB 2H2PD 3SE4C 3QNXA 5I18L 3VIIA 2FIRT 3MRQA 4KAQL 4AYEC 3C8FA 3FT4B 4PJFA 3AITA 3VFWA 2EKCA 3QI9D 4ZDHA 4HU0A 2R51A 1E8XA 3ML8A 1S4IA 2C26A 2FWUA 3PNWB 1PBGA 2CHDA 4IJRA 1NC2B 4WK0B 3V52L 4LOUD 1KYOJ 4K7VA 4GB9A 5HNTA 4Z76B 3N55A 4XCFH 1HJVA 3BKJL 5F7LB 4IXHA 3YPIA 2IKHA 4UR9A 4R4BB 1SY6A 1A49A 4I7WA 4CLMA 4RPQA 4FKHA 4UB0H 3I6LD 1WC7B 3V95A 3AOFA 4Z08A 2D22A 3QRBA 5DZ9A 3IWPA 5FD0A 2AJVH 5DZJA 1YEKH 1DQIA 5B39G 5LDSA 1V02E 5J3HD 2ALDA 1TYGA 3NGBB 1P7KB 5K4XA 1HKIA 4JG1H 1VHNA 4HJGB 3PREA 3C9NA 4NQEB 3C6LD 4H20L 4ZUWB 5KYXB 4JQ1A 3BIKA 5HHOB 1K8DB 3RE0A 5HK4A 3MRMB 4AF0B 5BOOA 3DWTA 3H12A 4GBXC 5HHOA 4C5ZA 3S34H 3QKZA 2OI9C 1PSCA 2VLLB 1KJ2A 1DQML 3ECUA 4K5LA 4A2DA 4LVBA 4XX6A 1HXKA 2V63A 1S78D 2H8PB 3AIEA 2DIBA 4PJCE 4XAGA 1T0NA 3ZHLA 3MLTA 2HUHA 2XVKA 3DKHA 4F7CA 5H8UA 3WL0A 1NBZB 5C0BB 3JVAA 1EBAA 1FKWA 1G4PA 2C18A 2J9ZA 5J9PA 1AVAA 2ZWLT 3QZNA 3F6LA 4HPYL 4WK4B 5FUOH 3N43F 4HDIA 1EC7A 1FDLL 2PDBA 1SLVA 3CX2A 4HA4A 4NENA 1GMEA 4GJJA 5BO1L 2CIKB 4CKQA 2XIMA 3TC3A 4XE0A 3PUEA 5I28A 3WBXA 2ZRUA 6REQA 5BW6A 3GXNA 3U82B 4MMWA 2Y6SD 3C0LA 3IT8D 1Y7VA 4KQ4H 5ID0A 1KACB 1DBKL 1RAMA 2CAKA 1LJMA 3PUOA 3ZZSA 1JNJA 2XV3A 2V2TB 4CNIB 4BFAA 25C8H 2R0LL 2WVUA 3V75A 1HSAB 1FLTX 5FYLL 1U3ZA 3KAAA 1OGTA 2AQ1A 2Q76B 1O7VA 4L3CB 4ZFQA 2DORA 4KRUA 3SFWA 4KQ3L 1AS7A 1OGTB 1O75A 3BLPX 3CE1A 2X70B 3HE6B 2ZE3A 4MDRA 3R8BB 2VMCA 3U5YA 3DFQA 2YMTA 4MMYA 5K9OB 3A4FA 1I9IH 5C8BB 2Y89A 3G6MA 3BCDA 2R1NA 3UG8A 4XPGL 1MXSA 1IVLA 5DQ9A 4N2HA 1EP2A 1ISWA 4WQ6A 2DW5A 1I1AD 4B9KC 3PWGA 3FNDA 4NT0A 4QSHA 4NG3A 3UPBA 1SY6H 3NCWA 3KBHE 4OIIH 3KPRB 3VRLF 5DHEA 4H01A 3CV2A 2YQ3A 2ZKHH 3DLQR 1K7EA 1XP3A 5XIAA 4IEFA 1MG3C 3F04A 4PP1C 5CLXA 3VFVB 1V4YA 1SJVA 2ZXBA 4C7DA 1CFMA 1B2WH 3TOPA 4Y4KD 1OB0A 4R4ND 2QQ6A 1UURA 2BB0A 2RJMA 4LCCB 4H1ZA 2A6DA 2NTFA 4YBQC 5I0WA 2G95A 5K7JA 4JD4A 3RHGA 2DMGA 2WMPB 3SGDI 1KPVA 3UTTD 5LSMA 5CM1A 4Y5YA 3ZVHB 1AZUA 3WD5L 2W27A 1QBLL 3H22A 3LU2A 5T1DH 4FQQA 3I9IA 3UTZA 4G8FA 4C4KO 2VX4A 3AQUA 5I75C 3U36B 3W39A 3TASA 5DGRA 4FTVD 4K71B 5CBEA 3UJJL 1DQWA 4UTAL 1SEBB 1OK6A 3BO8B 2CD0A 3I6GB 4NRZA 2GI7A 2YD0A 2R94A 4PC8A 2KT6A 1LQ0A 2XV2A 4EPDC 3STBA 1MNSA 5EMLA 4URKA 4I2XB 2CPUA 4O5LL 5EMUA 2CGZA 1NDWA 1D7DA 2IPWA 4H8VA 4ZZ9A 4E8CA 2WYHA 5D05A 5DY3A 4DERA 5I17B 3AROA 1TPXB 4AVNA 2AXGA 4LSUL 4BRVA 4B3KA 2CO6B 5I6KA 4QG6A 5T91A 5T1MB 2R8SL 4P3WA 3GSNB 4E9WA 1ADSA 1U1UA 1SDDA 3FVMA 5FF6A 3CNKA 1U91A 3IWVA 2XFWA 4GRWH 3KTXA 4PG2A 1KJ3H 2OMVA 1Q6OA 3S48A 3BWWA 4PGJA 4UTBA 3ZVVA 3MRHB 3V7AG 1E56A 4ZENA 1W91A 1SPDA 5HUPA 4RAVA 2J5LB 2G30A 4FALA 4XPHL 1WT5A 3N3MA 4G42A 2AKZA 1TVPA 4Q0XH 1MH5A 3DCPA 2JCCE 4XZNX 1P7QA 3R7RA 2LLGA 4N2KA 3W7EA 4L8SC 4C6EA 2C71A 1D5MA 1NP2A 1JHTB 2GGEA 5CCHE 1HOCB 1OAXL 4KZDL 1VGKA 2V5SA 5HTSA 2CK0H 1KUMA 2O9RA 3Q1EA 1K8YA 3TVMB 1YDPB 1TQBC 2DQIL 3O1NA 1KCXA 1TFPA 1LL7A 3QR0A 4ZFFB 5DQDL 1S9YA 2V81A 5AL0A 4L56A 5IRPA 5CJ8A 3PE9A 1SW0A 4U1KA 3UMNA 1RUSA 3QEUA 3JUZA 2QW5A 3L08A 4U4MA 1H50A 1IF2A 3WQ4A 1QPOA 2ITCB 1IR2A 5MENB 3B8WA 4QOKE 4UNIA 3WK2A 3HUJB 4C6NA 3DBXB 2AJ3B 2HKHH 4S1QH 5KVEL 3DUSA 1HXYA 2BP8A 1A8ZA 5ANME 3W87A 4HH9B 3UWVA 3U83A 4R3SA 4NAMA 1A3LL 1U33A 3UWWA 5ADOL 4G6FB 3WF4A 3IPEA 3RWEA 3S6DA 4CVWA 3GIYA 1WGOA 2WTOA 3AXLB 5F89B 3HS0B 1YNYA 4GQQA 4BS0A 1FCGA 2Q7YB 1G1KA 3SGEH 5C3IA 5M95B 3HS0A 1TCRA 4PJ9B 5IFJB 2APSA 1W8GA 1DJSA 5GRVL 3VRIB 3QGAC 3HMWH 4EF8A 1V7AA 1ZOXA 3EG9B 3R1GL 5I24A 4X7CC 1X9UA 4A05A 3PWLB 3M0ZA 3W07A 3WMLA 4I8YA 2LU4A 1E9OB 2DQJL 1JXGA 3C60D 3MANA 3IEAA 3A9BA 5A8NA 4IKKA 5CEXA 5DD5L 1Q72H 1CXIA 3GM0A 3SYQA 3AQYA 4DOHB 1NDTA 2WW8A 4EN3D 2NUWA 4UTTA 3BZFB 4X2UA 1H4PA 4LGPB 3SKMB 1JGVL 2JKIS 2ZFAA 3CTTA 3HBLA 4J3ZA 2YL9A 1NGYA 3HG3A 3DOPA 1BQLL 3ZHKA 3IMBA 3KL3A 4JFEA 4A3YA 3BN3B 3J7HA 3ZKXC 2OBGA 3OGCB 3OMZA 2IVFC 3QEQE 1IGFL 1A4CA 4OJAA 5D38A 1GUVA 3QULA 4ASTA 2BNJA 4XP5L 3KG5A 4KVPA 4QHNA 4MJ5A 5EZOH 5AW4B 1G6CA 3RO6A 3C12A 2NY3B 1Y5XA 1R34A 2Z93A 4JAMB 2HPTA 5DJXA 3WD2A 4OLYL 4GCAA 3VIGA 3ZOAA 1PKOA 1AI1L 1X9LA 5H37H 3SQBB 1QO2A 4PBVC 5EBWA 1PS9A 3FJ4A 4LV4A 5ABHA 5FV2A 5BRQA 4YXHL 1I2PA 5DMJB 3T6CA 2UWEB 3K3QA 1W3NA 4M48H 1XFPA 3V1HA 2XGIA 3OAYH 5F0PB 1RZKL 4GMSH 3CVHB 1X1OA 5D7LB 3KPPA 2BXVA 2R1PA 2FB4L 4HZLA 3CVHA 4R2GD 4JGMA 8TIMA 1M05B 1XEUA 3R4DA 5EO1A 1WNOA 5BZDA 3VG0L 2NV9A 3MLVH 3GTIA 1U2YA 3EOTH 1A64A 3WQ8A 3MZGB 4BSWB 4JNMA 1OGAE 2G5UA 2YKKA 1W1TA 2FSEA 5GS1B 5LDUA 3QXWA 3BLBA 1UH4A 2FIQA 4KPHL 1CTMA 2HT3C 3QUZB 5JA9A 4IRJA 1O7AA 2NCEA 3X3FL 5GS1A 2ZYIA 1JV2B 1JNLH 1Z1WA 1JERA 4UTCA 3CQPA 3KYKH 1A3HA 1INDH 3RDTB 3VGHA 5IESH 4TQ8A 1XM3A 4N42A 4BI7A 2MEJB 2ZXEB 1WTGT 4TVPL 4XAPA 1B2WL 1OF2A 4F2FA 3FKRA 3TN3A 1UJ3C 2ZTBA 3MGOA 3WIHL 4DP5X 1DLFL 2HKAA 3IF1B 3JVGA 4M5SA 1FCVA 4NOFA 3G5VB 1CGUA 1XQ4A 3DX7A 3RL1A 3M86A 5GRJH 5DR5L 1WOAA 4PB0L 5DD1L 3CO4A 4FCHA 3SGZA 3F7LA 1OAZL 4DP9X 3S0CA 4UTMA 2Z00A 5F7KC 1I1YB 4LLWB 4MCYB 3IU3A 3QC6X 3A67H 4MBRA 1TWZA 2HFGH 3QHZH 2CQVA 3ZL4L 2UBPC 3AHVA 3CO8A 3GSMA 4TVUA 3VC5A 5LHFA 3JT2A 3UYOD 1VRXA 4K38A 4H9VA 1ITXA 4BK4A 3H4FA 4ZS7H 3DRTA 5ECJE 4B0MB 4Y9EA 3G1VA 1GKOA 3NZGA 3BZGA 3TNMA 3N4FA 4JNZA 3M0XA 2Z65C 4P5KB 2ORBL 1GY2A 1OGAB 1G84A 1TIWA 4PJIA 4RNJA 3L7FB 4HEPG 3S2NA 1MCPL 3U6XS 3CQFA 3WDIA 3BKML 1T1ZB 2J8GA 3JZYA 3EOUA 4R4FL 2AQQA 4GMTL 3BH4A 5CSSA 1CX9A 2X1XR 4DI9A 2GT9B 2N3JA 3FCGA 3KCJA 3H2EA 1MI5D 3GB7A 3C9NB 4RIRA 5DJ0A 2WINA 5C0AB 1MFVA 4DZAA 1QI0A 2D7MA 2EXWD 4GKSB 1JPMA 3HPJA 3LV6A 4ZMYA 4QRRE 4Q4EA 3DDMA 3ITXA 3KZPA 3ZVIA 4FJZA 1A3RL 2WNNA 1S5VA 1RSYA 5A6JA 3QDJD 4KTEL 1FWWA 1YNPA 2ATPB 1UEYA 4JY9A 3CFJB 3LHPH 3UBPC 4Z7NB 5CZXC 2V33A 3GG0A 2VXQL 2ZCKH 4WNQB 1LO5A 5TQ2H 4UTWA 2JF1A 4H25A 3E9TA 4LCYB 2CZDA 5ICYB 5FK9A 3W7HA 4ES8A 1SJEB 2HVKB 2X4RB 4PQXA 2YC1A 3HI6L 1GPFA 4F7EB 4J1OA 1EUNA 3EH5B 3PZIA 2AS5M 2Y7EA 1QFWL 4GG6A 2VH5L 4X4MA 1XF5B 1CDUA 2C1HA 2JXMB 2XYLA 4L6HA 1ULVA 4RWYH 4AZUA 5KYNA 3Q2LA 5EFIB 2WVSA 3AAMA 3QXUA 5A6SA 4ZTXA 1YPIA 5LN4A 3HURA 3T65A 1WX0A 2ARJB 1XSJA 4WGWB 3IJDA 3HJ0A 5B1AB 1B3YA 3FPXA 1K8IA 1XF4B 5DMKA 3NIFB 4ZJ9A 4L64A 5HATA 4L3EE 3AQDA 2HG0A 2XG4B 1FL5A 3DYOA 3L17A 5KVMC 3VD2A 4NASA 2PCXA 3MNZA 1UZDA 5DC4B 4ZO8A 3PAOA 1RURH 2XHYA 5GGSB 4TUKH 3AU0A 1O7DE 4K3DH 2MANA 1G6RB 2W60A 1A0QL 3FQWB 4Y5XA 5D1ZC 4KETA 2B4CC 2G96A 3P4LA 4BQ4A 4JZ5A 3QQNA 1KGCE 3QIUC 3G0SA 1H0DA 1WUZA 4B7LA 2NWSA 2TMDA 4OZFA 1NOAA 1ONQB 4JQIA 2WQAA 2FTWA 4LP8A 3EBVA 2ZCHL 2ILLA 4W9IC 3BN9C 4G9DA 1W6WA 3VJ6A 2X4SB 1Z5LA 2J7EA 4EBQH 5G2IA 5GGTH 1QWHA 4RWYL 3F5KA 3FQ4A 4NZ1A 5AHFA 5EC1B 5C0EA 4FOUA 1IUZA 2WNKA 1VLIA 1JGIA 5LXXA 3SKOB 3WN5B 1KCSL 2KZBA 4OGAD 5A8QA 4XD5A 3BXNA 5AZ2L 1R3VA 2Y63A 2WIIA 3GW3A 1USQA 2QSCH 3MWAA 2HISA 1ZHLA 2VWEE 1FP8A 1YBQA 1BQHA 5JUEH 4ZMTA 4JQXA 1YMHA 1W9PA 5D8JH 4RCAA 3VM5A 1M9SA 1YBQB 4LAOA 4YQXL 1I85A 4FLSA 1J1OL 1V3HA 4DP2X 1EAOA 5L6YH 5E5MA 4YNGA 1MFBH 5EOCJ 1N59B 1X5ZA 1ZT7B 5TF1L 4PJ7A 2E4FA 1A6VH 1RIUL 2DQFA 1DJGA 1HQ4B 3DROB 2H3BA 5KS9A 2O61A 3KL0A 2ZYHA 4EDWL 1OLLA 4LBRA 1PY9A 4BZ2A 2E7BA 2A4ZA 4NQDD 1T1WB 1CVSC 1E9QB 1MJUL 2DLTA 4OJCA 3TEWA 1ZK5A 4ZXBA 2V2WA 1TYJA 1LUCB 3VXRA 3BSMA 1GQNA 3BZEB 2Y06L 5IIEA 3E2HC 1MF2H 4OF0A 5I82A 1HZHH 2AXGB 3B8YA 3V0WL 3U0WH 4I9WD 3TPUB 4AH2A 1MFAL 3DI3B 3SOBL 4A2RA 4LEEA 4ETYA 5JBEA 1XRVA 5C7XL 4GK8A 5ESVA 2MSPA 1Y6KR 3GEFA 3ET9F 5FL1A 3NA9L 1F6FB 1XH3B 1HESA 1KOAA 4WFFD 1F2JA 4PMUA 1HDMA 5E1AB 1EP3A 4JFED 1A0EA 3QIWD 4OBSA 1OBAA 3MBWB 3BWAB 4G7VL 4J3WA 5DJCA 3ABQA 3TJEL 2CRZA 3NL5A 1M41A 1R1CA 3RPIB 4AHQA 1A21A 1F8TH 2PLMA 3ZRCC 3L3JB 1DQJB 1XR9B 2QKIC 3O3AA 1SPQA 1SM3H 4NUGL 1SOXA 3BFWA 2Z35A 1TPH1 2ZXAA 1TVHA 3H6JA 5ABZA 5IESL 5IKCB 3IWUA 4FC3E 4OM1L 3T07A 4O2CA 1CDJA 2GW5A 3T55A 1FG9C 2CKBA 3BFOA 3P9LB 4AK2A 1SJDA 1U8NB 3HFMH 4X98B 1Y8BA 4PRRA 4FNLH 1ACZA 1XLFA 4V28A 4XSMA 5HANA 3Q0HA 5F1NB 4QF1B 2EUVA 5E5UB 3BAEH 4PTTB 3RVXC 2ETWA 1VF8A 2WZ6A 4U05A 3D18A 4IM4A 4H8WL 3RK8A 4OD1L 3ISRA 3T4WA 3DKLA 3DXAB 5C9JB 3JTBA 1A2YA 3CFUA 4Z5RB 2VJXA 3U30C 3T05A 5HDQL 3LPWA 1BXBA 4AFYA 2PMQA 4ZRGA 2PDPA 2WXOA 2V9QA 5FB8B 3ILQC 4H3DA 2YZ8A 2YPVA 3ECWA 1S2VA 4FQCH 1CI1A 2BX7A 5BOPA 3M9YA 4OQTL 4WTWA 1E7VA 3SEPA 1FFOA 1G7LB 3ATFA 1K8CA 1V08A 3NZSA 1IEBB 4AQZA 2R29L 3K2MC 4PH8A 1JV5A 2YRLA 3CQIA 1LLZA 2AJZB 1XIJA 1B4JH 5CCKH 3ASNB 4PW3A 3WH7A 1CJYA 1G1YA 3LHYA 3FFCE 1T1YA 3OAUL 2O56A 5LXGL 7XIMA 2G60H 2VDRL 3AZSA 5IMOB 3WNMA 1GK8A 5MEPA 1Y18B 1CLCA 2B59B 5DJZB 3NAAH 4JHZA 1ZA6A 1T41A 3KOYA 3LRMA 3T40A 1PYFA 3I3DA 4N68A 1R3HB 3QJRB 5JHDE 5I9QC 4S3FA 1OD0A 1RMFH 5AN7A 1TXKA 2ZOKA 3FFSA 2XH2A 1ADOA 1EWEA 1O6VA 4IGBD 5TE7H 5KN5A 4CC4C 2ZSVA 2VR7A 1K3ZA 1I1XA 1TPFA 3GFYA 4IMEA 4JJOA 3OLEA 4YFLF 3KOZA 4XN8A 2E59A 4P9ML 3HJEA 4QRSB 1R6VA 1Q0XH 1TDQA 3CX5J 1BXNA 1QRQA 4Y8EA 1P7KA 1ZDSA 4W1TA 3T81A 3MLUH 4J3XA 3N73A 3MDUA 3E2VA 5CGTA 1H19A 3BGFC 4JY8A 4R7NB 3WMCA 5EF3A 1N6QL 4E9XA 4ICWA 1LE5A 1ONEA 3MA8A 4YXLH 2H1PL 4MA8L 2N7BA 4W6YB 2JBMA 1BXCA 1J9TA 1NM9A 4ORZC 4GVIA 2ZZ4A 3O4LE 1AP2B 4X5PA 3C61A 4CNNA 2I5YH 1EQCA 4AD3A 3VXMA 2J75A 4ZQMA 3TLQA 4RDZA 2YRBA 2C1PB 1OIOA 3P77B 1JEZA 2XN2A 2AAAA 4IRJC 4YSQA 1SO6A 5TIMA 4LSTH 5HVWA 2GSMB 3QDGB 3BJSA 1NFDA 1EGJL 3N6QA 3LIZA 4B7IA 2DJSA 2DF3A 4WO0A 4M61A 1RMFL 2I32A 2UYLA 5L4JA 1EB3A 4NF7A 2W4XA 4XZHA 3W11C 4D94A 4RZBA 5CG7A 4JG0H 1NOLA 4JVPA 3KOWA 4KTDH 3IK2A 2YLAA 3CLFH 4ZEPA 1HCYA 4XMTA 4OFPA 4PRDB 5BZDB 3IXAA 4D0CA 5LUMA 3EYOB 3ZYJA 4S39A 1UKQA 2W38A 4NQ1A 1EAJA 1M7UA 3SCMB 3VCLB 1RVKA 5AOKA 3L95B 3UZEC 3U4BL 2G4JA 2B1OA 5C2CA 2R27A 5JHBA 1WITA 4BQ6A 4HKBB 4LS2A 3N40P 3W2NA 4WUKL 12E8L 1EV2E 2YLKA 4KJWC 2PPAA 1S7RA 1PFOA 4UZSA 2VXTL 3I74A 1RSCA 2PU0A 1YUHB 4DQOL 4F3HA 1TFHA 4IKJA 3TV3H 2MH4A 5A16A 1OPOA 3W1TA 4L3EA 2OCJA 2BGSA 2BSSA 3NESA 2NY3D 4TULH 2Y23A 1XLIA 4GFSA 3MU7A 1XCQB 2A3CA 4IPLA 4HUNB 2PCQA 4KHXL 2B0SH 2WMIB 4I48A 2YD5A 4J6RL 4R6UA 1GY1A 4F91B 1RPUA 1NQKA 4TN9A 5AB2A 4RZ5A 3S2JA 3WO8A 1CZ8H 1ODAA 3OZKA 2ACQA 4H04A 4NBYB 5MKGB 3DFYA 4YN5A 2V5TA 3IFNL 4WNSA 2OJZL 1DEEB 3TZFA 3I3BA 4FD0A 5FV1L 4ODXA 2FT8A 4KXAA 1H3TA 3T3PB 3FO9B 4BZ1A 3WTWA 1TPC1 2BASA 4DPCX 2DL9A 1R5WA 3CN1A 3G5YA 3PG9A 4EDWH 4WGHA 1KB9J 2BVTA 1PZUB 1U8IB 4GUHA 2EH8H 1RU9L 3QARA 4PBWD 4V15A 2HKFH 4R2GC 3O0RL 1BZDA 2JWYA 3K0WA 4EUPG 2CMRL 1A14H 3JQOB 4C55A 3QNZA 1GG1A 1JD9A 4DGWC 3PQYD 3WTTA 1D6EB 4BJHA 1NWOA 2WM0A 3QFDA 2MMXA 4KITB 4Q4KA 3RN6A 1S7WB 1IL1B 2PW2B 4RRPM 3U46B 1Z6KA 1KFCA 3W25A 4NKOA 3MLZH 4LVAA 2OG9A 3V5KB 1XYFA 3WBDA 2VCAA 1UD5A 3KJ6H 5JO5A 1DSFL 2G75B 4TRPL 3LBOA 3Q37A 4JM4H 5HHVL 4L4JA 3UBHA 3DJZA 3MHFA 1A7NH 4JFFB 4GS7C 4LB3A 3A22A 2WLIB 3FJ6A 5IB1B 4U2YA 4ZXBD 1YNLH 4PFHA 2CHZA 3K1GA 1U3HC 4FQ1L 4I87A 5HP5A 3TCSA 5LJYH 3URQA 5TJWK 3H53A 4EN3C 3NTCH 4RZCB 5EU6A 2VDPB 1UUSA 3QWOA 3WFEL 5KYYA 1UP2A 2NQZA 3TXZA 4AZCA 3FU7B 4GAYA 1K6QH 1E6SM 4HLZG 3SCMD 1BP3B 3V4PB 1ZLVH 1S39A 1PW3A 3HZKA 4FZEL 2GUYA 3P14A 4XPBH 2ZWKA 3VXNB 2FTPA 2ZNWA 5B8CB 1SBBA 2JLPA 2NZ9C 4MJIE 1RXOB 2WMPA 2CR3A 5D70H 1OD8A 1AS8A 1O7DC 2Q2EB 5MERB 3PWJB 1WXZA 5D72H 2DMHA 5JA8B 2JJUA 5AVQB 3C8DA 4AQ1B 2V82A 3GD6A 4B9ZA 3BN9D 1U93A 1GC1L 4FL4B 1P69B 3V7MA 1EX5A 3QQ3B 5LIKX 3I75A 1U8HB 3G1HA 5B1JC 1DBAL 1NEZG 4Z78B 1ET7A 4BQ3A 1A7OL 1LMIA 3MHUA 1KPRB 7FABL 5CP3A 2LU7A 1U8PA 2VSCA 4MD4A 3E74A 3MOAH 4Z7QF 2D69A 4X6CE 3V5FA 2B20A 4DN4H 1GZGA 4PL1A 2BC4A 4L5FL 1BJMA 4Y9FA 2VDNL 2XN9A 4URTB 1QPPA 3PSVA 2IANE 2UZYA 2PCFB 1KKRA 3P60A 2PW1B 1IAMA 5DHMC 5MHSE 2EXYC 5DRWB 4X7SL 3SPHA 3F7RA 4X0KA 3LZFL 1EP1A 1GKEA 4LVOB 4BUGA 1RBLA 5DYOB 4LVHC 4E2VA 1XZ0A 1U8QB 2NY2B 3UZQA 1PD6A 3R06B 4MNHA 2FYMA 3GIPA 3QSTA 3VKCA 4O57A 5KSAC 2BVEA 4JDEA 3PL6B 4IQEA 2QSTA 3LH8A 3NPZB 4GSXA 1J1XH 5FECB 1CFQA 1UQSA 1JZDC 3MYZA 3UCRA 2OWCA 4PRNA 3VWKA 4EKJA 4MQSB 1FG2B 1G9NC 3U2CA 3VK5A 4UF7C 1AI1H 3EHBD 3ETTA 1OE1A 4DF0A 2VHLA 1A47A 3DSNA 2QSVA 3A24A 5DMGD 5JMOC 5D1QD 2JKSA 4P2RE 4JTTA 2WVTA 3WBYA 5C71A 5AYIA 2XSBA 4DNLA 1OAQL 1XR2A 1F6LL 2EZ0C 3B83A 4UM9B 4NHUB 4MS6A 3V52H 4HSOA 4K37A 5DHYB 4U10A 3UA4A 4IBYA 1NGYB 3M16A 1DN2A 1ZLDA 1BYAA 1EJXC 3NSFA 3WX7A 2GC7C 4PLJC 2DQ6A 3NJKA 4ZPTA 1DN0B 2PXYB 3PHQB 3ZLQC 4HA3A 3PBGA 4DP8X 1WQVT 5KSBA 2YUVA 2LVEA 1YYLH 4CJ0A 4JTSA 1I8IA 2PYFB 1F6AA 2J21A 2X87A 3OR7A 1JZ6A 1GWJA 1LMKA 2DUXA 4OZGB 1ZLUH 1PLBA 2MQ0A 1MCEA 2HCVA 1XYCA 3W1LA 3KJ4C 4JDVA 3IIVA 5CS7A 3CFKB 3GBML 3UFYA 4K4KA 1R85A 1DQJA 1XR9A 1BJ1H 1NDYA 4GJTB 4JK0D 3EO0B 4P05A 3ZJAA 2A0LD 3BIBX 1JPDX 2ESVA 2XZCL 3LSCA 4MGXA 4G7FA 3Q8AA 5CZRA 4NCC1 4LANA 2SEBB 5J1TC 4M6PA 3P9LA 1S9VB 3BLKA 4W9KC 5ILTH 5BOFA 3S37H 4PRID 5LCVH 2D2JA 5G4WA 4IQDA 3WKZA 4TL4A 3DV6B 2DIEA 2V9RA 3IAQA 3KNBA 4LUIA 5D2LB 2X4OB 3USBA 2ZADA 5HNUA 5FGCE 3V10A 1FCQA 3GDLA 4MX7B 3T8VA 2DZEA 3EOAA 5E99H 4X63A 3FCBA 1TJPA 3LZOA 4LIQE 2CBJA 4QG9A 3U48A 4UZGA 2QELA 3P2BA 4Y5VA 4JZOA 3M0JA 4S1QL 1UXWA 2MKWA 3WFCH 5BNXD 1CK0H 2VITA 3IRPX 4MNGA 1IAKA 2PYEE 3CSYB 5C2BH 1BTMA 3BUPA 1JDEA 1QWKA 2HV5A 3RP1A 3GDRA 3NIFF 1H3WM 2CLVA 3BVXA 3OKMB 3OXSA 5D9NA 4OB5L 1JVOA 2BNQB 3BVNA 1LD9A 4MDIA 4P06A 4UQ3A 5TDPA 3AMCA 1KBGL 4LF2A 1LE9B 2A7PA 4YE4H 4IBWA 4GVGA 3QFJD 2R8WA 5KVDE 2W0KA 4U33A 4DW2H 5FCUL 3TLLA 3ZE2B 5J12B 1SXBA 2UZXB 3NAVA 3MRRB 5HVGB 2UXVA 4RZ4A 3WENA 5CEYA 5L8KB 3H7RA 1RP9A 2NXZC 1PYMA 3MRHA 3MA7B 3F5WB 1KYOK 1XIMA 2WD0A 4GY7A 4TV6A 2EYTA 4NQCA 3GNML 4M7ZC 4PREA 4RDQG 3KL5A 2E5EA 3BFQG 1OSZA 4ZUUB 4Q0XL 2OX4A 1NC4A 5E2TL 4N0YL 5KZDA 4FOMA 1AYRA 2Y4SA 1YEDA 4PWFA 1ACYH 3SGGA 1DVFB 2YZ5A 2AI0L 4XN5A 3KBNA 3NXLA 1A6PA 4UM9D 5CD3B 1NEPA 4PR5B 1WV2A 2PBGA 1T0MA 4H19A 1JN6B 1AD4A 3UR5A 3G1XA 3LKPB 1PNCA 1F1GA 1NEZB 3ARBD 4M6NH 4ODSL 3E0WA 4MWAE 3HB3C 3IPFA 1NC2D 5KOMC 5HGAA 4QHKI 4IIZA 1VPYA 4XP1H 3M1OA 2GYIA 3EA2A 4GAAA 3B2MA 1G5GA 2PP7A 3UYPB 2VWTA 3AGVA 4PJ5A 4AI7A 4XP5H 5B1KA 1QTWA 2ZG2A 3QFJA 1W37A 2K1MA 3CUJA 3CUPB 2FPTA 2HE5A 1BG4A 3VFOA 3K5RA 2QAPA 3MSRA 1XXFC 5GGTA 3CHCA 4PJEE 4LSUH 3MMTA 4CGTA 1GZPB 1L7TH 1PKQE 4QEHA 2OJEA 4N2YA 3XIMA 1I53A 2DKUA 3DPBB 3SGJC 2JJVA 1MQQA 3CJJA 3BD3A 4X6FA 1PCSA 3MKKA 3GMQA 3B3IA 1RZKH 2PLTA 1L3NA 3LA4A 3M64A 4JTQA 2WXMA 4NBXB 1EJUC 1PDKB 3B3IB 1Y0LB 2J78A 3TBWB 1KWGA 2N4IA 3HRZC 4IG2A 3ATZA 1WZ1H 2ZD0A 2FNWA 4GSQA 1EF2A 3F3HA 2HX7A 1IO4C 1I45A 2A6NA 3B6SB 4Q32A 1PCXA 4YFEA 1OPGH 2BNRD 4OJYA 5H37A 1QSFA 2YMXH 4M8QA 4B5WA 4CD4A 4W86A 5AW8B 3M0KA 4LSBA 4MKMA 3CZNA 2ADFL 3WJMA 1Z0MA 4LLAA 3EB2A 4Q4RA 3FB6A 3FTUA 3LPFA 1USZA 4AYFB 1TUFA 3APTA 2R15A 4HIXH 3VH8G 4D1IA 1P48A 5DUJA 3RZCD 2FZ9A 2GK2A 3RFZB 1H0IA 4PGEB 4WDIA 5JIHA 1UBSA 1GC1C 2ZAGA 3H7BB 4B9JA 4C56B 4KUZH 3PZUA 4L4TB 4NYUA 3UVAA 1P4CA 4IKNA 3ZE2E 3KRZA 1T6WA 3DZ1A 3WQEA 1J0KA 5JUEL 3VI4E 2R7EA 1XFBA 4WOQA 3ZZQA 4P2QB 4HMCA 5KBMA 4P8XA 4BF7A 4FG2A 4G43B 2V8ZA 3BKCL 3CV6A 5T3ZD 1VACA 5AVVB 1AKPA 2CU0A 2IPFA 4B90A 2JI1A 1FAIL 3OKNB 4X5QA 2F58H 4G43A 3CUFA 3QKEA 1IGIH 5D7KD 1K2DA 1R9YA 1L6XA 4NSKA 4ZAKD 1UQZA 4JM2C 3BW9A 3O0FA 3SKJL 3C2RA 3E6HA 1A3LH 2K6YA 2WKOF 1XF2B 2QJNA 4BKNA 5C0CD 4TOYH 2DQXA 4ZCWA 3BUYB 1NINA 2R2EA 3HN3A 2EDXA 2QVMA 4IJ3C 1V10A 4UI2A 4AVFA 2XFGB 3H4XA 4CU6A 5ITFA 2PDGA 2WQSA 4LEBA 4NENB 5DD0H 5GRVK 5IDIA 3Q2CA 1BMZA 2X44D 5ID0B 3P61A 1N26A 3R4RA 4BE6A 1E67A 2AHIA 4HHAA 5EO0B 4Z77A 5J1AB 1TIMA 1S2TA 1D7CA 2VSDA 3S4TA 3IGSA 4ZG1A 4AGNA 1JXJA 4YDJA 1UYQA 5IB4A 4FFTA 4KUZL 4ZUTA 4HG4K 3M47A 1KEGL 4Y9AA 3LZ3A 3EFDH 1AACA 2OMWB 1ZHNA 2XXCB 5DS8A 3IDGB 2GQHA 4OZGE 4Q2ZB 3FTSA 5A40E 4JFTA 2IH3A 4RGMC 4OZIE 3UTTB 3ZKND 1M5WA 3VNJA 3ZLHA 4EDXA 3MXVL 2PTWA 3NSMA 4Q6JA 1E4MM 4R7DB 4N2BA 4ORGA 3PZQA 4MWAC 1IGIL 4UOJA 5I78A 1ROCA 4O19A 1MELA 5EFFA 1EFXB 3HBZA 4UDTB 1U92A 3E80A 3FGCB 3D0LB 4QOKB 1IE7C 2GQAA 4QNEA 4FMKA 4LSPH 4S0HA 3BZEA 1KM4A 4NFDA 1Q6FA 2B4CL 4XC1L 4YSTA 5HJGA 5CIPA 5I1GH 3M7FB 1IXOA 4PEKA 3FQRA 2J6EA 1J88A 1T21B 3MOQA 2H8XA 3VXTB 4F24A 2J88L 5GNXA 2OZTA 2PP8A 4UT6L 5MHSD 3ISYA 3CMOL 3U1QA 2WYTA 4F8LA 1W5PA 1UWTA 3ARDD 4BF5A 1N6VA 3TONA 4MFHA 2WNXA 2XGZA 1XLMA 1MCBA 2WC7A 4Z9KB 1MHHB 4PJ8C 4H83A 4M19A 4WFHD 2ICSA 2YMOA 2MCAA 1DWGM 2DSUA 1A65A 1MHHA 2JJWA 3DURB 4AVJA 4AEEA 5C2BL 5CCGE 3CL8A 3KPOB 2M1KA 3INPA 2Q8AH 4M7JL 5EORL 3MUHL 1T1XB 1XTLA 2F08A 3FQNB 4M8RA 3RRQA 4PB4A 4G8IB 1OCCB 4WEMB 3ZDYB 2REQB 3TYBA 1ZVSB 1NEYA 4YBLB 4K7FA 2OOGA 3RM4A 1YY8A 3X3GL 4Y8DC 1YDOA 3IS1X 4ZX5A 5DI8B 5FO7B 1YY9D 1K4DB 2XN0A 1ZK9A 2ZUYA 4C47A 2KKQA 5PTDA 5GSRB 2DQWA 3S9ZA 4XO6A 1KPRA 4JNXA 1DKWA 1MCSA 4Z7VE 4DPBX 4PCYA 3AVEA 2ZXWB 3E9AA 5SX4I 5I1EH 5DGQA 2OYLA 4BFIA 5E8EA 1KA9F 2YK1L 3ARYA 3GBLA 1SM9A 3H2FA 2V6AA 3V16A 3VOFA 3SZ8A 5KAQG 4PJHA 3SDYL 3LDBC 4A21A 4JJ5B 2NUTA 1CFTA 4N0YH 5A6TC 3MRPB 3FPYA 2DW7A 4P5TC 3TYCA 2E6DA 4QEGA 4LOEA 4JIEA 2VLJA 4PEEA 3WNOA 5AAPA 3NPUA 1EKOA 4MSSA 4U4IA 5MEND 1E5ZA 4BFJA 1H3VA 1UVQA 3HJZA 1X5KA 4A6YL 1R7AA 1QSEB 1V5JA 2VM8A 3DGRA 3T4AA 2DPKA 3V36A 3MBFA 5HJLA 4LRNH 3F7QA 2A2IA 2OGYA 4NKIL 1C8QA 3SSGA 5EUOB 1EXHA 2R23A 1JPFB 3I85A 1KXTB 1YNKH 5IR1A 1R3HA 4EUPA 4AQOA 3UWZA 1OYCA 3JWDH 3GX9A 5FYJE 4D0BB 3PZVA 4LV9A 3EGDB 4Q33A 3IM1A 2J4WL 4QROA 2PWGA 2A3TA 3F7VB 3JWDC 3NIGE 4FQLL 4M5YH 1XISA 4AQLA 1SF3A 1WHOA 3OQRA 4TQIA 3D18B 1WAAF 3TVMA 4FHJA 3UTZB 3ZDXE 1Z9AA 2ZZ6A 4H8NA 4NRXB 1SW7A 2XPKA 5KUMA 4JFFE 1DVTA 1W31A 2VD8A 4RFNC 3WLOA 1DUYB 4HCLA 3C87A 4XN4A 4OCYL 1YE6A 1TQUA 4M1CD 4ELKA 4A2FA 1ZHBB 3PUUA 1JWSA 1I31A 4MWAA 5IJVB 2ITCA 3P2TA 2DAVA 5B38G 3QCTL 1XL9A 5AC4A 3E2SA 4JMNA 1KTBA 3KAOA 4KQ4L 4U1KB 3P0WA 2WQXA 2VC5A 1SN2A 2C19A 4CD7A 4MNLA 2F5AH 2NNCA 4HCFA 4FYTA 5DYOA 1NAMA 3QVAA 2DB8A 1C90A 2QDHA 3U2OA 1DQLH 3AB0B 2IWFA 4FAMA 2YGOA 2OR2A 1A7RH 2KMWA 3FTVA 1HCFX 5GRZA 2ZA3A 1NFDB 3H2WA 4U1SB 3L6FA 4K94C 4MCZA 4R34A 2ITFA 3SIKA 4Y2OA 2VXUL 3KFTA 1AC6A 1BFSA 3S8FB 3DGBA 3ARXA 3RDTC 4QNPE 5EB9A 1ZTXL 4ZXBC 2IQ9H 2LV4A 1QUNB 2Z28A 4PODA 1DO6A 2A9DA 4CQ8A 2ITEA 3GKFA 2R1XA 3QI9A 1QSFD 3G6JF 3TYAA 3UJTH 2X0SA 3VUSA 3Q6GH 4F58L 4M8UA 1W72A 2ZZUT 3OLDA 2IWKA 1X44A 2YGVA 1KBPA 3B7RL 4S11A 5AZEL 3T0AA 1V3MA 3O6LL 3GU2A 2QGDA 1MF2L 3ZTJH 4GRSA 4JHMA 4QDMA 3UJRA 4EPEC 4IDJH 5T3ZH 2ERJB 1B4EA 2J88A 3BSZH 2YL5A 1TX0A 3URAA 5I66A 4AH2B 3NAAL 4X7TA 4WWPA 3TN0B 1HVQA 5J4MA 1JZ3A 4YVUA 3BVTA 4I77L 3FJTA 4OJEH 3DARA 1N8OE 2FLIA 2PZNA 2Y1AA 3U7AA 2K6WA 4G7VH 3UIZA 3CCHB 4UMAA 3FO0H 5I02A 4OFYA 3NJJA 1D7BA 4AW4A 1IEWA 3NMEA 4XO4A 3WF0A 1QBLH 3BVWA 2HJFB 3H9HB 1NBQA 5AQ0A 4EIBA 2CR6A 5AW5B 3KBVA 2O26U 1R4XA 3OPUA 3O4OC 3T4CA 3K6IA 2B5IB 2CLKA 4QXWA 3Q8CA 4X4XB 2VN3A 4LU5H 1CN4A 1TRDA 3PB2A 3TH3T 5KMYA 4XK2A 3ZPDA 3QQ0A 2IXQB 1G43A 5D7LA 3UC0H 4BDVA 2JJTA 3A12A 1BZ7B 4FFVC 1VSCA 3QUXA 1HXJA 1Q1JH 3M88A 1ZRUA 1W5NA 3P81A 4TSCH 3O45B 1BZ8A 3B4NA 5E6IB 4BZYA 3VXPA 1QFUL 2YA2A 5JIDA 4GYPA 4O10A 4QRNA 5DEFA 4UNKA 2X4OA 5CO1A 1UA6H 4JO2L 4KBXA 2PEVA 4UZUA 3RUGA 2EDRA 3BH8B 3CHQA 4JANA 3H3KA 1J4EA 3S3DB 2DT3A 3BEVA 3KWVA 3QFDB 2E9JA 5DQJB 1ZAGA 4OR1A 1R9FA 3IDYC 1NGXB 3MR9A 1PLGH 3ES6A 1HZHL 4XPTH 2EEFA 1TVBB 3FCTA 5IUCA 3B3BA 4XMKH 3BDYH 5AYUH 3MNMA 2PDLA 4OV5B 1N8WA 3ANYA 3PUDA 1FIEA 1CLZH 1MI5B 3O9WC 4K3EH 2K70A 3HF3A 2OGJA 4NO3A 4ERIA 1NCCL 4Y2DA 4Y6GA 2Y7MA 3OJ2C 4NPYB 2E6QA 1AR1C 3B7SA 4DZ8B 1YEKL 4E0RA 2F54A 3ILQD 2QCHA 5I1DA 2EE0A 5E56A 5JHLH 3EKZA 4S1FA 3OAUH 1E5UI 4MYAA 4S3EA 3LVEA 3BAXA 4N8PA 4G1KA 4E8DA 4KK9C 5E95B 3JVFC 4LCWE 2ZC1A 3R58A 1I75A 4N28A 3O3DB 4MZ3A 4ZTPL 2ACRA 2G0WA 3QN3A 4LPWA 4KZDH 3NCJL 1JPHA 4WJEA 1ZA6B 3VDGA 2NY2C 2IAMC 3NJHA 3OHMB 1I7TB 3ZE1F 3LEPA 1IM3A 4NJIA 2Z91B 1TZHB 3UPRB 2PDKA 3EO9H 4HCRH 2DQEL 2PETA 2ZCLL 4GW5B 5DMGC 2YARA 2EC9U 4PWIA 4DK3A 1M7JA 2EAWA 3GSRB 1HFBA 3GMLB 2ZVRA 5B7YA 2A6LA 4WD0A 3RKPA 4EE2A 4X9YA 4OLXH 4WV1C 4Y4KB 3SDDC 4BGLA 2WUCL 4JFHD 4ODVL 5GHWH 1JHKL 5JOFB 2GFTA 1CG9B 4A8LA 1JUFA 1GS7A 5L2KA 1O5XA 4JRXD 3SPGA 1Y65A 4Y89A 5TDOA 4AEIL 4Q9CA 4KCUA 3TURA 4PM1A 4GKSA 1VFHA 1OG0A 2G3ZA 2PCYA 4HPHA 3K5XA 4IT1A 4KJPC 3IIXA 4PBFA 2OJ1A 1BZ9B 2ADYA 3IVKB 2K4WA 4FTVB 2WXIA 4LC8A 4OD2A 4JY5H 3TBSA 5D2NE 2E9MA 4JTKA 1YN7B 3L5HA 4CC0A 3LI1A 1MDAA 3DXAE 1SQ2N 4KCWA 1OINA 2YDAA 5I09A 1XYLA 5A2CA 1JRCA 3BKJH 2EEBA 3M07A 3GNOA 4X6EA 4OGAC 3CFTA 3WQGA 5DJAB 4AL8L 4YHPB 4L1XA 4K07A 3HVDA 3ARED 1HF6A 5AD0B 3LN5B 3OGSA 4K1WA 2YQ2A 3IDYB 3IYLW 5FDWB 3FU7A 3IIPA 4JDEB