1U35C

Crystal structure of the nucleosome core particle containing the histone domain of macroh2a
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
KTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAVNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of the histone variant macroH2A.
pubmed doi rcsb
molecule keywords alpha-satellite DNA
molecule tags Structural protein/dna
source organism Homo sapiens
total genus 28
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1u35C00
4WU8D 3C1CC 1P3GD 3MGQD 1AOIB 5AY8B 2NZDC 5CP6D 5AV8C 2NQBA 5CPIA 5GXQA 5AV5C 3REHD 5B33A 1P3BC 4R8PA 2L5AA 4H9OA 4QLCB 2YFVB 3AZHA 1ZLAA 3AZGC 3A6ND 4G92C 5AV8B 3REJC 3V9RA 1P3GA 5B24D 3MGQA 4Z66D 5B2IB 5AV5B 1HTAA 3WA9C 1P3BB 3W99A 4J8UD 3AZGB 3REJB 3WAAD 3KWQC 3REHA 5B2JB 5BNXB 5B1LC 3VH5W 3AZJC 3A6NA 3WA9B 5GT0B 2YFWB 2AROD 4KGCC 4Z66A 4Z2MH 4J8VA 3KWQB 5FUGB 4KUDB 4CSRB 4J8UA 4XZQB 1M19C 2CWEA 5AVCB 3AN2A 5CPJB 3WAAA 5F99D 1TAFB 1KX5B 5B0ZC 1P3AD 2F8NH 3UT9D 5AVBC 2AROA 3KUYC 3REKD 3WKJB 3AZKC 2BYMB 3B6FD 5F99A 3VH5A 3C1CD 1P3AA 2NQBC 3B0CW 1Q9CA 2RVQD 5CPIC 3UT9A 5GXQC 3AFAB 3AZKB 2CV5A 5DNMB 5B33C 4ZBJB 4R8PC 4X23A 1P3MB 2HIOA 3AZHC 1ZLAC 3W97D 3LZ0D 3KSYA 4WU8C 1P3GC 5DNND 3B0DC 5GXQB 3MGQC 3B6FA 5CP6C 5BO0A 4XUJB 3W99C 4AWLC 4H9OB 4WU9B 3VH6W 5KDMB 3WTPA 3AZHB 1F66D 2LY8A 5G49A 3REHC 1KX3B 3V9RB 4G91B 4WU8B 1P3GB 1B6WA 5CP6B 3A6NC 3MNND 3W97A 4AWLB 3AZJD 3RELD 5B24C 5DNNA 1HQ3D 4Z66C 4J8VC 3AYWD 3AV2A 5GT3D 4YS3B 4J8UC 2IO5C 1A7WA 3AN2C 1F66A 3WAAC 4E45A 4HGAB 5B24B 4Z66B 4J8XD 3X1VD 3MNNA 1P34A 3RELA 2AROC 3C1BD 1HQ3A 3LELB 3WAAB 3AYWA 3VH6A 5GT3A 1S32D 3KUYD 5F99C 1P3AC 1JFIB 4J8XA 5AV9D 3UT9C 1BH8A 3X1VA 5GSUB 3MGPB 4UUZA 2CV5C 4H9PB 3C1BA 4X23C 2JSSA 5F99B 5B33D 2HIOC 3AZMA 3NQUA 1S32A 3AV1D 5B32G 3LJAD 3UT9B 3B6FC 3MVDA 2F8NK 3X1UD 2RVQC 5AV9A 3TU4D 3REKB 3WTPC 4LD9B 5B31G 3W99D 1M18A 1N1JB 5BNVA 3B6FB 3AZEB 1B67A 3C1CB 3X1TA 3W97C 2NZDB 3AV1A 3LZ0C 3LJAA 5DNNC 5E5AA 5G49B 3X1UA 3AV2C 4NE6A 3TU4A 4J8VD 4H9NA 1F66C 4KHAA 4Z5TD 3LZ0B 5B1MD 5AV6D 3AN2D 3KXBD 3W96A 4G92B 5DNNB 1U35D 3MNNC 1P34C 3RELC 2F8NB 1HQ3C 4H9RA 5JA4B 4JJND 1F66B 3AYWC 5GT3C 2FJ7D 2PYOD 5B1LB 1M1AD 4Z5TA 5B1MA 5AV6A 3RELB 3KXBA 3UTBA 3NQJA 4ZUXD 3AZJB 1HQ3B 4J8XC 1U35A 3X1VC 3AZIA 1R4VA 4KGCB 5GT3B 3C1BC 4JJNA 2CV5D 1M19B 5B31A 1BFMA 3AZMC 2FJ7A 4X23D 1S32C 2HIOD 1BH8B 2PYOA 5B0ZB 1M1AA 3MVDC 5B0YD 4ZUXA 5AVBB 5AV9C 3AZFD 4WV4B 1P3KD 3KUYB 1M18C 3WTPD 4Z2MG 4YM6D 4H9QA 3X1TC 3REIA 3AV1C 3LZ1D 3LJAC 1P3ID 1P3OD 2NQBB 5E5AC 2BYKA 5CPIB 3X1UC 5CHLB 5B0YA 1KU5A 3TU4C 3AZFA 5B33B 1P3KA 4R8PB 3AV2D 1EQZD 3AV1B 1ZLAB 3LJAB 4YM6A 4NFTA 4QLCD 3B0DB 3MGQB 3LZ1A 1P3IA 4CAYA 1P3OA 1P34D 5B40D 1ID3D 1AOIA 3W99B 4KHAB 5B2ID 3REHB 1EQZA 4Z5TC 1P3LD 5B1MC 5AV6C 3UTBC 3KXBC 3A6NB 5B2JD 4QLCA 1U35C 2YFVA 3WTPE 5JRGD 4NE3A 5GT0D 5BT1D 4J8VB 4JJNC 5B40A 1ID3A 4J8UB 2IO5B 5B2IA 5B31C 4Z5TB 5B1MB 5AV6B 3AN2B 2FJ7C 3B6GD 4KUDD 3W98D 4XZQD 3AZMD 3AZLD 2PYOC 5AVCD 1M1AC 5CPJD 1P3LA 1KX5D 4ZUXC 5B2JA 4JJNB 3MVDD 4WNNA 2AROB 5JRGA 2FJ7B 5GT0A 4DRBA 3B0BA 2PYOB 1H3OA 1M18D 4EO5C 5CPKD 5FUGA 3B6GA 4ZUXB 3WKJD 3W98A 3REIC 4KUDA 4XZQA 3AZLA 5AVCA 1P3AB 3X1TD 4WZSB 5CPJA 1TAFA 5B0YC 1KX5A 5E5AD 2CV5B 3AZFC 1P3KC 4EO5B 4X23B 3AFAD 5DNMD 2HIOB 4YM6C 5CPKA 2BYKB 5C3IC 5B0YB 3W96D 3WKJA 3LZ1C 1P3IC 1P3OC 5BO0B 1P3KB 3WTPB 4XUJD 1WWIA 4YM6B 3AZND 1EQZC 3AFAA 5DNMA 3LZ1B 1P3IB 1P3OB 1KX3D 3W97B 3R45A 1P3MA 3VH5T 4QLCC 3UTBD 3O62D 5B32D 3AZID 1ULYA 1ID3C 5B40C 3AV2B 1BH9A 1EQZB 5B2IC 4XUJA 3AZNA 4YS3D 5B31D 4WU9A 5KDMA 1P3LC 4J8WD 1KX3A 3MNNB 5B2JC 4WU8A 5B40B 1P34B 1ID3B 3O62A 5CP6A 5JRGC 5B32A 5GT0C 5BT1C 3UTAD 3AYWB 1TZYD 3LELD 1P3LB 3B6GC 4KUDC 4YS3A 3W98C 4XZQC 3AZLC 5AVCC 1KX4D 4WNNB 5JRGB 3REID 3MGRD 5CPJC 4J8WA 4J8XB 3X1VB 1KX5C 4UUZB 5B24A 3B0CT 3X1SD 3MGSD 1H3OB 3C1BB 5GSUD 3MGPD 1P3PD 3B6GB 3UTAA 3W98B 3AZMB 1TZYA 3AZLB 3NQUB 3LELA 1S32B 1P3FD 5CPKC 3WKJC 3MVDB 4E44A 4H9SA 1KX4A 3MGRA 5AV9B 1AOID 3X1SA 3MGSA 5AY8D 1JFIA 2F8NG 1M18B 5BS7A 3VH6T 5CPKB 5BNVB 5GSUA 3MGPA 1P3PA 4LD9D 3AFAC 4H9PA 5DNMC 4ZBJC 3X1TB 1P3FA 1P3MC 3AZED 3W96C 2NZDD 5E5AB 3X1UB 5AV8D 3TU4B 4H9NB 4XUJC 5AY8A 3AZNC 1WWSA 4WU9C 3R45B 5AV5D 3REKA 1P3BD 4LD9A 3W96B 1N1JA 1KX3C 4G91C 3AZGD 2HUEC 3REJD 1BH9B 3AZEA 3O62C 5B32C 4H9RB 3C1CA 2NZDA 3AZNB 3AZIC 5AV8A 3WA9D 2F8ND 1F1EA 4YS3C 2HUEB 5AV5A 3KWQD 3UTBB 1P3BA 3KXBB 3O62B 3NQJB 5B32B 4J8WC 5B1LD 3LZ0A 4HGAC 1U35B 3AZIB 3AZGA 3REJA 5BNXA 3UTAC 4NE5A 4KGCD 5B31B 1TZYC 3WA9A 2F8NA 5JA4A 3LELC 2YFWA 4J8WB 1M19D 1M1AB 3KWQA 4H9SC 1KX4C 5B0ZD 4CSRA 3MGRC 5B1LA 3UTAB 3AZJA 1TZYB 3MGSC 3X1SC 5AVBD 5BS7C 5GSUC 3MGPC 1P3PC 4H9QB 4KGCA 1KX4B 1P3FC 3AZKD 3REIB 3MGRB 4M6BA 1M19A 3X1SB 3MGSB 1P3MD 5B0ZA 2NQBD 1P3PB 3AZFB 2BYMA 5CPID 1AOIC 5GXQD 4DRAA 5AY8C 5AVBA 1P3FB 3REKC 4LD9C 4R8PD 4WU9D 3KUYA 5C3IB 3AZHD 1ZLAD 3AZKA 3AZEC 4CAYB
chains in the Genus database with same CATH superfamily
4WU8D 3C1CC 1P3GD 3MGQD 1AOIB 5AY8B 2NZDC 5CP6D 5AV8C 2NQBA 3KFUG 5CPIA 5GXQA 5AV5C 3REHD 5B33A 1P3BC 4R8PA 2L5AA 4H9OA 4QLCB 2YFVB 3AZHA 1ZLAA 3AZGC 3A6ND 4G92C 5AV8B 3REJC 2XD5A 3V9RA 1P3GA 5B24D 2Y2NA 3MGQA 4Z66D 5B2IB 5AV5B 1HTAA 3WA9C 1P3BB 3W99A 4J8UD 3AZGB 3REJB 3WAAD 3KWQC 3REHA 5B2JB 3F6TA 5BNXB 5B1LC 3VH5W 3AZJC 3A6NA 3WA9B 5GT0B 2ZY3A 2YFWB 2AROD 4KGCC 4Z66A 4Z2MH 3EPLA 3KWQB 4J8VA 5FUGB 4KUDB 4CSRB 4J8UA 4XZQB 1M19C 2CWEA 5AVCB 3AN2A 5CPJB 3WAAA 5F99D 1TAFB 1KX5B 5B0ZC 1P3AD 2F8NH 3UT9D 2J8PA 5AVBC 2AROA 3KUYC 3REKD 2XD1A 3WKJB 3AZKC 2DQNC 2BYMB 3B6FD 3H0LC 5F99A 3VH5A 3C1CD 1P3AA 2NQBC 3B0CW 1Q9CA 2RVQD 5CPIC 3UT9A 5GXQC 3AFAB 3AZKB 2CV5A 5DNMB 5B33C 4ZBJB 4R8PC 4X23A 1P3MB 2HIOA 3AZHC 1ZLAC 3W97D 3LZ0D 3KSYA 4WU8C 1P3GC 5DNND 3B0DC 5GXQB 3MGQC 3B6FA 2ZM5A 2BG1A 5CP6C 3A1KA 5BO0A 4XUJB 3W99C 4AWLC 4H9OB 4WU9B 3VH6W 5KDMB 3WTPA 3AZHB 1F66D 2LY8A 3EG5B 5G49A 3REHC 1KX3B 3V9RB 4G91B 4WU8B 1P3GB 1B6WA 5CP6B 3A6NC 3MNND 3W97A 4AWLB 3AZJD 3RELD 5B24C 5DNNA 1HQ3D 1Z2CB 4Z66C 4J8VC 3AYWD 3AV2A 5GT3D 4YS3B 4J8UC 2IO5C 1A7WA 3AN2C 1F66A 3WAAC 4E45A 4HGAB 5B24B 4Z66B 4J8XD 3X1VD 3MNNA 1P34A 3RELA 2AROC 3C1BD 1HQ3A 3LELB 3WAAB 3AYWA 3VH6A 5GT3A 1S32D 3KUYD 2Y2IA 5F99C 1P3AC 1JFIB 4J8XA 2Y2QA 5AV9D 1BH8A 3UT9C 2RIQA 3X1VA 5GSUB 3A1IA 4UUZA 4UPKA 3MGPB 2CV5C 4H9PB 3C1BA 4X23C 2JSSA 5F99B 5B33D 2HIOC 3AZMA 3NQUA 1S32A 3AV1D 5B32G 3LJAD 3UT9B 3B6FC 3MVDA 2F8NK 3X1UD 2RVQC 2JE5A 5AV9A 3TU4D 3REKB 3WTPC 4LD9B 5B31G 3W99D 3EPKA 1M18A 1N1JB 5BNVA 3B6FB 3AZEB 1B67A 3C1CB 3X1TA 3W97C 2NZDB 3AV1A 3LZ0C 3LJAA 5DNNC 5E5AA 2Y2HA 2Y2PA 5G49B 3X1UA 3AV2C 4NE6A 3TU4A 2Y2GA 4J8VD 4H9NA 1F66C 4KHAA 4Z5TD 3LZ0B 4WJ3C 5B1MD 5AV6D 3AN2D 3KXBD 3W96A 4G92B 5DNNB 2Y2LA 1U35D 3MNNC 1P34C 3RELC 2F8NB 1HQ3C 4H9RA 5JA4B 4JJND 1F66B 3AYWC 5GT3C 2FJ7D 2PYOD 5B1LB 1M1AD 4Z5TA 5B1MA 5AV6A 3RELB 3KXBA 3UTBA 3NQJA 4ZUXD 3AZJB 1HQ3B 4J8XC 1U35A 2F2AC 3X1VC 3AZIA 1R4VA 4KGCB 5GT3B 2ZY2A 2Y2KA 3C1BC 4JJNA 2CV5D 1M19B 5B31A 1BFMA 3AZMC 2FJ7A 4X23D 1S32C 2HIOD 1BH8B 2PYOA 5B0ZB 1M1AA 3MVDC 5B0YD 4ZUXA 5AVBB 5AV9C 3AZFD 4WV4B 1P3KD 3KUYB 1M18C 3WTPD 4Z2MG 4YM6D 4H9QA 2Y2MA 3X1TC 3REIA 3AV1C 3LZ1D 3LJAC 1P3ID 1P3OD 2NQBB 5E5AC 2BYKA 5CPIB 3X1UC 5CHLB 5B0YA 1KU5A 3TU4C 3AZFA 5B33B 1P3KA 4R8PB 3AV2D 1EQZD 3AV1B 1ZLAB 3LJAB 4YM6A 4NFTA 4QLCD 3B0DB 3MGQB 3LZ1A 1P3IA 4CAYA 1P3OA 1P34D 5B40D 1ID3D 1AOIA 3W99B 4KHAB 5B2ID 3REHB 1EQZA 4Z5TC 1P3LD 5B1MC 5AV6C 3UTBC 3KXBC 3A6NB 5B2JD 2Y2OA 4QLCA 1U35C 2YFVA 3WTPE 5JRGD 4NE3A 5GT0D 5BT1D 4J8VB 4JJNC 5B40A 1ID3A 4J8UB 2VQRA 2IO5B 5B2IA 5B31C 4Z5TB 5B1MB 5AV6B 3AN2B 2FJ7C 3B6GD 4KUDD 3W98D 4XZQD 3AZMD 3AZLD 2PYOC 5AVCD 1M1AC 5CPJD 1P3LA 1KX5D 4ZUXC 5B2JA 4JJNB 3MVDD 4WNNA 2AROB 5JRGA 4DQYB 2FJ7B 5GT0A 4DRBA 3B0BA 2PYOB 1H3OA 1M18D 4EO5C 5CPKD 5FUGA 3B6GA 4ZUXB 3WKJD 3W98A 3REIC 4KUDA 4XZQA 3AZLA 5AVCA 1P3AB 3X1TD 4WZSB 5CPJA 2JCHA 1TAFA 5B0YC 1KX5A 5E5AD 2CV5B 3AZFC 1P3KC 4EO5B 3AL0C 4X23B 3AFAD 5DNMD 2HIOB 4YM6C 5CPKA 1T3UA 2BYKB 5C3IC 5B0YB 3W96D 3WKJA 3LZ1C 1P3IC 1P3OC 5BO0B 1P3KB 3WTPB 4XUJD 1WWIA 4YM6B 3AZND 1EQZC 3AFAA 5DNMA 3LZ1B 1P3IB 1PZRA 1P3OB 3P5JB 1KX3D 3W97B 3R45A 1P3MA 3VH5T 4QLCC 3UTBD 3O62D 5B32D 3AZID 1ULYA 1ID3C 5B40C 3AV2B 1BH9A 1EQZB 5B2IC 4XUJA 3AZNA 4YS3D 5B31D 4WU9A 3EPHA 5KDMA 1P3LC 4J8WD 1KX3A 3MNNB 5B2JC 4WU8A 2DF4C 5B40B 1P34B 1ID3B 3O62A 5CP6A 5JRGC 5B32A 5GT0C 5BT1C 3UTAD 3AYWB 1TZYD 3LELD 1P3LB 3B6GC 4KUDC 4YS3A 3W98C 4XZQC 3AZLC 5AVCC 1KX4D 4WNNB 5JRGB 3REID 3MGRD 5CPJC 4J8WA 4J8XB 3X1VB 1KX5C 4UUZB 5B24A 3B0CT 3X1SD 3MGSD 1H3OB 3C1BB 5GSUD 3MGPD 1P3PD 3B6GB 3UTAA 3W98B 2ZY4A 3AZMB 1TZYA 3AZLB 3NQUB 3FDDA 3LELA 1S32B 1P3FD 5CPKC 2ZY5A 3WKJC 3MVDB 2UWXA 4H9SA 4E44A 1KX4A 2G5IC 3MGRA 5AV9B 1AOID 3X1SA 3MGSA 5AY8D 1JFIA 2F8NG 1M18B 5BS7A 3VH6T 5CPKB 5BNVB 5GSUA 3MGPA 1P3PA 4LD9D 3AFAC 2FFFB 4H9PA 5DNMC 3IP4C 4ZBJC 3X1TB 1P3FA 1P3MC 3AZED 3W96C 2NZDD 5E5AB 3X1UB 5AV8D 3TU4B 4H9NB 4XUJC 5AY8A 3AZNC 1WWSA 4WU9C 3R45B 5AV5D 3REKA 3EPJA 1P3BD 4LD9A 3W96B 1N1JA 1KX3C 4G91C 3AZGD 2HUEC 3REJD 1BH9B 2W8SA 3AZEA 3O62C 1W2EA 5B32C 4H9RB 3C1CA 2NZDA 3AZNB 3AZIC 5AV8A 3WA9D 2F8ND 1F1EA 3H0MC 4YS3C 2HUEB 5AV5A 3KWQD 3UTBB 1P3BA 3KXBB 3O62B 3NQJB 5B32B 4J8WC 5B1LD 3LZ0A 4HGAC 1U35B 3AZIB 3AZGA 3REJA 5BNXA 3UTAC 4NE5A 4KGCD 5B31B 1TZYC 3WA9A 3H0RC 2F8NA 5JA4A 3LELC 2YFWA 4J8WB 1M19D 1M1AB 3KWQA 4H9SC 1KX4C 5B0ZD 4CSRA 3MGRC 5B1LA 3UTAB 3AZJA 1TZYB 3MGSC 3X1SC 5AVBD 5BS7C 5GSUC 3MGPC 1P3PC 4H9QB 4KGCA 1KX4B 2Y2JA 1P3FC 3AZKD 3REIB 3MGRB 4M6BA 1M19A 3X1SB 3MGSB 1P3MD 5B0ZA 2NQBD 1P3PB 3AZFB 2BYMA 5CPID 1AOIC 5GXQD 4DRAA 5AY8C 5AVBA 1P3FB 3REKC 4LD9C 4R8PD 4WU9D 3KUYA 5C3IB 3AZHD 2G5HC 1ZLAD 3AZKA 3AZEC 4CAYB
chains in the Genus database with same CATH topology
4WU8D 3C1CC 1P3GD 3MGQD 1AOIB 5AY8B 2NZDC 5CP6D 5AV8C 2NQBA 3KFUG 5CPIA 5GXQA 5AV5C 3REHD 5B33A 1P3BC 4R8PA 2L5AA 4H9OA 4QLCB 2YFVB 3AZHA 1ZLAA 3AZGC 3A6ND 4G92C 5AV8B 3REJC 2XD5A 3V9RA 1P3GA 5B24D 2Y2NA 3MGQA 4Z66D 5B2IB 5AV5B 1HTAA 3WA9C 1P3BB 3W99A 4J8UD 3AZGB 3REJB 3WAAD 3KWQC 3REHA 5B2JB 3F6TA 5BNXB 5B1LC 3VH5W 3AZJC 3A6NA 3WA9B 5GT0B 2ZY3A 2YFWB 2AROD 4KGCC 4Z66A 4Z2MH 3EPLA 3KWQB 4J8VA 5FUGB 4KUDB 4CSRB 4J8UA 4XZQB 1M19C 2CWEA 5AVCB 3AN2A 5CPJB 3WAAA 5F99D 1TAFB 1KX5B 5B0ZC 1P3AD 2F8NH 3UT9D 2J8PA 5AVBC 2AROA 3KUYC 3REKD 2XD1A 3WKJB 3AZKC 2DQNC 2BYMB 3B6FD 3H0LC 5F99A 3VH5A 3C1CD 1P3AA 2NQBC 3B0CW 1Q9CA 2RVQD 5CPIC 3UT9A 5GXQC 3AFAB 3AZKB 2CV5A 5DNMB 5B33C 4ZBJB 4R8PC 4X23A 1P3MB 2HIOA 3AZHC 1ZLAC 3W97D 3LZ0D 3KSYA 4WU8C 1P3GC 5DNND 3B0DC 5GXQB 3MGQC 3B6FA 2ZM5A 2BG1A 5CP6C 3A1KA 5BO0A 4XUJB 3W99C 4AWLC 4H9OB 4WU9B 3VH6W 5KDMB 3WTPA 3AZHB 1F66D 2LY8A 3EG5B 5G49A 3REHC 1KX3B 3V9RB 4G91B 4WU8B 1P3GB 1B6WA 5CP6B 3A6NC 3MNND 3W97A 4AWLB 3AZJD 3RELD 5B24C 5DNNA 1HQ3D 1Z2CB 4Z66C 4J8VC 3AYWD 3AV2A 5GT3D 4YS3B 4J8UC 2IO5C 1A7WA 3AN2C 1F66A 3WAAC 4E45A 4HGAB 5B24B 4Z66B 4J8XD 3X1VD 3MNNA 1P34A 3RELA 2AROC 3C1BD 1HQ3A 3LELB 3WAAB 3AYWA 3VH6A 5GT3A 1S32D 3KUYD 2Y2IA 5F99C 1P3AC 1JFIB 4J8XA 2Y2QA 5AV9D 1BH8A 3UT9C 2RIQA 3X1VA 5GSUB 3A1IA 4UUZA 4UPKA 3MGPB 2CV5C 4H9PB 3C1BA 4X23C 2JSSA 5F99B 5B33D 2HIOC 3AZMA 3NQUA 1S32A 3AV1D 5B32G 3LJAD 3UT9B 3B6FC 3MVDA 2F8NK 3X1UD 2RVQC 2JE5A 5AV9A 3TU4D 3REKB 3WTPC 4LD9B 5B31G 3W99D 3EPKA 1M18A 1N1JB 5BNVA 3B6FB 3AZEB 1B67A 3C1CB 3X1TA 3W97C 2NZDB 3AV1A 3LZ0C 3LJAA 5DNNC 5E5AA 2Y2HA 2Y2PA 5G49B 3X1UA 3AV2C 4NE6A 3TU4A 2Y2GA 4J8VD 4H9NA 1F66C 4KHAA 4Z5TD 3LZ0B 4WJ3C 5B1MD 5AV6D 3AN2D 3KXBD 3W96A 4G92B 5DNNB 2Y2LA 1U35D 3MNNC 1P34C 3RELC 2F8NB 1HQ3C 4H9RA 5JA4B 4JJND 1F66B 3AYWC 5GT3C 2FJ7D 2PYOD 5B1LB 1M1AD 4Z5TA 5B1MA 5AV6A 3RELB 3KXBA 3UTBA 3NQJA 4ZUXD 3AZJB 1HQ3B 4J8XC 1U35A 2F2AC 3X1VC 3AZIA 1R4VA 4KGCB 5GT3B 2ZY2A 2Y2KA 3C1BC 4JJNA 2CV5D 1M19B 5B31A 1BFMA 3AZMC 2FJ7A 4X23D 1S32C 2HIOD 1BH8B 2PYOA 5B0ZB 1M1AA 3MVDC 5B0YD 4ZUXA 5AVBB 5AV9C 3AZFD 4WV4B 1P3KD 3KUYB 1M18C 3WTPD 4Z2MG 4YM6D 4H9QA 2Y2MA 3X1TC 3REIA 3AV1C 3LZ1D 3LJAC 1P3ID 1P3OD 2NQBB 5E5AC 2BYKA 5CPIB 3X1UC 5CHLB 5B0YA 1KU5A 3TU4C 3AZFA 5B33B 1P3KA 4R8PB 3AV2D 1EQZD 3AV1B 1ZLAB 3LJAB 4YM6A 4NFTA 4QLCD 3B0DB 3MGQB 3LZ1A 1P3IA 4CAYA 1P3OA 1P34D 5B40D 1ID3D 1AOIA 3W99B 4KHAB 5B2ID 3REHB 1EQZA 4Z5TC 1P3LD 5B1MC 5AV6C 3UTBC 3KXBC 3A6NB 5B2JD 2Y2OA 4QLCA 1U35C 2YFVA 3WTPE 5JRGD 4NE3A 5GT0D 5BT1D 4J8VB 4JJNC 5B40A 1ID3A 4J8UB 2VQRA 2IO5B 5B2IA 5B31C 4Z5TB 5B1MB 5AV6B 3AN2B 2FJ7C 3B6GD 4KUDD 3W98D 4XZQD 3AZMD 3AZLD 2PYOC 5AVCD 1M1AC 5CPJD 1P3LA 1KX5D 4ZUXC 5B2JA 4JJNB 3MVDD 4WNNA 2AROB 5JRGA 4DQYB 2FJ7B 5GT0A 4DRBA 3B0BA 2PYOB 1H3OA 1M18D 4EO5C 5CPKD 5FUGA 3B6GA 4ZUXB 3WKJD 3W98A 3REIC 4KUDA 4XZQA 3AZLA 5AVCA 1P3AB 3X1TD 4WZSB 5CPJA 2JCHA 1TAFA 5B0YC 1KX5A 5E5AD 2CV5B 3AZFC 1P3KC 4EO5B 3AL0C 4X23B 3AFAD 5DNMD 2HIOB 4YM6C 5CPKA 1T3UA 2BYKB 5C3IC 5B0YB 3W96D 3WKJA 3LZ1C 1P3IC 1P3OC 5BO0B 1P3KB 3WTPB 4XUJD 1WWIA 4YM6B 3AZND 1EQZC 3AFAA 5DNMA 3LZ1B 1P3IB 1PZRA 1P3OB 3P5JB 1KX3D 3W97B 3R45A 1P3MA 3VH5T 4QLCC 3UTBD 3O62D 5B32D 3AZID 1ULYA 1ID3C 5B40C 3AV2B 1BH9A 1EQZB 5B2IC 4XUJA 3AZNA 4YS3D 5B31D 4WU9A 3EPHA 5KDMA 1P3LC 4J8WD 1KX3A 3MNNB 5B2JC 4WU8A 2DF4C 5B40B 1P34B 1ID3B 3O62A 5CP6A 5JRGC 5B32A 5GT0C 5BT1C 3UTAD 3AYWB 1TZYD 3LELD 1P3LB 3B6GC 4KUDC 4YS3A 3W98C 4XZQC 3AZLC 5AVCC 1KX4D 4WNNB 5JRGB 3REID 3MGRD 5CPJC 4J8WA 4J8XB 3X1VB 1KX5C 4UUZB 5B24A 3B0CT 3X1SD 3MGSD 1H3OB 3C1BB 5GSUD 3MGPD 1P3PD 3B6GB 3UTAA 3W98B 2ZY4A 3AZMB 1TZYA 3AZLB 3NQUB 3FDDA 3LELA 1S32B 1P3FD 5CPKC 2ZY5A 3WKJC 3MVDB 2UWXA 4H9SA 4E44A 1KX4A 2G5IC 3MGRA 5AV9B 1AOID 3X1SA 3MGSA 5AY8D 1JFIA 2F8NG 1M18B 5BS7A 3VH6T 5CPKB 5BNVB 5GSUA 3MGPA 1P3PA 4LD9D 3AFAC 2FFFB 4H9PA 5DNMC 3IP4C 4ZBJC 3X1TB 1P3FA 1P3MC 3AZED 3W96C 2NZDD 5E5AB 3X1UB 5AV8D 3TU4B 4H9NB 4XUJC 5AY8A 3AZNC 1WWSA 4WU9C 3R45B 5AV5D 3REKA 3EPJA 1P3BD 4LD9A 3W96B 1N1JA 1KX3C 4G91C 3AZGD 2HUEC 3REJD 1BH9B 2W8SA 3AZEA 3O62C 1W2EA 5B32C 4H9RB 3C1CA 2NZDA 3AZNB 3AZIC 5AV8A 3WA9D 2F8ND 1F1EA 3H0MC 4YS3C 2HUEB 5AV5A 3KWQD 3UTBB 1P3BA 3KXBB 3O62B 3NQJB 5B32B 4J8WC 5B1LD 3LZ0A 4HGAC 1U35B 3AZIB 3AZGA 3REJA 5BNXA 3UTAC 4NE5A 4KGCD 5B31B 1TZYC 3WA9A 3H0RC 2F8NA 5JA4A 3LELC 2YFWA 4J8WB 1M19D 1M1AB 3KWQA 4H9SC 1KX4C 5B0ZD 4CSRA 3MGRC 5B1LA 3UTAB 3AZJA 1TZYB 3MGSC 3X1SC 5AVBD 5BS7C 5GSUC 3MGPC 1P3PC 4H9QB 4KGCA 1KX4B 2Y2JA 1P3FC 3AZKD 3REIB 3MGRB 4M6BA 1M19A 3X1SB 3MGSB 1P3MD 5B0ZA 2NQBD 1P3PB 3AZFB 2BYMA 5CPID 1AOIC 5GXQD 4DRAA 5AY8C 5AVBA 1P3FB 3REKC 4LD9C 4R8PD 4WU9D 3KUYA 5C3IB 3AZHD 2G5HC 1ZLAD 3AZKA 3AZEC 4CAYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WU8 D;  3C1C C;  1P3G D;  3MGQ D;  1AOI B;  5AY8 B;  2NZD C;  5CP6 D;  5AV8 C;  2NQB A;  5CPI A;  5GXQ A;  5AV5 C;  3REH D;  5B33 A;  1P3B C;  4R8P A;  2L5A A;  4H9O A;  4QLC B;  2YFV B;  3AZH A;  1ZLA A;  3AZG C;  3A6N D;  4G92 C;  5AV8 B;  3REJ C;  3V9R A;  1P3G A;  5B24 D;  3MGQ A;  4Z66 D;  5B2I B;  5AV5 B;  1HTA A;  3WA9 C;  1P3B B;  3W99 A;  4J8U D;  3AZG B;  3REJ B;  3WAA D;  3KWQ C;  3REH A;  5B2J B;  5BNX B;  5B1L C;  3VH5 W;  3AZJ C;  3A6N A;  3WA9 B;  5GT0 B;  2YFW B;  2ARO D;  4KGC C;  4Z66 A;  4Z2M H;  4J8V A;  3KWQ B;  5FUG B;  4KUD B;  4CSR B;  4J8U A;  4XZQ B;  1M19 C;  2CWE A;  5AVC B;  3AN2 A;  5CPJ B;  3WAA A;  5F99 D;  1TAF B;  1KX5 B;  5B0Z C;  1P3A D;  2F8N H;  3UT9 D;  5AVB C;  2ARO A;  3KUY C;  3REK D;  3WKJ B;  3AZK C;  2BYM B;  3B6F D;  5F99 A;  3VH5 A;  3C1C D;  1P3A A;  2NQB C;  3B0C W;  1Q9C A;  2RVQ D;  5CPI C;  3UT9 A;  5GXQ C;  3AFA B;  3AZK B;  2CV5 A;  5DNM B;  5B33 C;  4ZBJ B;  4R8P C;  4X23 A;  1P3M B;  2HIO A;  3AZH C;  1ZLA C;  3W97 D;  3LZ0 D;  3KSY A;  4WU8 C;  1P3G C;  5DNN D;  3B0D C;  5GXQ B;  3MGQ C;  3B6F A;  5CP6 C;  5BO0 A;  4XUJ B;  3W99 C;  4AWL C;  4H9O B;  4WU9 B;  3VH6 W;  5KDM B;  3WTP A;  3AZH B;  1F66 D;  2LY8 A;  5G49 A;  3REH C;  1KX3 B;  3V9R B;  4G91 B;  4WU8 B;  1P3G B;  1B6W A;  5CP6 B;  3A6N C;  3MNN D;  3W97 A;  4AWL B;  3AZJ D;  3REL D;  5B24 C;  5DNN A;  1HQ3 D;  4Z66 C;  4J8V C;  3AYW D;  3AV2 A;  5GT3 D;  4YS3 B;  4J8U C;  2IO5 C;  1A7W A;  3AN2 C;  1F66 A;  3WAA C;  4E45 A;  4HGA B;  5B24 B;  4Z66 B;  4J8X D;  3X1V D;  3MNN A;  1P34 A;  3REL A;  2ARO C;  3C1B D;  1HQ3 A;  3LEL B;  3WAA B;  3AYW A;  3VH6 A;  5GT3 A;  1S32 D;  3KUY D;  5F99 C;  1P3A C;  1JFI B;  4J8X A;  5AV9 D;  3UT9 C;  1BH8 A;  3X1V A;  5GSU B;  3MGP B;  4UUZ A;  2CV5 C;  4H9P B;  3C1B A;  4X23 C;  2JSS A;  5F99 B;  5B33 D;  2HIO C;  3AZM A;  3NQU A;  1S32 A;  3AV1 D;  5B32 G;  3LJA D;  3UT9 B;  3B6F C;  3MVD A;  2F8N K;  3X1U D;  2RVQ C;  5AV9 A;  3TU4 D;  3REK B;  3WTP C;  4LD9 B;  5B31 G;  3W99 D;  1M18 A;  1N1J B;  5BNV A;  3B6F B;  3AZE B;  1B67 A;  3C1C B;  3X1T A;  3W97 C;  2NZD B;  3AV1 A;  3LZ0 C;  3LJA A;  5DNN C;  5E5A A;  5G49 B;  3X1U A;  3AV2 C;  4NE6 A;  3TU4 A;  4J8V D;  4H9N A;  1F66 C;  4KHA A;  4Z5T D;  3LZ0 B;  5B1M D;  5AV6 D;  3AN2 D;  3KXB D;  3W96 A;  4G92 B;  5DNN B;  1U35 D;  3MNN C;  1P34 C;  3REL C;  2F8N B;  1HQ3 C;  4H9R A;  5JA4 B;  4JJN D;  1F66 B;  3AYW C;  5GT3 C;  2FJ7 D;  2PYO D;  5B1L B;  1M1A D;  4Z5T A;  5B1M A;  5AV6 A;  3REL B;  3KXB A;  3UTB A;  3NQJ A;  4ZUX D;  3AZJ B;  1HQ3 B;  4J8X C;  1U35 A;  3X1V C;  3AZI A;  1R4V A;  4KGC B;  5GT3 B;  3C1B C;  4JJN A;  2CV5 D;  1M19 B;  5B31 A;  1BFM A;  3AZM C;  2FJ7 A;  4X23 D;  1S32 C;  2HIO D;  1BH8 B;  2PYO A;  5B0Z B;  1M1A A;  3MVD C;  5B0Y D;  4ZUX A;  5AVB B;  5AV9 C;  3AZF D;  4WV4 B;  1P3K D;  3KUY B;  1M18 C;  3WTP D;  4Z2M G;  4YM6 D;  4H9Q A;  3X1T C;  3REI A;  3AV1 C;  3LZ1 D;  3LJA C;  1P3I D;  1P3O D;  2NQB B;  5E5A C;  2BYK A;  5CPI B;  3X1U C;  5CHL B;  5B0Y A;  1KU5 A;  3TU4 C;  3AZF A;  5B33 B;  1P3K A;  4R8P B;  3AV2 D;  1EQZ D;  3AV1 B;  1ZLA B;  3LJA B;  4YM6 A;  4NFT A;  4QLC D;  3B0D B;  3MGQ B;  3LZ1 A;  1P3I A;  4CAY A;  1P3O A;  1P34 D;  5B40 D;  1ID3 D;  1AOI A;  3W99 B;  4KHA B;  5B2I D;  3REH B;  1EQZ A;  4Z5T C;  1P3L D;  5B1M C;  5AV6 C;  3UTB C;  3KXB C;  3A6N B;  5B2J D;  4QLC A;  1U35 C;  2YFV A;  3WTP E;  5JRG D;  4NE3 A;  5GT0 D;  5BT1 D;  4J8V B;  4JJN C;  5B40 A;  1ID3 A;  4J8U B;  2IO5 B;  5B2I A;  5B31 C;  4Z5T B;  5B1M B;  5AV6 B;  3AN2 B;  2FJ7 C;  3B6G D;  4KUD D;  3W98 D;  4XZQ D;  3AZM D;  3AZL D;  2PYO C;  5AVC D;  1M1A C;  5CPJ D;  1P3L A;  1KX5 D;  4ZUX C;  5B2J A;  4JJN B;  3MVD D;  4WNN A;  2ARO B;  5JRG A;  2FJ7 B;  5GT0 A;  4DRB A;  3B0B A;  2PYO B;  1H3O A;  1M18 D;  4EO5 C;  5CPK D;  5FUG A;  3B6G A;  4ZUX B;  3WKJ D;  3W98 A;  3REI C;  4KUD A;  4XZQ A;  3AZL A;  5AVC A;  1P3A B;  3X1T D;  4WZS B;  5CPJ A;  1TAF A;  5B0Y C;  1KX5 A;  5E5A D;  2CV5 B;  3AZF C;  1P3K C;  4EO5 B;  4X23 B;  3AFA D;  5DNM D;  2HIO B;  4YM6 C;  5CPK A;  2BYK B;  5C3I C;  5B0Y B;  3W96 D;  3WKJ A;  3LZ1 C;  1P3I C;  1P3O C;  5BO0 B;  1P3K B;  3WTP B;  4XUJ D;  1WWI A;  4YM6 B;  3AZN D;  1EQZ C;  3AFA A;  5DNM A;  3LZ1 B;  1P3I B;  1P3O B;  1KX3 D;  3W97 B;  3R45 A;  1P3M A;  3VH5 T;  4QLC C;  3UTB D;  3O62 D;  5B32 D;  3AZI D;  1ULY A;  1ID3 C;  5B40 C;  3AV2 B;  1BH9 A;  1EQZ B;  5B2I C;  4XUJ A;  3AZN A;  4YS3 D;  5B31 D;  4WU9 A;  5KDM A;  1P3L C;  4J8W D;  1KX3 A;  3MNN B;  5B2J C;  4WU8 A;  5B40 B;  1P34 B;  1ID3 B;  3O62 A;  5CP6 A;  5JRG C;  5B32 A;  5GT0 C;  5BT1 C;  3UTA D;  3AYW B;  1TZY D;  3LEL D;  1P3L B;  3B6G C;  4KUD C;  4YS3 A;  3W98 C;  4XZQ C;  3AZL C;  5AVC C;  1KX4 D;  4WNN B;  5JRG B;  3REI D;  3MGR D;  5CPJ C;  4J8W A;  4J8X B;  3X1V B;  1KX5 C;  4UUZ B;  5B24 A;  3B0C T;  3X1S D;  3MGS D;  1H3O B;  3C1B B;  5GSU D;  3MGP D;  1P3P D;  3B6G B;  3UTA A;  3W98 B;  3AZM B;  1TZY A;  3AZL B;  3NQU B;  3LEL A;  1S32 B;  1P3F D;  5CPK C;  3WKJ C;  3MVD B;  4E44 A;  4H9S A;  1KX4 A;  3MGR A;  5AV9 B;  1AOI D;  3X1S A;  3MGS A;  5AY8 D;  1JFI A;  2F8N G;  1M18 B;  5BS7 A;  3VH6 T;  5CPK B;  5BNV B;  5GSU A;  3MGP A;  1P3P A;  4LD9 D;  3AFA C;  4H9P A;  5DNM C;  4ZBJ C;  3X1T B;  1P3F A;  1P3M C;  3AZE D;  3W96 C;  2NZD D;  5E5A B;  3X1U B;  5AV8 D;  3TU4 B;  4H9N B;  4XUJ C;  5AY8 A;  3AZN C;  1WWS A;  4WU9 C;  3R45 B;  5AV5 D;  3REK A;  1P3B D;  4LD9 A;  3W96 B;  1N1J A;  1KX3 C;  4G91 C;  3AZG D;  2HUE C;  3REJ D;  1BH9 B;  3AZE A;  3O62 C;  5B32 C;  4H9R B;  3C1C A;  2NZD A;  3AZN B;  3AZI C;  5AV8 A;  3WA9 D;  2F8N D;  1F1E A;  4YS3 C;  2HUE B;  5AV5 A;  3KWQ D;  3UTB B;  1P3B A;  3KXB B;  3O62 B;  3NQJ B;  5B32 B;  4J8W C;  5B1L D;  3LZ0 A;  4HGA C;  1U35 B;  3AZI B;  3AZG A;  3REJ A;  5BNX A;  3UTA C;  4NE5 A;  4KGC D;  5B31 B;  1TZY C;  3WA9 A;  2F8N A;  5JA4 A;  3LEL C;  2YFW A;  4J8W B;  1M19 D;  1M1A B;  3KWQ A;  4H9S C;  1KX4 C;  5B0Z D;  4CSR A;  3MGR C;  5B1L A;  3UTA B;  3AZJ A;  1TZY B;  3MGS C;  3X1S C;  5AVB D;  5BS7 C;  5GSU C;  3MGP C;  1P3P C;  4H9Q B;  4KGC A;  1KX4 B;  1P3F C;  3AZK D;  3REI B;  3MGR B;  4M6B A;  1M19 A;  3X1S B;  3MGS B;  1P3M D;  5B0Z A;  2NQB D;  1P3P B;  3AZF B;  2BYM A;  5CPI D;  1AOI C;  5GXQ D;  4DRA A;  5AY8 C;  5AVB A;  1P3F B;  3REK C;  4LD9 C;  4R8P D;  4WU9 D;  3KUY A;  5C3I B;  3AZH D;  1ZLA D;  3AZK A;  3AZE C;  4CAY B; 
#chains in the Genus database with same CATH topology
 4WU8 D;  3C1C C;  1P3G D;  3MGQ D;  1AOI B;  5AY8 B;  2NZD C;  5CP6 D;  5AV8 C;  2NQB A;  3KFU G;  5CPI A;  5GXQ A;  5AV5 C;  3REH D;  5B33 A;  1P3B C;  4R8P A;  2L5A A;  4H9O A;  4QLC B;  2YFV B;  3AZH A;  1ZLA A;  3AZG C;  3A6N D;  4G92 C;  5AV8 B;  3REJ C;  2XD5 A;  3V9R A;  1P3G A;  5B24 D;  2Y2N A;  3MGQ A;  4Z66 D;  5B2I B;  5AV5 B;  1HTA A;  3WA9 C;  1P3B B;  3W99 A;  4J8U D;  3AZG B;  3REJ B;  3WAA D;  3KWQ C;  3REH A;  5B2J B;  3F6T A;  5BNX B;  5B1L C;  3VH5 W;  3AZJ C;  3A6N A;  3WA9 B;  5GT0 B;  2ZY3 A;  2YFW B;  2ARO D;  4KGC C;  4Z66 A;  4Z2M H;  3EPL A;  3KWQ B;  4J8V A;  5FUG B;  4KUD B;  4CSR B;  4J8U A;  4XZQ B;  1M19 C;  2CWE A;  5AVC B;  3AN2 A;  5CPJ B;  3WAA A;  5F99 D;  1TAF B;  1KX5 B;  5B0Z C;  1P3A D;  2F8N H;  3UT9 D;  2J8P A;  5AVB C;  2ARO A;  3KUY C;  3REK D;  2XD1 A;  3WKJ B;  3AZK C;  2DQN C;  2BYM B;  3B6F D;  3H0L C;  5F99 A;  3VH5 A;  3C1C D;  1P3A A;  2NQB C;  3B0C W;  1Q9C A;  2RVQ D;  5CPI C;  3UT9 A;  5GXQ C;  3AFA B;  3AZK B;  2CV5 A;  5DNM B;  5B33 C;  4ZBJ B;  4R8P C;  4X23 A;  1P3M B;  2HIO A;  3AZH C;  1ZLA C;  3W97 D;  3LZ0 D;  3KSY A;  4WU8 C;  1P3G C;  5DNN D;  3B0D C;  5GXQ B;  3MGQ C;  3B6F A;  2ZM5 A;  2BG1 A;  5CP6 C;  3A1K A;  5BO0 A;  4XUJ B;  3W99 C;  4AWL C;  4H9O B;  4WU9 B;  3VH6 W;  5KDM B;  3WTP A;  3AZH B;  1F66 D;  2LY8 A;  3EG5 B;  5G49 A;  3REH C;  1KX3 B;  3V9R B;  4G91 B;  4WU8 B;  1P3G B;  1B6W A;  5CP6 B;  3A6N C;  3MNN D;  3W97 A;  4AWL B;  3AZJ D;  3REL D;  5B24 C;  5DNN A;  1HQ3 D;  1Z2C B;  4Z66 C;  4J8V C;  3AYW D;  3AV2 A;  5GT3 D;  4YS3 B;  4J8U C;  2IO5 C;  1A7W A;  3AN2 C;  1F66 A;  3WAA C;  4E45 A;  4HGA B;  5B24 B;  4Z66 B;  4J8X D;  3X1V D;  3MNN A;  1P34 A;  3REL A;  2ARO C;  3C1B D;  1HQ3 A;  3LEL B;  3WAA B;  3AYW A;  3VH6 A;  5GT3 A;  1S32 D;  3KUY D;  2Y2I A;  5F99 C;  1P3A C;  1JFI B;  4J8X A;  2Y2Q A;  5AV9 D;  1BH8 A;  3UT9 C;  2RIQ A;  3X1V A;  5GSU B;  3A1I A;  4UUZ A;  4UPK A;  3MGP B;  2CV5 C;  4H9P B;  3C1B A;  4X23 C;  2JSS A;  5F99 B;  5B33 D;  2HIO C;  3AZM A;  3NQU A;  1S32 A;  3AV1 D;  5B32 G;  3LJA D;  3UT9 B;  3B6F C;  3MVD A;  2F8N K;  3X1U D;  2RVQ C;  2JE5 A;  5AV9 A;  3TU4 D;  3REK B;  3WTP C;  4LD9 B;  5B31 G;  3W99 D;  3EPK A;  1M18 A;  1N1J B;  5BNV A;  3B6F B;  3AZE B;  1B67 A;  3C1C B;  3X1T A;  3W97 C;  2NZD B;  3AV1 A;  3LZ0 C;  3LJA A;  5DNN C;  5E5A A;  2Y2H A;  2Y2P A;  5G49 B;  3X1U A;  3AV2 C;  4NE6 A;  3TU4 A;  2Y2G A;  4J8V D;  4H9N A;  1F66 C;  4KHA A;  4Z5T D;  3LZ0 B;  4WJ3 C;  5B1M D;  5AV6 D;  3AN2 D;  3KXB D;  3W96 A;  4G92 B;  5DNN B;  2Y2L A;  1U35 D;  3MNN C;  1P34 C;  3REL C;  2F8N B;  1HQ3 C;  4H9R A;  5JA4 B;  4JJN D;  1F66 B;  3AYW C;  5GT3 C;  2FJ7 D;  2PYO D;  5B1L B;  1M1A D;  4Z5T A;  5B1M A;  5AV6 A;  3REL B;  3KXB A;  3UTB A;  3NQJ A;  4ZUX D;  3AZJ B;  1HQ3 B;  4J8X C;  1U35 A;  2F2A C;  3X1V C;  3AZI A;  1R4V A;  4KGC B;  5GT3 B;  2ZY2 A;  2Y2K A;  3C1B C;  4JJN A;  2CV5 D;  1M19 B;  5B31 A;  1BFM A;  3AZM C;  2FJ7 A;  4X23 D;  1S32 C;  2HIO D;  1BH8 B;  2PYO A;  5B0Z B;  1M1A A;  3MVD C;  5B0Y D;  4ZUX A;  5AVB B;  5AV9 C;  3AZF D;  4WV4 B;  1P3K D;  3KUY B;  1M18 C;  3WTP D;  4Z2M G;  4YM6 D;  4H9Q A;  2Y2M A;  3X1T C;  3REI A;  3AV1 C;  3LZ1 D;  3LJA C;  1P3I D;  1P3O D;  2NQB B;  5E5A C;  2BYK A;  5CPI B;  3X1U C;  5CHL B;  5B0Y A;  1KU5 A;  3TU4 C;  3AZF A;  5B33 B;  1P3K A;  4R8P B;  3AV2 D;  1EQZ D;  3AV1 B;  1ZLA B;  3LJA B;  4YM6 A;  4NFT A;  4QLC D;  3B0D B;  3MGQ B;  3LZ1 A;  1P3I A;  4CAY A;  1P3O A;  1P34 D;  5B40 D;  1ID3 D;  1AOI A;  3W99 B;  4KHA B;  5B2I D;  3REH B;  1EQZ A;  4Z5T C;  1P3L D;  5B1M C;  5AV6 C;  3UTB C;  3KXB C;  3A6N B;  5B2J D;  2Y2O A;  4QLC A;  1U35 C;  2YFV A;  3WTP E;  5JRG D;  4NE3 A;  5GT0 D;  5BT1 D;  4J8V B;  4JJN C;  5B40 A;  1ID3 A;  4J8U B;  2VQR A;  2IO5 B;  5B2I A;  5B31 C;  4Z5T B;  5B1M B;  5AV6 B;  3AN2 B;  2FJ7 C;  3B6G D;  4KUD D;  3W98 D;  4XZQ D;  3AZM D;  3AZL D;  2PYO C;  5AVC D;  1M1A C;  5CPJ D;  1P3L A;  1KX5 D;  4ZUX C;  5B2J A;  4JJN B;  3MVD D;  4WNN A;  2ARO B;  5JRG A;  4DQY B;  2FJ7 B;  5GT0 A;  4DRB A;  3B0B A;  2PYO B;  1H3O A;  1M18 D;  4EO5 C;  5CPK D;  5FUG A;  3B6G A;  4ZUX B;  3WKJ D;  3W98 A;  3REI C;  4KUD A;  4XZQ A;  3AZL A;  5AVC A;  1P3A B;  3X1T D;  4WZS B;  5CPJ A;  2JCH A;  1TAF A;  5B0Y C;  1KX5 A;  5E5A D;  2CV5 B;  3AZF C;  1P3K C;  4EO5 B;  3AL0 C;  4X23 B;  3AFA D;  5DNM D;  2HIO B;  4YM6 C;  5CPK A;  1T3U A;  2BYK B;  5C3I C;  5B0Y B;  3W96 D;  3WKJ A;  3LZ1 C;  1P3I C;  1P3O C;  5BO0 B;  1P3K B;  3WTP B;  4XUJ D;  1WWI A;  4YM6 B;  3AZN D;  1EQZ C;  3AFA A;  5DNM A;  3LZ1 B;  1P3I B;  1PZR A;  1P3O B;  3P5J B;  1KX3 D;  3W97 B;  3R45 A;  1P3M A;  3VH5 T;  4QLC C;  3UTB D;  3O62 D;  5B32 D;  3AZI D;  1ULY A;  1ID3 C;  5B40 C;  3AV2 B;  1BH9 A;  1EQZ B;  5B2I C;  4XUJ A;  3AZN A;  4YS3 D;  5B31 D;  4WU9 A;  3EPH A;  5KDM A;  1P3L C;  4J8W D;  1KX3 A;  3MNN B;  5B2J C;  4WU8 A;  2DF4 C;  5B40 B;  1P34 B;  1ID3 B;  3O62 A;  5CP6 A;  5JRG C;  5B32 A;  5GT0 C;  5BT1 C;  3UTA D;  3AYW B;  1TZY D;  3LEL D;  1P3L B;  3B6G C;  4KUD C;  4YS3 A;  3W98 C;  4XZQ C;  3AZL C;  5AVC C;  1KX4 D;  4WNN B;  5JRG B;  3REI D;  3MGR D;  5CPJ C;  4J8W A;  4J8X B;  3X1V B;  1KX5 C;  4UUZ B;  5B24 A;  3B0C T;  3X1S D;  3MGS D;  1H3O B;  3C1B B;  5GSU D;  3MGP D;  1P3P D;  3B6G B;  3UTA A;  3W98 B;  2ZY4 A;  3AZM B;  1TZY A;  3AZL B;  3NQU B;  3FDD A;  3LEL A;  1S32 B;  1P3F D;  5CPK C;  2ZY5 A;  3WKJ C;  3MVD B;  2UWX A;  4H9S A;  4E44 A;  1KX4 A;  2G5I C;  3MGR A;  5AV9 B;  1AOI D;  3X1S A;  3MGS A;  5AY8 D;  1JFI A;  2F8N G;  1M18 B;  5BS7 A;  3VH6 T;  5CPK B;  5BNV B;  5GSU A;  3MGP A;  1P3P A;  4LD9 D;  3AFA C;  2FFF B;  4H9P A;  5DNM C;  3IP4 C;  4ZBJ C;  3X1T B;  1P3F A;  1P3M C;  3AZE D;  3W96 C;  2NZD D;  5E5A B;  3X1U B;  5AV8 D;  3TU4 B;  4H9N B;  4XUJ C;  5AY8 A;  3AZN C;  1WWS A;  4WU9 C;  3R45 B;  5AV5 D;  3REK A;  3EPJ A;  1P3B D;  4LD9 A;  3W96 B;  1N1J A;  1KX3 C;  4G91 C;  3AZG D;  2HUE C;  3REJ D;  1BH9 B;  2W8S A;  3AZE A;  3O62 C;  1W2E A;  5B32 C;  4H9R B;  3C1C A;  2NZD A;  3AZN B;  3AZI C;  5AV8 A;  3WA9 D;  2F8N D;  1F1E A;  3H0M C;  4YS3 C;  2HUE B;  5AV5 A;  3KWQ D;  3UTB B;  1P3B A;  3KXB B;  3O62 B;  3NQJ B;  5B32 B;  4J8W C;  5B1L D;  3LZ0 A;  4HGA C;  1U35 B;  3AZI B;  3AZG A;  3REJ A;  5BNX A;  3UTA C;  4NE5 A;  4KGC D;  5B31 B;  1TZY C;  3WA9 A;  3H0R C;  2F8N A;  5JA4 A;  3LEL C;  2YFW A;  4J8W B;  1M19 D;  1M1A B;  3KWQ A;  4H9S C;  1KX4 C;  5B0Z D;  4CSR A;  3MGR C;  5B1L A;  3UTA B;  3AZJ A;  1TZY B;  3MGS C;  3X1S C;  5AVB D;  5BS7 C;  5GSU C;  3MGP C;  1P3P C;  4H9Q B;  4KGC A;  1KX4 B;  2Y2J A;  1P3F C;  3AZK D;  3REI B;  3MGR B;  4M6B A;  1M19 A;  3X1S B;  3MGS B;  1P3M D;  5B0Z A;  2NQB D;  1P3P B;  3AZF B;  2BYM A;  5CPI D;  1AOI C;  5GXQ D;  4DRA A;  5AY8 C;  5AVB A;  1P3F B;  3REK C;  4LD9 C;  4R8P D;  4WU9 D;  3KUY A;  5C3I B;  3AZH D;  2G5H C;  1ZLA D;  3AZK A;  3AZE C;  4CAY B; 
#chains in the Genus database with same CATH homology
 4WU8 D;  3C1C C;  1P3G D;  3MGQ D;  1AOI B;  5AY8 B;  2NZD C;  5CP6 D;  5AV8 C;  2NQB A;  3KFU G;  5CPI A;  5GXQ A;  5AV5 C;  3REH D;  5B33 A;  1P3B C;  4R8P A;  2L5A A;  4H9O A;  4QLC B;  2YFV B;  3AZH A;  1ZLA A;  3AZG C;  3A6N D;  4G92 C;  5AV8 B;  3REJ C;  2XD5 A;  3V9R A;  1P3G A;  5B24 D;  2Y2N A;  3MGQ A;  4Z66 D;  5B2I B;  5AV5 B;  1HTA A;  3WA9 C;  1P3B B;  3W99 A;  4J8U D;  3AZG B;  3REJ B;  3WAA D;  3KWQ C;  3REH A;  5B2J B;  3F6T A;  5BNX B;  5B1L C;  3VH5 W;  3AZJ C;  3A6N A;  3WA9 B;  5GT0 B;  2ZY3 A;  2YFW B;  2ARO D;  4KGC C;  4Z66 A;  4Z2M H;  3EPL A;  3KWQ B;  4J8V A;  5FUG B;  4KUD B;  4CSR B;  4J8U A;  4XZQ B;  1M19 C;  2CWE A;  5AVC B;  3AN2 A;  5CPJ B;  3WAA A;  5F99 D;  1TAF B;  1KX5 B;  5B0Z C;  1P3A D;  2F8N H;  3UT9 D;  2J8P A;  5AVB C;  2ARO A;  3KUY C;  3REK D;  2XD1 A;  3WKJ B;  3AZK C;  2DQN C;  2BYM B;  3B6F D;  3H0L C;  5F99 A;  3VH5 A;  3C1C D;  1P3A A;  2NQB C;  3B0C W;  1Q9C A;  2RVQ D;  5CPI C;  3UT9 A;  5GXQ C;  3AFA B;  3AZK B;  2CV5 A;  5DNM B;  5B33 C;  4ZBJ B;  4R8P C;  4X23 A;  1P3M B;  2HIO A;  3AZH C;  1ZLA C;  3W97 D;  3LZ0 D;  3KSY A;  4WU8 C;  1P3G C;  5DNN D;  3B0D C;  5GXQ B;  3MGQ C;  3B6F A;  2ZM5 A;  2BG1 A;  5CP6 C;  3A1K A;  5BO0 A;  4XUJ B;  3W99 C;  4AWL C;  4H9O B;  4WU9 B;  3VH6 W;  5KDM B;  3WTP A;  3AZH B;  1F66 D;  2LY8 A;  3EG5 B;  5G49 A;  3REH C;  1KX3 B;  3V9R B;  4G91 B;  4WU8 B;  1P3G B;  1B6W A;  5CP6 B;  3A6N C;  3MNN D;  3W97 A;  4AWL B;  3AZJ D;  3REL D;  5B24 C;  5DNN A;  1HQ3 D;  1Z2C B;  4Z66 C;  4J8V C;  3AYW D;  3AV2 A;  5GT3 D;  4YS3 B;  4J8U C;  2IO5 C;  1A7W A;  3AN2 C;  1F66 A;  3WAA C;  4E45 A;  4HGA B;  5B24 B;  4Z66 B;  4J8X D;  3X1V D;  3MNN A;  1P34 A;  3REL A;  2ARO C;  3C1B D;  1HQ3 A;  3LEL B;  3WAA B;  3AYW A;  3VH6 A;  5GT3 A;  1S32 D;  3KUY D;  2Y2I A;  5F99 C;  1P3A C;  1JFI B;  4J8X A;  2Y2Q A;  5AV9 D;  1BH8 A;  3UT9 C;  2RIQ A;  3X1V A;  5GSU B;  3A1I A;  4UUZ A;  4UPK A;  3MGP B;  2CV5 C;  4H9P B;  3C1B A;  4X23 C;  2JSS A;  5F99 B;  5B33 D;  2HIO C;  3AZM A;  3NQU A;  1S32 A;  3AV1 D;  5B32 G;  3LJA D;  3UT9 B;  3B6F C;  3MVD A;  2F8N K;  3X1U D;  2RVQ C;  2JE5 A;  5AV9 A;  3TU4 D;  3REK B;  3WTP C;  4LD9 B;  5B31 G;  3W99 D;  3EPK A;  1M18 A;  1N1J B;  5BNV A;  3B6F B;  3AZE B;  1B67 A;  3C1C B;  3X1T A;  3W97 C;  2NZD B;  3AV1 A;  3LZ0 C;  3LJA A;  5DNN C;  5E5A A;  2Y2H A;  2Y2P A;  5G49 B;  3X1U A;  3AV2 C;  4NE6 A;  3TU4 A;  2Y2G A;  4J8V D;  4H9N A;  1F66 C;  4KHA A;  4Z5T D;  3LZ0 B;  4WJ3 C;  5B1M D;  5AV6 D;  3AN2 D;  3KXB D;  3W96 A;  4G92 B;  5DNN B;  2Y2L A;  1U35 D;  3MNN C;  1P34 C;  3REL C;  2F8N B;  1HQ3 C;  4H9R A;  5JA4 B;  4JJN D;  1F66 B;  3AYW C;  5GT3 C;  2FJ7 D;  2PYO D;  5B1L B;  1M1A D;  4Z5T A;  5B1M A;  5AV6 A;  3REL B;  3KXB A;  3UTB A;  3NQJ A;  4ZUX D;  3AZJ B;  1HQ3 B;  4J8X C;  1U35 A;  2F2A C;  3X1V C;  3AZI A;  1R4V A;  4KGC B;  5GT3 B;  2ZY2 A;  2Y2K A;  3C1B C;  4JJN A;  2CV5 D;  1M19 B;  5B31 A;  1BFM A;  3AZM C;  2FJ7 A;  4X23 D;  1S32 C;  2HIO D;  1BH8 B;  2PYO A;  5B0Z B;  1M1A A;  3MVD C;  5B0Y D;  4ZUX A;  5AVB B;  5AV9 C;  3AZF D;  4WV4 B;  1P3K D;  3KUY B;  1M18 C;  3WTP D;  4Z2M G;  4YM6 D;  4H9Q A;  2Y2M A;  3X1T C;  3REI A;  3AV1 C;  3LZ1 D;  3LJA C;  1P3I D;  1P3O D;  2NQB B;  5E5A C;  2BYK A;  5CPI B;  3X1U C;  5CHL B;  5B0Y A;  1KU5 A;  3TU4 C;  3AZF A;  5B33 B;  1P3K A;  4R8P B;  3AV2 D;  1EQZ D;  3AV1 B;  1ZLA B;  3LJA B;  4YM6 A;  4NFT A;  4QLC D;  3B0D B;  3MGQ B;  3LZ1 A;  1P3I A;  4CAY A;  1P3O A;  1P34 D;  5B40 D;  1ID3 D;  1AOI A;  3W99 B;  4KHA B;  5B2I D;  3REH B;  1EQZ A;  4Z5T C;  1P3L D;  5B1M C;  5AV6 C;  3UTB C;  3KXB C;  3A6N B;  5B2J D;  2Y2O A;  4QLC A;  1U35 C;  2YFV A;  3WTP E;  5JRG D;  4NE3 A;  5GT0 D;  5BT1 D;  4J8V B;  4JJN C;  5B40 A;  1ID3 A;  4J8U B;  2VQR A;  2IO5 B;  5B2I A;  5B31 C;  4Z5T B;  5B1M B;  5AV6 B;  3AN2 B;  2FJ7 C;  3B6G D;  4KUD D;  3W98 D;  4XZQ D;  3AZM D;  3AZL D;  2PYO C;  5AVC D;  1M1A C;  5CPJ D;  1P3L A;  1KX5 D;  4ZUX C;  5B2J A;  4JJN B;  3MVD D;  4WNN A;  2ARO B;  5JRG A;  4DQY B;  2FJ7 B;  5GT0 A;  4DRB A;  3B0B A;  2PYO B;  1H3O A;  1M18 D;  4EO5 C;  5CPK D;  5FUG A;  3B6G A;  4ZUX B;  3WKJ D;  3W98 A;  3REI C;  4KUD A;  4XZQ A;  3AZL A;  5AVC A;  1P3A B;  3X1T D;  4WZS B;  5CPJ A;  2JCH A;  1TAF A;  5B0Y C;  1KX5 A;  5E5A D;  2CV5 B;  3AZF C;  1P3K C;  4EO5 B;  3AL0 C;  4X23 B;  3AFA D;  5DNM D;  2HIO B;  4YM6 C;  5CPK A;  1T3U A;  2BYK B;  5C3I C;  5B0Y B;  3W96 D;  3WKJ A;  3LZ1 C;  1P3I C;  1P3O C;  5BO0 B;  1P3K B;  3WTP B;  4XUJ D;  1WWI A;  4YM6 B;  3AZN D;  1EQZ C;  3AFA A;  5DNM A;  3LZ1 B;  1P3I B;  1PZR A;  1P3O B;  3P5J B;  1KX3 D;  3W97 B;  3R45 A;  1P3M A;  3VH5 T;  4QLC C;  3UTB D;  3O62 D;  5B32 D;  3AZI D;  1ULY A;  1ID3 C;  5B40 C;  3AV2 B;  1BH9 A;  1EQZ B;  5B2I C;  4XUJ A;  3AZN A;  4YS3 D;  5B31 D;  4WU9 A;  3EPH A;  5KDM A;  1P3L C;  4J8W D;  1KX3 A;  3MNN B;  5B2J C;  4WU8 A;  2DF4 C;  5B40 B;  1P34 B;  1ID3 B;  3O62 A;  5CP6 A;  5JRG C;  5B32 A;  5GT0 C;  5BT1 C;  3UTA D;  3AYW B;  1TZY D;  3LEL D;  1P3L B;  3B6G C;  4KUD C;  4YS3 A;  3W98 C;  4XZQ C;  3AZL C;  5AVC C;  1KX4 D;  4WNN B;  5JRG B;  3REI D;  3MGR D;  5CPJ C;  4J8W A;  4J8X B;  3X1V B;  1KX5 C;  4UUZ B;  5B24 A;  3B0C T;  3X1S D;  3MGS D;  1H3O B;  3C1B B;  5GSU D;  3MGP D;  1P3P D;  3B6G B;  3UTA A;  3W98 B;  2ZY4 A;  3AZM B;  1TZY A;  3AZL B;  3NQU B;  3FDD A;  3LEL A;  1S32 B;  1P3F D;  5CPK C;  2ZY5 A;  3WKJ C;  3MVD B;  2UWX A;  4H9S A;  4E44 A;  1KX4 A;  2G5I C;  3MGR A;  5AV9 B;  1AOI D;  3X1S A;  3MGS A;  5AY8 D;  1JFI A;  2F8N G;  1M18 B;  5BS7 A;  3VH6 T;  5CPK B;  5BNV B;  5GSU A;  3MGP A;  1P3P A;  4LD9 D;  3AFA C;  2FFF B;  4H9P A;  5DNM C;  3IP4 C;  4ZBJ C;  3X1T B;  1P3F A;  1P3M C;  3AZE D;  3W96 C;  2NZD D;  5E5A B;  3X1U B;  5AV8 D;  3TU4 B;  4H9N B;  4XUJ C;  5AY8 A;  3AZN C;  1WWS A;  4WU9 C;  3R45 B;  5AV5 D;  3REK A;  3EPJ A;  1P3B D;  4LD9 A;  3W96 B;  1N1J A;  1KX3 C;  4G91 C;  3AZG D;  2HUE C;  3REJ D;  1BH9 B;  2W8S A;  3AZE A;  3O62 C;  1W2E A;  5B32 C;  4H9R B;  3C1C A;  2NZD A;  3AZN B;  3AZI C;  5AV8 A;  3WA9 D;  2F8N D;  1F1E A;  3H0M C;  4YS3 C;  2HUE B;  5AV5 A;  3KWQ D;  3UTB B;  1P3B A;  3KXB B;  3O62 B;  3NQJ B;  5B32 B;  4J8W C;  5B1L D;  3LZ0 A;  4HGA C;  1U35 B;  3AZI B;  3AZG A;  3REJ A;  5BNX A;  3UTA C;  4NE5 A;  4KGC D;  5B31 B;  1TZY C;  3WA9 A;  3H0R C;  2F8N A;  5JA4 A;  3LEL C;  2YFW A;  4J8W B;  1M19 D;  1M1A B;  3KWQ A;  4H9S C;  1KX4 C;  5B0Z D;  4CSR A;  3MGR C;  5B1L A;  3UTA B;  3AZJ A;  1TZY B;  3MGS C;  3X1S C;  5AVB D;  5BS7 C;  5GSU C;  3MGP C;  1P3P C;  4H9Q B;  4KGC A;  1KX4 B;  2Y2J A;  1P3F C;  3AZK D;  3REI B;  3MGR B;  4M6B A;  1M19 A;  3X1S B;  3MGS B;  1P3M D;  5B0Z A;  2NQB D;  1P3P B;  3AZF B;  2BYM A;  5CPI D;  1AOI C;  5GXQ D;  4DRA A;  5AY8 C;  5AVB A;  1P3F B;  3REK C;  4LD9 C;  4R8P D;  4WU9 D;  3KUY A;  5C3I B;  3AZH D;  2G5H C;  1ZLA D;  3AZK A;  3AZE C;  4CAY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...