1U30A

In situ extension as an approach for identifying novel alpha-amylase inhibitors, structure containing maltosyl-alpha (1,4)-d-gluconhydroximo-1,5-lactam
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title In Situ Extension as an Approach for Identifying Novel alpha-Amylase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 168
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1u30A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1u30A01
4N42A 2DQXA 2J78A 3T08A 4LQ1A 1VBRA 3H53A 4UCFA 1HX0A 2ZUWA 3BVXA 3ARRA 3PZGA 1X1NA 1HVQA 1I75A 1CBGA 2XYLA 5FKYA 2ZX7A 3OLDA 4J3TA 4UQDA 1KXVA 1TVPA 2CETA 4MAVA 2X8RA 4AZBA 4FMVA 4BQ4A 3T2QA 4JCLA 3IJ7A 2BHZA 1UWSA 3AQUA 1B2YA 3UR8A 3II1A 1C8QA 3CMJA 5BYWA 1UD5A 3U7VA 4M24A 4DUWA 3VDCA 4UNIA 1NWTA 5CSYA 4KRUA 1E4NA 2IXVA 3AIVA 3WN6A 3MUAA 1VFFA 2WWDA 1FH7A 2D20A 2CHNA 3A23A 1V3KA 1KTBA 2CEQA 2NSXA 3ZQ9A 1C8YA 2VRJA 3DX2A 2WMJA 1V0MA 4WSKA 1JNDA 1ISZA 3VMOA 3EDFA 3OGRA 1UQYA 3L2LA 3ARQA 3CHDA 4H41A 1Q6EA 1JL8A 4BQ5A 1HKKA 1WCGA 4M82A 3WQVA 1ZL1A 2IUZA 2DT0A 3L4TA 5A6KA 4MTVA 2WSKA 3IANA 3WSUA 5FCZA 4AD5A 2J77A 2CNCA 4W93A 2YBUA 3AJ7A 1V6XA 3M46A 2EPLX 3VGDA 1E6RA 1HXJA 2VUYA 1K9EA 2YDQA 4HPGA 2E40A 5CGTA 1WPCA 2WC3A 4BCEA 1FHLA 3MUZ1 4AMWA 3WH7A 4URIA 3WQ8A 2WB5A 1MQPA 1XC6A 4JHOA 1JZ4A 4GQRA 3T09A 1IV8A 1V6WA 3CZEA 4H8UA 3WIJA 3WMCA 2WKLA 1PX4A 2W66A 5DO8A 5HOSA 2YDSA 1BVNP 3ARUA 1JD9A 3O2LA 2XFRA 4PUDA 2VZSA 2EAEA 3GNOA 3PZMA 4P7NA 1HJQA 1QBAA 3MSGA 2PWDA 4JFUA 3BCDA 4NF7A 1LQ0A 2YOCA 1FH8A 2WHKA 1GUVA 3EDDA 1KXTA 4MB5A 4E2OA 3UG3A 2ZXDA 3K46A 3FAXA 4XUYA 3OIHA 3L4ZA 3ARPA 2X2JA 4ZEPA 2CERA 3FW6A 2EPKX 1VEOA 4AC1X 1UKQA 1ISVA 1UA7A 1JYVA 2W61A 1J10A 5A6SA 2J8GA 2XVLA 4DM2A 4W85A 2J75A 2X2HA 4RE2A 5EBAA 3IGUA 3KE0A 3WY4A 2WZIA 5CPSA 2GJRA 1OWQA 2XTKA 1QHPA 2GVYA 1HTYA 3A47A 2W4XA 4GZIA 4WKHA 2BXYA 1E0VA 2J7EA 2VR5A 4AZGA 1UR0A 4WKFA 2ZE0A 1WDRA 4FNPA 2WLYA 3VD4A 3WDIA 2OYLA 1C8XA 5I79A 3O6AA 1XCWA 3LXAA 2Y8KA 4AD1A 4EK7A 2XM1A 3WD0A 3MS8A 1QNRA 4H2CA 3WDJA 2VX5A 4W7UA 4PUEA 4LX4A 5JIPA 3AFBA 4GI6A 4D72A 4BA0A 3OGSA 1J9YA 2BVDA 3J7HA 1V3LA 1B9ZA 4OZOA 1JFXA 4JFWA 5EMYA 1B3VA 5CJ5A 5A6BD 1CXFA 2UY2A 5LA0A 2XVPA 1SFSA 2QMJA 3D4YA 2D0GA 4ZFMA 4U5IA 5IXEA 3FHQA 1B90A 3BVVA 1WKYA 1CXKA 4MNKA 1C92A 3VUPA 3CUIA 2E3ZA 4D1JA 1E43A 3PZ9A 4HOZA 3RJYA 3T0AA 3B8SA 1ISYA 1A3HA 3N12A 2VNCA 2VOTA 5D8ZA 2ZX5A 4GO9A 1TQUA 1GQKA 2JIWA 1PAMA 1OIFA 3WNPA 4M80A 3WH5A 3HMCA 1BGAA 1MW2A 2AAAA 3KLKA 1V08A 3MMWA 1UYQA 4CD8A 3AOFA 2WC4A 5JIWA 2Y2WA 1JYXA 5ABFA 1ESWA 3VGHA 3T0DA 1D3CA 3TTSA 3T0BA 1RD6A 4HOXA 1OGBA 2GJXA 2XHYA 5I6SA 3VOCA 2QPSA 1F4HA 3WH6A 3SCWA 1HXKA 2C0HA 3SCOA 4OGZA 3DX4A 3L4VA 3QOKA 1UD4A 1XD1A 5A8OA 1B3WA 3HJEA 4ATLA 4BS0A 5I77A 1HNYA 4MJ4A 1BSIA 1WDQA 1BYAA 2Z1KA 4UZSA 2Q8XA 1KXHA 1TQVA 2WMGA 4W8BA 1PZ3A 4AYGA 1UH4A 4IPLA 4C7GA 5BXRA 3S5YA 4XZWA 3UCQA 3LRKA 2FDMA 5ABFB 5JUVA 3BAKA 2YL5A 1Y7VA 2MANA 4C7DA 1E0XA 5FIPA 4FK9A 3U5UA 3W29A 1D2KA 1VEMA 2WANA 3EMCA 2EPMX 4D6HA 1GHSA 1BYCA 2B31A 1UKOA 4AD0A 2WWCA 2WHLA 3VNZA 5A69A 3VIGA 2D2OA 4FLRA 3AMLA 4U3CA 3NDYA 3ARSA 3VD7A 4GIAA 5IHSA 4CN4A 2XSAA 3VO0A 2CYGA 1V0KA 1M53A 1AQ0A 5A3HA 1TUXA 2WC7A 2VT0A 4PSPA 3UG4A 4D6FA 1CXEA 3WENA 1GQJA 5FL1A 1E71M 2D23A 3FN9A 3WEZA 3CLWA 3AYSA 1GPFA 2BS9A 4UFMA 2V3DA 4NRRA 3F5KA 5E6ZA 1Q6DA 3ZT6A 3CZLA 4ML4A 2W63A 1KXQA 1HN1A 1HVXA 3S5ZA 4D71A 4U5KA 1NOFA 1QOXA 1QVBA 2VCBA 3B9DA 3DYMA 3ZMRA 5CPTA 5LYRA 2XJ7A 4P7RA 4OOZA 3DHUA 1VEPA 3GM8A 3N9KA 4MDPA 3AZRA 5D9OA 2J7GA 4NZJA 3CTTA 1RP9A 3BVTA 1JIBA 2F1AA 1QNOA 3VX0A 3EDJA 3ALGA 4Z2IA 1E4MM 2PC8A 1V3MA 5E9AA 1NWRA 3BH4A 1G1YA 2F8QA 4MB4A 1VBUA 1ZU8A 3CZGA 4AD4A 3CC1A 3QOMA 1MFUA 3ZJ7A 3SCVA 7CGTA 2D22A 4J7RA 1I1XA 5A94A 2DSUA 4DWSB 4JFVA 4AZHA 4WJXA 2G3JA 1ZJBA 1WZAA 3GNRA 1TQTA 5I23A 4QDMA 3DX1A 2ESCA 2J74A 1DP0A 3BGAA 1PIGA 5JBDA 1W9XA 3GH4A 4HU8A 1OT1A 2D73A 1VAHA 2O92A 3HG2A 4DWSC 3SCSA 4ATWA 1V3IA 1LWJA 1MVYA 1U33A 1CGXA 3MV11 4HZ8A 2OLHA 1DWHM 1K9DA 2EADA 6A3HA 3PTKA 3AHZA 5CLWA 3MMUA 3CH9A 5HPOA 2J7FA 2WKGA 5E0FA 1BYDA 4J3UA 2ZUUA 3EMZA 3GYCA 1GZJA 4ACZA 1DWGM 2J7BA 3ARTA 1OBAA 3VTRA 3VIPA 5E6YA 1KGUA 4UQBA 3ARZA 1W32A 3CUHA 3AHYA 2WMIB 3VIMA 1E15A 1O7DC 3W28A 1E40A 3A21A 1EDQA 1GORA 3PTMA 4FLSA 2VL4A 3BLKA 1Q6GA 3D50A 1LJYA 2CKSA 4MNJA 8CGTA 7TAAA 4RL3A 4JFTA 2ZUVA 2YLAA 3WUBA 3VMPA 3WQ5A 2J25A 1QBBA 4AIOA 1WZLA 1LG1A 4OOUA 1H41A 1X6LA 1KR1A 1IZKA 3IAQA 4YHEA 4UZUA 3ZR6A 1UH3A 4M8UA 1VJZA 2VVNA 5M3WA 3ZOAA 2YIHA 2E8ZA 3WF1A 5I2UA 3GH5A 2EXOA 5BXTA 1M01A 4MJ2A 4Z2GA 2ZOXA 1L8NA 1BTCA 4GPNA 2XUCA 3DHPA 3D52A 5CQ1A 3UETA 1HJXA 2UWFA 5BRPA 3BVWA 3WUEA 2J62A 3KL5A 3ZR5A 3PBGA 3K8KA 3OA5A 1C90A 4J3WA 1Q6CA 2DPEA 3N11A 1H1NA 2PI6A 3LRMA 1VB9A 4PMUA 3AZTA 1QI2A 2EEXA 3VD5A 2W67A 3WD3A 3POCA 2XN0A 1HIZA 3AS2A 1G5AA 1SMDA 3WQ6A 3HU7A 5A2BA 2G41A 3L4UA 2C7FA 1WZMA 4H8HA 1EO7A 5C71A 2WSPA 4ZE5A 2PWFA 2BXZA 2WPGA 4FLOA 1XH0A 4H8VA 2J7CA 4S3KA 4A3YA 5CG0A 2J7HA 4AYSA 2CKRA 1V03A 4FLQA 3RDKA 5HXMA 2YL6A 4M81A 2EACA 1WP6A 3AMCA 1B3XA 1TE1A 2V5CA 3ZSTA 3K8LA 3W37A 1ZBKA 4OBSA 4ACYA 4KH2A 1TA3B 4LYQA 4X0VA 4P8UA 1H09A 4B3KA 4J3VA 4UOQA 1HP4A 4WK9A 2VO5A 1WDSA 1HKIA 1R46A 3W6LA 1NP0A 2J7DA 1JXJA 4CKQA 3SCPA 4AWEA 4AW7A 5I5RA 1CPUA 4NRSA 3AYRA 1ZBWA 3VVGA 4WIWA 2WVUA 4HZ6A 4L4OA 4GZJA 4K68A 2EABA 1NOUA 2DSKA 2WW5A 2CXGA 2XFYA 3CIVA 4Z2KA 2CITA 4TUFA 4AIEA 3CHEA 4CD6A 4DUXA 3BXWA 3DX3A 1XHGA 4YPJA 1BFNA 5IFTA 1LL4A 1PS3A 4WF7A 1CGTA 1CXIA 4RE4A 3DDFA 3NSMA 1E1EA 4NXSA 1GOOA 1UWQA 1E6PA 3TP4A 3ZJ6A 1HF6A 1TZ7A 2E9BA 2ZUNA 4PMOA 4Q22A 4UOZA 4PMRA 3ARYA 1UR8A 2IXUA 1GQIA 1CNVA 2VQUA 4KRTA 3VIFA 1LL6A 4FNRA 4AMXA 4QLLA 1JZ2A 3L4XA 3OGVA 4AZCB 1MXGA 1BG9A 2BY3A 1J12A 4W88A 5BCAA 1JZ7A 1TA3A 2WYSA 4HMCA 4AEEA 3A4AA 1R87A 5ABEA 2IGTA 1WB0A 3H54A 1GOKA 2FH6A 3EBVA 3DC0A 4PMXA 1JFHA 1BQCA 5BXSA 1EQCA 3BVUA 3E1F1 1GQLA 2YA0A 2YKKA 1QWUA 4U33A 4CD5A 3EJQA 1OD0A 3VGGA 5LA1A 1Z32X 3K4AA 2W5FA 1J18A 1LL7A 4AD3A 2WBGA 2WZEA 2Y24A 1KGWA 2F61A 1J0IA 1NH6A 3FY1A 2CBVA 3CUGA 5HNNA 3L2MA 2UY5A 4Y7EA 3TA9A 3EDEA 3DYPA 1UWRA 1W3LA 2V5DA 1MYRA 1G94A 2WHMA 2CESA 1G01A 4PMZA 2D0HA 2BHUA 2BFGA 4EKJA 1HL8A 3WDQA 5GNZA 3PZQA 3WF3A 5BXPA 5CSUA 4HU0A 4P7QA 2X05A 3WF4A 1OGGA 1CECA 5BRQA 5CPQA 3I3DA 3RM4A 1R85A 1H5VA 3WUGA 3DECA 3VSVA 3W25A 4D6EA 5A1AA 3UG5A 3CZJA 2XVNA 4Q7NA 1UD2A 4AEFA 1V6YA 5DEZA 2YA1A 5M5DA 5DFAA 1FA2A 1UR1A 4EAMA 3CBWA 1GJWA 2GDVA 4W7VA 3DDGA 3CHFA 2XVGA 1IZJA 1MQRA 3GZAA 1U2YA 3AIUA 3RCNA 3WH9A 4AZCA 1DWIM 1UR9A 1CXHA 2RGMA 4DWSD 4Z2LA 7A3HA 1BAGA 4PMDA 5AYIA 3D5HA 2XGBA 2UY3A 2VZOA 1J0KA 1KB3A 1W9UA 4E4PA 4M1RA 3IAPA 2JF6A 1UHVA 3WNLA 2E0PA 2A3CA 2G8ZA 4PTVA 3RILA 1SZNA 1JDAA 1R75A 3NCOA 3TTOA 1QHZA 3H55A 4D6JA 2D0FA 4OBRA 1W9VA 1L0PA 4YN5A 2ZXAA 1BHGA 2VURA 3A24A 3WH8A 5A6JA 1C3FA 2DGAA 5HPCA 4C7FA 4WLCA 2XIIA 3BAYA 4HA3A 1N82A 3WDPP 1PX8A 1CYGA 2PB1A 1DWFM 3SUUA 3MU7A 2EBNA 3AISA 4MB1A 1P6WA 3BAXA 4PBGA 3PZNA 1HJUA 2J8FA 4HP5A 1QI3A 1QW9A 3AROA 3FXYA 1ITCA 2XWDA 2XM2A 3AICA 1HJVA 4S3JA 1M7XA 3BUQA 1SYTA 1MQQA 1NQ6A 4PMNA 2D3NA 4MADA 2F18A 5C8BB 3BUIA 1E70M 3SUTA 2VR4A 1PPIA 4QCEA 1JAEA 4H04A 1E3ZA 2WMKA 3MANA 6TAAA 2BY0A 2ZUSA 1HJSA 4UQ9A 5A2AA 2VX7A 1ZJAA 4BF7A 4MDOA 3PHAA 5AYBA 3PZIA 2A3EA 2V3FA 1M04A 2X2YA 2JEPA 5A8MA 1VIWA 1UUQA 3AXIA 3MO4A 2GK1A 3DX0A 3UEQA 1FOBA 3F4VA 1XCXA 2PBGA 2PWGA 3VIKA 1D7FA 1AQHA 2D1ZA 1B0IA 2VQTA 4Z2HA 2WCGA 1W3KA 1JDCA 2A3HA 4JKMA 1B3ZA 5LA2A 4MNLA 3W27A 1JGIA 2GUYA 4WSJA 1VF8A 2F7QA 5I3DA 4QFUA 3NSNA 5IHRA 1XGZA 2XWEA 4W87A 2EO7A 2O9OA 3GXMA 2ZX6A 3G6MA 2PWHA 3D4ZA 2EPNA 1EHNA 1DTUA 5IFPA 1QNQA 4XX6A 5D9NA 5IDIA 3DYOA 1B30A 3WNKA 1US3A 9CGTA 3BUBA 3VIIA 1LG2A 3W24A 1BPLB 1JYNA 4NZFA 1BGGA 1EOKA 3ZO9A 3OG2A 2G3MA 1C7TA 1WO2A 4ATDA 1TMQA 3BAJA 1R7OA 1ISXA 1QNPA 1JI1A 2XN1A 1EDGA 4M29A 1EGZA 2WMIA 3WY2A 3M6DA 3W0KA 3KL0A 2V38A 3GNPA 4XB3A 2ZX8A 5JBFA 2WCAA 1GCYA 5I24A 1SR0A 1TQSA 5EB8A 2NT1A 3N04A 4GI9A 1GOMA 3WNMA 3RPMA 1FFQA 1Q4NX 1E73M 1GOQA 2BNJA 5M03A 3W26A 1IT0A 3AMGA 1GJUA 2VVSA 1R33A 1JNEA 5D9PA 4OUEA 2WCSA 3VDAA 2QV4A 1OINA 3W53A 3ZIZA 3BLBA 1J11A 2YLLA 4D6CA 5D9MA 3RM9A 3WUFA 1B3YA 5A95A 2G3IA 3VM5A 4F9DA 2OYKA 5F7UA 2PF0A 3WF2A 3VMNA 2YL8A 3FHAA 4GINA 3KEHA 4PTXA 3PZVA 1UKTA 2WVVB 2A3BA 1JZ3A 4ACZB 3BMWA 2FGZA 3OB8A 1V6UA 3VU2A 3U7BA 3WFZA 3EJTA 3CUJA 3KZSA 1TG7A 3WEOA 4B9ZA 1HJWA 5BWFA 2QHAA 1UOKA 2YFNA 1O6IA 4ZXOA 2FH8A 3GBDA 1EOMA 3MMDA 1US2A 3VIHA 1H2JA 4AISA 2NT0A 3WELA 3F5JA 5DT5A 2BVYA 3N17A 3GXPA 1EHAA 3UESA 2WVSA 3AXXA 1JXKA 4OKDA 2ZWZA 3PZUA 1H4PA 1R34A 1OGSA 1XSJA 2VZTA 2QMKA 1AMYA 3KLLA 1JI2A 1E72M 4AZ7A 3QGVA 1V0LA 1QHOA 1R86A 2WM0A 2DIJA 2VI0A 3VIOA 2VX4A 1AVAA 3AIWA 5A6LA 1R8LA 1TQWA 1JYWA 4KMQA 3ZSSA 1VENA 3VDBA 4TVDA 4TVUA 3AIRA 5ECUA 4V28A 1SMAA 1JD7A 3CZKA 4CN1A 4EANA 2XPKA 3LXBA 3MUIA 4A3HA 2X0HA 5CXPA 1RH9A 3VIJA 5HDRA 4PEEA 4LGXA 2PBOA 4XV0A 2YDRA 4P7LA 2Y5EA 1CDGA 3BLPX 1E56A 5FOOA 1W91A 1CXLA 4ZXLA 1B1YA 2W62A 2BV9A 4BZYA 1JZ5A 2VMFA 4JZ5A 1T0OA 3SUSA 1NOWA 4KGJA 1CEOA 3VSUA 3WBAA 4BQ2A 1EO5A 2O9RA 3TTYA 3EJUA 3M07A 3WQWA 4UFJA 3LPFA 3SIMA 4DM1A 2ZWYA 1ZBVA 4MB3A 4UFLA 2JF7A 3L4WA 3A6OA 3NDZA 5E1QA 1S46A 1A47A 3K1DA 3W38A 2DT2A 3BAWA 2CPUA 4PTMA 1J01A 1UH2A 4P8VA 4AZ6A 4F79A 3GXNA 4F9JA 3VPLA 2QPUA 3CZSA 1JDDA 2WNWA 1GOWA 3SCTA 1UD3A 4W86A 3L4YA 3SUWA 1CENA 1EIBA 5DMYA 3NJ3A 1KBKA 4IM4A 5GNYA 4V27A 4OJYA 1W9BM 2OYMA 3OLGA 3W81A 1J0YA 3I3BA 3WD2A 3U5YA 1CGUA 1R47A 2YL9A 4HOWA 1XYZA 4UQAA 4AZIA 5C70A 2RGLA 4ZE4A 4L4PA 3K8MA 1KBBA 4MNMA 1W1VA 4PTWA 3UERA 1UZ4A 2DH2A 1UWTA 1NP2A 1DHKA 4R5EA 1GVYA 3A4XA 3VD3A 1NWSA 3PZOA 3AMDA 4P7OA 4E8DA 4UQCA 3WD1A 4D6DA 1V3JA 4IISA 2BY2A 1K9TA 3MI6A 4J27A 1W9PA 1ITXA 4IPNB 1E4IA 2CBIA 2E9LA 4PCTA 2GK1B 1E3XA 4HA1A 4MPKA 3OLEA 1W3JA 3WD4A 5CLTA 2WMHA 1R7AA 3ZM8A 2J47A 2XN2A 1FP8A 2YFOA 2CBUA 1F4AA 4JAWA 1KQZA 2WLZA 4YHGA 4IUGA 4HA4A 1MWOA 2E9MA 3K4DA 4DO4A 3NUKA 2WAGA 4W5ZA 1QPKA 1DEDA 2X09A 2F7PA 3VILA 1PZ2A 2AOSA 1E6ZA 2XGIA 3VDHA 8A3HA 1W1TA 1WZKA 5AC5A 3THCA 2CHOA 2JEQA 4B15A 3VX1A 3D3AA 5D4YA 3S6TA 2QF8A 2EPOA 1MFVA 2OW7A 2NW0A 3ARVA 4D6GA 3HG5A 2VCCA 1BYBA 2W92A 3N18A 4UFIA 2VRKA 3RMEA 3AS1A 2VX6A 1JZ6A 2Y4SA 5E09A 1FH9A 2BHYA 1UKPA 2J79A 2WK2A 4J28A 3TONA 1LWHA 4FNTA 2W91A 1PX3A 1VFMA 3VD9A 3IK2A 4U2ZA 4RE3A 3ZJ8A 1Q6FA 2A3AA 3IJ8A 4W5UA 1KTCA 2FHBA 1QI4A 4N0RA 2VTFA 2ALWA 1UZ1A 1E1FA 2D24A 1WDPA 3CZNA 1NM9A 4TOQA 3GH7A 5I78A 1CZ1A 1J0HA 1CWYA 4P8XA 3W4RA 2YJQA 5KZ6A 3OBAA 2XIBA 1C93A 1CIUA 2XFFA 1TCMA 5A6AA 1ZS2A 4OIFA 1W2PA 3SEPA 4CN6A 1HP5A 4FF5A 3PZTA 2WBKA 1XSKA 2F2HA 2DEPA 4D6IA 4TTUA 4PMVA 2J4GA 5A2CA 1MXDA 1GNXA 4CCDA 3BUDA 3LXCA 4FNQA 1JZ8A 3TV8A 4DO5A 1XYFA 1MW0A 5ABGA 4AXNA 2VZUA 5AC4A 1HKJA 4LPCA 3SUVA 3GXFA 4JFSA 5A6BA 3LPOA 1FHDA 1LF1A 1LLOA 5A8PA 2EJ1A 3BUPA 4GZEA 2GDUA 2Y8VA 1DWJM 2OWCA 3CZ8A 1G0CA 2F1BA 3VGFA 3ZJKA 2OWWA 2YA2A 1JAKA 1ODZA 2CIPA 4E8CA 4QCFA 3UR7A 2OSXA 4R27A 1VFUA 1U30A 1AQMA 1GHRA 1H0GA 1QW8A 2X0YA 4V2XA 4JIEA 1M03A 4CU8A 1GONA 1UR4A 3RIKA 4JKLA 2Z1SA 2O9TA 2O9PA 3VKKA 5M17A 1K6AA 4DWSA 2ZXBA 2ZICA 1CLVA 2UY4A 4GQQA 3MKKA 2WVTA 2OW6A 2XG9A 4UTFA 5HBFA 4CVUA 5CZKA 3GXTA 4NX0A 4QLKA 1YHTA 4XZBA 1QI0A 3WDHA 3D51A 4PYSA 2VC9A 3VINA 4BQ3A 1EXPA 3WEMA 4B3LA 5FL0A 3SCNA 4GXPA 4GI8A 1DWAM 1NWUA 3HG3A 3AXHA 3WBEA 4EE9A 3JUGA 6CGTA 4GO8A 1QX1A 3SURA 1GVIA 4F8XA 4MAZA 2WZHA 3KWXA 2PWEA 1RP8A 4UOJA 3WNOA 3RJXA 5EFFA 4NSBA 1UG6A 1PEZA 2DSZA 3ZT7A 1E6QM 5AY7A 1XRVA 1HKMA 4TVCA 1QNSA 4HZ7A 2JFEX 4UFHA 1VFOA 3AIBA 2EQDA 1W1YA 4DO6A 1H0IA 1E6NA 1UD8A 3GXDA 3U57A 2DSWA 3CO4A 3PN8A 4WKAA 1V02E 4JKKA 3AIQA 2CCRA 2WXDM 3GXIA 1UD6A 2FHCA 1UR2A 4AIUA 5TD4A 3BAIA 3N15A 1UWIA 1MW3A 2QLYA 1KQYA 3CGTA 3I3EA 3VGEA 2FYVA 1PJ9A 1E5JA 1NARA 3BSHA 1WE5A 2TAAA 3APGA 3VM7A 2FGLA 5KEZA 1W9DM 3NIYA 3NSXA 1C7SA 4TX6A 4U3AA 3FAWA 4QLJA 1V3HA 4PSRA 2VZVA 2F7RA 3AS3A 1E55A 4M56A 3CHCA 1E0WA 3W6MA 4GKLA 3ALFA 1H3GA 5A6MA 2X2IA 1UQZA 5A8NA 2GJPA 3A3HA 3AHTA 3BSGA 4W8LA 1ODUA 3LRLA 4LYRA 3EYPA 4FNSA 3WNNA 1HL9A 3ARWA 5I0DA 5FD0A 4J3XA 1CGYA 1H11A 5GQBA 3AIEA 1UASA 4UFKA 1TFVA 4CCCA 3WDRA 1CGWA 4A4AA 2ZUTA 4P8WA 3BMVA 2YBTA 2DH3A 5E0CA 3ARXA 1XD0A 4CU6A 1KCLA 2G4FA 3WMSA 3LX9A 2DSVA 2DT1A 3O9NA 3WY3A 3WL1A 1XSIA 2JALA 3EJRA 1GOIA 4QP0A 3B9EA 3QHMA 3GTNA 3SCRA 3CMGA 3HG4A 4HPHA 1JF6A 1KGXA 4FNUA 4JCMA 4PMQA 3WMBA 1RPKA 1CLXA 3ECQA 5DF0A 1H49A 4JHZA 3EJPA 3KL3A 3CUFA 3MSDA 3WY1A 3AHXA 3AZSA 4AMCA 4AZ5A 1OSEA 3A22A 3WF0A 1UA3A 1BVZA 1OM0A 1E5NA 2OWXA 5ABHA 2E8YA 1WNOA 1J0ZA 3QHNA 3T2OA 1ECEA 1VRXA 1X6NA 3POHA 2FHFA 3TTQA 1HT6A 1UWUA 1EA9C 3B9AA 4JL1A 1W1PA 3SCQA 4TTGA 2C8NA 4KWUA 1JG9A 4Z2JA 3GDBA 3AMKA 3PTQA 1MW1A 1XV8A 1V6VA 2VRQA 1E4LA 2DIEA 1J0JA 2F7OA 2GSJA 4NI3A 4W89A 4F66A 4PCSA 4J3SA 4NZCA 4CCEA 3BCFA 4PRWA 3VNYA 3LMYA 3EDKA 1C91A 1E6XM 2G3NA 2WVVA 3G6LA 4X0NA 2WMFA 4TXEA 3N1AA 1CGVA 2D3LA 1EQPA 3OZPA 4UR9A 3RM8A 1QWNA 4AY1A 3HZ3A 2BY1A 1V0NA 2ZUMA 2AMGA 1ZB5A 5EFDA 1PIFA 4PN2A 1UKSA 3AI0A 2XSBA 2JE8A 5JBEA 2OSYA 2XVKA 1QI5A 1B31A 3OZOA 4W8AA 3EMQA 3THDA 2OSWA 2BVTA 4CD7A 4KGLA 5CGMA 3WFLA 1PBGA 4H7VA 4HMDA 3BC9A 3N13A 1KCKA 4QAWA 1CTNA 3NYDA 2VJXA 3GBEA 1O7AA 4HMEA 4CUCA 1VJSA 2WHJA 4CVWA 3WKZA 3W82A 2VCAA 3VSTA 5E70A 2GJXB 3F5LA 3FNDA 1I1WA 4W84A 5BROA 3A5VA 3MV01 2HISA 3WQ4A 4B9YA 3CPUA 3EJSA 2JIEA 1BG4A 3WL0A 2V3GA 1FFRA 1YQ2A 5GPRA 1KFWA 1E9LA 5DT7A 1G9HA 1HWWA 4PMYA 1OD8A 1EDTA 4B16A 1TR1A 4CU7A 3CV5A 1W2VA 1XH2A 3ZT5A 1ZBCA 1OIMA 3SCUA 4AD2A 1W3HA 1GW1A 3IJ9A 2GFTA 4JL2A 1E6SM 1ISWA 3T2PA 3AHVA 4CGTA 3LPPA 1BF2A 3AS0A 3RO8A 5A8QA 3M7SA 4UQEA 4HTYA 4DUVA 2E4TA 3HN3A 2HVMA 2X1IA 4LYPA 4D1IA 3A4WA 4U2YA 1K9FA 4U31A 1FP9A 1V02A 1KWGA 2FE0A 2V3EA 1WAWA 3QHOA 2ZX9A 4W7WA 3OLIA 4LXFA 3VGBA 3LPGA 3TOPA 1TVNA 4ZENA 4NXKA 2ZIDA 3MUY1 1OCQA 4TX8A 2CBJA 4CD4A 1XH1A 1OT2A 2DT3A 3QR3A 2ZXQA 2DDXA 4X9YA 1EH9A 1BLIA 1JF5A 3S2CA 5GNXA 5D8WA 1OB0A 1KWKA 1KR0A
chains in the Genus database with same CATH superfamily
2BIOA 2LLGA 2XYCA 2GB2A 4L5FH 4MYWB 5AYUL 1LUCA 3INPA 1T83C 7XIMA 4Y1AD 4M6UA 2DZWA 2R23A 2RJGA 1LK2A 2HTKC 3BVXA 5MEQA 3PZGA 4O51A 3TKFA 5CWSA 4RAUB 5CKGA 3UL4A 5D2NA 3ZRSA 4Q9QL 1F3XA 2VXTH 1ROWA 1X44A 2FECL 4J3TA 5A3ID 5J1SC 1IIGA 2HWGA 1S2UA 1EZSA 2JB5L 5EZLA 2AQOA 3KBSA 3W3OA 5C9JA 4AF0B 2OTWB 4UNTA 4GOSA 1XGTA 1N6VA 5IVXE 3T4YB 4FMVA 4AZBA 5LNRA 1RY8A 2F8XC 1WD9A 3T2QA 3L3OA 3IJ7A 4MDIA 1RZFH 3MODL 3B0VC 4WUUD 3II1A 1XGPB 1C8QA 3P4NA 3T6WA 3VU1A 4XK2A 3M7OA 1G9ML 1UD5A 1KG0A 2BRRH 4MAYA 4KKLD 2J6XA 3MRMA 4M24A 3U7VA 1M05B 4UNIA 5AC7A 5EYWA 5SWQB 5CEZE 2GUBA 5FF4A 1Q7MA 3AIVA 4B97A 4L4TB 3T65B 1FH7A 2WLJA 2CJUH 2D9QB 3C6LC 3DMMD 2E6QA 4DESA 5I6XC 5DCEA 1QBLL 2FSEA 1NGXA 4Y7MA 1AZ1A 2NLYA 2JKLA 4AMAA 1ODAA 2CHNA 3A23A 3HCVA 4MNQB 4DP7X 4E9TA 1V3KA 3GRWH 1AZUA 1SYVA 3H2QA 2VLKE 1SRDA 5DVMA 4IOSD 3TCLB 3GZPA 1REQB 3PHOA 4KWOA 2ZE3A 6REQB 4UAOB 4W6WB 4TO8A 1BYNA 3BIAX 1A49A 2PCPB 3SY0A 12E8H 4NQCD 3TBSB 3UJJH 1NGXB 3ZQ9A 1L4IA 2C9SA 2QQQA 1KB9J 2ZYSA 4K94H 4XH2B 5E08H 3U46B 1C8YA 3VWJC 1SU5A 2VRJA 4YE4H 4K3DL 2LHAA 3Q6FB 2PTYA 5MP6L 1JNDA 4WQ6A 3MHZA 4HEMA 1KM3A 3NURA 1FO0A 5KG9A 4P2OB 2G9KA 2GJZA 2W8CA 1ISZA 1GW0A 2K3TA 1FSKB 3FUMA 1UQYA 3U2CA 4I87A 4R88A 2IOOA 1Z48A 4LV9A 2R9HD 4C5YA 4OCXH 1JL8A 1U8JB 3TVMB 1Q6EA 1HKKA 4IS6B 3QRHA 4CNPA 1RK0B 1ZHBA 4ZS6C 1OSYA 5TDNB 1F97A 3QO0B 1MFEL 3GIVA 1ZL1A 4O53A 2DT0A 1MWAL 1KIRA 4E9WA 4GAGH 5EUOA 5IG7B 5LIUX 4MTVA 2ATAA 3VQLA 2WSQA 2R4RL 2HT4D 3ZGIA 2BFVL 1A0DA 1YX1A 3QEZA 2J77A 4KIEA 3N1MC 4AD5A 1FGVH 4U1LA 1BBJA 3SPJA 2YBUA 3AJ7A 3L17A 4IU3B 1FWDC 3DJTA 3MV8E 1ZKAA 4Z76B 2EPLX 5IUCA 1E6RA 3DOPA 1X5KA 2PW2B 2VUYA 3DUSA 2IAAC 3EJCA 4UR7A 4H0IA 5CBAA 5L8KB 2BG5A 3CXOA 2E40A 3QNZA 4K3EH 2B4CC 5CGTA 3RG1C 2CJUL 3JVGC 3RPIB 1WPCA 1JCTA 3VGAB 4BCEA 4AMWA 2H32A 3WQ8A 1LEKA 3VTTA 3OAZK 3D2UD 1INEL 1F58L 3GPEA 2PR4L 3L7EB 5CEXA 1OAUL 1M7PA 3X11A 1RD5A 1IAKA 1M41A 1WOAA 3I4EA 1KEML 4H8UA 2WKLA 4M9OA 4JFXA 2DBJA 3V55A 2J1XA 2GQ3A 1BVNP 5HOSA 3BFQG 3B83A 1CE6B 2AMXA 4HSCX 4UTAH 1M2OA 5D7KD 2V4LA 1P1ZA 4KROD 3GKFA 4HK3N 4PUDA 3HZKB 4WFED 1Q5MA 2J6WA 1S9YA 3RP1A 2EKSA 3VW3L 3KFTA 4ZA0A 2VW6A 5HNRA 3O6DA 1GRWA 2GWGA 3EOAA 1QBAA 3CVIH 5TFSL 2R9RA 4G8AC 1IFHL 4YBLB 3WS6A 1YRRA 3BCDA 1KN2H 3FO9B 4GG8B 4U1GC 3EH2A 3RB5A 2EDFA 4QKTA 4NF7A 3RRAA 3L6FA 5C0GB 1FKWA 1CR9L 4ZPVA 2YOCA 2Y36L 2V8ZA 2Y62A 3VXPA 5EMMA 3S9DB 5G2HA 1MFEH 3CPLA 3V0JA 3P0VL 1R3KA 2OP4H 3F2LA 3QDGD 4UAHA 1MSSA 3QDAA 3TEUA 4E2OA 4L64A 3ZR4A 4J3OH 1C5BH 4KKZA 1NEYA 2FZMA 3K46A 1N7KA 2X4NA 4OFYD 2F53A 3GKZA 4F7PA 1NCDH 1EX0A 2V2WB 4CBPA 1UOVA 3CUPB 1A50A 4GIEA 2BVQB 2DOCA 5D93B 3D0VA 1TTGA 2BIMA 3FW6A 5MP6H 2EC9U 4NJIA 3HE6B 1C9DA 4KX8A 2PRHA 1WG3A 4AC1X 3EFOB 3WBWA 1UKQA 3P40A 3NQBA 4LCRA 4ZS6D 1UFGA 2FUTA 4GG9A 3WH5A 2X7WA 1IM3A 1E4XL 1W72B 2J75A 2F54E 2EDMA 3NCBB 4WEBL 3IJEB 2MCPH 3VSQA 2REQB 1FC2D 4LLYA 3FT1A 3D08A 2D7NA 4JDZA 4XCYA 5D2LB 5I1CH 3GS7A 3NEEA 5EBAA 1D5BB 2ALDA 2IPUG 3CVHB 2IVFC 1CD8A 4GABA 1GPOL 2V7NA 1VFLA 3H23A 4DNHA 4YDKH 2GAZB 5CPSA 1BSLA 4XD6A 4CW1B 5C0AD 2GVYA 1WBZA 4PJGF 3BPOB 5FO7B 1YXCA 3ZVHB 1BQKA 1M71B 5IB3A 1E0VA 4QEHA 2AK4A 4DN3L 5BW7C 4C6QA 2WQSA 4LSSL 4XAWL 2VR5A 3BO9A 3ULUE 5M1TA 1IFRA 1U2HA 2P8BA 3IB4A 1ZT1A 3C60C 3G08B 4QOKE 1DPMA 1JV2B 5DHEA 4AH2B 3NGBB 2CDEB 5DMKB 4GZ7A 2QLVB 2ZE0A 3V0HA 2OT1A 1BX2B 4EZLA 1WAAE 1ZGLA 3GG1A 4JX0A 4P4KA 1DVUA 3MCG1 4NRZA 1AQKH 1X5IA 1FN4B 1DQJA 2WLYA 2ID5A 3QR2A 3XISA 4K37A 1Q6LA 1Q7ZA 2AK4E 2YSSB 1H7RA 1BX2A 2A9AA 5SV4A 5JYLA 1QOQA 1CCWB 2X3BA 4U1MA 1NEZA 4NQUA 3PGCA 2XM1A 2D2JA 3LEPA 3WD0A 4EK7A 1PZ5B 1BQLH 1KKOA 1QNRA 3JQOB 4GP8B 1WAAA 4N2EA 4GUIA 2XKUA 5JIPA 3PV7A 3VRIB 1D5MB 1SZGA 2AQVA 3HLKA 4D72A 1A2YA 1SDYA 3OGSA 1UCBL 2AJYH 3VXOA 4MD4A 4OV5A 3VKBA 3GSRB 3NQCA 4UANA 4LAQL 4TLTA 4B4FA 25C8H 5KS9A 2DTMH 4OZOA 2H8PA 5IROC 3JUZA 1JFXA 3SBFA 3CTLA 2I9EA 4X9BA 3OW1A 3B9OA 4QF1A 5HYIA 2XVPA 5H37A 3WLWD 3MLZH 4XRCB 1VR6A 4M3HA 4NZ1A 2FTPA 3IMSA 4XIMA 2XJKA 2XZCH 3EO9L 5F89A 4ZFMA 4QUOA 4PA8A 2ZTJA 1OCCB 4QXVA 2M83A 3EAKA 1YDPB 1AGFB 4F9PA 1TKKA 1VGEH 4U1SA 5DXYA 4NN7B 4JPIB 5B21A 4XD3A 3QJTB 5CPNA 3LH2H 4F7MA 5C3LD 4NILA 1TV4A 4O9HH 5TDPB 1SSGA 2ISFA 3VUPA 3MRLB 2AXJA 4HHAB 1I4NA 2E3ZA 1R5WA 1YEIH 4CVXA 1P7TB 3MV7E 2VSMB 3EYUL 4MHHG 4LKXA 2AJSH 1WKDA 3SPIA 4F7CA 2P46B 3T0AA 3ID7A 3B8SA 1J4EA 4ZNEA 1M4KA 1QZ1A 2TMDA 3MJ7A 3C9NB 3ZE2E 2ZZ3A 4FXJA 4U0RC 2QDGA 2LAAA 2VOTA 2ZX5A 4MWAA 3IKCA 5D8ZA 2R69H 3WJXA 1N19A 1PAMA 2HE8A 5B7ZA 4G7FA 3RB7A 3T2LA 3WNPA 3GR4A 3ZE1F 2CLKA 3RRQA 1BECA 3E6HB 2RDUA 1DSFL 1KUMA 2B1OA 3HMCA 5T5NG 4F15C 2GK0B 2I26N 1AGBB 2JK5B 3OF6D 1ITUA 2ZXEB 4PRPD 1DSYA 1K03A 3BQUB 2M1KA 3EYSL 3N85L 2E67A 4NZ5A 3FA5A 5IJVB 2XN9B 1L2QA 4ZAKD 1TPEA 2CO3A 1OTUD 5ABFA 2W65A 4GAGL 3QIBC 3IS1X 1AMXA 1D3CA 1WIOA 4B0MB 5ACMA 2YAEA 3S96A 5IWLA 4XX5A 3ZTEA 1IT7A 1TTQA 2R7EB 5I6SA 3VOCA 1QMUA 2Y5QA 2YXWA 4IKIA 1T6WA 4L7ZA 2QPSA 4TUUA 3GNNA 4CDGC 1HXKA 4DW2L 1BEYH 2Y5TB 5BV7L 1KM2A 2YUVA 2C0HA 3SCOA 3RUGF 4LOEA 3VQ1C 3BEWB 1NAMB 1TPUA 4NO2B 3DX4A 5EU6B 4HWBA 3LCGA 4ZPTA 1XD1A 2GCYB 5DELA 4ATLA 25C8L 5I77A 1HNYA 1YNLH 1BP3B 4Z78A 1P5VB 4WGHA 3C61A 2PP3A 1BVKA 2O55A 2HFEA 2PD9A 2OXGA 4NP4H 3DOHA 1LRTA 1HUVA 4FOJA 5M3WA 3G6JB 3VOIA 4CSZA 1FA4A 1Q90A 1HKVA 3FBQA 3HZKA 3MUJA 3TZVA 4PBVC 3QV6A 1PZ3A 4LSUH 3ZL4L 1YLBB 4XNMB 2YDAA 1XS2A 5TBOA 3FCSA 3WD5H 3TYUA 3W3BA 1OEZW 1XHHA 3L4CA 4L1SA 3Q58A 4NP7A 1H62A 4NHCL 4XZWA 5JHDE 5L9DL 3NL2A 1SYSA 4GCAA 3BSZL 3NABL 4AEHH 1B4KA 1PL9A 3IDIB 5J1AA 4JTHA 4V1DE 4JFDB 2PCFB 4FAMA 5ABFB 3QIBB 2GUOA 4WIQA 2BJML 1HHIA 4WZHA 2GI7A 3PAYA 2ZCLH 4DFHA 4ILSA 3N5AA 5I1JH 1XUUA 4N24A 2PDBA 3TO4C 3MUGB 1SY6L 3VKDA 3FTGB 2OVLA 2DMCA 5AVQB 4JN6A 1TSRA 5HDOA 2VM9A 1FCBA 5EBMB 4M1CD 5L2KD 1A80A 4A8RA 5FF6B 1P1VA 5FIPA 1U6AL 3R0MA 2OK0H 2FVMA 4FK9A 1OSPL 4WU5B 4FALA 1XFPA 3BPNC 3VAEA 5T33L 3A9IA 4N68A 2HJLA 4IU2A 3BWWA 5HPMB 2HRPL 2PO6C 5I17B 1Y0LA 2P50A 3UTTD 5FJPA 3LCHA 3G3DA 4XP6L 3JV4A 2Q8AL 1XYBA 1GHSA 3ZLFA 1C5CH 5F70A 1LVEA 4KTEH 5DZPA 3SYAA 3B2MA 2J66A 2ZDRA 4R33A 3UFYA 3IARA 1VD6A 4KTYA 2CRYA 2QCGA 4FP8H 1UZ6E 3QTGA 5F4XA 4DF1A 3FZUC 4PJIA 3QH2A 5LZLA 4I1PA 4XRCA 2H1PH 4XC1H 4WHYG 1QUNA 4JTIA 2NZLA 4Z0XA 3UGEA 2OX5A 2Z0BA 3BJFA 3F3HA 2VWEE 3RJQB 3WHXA 1QO2A 3VI3F 3G0UA 1AGFA 4P46D 2YKLL 3DHFA 1ORSB 4JFFE 2VN5A 4FS0A 1U92B 4DN4L 5DBTA 4U3CA 4Y9CA 4EIBA 2HLFD 4LLWB 1DE5A 1DIOA 2BVUA 1WXJA 3P62A 2DKMA 3VD7A 3ULUF 2JJVA 1WFTA 1YEHL 2KHAA 5ITFA 3ABGA 3GDKA 3TN5A 1MNZA 4GJ1A 1J5SA 2VMCA 2ZYIA 6TIMA 3NFPA 3OXSA 3IDIA 3FC8A 4G6AD 3VO0A 5BUGA 1HQ4B 5J1AB 3QM3A 3ZZQA 4UTTA 1JGEA 2DLIA 1M53A 2AQ1A 1NLDL 3FOMB 3IJSB 4HLZG 4LRNL 4MA7H 3WKQA 1TUXA 5A3HA 2VT0A 3FH8A 3U0TB 3C8KA 2NLIA 1GZ1A 1Q9LB 3EGSA 2LGNA 3HBGA 2LT9A 1FAKT 3HI6H 4P5SA 5AW7B 2G5UA 3UG4A 4C58B 2DIBA 3L12A 3OBKA 2VWEC 3N25A 1IE5A 3AQZA 3PWLA 2J56A 2WGXA 3CLWA 5HP5A 2FLBT 1XGYH 3BD5A 5FX3A 3V5HA 1IT9L 3QO1A 4XMVA 3KPNA 4MCYA 1S5IL 4XNYL 1J6PA 4QRPA 4YGVA 1T8XA 3HB3B 1JWUB 2V3DA 5DJ2B 3M1ZA 1REIA 4LNRB 5IKCB 1HINH 1L6FA 5CINH 1JS4A 3F5KA 5E6ZA 4XCEB 4BWUA 3MRBB 4DPBX 1GT8A 1OFDA 4MFEA 5DYOA 3W7MA 2WN3A 4OLZH 5GGVY 4PTUA 4MJHA 2X4QB 4QHPA 3IPWA 2ZCLL 3HFFA 3V8OA 1MCKA 1K4CA 1HHHA 3ZDXB 1NOFA 5DHXB 1GGIL 1JV2A 4C83A 4DY1A 1QVBA 3OA3A 2VCBA 1LO3H 1GSMA 1QATA 3DYMA 2WWKO 5EOCJ 4X98B 3EKCA 3H7BB 5CPTA 5LYRA 4DVOA 3JRKA 1TIWA 2XJ7A 3T6XA 4Z3HA 2VDQL 3ILQC 5EN2B 1A5FL 1MNUL 3F83A 1JNLH 2KZHA 4NI8A 1DBKL 3IFNL 3GKAA 3CVDA 2HVJB 4KJQC 1YDYA 3DX6B 3AZRA 3DTUB 5AL8A 5BQ7A 5AB2A 3S3PA 1ZAHA 2J7GA 4OZHE 1ONXA 3CTTA 1RP9A 1A8ZA 4LP5A 3K6SA 3O0RL 3R6IA 3CXHK 2PC8A 2NQCA 5E9AA 1JJKA 3LHVA 5T3ZD 1NWRA 4IMEA 1IAKB 2YGPA 1BVNT 1QFUH 2P5WE 4W9KC 4B9FA 1I2NA 4WUIA 1JBJA 2GG1A 1SHWA 4QXTA 3HJ0A 3CZGA 3ULUL 4L3CA 2CO1A 5JIQA 4KVNL 4Q8UA 1CG9B 4DKEL 2WXJA 4KK5D 2QCEA 3ZJ7A 3O9WB 5KW9H 3AWFA 5K39B 3IJYB 7CGTA 5M7QA 3MNMA 4HU4A 1BGXH 1FQ9C 3O6LH 3D3VE 4ZUVB 3GIVB 4PJDF 5CJQH 3U1SH 2NY6C 2OLAA 2OBGA 4BFNA 4DWSB 5IOPA 4DYJA 4HSNA 4JFVA 3GFXA 2VH5L 3Q9QA 4GKOA 1GS8A 3QIWB 5C0BD 5IR1B 2EH7L 1EUAA 3BPWA 4NAFA 1RZJC 4KO7A 4X8JA 4BFAA 2O5YH 4YTSA 5FYKD 4WY7L 4AM0Q 4YWGH 3CU2A 1NGWA 1E2ZA 4MJJA 2PAJA 4BFGA 4E0CA 3QV8A 4AY7A 4IK6A 2J74A 3BGAA 3V0IA 4HU8A 1P9MA 3GH4A 2JVUA 5HGGS 3O16A 3I6KB 3S47A 4BF5A 2A9ML 1AG6A 2YAFA 4HLJA 2HCVA 2VEPA 2IBZY 2WZMA 4AEOA 4WI0B 4L6DA 1AAJA 1G9EA 4IDJH 2DEWX 1RCYA 2D7PA 3RNKA 3W6YA 1TJ2A 1KLZA 4ZUSA 1W3NA 4ATWA 1YMMD 3GSQA 2B81A 4U10A 3KWTA 3FOKA 1GIGH 5BU6A 3PNZA 1MEXL 4QT5A 3DHJA 1CGXA 2WCPA 4QROA 4KBPA 3V6FB 4W9GC 5MERA 5FSEC 1WLHA 2OLHA 4HJWA 4DWDA 1CFQA 5KOVC 3W7RA 2WBWB 4DPPA 3LZQA 4HX1B 1HNFA 3RVUD 5B1JA 2ON3A 5FA3A 4EI5D 3CSGA 5LCVL 3O4LA 1MNNA 2VXTL 1G7HA 3C2VA 1OB1A 4I9TA 3AY2A 5BV7H 1R3WA 4F0MA 2ADFL 3JZ7A 2QZ5A 3VE7A 4J3BA 2J7FA 4M62L 4ORZC 3WTSA 4AUYA 1BYDA 5FYJU 4S3CA 2DKUA 1GZJA 2QGEA 4JN1L 3GYCA 2F53E 4HKBA 2ZD0A 1DWGM 3ARTA 3N0PB 4R97B 5AAWA 1DQIA 3KDOA 4UR8A 2WAQA 4M1DH 5DVKA 4GBXA 3GYRA 1SBSL 4PLKC 1AS7A 3T0EC 4Q8MA 2R39A 2V9RA 3PJXA 3BGFC 4PIRF 2D03L 1QSFD 5CWSB 5DEFB 3W28A 1FHNA 1E40A 1MSPA 5D2NE 1EDQA 4KUCD 3BIKB 4NN6C 5EH1A 3I6TA 2VL4A 3BLKA 3LS4L 3TBTA 3LNGA 3DVFA 1LJYA 2CKSA 5SX4I 1MUMA 3QEHA 4N9DA 4X60A 3V0UA 1EEPA 4LBEA 8CGTA 3KYMB 1S8DA 4QPEA 4X6DA 1O5KA 1DSWA 4I90A 2OU4A 3HE7C 3PWPE 3SY8A 1UZ8B 4WQOA 4JFTA 3STZB 2BGSA 4JREB 3WQPA 5GS1B 4AAJA 5C9XA 1FWJC 1TZ9A 1TFPA 3OHMB 3FQ1A 1DN0B 2XZAL 4YFEA 1F86A 4IHOA 3KOYA 5MERB 3V6FA 3RIAF 1AD4A 2IBBA 1KYFA 1A64A 2IQ9L 2N7BA 4FI8A 3C8DA 5IB4A 2JMRA 1H41A 2VM8A 1BMZA 3AT8A 1KR1A 5DXXA 3MSPA 4A2LA 1UOWA 3G0SA 3KCJA 2WJFA 4A2DA 4QGCA 4HUXA 4XP9L 2V81A 1RK1A 4HD5A 4FQ2L 4KK8D 4OAWB 2AQSA 4CNTA 3ZLHA 2Z8RA 3LKQA 5K3VA 3C75A 4G1EB 3T0VA 1J6OA 1ZLWK 3CQJA 3PL6B 4HK5A 2WZAA 2HT3C 4C59B 1JCYA 1VJZA 2NV1A 1RY7B 2ZCGA 3MUCA 1A9BA 2FX9L 4LE8A 2X53A 2C1HA 3B6SA 5D72H 5DFVC 3AO0A 3D25A 1U3ZA 3DWTA 5CP7A 5A16A 5DURB 3C56A 3WF1A 3UJJL 3S4TA 1NGQH 4TUOB 4PRPB 4FX8A 5REQA 1P5UC 4S0SD 3RVUC 1TCRB 3CHQA 4F0RA 3OPUA 3NH7H 1KV3A 4TNWK 3EPOA 3ITGA 1D9KD 3VG9C 2YCKX 3DO7B 4JBRA 2IV9A 3H2AA 4WEUD 1NUNB 5EOTA 4GPNA 3V4PH 4G6FD 4GY4A 3UETA 2OR2A 4U6XB 2UWFA 3PV6A 4YHIB 3CWGA 3QZOA 3BEVA 4KVPA 3MOAL 3BVWA 5FK9B 4ZUVA 2JJWA 4Y1TA 2CO4A 3BX7C 3QFDA 4HKXA 1AD0B 5FO2A 5KZDA 4XNUL 2YYTA 1NF7A 1F6YA 1YN7A 4J1UB 3DKHA 3HVDA 2H2PD 2VFGA 1GOXA 5TF1L 4H6QA 2C4FT 3Q05A 1J79A 3V7MA 4QJ3B 4G3YL 1RLBA 4FHAA 3O4OB 2VLJD 3QZBA 4MAUH 1D8CA 1DQDH 3JWNE 3RWGA 4FPSA 1I7TA 4PMUA 1IGTA 4WVRA 2X4UA 5BVJB 3KBHE 5FF3A 1JTOA 1NKOA 4FE9A 3DV6A 4PW3A 4X0KB 2EEXA 2Z91A 4JLRA 3VB8A 1P43A 2W67A 1NCBL 3U25A 1JGVH 2F5AL 4WDTA 2C26A 1GYUA 3R8QA 2DW7A 1UATA 3UBXG 4LASH 4R26L 1WUNT 4Q14A 4XX1G 5IHZB 1Z7AA 3LNDA 1HIZA 3OG6B 4U1IB 1Y5WA 1W0MA 2NQLA 1R2RA 4R34A 1KCSH 3AG3B 4HYTB 2JXMB 5ID1B 5L88L 2P80A 1CR9H 2AJUH 2PKDA 4TNVF 1DJXA 2KBGA 3L4UA 1L3NA 3CQIA 4JAMB 2V8LA 1RUML 5C09A 1V7NL 1WZMA 3VFMA 3HO8A 5C55A 5G4NA 5I2IB 1DFBH 5EU6A 2D7QA 5DO2C 5IP4A 4FADA 2WSPA 3SJNA 4FQXC 1Q13A 4A3QA 2PWFA 2XPGA 4ZDHB 4A29A 4KTDH 5A3IC 3M0VA 2J7CA 1GGIH 4OJDH 4KKXA 4S3KA 4POYA 4A3YA 3CDCA 3BDBA 1TTBA 4AYSA 3C60D 5E24E 4YLCA 5JORB 2Z93B 3TXAA 2A5HA 3RDKA 2FWSA 4IGMA 4BFOA 4ERGA 1WAUA 4E2DA 3VNMA 5JPNA 1JMXA 1B3XA 4JANA 3G9VA 4CVZB 1FBAA 1FDYA 4IIEA 4R90H 4P2VA 2JKRM 5KTLA 4OH2A 1Z8AA 3DXIA 2WLIB 4WWNA 1TA3B 3D12B 1N3NA 3QHFH 3AT9A 1H09A 4XZNX 2A6NA 2G9HA 3MROA 1OWWA 2ICEB 4DLFA 3R5EA 3WCZA 1HP4A 1GC1H 3FNKA 4AHQA 1IC1A 3FULA 2AKMA 4WK9A 5I3HA 1AHWA 2LE9A 2EVJA 3IUDA 2CWRA 3W6LA 4E9RA 5FAGA 2J13A 1KENH 2K6YA 3IAGC 4X80L 2R83A 5EZOH 3QEHB 2FATL 5LXGL 1NMCB 3EA2A 4AW7A 5I5RA 3P7YA 1IKNA 1T3FB 2CKBH 2F38A 4IDLA 3CVHL 3MCNA 1ZPUA 1A14L 2WVUA 1WQ5A 1ADQL 1URLA 3WFEL 3BAEH 3HRPA 3ZQXA 3EX3A 4M8VA 4AL8H 1MCPH 3G04A 3QQNA 4FLHA 3LRHA 4K68A 4Y16D 1KIUA 1CE1L 1Z5YD 5TQ0H 1BWVA 5E6SB 4FCAA 5IB1B 2ZKHL 2AQQA 4NJ9H 2CXGA 4ES8A 2XFYA 4JTFA 3OO2A 5I03A 2PUZA 3OKDA 4QQUA 1BIIB 4HOMA 3PWNB 5AZEH 4N26A 4N8VB 4WFFD 1H7WA 4DUXA 3G3LA 1IGSA 2EAWA 1XHGA 2H26A 5EUKB 1OW0A 3QUGA 5SWZD 2PLCA 2QJIA 4UDTA 4M6OH 4V1DA 4ZMYA 3KVLA 2WY3B 2Q02A 4R3SA 4O50A 3QIBA 3NSMA 1IBGH 1OX4A 5MEQB 3R06B 3S1VA 4XP6H 4IXXA 2X1OA 4OZGF 5I8OL 1KFCA 5JYMA 2H90A 2X2GA 3IMBA 5I00A 1UWQA 3ZJ6A 3EXJA 3QP3A 2E9BA 5EPMA 5T5FA 3KVDD 4AENB 2ZUNA 3RVXC 4PMOA 4B60A 4GYPA 1POKA 1YQVH 4N3UA 4Q22A 2Y61A 3GDRA 5GGQH 1TJRA 1UR8A 4H8WC 1U8NB 4A21A 1ACXA 5IHUL 2VIRB 3TFCA 2FMNA 4FNRA 5FFLA 2DWDA 4ODTL 1WBXB 3EFDH 4NWTL 1LO2H 4OSUL 2HRPH 4OZ4A 3FTYA 4UQ3A 4XVSH 4WWPA 1FWGC 4F7KA 1FDLL 2F74B 2MRYA 4QLLA 3OGVA 1MFAL 2ESVD 4AZCB 3NA9L 3KG5A 1HKWA 1FUYA 1CWVA 4OY9A 1QUNB 3OQRA 2M26A 1BG9A 4ZFGH 4XPBH 1TJGL 3UY8A 3QJUB 3HM7A 1J12A 3RLUA 5BCAA 1P84J 3BIBX 1B6UA 1J93A 3A6CL 3CHXA 4UMSA 3H54A 1WB0A 1LP9B 2FH6A 3DC0A 2HFGL 5B39G 3SQBB 5IM7A 3PHQA 2NR6C 1HH6A 4G6KL 1ML0A 1TVBA 2NMSA 4MFHA 5SWSD 1FWCC 1A1NA 5CJOL 5H35A 3GDMA 2YA0A 4HIPA 1NQBA 1E8YA 5KBMA 6FABH 1TU2B 3NCJL 2YB1A 3L23A 2NY4C 5D7IE 2BCKA 3VGGA 5J4MA 2EDQA 2ZOUA 5SWZE 3PFMA 5TE7L 1FORL 2DQ6A 1EMTL 1GGBH 5EG6C 1PV8A 1T1ZB 1J18A 2NXZB 5BRZA 3ZLQC 4AD3A 1MCLA 2WBGA 1EAOA 2WZEA 3MYZA 3I7SA 2OR9L 3R19A 1KGWA 2F61A 2ARJA 4LIQL 5F9WC 1TSIA 2QUNA 3DFPA 3CUGA 3CDZA 3BRGC 2UY5A 1W2KT 4KKPA 4PG2A 2JI3A 1VS1A 4WKZB 1W17A 4FQQB 2V5DA 3BLOA 1SZRA 4GW1B 5LGHL 5A6TC 2UX6A 2YK1L 2OTPA 1MJ8L 1FCQA 1AGBA 3O8XC 4J3OD 4ODUB 5T8IA 2BHUA 4TVPL 4PMZA 5H91A 3O2WH 3UBHA 2RTTA 4NQCB 4E8CA 5KAQG 2FWOA 5BXPA 1X9UA 5D1QE 4WEMB 4BZ2L 1GYMA 1BXXA 4BHUI 4MNQD 1INQB 3NRPA 5IFJB 1T99A 1SFDA 1U5VA 1B4TA 3K2MC 1SHXA 3K72B 4U1SB 1CECA 2JKEA 3I3DA 4MJ5B 3UJSA 5FGRA 1H5VA 3TPKA 4XVTL 1XYLA 2QCMA 3I75A 4IFKB 3WUGA 1AYOA 2I5GA 4GA8A 3W25A 1DVQA 3N9GL 5DHVB 4JO4H 1VCBC 1FXPA 1H8OA 3NVTA 3CZJA 3DX9A 5G4WA 3OAUH 4CEXC 3KJ4C 4FIRA 4G11A 4IQLA 3KXFD 5CILH 1FDLH 2Z31D 1FA2A 3UR5A 3CHOA 3M41A 1UR1A 4UTBH 5SWSE 4EAMA 2NY3B 4Q6YA 1GJWA 5F96H 4NUWA 4H13C 1YADA 3B8DA 1IXNA 1DE6A 2QCCA 4DB7A 2QIWA 5C0RL 5MKGB 3TXZA 4JFYB 1IGYA 2GDQA 1J1OH 4QMEA 3WFCL 4H2AA 4GC4A 1IXOA 4DZ5A 1EBAA 2EDLA 4DWSD 2ADAA 4WV1A 1HXMA 3BJ91 2NQ9A 2NXIA 1CFNB 3QY6A 4ONGH 4D9QE 1F6AB 1R17A 4BXVA 4Z8FL 2FT8A 1PAZA 1OCOB 2EDTA 1RZKL 4CC1A 2PTTB 1Y0EA 3JWDC 1UJTA 4F5CA 4DNMA 1AS8A 3U4EA 2I7GA 3HA0A 2XGBA 4LP4A 2ICCA 1AJZA 1KB3A 3CFTA 5DD1H 2R0LL 4M1RA 3IAPA 2E5EA 4HCIA 3N6QA 1ZK9A 3WNLA 1K8IA 2A3CA 3DARA 1RCXB 2D7OA 2G8ZA 3RILA 1SZNA 1U8NA 3MNVA 4K94L 5I0XA 5E08L 3NCOA 3VI4E 4XISA 1ZS8B 1M1SA 2Q3OA 4D6JA 3MLVL 1CFSB 5TAOA 2CALA 3A9BA 3PJWA 5DRNA 2A7PA 4OLEA 3GI9H 1LT7A 3KOXA 2DAVA 2CWNA 4GY1A 5T8GA 5F2MA 4RFNB 3MNDA 1BHGA 1ES0B 1SFLA 5DRWB 5A6JA 2DJMA 3QZWB 4XN4A 3H9SD 1CUOA 4HZLA 4WJ8A 2RDXA 3ALXA 2XIIA 3CFJB 1V7NH 1LDPH 3FQWB 5IVXA 3KH3A 1IEQA 2R15A 1RI8A 2I5YL 2RGSA 3UTPE 5IB3B 5F1SA 1P69B 2Q2LA 1YMME 3WDPP 1BJMA 1P7QD 3ZTJH 1CYGA 1SGKA 3DXAA 4N2LA 2PB1A 3SUUA 5DZLA 1OAYH 3C5JA 2E25A 4HZLB 4B0MM 1RMFH 3QF0A 2Q9OA 3GMMA 4MB1A 1PDYA 3OKDB 1TYJA 4TNFA 4PBGA 1ORSA 1EO8L 4KX7A 1SYSB 1I9CB 3FSWA 3KPRB 4JX6A 3IIPA 3DRTA 1KB5B 4NRZB 3RDTD 4WX2A 1V7AA 1XIWD 4XPTH 2NUXA 3GMQA 4EN3B 1DXIA 1ITCA 4AC4A 1YYMH 3W9ZA 3AICA 1M7XA 1SYTA 1MQQA 1O5DT 2D3NA 5B3SB 1S7SB 4LCCB 4KMTH 4Q8OA 4K8GA 3EOUA 3KMDA 3EXRA 3BUIA 1MMFA 4PJIF 3VXRD 3NZPA 2JI2A 3LENA 4ZW3A 1XGTB 3DFOA 4N2CA 3LH9A 1IEAA 1V05A 4MFDA 3TFBA 2V7NB 1IB5A 2K6WA 1HJSA 2BNUA 5ISZB 1Z9AA 5FYKU 3CQ0A 1XIGA 2KDGA 4JIPA 3L3GB 2HB0A 2IALA 2G0LA 1QSEB 3L9RA 3Q2LA 2ABAA 2A0LC 4YSOA 5EORL 5DLLA 3PWAA 2A2IA 3DBXB 4R5VA 3CG8A 5DFVD 4ANUA 3C8FA 2H3NB 4GRWF 4WJKB 4L4VA 4WVXA 5GRJH 4N85A 1JNJA 4A3UA 5K7JA 2YARA 5A8MA 1VIWA 3NA9H 2FX9H 5FUZH 2TODA 3AXIA 3T2NL 1P84K 2ZCHL 2GK1A 3DX0A 4OCLC 4WI2A 5B1JC 3OZ9H 4APXB 5MENB 1XCXA 2AJXL 3FT3B 2R29H 1VADB 4TOYH 1BFOA 1Z9SB 1WWWX 4KK6C 3ZDXF 2VKXA 5HHXL 2ZNXA 4GRLA 3VIKA 1FF5A 2DQIL 3QQXA 1OYCA 3FCUB 1N55A 3C2AL 3RL2A 4E9VA 2O7SA 4K7PY 3CFBA 3GMPB 3NN8B 2CLZB 5IBTL 4B7LA 3ZUNC 2AERT 2NZ1A 5E2JA 1B3ZA 5DC2A 1JGIA 4ZYKB 1VF8A 3DCPA 3IBOA 4PJ9C 3V4PB 1UP2A 2E86A 2R8WA 2IPGA 4MWAB 1W0WA 1Z44A 3TQPA 4Q9RL 3NSNA 5JXEC 3HG1A 5CS7A 4BYHA 4PJEB 3QWRA 2EO7A 5HHMD 4W87A 3PNUA 2APSA 4XWUA 2OS7A 2O9OA 1CURA 3QDMA 4FABH 4C6BA 1F6AA 3ABKB 3G6MA 2JCCE 4ODXA 4RWHA 3S36L 5EF3A 3WZ0E 1UYWL 3FSVA 2PWHA 4PCKA 1S6NA 3O2DH 1ZV5A 5C8JB 3D4ZA 3GNDA 5C0GA 1SXBA 1YEWA 4DCQB 1DTUA 5LNGA 2EPNA 4LBSA 5IFPA 4NC0B 4IRSD 1ZK5A 4L0YA 3SAZA 3LKSB 3C87A 2OOGA 3U83A 3FDKA 2EG6A 5HJ3A 4UNKA 2ZA3A 2B1HH 3HFML 4EIGB 4KTEL 2TSBA 3UP1A 4ZX3A 3BUBA 1LG2A 3W24A 1BPLB 3B8UA 1LP9A 4I5RA 1RZGA 3N42F 1IM9B 1YY9D 4NNYA 1OK4A 3IGSA 3L68A 1B0GA 3VFUB 3X11B 1T5AA 2IKJA 1XQKA 1RKRA 3E0WA 1KBPA 3CSYB 2G3MA 3OG2A 4EPEC 4ATDA 4QHNA 1HAUA 4ZMZA 3FS2A 1IWAA 4G59C 3RAJL 2HSAA 3MY9A 3RUGB 5J7CC 1QW7A 1ZP3A 2IAMB 1HKLH 1JI1A 2XN1A 5T1KD 3QARA 2MPVA 1UCBH 2AJYL 1EGZA 1JNNL 3B2UD 2WMIA 1AK5A 4QSFA 3W0KA 4NENB 4R90L 4OF7A 1BD0A 5KVFL 3FK3A 4QRTB 3S1UA 1IKFL 2VEIA 3QQDA 5FYJE 1Q9WB 3EOBB 2NXHA 1AJ7H 4G2AA 4PBXA 1N5AA 3IDUA 3OMIB 5I6KA 4LTSA 1NMCC 1TQSA 2B1AL 4QRQA 2NT1A 4Z7UE 1RUQH 2V17L 2APVA 4IS6A 3U1QA 3EBAA 3B1TA 4YHKH 4YDZA 1R5VA 3CFDA 2EIMB 3BGFB 4AY8A 1M7IA 2BDQA 3RPMA 1FFQA 4PJ7A 5I1EH 1XIMA 2X44D 4UYQA 2ZFAA 4H7ZA 4H5SB 1W37A 3RUGE 1RUAH 1IT0A 4AYEC 2H9AA 5TDOA 5DJDA 4R7VA 2R59A 1RBAA 3NCCB 1QACA 3CYVA 3P74A 3QPZA 4CQDA 5JVLA 5M95B 3UZEA 3CN3A 5D9PA 1QPXA 3ES7A 2QSCL 4GK8A 4OUEA 1AC0A 3P9LA 2C9XA 1OINA 1XFBA 2G4JA 4P5MB 2VUKA 3ZIZA 1W72L 3FONB 3HC3H 2G2PA 3HMXA 1EFQA 3ZX1A 1YPZA 1N59A 2V2TA 3TNNA 5CG7A 1XGPA 2FAUA 3R1GH 5D9MA 3WUFA 4WI5A 1IU1A 1BF5A 2W3ZA 5A95A 2FZBA 5FYLH 1LTXA 2DUXA 5B3JF 5ERWB 1ESOA 1DUZA 4F9DA 4TMCA 2ZXCA 5BZWB 4K73A 2OYKA 3STBA 5F7UA 2PF0A 2YL8A 4GYPC 3EJJX 1HZLA 3EH1A 2V9UA 3L81A 1A5LC 2YYUA 5F97E 3P4OB 4AUJA 4K15A 1AH4A 3KEHA 5K2ZA 2Y1AA 5SWZA 1ZGLB 1LBLA 2WVVB 2DI9A 2QJJA 4R8WH 1A7OH 4MPQA 3UBFA 2CDEA 4JHMA 2WZPA 4MZ1A 4Q6XA 2QBWA 2FGZA 4PHXA 1LK2B 1KNOB 5F9AC 2G97A 4N20A 3VU2A 1FIGH 2O5ZL 1SVDA 2OFJA 1CICB 1RQ5A 3U7BA 5KZMA 3O1NA 1X5FA 2YPIA 1NANH 3CUJA 1LO3L 3KZSA 4RE0A 4K3JH 3C2SA 2Q71A 5K4XA 1P4UA 4XTDA 2QHAA 4PJAE 1FL3A 2Y8UA 3BW9A 3FF8A 4AKQA 3UAFA 3PK7A 2UV3A 4IKLA 1EGJA 1GG1A 2YFNA 1LOLA 4JFOA 4HGWB 3GMRA 5EC1B 2NLJA 2ZDSA 4KAQL 5D7SH 2IADB 4KZEL 5KSUB 3CB3A 3BIKA 3DOSB 1E9QA 3CMOL 1H2JA 1XH3B 3VIHA 4JG0L 1IJ9A 5AW5B 4N25A 4ZW6A 1K7EA 2NT0A 5HR7A 4JO1H 3WELA 1ZQ5A 1E1CB 1QFUL 2QTVA 3UGXA 4YWIA 2EUVA 1D5RA 1ZXKA 5FDYA 1IEXA 2WVSA 3BN3B 4UIKL 3RGVA 1SLXA 5LQBL 2DVXA 3ABQA 3VWJA 4OKDA 1JEZA 4IG2A 3RVTC 1W1B1 3T6QC 1ECYA 3EO0B 3LCYA 3HI1B 2FVLA 3K6FA 4NAJA 3WXWH 3IFPA 5EO1A 2OK0L 4OV9A 4LL9A 3S83A 4ZB2A 4B2DA 1OGSA 3C12A 5AOKA 2PDQA 1S9WB 4FG6D 1EANA 4NPYA 4KIRA 2VZTA 1S5HB 4HIIA 3BGMB 4ZX6A 3ESUF 3KYOB 1IEHA 2I14A 3EO1B 2IKGA 2KZKA 1E0TA 2C6QA 4AZ7A 3VCLA 3WLKX 5F88B 1YMHA 2H9GA 3LN3A 1QHOA 3FRPA 2TYSA 3U0WH 5DRXB 2J9ZA 2BSDA 5F0PB 3RQ3A 3BGMA 2NY5C 2DIJA 5GISH 5JW4N 3SKOA 3MQIA 5LGYA 2KI6A 3H9ZA 3HAEH 3VCLB 1AVAA 3PB0A 4UU9B 4O0ZA 4C65A 4V11A 4OJFH 3I6EA 3NJXA 4GYBA 1T5WA 4PY8J 5DZJA 5HI4C 3VDBA 1M68A 2ESVE 1BA9A 3ARBD 3IU4L 3LH8A 4R0LB 4GVIA 2EDKA 4TVPE 4QR6A 2QSQA 4S0TD 5T3XD 2C3ZA 1FZKB 3LSOA 3K6SB 4QYOA 2X1XR 4GRWH 3Q8CA 5B22A 1MNSA 3T0ED 1JV5A 1SMAA 2Y1ZA 1IBFA 5ALCL 1EUNA 4S1DC 4S3GA 4XAPA 3UBXA 2FZ3A 3OZ9L 2DVUA 2IJ0C 4MLJA 1PZSA 1TF4A 2IH9A 1ZIAA 1OKEA 1NLDH 3LXBA 4A3HA 3HNSH 4HNTA 1UADC 2X1SA 5B7MA 2H3NA 3UYRH 3E6FA 3OAZH 1RH9A 3NFNA 5FCUH 1YN6B 2DF3A 4KX9A 4BQBA 2HMIC 3UZXA 1CS6A 3LKOB 5D55A 4LSRL 4C6KA 3T9WA 1MF2H 1UOLA 3VIJA 2OV0A 4AIXA 3EYFB 4LGXA 2GTWA 4MD0A 1TZ8A 3MOBH 3VXQA 2VC2L 1XIBA 4HUVA 4LUTB 4P7LA 2Y5EA 2OGJA 3N41B 4AGQA 4YXHL 5IB5A 4DJFD 1DXFA 3VKCA 1HWHB 3UTSE 4ALDA 3GMOA 4Z7VF 5CSBA 3U9PL 5DQPA 3EUUA 3IGAA 4C1NB 3UJ2A 2Z1WA 2QXWA 5H2BB 2DJ4A 3ATFA 4DI8A 2FECI 4P3DA 2OKOA 5INCA 2ZRWA 2CR0A 1IGCH 4MQ7B 5C0AE 1TR9A 4Q9CA 1I1AD 1DSFH 3UTQB 1RFDH 3TYFB 4YTQA 3AU1A 3QNYB 1X3DA 2G30A 4PJ8A 4P07A 5HI3C 5TE4L 3ZK0A 1CEOA 4FFYA 3VSUA 1EFXB 3KXFE 1F8TH 5C8BB 2OTUB 4BQ2A 1EO5A 3OKEB 3FB6A 5LNDA 3QDJB 3H2WA 4OD2B 2OP4L 3IEAA 3ZKNC 3E12A 4GX8A 3O4LB 1Z66A 1E90A 2IG2H 3EJUA 3QZWA 5SX5K 4NX5A 4UFJA 2VKWA 4MCZB 4OCRL 2ICWA 2NY7H 2J8UB 5B39B 4MDJB 5IVXB 3T1WA 4N2IA 4BKSC 1FL5A 5G5DB 4AK2A 3UCCA 3NO5A 3W75A 4FFZA 2E27L 4Y4KB 2PTVA 4RKAA 5G5IA 4YHPB 8RUCA 1BZ7B 4WU7A 4XP9H 5HGBA 3RY5A 3CYJA 5KTEH 2NYYC 5E1QA 5J11C 1S46A 4M6OL 4DWHA 3CWOX 5KANG 3W38A 2DT2A 3KPSE 3VXME 4U4MA 3H7VA 4A7TA 4Y4KD 3U4FA 5HPMA 3MNVB 1NC4B 5EULV 4QXUH 4G6JH 4ZTOH 2L7QA 4JY5L 4LEEA 1O6VA 5BZAA 4P4KC 3U6XA 3STGA 1KBLA 2P0OA 3IIXA 3C8KB 4FQCH 4PD4K 1Y0LB 4RA0C 5EIIA 5EU5B 1MZYA 2DV6A 2GITB 5I66A 2QVMA 1FCCA 2R9HC 3SBPA 1EA0A 1J9RA 4FXKA 1QR1A 1QTWA 3CZSA 4Y4HD 3SJVA 1EFXD 1JDDA 3BEWA 4Z5RB 1GOWA 1PCWA 4NFBA 4BFKA 4ORGA 1NGPL 3HR6A 5EZJA 3MCLL 2WNGA 4GIPD 4AQ8A 2W88A 1XW8A 5TE6H 4HS6B 4LEFA 1H8LA 3MBWB 5F6HJ 4ABVA 3NCXA 4L4MA 1JPSL 1DDHB 1AC6A 4L4TD 4N2FA 5M94B 1SDAB 3RGTA 3HZMA 5AB1A 3FVMA 4C6LA 3QJVB 3UXFA 1PIIA 3GHSA 4H4IA 3VD2A 4PJCA 4Q97A 2BGNE 5AW8B 2XFXB 3OKYA 4NYYA 1CC3A 4AL8C 1CGUA 2MEJB 4H20L 4XMTA 2YL9A 4DP4X 3WLTA 5AD0A 1TTPA 2EIDA 1RUKL 2R4SH 5AWNL 2YN3A 1OAXH 2GBAA 4UQAA 3MZNA 5E1AB 4EF8A 4CMMB 1VPQA 4PTDA 2FEDC 2O61B 4KK8C 5CBIA 3MN8A 1U6AH 3W0WE 3DI1A 3UZWA 3KOWA 1JRBA 3NJMA 2DH2A 2ISDA 43CAB 1NP2A 4G7EB 3NYKA 1BQUA 5F7KC 1ZEAH 3LKRA 1UVQA 1XGRA 5GGSB 3ATYA 3MXWL 6ENLA 4ZD3H 3N9RA 4LJ3A 1GVYA 3DV4B 5EO9B 3UCRA 2R14A 3A4XA 5I1DA 5K9QG 3SYOA 3UZQB 4L8SA 3CV1A 2VDQB 3FQNB 1LCOA 4ICWA 4P7OA 4QXTB 3N14A 3MVIA 1PF3A 4UQCA 5D5MA 4CSSA 1AXTL 4LCYB 2BY2A 5D1QB 4AQ1A 5GGSY 1UW9A 4XCEA 4N90D 4JO2L 3BKML 2QS8A 3QUZD 4TQEL 4ZUTB 1W9PA 3VFWB 5GJPA 1WCQA 1YSOA 2Z8WC 4OLYL 3OR6A 5HGHB 1FO0L 2FYMA 2X7LB 2ZVRA 3PBGA 1JK8A 3PGDB 2GK1B 3GRWA 2YQGA 3R8BB 3OLEA 2EYRB 3JVFC 4PJAA 1C5CL 1LEGA 1R7AA 1F11B 5HDQL 4E0RB 1YEJL 3NIFE 4TQIA 4EJ1C 1W15A 1MCPL 2OCJA 3NDZE 3D39A 5MENA 5BQ7B 4GRLB 4YHGA 2ISWA 4S2CA 4DZ8A 4H9VA 4NZ8A 4UBDD 3I75B 3OKKB 3CT7A 1TU2A 3K4DA 5GZNA 1XLGA 5EZIH 2DWYA 3TSDA 1MPAL 3VG0H 4NOFA 4H8QA 2GWNA 5E6ID 4AX6A 3IMRA 4ODHH 4W5ZA 3SGEH 2GI0A 1QPKA 1M3UA 2QTEA 2BXVA 3NN8A 3OD3A 4POZD 4X6CB 1N64L 1RHFA 3T3PE 3VILA 2HJFA 5BJTA 2HKHH 1QRNA 2AGJL 1O9VA 4Z77A 1P5UB 2YGVA 3RU8H 2O30A 3SGJC 3W0WD 2YSWA 3LCLA 5KJRL 3TNOA 5K4ZA 4P99A 3HG1B 1XGUA 4EN3C 2CZVA 2Y88A 1NBQA 3SKNB 4LC8A 2BSSB 3THCA 2PFHA 1S9XB 2WYTA 2HFFA 2G4EA 1VZWA 1E9PA 2AEOA 3U9IA 3TEXA 5AG9A 4ORIA 4ZQRA 1L0QA 1UYWH 2R0WH 1KPUA 2EPOA 2J6EL 1A4CA 1GHFH 1LNUA 4G80B 5ITBH 4ZBCA 4YSUA 4L2YA 1DQVA 1NUDA 4RMWA 4UNVA 2VDGA 3TR9A 5B80A 4XCCL 2W92A 2Y7MA 4ODTH 3RIAK 2BC4A 3IMVA 4M8QB 4RSYA 4U1JA 3DI0A 1J8HB 4NCC1 5B1AB 2OZ4L 3CK0H 2XZQL 3WOVA 1HQRA 4ETYA 3EZJB 2XACC 3P0VH 1U0QA 1MAKA 1ETJA 2FJFA 3WEAA 3GT6A 1JZ6A 4UBPC 5E09A 1UKPA 4ABQA 3TN4A 1HZHL 4HJIA 3DMMA 2CLMA 2XA8H 2EKCA 4GAYB 1X5HA 3QC3A 3W7LA 4JY8A 4YK4B 3UXIA 3SDAC 1PX3A 4X4YB 4Y9FA 4U4BA 1GVRA 1ZAIA 2AQ2A 2EDNA 3LZLA 4I0PB 2OMAA 1CICC 5PCYA 4W9LC 5AVRB 3IK2A 5LXVA 2NQHA 3N34A 1UUOA 4K2SA 5D1ZD 3CLEH 5C97A 1KEGL 4LVOC 1Q6FA 4X6BB 3MI2A 1SLWA 5T1LA 2Y85A 4Z0XB 5J04A 1A4KB 1WFNA 1RJQA 4FOKA 4W1TA 4S38A 3VD1A 1KFAH 3CMFA 1NM9A 1AACA 1RZPA 1U8HB 4GKNB 4CQ9A 1HO4A 2QV2A 5DK0B 5J13C 3W4RA 2YJQA 1LE9A 3V5KA 3I2CH 4QXGL 2WLLB 3QAZC 1NFDA 5CC6A 4HUCA 1NC2A 1IGIL 2P43B 3AVEA 1JCLA 3K2KA 4G6FB 4XXWC 4NQVA 4C47A 2UZXA 2QDEA 2E46A 4EN3A 3BZFA 5EBMA 4JRXB 3RWEB 1HP5A 2P44B 5HATA 4FTVE 2YUXA 2DM3A 4WUUA 5L4MA 3HGSA 5A7BA 2Y6SC 3FQYA 1YC8A 5ISZE 1Q8AA 5CN2A 5JQHC 1TPWA 4E41D 2PTUA 2CRIA 1EGMA 1WBHA 4KS0A 4D6IA 4R5TA 2GZXA 3MGOB 3EFOA 1KBGL 3TBWB 4X2UA 2DTSA 1GNXA 1LDCA 4BKNA 2BWGA 1KGYE 3BUDA 1X5XA 1JZ8A 3IMWA 4HH8A 5DEGB 5C0BA 3V95A 2YZ5A 3QUKB 4AXNA 5AFAA 4NJHA 1HEZA 5ITBL 4QITA 4ZRGA 1ACYH 3Q8FA 3ULVC 3SUVA 1CD1B 4FTVA 4IT1A 4LUIA 3HGOA 5F9OL 5A6BA 4ZMGA 1W3TA 2HDJA 1MVUB 1FPTH 4G72B 4IYKA 2KERA 2TRSA 5T1LB 5IROD 4M5TA 3QE5A 5J9PA 3OXRA 2PRLA 3OAYK 2Y8VA 1FNEA 2Y25A 2OWCA 3CZ8A 2TPSA 4ZTPH 2WYIA 5EOCH 1E67A 5DANA 4Q4SA 2MTAA 3I84A 1YNPA 4K38A 4M7ZC 2JJSC 2OWWA 1R3JA 2IAMC 3FDWA 5FUOH 4P3CH 4OCWL 1ODZA 1I85C 4NT6B 1Q2RA 4UWQB 2I60H 2CIPA 2G60L 3DIVA 4WHTA 2DQFB 5ALBL 3LLDA 3WK0A 4QCFA 1FH5L 3ME0A 4YHYB 1OGAE 3WK1A 5E8NA 4OCYH 2QELA 4FTDA 4GH7B 1LO4L 3LNEA 1VSCA 5K59F 4YTTA 1VFUA 4KPHL 4HC1H 3QH3A 2MOGA 5F7YC 1GHRA 4KI5F 4V2XA 2NDFA 1NBZA 4Y1AE 5EBWB 2DI7A 1PBYA 2NY5H 4FJZA 4BJHA 3L48A 4JIEA 3EEGA 4M4PA 2Q5BA 4CU8A 3TBSA 5ENWB 1UR4A 2ZWKA 3K7UA 3DRQB 1OZTG 3IRCA 1OYAA 4ZMPA 3NOEA 1AD0A 3STCA 2I07A 3BKJH 5IJVA 4WKZA 2QSVA 4P2AA 2FQIA 4YO0B 3RI5K 3ZHLA 5EU6E 4Z76A 4ONFL 3MPCA 4QRRB 1I1RA 4UXDA 4MZIA 4JOMA 3KEDA 4DCQA 2WMPB 1U58B 3O3DA 2E6AA 2ZICA 4IJ3B 5FPIA 3DG6A 1CLVA 2NXYB 4PRHA 4Y89A 4GQQA 5GJSL 2GTZA 5IM7B 3SQBA 4B7IA 5HQLA 2WVTA 1R2TA 2XG9A 1K4HA 1YMHB 4JDYA 1QNZL 1H1YA 1JTTA 1Z3GL 4MJ5A 4NZTH 1BZ8A 3F64A 4N1EA 5FW8A 5BZZA 2VLMD 1YHTA 4MG4A 5EOCL 3HQ1A 4XZBA 4FERA 4PYSA 3HHSA 2BSRB 2EC8A 3X3GH 4AW4A 4ZQTA 3KLHC 4ZQKA 3BWZA 1FVPA 2XSXA 4ORMA 2LLNA 1HHGA 4GI8A 4M51A 1NWUA 4W68A 3A67L 4A67A 2EE0A 4HHHA 4MA8H 5DQJB 3P82A 4R7JA 4Y2LA 3PSWA 2XIMA 4OZHB 1VHPA 3G6AA 4GOAA 4MJID 2P28B 5AW2B 3ANYA 4WKXA 1LL1A 3SY0B 2CGRH 3CVBA 3NP4A 2VLKD 3QFJD 1LBFA 5BNXD 1MO0A 3DLQR 5EUOF 2O5XL 4N8UA 2LAGB 1UURA 4EOWL 4DF0A 1TSHA 2IH3A 2CJSA 1KIQB 1SQMA 4JNXA 2P80D 3NDOA 1E8ZA 1D5XB 5DMMA 1RP8A 43C9B 4UOJA 4F37K 3EGXB 4IMLA 1MI5B 3NCWA 3DIPA 3Q2NA 4EZJA 4Q8NA 3J8F7 1F1DA 1FYHB 4OD3H 1XXFC 4TQPA 4JN2B 4EXAA 1TV3A 4NSBA 1LXMA 4K7PL 3AY4C 4DKEH 4P2RB 4QTHA 5J3HC 1E6QM 5AY7A 5JOPD 2E1WA 1HKMA 5AUMA 3LRSA 3HS0B 4TVCA 1E27B 4A2RA 2EE9A 3AU6A 1QNSA 4IMFA 5I15L 5DLML 3Q6GL 2V2XB 4UFHA 1INDH 1VFOA 1MEWA 1W1YA 2B77A 3GO2A 3QWQB 1GOMA 5I1KL 4DO6A 1TRIA 4PUUA 1X5GA 3P4MB 1TR7A 4UB0L 4MZRA 3G1RA 4DJEA 1KLFB 2BVQA 2BVEA 4U1NA 3L54A 1HIMH 1GK8A 3NYZA 5AZUA 3GIZL 3H26A 3PN8A 1N67A 4WKAA 3FT4B 1V02E 3AIQA 3UJTL 1Y6NR 3L3KB 2Q6WB 1OFRA 2EIJB 2YW4A 3TAKA 4P0DA 5I0VA 2VGIA 2EO1A 1QRNB 4WDIA 4XHJC 5TD4A 4IGBC 3VXSB 2XTJC 3N50A 2OTUA 3BAIA 3T4AB 4F58L 5J6GA 5DMKA 1NIUA 1UWIA 5TK2A 3BT2H 2PTDA 3IJEA 1KQYA 2J20A 3O2WL 4P4KD 5C0CB 3I6RA 2QSTA 1ADOA 2FFIA 5EZJB 3H0TA 3BP6B 5CUSH 3QQ9D 3VGEA 3T4CA 1TVDA 3MLSH 4GRWE 5TPWH 3TA3A 2CLLA 3GSNB 1NARA 3AABA 3F58H 3BSHA 3D0CA 1BTMA 4PJGE 1CBJA 2VYRE 1WE5A 5C0FB 4JNZA 1NFPA 5IEHA 8TIMA 5CAHA 2FGLA 3R06A 1ZANL 4F8TA 2ICWI 4IGBB 1F6FB 1YXYA 3O0KA 1GHFL 4LEOB 3VQMA 5JPNB 3EOSA 3FXGA 3TDFA 3HMXH 4NQSB 2ZRZA 3RJOA 3ARBC 4LVHB 2YZRA 1MJUL 3G6DL 1SJEA 4XOEA 3RBGA 3L9YA 5KVDH 3CHCA 4Y4HA 3SJVD 4M6PA 4R7NA 1ELSA 3H85A 1G7PA 3H6OA 1V10A 1CDUA 1INDL 4PEKA 4J1OA 4WJG3 5I28A 3TFKC 5A8NA 3HB9A 1JSYA 4XBPB 1YNKL 5FO9B 1NSJA 1KT2B 35C8L 4WW1B 2QPEB 1JUEA 3ARWA 1H7PA 1OWRM 1RZJH 5I0DA 3O05A