1U35C

Crystal structure of the nucleosome core particle containing the histone domain of macroh2a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
KTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAVNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-satellite DNA
publication title Structural characterization of the histone variant macroH2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1u35C00
5B1MD 5GT3A 2CWEA 5AV8D 3KUYA 3AZEA 4LD9C 3W96B 5B0ZC 4J8VD 1P3GD 1HTAA 5AY8A 5AVCD 4X23C 1P3MD 4Z66A 1AOIC 1BH8A 1M1AC 5JA4B 1Q9CA 4Z5TB 2CV5B 2F8NH 1ZLAB 3REIC 3O62B 3C1BA 3WKJD 4WU8A 3UTBB 1N1JA 3B0CT 4J8WD 5AV8A 5CPKB 5DNMB 4H9RA 2PYOC 5B1LB 4XZQB 3C1CD 4QLCD 4J8VA 3LJAD 5AVCA 3REHD 1P3AB 5C3IB 1P3GA 1M18C 1P3MA 5B31D 3MNND 3MGSB 5B32C 1R4VA 5CPKD 1P34B 5B2ID 5B33B 3X1SD 4YS3B 1P3FB 1A7WA 4WNNA 3REJC 5JA4A 3KUYC 2CV5A 1F66C 5CPIB 1ZLAA 3WA9B 3O62A 3MGPD 3AZHC 3AZEC 3UTBA 3LZ1B 3C1CA 3AZLB 1KX3A 3LJAA 4H9PA 3REHA 5AY8C 5B31A 4Z66C 5CPKA 4NE5A 3B6GD 3W97D 3B0CW 2IO5B 3LZ1D 3C1BC 1P3AA 5B1MC 3MGSA 4ZBJC 2NZDB 5AV8C 4AWLB 3TU4D 4WU9B 4YS3A 1P3GC 4J8VC 5AVCC 4CSRA 3W97A 1P3MC 3B6GA 1F1EA 3UTAD 1JFIA 5CPIA 3WA9A 4WU9D 3LZ1A 3WKJC 1HQ3B 4J8WC 1TZYB 3AZIB 4J8XD 5AV6D 5G49B 4YM6D 3TU4A 1KX5D 1HQ3D 3C1CC 4QLCC 1KX3C 3LJAC 3REHC 4LD9B 2NZDA 5B31C 5B0ZB 3MNNC 5JRGB 3UTAA 5GT0D 4X23B 2AROD 3AZJB 5B2IC 5CPKC 4Z2MH 1AOIB 4WU9A 1M1AB 5KDMB 3X1SC 2FJ7D 3REIB 3MVDD 3MGSC 5JRGD 4DRAA 3X1TD 5AV6A 4YM6A 1KX5A 3MGPC 3VH5T 1HQ3A 2PYOB 2F8NB 3W97C 3B6GC 1B67A 3AZGB 3VH6T 3LZ1C 3AV1D 4LD9A 3MVDA 5JRGA 3X1TA 3AZJA 3REJB 3TU4C 1M1AA 3KUYB 1F66B 5GXQD 3REIA 4WZSB 3AZHB 3AZEB 4AWLC 3UTAC 5AY8B 4Z66B 3KWQB 4WU9C 3AV1A 3A6ND 2F8NA 4J8XC 5B1MB 5AV6C 3AZGA 2BYKB 4YM6C 3KWQD 4ZBJB 1KX5C 1HQ3C 5GXQA 3VH6W 1U35D 2NQBD 4H9RB 1P3GB 4J8VB 3NQJB 5AVCB 5GT0C 2AROC 3REJA 1P3MB 3W98D 4KHAA 1F66A 1P3ID 2HIOD 3X1UD 3AZHA 2FJ7C 4HGAC 3MVDC 3WKJB 5JRGC 5B0YB 3X1TC 3AZJC 3REKB 4J8WB 4WNNB 4E45A 3KWQA 1WWSA 5BT1D 3C1CB 1KX3B 4QLCB 5B1MA 5B0YD 4H9PB 3LJAB 3REHB 2BYKA 3REKD 5B31B 3MNNB 3AV1C 5B2IB 3X1UA 3AZND 3X1SB 3NQJA 3AZGC 2BYMB 5GXQC 4NFTA 3KXBD 3MGPB 1EQZB 3WKJA 5B0YA 3REKA 4J8WA 4H9SA 4CSRB 3W97B 3B6GB 5CPJB 1JFIB 1TAFA 1EQZD 4QLCA 1M19D 3MNNA 3KWQC 1ID3D 5CPJD 3B6FD 5B2IA 4NE3A 4DRBA 3MGQD 3TU4B 1U35C 3X1SA 4JJND 2NQBC 5FUGB 3B0BA 3UTAB 3W98C 2BYMA 1P3IC 2HIOC 3X1UC 3AFAD 3MGPA 1EQZA 3AZMD 4M6BA 1M19A 4J8XB 5CPJA 5AV6B 2JSSA 4YM6B 5AV9D 3MGQA 1KX5B 5BT1C 4JJNA 4ZUXD 5B32G 3LZ0D 3UT9D 5B0YC 3WTPD 3REKC 4H9SC 1H3OA 5GT0B 2AROB 5BO0B 5CP6D 3AZNC 5FUGA 4NE6A 2FJ7B 4XUJD 4HGAB 3MVDB 5E5AD 3X1VD 3X1TB 1P3OD 3KXBC 2F8NK 4ZUXA 4KGCB 3UT9A 4J8XA 1S32D 4R8PD 1EQZC 4CAYA 3AV1B 4KGCD 5AV5D 4EO5C 3R45B 5B40D 5AVBD 1M19C 1ID3C 5CPJC 5GT0A 3B6FC 2AROA 5BO0A 1P3KD 3MGQC 1P3OA 4KUDD 4JJNC 2FJ7A 5GXQB 5BNVB 5F99D 1S32A 4R8PA 3RELD 3AFAC 1KX4D 3AZMC 4KHAB 5DNND 5AV5A 5B24D 3A6NB 3AV2B 4KGCA 5B40A 1P3LD 4UUZB 3AV2D 4ZUXC 3LZ0C 3UT9C 3WTPC 1U35B 3R45A 3VH5W 2NQBB 3AZFD 3LELD 5B2JB 5CP6C 1KX3D 4H9NA 3W98B 5DNNA 1P3IB 2HIOB 3X1UB 4XUJC 5BNVA 5B32D 5B2JD 3X1VC 3VH5A 1P3OC 4G91C 3AV2A 3A6NA 5GT3D 3AYWD 3AN2D 3LELA 3VH6A 5CHLB 4E44A 1S32C 3WAAD 4R8PC 4UUZA 4KGCC 5AV5C 1U35A 3AZNB 1TAFB 2NQBA 5AVBC 5B40C 4H9QA 5B2JA 1WWIA 2L5AA 3W98A 4WU8D 4KUDC 2YFWB 1P3IA 2HIOA 3AYWA 3KXBB 5F99C 3AN2A 5GSUD 3WAAA 2HUEC 3RELC 3W99D 1KX4C 5DNNC 5B24C 1BFMA 1P3LC 1BH9A 4EO5B 1M19B 3W96D 1ID3B 3B6FB 3AV2C 3A6NC 3AZNA 3MGQB 4JJNB 1ULYA 4Z5TD 5GSUA 3AZFC 3LELC 2CV5D 1ZLAD 3O62D 1H3OB 3UTBD 3W99A 2YFWA 3KXBA 3AFAB 2RVQD 3AZMB 5BNXB 1P3BB 5DNMD 5B2JC 5B1LD 3W96A 4XZQD 1P3AD 1KU5A 5GT3C 5AV9B 3AYWC 3MGSD 1P34D 4ZUXB 1P3BD 4Z5TA 5B33D 3LZ0B 2YFVB 3WAAC 3WTPB 3UT9B 3AN2C 1ID3A 2F8NG 3B6FA 4YS3D 1P3FD 5CP6B 3MGRB 4CAYB 1P3PC 3AZKB 5CPID 5DNMA 3WA9D 4XUJB 5B1LA 5E5AB 3AZLD 4XZQA 3B0DC 1B6WA 3X1VB 4WU8C 3MGRD 3AFAA 1P3OB 1P34A 3AZMA 4G91B 5BNXA 1P3BA 3AZKD 5B33A 5GSUC 4G92C 4J8UB 3W99C 1P3FA 1S32B 5AV9A 4R8PB 2NZDD 3LZ0A 5AV5B 2YFVA 3WTPA 4J8UD 5B40B 5AVBB 3KSYA 3W96C 3AZLA 5CP6A 3MGRA 1P3KB 3V9RB 1P3PB 4KUDB 3AZKA 4Z5TC 2CV5C 4XUJA 1ZLAC 5E5AA 3O62C 4H9OB 2LY8A 5F99B 3X1VA 3UTBC 2HUEB 1P3PD 3NQUB 1TZYD 3RELB 3AZID 4H9NB 1KX4B 2RVQC 5DNNB 5B24B 5DNMC 4J8UA 5B1LC 1P3LB 4XZQC 1P3AC 5C3IC 4LD9D 5BS7A 5B0ZD 3WTPE 1P34C 4X23D 3AZJD 1P3BC 5B33C 1AOID 5AVBA 1M1AD 3AZFB 4YS3C 3LELB 3REID 1P3FC 1P3KA 3V9RA 1TZYA 5AV9C 3AZIA 1P3PA 4KUDA 5B31G 1M18B 5G49A 5CPIC 3WA9C 4H9OA 5B32B 5F99A 4H9QB 3AZLC 3NQUA 3RELA 2F8ND 3MGRC 2PYOD 1KX4A 5B0ZA 4X23A 1M18D 5B24A 2IO5C 5GT3B 3AZKC 3AZGD 3AYWB 1AOIA 5E5AC 5KDMA 1P3LA 3AN2B 4Z2MG 3WAAB 2NZDC 3REJD 4J8UC 1BH8B 3KUYD 3AZFA 1F66D 1BH9B 3AZHD 2PYOA 3AZED 5BS7C 3B0DB 3C1BB 4WU8B 1M18A 5AY8D 1N1JB 4WV4B 4Z66D 5B32A 5AV8B 5GSUB 4G92B 1P3KC 3C1BD 1TZYC 3AZIC 3W99B
chains in the Genus database with same CATH superfamily
5B1MD 5GT3A 2CWEA 5AV8D 3KUYA 3AZEA 4LD9C 3W96B 5B0ZC 4J8VD 1P3GD 1HTAA 5AY8A 5AVCD 4X23C 1P3MD 4Z66A 1AOIC 1BH8A 1M1AC 5JA4B 1Q9CA 4Z5TB 2CV5B 2F8NH 1ZLAB 3REIC 3O62B 3C1BA 3WKJD 3A1KA 4WU8A 3UTBB 1N1JA 3B0CT 4J8WD 5AV8A 5CPKB 5DNMB 2F2AC 4H9RA 2PYOC 5B1LB 4XZQB 3C1CD 4QLCD 4J8VA 3LJAD 5AVCA 3REHD 1P3AB 5C3IB 1P3GA 1M18C 1P3MA 5B31D 2JE5A 3MNND 5B32C 1R4VA 3MGSB 5CPKD 1P34B 5B2ID 5B33B 3X1SD 4YS3B 1P3FB 1A7WA 4WNNA 3REJC 5JA4A 3KUYC 2CV5A 1F66C 5CPIB 1ZLAA 3WA9B 3O62A 3MGPD 3AZHC 3AZEC 3UTBA 3LZ1B 3C1CA 3AZLB 2G5HC 1KX3A 3LJAA 4H9PA 3REHA 5AY8C 4WJ3C 5B31A 4Z66C 5CPKA 4NE5A 3B6GD 3W97D 3B0CW 2IO5B 3EPJA 3LZ1D 3C1BC 2ZY3A 1P3AA 5B1MC 3MGSA 4ZBJC 2NZDB 5AV8C 4AWLB 3EPHA 3TU4D 4WU9B 4YS3A 1P3GC 4J8VC 5AVCC 4DQYB 4CSRA 3W97A 1P3MC 3B6GA 1F1EA 3UTAD 1JFIA 5CPIA 3WA9A 4WU9D 3LZ1A 3WKJC 1HQ3B 4J8WC 1TZYB 3AZIB 4J8XD 5AV6D 5G49B 4YM6D 3TU4A 1KX5D 1HQ3D 3C1CC 4QLCC 1KX3C 3LJAC 3REHC 4LD9B 2NZDA 2XD1A 5B31C 5B0ZB 3MNNC 5JRGB 3UTAA 5GT0D 4X23B 2AROD 3AZJB 5B2IC 5CPKC 4Z2MH 1AOIB 4WU9A 1M1AB 5KDMB 3X1SC 2FJ7D 3REIB 3MVDD 3MGSC 5JRGD 4DRAA 3X1TD 2Y2GA 5AV6A 4YM6A 1KX5A 3MGPC 3VH5T 1HQ3A 2PYOB 2F8NB 3W97C 3B6GC 1B67A 3AZGB 3VH6T 2Y2JA 3LZ1C 3AV1D 4LD9A 3MVDA 5JRGA 3X1TA 3AZJA 3REJB 3H0LC 3TU4C 1M1AA 3KUYB 1F66B 5GXQD 3REIA 4WZSB 3AZHB 3AZEB 4AWLC 3UTAC 5AY8B 3EPLA 2XD5A 4Z66B 3KWQB 4WU9C 3AL0C 3AV1A 3A6ND 2F8NA 4J8XC 5B1MB 5AV6C 3AZGA 2BG1A 2BYKB 4YM6C 3KWQD 4ZBJB 1KX5C 1HQ3C 5GXQA 3VH6W 1U35D 2NQBD 4H9RB 1P3GB 4J8VB 3NQJB 5AVCB 5GT0C 2AROC 3REJA 1P3MB 3W98D 4KHAA 1F66A 1P3ID 2HIOD 2ZY4A 3X1UD 3AZHA 2FJ7C 4HGAC 3MVDC 3WKJB 5JRGC 5B0YB 3X1TC 3AZJC 3REKB 4J8WB 2ZM5A 4WNNB 4E45A 3KWQA 1WWSA 5BT1D 3C1CB 1KX3B 5B0YD 5B1MA 4QLCB 4H9PB 3LJAB 3REHB 2BYKA 3REKD 5B31B 3MNNB 3P5JB 3AV1C 5B2IB 3X1UA 3AZND 3KFUG 2ZY5A 3X1SB 3NQJA 3AZGC 2BYMB 5GXQC 4NFTA 3KXBD 3MGPB 1EQZB 3WKJA 2DF4C 5B0YA 3REKA 4J8WA 4H9SA 4UPKA 4CSRB 3W97B 3B6GB 5CPJB 1JFIB 2Y2MA 2Y2OA 1TAFA 1EQZD 4QLCA 1M19D 3MNNA 3KWQC 1ID3D 5CPJD 3B6FD 5B2IA 4NE3A 4DRBA 3MGQD 3TU4B 1U35C 3X1SA 4JJND 2NQBC 5FUGB 3B0BA 1W2EA 3UTAB 3W98C 1Z2CB 2BYMA 1P3IC 2HIOC 2Y2IA 3X1UC 3AFAD 3MGPA 1EQZA 3AZMD 4M6BA 2G5IC 1M19A 4J8XB 5CPJA 5AV6B 2JSSA 4YM6B 5AV9D 3MGQA 1KX5B 5BT1C 4JJNA 4ZUXD 5B32G 3LZ0D 3UT9D 5B0YC 3WTPD 3REKC 1H3OA 4H9SC 5GT0B 2AROB 5BO0B 5CP6D 3AZNC 5FUGA 4NE6A 2Y2KA 2FJ7B 4XUJD 3H0RC 4HGAB 3MVDB 5E5AD 3X1VD 3X1TB 2J8PA 3FDDA 1P3OD 3KXBC 2F8NK 4ZUXA 4KGCB 3UT9A 4J8XA 2RIQA 1S32D 4R8PD 2ZY2A 1EQZC 4CAYA 3AV1B 4KGCD 5AV5D 4EO5C 3H0MC 3R45B 5B40D 5AVBD 1M19C 1ID3C 5CPJC 5GT0A 3B6FC 2AROA 5BO0A 1P3KD 3MGQC 1P3OA 4KUDD 4JJNC 2FJ7A 5GXQB 5BNVB 5F99D 1S32A 4R8PA 3RELD 3AFAC 1KX4D 3AZMC 4KHAB 5DNND 5AV5A 5B24D 3A6NB 3AV2B 4KGCA 5B40A 1P3LD 4UUZB 3AV2D 4ZUXC 3LZ0C 3UT9C 3WTPC 1U35B 3R45A 3EG5B 3VH5W 2NQBB 3AZFD 3LELD 5B2JB 5CP6C 1KX3D 4H9NA 3W98B 2Y2PA 5DNNA 1P3IB 2HIOB 3X1UB 4XUJC 5BNVA 5B32D 5B2JD 3X1VC 2W8SA 3VH5A 1P3OC 4G91C 3AV2A 3A6NA 5GT3D 3AYWD 3AN2D 3LELA 3VH6A 5CHLB 4E44A 1S32C 3WAAD 4R8PC 1PZRA 4UUZA 4KGCC 5AV5C 1U35A 3AZNB 1TAFB 2NQBA 5AVBC 5B40C 4H9QA 5B2JA 1WWIA 2L5AA 3W98A 4WU8D 4KUDC 2YFWB 1P3IA 2HIOA 3AYWA 3KXBB 5F99C 3AN2A 5GSUD 3WAAA 2HUEC 2Y2HA 3RELC 3W99D 1KX4C 5DNNC 5B24C 3IP4C 1BFMA 1P3LC 1BH9A 4EO5B 1M19B 3W96D 1ID3B 3B6FB 3AV2C 3A6NC 3AZNA 3MGQB 4JJNB 1ULYA 4Z5TD 5GSUA 3AZFC 3LELC 3F6TA 2CV5D 1ZLAD 3O62D 1H3OB 3UTBD 3W99A 2YFWA 3KXBA 3AFAB 2RVQD 3AZMB 5BNXB 1P3BB 5DNMD 5B2JC 5B1LD 3W96A 4XZQD 1P3AD 1KU5A 5GT3C 5AV9B 3AYWC 3MGSD 1P34D 4ZUXB 1P3BD 4Z5TA 5B33D 3LZ0B 2YFVB 3WAAC 3WTPB 3EPKA 3UT9B 3AN2C 1ID3A 2F8NG 3B6FA 4YS3D 1P3FD 5CP6B 3MGRB 4CAYB 1P3PC 3AZKB 5CPID 5DNMA 3WA9D 4XUJB 5B1LA 5E5AB 3AZLD 4XZQA 3B0DC 1B6WA 3X1VB 2Y2NA 4WU8C 3MGRD 3AFAA 1P3OB 1P34A 3AZMA 4G91B 5BNXA 1P3BA 3AZKD 5B33A 5GSUC 4G92C 4J8UB 3W99C 1P3FA 1S32B 5AV9A 4R8PB 2NZDD 3LZ0A 5AV5B 2YFVA 3WTPA 4J8UD 5B40B 5AVBB 3KSYA 3W96C 3AZLA 5CP6A 3MGRA 1P3KB 3V9RB 1P3PB 4KUDB 3AZKA 4Z5TC 2CV5C 4XUJA 1ZLAC 5E5AA 3O62C 4H9OB 2LY8A 5F99B 3X1VA 3UTBC 2HUEB 1P3PD 3NQUB 1TZYD 3RELB 3AZID 4H9NB 1KX4B 2DQNC 2RVQC 5DNNB 5B24B 5DNMC 4J8UA 5B1LC 1P3LB 4XZQC 1P3AC 5C3IC 4LD9D 5BS7A 3A1IA 5B0ZD 2VQRA 3WTPE 1P34C 4X23D 3AZJD 1P3BC 5B33C 1AOID 5AVBA 1M1AD 3AZFB 4YS3C 3LELB 3REID 1P3FC 2Y2LA 1P3KA 3V9RA 1TZYA 5AV9C 3AZIA 1P3PA 4KUDA 5B31G 1M18B 5G49A 5CPIC 3WA9C 4H9OA 5B32B 5F99A 4H9QB 3AZLC 2FFFB 3NQUA 3RELA 2F8ND 3MGRC 2PYOD 1KX4A 5B0ZA 4X23A 1M18D 5B24A 2IO5C 5GT3B 3AZKC 3AZGD 3AYWB 1AOIA 5E5AC 5KDMA 1P3LA 3AN2B 4Z2MG 3WAAB 1T3UA 2NZDC 3REJD 4J8UC 1BH8B 3KUYD 3AZFA 1F66D 1BH9B 3AZHD 2PYOA 3AZED 5BS7C 3B0DB 3C1BB 4WU8B 2UWXA 1M18A 5AY8D 1N1JB 2Y2QA 4WV4B 4Z66D 5B32A 5AV8B 5GSUB 4G92B 1P3KC 3C1BD 1TZYC 2JCHA 3AZIC 3W99B
chains in the Genus database with same CATH topology
5B1MD 5GT3A 2CWEA 5AV8D 3KUYA 3AZEA 4LD9C 3W96B 5B0ZC 4J8VD 1P3GD 1HTAA 5AY8A 5AVCD 4X23C 1P3MD 4Z66A 1AOIC 1BH8A 1M1AC 5JA4B 1Q9CA 4Z5TB 2CV5B 2F8NH 1ZLAB 3REIC 3O62B 3C1BA 3WKJD 3A1KA 4WU8A 3UTBB 1N1JA 3B0CT 4J8WD 5AV8A 5CPKB 5DNMB 2F2AC 4H9RA 2PYOC 5B1LB 4XZQB 3C1CD 4QLCD 4J8VA 3LJAD 5AVCA 3REHD 1P3AB 5C3IB 1P3GA 1M18C 1P3MA 5B31D 2JE5A 3MNND 5B32C 1R4VA 3MGSB 5CPKD 1P34B 5B2ID 5B33B 3X1SD 4YS3B 1P3FB 1A7WA 4WNNA 3REJC 5JA4A 3KUYC 2CV5A 1F66C 5CPIB 1ZLAA 3WA9B 3O62A 3MGPD 3AZHC 3AZEC 3UTBA 3LZ1B 3C1CA 3AZLB 2G5HC 1KX3A 3LJAA 4H9PA 3REHA 5AY8C 4WJ3C 5B31A 4Z66C 5CPKA 4NE5A 3B6GD 3W97D 3B0CW 2IO5B 3EPJA 3LZ1D 3C1BC 2ZY3A 1P3AA 5B1MC 3MGSA 4ZBJC 2NZDB 5AV8C 4AWLB 3EPHA 3TU4D 4WU9B 4YS3A 1P3GC 4J8VC 5AVCC 4DQYB 4CSRA 3W97A 1P3MC 3B6GA 1F1EA 3UTAD 1JFIA 5CPIA 3WA9A 4WU9D 3LZ1A 3WKJC 1HQ3B 4J8WC 1TZYB 3AZIB 4J8XD 5AV6D 5G49B 4YM6D 3TU4A 1KX5D 1HQ3D 3C1CC 4QLCC 1KX3C 3LJAC 3REHC 4LD9B 2NZDA 2XD1A 5B31C 5B0ZB 3MNNC 5JRGB 3UTAA 5GT0D 4X23B 2AROD 3AZJB 5B2IC 5CPKC 4Z2MH 1AOIB 4WU9A 1M1AB 5KDMB 3X1SC 2FJ7D 3REIB 3MVDD 3MGSC 5JRGD 4DRAA 3X1TD 2Y2GA 5AV6A 4YM6A 1KX5A 3MGPC 3VH5T 1HQ3A 2PYOB 2F8NB 3W97C 3B6GC 1B67A 3AZGB 3VH6T 2Y2JA 3LZ1C 3AV1D 4LD9A 3MVDA 5JRGA 3X1TA 3AZJA 3REJB 3H0LC 3TU4C 1M1AA 3KUYB 1F66B 5GXQD 3REIA 4WZSB 3AZHB 3AZEB 4AWLC 3UTAC 5AY8B 3EPLA 2XD5A 4Z66B 3KWQB 4WU9C 3AL0C 3AV1A 3A6ND 2F8NA 4J8XC 5B1MB 5AV6C 3AZGA 2BG1A 2BYKB 4YM6C 3KWQD 4ZBJB 1KX5C 1HQ3C 5GXQA 3VH6W 1U35D 2NQBD 4H9RB 1P3GB 4J8VB 3NQJB 5AVCB 5GT0C 2AROC 3REJA 1P3MB 3W98D 4KHAA 1F66A 1P3ID 2HIOD 2ZY4A 3X1UD 3AZHA 2FJ7C 4HGAC 3MVDC 3WKJB 5JRGC 5B0YB 3X1TC 3AZJC 3REKB 4J8WB 2ZM5A 4WNNB 4E45A 3KWQA 1WWSA 5BT1D 3C1CB 1KX3B 5B0YD 5B1MA 4QLCB 4H9PB 3LJAB 3REHB 2BYKA 3REKD 5B31B 3MNNB 3P5JB 3AV1C 5B2IB 3X1UA 3AZND 3KFUG 2ZY5A 3X1SB 3NQJA 3AZGC 2BYMB 5GXQC 4NFTA 3KXBD 3MGPB 1EQZB 3WKJA 2DF4C 5B0YA 3REKA 4J8WA 4H9SA 4UPKA 4CSRB 3W97B 3B6GB 5CPJB 1JFIB 2Y2MA 2Y2OA 1TAFA 1EQZD 4QLCA 1M19D 3MNNA 3KWQC 1ID3D 5CPJD 3B6FD 5B2IA 4NE3A 4DRBA 3MGQD 3TU4B 1U35C 3X1SA 4JJND 2NQBC 5FUGB 3B0BA 1W2EA 3UTAB 3W98C 1Z2CB 2BYMA 1P3IC 2HIOC 2Y2IA 3X1UC 3AFAD 3MGPA 1EQZA 3AZMD 4M6BA 2G5IC 1M19A 4J8XB 5CPJA 5AV6B 2JSSA 4YM6B 5AV9D 3MGQA 1KX5B 5BT1C 4JJNA 4ZUXD 5B32G 3LZ0D 3UT9D 5B0YC 3WTPD 3REKC 1H3OA 4H9SC 5GT0B 2AROB 5BO0B 5CP6D 3AZNC 5FUGA 4NE6A 2Y2KA 2FJ7B 4XUJD 3H0RC 4HGAB 3MVDB 5E5AD 3X1VD 3X1TB 2J8PA 3FDDA 1P3OD 3KXBC 2F8NK 4ZUXA 4KGCB 3UT9A 4J8XA 2RIQA 1S32D 4R8PD 2ZY2A 1EQZC 4CAYA 3AV1B 4KGCD 5AV5D 4EO5C 3H0MC 3R45B 5B40D 5AVBD 1M19C 1ID3C 5CPJC 5GT0A 3B6FC 2AROA 5BO0A 1P3KD 3MGQC 1P3OA 4KUDD 4JJNC 2FJ7A 5GXQB 5BNVB 5F99D 1S32A 4R8PA 3RELD 3AFAC 1KX4D 3AZMC 4KHAB 5DNND 5AV5A 5B24D 3A6NB 3AV2B 4KGCA 5B40A 1P3LD 4UUZB 3AV2D 4ZUXC 3LZ0C 3UT9C 3WTPC 1U35B 3R45A 3EG5B 3VH5W 2NQBB 3AZFD 3LELD 5B2JB 5CP6C 1KX3D 4H9NA 3W98B 2Y2PA 5DNNA 1P3IB 2HIOB 3X1UB 4XUJC 5BNVA 5B32D 5B2JD 3X1VC 2W8SA 3VH5A 1P3OC 4G91C 3AV2A 3A6NA 5GT3D 3AYWD 3AN2D 3LELA 3VH6A 5CHLB 4E44A 1S32C 3WAAD 4R8PC 1PZRA 4UUZA 4KGCC 5AV5C 1U35A 3AZNB 1TAFB 2NQBA 5AVBC 5B40C 4H9QA 5B2JA 1WWIA 2L5AA 3W98A 4WU8D 4KUDC 2YFWB 1P3IA 2HIOA 3AYWA 3KXBB 5F99C 3AN2A 5GSUD 3WAAA 2HUEC 2Y2HA 3RELC 3W99D 1KX4C 5DNNC 5B24C 3IP4C 1BFMA 1P3LC 1BH9A 4EO5B 1M19B 3W96D 1ID3B 3B6FB 3AV2C 3A6NC 3AZNA 3MGQB 4JJNB 1ULYA 4Z5TD 5GSUA 3AZFC 3LELC 3F6TA 2CV5D 1ZLAD 3O62D 1H3OB 3UTBD 3W99A 2YFWA 3KXBA 3AFAB 2RVQD 3AZMB 5BNXB 1P3BB 5DNMD 5B2JC 5B1LD 3W96A 4XZQD 1P3AD 1KU5A 5GT3C 5AV9B 3AYWC 3MGSD 1P34D 4ZUXB 1P3BD 4Z5TA 5B33D 3LZ0B 2YFVB 3WAAC 3WTPB 3EPKA 3UT9B 3AN2C 1ID3A 2F8NG 3B6FA 4YS3D 1P3FD 5CP6B 3MGRB 4CAYB 1P3PC 3AZKB 5CPID 5DNMA 3WA9D 4XUJB 5B1LA 5E5AB 3AZLD 4XZQA 3B0DC 1B6WA 3X1VB 2Y2NA 4WU8C 3MGRD 3AFAA 1P3OB 1P34A 3AZMA 4G91B 5BNXA 1P3BA 3AZKD 5B33A 5GSUC 4G92C 4J8UB 3W99C 1P3FA 1S32B 5AV9A 4R8PB 2NZDD 3LZ0A 5AV5B 2YFVA 3WTPA 4J8UD 5B40B 5AVBB 3KSYA 3W96C 3AZLA 5CP6A 3MGRA 1P3KB 3V9RB 1P3PB 4KUDB 3AZKA 4Z5TC 2CV5C 4XUJA 1ZLAC 5E5AA 3O62C 4H9OB 2LY8A 5F99B 3X1VA 3UTBC 2HUEB 1P3PD 3NQUB 1TZYD 3RELB 3AZID 4H9NB 1KX4B 2DQNC 2RVQC 5DNNB 5B24B 5DNMC 4J8UA 5B1LC 1P3LB 4XZQC 1P3AC 5C3IC 4LD9D 5BS7A 3A1IA 5B0ZD 2VQRA 3WTPE 1P34C 4X23D 3AZJD 1P3BC 5B33C 1AOID 5AVBA 1M1AD 3AZFB 4YS3C 3LELB 3REID 1P3FC 2Y2LA 1P3KA 3V9RA 1TZYA 5AV9C 3AZIA 1P3PA 4KUDA 5B31G 1M18B 5G49A 5CPIC 3WA9C 4H9OA 5B32B 5F99A 4H9QB 3AZLC 2FFFB 3NQUA 3RELA 2F8ND 3MGRC 2PYOD 1KX4A 5B0ZA 4X23A 1M18D 5B24A 2IO5C 5GT3B 3AZKC 3AZGD 3AYWB 1AOIA 5E5AC 5KDMA 1P3LA 3AN2B 4Z2MG 3WAAB 1T3UA 2NZDC 3REJD 4J8UC 1BH8B 3KUYD 3AZFA 1F66D 1BH9B 3AZHD 2PYOA 3AZED 5BS7C 3B0DB 3C1BB 4WU8B 2UWXA 1M18A 5AY8D 1N1JB 2Y2QA 4WV4B 4Z66D 5B32A 5AV8B 5GSUB 4G92B 1P3KC 3C1BD 1TZYC 2JCHA 3AZIC 3W99B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1M D;  5GT3 A;  2CWE A;  5AV8 D;  3KUY A;  3AZE A;  4LD9 C;  3W96 B;  5B0Z C;  4J8V D;  1P3G D;  1HTA A;  5AY8 A;  5AVC D;  4X23 C;  1P3M D;  4Z66 A;  1AOI C;  1BH8 A;  1M1A C;  5JA4 B;  1Q9C A;  4Z5T B;  2CV5 B;  2F8N H;  1ZLA B;  3REI C;  3O62 B;  3C1B A;  3WKJ D;  4WU8 A;  3UTB B;  1N1J A;  3B0C T;  4J8W D;  5AV8 A;  5CPK B;  5DNM B;  4H9R A;  2PYO C;  5B1L B;  4XZQ B;  3C1C D;  4QLC D;  4J8V A;  3LJA D;  5AVC A;  3REH D;  1P3A B;  5C3I B;  1P3G A;  1M18 C;  1P3M A;  5B31 D;  3MNN D;  3MGS B;  5B32 C;  1R4V A;  5CPK D;  1P34 B;  5B2I D;  5B33 B;  3X1S D;  4YS3 B;  1P3F B;  1A7W A;  4WNN A;  3REJ C;  5JA4 A;  3KUY C;  2CV5 A;  1F66 C;  5CPI B;  1ZLA A;  3WA9 B;  3O62 A;  3MGP D;  3AZH C;  3AZE C;  3UTB A;  3LZ1 B;  3C1C A;  3AZL B;  1KX3 A;  3LJA A;  4H9P A;  3REH A;  5AY8 C;  5B31 A;  4Z66 C;  5CPK A;  4NE5 A;  3B6G D;  3W97 D;  3B0C W;  2IO5 B;  3LZ1 D;  3C1B C;  1P3A A;  5B1M C;  3MGS A;  4ZBJ C;  2NZD B;  5AV8 C;  4AWL B;  3TU4 D;  4WU9 B;  4YS3 A;  1P3G C;  4J8V C;  5AVC C;  4CSR A;  3W97 A;  1P3M C;  3B6G A;  1F1E A;  3UTA D;  1JFI A;  5CPI A;  3WA9 A;  4WU9 D;  3LZ1 A;  3WKJ C;  1HQ3 B;  4J8W C;  1TZY B;  3AZI B;  4J8X D;  5AV6 D;  5G49 B;  4YM6 D;  3TU4 A;  1KX5 D;  1HQ3 D;  3C1C C;  4QLC C;  1KX3 C;  3LJA C;  3REH C;  4LD9 B;  2NZD A;  5B31 C;  5B0Z B;  3MNN C;  5JRG B;  3UTA A;  5GT0 D;  4X23 B;  2ARO D;  3AZJ B;  5B2I C;  5CPK C;  4Z2M H;  1AOI B;  4WU9 A;  1M1A B;  5KDM B;  3X1S C;  2FJ7 D;  3REI B;  3MVD D;  3MGS C;  5JRG D;  4DRA A;  3X1T D;  5AV6 A;  4YM6 A;  1KX5 A;  3MGP C;  3VH5 T;  1HQ3 A;  2PYO B;  2F8N B;  3W97 C;  3B6G C;  1B67 A;  3AZG B;  3VH6 T;  3LZ1 C;  3AV1 D;  4LD9 A;  3MVD A;  5JRG A;  3X1T A;  3AZJ A;  3REJ B;  3TU4 C;  1M1A A;  3KUY B;  1F66 B;  5GXQ D;  3REI A;  4WZS B;  3AZH B;  3AZE B;  4AWL C;  3UTA C;  5AY8 B;  4Z66 B;  3KWQ B;  4WU9 C;  3AV1 A;  3A6N D;  2F8N A;  4J8X C;  5B1M B;  5AV6 C;  3AZG A;  2BYK B;  4YM6 C;  3KWQ D;  4ZBJ B;  1KX5 C;  1HQ3 C;  5GXQ A;  3VH6 W;  1U35 D;  2NQB D;  4H9R B;  1P3G B;  4J8V B;  3NQJ B;  5AVC B;  5GT0 C;  2ARO C;  3REJ A;  1P3M B;  3W98 D;  4KHA A;  1F66 A;  1P3I D;  2HIO D;  3X1U D;  3AZH A;  2FJ7 C;  4HGA C;  3MVD C;  3WKJ B;  5JRG C;  5B0Y B;  3X1T C;  3AZJ C;  3REK B;  4J8W B;  4WNN B;  4E45 A;  3KWQ A;  1WWS A;  5BT1 D;  3C1C B;  1KX3 B;  4QLC B;  5B1M A;  5B0Y D;  4H9P B;  3LJA B;  3REH B;  2BYK A;  3REK D;  5B31 B;  3MNN B;  3AV1 C;  5B2I B;  3X1U A;  3AZN D;  3X1S B;  3NQJ A;  3AZG C;  2BYM B;  5GXQ C;  4NFT A;  3KXB D;  3MGP B;  1EQZ B;  3WKJ A;  5B0Y A;  3REK A;  4J8W A;  4H9S A;  4CSR B;  3W97 B;  3B6G B;  5CPJ B;  1JFI B;  1TAF A;  1EQZ D;  4QLC A;  1M19 D;  3MNN A;  3KWQ C;  1ID3 D;  5CPJ D;  3B6F D;  5B2I A;  4NE3 A;  4DRB A;  3MGQ D;  3TU4 B;  1U35 C;  3X1S A;  4JJN D;  2NQB C;  5FUG B;  3B0B A;  3UTA B;  3W98 C;  2BYM A;  1P3I C;  2HIO C;  3X1U C;  3AFA D;  3MGP A;  1EQZ A;  3AZM D;  4M6B A;  1M19 A;  4J8X B;  5CPJ A;  5AV6 B;  2JSS A;  4YM6 B;  5AV9 D;  3MGQ A;  1KX5 B;  5BT1 C;  4JJN A;  4ZUX D;  5B32 G;  3LZ0 D;  3UT9 D;  5B0Y C;  3WTP D;  3REK C;  4H9S C;  1H3O A;  5GT0 B;  2ARO B;  5BO0 B;  5CP6 D;  3AZN C;  5FUG A;  4NE6 A;  2FJ7 B;  4XUJ D;  4HGA B;  3MVD B;  5E5A D;  3X1V D;  3X1T B;  1P3O D;  3KXB C;  2F8N K;  4ZUX A;  4KGC B;  3UT9 A;  4J8X A;  1S32 D;  4R8P D;  1EQZ C;  4CAY A;  3AV1 B;  4KGC D;  5AV5 D;  4EO5 C;  3R45 B;  5B40 D;  5AVB D;  1M19 C;  1ID3 C;  5CPJ C;  5GT0 A;  3B6F C;  2ARO A;  5BO0 A;  1P3K D;  3MGQ C;  1P3O A;  4KUD D;  4JJN C;  2FJ7 A;  5GXQ B;  5BNV B;  5F99 D;  1S32 A;  4R8P A;  3REL D;  3AFA C;  1KX4 D;  3AZM C;  4KHA B;  5DNN D;  5AV5 A;  5B24 D;  3A6N B;  3AV2 B;  4KGC A;  5B40 A;  1P3L D;  4UUZ B;  3AV2 D;  4ZUX C;  3LZ0 C;  3UT9 C;  3WTP C;  1U35 B;  3R45 A;  3VH5 W;  2NQB B;  3AZF D;  3LEL D;  5B2J B;  5CP6 C;  1KX3 D;  4H9N A;  3W98 B;  5DNN A;  1P3I B;  2HIO B;  3X1U B;  4XUJ C;  5BNV A;  5B32 D;  5B2J D;  3X1V C;  3VH5 A;  1P3O C;  4G91 C;  3AV2 A;  3A6N A;  5GT3 D;  3AYW D;  3AN2 D;  3LEL A;  3VH6 A;  5CHL B;  4E44 A;  1S32 C;  3WAA D;  4R8P C;  4UUZ A;  4KGC C;  5AV5 C;  1U35 A;  3AZN B;  1TAF B;  2NQB A;  5AVB C;  5B40 C;  4H9Q A;  5B2J A;  1WWI A;  2L5A A;  3W98 A;  4WU8 D;  4KUD C;  2YFW B;  1P3I A;  2HIO A;  3AYW A;  3KXB B;  5F99 C;  3AN2 A;  5GSU D;  3WAA A;  2HUE C;  3REL C;  3W99 D;  1KX4 C;  5DNN C;  5B24 C;  1BFM A;  1P3L C;  1BH9 A;  4EO5 B;  1M19 B;  3W96 D;  1ID3 B;  3B6F B;  3AV2 C;  3A6N C;  3AZN A;  3MGQ B;  4JJN B;  1ULY A;  4Z5T D;  5GSU A;  3AZF C;  3LEL C;  2CV5 D;  1ZLA D;  3O62 D;  1H3O B;  3UTB D;  3W99 A;  2YFW A;  3KXB A;  3AFA B;  2RVQ D;  3AZM B;  5BNX B;  1P3B B;  5DNM D;  5B2J C;  5B1L D;  3W96 A;  4XZQ D;  1P3A D;  1KU5 A;  5GT3 C;  5AV9 B;  3AYW C;  3MGS D;  1P34 D;  4ZUX B;  1P3B D;  4Z5T A;  5B33 D;  3LZ0 B;  2YFV B;  3WAA C;  3WTP B;  3UT9 B;  3AN2 C;  1ID3 A;  2F8N G;  3B6F A;  4YS3 D;  1P3F D;  5CP6 B;  3MGR B;  4CAY B;  1P3P C;  3AZK B;  5CPI D;  5DNM A;  3WA9 D;  4XUJ B;  5B1L A;  5E5A B;  3AZL D;  4XZQ A;  3B0D C;  1B6W A;  3X1V B;  4WU8 C;  3MGR D;  3AFA A;  1P3O B;  1P34 A;  3AZM A;  4G91 B;  5BNX A;  1P3B A;  3AZK D;  5B33 A;  5GSU C;  4G92 C;  4J8U B;  3W99 C;  1P3F A;  1S32 B;  5AV9 A;  4R8P B;  2NZD D;  3LZ0 A;  5AV5 B;  2YFV A;  3WTP A;  4J8U D;  5B40 B;  5AVB B;  3KSY A;  3W96 C;  3AZL A;  5CP6 A;  3MGR A;  1P3K B;  3V9R B;  1P3P B;  4KUD B;  3AZK A;  4Z5T C;  2CV5 C;  4XUJ A;  1ZLA C;  5E5A A;  3O62 C;  4H9O B;  2LY8 A;  5F99 B;  3X1V A;  3UTB C;  2HUE B;  1P3P D;  3NQU B;  1TZY D;  3REL B;  3AZI D;  4H9N B;  1KX4 B;  2RVQ C;  5DNN B;  5B24 B;  5DNM C;  4J8U A;  5B1L C;  1P3L B;  4XZQ C;  1P3A C;  5C3I C;  4LD9 D;  5BS7 A;  5B0Z D;  3WTP E;  1P34 C;  4X23 D;  3AZJ D;  1P3B C;  5B33 C;  1AOI D;  5AVB A;  1M1A D;  3AZF B;  4YS3 C;  3LEL B;  3REI D;  1P3F C;  1P3K A;  3V9R A;  1TZY A;  5AV9 C;  3AZI A;  1P3P A;  4KUD A;  5B31 G;  1M18 B;  5G49 A;  5CPI C;  3WA9 C;  4H9O A;  5B32 B;  5F99 A;  4H9Q B;  3AZL C;  3NQU A;  3REL A;  2F8N D;  3MGR C;  2PYO D;  1KX4 A;  5B0Z A;  4X23 A;  1M18 D;  5B24 A;  2IO5 C;  5GT3 B;  3AZK C;  3AZG D;  3AYW B;  1AOI A;  5E5A C;  5KDM A;  1P3L A;  3AN2 B;  4Z2M G;  3WAA B;  2NZD C;  3REJ D;  4J8U C;  1BH8 B;  3KUY D;  3AZF A;  1F66 D;  1BH9 B;  3AZH D;  2PYO A;  3AZE D;  5BS7 C;  3B0D B;  3C1B B;  4WU8 B;  1M18 A;  5AY8 D;  1N1J B;  4WV4 B;  4Z66 D;  5B32 A;  5AV8 B;  5GSU B;  4G92 B;  1P3K C;  3C1B D;  1TZY C;  3AZI C;  3W99 B; 
#chains in the Genus database with same CATH topology
 5B1M D;  5GT3 A;  2CWE A;  5AV8 D;  3KUY A;  3AZE A;  4LD9 C;  3W96 B;  5B0Z C;  4J8V D;  1P3G D;  1HTA A;  5AY8 A;  5AVC D;  4X23 C;  1P3M D;  4Z66 A;  1AOI C;  1BH8 A;  1M1A C;  5JA4 B;  1Q9C A;  4Z5T B;  2CV5 B;  2F8N H;  1ZLA B;  3REI C;  3O62 B;  3C1B A;  3WKJ D;  3A1K A;  4WU8 A;  3UTB B;  1N1J A;  3B0C T;  4J8W D;  5AV8 A;  5CPK B;  5DNM B;  2F2A C;  4H9R A;  2PYO C;  5B1L B;  4XZQ B;  3C1C D;  4QLC D;  4J8V A;  3LJA D;  5AVC A;  3REH D;  1P3A B;  5C3I B;  1P3G A;  1M18 C;  1P3M A;  5B31 D;  2JE5 A;  3MNN D;  5B32 C;  1R4V A;  3MGS B;  5CPK D;  1P34 B;  5B2I D;  5B33 B;  3X1S D;  4YS3 B;  1P3F B;  1A7W A;  4WNN A;  3REJ C;  5JA4 A;  3KUY C;  2CV5 A;  1F66 C;  5CPI B;  1ZLA A;  3WA9 B;  3O62 A;  3MGP D;  3AZH C;  3AZE C;  3UTB A;  3LZ1 B;  3C1C A;  3AZL B;  2G5H C;  1KX3 A;  3LJA A;  4H9P A;  3REH A;  5AY8 C;  4WJ3 C;  5B31 A;  4Z66 C;  5CPK A;  4NE5 A;  3B6G D;  3W97 D;  3B0C W;  2IO5 B;  3EPJ A;  3LZ1 D;  3C1B C;  2ZY3 A;  1P3A A;  5B1M C;  3MGS A;  4ZBJ C;  2NZD B;  5AV8 C;  4AWL B;  3EPH A;  3TU4 D;  4WU9 B;  4YS3 A;  1P3G C;  4J8V C;  5AVC C;  4DQY B;  4CSR A;  3W97 A;  1P3M C;  3B6G A;  1F1E A;  3UTA D;  1JFI A;  5CPI A;  3WA9 A;  4WU9 D;  3LZ1 A;  3WKJ C;  1HQ3 B;  4J8W C;  1TZY B;  3AZI B;  4J8X D;  5AV6 D;  5G49 B;  4YM6 D;  3TU4 A;  1KX5 D;  1HQ3 D;  3C1C C;  4QLC C;  1KX3 C;  3LJA C;  3REH C;  4LD9 B;  2NZD A;  2XD1 A;  5B31 C;  5B0Z B;  3MNN C;  5JRG B;  3UTA A;  5GT0 D;  4X23 B;  2ARO D;  3AZJ B;  5B2I C;  5CPK C;  4Z2M H;  1AOI B;  4WU9 A;  1M1A B;  5KDM B;  3X1S C;  2FJ7 D;  3REI B;  3MVD D;  3MGS C;  5JRG D;  4DRA A;  3X1T D;  2Y2G A;  5AV6 A;  4YM6 A;  1KX5 A;  3MGP C;  3VH5 T;  1HQ3 A;  2PYO B;  2F8N B;  3W97 C;  3B6G C;  1B67 A;  3AZG B;  3VH6 T;  2Y2J A;  3LZ1 C;  3AV1 D;  4LD9 A;  3MVD A;  5JRG A;  3X1T A;  3AZJ A;  3REJ B;  3H0L C;  3TU4 C;  1M1A A;  3KUY B;  1F66 B;  5GXQ D;  3REI A;  4WZS B;  3AZH B;  3AZE B;  4AWL C;  3UTA C;  5AY8 B;  3EPL A;  2XD5 A;  4Z66 B;  3KWQ B;  4WU9 C;  3AL0 C;  3AV1 A;  3A6N D;  2F8N A;  4J8X C;  5B1M B;  5AV6 C;  3AZG A;  2BG1 A;  2BYK B;  4YM6 C;  3KWQ D;  4ZBJ B;  1KX5 C;  1HQ3 C;  5GXQ A;  3VH6 W;  1U35 D;  2NQB D;  4H9R B;  1P3G B;  4J8V B;  3NQJ B;  5AVC B;  5GT0 C;  2ARO C;  3REJ A;  1P3M B;  3W98 D;  4KHA A;  1F66 A;  1P3I D;  2HIO D;  2ZY4 A;  3X1U D;  3AZH A;  2FJ7 C;  4HGA C;  3MVD C;  3WKJ B;  5JRG C;  5B0Y B;  3X1T C;  3AZJ C;  3REK B;  4J8W B;  2ZM5 A;  4WNN B;  4E45 A;  3KWQ A;  1WWS A;  5BT1 D;  3C1C B;  1KX3 B;  5B0Y D;  5B1M A;  4QLC B;  4H9P B;  3LJA B;  3REH B;  2BYK A;  3REK D;  5B31 B;  3MNN B;  3P5J B;  3AV1 C;  5B2I B;  3X1U A;  3AZN D;  3KFU G;  2ZY5 A;  3X1S B;  3NQJ A;  3AZG C;  2BYM B;  5GXQ C;  4NFT A;  3KXB D;  3MGP B;  1EQZ B;  3WKJ A;  2DF4 C;  5B0Y A;  3REK A;  4J8W A;  4H9S A;  4UPK A;  4CSR B;  3W97 B;  3B6G B;  5CPJ B;  1JFI B;  2Y2M A;  2Y2O A;  1TAF A;  1EQZ D;  4QLC A;  1M19 D;  3MNN A;  3KWQ C;  1ID3 D;  5CPJ D;  3B6F D;  5B2I A;  4NE3 A;  4DRB A;  3MGQ D;  3TU4 B;  1U35 C;  3X1S A;  4JJN D;  2NQB C;  5FUG B;  3B0B A;  1W2E A;  3UTA B;  3W98 C;  1Z2C B;  2BYM A;  1P3I C;  2HIO C;  2Y2I A;  3X1U C;  3AFA D;  3MGP A;  1EQZ A;  3AZM D;  4M6B A;  2G5I C;  1M19 A;  4J8X B;  5CPJ A;  5AV6 B;  2JSS A;  4YM6 B;  5AV9 D;  3MGQ A;  1KX5 B;  5BT1 C;  4JJN A;  4ZUX D;  5B32 G;  3LZ0 D;  3UT9 D;  5B0Y C;  3WTP D;  3REK C;  1H3O A;  4H9S C;  5GT0 B;  2ARO B;  5BO0 B;  5CP6 D;  3AZN C;  5FUG A;  4NE6 A;  2Y2K A;  2FJ7 B;  4XUJ D;  3H0R C;  4HGA B;  3MVD B;  5E5A D;  3X1V D;  3X1T B;  2J8P A;  3FDD A;  1P3O D;  3KXB C;  2F8N K;  4ZUX A;  4KGC B;  3UT9 A;  4J8X A;  2RIQ A;  1S32 D;  4R8P D;  2ZY2 A;  1EQZ C;  4CAY A;  3AV1 B;  4KGC D;  5AV5 D;  4EO5 C;  3H0M C;  3R45 B;  5B40 D;  5AVB D;  1M19 C;  1ID3 C;  5CPJ C;  5GT0 A;  3B6F C;  2ARO A;  5BO0 A;  1P3K D;  3MGQ C;  1P3O A;  4KUD D;  4JJN C;  2FJ7 A;  5GXQ B;  5BNV B;  5F99 D;  1S32 A;  4R8P A;  3REL D;  3AFA C;  1KX4 D;  3AZM C;  4KHA B;  5DNN D;  5AV5 A;  5B24 D;  3A6N B;  3AV2 B;  4KGC A;  5B40 A;  1P3L D;  4UUZ B;  3AV2 D;  4ZUX C;  3LZ0 C;  3UT9 C;  3WTP C;  1U35 B;  3R45 A;  3EG5 B;  3VH5 W;  2NQB B;  3AZF D;  3LEL D;  5B2J B;  5CP6 C;  1KX3 D;  4H9N A;  3W98 B;  2Y2P A;  5DNN A;  1P3I B;  2HIO B;  3X1U B;  4XUJ C;  5BNV A;  5B32 D;  5B2J D;  3X1V C;  2W8S A;  3VH5 A;  1P3O C;  4G91 C;  3AV2 A;  3A6N A;  5GT3 D;  3AYW D;  3AN2 D;  3LEL A;  3VH6 A;  5CHL B;  4E44 A;  1S32 C;  3WAA D;  4R8P C;  1PZR A;  4UUZ A;  4KGC C;  5AV5 C;  1U35 A;  3AZN B;  1TAF B;  2NQB A;  5AVB C;  5B40 C;  4H9Q A;  5B2J A;  1WWI A;  2L5A A;  3W98 A;  4WU8 D;  4KUD C;  2YFW B;  1P3I A;  2HIO A;  3AYW A;  3KXB B;  5F99 C;  3AN2 A;  5GSU D;  3WAA A;  2HUE C;  2Y2H A;  3REL C;  3W99 D;  1KX4 C;  5DNN C;  5B24 C;  3IP4 C;  1BFM A;  1P3L C;  1BH9 A;  4EO5 B;  1M19 B;  3W96 D;  1ID3 B;  3B6F B;  3AV2 C;  3A6N C;  3AZN A;  3MGQ B;  4JJN B;  1ULY A;  4Z5T D;  5GSU A;  3AZF C;  3LEL C;  3F6T A;  2CV5 D;  1ZLA D;  3O62 D;  1H3O B;  3UTB D;  3W99 A;  2YFW A;  3KXB A;  3AFA B;  2RVQ D;  3AZM B;  5BNX B;  1P3B B;  5DNM D;  5B2J C;  5B1L D;  3W96 A;  4XZQ D;  1P3A D;  1KU5 A;  5GT3 C;  5AV9 B;  3AYW C;  3MGS D;  1P34 D;  4ZUX B;  1P3B D;  4Z5T A;  5B33 D;  3LZ0 B;  2YFV B;  3WAA C;  3WTP B;  3EPK A;  3UT9 B;  3AN2 C;  1ID3 A;  2F8N G;  3B6F A;  4YS3 D;  1P3F D;  5CP6 B;  3MGR B;  4CAY B;  1P3P C;  3AZK B;  5CPI D;  5DNM A;  3WA9 D;  4XUJ B;  5B1L A;  5E5A B;  3AZL D;  4XZQ A;  3B0D C;  1B6W A;  3X1V B;  2Y2N A;  4WU8 C;  3MGR D;  3AFA A;  1P3O B;  1P34 A;  3AZM A;  4G91 B;  5BNX A;  1P3B A;  3AZK D;  5B33 A;  5GSU C;  4G92 C;  4J8U B;  3W99 C;  1P3F A;  1S32 B;  5AV9 A;  4R8P B;  2NZD D;  3LZ0 A;  5AV5 B;  2YFV A;  3WTP A;  4J8U D;  5B40 B;  5AVB B;  3KSY A;  3W96 C;  3AZL A;  5CP6 A;  3MGR A;  1P3K B;  3V9R B;  1P3P B;  4KUD B;  3AZK A;  4Z5T C;  2CV5 C;  4XUJ A;  1ZLA C;  5E5A A;  3O62 C;  4H9O B;  2LY8 A;  5F99 B;  3X1V A;  3UTB C;  2HUE B;  1P3P D;  3NQU B;  1TZY D;  3REL B;  3AZI D;  4H9N B;  1KX4 B;  2DQN C;  2RVQ C;  5DNN B;  5B24 B;  5DNM C;  4J8U A;  5B1L C;  1P3L B;  4XZQ C;  1P3A C;  5C3I C;  4LD9 D;  5BS7 A;  3A1I A;  5B0Z D;  2VQR A;  3WTP E;  1P34 C;  4X23 D;  3AZJ D;  1P3B C;  5B33 C;  1AOI D;  5AVB A;  1M1A D;  3AZF B;  4YS3 C;  3LEL B;  3REI D;  1P3F C;  2Y2L A;  1P3K A;  3V9R A;  1TZY A;  5AV9 C;  3AZI A;  1P3P A;  4KUD A;  5B31 G;  1M18 B;  5G49 A;  5CPI C;  3WA9 C;  4H9O A;  5B32 B;  5F99 A;  4H9Q B;  3AZL C;  2FFF B;  3NQU A;  3REL A;  2F8N D;  3MGR C;  2PYO D;  1KX4 A;  5B0Z A;  4X23 A;  1M18 D;  5B24 A;  2IO5 C;  5GT3 B;  3AZK C;  3AZG D;  3AYW B;  1AOI A;  5E5A C;  5KDM A;  1P3L A;  3AN2 B;  4Z2M G;  3WAA B;  1T3U A;  2NZD C;  3REJ D;  4J8U C;  1BH8 B;  3KUY D;  3AZF A;  1F66 D;  1BH9 B;  3AZH D;  2PYO A;  3AZE D;  5BS7 C;  3B0D B;  3C1B B;  4WU8 B;  2UWX A;  1M18 A;  5AY8 D;  1N1J B;  2Y2Q A;  4WV4 B;  4Z66 D;  5B32 A;  5AV8 B;  5GSU B;  4G92 B;  1P3K C;  3C1B D;  1TZY C;  2JCH A;  3AZI C;  3W99 B; 
#chains in the Genus database with same CATH homology
 5B1M D;  5GT3 A;  2CWE A;  5AV8 D;  3KUY A;  3AZE A;  4LD9 C;  3W96 B;  5B0Z C;  4J8V D;  1P3G D;  1HTA A;  5AY8 A;  5AVC D;  4X23 C;  1P3M D;  4Z66 A;  1AOI C;  1BH8 A;  1M1A C;  5JA4 B;  1Q9C A;  4Z5T B;  2CV5 B;  2F8N H;  1ZLA B;  3REI C;  3O62 B;  3C1B A;  3WKJ D;  3A1K A;  4WU8 A;  3UTB B;  1N1J A;  3B0C T;  4J8W D;  5AV8 A;  5CPK B;  5DNM B;  2F2A C;  4H9R A;  2PYO C;  5B1L B;  4XZQ B;  3C1C D;  4QLC D;  4J8V A;  3LJA D;  5AVC A;  3REH D;  1P3A B;  5C3I B;  1P3G A;  1M18 C;  1P3M A;  5B31 D;  2JE5 A;  3MNN D;  5B32 C;  1R4V A;  3MGS B;  5CPK D;  1P34 B;  5B2I D;  5B33 B;  3X1S D;  4YS3 B;  1P3F B;  1A7W A;  4WNN A;  3REJ C;  5JA4 A;  3KUY C;  2CV5 A;  1F66 C;  5CPI B;  1ZLA A;  3WA9 B;  3O62 A;  3MGP D;  3AZH C;  3AZE C;  3UTB A;  3LZ1 B;  3C1C A;  3AZL B;  2G5H C;  1KX3 A;  3LJA A;  4H9P A;  3REH A;  5AY8 C;  4WJ3 C;  5B31 A;  4Z66 C;  5CPK A;  4NE5 A;  3B6G D;  3W97 D;  3B0C W;  2IO5 B;  3EPJ A;  3LZ1 D;  3C1B C;  2ZY3 A;  1P3A A;  5B1M C;  3MGS A;  4ZBJ C;  2NZD B;  5AV8 C;  4AWL B;  3EPH A;  3TU4 D;  4WU9 B;  4YS3 A;  1P3G C;  4J8V C;  5AVC C;  4DQY B;  4CSR A;  3W97 A;  1P3M C;  3B6G A;  1F1E A;  3UTA D;  1JFI A;  5CPI A;  3WA9 A;  4WU9 D;  3LZ1 A;  3WKJ C;  1HQ3 B;  4J8W C;  1TZY B;  3AZI B;  4J8X D;  5AV6 D;  5G49 B;  4YM6 D;  3TU4 A;  1KX5 D;  1HQ3 D;  3C1C C;  4QLC C;  1KX3 C;  3LJA C;  3REH C;  4LD9 B;  2NZD A;  2XD1 A;  5B31 C;  5B0Z B;  3MNN C;  5JRG B;  3UTA A;  5GT0 D;  4X23 B;  2ARO D;  3AZJ B;  5B2I C;  5CPK C;  4Z2M H;  1AOI B;  4WU9 A;  1M1A B;  5KDM B;  3X1S C;  2FJ7 D;  3REI B;  3MVD D;  3MGS C;  5JRG D;  4DRA A;  3X1T D;  2Y2G A;  5AV6 A;  4YM6 A;  1KX5 A;  3MGP C;  3VH5 T;  1HQ3 A;  2PYO B;  2F8N B;  3W97 C;  3B6G C;  1B67 A;  3AZG B;  3VH6 T;  2Y2J A;  3LZ1 C;  3AV1 D;  4LD9 A;  3MVD A;  5JRG A;  3X1T A;  3AZJ A;  3REJ B;  3H0L C;  3TU4 C;  1M1A A;  3KUY B;  1F66 B;  5GXQ D;  3REI A;  4WZS B;  3AZH B;  3AZE B;  4AWL C;  3UTA C;  5AY8 B;  3EPL A;  2XD5 A;  4Z66 B;  3KWQ B;  4WU9 C;  3AL0 C;  3AV1 A;  3A6N D;  2F8N A;  4J8X C;  5B1M B;  5AV6 C;  3AZG A;  2BG1 A;  2BYK B;  4YM6 C;  3KWQ D;  4ZBJ B;  1KX5 C;  1HQ3 C;  5GXQ A;  3VH6 W;  1U35 D;  2NQB D;  4H9R B;  1P3G B;  4J8V B;  3NQJ B;  5AVC B;  5GT0 C;  2ARO C;  3REJ A;  1P3M B;  3W98 D;  4KHA A;  1F66 A;  1P3I D;  2HIO D;  2ZY4 A;  3X1U D;  3AZH A;  2FJ7 C;  4HGA C;  3MVD C;  3WKJ B;  5JRG C;  5B0Y B;  3X1T C;  3AZJ C;  3REK B;  4J8W B;  2ZM5 A;  4WNN B;  4E45 A;  3KWQ A;  1WWS A;  5BT1 D;  3C1C B;  1KX3 B;  5B0Y D;  5B1M A;  4QLC B;  4H9P B;  3LJA B;  3REH B;  2BYK A;  3REK D;  5B31 B;  3MNN B;  3P5J B;  3AV1 C;  5B2I B;  3X1U A;  3AZN D;  3KFU G;  2ZY5 A;  3X1S B;  3NQJ A;  3AZG C;  2BYM B;  5GXQ C;  4NFT A;  3KXB D;  3MGP B;  1EQZ B;  3WKJ A;  2DF4 C;  5B0Y A;  3REK A;  4J8W A;  4H9S A;  4UPK A;  4CSR B;  3W97 B;  3B6G B;  5CPJ B;  1JFI B;  2Y2M A;  2Y2O A;  1TAF A;  1EQZ D;  4QLC A;  1M19 D;  3MNN A;  3KWQ C;  1ID3 D;  5CPJ D;  3B6F D;  5B2I A;  4NE3 A;  4DRB A;  3MGQ D;  3TU4 B;  1U35 C;  3X1S A;  4JJN D;  2NQB C;  5FUG B;  3B0B A;  1W2E A;  3UTA B;  3W98 C;  1Z2C B;  2BYM A;  1P3I C;  2HIO C;  2Y2I A;  3X1U C;  3AFA D;  3MGP A;  1EQZ A;  3AZM D;  4M6B A;  2G5I C;  1M19 A;  4J8X B;  5CPJ A;  5AV6 B;  2JSS A;  4YM6 B;  5AV9 D;  3MGQ A;  1KX5 B;  5BT1 C;  4JJN A;  4ZUX D;  5B32 G;  3LZ0 D;  3UT9 D;  5B0Y C;  3WTP D;  3REK C;  1H3O A;  4H9S C;  5GT0 B;  2ARO B;  5BO0 B;  5CP6 D;  3AZN C;  5FUG A;  4NE6 A;  2Y2K A;  2FJ7 B;  4XUJ D;  3H0R C;  4HGA B;  3MVD B;  5E5A D;  3X1V D;  3X1T B;  2J8P A;  3FDD A;  1P3O D;  3KXB C;  2F8N K;  4ZUX A;  4KGC B;  3UT9 A;  4J8X A;  2RIQ A;  1S32 D;  4R8P D;  2ZY2 A;  1EQZ C;  4CAY A;  3AV1 B;  4KGC D;  5AV5 D;  4EO5 C;  3H0M C;  3R45 B;  5B40 D;  5AVB D;  1M19 C;  1ID3 C;  5CPJ C;  5GT0 A;  3B6F C;  2ARO A;  5BO0 A;  1P3K D;  3MGQ C;  1P3O A;  4KUD D;  4JJN C;  2FJ7 A;  5GXQ B;  5BNV B;  5F99 D;  1S32 A;  4R8P A;  3REL D;  3AFA C;  1KX4 D;  3AZM C;  4KHA B;  5DNN D;  5AV5 A;  5B24 D;  3A6N B;  3AV2 B;  4KGC A;  5B40 A;  1P3L D;  4UUZ B;  3AV2 D;  4ZUX C;  3LZ0 C;  3UT9 C;  3WTP C;  1U35 B;  3R45 A;  3EG5 B;  3VH5 W;  2NQB B;  3AZF D;  3LEL D;  5B2J B;  5CP6 C;  1KX3 D;  4H9N A;  3W98 B;  2Y2P A;  5DNN A;  1P3I B;  2HIO B;  3X1U B;  4XUJ C;  5BNV A;  5B32 D;  5B2J D;  3X1V C;  2W8S A;  3VH5 A;  1P3O C;  4G91 C;  3AV2 A;  3A6N A;  5GT3 D;  3AYW D;  3AN2 D;  3LEL A;  3VH6 A;  5CHL B;  4E44 A;  1S32 C;  3WAA D;  4R8P C;  1PZR A;  4UUZ A;  4KGC C;  5AV5 C;  1U35 A;  3AZN B;  1TAF B;  2NQB A;  5AVB C;  5B40 C;  4H9Q A;  5B2J A;  1WWI A;  2L5A A;  3W98 A;  4WU8 D;  4KUD C;  2YFW B;  1P3I A;  2HIO A;  3AYW A;  3KXB B;  5F99 C;  3AN2 A;  5GSU D;  3WAA A;  2HUE C;  2Y2H A;  3REL C;  3W99 D;  1KX4 C;  5DNN C;  5B24 C;  3IP4 C;  1BFM A;  1P3L C;  1BH9 A;  4EO5 B;  1M19 B;  3W96 D;  1ID3 B;  3B6F B;  3AV2 C;  3A6N C;  3AZN A;  3MGQ B;  4JJN B;  1ULY A;  4Z5T D;  5GSU A;  3AZF C;  3LEL C;  3F6T A;  2CV5 D;  1ZLA D;  3O62 D;  1H3O B;  3UTB D;  3W99 A;  2YFW A;  3KXB A;  3AFA B;  2RVQ D;  3AZM B;  5BNX B;  1P3B B;  5DNM D;  5B2J C;  5B1L D;  3W96 A;  4XZQ D;  1P3A D;  1KU5 A;  5GT3 C;  5AV9 B;  3AYW C;  3MGS D;  1P34 D;  4ZUX B;  1P3B D;  4Z5T A;  5B33 D;  3LZ0 B;  2YFV B;  3WAA C;  3WTP B;  3EPK A;  3UT9 B;  3AN2 C;  1ID3 A;  2F8N G;  3B6F A;  4YS3 D;  1P3F D;  5CP6 B;  3MGR B;  4CAY B;  1P3P C;  3AZK B;  5CPI D;  5DNM A;  3WA9 D;  4XUJ B;  5B1L A;  5E5A B;  3AZL D;  4XZQ A;  3B0D C;  1B6W A;  3X1V B;  2Y2N A;  4WU8 C;  3MGR D;  3AFA A;  1P3O B;  1P34 A;  3AZM A;  4G91 B;  5BNX A;  1P3B A;  3AZK D;  5B33 A;  5GSU C;  4G92 C;  4J8U B;  3W99 C;  1P3F A;  1S32 B;  5AV9 A;  4R8P B;  2NZD D;  3LZ0 A;  5AV5 B;  2YFV A;  3WTP A;  4J8U D;  5B40 B;  5AVB B;  3KSY A;  3W96 C;  3AZL A;  5CP6 A;  3MGR A;  1P3K B;  3V9R B;  1P3P B;  4KUD B;  3AZK A;  4Z5T C;  2CV5 C;  4XUJ A;  1ZLA C;  5E5A A;  3O62 C;  4H9O B;  2LY8 A;  5F99 B;  3X1V A;  3UTB C;  2HUE B;  1P3P D;  3NQU B;  1TZY D;  3REL B;  3AZI D;  4H9N B;  1KX4 B;  2DQN C;  2RVQ C;  5DNN B;  5B24 B;  5DNM C;  4J8U A;  5B1L C;  1P3L B;  4XZQ C;  1P3A C;  5C3I C;  4LD9 D;  5BS7 A;  3A1I A;  5B0Z D;  2VQR A;  3WTP E;  1P34 C;  4X23 D;  3AZJ D;  1P3B C;  5B33 C;  1AOI D;  5AVB A;  1M1A D;  3AZF B;  4YS3 C;  3LEL B;  3REI D;  1P3F C;  2Y2L A;  1P3K A;  3V9R A;  1TZY A;  5AV9 C;  3AZI A;  1P3P A;  4KUD A;  5B31 G;  1M18 B;  5G49 A;  5CPI C;  3WA9 C;  4H9O A;  5B32 B;  5F99 A;  4H9Q B;  3AZL C;  2FFF B;  3NQU A;  3REL A;  2F8N D;  3MGR C;  2PYO D;  1KX4 A;  5B0Z A;  4X23 A;  1M18 D;  5B24 A;  2IO5 C;  5GT3 B;  3AZK C;  3AZG D;  3AYW B;  1AOI A;  5E5A C;  5KDM A;  1P3L A;  3AN2 B;  4Z2M G;  3WAA B;  1T3U A;  2NZD C;  3REJ D;  4J8U C;  1BH8 B;  3KUY D;  3AZF A;  1F66 D;  1BH9 B;  3AZH D;  2PYO A;  3AZE D;  5BS7 C;  3B0D B;  3C1B B;  4WU8 B;  2UWX A;  1M18 A;  5AY8 D;  1N1J B;  2Y2Q A;  4WV4 B;  4Z66 D;  5B32 A;  5AV8 B;  5GSU B;  4G92 B;  1P3K C;  3C1B D;  1TZY C;  2JCH A;  3AZI C;  3W99 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...