1U35C

Crystal structure of the nucleosome core particle containing the histone domain of macroh2a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
b'KTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAVNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-satellite DNA
publication title Structural characterization of the histone variant macroH2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1u35C00
5AY8D 2PYOA 1M18C 3C1CB 3A6ND 2PYOC 5B2JA 3TU4C 4XUJD 5JRGA 3REID 1P3OA 4HGAB 5JRGC 5KDMA 3W98D 5CPJD 5B24D 4H9QB 3AZMB 1KX4D 3KXBA 2BYMA 5AVBA 3KXBC 3AV1D 3REHC 3AN2D 2PYOB 3NQUA 5B31D 3REJA 5B2IC 5B1LD 3MGSD 5JRGB 1P3OB 2NZDD 5FUGB 3WTPA 3WTPC 5BO0A 3WA9C 3AZKD 1P34A 1P3BA 3KXBB 3X1UA 4J8XA 3REHB 5GXQD 3KSYA 1HQ3A 5AVCA 4J8VC 3REJB 4WU9C 5AV9A 4H9NA 5F99A 3AFAC 5AV9C 3WTPB 5AV6C 3WA9B 4NFTA 5B0YD 5B1MD 4H9SC 5BO0B 3X1TD 1P3BB 3REKA 3WKJD 3MGPD 3REKC 4KGCD 3AZEA 1HQ3B 3AZJD 4WU9B 3MGRD 3W99D 4LD9C 3AFAB 5B32A 2CV5A 1P3KC 3AZHD 5AV9B 4H9NB 5F99B 5B32C 2CV5C 5BT1D 1P3LA 1P3IA 1P3LC 5CPKC 3UTAD 3RELA 2F8NA 3REKB 5GSUD 3AYWA 3RELC 3MGQC 4QLCA 5GT0D 1U35D 4LD9B 4XZQA 3AZIC 3AZFA 1P3KB 5C3IC 4XZQC 5B32B 1M1AA 3C1BA 2CV5B 3W97D 1M1AC 4Z66D 3MNNC 3UT9A 4E44A 3LJAA 1P3LB 5CPKB 1HTAA 3LJAC 3WAAA 1R4VA 3LELD 3WAAC 3RELB 1ZLAA 2F8NB 3LZ0D 3AYWB 3B0BA 1AOID 1A7WA 1ZLAC 2NQBC 4YS3C 4J8WC 3AZIB 5B40C 1KX3C 5C3IB 4XZQB 4R8PC 5AV8A 3AZFB 1M1AB 4J8UD 3MNNB 1EQZA 3X1VA 1F66A 3UT9B 5CP6C 1F66C 5DNNA 3LJAB 1BFMA 4H9RA 1S32C 3WAAB 3B0DC 1TZYC 1ID3D 1KX5D 4X23D 1ZLAB 2NQBB 1P3FA 4J8WB 1KX3B 5B40B 4ZBJC 2HIOA 4R8PB 3X1SC 1P3FC 2RVQD 5E5AC 2HIOC 5AY8C 3B6FD 1EQZB 5CP6B 3KUYD 3X1VB 4WU8A 1F66B 3A6NC 4AWLC 3REIA 1TZYB 3B0DB 4XUJC 3REIC 4H9RB 3W98A 1S32D 5B24A 3W98C 5CPJC 4ZBJB 3X1SB 3V9RB 5B24C 3AZND 1P3FB 3B0CW 5CPID 2HIOB 3WTPE 3AZGA 1KX4C 4H9PA 4H9QA 3AZMA 3AV1A 3VH5W 5AY8B 5E5AD 3AV1C 1P3PD 4AWLB 3AN2C 1M18A 5B31C 5B1LA 5AV5C 4WU8B 3MGSA 4XUJB 3REIB 3TU4A 5B1LC 2NZDA 3MGSC 3W98B 5CPJB 2NZDC 1H3OB 4DRBA 3KWQC 5B24B 5FUGA 1KX4B 2YFVB 3AZKC 3AZGB 4H9PB 5BS7A 3AV1B 5GXQA 5BS7C 5GXQC 3REHA 1M18B 5B1LB 3MGSB 5B2IA 5AV5D 3TU4B 2NZDB 4Z5TD 5GT3D 5B1MA 4WZSB 3KWQD 1P3MD 5B0YC 5B1MC 3WA9A 3X1TC 3WKJA 3MGPA 3WKJC 4KGCA 5GXQB 5DNMD 3AZLD 3MGPC 4KGCC 4ZUXD 3MGRA 3W99A 4J8VA 3AZJC 3MGRC 3W99C 5B2IB 4WU9A 1P3GD 2FJ7D 5B31G 3AFAA 3AZHC 5BT1C 5AV6A 5B1MB 4H9SA 3MVDD 3UTAA 3WKJB 5B2JD 3UTAC 1P3OD 5GT0A 3MGPB 4KGCB 5GSUC 1U35A 3AZJB 5GT0C 3MGRB 3W99B 1U35C 4J8VB 4LD9A 3W97A 1P3KA 4Z66A 5B0ZD 3W97C 4Z66C 5AVBD 5AV6B 3LZ1D 4NE6A 4Z2MH 3UTAB 4NE3A 1P3AD 5CPKA 3LELC 5GSUB 5GT0B 3LZ0C 3MGQA 1AOIC 1U35B 3AZIA 3W97B 4J8UC 4Z66B 1F1EA 4G92C 1P34D 1P3BD 3MNNA 3X1UD 4J8XD 1HQ3D 4X23A 5AVCD 2AROD 3LELB 1ID3C 1KX5C 4X23C 3LZ0B 2F8NH 3MGQB 2NQBA 4YS3A 4J8WA 1KX3A 5B40A 2RVQC 4R8PA 5JA4B 3AV2C 4CSRA 3B6FC 3KUYC 5CP6A 3VH5A 1ID3B 1WWSA 3AZED 1KX5B 4X23B 1S32A 1TZYA 3NQJB 3W96C 3O62D 4EO5C 3UTBD 5CPIA 3AZNC 3X1SA 5CPIC 3V9RA 4YS3B 5E5AA 4G91C 3B6FB 1P3ID 5AY8A 4CSRB 3KUYB 1P3PC 3AV2D 3A6NA 4QLCD 4XUJA 4EO5B 1S32B 3AZFD 3W96D 5CPJA 1H3OA 3C1BD 3AZNB 5CPIB 3VH6W 3UT9D 4G91B 1N1JA 2CWEA 1KX4A 2YFVA 5E5AB 1P3PB 3B6GD 1M19D 2BYKB 3AN2A 4NE5A 5B31A 5AV5A 3A6NB 4Z5TA 1BH9A 4Z5TC 5GT3A 5AV8D 3KWQA 5GT3C 1P3MA 4JJND 1EQZD 1P3MC 3AZKA 1N1JB 5DNND 3AZLA 4ZUXA 5DNMC 3AZLC 4YM6D 4ZUXC 1WWIA 3AN2B 5B31B 5AV5B 5B33D 1P3GA 2FJ7A 4KUDD 4E45A 4Z5TB 3R45A 1BH9B 1P3GC 2FJ7C 5BNXB 5GT3B 2L5AA 3B0CT 3KWQB 1P3MB 3MVDA 1ULYA 3VH5T 5B0YA 3MVDC 3X1TA 4WU8D 3AZKB 1B67A 3C1CD 5B2JC 5DNMB 3AZLB 1P3OC 4ZUXB 3AZJA 1P3GB 2FJ7B 5B0ZA 5BNVA 3R45B 3AZGD 3AZHA 5B0ZC 3AZMD 4H9OA 5AVBC 3LZ1A 3MVDB 1P3AA 5B0YB 3LZ1C 1M18D 5B2JB 3X1TB 1P3AC 3REJC 2PYOD 3TU4D 5KDMB 5GSUA 5JRGD 2F8NK 5B0ZB 2LY8A 5BNVB 3AZHB 2BYMB 4CAYA 4H9OB 1P34C 5AVBB 1P3BC 2JSSA 3X1UC 3KXBD 4J8XC 3LZ1B 3NQUB 2AROA 3REHD 1P3AB 1HQ3C 5AVCC 1BH8A 2AROC 5B2ID 1Q9CA 3LELA 1TAFA 3REJD 5F99C 3LZ0A 1AOIA 3WTPD 3WA9D 5JA4A 4J8UA 1P34B 2HUEC 4CAYB 3X1UB 4J8XB 5AVCB 2AROB 3O62A 3UTBA 4J8VD 3AZEC 1BH8B 3O62C 1ID3A 1KX5A 3UTBC 3NQJA 4WU9D 1TAFB 3AFAD 5CHLB 1AOIB 5AV9D 5F99D 4WNNA 1KU5A 5AV6D 3VH6A 3AV2A 2HUEB 4J8UB 1P3IC 4UUZA 4G92B 3B6FA 3KUYA 3AYWC 3REKD 3AZEB 4QLCC 3O62B 3UTBB 3W96A 3AZFC 4LD9D 1B6WA 1P3KD 3C1BC 5B32D 3AZNA 2CV5D 1JFIA 3UT9C 4WNNB 1P3IB 1M19A 3B6GA 3AV2B 1P3LD 5CPKD 2IO5C 4UUZB 1P3PA 1M19C 4Z2MG 3B6GC 2BYKA 4QLCB 3RELD 3MGQD 2F8ND 3AYWD 2YFWA 4M6BA 3AZID 3W96B 3C1BB 5AV8C 4XZQD 4JJNA 4JJNC 1M1AD 1EQZC 4WV4B 3X1VC 5B32G 3MNND 1JFIB 5DNNC 2IO5B 1M19B 4YM6A 3LJAD 3B6GB 4YM6C 4KHAA 5B33A 3WAAD 4KUDA 5B33C 5G49A 4KUDC 1ZLAD 2NQBD 4YS3D 4J8WD 1KX3D 5B40D 5AV8B 2F8NG 2YFWB 4R8PD 5BNXA 4JJNB 5DNNB 5CP6D 3C1CA 4WU8C 3X1VD 1F66D 3C1CC 4YM6B 1TZYD 5DNMA 4KHAB 5B33B 4KUDB 4HGAC 5G49B 3X1SD 1P3FD 3AZGC 3VH6T 2HIOD 3AZMC 4DRAA
chains in the Genus database with same CATH superfamily
5AY8D 2PYOA 1M18C 3C1CB 3A6ND 2PYOC 5B2JA 3TU4C 4XUJD 5JRGA 3REID 1P3OA 4HGAB 5JRGC 5KDMA 3W98D 5CPJD 5B24D 4H9QB 3AZMB 1KX4D 3KXBA 2BYMA 5AVBA 2VQRA 3KXBC 3A1KA 3AV1D 2Y2KA 3REHC 3AN2D 2PYOB 3NQUA 5B31D 3REJA 5B2IC 1W2EA 5B1LD 3MGSD 5JRGB 1P3OB 2NZDD 5FUGB 3WTPA 3WTPC 5BO0A 3WA9C 3AZKD 1P34A 1P3BA 3KXBB 3H0LC 3X1UA 4J8XA 3REHB 5GXQD 3KSYA 1HQ3A 5AVCA 4J8VC 3REJB 4WU9C 5AV9A 4H9NA 1T3UA 5F99A 3AFAC 5AV9C 1PZRA 3WTPB 5AV6C 3WA9B 4NFTA 5B0YD 5B1MD 4H9SC 5BO0B 3X1TD 3FDDA 1P3BB 3REKA 3WKJD 3MGPD 3REKC 4KGCD 3AZEA 1HQ3B 3AZJD 4WU9B 3MGRD 3W99D 4LD9C 3AFAB 5B32A 2CV5A 1P3KC 3AZHD 5AV9B 4H9NB 5F99B 5B32C 2CV5C 5BT1D 3EPLA 1P3LA 2Y2JA 1P3IA 1P3LC 5CPKC 3UTAD 2JCHA 3RELA 2F8NA 3REKB 5GSUD 3AYWA 3RELC 3MGQC 4QLCA 5GT0D 1U35D 4LD9B 4XZQA 3AZIC 3AZFA 1P3KB 5C3IC 4XZQC 5B32B 1M1AA 3C1BA 2CV5B 3W97D 1M1AC 4Z66D 3MNNC 3UT9A 2Y2NA 4E44A 3LJAA 1P3LB 5CPKB 1HTAA 3LJAC 3WAAA 1R4VA 3LELD 3WAAC 3RELB 1ZLAA 2F8NB 3LZ0D 3AYWB 3B0BA 1AOID 1A7WA 1ZLAC 2NQBC 4YS3C 4J8WC 3AZIB 5B40C 1KX3C 5C3IB 4XZQB 4R8PC 5AV8A 3AZFB 1M1AB 4J8UD 3MNNB 1EQZA 3X1VA 1F66A 3UT9B 5CP6C 4UPKA 3EPKA 1F66C 5DNNA 3LJAB 1BFMA 4H9RA 1S32C 3WAAB 3B0DC 1TZYC 1ID3D 1KX5D 4X23D 1ZLAB 2NQBB 1P3FA 4J8WB 1KX3B 5B40B 4ZBJC 2HIOA 4R8PB 3X1SC 1P3FC 2RVQD 5E5AC 2HIOC 5AY8C 3B6FD 1EQZB 5CP6B 3KUYD 3X1VB 4WU8A 1F66B 3A6NC 4AWLC 3REIA 3P5JB 1TZYB 3B0DB 4XUJC 3KFUG 3REIC 4H9RB 3W98A 2ZY3A 1S32D 5B24A 3W98C 5CPJC 4ZBJB 3X1SB 3V9RB 5B24C 3AZND 1P3FB 3B0CW 3H0MC 5CPID 2HIOB 3WTPE 3AZGA 1KX4C 4H9PA 4H9QA 3AZMA 3AV1A 3VH5W 5AY8B 5E5AD 3AV1C 1P3PD 3EG5B 2ZY5A 4AWLB 3AN2C 1M18A 5B31C 5B1LA 5AV5C 4WU8B 3MGSA 3AL0C 4XUJB 3REIB 3TU4A 5B1LC 2RIQA 3MGSC 2NZDA 3W98B 5CPJB 2NZDC 1H3OB 4DRBA 3KWQC 5B24B 5FUGA 1KX4B 2YFVB 3AZKC 3AZGB 4H9PB 5BS7A 3AV1B 5GXQA 5BS7C 5GXQC 3REHA 2UWXA 1M18B 5B1LB 3MGSB 5B2IA 5AV5D 3TU4B 2NZDB 4Z5TD 5GT3D 2F2AC 5B1MA 4WZSB 3KWQD 2Y2HA 3A1IA 1P3MD 2G5IC 5B0YC 5B1MC 3WA9A 3X1TC 3WKJA 2J8PA 2Y2MA 3MGPA 3WKJC 4KGCA 5GXQB 5DNMD 3AZLD 2DF4C 3MGPC 4KGCC 4ZUXD 3MGRA 3W99A 4J8VA 3AZJC 3MGRC 3W99C 5B2IB 4WU9A 1P3GD 2FJ7D 5B31G 3AFAA 3AZHC 5BT1C 5AV6A 5B1MB 4H9SA 3MVDD 3UTAA 3WKJB 5B2JD 3UTAC 1P3OD 5GT0A 3MGPB 4KGCB 5GSUC 1U35A 3AZJB 5GT0C 3MGRB 3W99B 1U35C 4J8VB 2Y2QA 4LD9A 2G5HC 3W97A 1P3KA 4Z66A 5B0ZD 3W97C 4Z66C 5AVBD 5AV6B 3LZ1D 4NE6A 4Z2MH 3UTAB 4NE3A 1P3AD 5CPKA 3LELC 5GSUB 5GT0B 2Y2IA 3LZ0C 3MGQA 2ZM5A 1U35B 1AOIC 3AZIA 3W97B 4J8UC 4Z66B 1F1EA 4G92C 1P34D 1P3BD 3MNNA 3X1UD 4J8XD 1HQ3D 4X23A 2JE5A 2AROD 5AVCD 3LELB 1ID3C 1KX5C 4X23C 3LZ0B 2F8NH 3MGQB 2NQBA 4YS3A 4J8WA 1KX3A 5B40A 2RVQC 4R8PA 5JA4B 2ZY4A 3AV2C 4CSRA 3B6FC 3KUYC 5CP6A 3VH5A 2FFFB 1ID3B 1WWSA 3AZED 1KX5B 4X23B 1S32A 1TZYA 3NQJB 3W96C 3O62D 4EO5C 3UTBD 5CPIA 3AZNC 3X1SA 2Y2OA 3V9RA 5CPIC 4YS3B 5E5AA 4G91C 3B6FB 1P3ID 5AY8A 4CSRB 3KUYB 1P3PC 3AV2D 3A6NA 4QLCD 4XUJA 4EO5B 1S32B 3AZFD 3W96D 5CPJA 1H3OA 3C1BD 3AZNB 5CPIB 3VH6W 3UT9D 4G91B 1N1JA 2CWEA 1KX4A 2YFVA 5E5AB 1P3PB 3B6GD 1M19D 2BYKB 3AN2A 4NE5A 5B31A 5AV5A 3A6NB 2BG1A 4Z5TA 1BH9A 4Z5TC 5GT3A 5AV8D 3KWQA 5GT3C 1P3MA 4JJND 1EQZD 1P3MC 3AZKA 1N1JB 5DNND 3AZLA 3H0RC 4ZUXA 5DNMC 3AZLC 4YM6D 4ZUXC 1WWIA 3AN2B 5B31B 5AV5B 5B33D 1P3GA 2FJ7A 4KUDD 4E45A 4Z5TB 3R45A 1BH9B 1P3GC 2FJ7C 5BNXB 5GT3B 2L5AA 3B0CT 3KWQB 1P3MB 3MVDA 1ULYA 3VH5T 5B0YA 3MVDC 3X1TA 4WU8D 3AZKB 1B67A 3C1CD 5B2JC 5DNMB 3AZLB 1P3OC 4ZUXB 3IP4C 3AZJA 1P3GB 2FJ7B 5B0ZA 5BNVA 3R45B 3AZGD 3AZHA 5B0ZC 3AZMD 4H9OA 5AVBC 3LZ1A 3MVDB 1P3AA 5B0YB 3LZ1C 1M18D 5B2JB 3X1TB 1P3AC 3REJC 2PYOD 3TU4D 5KDMB 5GSUA 5JRGD 2DQNC 2F8NK 3F6TA 5B0ZB 2LY8A 5BNVB 3AZHB 2BYMB 4CAYA 4H9OB 1P34C 5AVBB 1P3BC 2JSSA 3X1UC 3KXBD 2Y2PA 3LZ1B 4J8XC 3NQUB 4DQYB 2AROA 3REHD 1P3AB 1HQ3C 5AVCC 1BH8A 2AROC 5B2ID 1Q9CA 3LELA 1TAFA 3REJD 5F99C 3LZ0A 1AOIA 3WTPD 3WA9D 5JA4A 4J8UA 1P34B 2HUEC 4CAYB 3X1UB 4J8XB 2Y2GA 5AVCB 2AROB 3O62A 3UTBA 4J8VD 3AZEC 1BH8B 3O62C 1ID3A 1KX5A 3UTBC 3NQJA 4WU9D 1TAFB 3AFAD 5CHLB 1AOIB 5AV9D 5F99D 2XD5A 4WNNA 1KU5A 5AV6D 3VH6A 3AV2A 2HUEB 4J8UB 1P3IC 4UUZA 4G92B 3B6FA 3KUYA 3AYWC 3REKD 3AZEB 4QLCC 3O62B 3UTBB 3W96A 3AZFC 4LD9D 1B6WA 1P3KD 3C1BC 5B32D 3AZNA 2CV5D 1JFIA 3UT9C 4WNNB 1P3IB 1M19A 3B6GA 3AV2B 1P3LD 5CPKD 2IO5C 4UUZB 1P3PA 1M19C 4Z2MG 3B6GC 2BYKA 3EPHA 3EPJA 4QLCB 3RELD 3MGQD 2F8ND 2Y2LA 3AYWD 1Z2CB 2YFWA 4M6BA 3AZID 3W96B 3C1BB 5AV8C 4XZQD 4JJNA 2ZY2A 4JJNC 1M1AD 2W8SA 1EQZC 4WV4B 3X1VC 5B32G 3MNND 1JFIB 5DNNC 2IO5B 1M19B 4YM6A 3LJAD 3B6GB 4WJ3C 4YM6C 4KHAA 5B33A 3WAAD 4KUDA 5B33C 5G49A 4KUDC 1ZLAD 2NQBD 4YS3D 4J8WD 1KX3D 5B40D 5AV8B 2F8NG 2YFWB 4R8PD 5BNXA 4JJNB 2XD1A 5DNNB 5CP6D 3C1CA 4WU8C 3X1VD 1F66D 3C1CC 4YM6B 1TZYD 5DNMA 4KHAB 5B33B 4KUDB 4HGAC 5G49B 3X1SD 1P3FD 3AZGC 3VH6T 2HIOD 3AZMC 4DRAA
chains in the Genus database with same CATH topology
5AY8D 2PYOA 1M18C 3C1CB 3A6ND 2PYOC 5B2JA 3TU4C 4XUJD 5JRGA 3REID 1P3OA 4HGAB 5JRGC 5KDMA 3W98D 5CPJD 5B24D 4H9QB 3AZMB 1KX4D 3KXBA 2BYMA 5AVBA 2VQRA 3KXBC 3A1KA 3AV1D 2Y2KA 3REHC 3AN2D 2PYOB 3NQUA 5B31D 3REJA 5B2IC 1W2EA 5B1LD 3MGSD 5JRGB 1P3OB 2NZDD 5FUGB 3WTPA 3WTPC 5BO0A 3WA9C 3AZKD 1P34A 1P3BA 3KXBB 3H0LC 3X1UA 4J8XA 3REHB 5GXQD 3KSYA 1HQ3A 5AVCA 4J8VC 3REJB 4WU9C 5AV9A 4H9NA 1T3UA 5F99A 3AFAC 5AV9C 1PZRA 3WTPB 5AV6C 3WA9B 4NFTA 5B0YD 5B1MD 4H9SC 5BO0B 3X1TD 3FDDA 1P3BB 3REKA 3WKJD 3MGPD 3REKC 4KGCD 3AZEA 1HQ3B 3AZJD 4WU9B 3MGRD 3W99D 4LD9C 3AFAB 5B32A 2CV5A 1P3KC 3AZHD 5AV9B 4H9NB 5F99B 5B32C 2CV5C 5BT1D 3EPLA 1P3LA 2Y2JA 1P3IA 1P3LC 5CPKC 3UTAD 2JCHA 3RELA 2F8NA 3REKB 5GSUD 3AYWA 3RELC 3MGQC 4QLCA 5GT0D 1U35D 4LD9B 4XZQA 3AZIC 3AZFA 1P3KB 5C3IC 4XZQC 5B32B 1M1AA 3C1BA 2CV5B 3W97D 1M1AC 4Z66D 3MNNC 3UT9A 2Y2NA 4E44A 3LJAA 1P3LB 5CPKB 1HTAA 3LJAC 3WAAA 1R4VA 3LELD 3WAAC 3RELB 1ZLAA 2F8NB 3LZ0D 3AYWB 3B0BA 1AOID 1A7WA 1ZLAC 2NQBC 4YS3C 4J8WC 3AZIB 5B40C 1KX3C 5C3IB 4XZQB 4R8PC 5AV8A 3AZFB 1M1AB 4J8UD 3MNNB 1EQZA 3X1VA 1F66A 3UT9B 5CP6C 4UPKA 3EPKA 1F66C 5DNNA 3LJAB 1BFMA 4H9RA 1S32C 3WAAB 3B0DC 1TZYC 1ID3D 1KX5D 4X23D 1ZLAB 2NQBB 1P3FA 4J8WB 1KX3B 5B40B 4ZBJC 2HIOA 4R8PB 3X1SC 1P3FC 2RVQD 5E5AC 2HIOC 5AY8C 3B6FD 1EQZB 5CP6B 3KUYD 3X1VB 4WU8A 1F66B 3A6NC 4AWLC 3REIA 3P5JB 1TZYB 3B0DB 4XUJC 3KFUG 3REIC 4H9RB 3W98A 2ZY3A 1S32D 5B24A 3W98C 5CPJC 4ZBJB 3X1SB 3V9RB 5B24C 3AZND 1P3FB 3B0CW 3H0MC 5CPID 2HIOB 3WTPE 3AZGA 1KX4C 4H9PA 4H9QA 3AZMA 3AV1A 3VH5W 5AY8B 5E5AD 3AV1C 1P3PD 3EG5B 2ZY5A 4AWLB 3AN2C 1M18A 5B31C 5B1LA 5AV5C 4WU8B 3MGSA 3AL0C 4XUJB 3REIB 3TU4A 5B1LC 2RIQA 3MGSC 2NZDA 3W98B 5CPJB 2NZDC 1H3OB 4DRBA 3KWQC 5B24B 5FUGA 1KX4B 2YFVB 3AZKC 3AZGB 4H9PB 5BS7A 3AV1B 5GXQA 5BS7C 5GXQC 3REHA 2UWXA 1M18B 5B1LB 3MGSB 5B2IA 5AV5D 3TU4B 2NZDB 4Z5TD 5GT3D 2F2AC 5B1MA 4WZSB 3KWQD 2Y2HA 3A1IA 1P3MD 2G5IC 5B0YC 5B1MC 3WA9A 3X1TC 3WKJA 2J8PA 2Y2MA 3MGPA 3WKJC 4KGCA 5GXQB 5DNMD 3AZLD 2DF4C 3MGPC 4KGCC 4ZUXD 3MGRA 3W99A 4J8VA 3AZJC 3MGRC 3W99C 5B2IB 4WU9A 1P3GD 2FJ7D 5B31G 3AFAA 3AZHC 5BT1C 5AV6A 5B1MB 4H9SA 3MVDD 3UTAA 3WKJB 5B2JD 3UTAC 1P3OD 5GT0A 3MGPB 4KGCB 5GSUC 1U35A 3AZJB 5GT0C 3MGRB 3W99B 1U35C 4J8VB 2Y2QA 4LD9A 2G5HC 3W97A 1P3KA 4Z66A 5B0ZD 3W97C 4Z66C 5AVBD 5AV6B 3LZ1D 4NE6A 4Z2MH 3UTAB 4NE3A 1P3AD 5CPKA 3LELC 5GSUB 5GT0B 2Y2IA 3LZ0C 3MGQA 2ZM5A 1U35B 1AOIC 3AZIA 3W97B 4J8UC 4Z66B 1F1EA 4G92C 1P34D 1P3BD 3MNNA 3X1UD 4J8XD 1HQ3D 4X23A 2JE5A 2AROD 5AVCD 3LELB 1ID3C 1KX5C 4X23C 3LZ0B 2F8NH 3MGQB 2NQBA 4YS3A 4J8WA 1KX3A 5B40A 2RVQC 4R8PA 5JA4B 2ZY4A 3AV2C 4CSRA 3B6FC 3KUYC 5CP6A 3VH5A 2FFFB 1ID3B 1WWSA 3AZED 1KX5B 4X23B 1S32A 1TZYA 3NQJB 3W96C 3O62D 4EO5C 3UTBD 5CPIA 3AZNC 3X1SA 2Y2OA 3V9RA 5CPIC 4YS3B 5E5AA 4G91C 3B6FB 1P3ID 5AY8A 4CSRB 3KUYB 1P3PC 3AV2D 3A6NA 4QLCD 4XUJA 4EO5B 1S32B 3AZFD 3W96D 5CPJA 1H3OA 3C1BD 3AZNB 5CPIB 3VH6W 3UT9D 4G91B 1N1JA 2CWEA 1KX4A 2YFVA 5E5AB 1P3PB 3B6GD 1M19D 2BYKB 3AN2A 4NE5A 5B31A 5AV5A 3A6NB 2BG1A 4Z5TA 1BH9A 4Z5TC 5GT3A 5AV8D 3KWQA 5GT3C 1P3MA 4JJND 1EQZD 1P3MC 3AZKA 1N1JB 5DNND 3AZLA 3H0RC 4ZUXA 5DNMC 3AZLC 4YM6D 4ZUXC 1WWIA 3AN2B 5B31B 5AV5B 5B33D 1P3GA 2FJ7A 4KUDD 4E45A 4Z5TB 3R45A 1BH9B 1P3GC 2FJ7C 5BNXB 5GT3B 2L5AA 3B0CT 3KWQB 1P3MB 3MVDA 1ULYA 3VH5T 5B0YA 3MVDC 3X1TA 4WU8D 3AZKB 1B67A 3C1CD 5B2JC 5DNMB 3AZLB 1P3OC 4ZUXB 3IP4C 3AZJA 1P3GB 2FJ7B 5B0ZA 5BNVA 3R45B 3AZGD 3AZHA 5B0ZC 3AZMD 4H9OA 5AVBC 3LZ1A 3MVDB 1P3AA 5B0YB 3LZ1C 1M18D 5B2JB 3X1TB 1P3AC 3REJC 2PYOD 3TU4D 5KDMB 5GSUA 5JRGD 2DQNC 2F8NK 3F6TA 5B0ZB 2LY8A 5BNVB 3AZHB 2BYMB 4CAYA 4H9OB 1P34C 5AVBB 1P3BC 2JSSA 3X1UC 3KXBD 2Y2PA 3LZ1B 4J8XC 3NQUB 4DQYB 2AROA 3REHD 1P3AB 1HQ3C 5AVCC 1BH8A 2AROC 5B2ID 1Q9CA 3LELA 1TAFA 3REJD 5F99C 3LZ0A 1AOIA 3WTPD 3WA9D 5JA4A 4J8UA 1P34B 2HUEC 4CAYB 3X1UB 4J8XB 2Y2GA 5AVCB 2AROB 3O62A 3UTBA 4J8VD 3AZEC 1BH8B 3O62C 1ID3A 1KX5A 3UTBC 3NQJA 4WU9D 1TAFB 3AFAD 5CHLB 1AOIB 5AV9D 5F99D 2XD5A 4WNNA 1KU5A 5AV6D 3VH6A 3AV2A 2HUEB 4J8UB 1P3IC 4UUZA 4G92B 3B6FA 3KUYA 3AYWC 3REKD 3AZEB 4QLCC 3O62B 3UTBB 3W96A 3AZFC 4LD9D 1B6WA 1P3KD 3C1BC 5B32D 3AZNA 2CV5D 1JFIA 3UT9C 4WNNB 1P3IB 1M19A 3B6GA 3AV2B 1P3LD 5CPKD 2IO5C 4UUZB 1P3PA 1M19C 4Z2MG 3B6GC 2BYKA 3EPHA 3EPJA 4QLCB 3RELD 3MGQD 2F8ND 2Y2LA 3AYWD 1Z2CB 2YFWA 4M6BA 3AZID 3W96B 3C1BB 5AV8C 4XZQD 4JJNA 2ZY2A 4JJNC 1M1AD 2W8SA 1EQZC 4WV4B 3X1VC 5B32G 3MNND 1JFIB 5DNNC 2IO5B 1M19B 4YM6A 3LJAD 3B6GB 4WJ3C 4YM6C 4KHAA 5B33A 3WAAD 4KUDA 5B33C 5G49A 4KUDC 1ZLAD 2NQBD 4YS3D 4J8WD 1KX3D 5B40D 5AV8B 2F8NG 2YFWB 4R8PD 5BNXA 4JJNB 2XD1A 5DNNB 5CP6D 3C1CA 4WU8C 3X1VD 1F66D 3C1CC 4YM6B 1TZYD 5DNMA 4KHAB 5B33B 4KUDB 4HGAC 5G49B 3X1SD 1P3FD 3AZGC 3VH6T 2HIOD 3AZMC 4DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AY8 D;  2PYO A;  1M18 C;  3C1C B;  3A6N D;  2PYO C;  5B2J A;  3TU4 C;  4XUJ D;  5JRG A;  3REI D;  1P3O A;  4HGA B;  5JRG C;  5KDM A;  3W98 D;  5CPJ D;  5B24 D;  4H9Q B;  3AZM B;  1KX4 D;  3KXB A;  2BYM A;  5AVB A;  3KXB C;  3AV1 D;  3REH C;  3AN2 D;  2PYO B;  3NQU A;  5B31 D;  3REJ A;  5B2I C;  5B1L D;  3MGS D;  5JRG B;  1P3O B;  2NZD D;  5FUG B;  3WTP A;  3WTP C;  5BO0 A;  3WA9 C;  3AZK D;  1P34 A;  1P3B A;  3KXB B;  3X1U A;  4J8X A;  3REH B;  5GXQ D;  3KSY A;  1HQ3 A;  5AVC A;  4J8V C;  3REJ B;  4WU9 C;  5AV9 A;  4H9N A;  5F99 A;  3AFA C;  5AV9 C;  3WTP B;  5AV6 C;  3WA9 B;  4NFT A;  5B0Y D;  5B1M D;  4H9S C;  5BO0 B;  3X1T D;  1P3B B;  3REK A;  3WKJ D;  3MGP D;  3REK C;  4KGC D;  3AZE A;  1HQ3 B;  3AZJ D;  4WU9 B;  3MGR D;  3W99 D;  4LD9 C;  3AFA B;  5B32 A;  2CV5 A;  1P3K C;  3AZH D;  5AV9 B;  4H9N B;  5F99 B;  5B32 C;  2CV5 C;  5BT1 D;  1P3L A;  1P3I A;  1P3L C;  5CPK C;  3UTA D;  3REL A;  2F8N A;  3REK B;  5GSU D;  3AYW A;  3REL C;  3MGQ C;  4QLC A;  5GT0 D;  1U35 D;  4LD9 B;  4XZQ A;  3AZI C;  3AZF A;  1P3K B;  5C3I C;  4XZQ C;  5B32 B;  1M1A A;  3C1B A;  2CV5 B;  3W97 D;  1M1A C;  4Z66 D;  3MNN C;  3UT9 A;  4E44 A;  3LJA A;  1P3L B;  5CPK B;  1HTA A;  3LJA C;  3WAA A;  1R4V A;  3LEL D;  3WAA C;  3REL B;  1ZLA A;  2F8N B;  3LZ0 D;  3AYW B;  3B0B A;  1AOI D;  1A7W A;  1ZLA C;  2NQB C;  4YS3 C;  4J8W C;  3AZI B;  5B40 C;  1KX3 C;  5C3I B;  4XZQ B;  4R8P C;  5AV8 A;  3AZF B;  1M1A B;  4J8U D;  3MNN B;  1EQZ A;  3X1V A;  1F66 A;  3UT9 B;  5CP6 C;  1F66 C;  5DNN A;  3LJA B;  1BFM A;  4H9R A;  1S32 C;  3WAA B;  3B0D C;  1TZY C;  1ID3 D;  1KX5 D;  4X23 D;  1ZLA B;  2NQB B;  1P3F A;  4J8W B;  1KX3 B;  5B40 B;  4ZBJ C;  2HIO A;  4R8P B;  3X1S C;  1P3F C;  2RVQ D;  5E5A C;  2HIO C;  5AY8 C;  3B6F D;  1EQZ B;  5CP6 B;  3KUY D;  3X1V B;  4WU8 A;  1F66 B;  3A6N C;  4AWL C;  3REI A;  1TZY B;  3B0D B;  4XUJ C;  3REI C;  4H9R B;  3W98 A;  1S32 D;  5B24 A;  3W98 C;  5CPJ C;  4ZBJ B;  3X1S B;  3V9R B;  5B24 C;  3AZN D;  1P3F B;  3B0C W;  5CPI D;  2HIO B;  3WTP E;  3AZG A;  1KX4 C;  4H9P A;  4H9Q A;  3AZM A;  3AV1 A;  3VH5 W;  5AY8 B;  5E5A D;  3AV1 C;  1P3P D;  4AWL B;  3AN2 C;  1M18 A;  5B31 C;  5B1L A;  5AV5 C;  4WU8 B;  3MGS A;  4XUJ B;  3REI B;  3TU4 A;  5B1L C;  2NZD A;  3MGS C;  3W98 B;  5CPJ B;  2NZD C;  1H3O B;  4DRB A;  3KWQ C;  5B24 B;  5FUG A;  1KX4 B;  2YFV B;  3AZK C;  3AZG B;  4H9P B;  5BS7 A;  3AV1 B;  5GXQ A;  5BS7 C;  5GXQ C;  3REH A;  1M18 B;  5B1L B;  3MGS B;  5B2I A;  5AV5 D;  3TU4 B;  2NZD B;  4Z5T D;  5GT3 D;  5B1M A;  4WZS B;  3KWQ D;  1P3M D;  5B0Y C;  5B1M C;  3WA9 A;  3X1T C;  3WKJ A;  3MGP A;  3WKJ C;  4KGC A;  5GXQ B;  5DNM D;  3AZL D;  3MGP C;  4KGC C;  4ZUX D;  3MGR A;  3W99 A;  4J8V A;  3AZJ C;  3MGR C;  3W99 C;  5B2I B;  4WU9 A;  1P3G D;  2FJ7 D;  5B31 G;  3AFA A;  3AZH C;  5BT1 C;  5AV6 A;  5B1M B;  4H9S A;  3MVD D;  3UTA A;  3WKJ B;  5B2J D;  3UTA C;  1P3O D;  5GT0 A;  3MGP B;  4KGC B;  5GSU C;  1U35 A;  3AZJ B;  5GT0 C;  3MGR B;  3W99 B;  1U35 C;  4J8V B;  4LD9 A;  3W97 A;  1P3K A;  4Z66 A;  5B0Z D;  3W97 C;  4Z66 C;  5AVB D;  5AV6 B;  3LZ1 D;  4NE6 A;  4Z2M H;  3UTA B;  4NE3 A;  1P3A D;  5CPK A;  3LEL C;  5GSU B;  5GT0 B;  3LZ0 C;  3MGQ A;  1AOI C;  1U35 B;  3AZI A;  3W97 B;  4J8U C;  4Z66 B;  1F1E A;  4G92 C;  1P34 D;  1P3B D;  3MNN A;  3X1U D;  4J8X D;  1HQ3 D;  4X23 A;  5AVC D;  2ARO D;  3LEL B;  1ID3 C;  1KX5 C;  4X23 C;  3LZ0 B;  2F8N H;  3MGQ B;  2NQB A;  4YS3 A;  4J8W A;  1KX3 A;  5B40 A;  2RVQ C;  4R8P A;  5JA4 B;  3AV2 C;  4CSR A;  3B6F C;  3KUY C;  5CP6 A;  3VH5 A;  1ID3 B;  1WWS A;  3AZE D;  1KX5 B;  4X23 B;  1S32 A;  1TZY A;  3NQJ B;  3W96 C;  3O62 D;  4EO5 C;  3UTB D;  5CPI A;  3AZN C;  3X1S A;  5CPI C;  3V9R A;  4YS3 B;  5E5A A;  4G91 C;  3B6F B;  1P3I D;  5AY8 A;  4CSR B;  3KUY B;  1P3P C;  3AV2 D;  3A6N A;  4QLC D;  4XUJ A;  4EO5 B;  1S32 B;  3AZF D;  3W96 D;  5CPJ A;  1H3O A;  3C1B D;  3AZN B;  5CPI B;  3VH6 W;  3UT9 D;  4G91 B;  1N1J A;  2CWE A;  1KX4 A;  2YFV A;  5E5A B;  1P3P B;  3B6G D;  1M19 D;  2BYK B;  3AN2 A;  4NE5 A;  5B31 A;  5AV5 A;  3A6N B;  4Z5T A;  1BH9 A;  4Z5T C;  5GT3 A;  5AV8 D;  3KWQ A;  5GT3 C;  1P3M A;  4JJN D;  1EQZ D;  1P3M C;  3AZK A;  1N1J B;  5DNN D;  3AZL A;  4ZUX A;  5DNM C;  3AZL C;  4YM6 D;  4ZUX C;  1WWI A;  3AN2 B;  5B31 B;  5AV5 B;  5B33 D;  1P3G A;  2FJ7 A;  4KUD D;  4E45 A;  4Z5T B;  3R45 A;  1BH9 B;  1P3G C;  2FJ7 C;  5BNX B;  5GT3 B;  2L5A A;  3B0C T;  3KWQ B;  1P3M B;  3MVD A;  1ULY A;  3VH5 T;  5B0Y A;  3MVD C;  3X1T A;  4WU8 D;  3AZK B;  1B67 A;  3C1C D;  5B2J C;  5DNM B;  3AZL B;  1P3O C;  4ZUX B;  3AZJ A;  1P3G B;  2FJ7 B;  5B0Z A;  5BNV A;  3R45 B;  3AZG D;  3AZH A;  5B0Z C;  3AZM D;  4H9O A;  5AVB C;  3LZ1 A;  3MVD B;  1P3A A;  5B0Y B;  3LZ1 C;  1M18 D;  5B2J B;  3X1T B;  1P3A C;  3REJ C;  2PYO D;  3TU4 D;  5KDM B;  5GSU A;  5JRG D;  2F8N K;  5B0Z B;  2LY8 A;  5BNV B;  3AZH B;  2BYM B;  4CAY A;  4H9O B;  1P34 C;  5AVB B;  1P3B C;  2JSS A;  3X1U C;  3KXB D;  4J8X C;  3LZ1 B;  3NQU B;  2ARO A;  3REH D;  1P3A B;  1HQ3 C;  5AVC C;  1BH8 A;  2ARO C;  5B2I D;  1Q9C A;  3LEL A;  1TAF A;  3REJ D;  5F99 C;  3LZ0 A;  1AOI A;  3WTP D;  3WA9 D;  5JA4 A;  4J8U A;  1P34 B;  2HUE C;  4CAY B;  3X1U B;  4J8X B;  5AVC B;  2ARO B;  3O62 A;  3UTB A;  4J8V D;  3AZE C;  1BH8 B;  3O62 C;  1ID3 A;  1KX5 A;  3UTB C;  3NQJ A;  4WU9 D;  1TAF B;  3AFA D;  5CHL B;  1AOI B;  5AV9 D;  5F99 D;  4WNN A;  1KU5 A;  5AV6 D;  3VH6 A;  3AV2 A;  2HUE B;  4J8U B;  1P3I C;  4UUZ A;  4G92 B;  3B6F A;  3KUY A;  3AYW C;  3REK D;  3AZE B;  4QLC C;  3O62 B;  3UTB B;  3W96 A;  3AZF C;  4LD9 D;  1B6W A;  1P3K D;  3C1B C;  5B32 D;  3AZN A;  2CV5 D;  1JFI A;  3UT9 C;  4WNN B;  1P3I B;  1M19 A;  3B6G A;  3AV2 B;  1P3L D;  5CPK D;  2IO5 C;  4UUZ B;  1P3P A;  1M19 C;  4Z2M G;  3B6G C;  2BYK A;  4QLC B;  3REL D;  3MGQ D;  2F8N D;  3AYW D;  2YFW A;  4M6B A;  3AZI D;  3W96 B;  3C1B B;  5AV8 C;  4XZQ D;  4JJN A;  4JJN C;  1M1A D;  1EQZ C;  4WV4 B;  3X1V C;  5B32 G;  3MNN D;  1JFI B;  5DNN C;  2IO5 B;  1M19 B;  4YM6 A;  3LJA D;  3B6G B;  4YM6 C;  4KHA A;  5B33 A;  3WAA D;  4KUD A;  5B33 C;  5G49 A;  4KUD C;  1ZLA D;  2NQB D;  4YS3 D;  4J8W D;  1KX3 D;  5B40 D;  5AV8 B;  2F8N G;  2YFW B;  4R8P D;  5BNX A;  4JJN B;  5DNN B;  5CP6 D;  3C1C A;  4WU8 C;  3X1V D;  1F66 D;  3C1C C;  4YM6 B;  1TZY D;  5DNM A;  4KHA B;  5B33 B;  4KUD B;  4HGA C;  5G49 B;  3X1S D;  1P3F D;  3AZG C;  3VH6 T;  2HIO D;  3AZM C;  4DRA A; 
#chains in the Genus database with same CATH topology
 5AY8 D;  2PYO A;  1M18 C;  3C1C B;  3A6N D;  2PYO C;  5B2J A;  3TU4 C;  4XUJ D;  5JRG A;  3REI D;  1P3O A;  4HGA B;  5JRG C;  5KDM A;  3W98 D;  5CPJ D;  5B24 D;  4H9Q B;  3AZM B;  1KX4 D;  3KXB A;  2BYM A;  5AVB A;  2VQR A;  3KXB C;  3A1K A;  3AV1 D;  2Y2K A;  3REH C;  3AN2 D;  2PYO B;  3NQU A;  5B31 D;  3REJ A;  5B2I C;  1W2E A;  5B1L D;  3MGS D;  5JRG B;  1P3O B;  2NZD D;  5FUG B;  3WTP A;  3WTP C;  5BO0 A;  3WA9 C;  3AZK D;  1P34 A;  1P3B A;  3KXB B;  3H0L C;  3X1U A;  4J8X A;  3REH B;  5GXQ D;  3KSY A;  1HQ3 A;  5AVC A;  4J8V C;  3REJ B;  4WU9 C;  5AV9 A;  4H9N A;  1T3U A;  5F99 A;  3AFA C;  5AV9 C;  1PZR A;  3WTP B;  5AV6 C;  3WA9 B;  4NFT A;  5B0Y D;  5B1M D;  4H9S C;  5BO0 B;  3X1T D;  3FDD A;  1P3B B;  3REK A;  3WKJ D;  3MGP D;  3REK C;  4KGC D;  3AZE A;  1HQ3 B;  3AZJ D;  4WU9 B;  3MGR D;  3W99 D;  4LD9 C;  3AFA B;  5B32 A;  2CV5 A;  1P3K C;  3AZH D;  5AV9 B;  4H9N B;  5F99 B;  5B32 C;  2CV5 C;  5BT1 D;  3EPL A;  1P3L A;  2Y2J A;  1P3I A;  1P3L C;  5CPK C;  3UTA D;  2JCH A;  3REL A;  2F8N A;  3REK B;  5GSU D;  3AYW A;  3REL C;  3MGQ C;  4QLC A;  5GT0 D;  1U35 D;  4LD9 B;  4XZQ A;  3AZI C;  3AZF A;  1P3K B;  5C3I C;  4XZQ C;  5B32 B;  1M1A A;  3C1B A;  2CV5 B;  3W97 D;  1M1A C;  4Z66 D;  3MNN C;  3UT9 A;  2Y2N A;  4E44 A;  3LJA A;  1P3L B;  5CPK B;  1HTA A;  3LJA C;  3WAA A;  1R4V A;  3LEL D;  3WAA C;  3REL B;  1ZLA A;  2F8N B;  3LZ0 D;  3AYW B;  3B0B A;  1AOI D;  1A7W A;  1ZLA C;  2NQB C;  4YS3 C;  4J8W C;  3AZI B;  5B40 C;  1KX3 C;  5C3I B;  4XZQ B;  4R8P C;  5AV8 A;  3AZF B;  1M1A B;  4J8U D;  3MNN B;  1EQZ A;  3X1V A;  1F66 A;  3UT9 B;  5CP6 C;  4UPK A;  3EPK A;  1F66 C;  5DNN A;  3LJA B;  1BFM A;  4H9R A;  1S32 C;  3WAA B;  3B0D C;  1TZY C;  1ID3 D;  1KX5 D;  4X23 D;  1ZLA B;  2NQB B;  1P3F A;  4J8W B;  1KX3 B;  5B40 B;  4ZBJ C;  2HIO A;  4R8P B;  3X1S C;  1P3F C;  2RVQ D;  5E5A C;  2HIO C;  5AY8 C;  3B6F D;  1EQZ B;  5CP6 B;  3KUY D;  3X1V B;  4WU8 A;  1F66 B;  3A6N C;  4AWL C;  3REI A;  3P5J B;  1TZY B;  3B0D B;  4XUJ C;  3KFU G;  3REI C;  4H9R B;  3W98 A;  2ZY3 A;  1S32 D;  5B24 A;  3W98 C;  5CPJ C;  4ZBJ B;  3X1S B;  3V9R B;  5B24 C;  3AZN D;  1P3F B;  3B0C W;  3H0M C;  5CPI D;  2HIO B;  3WTP E;  3AZG A;  1KX4 C;  4H9P A;  4H9Q A;  3AZM A;  3AV1 A;  3VH5 W;  5AY8 B;  5E5A D;  3AV1 C;  1P3P D;  3EG5 B;  2ZY5 A;  4AWL B;  3AN2 C;  1M18 A;  5B31 C;  5B1L A;  5AV5 C;  4WU8 B;  3MGS A;  3AL0 C;  4XUJ B;  3REI B;  3TU4 A;  5B1L C;  2RIQ A;  3MGS C;  2NZD A;  3W98 B;  5CPJ B;  2NZD C;  1H3O B;  4DRB A;  3KWQ C;  5B24 B;  5FUG A;  1KX4 B;  2YFV B;  3AZK C;  3AZG B;  4H9P B;  5BS7 A;  3AV1 B;  5GXQ A;  5BS7 C;  5GXQ C;  3REH A;  2UWX A;  1M18 B;  5B1L B;  3MGS B;  5B2I A;  5AV5 D;  3TU4 B;  2NZD B;  4Z5T D;  5GT3 D;  2F2A C;  5B1M A;  4WZS B;  3KWQ D;  2Y2H A;  3A1I A;  1P3M D;  2G5I C;  5B0Y C;  5B1M C;  3WA9 A;  3X1T C;  3WKJ A;  2J8P A;  2Y2M A;  3MGP A;  3WKJ C;  4KGC A;  5GXQ B;  5DNM D;  3AZL D;  2DF4 C;  3MGP C;  4KGC C;  4ZUX D;  3MGR A;  3W99 A;  4J8V A;  3AZJ C;  3MGR C;  3W99 C;  5B2I B;  4WU9 A;  1P3G D;  2FJ7 D;  5B31 G;  3AFA A;  3AZH C;  5BT1 C;  5AV6 A;  5B1M B;  4H9S A;  3MVD D;  3UTA A;  3WKJ B;  5B2J D;  3UTA C;  1P3O D;  5GT0 A;  3MGP B;  4KGC B;  5GSU C;  1U35 A;  3AZJ B;  5GT0 C;  3MGR B;  3W99 B;  1U35 C;  4J8V B;  2Y2Q A;  4LD9 A;  2G5H C;  3W97 A;  1P3K A;  4Z66 A;  5B0Z D;  3W97 C;  4Z66 C;  5AVB D;  5AV6 B;  3LZ1 D;  4NE6 A;  4Z2M H;  3UTA B;  4NE3 A;  1P3A D;  5CPK A;  3LEL C;  5GSU B;  5GT0 B;  2Y2I A;  3LZ0 C;  3MGQ A;  2ZM5 A;  1U35 B;  1AOI C;  3AZI A;  3W97 B;  4J8U C;  4Z66 B;  1F1E A;  4G92 C;  1P34 D;  1P3B D;  3MNN A;  3X1U D;  4J8X D;  1HQ3 D;  4X23 A;  2JE5 A;  2ARO D;  5AVC D;  3LEL B;  1ID3 C;  1KX5 C;  4X23 C;  3LZ0 B;  2F8N H;  3MGQ B;  2NQB A;  4YS3 A;  4J8W A;  1KX3 A;  5B40 A;  2RVQ C;  4R8P A;  5JA4 B;  2ZY4 A;  3AV2 C;  4CSR A;  3B6F C;  3KUY C;  5CP6 A;  3VH5 A;  2FFF B;  1ID3 B;  1WWS A;  3AZE D;  1KX5 B;  4X23 B;  1S32 A;  1TZY A;  3NQJ B;  3W96 C;  3O62 D;  4EO5 C;  3UTB D;  5CPI A;  3AZN C;  3X1S A;  2Y2O A;  3V9R A;  5CPI C;  4YS3 B;  5E5A A;  4G91 C;  3B6F B;  1P3I D;  5AY8 A;  4CSR B;  3KUY B;  1P3P C;  3AV2 D;  3A6N A;  4QLC D;  4XUJ A;  4EO5 B;  1S32 B;  3AZF D;  3W96 D;  5CPJ A;  1H3O A;  3C1B D;  3AZN B;  5CPI B;  3VH6 W;  3UT9 D;  4G91 B;  1N1J A;  2CWE A;  1KX4 A;  2YFV A;  5E5A B;  1P3P B;  3B6G D;  1M19 D;  2BYK B;  3AN2 A;  4NE5 A;  5B31 A;  5AV5 A;  3A6N B;  2BG1 A;  4Z5T A;  1BH9 A;  4Z5T C;  5GT3 A;  5AV8 D;  3KWQ A;  5GT3 C;  1P3M A;  4JJN D;  1EQZ D;  1P3M C;  3AZK A;  1N1J B;  5DNN D;  3AZL A;  3H0R C;  4ZUX A;  5DNM C;  3AZL C;  4YM6 D;  4ZUX C;  1WWI A;  3AN2 B;  5B31 B;  5AV5 B;  5B33 D;  1P3G A;  2FJ7 A;  4KUD D;  4E45 A;  4Z5T B;  3R45 A;  1BH9 B;  1P3G C;  2FJ7 C;  5BNX B;  5GT3 B;  2L5A A;  3B0C T;  3KWQ B;  1P3M B;  3MVD A;  1ULY A;  3VH5 T;  5B0Y A;  3MVD C;  3X1T A;  4WU8 D;  3AZK B;  1B67 A;  3C1C D;  5B2J C;  5DNM B;  3AZL B;  1P3O C;  4ZUX B;  3IP4 C;  3AZJ A;  1P3G B;  2FJ7 B;  5B0Z A;  5BNV A;  3R45 B;  3AZG D;  3AZH A;  5B0Z C;  3AZM D;  4H9O A;  5AVB C;  3LZ1 A;  3MVD B;  1P3A A;  5B0Y B;  3LZ1 C;  1M18 D;  5B2J B;  3X1T B;  1P3A C;  3REJ C;  2PYO D;  3TU4 D;  5KDM B;  5GSU A;  5JRG D;  2DQN C;  2F8N K;  3F6T A;  5B0Z B;  2LY8 A;  5BNV B;  3AZH B;  2BYM B;  4CAY A;  4H9O B;  1P34 C;  5AVB B;  1P3B C;  2JSS A;  3X1U C;  3KXB D;  2Y2P A;  3LZ1 B;  4J8X C;  3NQU B;  4DQY B;  2ARO A;  3REH D;  1P3A B;  1HQ3 C;  5AVC C;  1BH8 A;  2ARO C;  5B2I D;  1Q9C A;  3LEL A;  1TAF A;  3REJ D;  5F99 C;  3LZ0 A;  1AOI A;  3WTP D;  3WA9 D;  5JA4 A;  4J8U A;  1P34 B;  2HUE C;  4CAY B;  3X1U B;  4J8X B;  2Y2G A;  5AVC B;  2ARO B;  3O62 A;  3UTB A;  4J8V D;  3AZE C;  1BH8 B;  3O62 C;  1ID3 A;  1KX5 A;  3UTB C;  3NQJ A;  4WU9 D;  1TAF B;  3AFA D;  5CHL B;  1AOI B;  5AV9 D;  5F99 D;  2XD5 A;  4WNN A;  1KU5 A;  5AV6 D;  3VH6 A;  3AV2 A;  2HUE B;  4J8U B;  1P3I C;  4UUZ A;  4G92 B;  3B6F A;  3KUY A;  3AYW C;  3REK D;  3AZE B;  4QLC C;  3O62 B;  3UTB B;  3W96 A;  3AZF C;  4LD9 D;  1B6W A;  1P3K D;  3C1B C;  5B32 D;  3AZN A;  2CV5 D;  1JFI A;  3UT9 C;  4WNN B;  1P3I B;  1M19 A;  3B6G A;  3AV2 B;  1P3L D;  5CPK D;  2IO5 C;  4UUZ B;  1P3P A;  1M19 C;  4Z2M G;  3B6G C;  2BYK A;  3EPH A;  3EPJ A;  4QLC B;  3REL D;  3MGQ D;  2F8N D;  2Y2L A;  3AYW D;  1Z2C B;  2YFW A;  4M6B A;  3AZI D;  3W96 B;  3C1B B;  5AV8 C;  4XZQ D;  4JJN A;  2ZY2 A;  4JJN C;  1M1A D;  2W8S A;  1EQZ C;  4WV4 B;  3X1V C;  5B32 G;  3MNN D;  1JFI B;  5DNN C;  2IO5 B;  1M19 B;  4YM6 A;  3LJA D;  3B6G B;  4WJ3 C;  4YM6 C;  4KHA A;  5B33 A;  3WAA D;  4KUD A;  5B33 C;  5G49 A;  4KUD C;  1ZLA D;  2NQB D;  4YS3 D;  4J8W D;  1KX3 D;  5B40 D;  5AV8 B;  2F8N G;  2YFW B;  4R8P D;  5BNX A;  4JJN B;  2XD1 A;  5DNN B;  5CP6 D;  3C1C A;  4WU8 C;  3X1V D;  1F66 D;  3C1C C;  4YM6 B;  1TZY D;  5DNM A;  4KHA B;  5B33 B;  4KUD B;  4HGA C;  5G49 B;  3X1S D;  1P3F D;  3AZG C;  3VH6 T;  2HIO D;  3AZM C;  4DRA A; 
#chains in the Genus database with same CATH homology
 5AY8 D;  2PYO A;  1M18 C;  3C1C B;  3A6N D;  2PYO C;  5B2J A;  3TU4 C;  4XUJ D;  5JRG A;  3REI D;  1P3O A;  4HGA B;  5JRG C;  5KDM A;  3W98 D;  5CPJ D;  5B24 D;  4H9Q B;  3AZM B;  1KX4 D;  3KXB A;  2BYM A;  5AVB A;  2VQR A;  3KXB C;  3A1K A;  3AV1 D;  2Y2K A;  3REH C;  3AN2 D;  2PYO B;  3NQU A;  5B31 D;  3REJ A;  5B2I C;  1W2E A;  5B1L D;  3MGS D;  5JRG B;  1P3O B;  2NZD D;  5FUG B;  3WTP A;  3WTP C;  5BO0 A;  3WA9 C;  3AZK D;  1P34 A;  1P3B A;  3KXB B;  3H0L C;  3X1U A;  4J8X A;  3REH B;  5GXQ D;  3KSY A;  1HQ3 A;  5AVC A;  4J8V C;  3REJ B;  4WU9 C;  5AV9 A;  4H9N A;  1T3U A;  5F99 A;  3AFA C;  5AV9 C;  1PZR A;  3WTP B;  5AV6 C;  3WA9 B;  4NFT A;  5B0Y D;  5B1M D;  4H9S C;  5BO0 B;  3X1T D;  3FDD A;  1P3B B;  3REK A;  3WKJ D;  3MGP D;  3REK C;  4KGC D;  3AZE A;  1HQ3 B;  3AZJ D;  4WU9 B;  3MGR D;  3W99 D;  4LD9 C;  3AFA B;  5B32 A;  2CV5 A;  1P3K C;  3AZH D;  5AV9 B;  4H9N B;  5F99 B;  5B32 C;  2CV5 C;  5BT1 D;  3EPL A;  1P3L A;  2Y2J A;  1P3I A;  1P3L C;  5CPK C;  3UTA D;  2JCH A;  3REL A;  2F8N A;  3REK B;  5GSU D;  3AYW A;  3REL C;  3MGQ C;  4QLC A;  5GT0 D;  1U35 D;  4LD9 B;  4XZQ A;  3AZI C;  3AZF A;  1P3K B;  5C3I C;  4XZQ C;  5B32 B;  1M1A A;  3C1B A;  2CV5 B;  3W97 D;  1M1A C;  4Z66 D;  3MNN C;  3UT9 A;  2Y2N A;  4E44 A;  3LJA A;  1P3L B;  5CPK B;  1HTA A;  3LJA C;  3WAA A;  1R4V A;  3LEL D;  3WAA C;  3REL B;  1ZLA A;  2F8N B;  3LZ0 D;  3AYW B;  3B0B A;  1AOI D;  1A7W A;  1ZLA C;  2NQB C;  4YS3 C;  4J8W C;  3AZI B;  5B40 C;  1KX3 C;  5C3I B;  4XZQ B;  4R8P C;  5AV8 A;  3AZF B;  1M1A B;  4J8U D;  3MNN B;  1EQZ A;  3X1V A;  1F66 A;  3UT9 B;  5CP6 C;  4UPK A;  3EPK A;  1F66 C;  5DNN A;  3LJA B;  1BFM A;  4H9R A;  1S32 C;  3WAA B;  3B0D C;  1TZY C;  1ID3 D;  1KX5 D;  4X23 D;  1ZLA B;  2NQB B;  1P3F A;  4J8W B;  1KX3 B;  5B40 B;  4ZBJ C;  2HIO A;  4R8P B;  3X1S C;  1P3F C;  2RVQ D;  5E5A C;  2HIO C;  5AY8 C;  3B6F D;  1EQZ B;  5CP6 B;  3KUY D;  3X1V B;  4WU8 A;  1F66 B;  3A6N C;  4AWL C;  3REI A;  3P5J B;  1TZY B;  3B0D B;  4XUJ C;  3KFU G;  3REI C;  4H9R B;  3W98 A;  2ZY3 A;  1S32 D;  5B24 A;  3W98 C;  5CPJ C;  4ZBJ B;  3X1S B;  3V9R B;  5B24 C;  3AZN D;  1P3F B;  3B0C W;  3H0M C;  5CPI D;  2HIO B;  3WTP E;  3AZG A;  1KX4 C;  4H9P A;  4H9Q A;  3AZM A;  3AV1 A;  3VH5 W;  5AY8 B;  5E5A D;  3AV1 C;  1P3P D;  3EG5 B;  2ZY5 A;  4AWL B;  3AN2 C;  1M18 A;  5B31 C;  5B1L A;  5AV5 C;  4WU8 B;  3MGS A;  3AL0 C;  4XUJ B;  3REI B;  3TU4 A;  5B1L C;  2RIQ A;  3MGS C;  2NZD A;  3W98 B;  5CPJ B;  2NZD C;  1H3O B;  4DRB A;  3KWQ C;  5B24 B;  5FUG A;  1KX4 B;  2YFV B;  3AZK C;  3AZG B;  4H9P B;  5BS7 A;  3AV1 B;  5GXQ A;  5BS7 C;  5GXQ C;  3REH A;  2UWX A;  1M18 B;  5B1L B;  3MGS B;  5B2I A;  5AV5 D;  3TU4 B;  2NZD B;  4Z5T D;  5GT3 D;  2F2A C;  5B1M A;  4WZS B;  3KWQ D;  2Y2H A;  3A1I A;  1P3M D;  2G5I C;  5B0Y C;  5B1M C;  3WA9 A;  3X1T C;  3WKJ A;  2J8P A;  2Y2M A;  3MGP A;  3WKJ C;  4KGC A;  5GXQ B;  5DNM D;  3AZL D;  2DF4 C;  3MGP C;  4KGC C;  4ZUX D;  3MGR A;  3W99 A;  4J8V A;  3AZJ C;  3MGR C;  3W99 C;  5B2I B;  4WU9 A;  1P3G D;  2FJ7 D;  5B31 G;  3AFA A;  3AZH C;  5BT1 C;  5AV6 A;  5B1M B;  4H9S A;  3MVD D;  3UTA A;  3WKJ B;  5B2J D;  3UTA C;  1P3O D;  5GT0 A;  3MGP B;  4KGC B;  5GSU C;  1U35 A;  3AZJ B;  5GT0 C;  3MGR B;  3W99 B;  1U35 C;  4J8V B;  2Y2Q A;  4LD9 A;  2G5H C;  3W97 A;  1P3K A;  4Z66 A;  5B0Z D;  3W97 C;  4Z66 C;  5AVB D;  5AV6 B;  3LZ1 D;  4NE6 A;  4Z2M H;  3UTA B;  4NE3 A;  1P3A D;  5CPK A;  3LEL C;  5GSU B;  5GT0 B;  2Y2I A;  3LZ0 C;  3MGQ A;  2ZM5 A;  1U35 B;  1AOI C;  3AZI A;  3W97 B;  4J8U C;  4Z66 B;  1F1E A;  4G92 C;  1P34 D;  1P3B D;  3MNN A;  3X1U D;  4J8X D;  1HQ3 D;  4X23 A;  2JE5 A;  2ARO D;  5AVC D;  3LEL B;  1ID3 C;  1KX5 C;  4X23 C;  3LZ0 B;  2F8N H;  3MGQ B;  2NQB A;  4YS3 A;  4J8W A;  1KX3 A;  5B40 A;  2RVQ C;  4R8P A;  5JA4 B;  2ZY4 A;  3AV2 C;  4CSR A;  3B6F C;  3KUY C;  5CP6 A;  3VH5 A;  2FFF B;  1ID3 B;  1WWS A;  3AZE D;  1KX5 B;  4X23 B;  1S32 A;  1TZY A;  3NQJ B;  3W96 C;  3O62 D;  4EO5 C;  3UTB D;  5CPI A;  3AZN C;  3X1S A;  2Y2O A;  3V9R A;  5CPI C;  4YS3 B;  5E5A A;  4G91 C;  3B6F B;  1P3I D;  5AY8 A;  4CSR B;  3KUY B;  1P3P C;  3AV2 D;  3A6N A;  4QLC D;  4XUJ A;  4EO5 B;  1S32 B;  3AZF D;  3W96 D;  5CPJ A;  1H3O A;  3C1B D;  3AZN B;  5CPI B;  3VH6 W;  3UT9 D;  4G91 B;  1N1J A;  2CWE A;  1KX4 A;  2YFV A;  5E5A B;  1P3P B;  3B6G D;  1M19 D;  2BYK B;  3AN2 A;  4NE5 A;  5B31 A;  5AV5 A;  3A6N B;  2BG1 A;  4Z5T A;  1BH9 A;  4Z5T C;  5GT3 A;  5AV8 D;  3KWQ A;  5GT3 C;  1P3M A;  4JJN D;  1EQZ D;  1P3M C;  3AZK A;  1N1J B;  5DNN D;  3AZL A;  3H0R C;  4ZUX A;  5DNM C;  3AZL C;  4YM6 D;  4ZUX C;  1WWI A;  3AN2 B;  5B31 B;  5AV5 B;  5B33 D;  1P3G A;  2FJ7 A;  4KUD D;  4E45 A;  4Z5T B;  3R45 A;  1BH9 B;  1P3G C;  2FJ7 C;  5BNX B;  5GT3 B;  2L5A A;  3B0C T;  3KWQ B;  1P3M B;  3MVD A;  1ULY A;  3VH5 T;  5B0Y A;  3MVD C;  3X1T A;  4WU8 D;  3AZK B;  1B67 A;  3C1C D;  5B2J C;  5DNM B;  3AZL B;  1P3O C;  4ZUX B;  3IP4 C;  3AZJ A;  1P3G B;  2FJ7 B;  5B0Z A;  5BNV A;  3R45 B;  3AZG D;  3AZH A;  5B0Z C;  3AZM D;  4H9O A;  5AVB C;  3LZ1 A;  3MVD B;  1P3A A;  5B0Y B;  3LZ1 C;  1M18 D;  5B2J B;  3X1T B;  1P3A C;  3REJ C;  2PYO D;  3TU4 D;  5KDM B;  5GSU A;  5JRG D;  2DQN C;  2F8N K;  3F6T A;  5B0Z B;  2LY8 A;  5BNV B;  3AZH B;  2BYM B;  4CAY A;  4H9O B;  1P34 C;  5AVB B;  1P3B C;  2JSS A;  3X1U C;  3KXB D;  2Y2P A;  3LZ1 B;  4J8X C;  3NQU B;  4DQY B;  2ARO A;  3REH D;  1P3A B;  1HQ3 C;  5AVC C;  1BH8 A;  2ARO C;  5B2I D;  1Q9C A;  3LEL A;  1TAF A;  3REJ D;  5F99 C;  3LZ0 A;  1AOI A;  3WTP D;  3WA9 D;  5JA4 A;  4J8U A;  1P34 B;  2HUE C;  4CAY B;  3X1U B;  4J8X B;  2Y2G A;  5AVC B;  2ARO B;  3O62 A;  3UTB A;  4J8V D;  3AZE C;  1BH8 B;  3O62 C;  1ID3 A;  1KX5 A;  3UTB C;  3NQJ A;  4WU9 D;  1TAF B;  3AFA D;  5CHL B;  1AOI B;  5AV9 D;  5F99 D;  2XD5 A;  4WNN A;  1KU5 A;  5AV6 D;  3VH6 A;  3AV2 A;  2HUE B;  4J8U B;  1P3I C;  4UUZ A;  4G92 B;  3B6F A;  3KUY A;  3AYW C;  3REK D;  3AZE B;  4QLC C;  3O62 B;  3UTB B;  3W96 A;  3AZF C;  4LD9 D;  1B6W A;  1P3K D;  3C1B C;  5B32 D;  3AZN A;  2CV5 D;  1JFI A;  3UT9 C;  4WNN B;  1P3I B;  1M19 A;  3B6G A;  3AV2 B;  1P3L D;  5CPK D;  2IO5 C;  4UUZ B;  1P3P A;  1M19 C;  4Z2M G;  3B6G C;  2BYK A;  3EPH A;  3EPJ A;  4QLC B;  3REL D;  3MGQ D;  2F8N D;  2Y2L A;  3AYW D;  1Z2C B;  2YFW A;  4M6B A;  3AZI D;  3W96 B;  3C1B B;  5AV8 C;  4XZQ D;  4JJN A;  2ZY2 A;  4JJN C;  1M1A D;  2W8S A;  1EQZ C;  4WV4 B;  3X1V C;  5B32 G;  3MNN D;  1JFI B;  5DNN C;  2IO5 B;  1M19 B;  4YM6 A;  3LJA D;  3B6G B;  4WJ3 C;  4YM6 C;  4KHA A;  5B33 A;  3WAA D;  4KUD A;  5B33 C;  5G49 A;  4KUD C;  1ZLA D;  2NQB D;  4YS3 D;  4J8W D;  1KX3 D;  5B40 D;  5AV8 B;  2F8N G;  2YFW B;  4R8P D;  5BNX A;  4JJN B;  2XD1 A;  5DNN B;  5CP6 D;  3C1C A;  4WU8 C;  3X1V D;  1F66 D;  3C1C C;  4YM6 B;  1TZY D;  5DNM A;  4KHA B;  5B33 B;  4KUD B;  4HGA C;  5G49 B;  3X1S D;  1P3F D;  3AZG C;  3VH6 T;  2HIO D;  3AZM C;  4DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...