1U3EM

Dna binding and cleavage by the hnh homing endonuclease i-hmui
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
174
Chain Sequence
MEWKDIKGYEGHYQVSNTGEVYSIKSGKTLKHQIPKDGYHRIGLFKGGKGKTFQVHRLVAIHFCEGYEEGLVVDHKDGNKDNNLSTNLRWVTQKINVENQMSRGTLNVSKAQQIAKIKNQKPIIVISPDGIEKEYPSTKCACEELGLTRGKVTDVLKGHRIHHKGYTFRYKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Binding and Cleavage by the HNH Homing Endonuclease I-HmuI.
pubmed doi rcsb
source organism Bacillus phage spo1
molecule tags Dna binding protein/dna
molecule keywords 36-MER
total genus 43
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF07463 NUMOD4 NUMOD4 motif
M PF13392 HNH_3 HNH endonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u3eM02
3.90.75.20 Alpha Beta Alpha-Beta Complex Homing Intron 3 (I-Ppo) Encoded Endonuclease; Chain A Homing Intron 3 (I-Ppo) Encoded Endonuclease; Chain A 1u3eM01
2CSOA 1X3UA 4KN7X 2UXXA 1TQIA 2QWWA 4NQWA 4EJOA 2HDCA 2FSWA 2IA1A 2L4AA 3QP6A 3I59B 3CUOA 1JXSA 2ZMEB 5BS6A 4ENJA 2QZ8A 1AWCA 4ZYGA 3GFIA 1U8RA 2JTVA 1ZG3A 3E6CC 4HAMA 5CVRA 1OYWA 3WTYC 2YX4A 3BOQA 1MJAA 3IC7A 1YG2A 1FC3A 2KRFA 1MDMB 1GXPA 2FE3A 2YR2A 3IL2A 3GO5A 1H9GA 3FXQA 3GF2A 2GQQA 4MQ9F 3N97A 1Z7UA 4UV8A 1S3JA 1YW7A 2XAFA 1T2KA 1BI1A 3Q5FA 1ZAOA 1ON1A 2O6GE 3ABUA 3M1EA 4L9NA 3QRFF 4NHJA 5EEGA 4P5OA 4M71A 1W7PA 1R5GA 4L5IA 2Q2EA 5LEKA 1DP7P 3MQ0A 4LFUA 2XAQA 3SQNA 1G6NA 2LSOA 1ZGAA 2QM3A 2MA3A 3QOPA 1R7JA 1T39A 4FHTA 5ICGA 1WWXA 3NEUA 1WRJA 2M5WA 2DPUA 5ILSA 1FYLA 2A07F 4LB5A 2EA4A 1T98A 1Z91A 1R36A 1XMAA 3REOA 3EQLF 5D8KB 3NRVA 2OZUA 4BHCA 4UNOA 5E1ZB 6PAXA 1I1SA 2COMA 3SXYA 3LAPA 1LDJA 4HLXA 2GXGA 3WU0A 4M9XA 2XHKA 2K7LA 3O6BB 4OIRF 1F4KA 3HRTA 2ZBKA 1FLIA 2LKPA 1GHCA 5L3CA 2G7HA 2ZJ2A 3CUQA 1EH7A 3L00A 1QZZA 2PG4A 2VC0A 2DO7A 4IRIA 3O2PE 2MH9A 3TGNA 3TO9A 2PLYA 1BI2A 1CGPA 1DDNA 2F5CA 1ULYA 3LQQA 1WSUA 4MEYF 4S05A 1IUYA 1O3SA 2K4BA 5D4SA 2MC3A 1R1UA 3H3UA 4ZYDA 4A0XA 2JZYA 2STWA 4IHSA 5FFZA 2K02A 3DKWA 3HHHA 3BJOA 3CJNA 3LA2A 5CVUA 2VN2A 3GLXA 1K78A 2STTA 5DD8A 3KLOA 3GWZA 4RAYA 2M45A 1KU2A 2G9WA 3T8RA 5HS7A 1TNTA 2ZXJA 2PI0A 2LF7A 5ICEA 3QP5A 1USSA 5LGNA 2EFNA 4KIGA 1BJAA 4P9FA 2HTJA 5E1WA 2VXZA 1MJ9A 1PUEE 5HOOA 1PDNC 2Z9OA 1Z6TA 1FWZA 2BE5F 3RI4A 3CDHA 3K1NA 3E5UA 3K1PA 1O3TA 3V7RA 4R1HA 4BHPA 1J0RA 1G3WA 3R6SA 2GIVA 2RQPA 1BN5A 3O3KA 3J81K 3ZMDA 1U5TA 4LG0A 1IN8A 4LJZF 3GUDA 3V8JA 3K1MA 1FP1D 4BAYA 2Z99A 1IRGA 2E1CA 3TDZC 2RC4A 4CGZA 1B4AA 4PZJA 4Q48A 4M9SA 5TRDA 3E3VA 2PFBA 3GFJA 2KIFA 5KK1A 3KFWX 4MTDA 5E8GA 4DQ2A 4WCGA 1KYWA 1SAXA 3FWEA 4WXHA 5LRRA 4RB2C 2EB7A 2ADUA 3R61A 1DUXC 1QNTA 4M9ZA 2VBWA 1YW8A 2J5OA 3H3ZA 4BH9A 1R22A 4IVNA 4WXCA 3L09A 3WE3A 1OKRA 4XLNF 1CF7B 3DV8A 3B02A 4LD5A 2CO5A 3BY6A 3PFIA 2IPQX 2HQRA 4Q4ZF 4DNCA 5D5XB 2MBFA 2HS5A 2QBYA 5CVIA 2DTRA 3WTTC 2DK5A 3ROUA 5J6XA 2JSCA 3JAMZ 3DEUA 3GZ5A 1JHFA 3I64A 4G7OF 2CG4A 1F9NA 3TKYA 3IRRA 4HF2A 2FA5A 3RPUA 5D5UB 4OOIA 2OU2A 3E6MA 1YIOA 1HQCA 3L7WA 4Y13A 1J2XA 2FEZA 2PJPA 1GXQA 5HDKA 3P9KA 1KU7A 4GGGA 3HSFA 1TQMA 1ZRCA 2FOKA 3GXOA 4KFCA 3MCZA 3WTZA 4CXFA 2A69F 1HKQA 1BI0A 5IT9K 3HRSA 5FD6A 3ZMSA 4MGRA 4G9YA 1BI3A 3T0YA 5FLXZ 2E1NA 4LB6B 3KP4A 3VFZA 3KZYA 1L0OC 5AIQA 3T1BA 4NB5A 4A0ZA 4A12A 4L9JA 1F5TA 3W6KB 3GVAA 2FBIA 1HSJA 2XIGA 3ZMTA 3JSOA 3KP5A 2DT5A 4LLGF 3K69A 2D1HA 3QPHA 2Y48A 4M72A 1R58A 4L5JA 1HW2A 3MFKA 1RIOH 1LJ9A 4MHGA 3PQJA 3HTSB 1S7AA 2H6CA 4A2UA 3G3ZA 3RPQA 4Y15A 2TDXA 2VE9A 1A04A 2QBYB 3AAFA 2MD5A 2F5FA 4L9TA 2M87A 1U6GA 4HQEA 2W84A 1J9IA 3F21A 4ON0A 5J8FA 2LNBA 5CVVA 2ESNA 5KVRA 4I01A 2G7UA 2IT0A 2P6SA 1QPMA 1YTYA 2AXLA 4LK0F 2Z33A 4G94A 5ILUA 2IVMA 4HLYA 2L01A 4AIHA 5BPIA 5DCFA 2ELHA 5CVJA 1EV7A 4A5MA 4EVIA 2OZ6A 2HYGD 2DI3A 4KN4X 3HTUA 1Z9CA 4LLLA 4KICA 2C6YA 4RGXA 3RJPA 4UXNA 4WX9A 4HYEA 1S29A 5A2QK 3R60A 1P92A 2XRNA 2DW4A 1HKTA 2OD5A 1STZA 4YFXF 2ETHA 5FGMA 2ZFWA 2K4JA 2V1DA 4IHTA 1OYIA 3CUQC 2BGCA 5D5VB 2FXAA 4EJVA 4LK1F 4QLCU 2ACJA 3EDPA 4M6YA 2A3SA 2BV6A 4I0AA 5DV5A 4XSZF 2VBXA 3F8MA 3V8LA 1F1ZA 5D6FA 3ABTA 4UVCA 1WI9A 1W7PB 4GXOA 4WF2A 2YX7A 1C0WA 5L3DA 4FX4A 2H6BA 4OIPF 3CLOA 2KJCA 3R0JA 1MD0A 4KDPA 3CUQB 2ISYA 3SFZA 3RKWA 4BYYA 1YO5C 2HWVA 3FZVA 5F1RA 3BROA 5DD4A 1FPQA 5DCMA 4ZZLA 1IRFA 3LAJA 1R1TA 2EA2A 3HRMA 4U7DA 3H92A 3K2ZA 3I58A 3FX3A 4UV9A 2QUFA 3T8TA 3V7SA 2D1VA 3VEPA 1FYKA 2HOEA 2IJLA 1S8NA 3M9AA 4U7BA 4KA4A 4HDVA 3KZZA 3KP6A 3EYIA 2F2EA 2W57A 4U0YA 3HSRA 4MEXF 1ZHFA 5BMZA 2P5LC 2V6CA 2XAJA 1YYVA 4B8XA 2Y0MA 4R8HA 4A6EA 1G3SA 3RIRA 1OYYA 3IKVA 3IWFA 3WG9A 3WTSC 4KMUX 4G7HF 2V9VA 1USTA 5D4RA 5D6EA 1U2WA 2FQ3A 3DQVC 5AONA 4H0EA 3JW4A 2HYFA 1LEAA 2EV0A 2P7CB 1YS7A 2KJBA 2JPBA 3E5XA 1IW7F 1P4AA 2EFPA 3HYIA 5HS9A 4A0YA 3Q9SA 3WTUC 4YG2F 4Y17A 1P4WA 1FP2A 5DUKA 4HF0A 1RUOA 3ML6A 5HLGA 4IRHA 3M8FA 5DUIA 5BOXA 4RGRA 2OAZA 1U5TB 1BOAA 3E6BA 2AS5F 4IJAA 5IT9Z 2LF8A 2DU9A 5E17F 4M74A 1G3TA 1K78B 1U78A 1I1GA 1SFUA 1XN7A 2RGVA 3QU6A 3ZP5A 2WC2A 4G6QA 4BNCA 1LEBA 2RKHA 4JBAA 3N4MA 3HRUA 3G73A 1ODDA 1AOYA 2BYVE 2VC1A 2M8EA 1WKMA 4XBFA 3F22A 3IRQA 2FMYA 3MZYA 3ZMVA 1BC8C 4ESBA 4R79A 4EM2A 1FT9A 3C3WA 4WXDA 4L0YB 1XB4A 3F8NA 3KEOA 1ZRDA 1I6XA 3FXRA 3MEXA 3F23A 5DCMB 5L3GA 5CYVA 1TBXA 3I0TA 1TTYA 1RI7A 3KETA 2YSRA 3DPLC 1B9MA 4CYDA 5E18F 3S2WA 1KA8A 4BXUA 3GZ6A 2FRHA 1TW3A 1FBQA 5E1XA 4OMZA 3I71A 4ENMA 4A6DA 1U5TC 2KIUA 1IXRC 1XDSA 3LWFA 3QU3A 2NNYA 1XD7A 4RB3C 3COAC 5LGTA 3BJ6A 2VODA 4M6XA 3IHUA 3WODF 1SD7A 2P5KA 3WGIA 1HKSA 3P7NA 4RGSA 4I0BA 1FY7A 2M30A 4ZH4F 3GEZA 2ZNZA 4EQQA 3J80Z 3IWZA 2WWYA 3VOEA 3BJAA 3TQNA 5TJJA 4ZZDA 4P96A 2GAUA 4GO1A 4N0BA 4KIFA 1NHAA 1U3EM 4UVBA 3DPTA 3ZQ7A 1SMYF 2E7WA 4S04A 3Q9VA 5BQTA 2PBIA 2HZTA 1BC7C 2CGPA 4TV7A 2DLLA 1OR7A 2HQNA 1KU9A 2MLGA 4FX0A 4ENKA 3MAJA 1LB2A 2IRFG 1YW9A 1Z1DA 2YPRA 1IXSB 1QZYA 3J7AO 2XVCA 1O57A 1I5ZA 4ESJA 4RS8A 4AIKA 5LRSA 4U88A 4P55A 2EFWA 1OPCA 4LMYA 4HBLA 3U9GA 3F72A 2DQRA 4XSXF 4GYGA 3GYHX 2XV4S 1HW1A 5CLSA 3F3XA 1KQ0A 3ECHA 4MNUA 1SMTA 4ASNA 3B73A 2H09A 4OMYA 5ED4A 1BIBA 1MGTA 3OOPA 3LA3A 3VODA 2EK5A 3RKXA 1ZYRF 5HLHA 3RDIA 5L3FA 2MLKA 5HDNA 1I27A 3WE2A 2YU3A 2PN6A 1LDDA 4AIJA 4KNYA 3KP7A 2QVOA 5L3BA 3BWGA 4GCVA 3BZ6A 3KE2A 2QQAA 5ERIA 4I7HA 2CFXA 1P6RA 1XSXA 4MQVA 3TDUC 1S7OA 4YFNF 3SHFA 2VBZA 2W25A 2J5PA 5H6QA 3F6VA 3HUGA 4IRGA 5HVQC 4IPAA 3ISPA 3P9CA 1J5YA 3U2RA 5JFRA 1FOKA 2H94A 2FNAA 3I53A 3WU1B 2XGXA 1ZGJA 5LHHA 1J7KA 2HFHA 3KP2A 3P9IA 4OINF 3F8CA 3U1DA 4I09A 3RYRA 4Z2YA 1EH8A 1BIAA 3JTHA 2RVCA 5ICCA 1SFEA 2L4MA 5LGUA 2ZNYA 1YFHA 3C7JA 3ZN1A 2VT2A 3HIFA 2A6HF 3RTRA 1ZG5A 2V79A 4MTEA 3HSEA 1YLFA 1SD5A 3TOBA 3D0SA 4WWCA 3RKYA 3HOTA 5LLQA 1P4XA 2DK8A 1LDKB 2CW0F 2XUBA 2P7VB 5FFXA 4IF4A 4EGYA 1RUNA 3FXUA 2UZKA 4F7ZA 2FNPA 1ON2A 2QYOA 2VT3A 1T38A 3ZMZA 3C18A 2HTSA 2Q0OA 1RNLA 4HQMA 2XKOA 2MH2A 4EM0B 2RNJA 4O3MA 1XGOA 2JPCA 3WTVC 2GWRA 3GW2A 1HXDA 4XRFA 1XDUA 1DPUA 3ZN0A 5DYMA 3KCCA 2NS0A 5F6FA 1UCRA 4LG0B 1SD6A 3SZPA 3E5QA 1Z05A 4ZYHA 5K1YA 4EJTA 4Q47A 4L9VA 2H27A 2Y75A 2RDPA 3EUHA 4N9HA 2Z3YA 1QGPA 4G7ZF 2O0YA 1ZH5A 2K27A 4HF1A 1HBXG 2IP2A 2P5VA 5D8LB 1ZG1A 4OIQF 5E8IA 4HA8A 4K2EA 1J59A 1IZ1A 2EWNA 4I2OA 3DP7A 4YIIA 4EM1A 3F6OA 3V8KA 3OV8A 2OQGA 2W24A 3EYYA 1LVAA 5JI6A 4OIOF 5K5QA 5FD5A 3R4KA 1D8KA 4OU0A 2HEOA 1FNNA 2D45A 2BEOA 1KGSA 3K9TA 1D5VA 3J80K 1WQ2A 3L2CA 1FX7A 2NAZA 1LQ1A 2CWEA 3ELKA 1IN6A 2EJRA 4RAZA 2L54A 4D0PA 3ULQB 3D5LA 1ONVA 4P9UA 3LFKA 1TNSA 4HX7A 2K86A 1H0MA 4HV5A 3V7CA 1JE8A 1IN4A 1ZRFA 5ICFA 2XAGA 1XCVA 4M73A 3VB2A 2ZCWA 2F5DA 2JRTA 2CYYA 3JTGA 3TOAA 1T0FA 2BBYA 1IAWA 3E97A 2L02A 2DBBA 1IF1A 1B9NA 1V3FA 4G6DA 4I98B 4CZZA 5HS8A 2W85A 2GA1A 2PMHA 3CO7C 1REPC 2XKPA 1W7PD 3FF5A 4HV6A 2ZKZA 5K5OA 1UHMA 2PQ8A 1B59A 2R7FA 4ENNA 2KKOA 5LHIA 1E17A 5JVTA 1D8JA 3RYPA 4L18B 5K5RA 1GVJA 1O3QA 3WGGA 3SZTA 1KU3A 2ZO4A 4KT5C 4EV0A 2GA2A 1IN5A 3QAHA 2XAHA 3FMRA 4XLPF 5FB2A 3CO6C 1TW2A 5D5WB 1K79A 1R00A 4BHBA 4UHTA 4UUVA 1RZ4A 4CHUA 5L3EA 2Q8KA 1FSHA 2P8TA 3R0AA 3KLNA 4PDKA 1ZN2A 4AD9A 4Q5SF 1MJBA 1G3YA 1B1BA 3ZPLA 2XROA 2FMLA 2X0LA 1KQ8A 2EFOA 4A5NA 4HDUA 5JR3A 4CICA 2A6EF 4JK1X 1YQAA 2CQKA 4PCQA 5H20A 4L0ZB 1K7AA 1T6SA 5J8CA 2A61A 2Z5UA 1O7LA 2M1BA 5CJ9A 4RGUA 2P4WA 2VE8A 5JHUA 2DPDA 2IW5A 1HSTA 4UVAA 3GFMA 4FT8A 4KUMA 1O7FA 2EFQA 1XGNA 4GYIA 3F8BA 1R1VA 1O3RA 1XSVA 1K6OA 1JGSA 2B0LA 4PGGA 1XGSA 5H6RA 1KYZA 4U0WA 4WK8F 2R3SA 3E6DA 4QWQA 1MZBA 4YFKF 1XSDA 5A2QZ 1G4DA 2X4HA 2HKXA 2O8XA 1B6AA 5ILVA 2R7DA 2QLZA 4JQFA 4RB0A 3DXJF 3WTWC 5BPDA 5LHGA 3TO7A 5E20A 3BPVA 1R23A 4IXAA 2RN7A 3F8FA 1S6LA 2DAOA 1J75A 1FYMA 1SD4A 1YS6A 4AVPA 2IA0A 4N9IA 2JT1A 3LQRA 2QQ9A 2OA4A 1H9TA 3HOSA 3DF8A 1QBJA 3GX4X 1UB9A 3MZHA 2D2WA 3WGHA 3M8EA 5LBQA 3ECOA 1EH6A 1FBUA 4I02A 5F64A 1XCBA 3K0LA 2FF4A 4AWXB 1W5SA 1IN7A 2DQLA 2O61A 2F5EA 3ERED 2GZWA 4O5VA 3W6JB 1FSEA 1R5HA 1DPRA 3PQKA 4LLNA 1MKMA 3JAMK 2ZMEA 3IKTA 2UWMA 3FMQA 3M7GA 1XMKA 4PGHA 5DDGA 4EGZA 3EETA 1PP7U 3I59A 2LDUA 2XASA 1CF7A 5HDGA 3FM3A 3FHZA 3LSTA 3WTXC 4HZFA 1Q1HA 4LGWA 1BM9A 2OQRA 5AIPA 3MWMA 1Y0UA 1MDMA 3I54A 4KYWA 3CTAA 3KP3A 2UXNA 4KMFA 1L3LA 1UFMA 2A68F 2FBHA 2ISZA 2L3DA 3BPXA 1E2XA 4KIBA 2OBPA 3I4PA 2FBKA 4CDGA 2HKOA 3BP8A 2QQBA 5HLIA 1KQ9A 1ZREA 5FO5A 2WV0A 2NYXA 2E7XA 2FU4A 2V1UA 2O03A 2IA2A 4EJUA 4ETSA 3TO6A 1OMIA 2DFIA 1BBYA 1P2FA 4YIFA 2EV6A 1ZLJA 4CO8A 2GXBA 2VBYA 2QENA 4RB1A 3JSPA 4G8XA 4B09A 5DEQA 1ZLKA 1QQIA 1TQPA 1W5TA 3L9FA 3DFGA 3I5UA 3NQOA 2A5YB 3HHGA 1JHHA 2VONA 2RV8A 2EV5A 3GFLA 4ZYEA 4O6JA 3FMSA 4BQAA 4EJWA 2PMUA 4E70A 2HR3A 3KEQA 1ZARA 1Z6RA 3QPTA 2VOPA 3V4GA 1V4RA 4HOBA 2O3FA 1FZPB 5LEJA 4HW0A 1D3YA 4HX4A 2VOOA 1PP8F 3C1DA 5IT3A 1TLHB 1LNWA 2V1XA 4HX8A 2HGCA 3T5XA 1HW5A 1XGMA 3BDDA 1QO0D 2KIMA 2WTEA 1W4MA 3J81Z 3FM5A 2NRAC 1FBSA 2NNNA 4EMSA 1UHWA 1IXCA 2PEXA 2ESHA 1VTNC 5FLXK 4ESFA 1SFXA 3ZMUA 2P6TA 3LA7A 4U0VA 5EEHA
chains in the Genus database with same CATH superfamily
3QYEA 2CSOA 1X3UA 1T08B 1TWCJ 4KN7X 2B7EA 2D5VA 2UXXA 1TQIA 2QWWA 4NQWA 4EJOA 2HDCA 2W48A 2FSWA 3GLLA 3JCUC 2BHZA 4EEFG 2IA1A 2O6MA 3H36A 1PVEA 2A5WA 1MBEA 3HL2A 4IHWA 2L4AA 3WHBA 1BA5A 3QP6A 2F48A 3I59B 4BE1A 3CUOA 1JXSA 2ZMEB 5BS6A 4PJMA 4MLOA 3VSLA 4ENJA 3TW7A 2QZ8A 5J1YA 1AWCA 4ZYGA 9ANTA 2XC7A 3FIWA 4B48A 3GFIA 3SJMA 4XQFA 2KP6A 1U8RA 2NVXJ 2XB0X 4CH7A 2BOLA 4L5EA 1VQ4I 1WJBA 2PMZN 2JTVA 1ZG3A 4ZTJA 3S1MJ 1AU7A 3L2VA 1OCTC 2IGNA 5EF6A 3E6CC 4HAMA 2VXDA 4JP0A 1D1CA 5CVRA 1OYWA 4AVZA 3BR2A 3WTYC 1X3ZB 2CW7A 2YX4A 3BOQA 2E71A 1MJAA 1Z3YA 2JVHA 3IC7A 1Y6IA 1YG2A 4NUBA 1V5FA 1FC3A 2KRFA 2XPVA 1MDMB 2FE3A 2YR2A 3IL2A 1GXPA 3GO5A 2ZMEC 1H9GA 5F0FA 3LSJA 2RNGA 3FXQA 3GF2A 3QPSA 1E3HA 2GQQA 4G12A 4MQ9F 2NXNB 3N97A 1Z7UA 4UV8A 1S3JA 1JTYA 1YW7A 2XAFA 1T2KA 5K7FA 1W5CC 1BI1A 5EG0A 5B66C 3HJEA 3Q5FA 3IH4A 1ZAOA 1ON1A 2VPRA 2O6GE 3ABUA 3M1EA 1JT0A 1IG7A 4L9NA 3GTQJ 3QRFF 4NHJA 4F91B 3HKZA 4J19A 5EEGA 4P5OA 4M71A 4A3CJ 1W7PA 5CQGA 2JMWA 1R5GA 4L5IA 1D0ZA 2ME0A 2Q2EA 5LEKA 1DP7P 4N4OB 1R4NB 4BJ6C 3MQ0A 3W3CA 1V5GA 2E1MC 1OISA 2JN6A 2AQEA 4LFUA 2XAQA 2GIZA 2GBYA 3A02A 1VNDA 3SQNA 4B1RA 1G6NA 2LSOA 3G71I 4XM3A 4ZYAA 3GTMJ 1ZGAA 1X2MA 2QM3A 3PNVA 3HG9A 2W7NA 2ZJPF 1PUFA 2MA3A 3QOPA 3DBHB 4FQGA 1R7JA 4NC6A 2KPMA 1X1PA 4HSRA 1T39A 4FHTA 1SVLA 5ICGA 1WWXA 3BQZA 1WRJA 3NEUA 1SFOJ 2M5WA 2RREA 2DPUA 2LC2A 5ILSA 1Z21A 3LNQA 1VQOI 1FYLA 2A07F 3E1SA 4ZJZA 4LB5A 2EA4A 4DBRA 1T98A 4S0HB 1Z91A 4XLCA 3H3VK 1R36A 1XMAA 4CCJA 4A3MJ 1VQ7I 3REOA 3EQLF 5D8KB 3NRVA 2I10A 2OZUA 4FE4A 4BHCA 1ZKGA 4UNOA 3BLYA 1E3OC 5E1ZB 3O8GA 6PAXA 2JRMA 4YEJA 1I1SA 2X1DA 2COMA 3SXYA 3OYAA 3LAPA 1LDJA 4HLXA 1LE8B 5B5EC 2GXGA 3WU0A 2XGCA 1X4OA 4M9XA 3L2RA 2XHKA 1QU3A 2L9VA 2Y69H 2K7LA 2BXZA 3O6BB 4IQJA 4IZZA 2HXOA 3DTKA 4OIRF 3OYIA 3DLLF 1F4KA 4B3XA 2ECBA 2XB5A 1DGRM 1Y56A 1TL8A 5J4YA 4X1EA 2QGUA 1JKPC 1WJCA 2HNHA 4LIUA 3CCJI 1D0XA 2LG4A 3HRTA 4ZDPA 1MSEC 1N77A 3ABMH 4XONA 3BR6A 5FKMA 2ZBKA 2OPTA 1FLIA 1YJWI 2LKPA 1GHCA 2FUG2 5L3CA 1FOXA 2G7HA 2ZJ2A 3CUQA 3MVPA 3ZQQA 1EH7A 3L00A 1QZZA 1CQTA 2PG4A 2VC0A 4RLQA 3G4SI 1JUSA 1X1CA 2DO7A 3Q0WA 4IRIA 1OCRH 3O2PE 1Z7LA 2MH9A 3TGNA 3TO9A 2CUEA 2PLYA 1CYQA 3JRHA 1K4TA 4QPQA 2LH9A 1BI2A 2L7FP 4KT6A 1MBFA 1CGPA 1DDNA 2BY2A 4BXXJ 4Y33A 2F5CA 2R7XA 4AIDA 1ULYA 4OWRB 1IO2A 3LQQA 1WSUA 4MEYF 4IL6C 4S05A 3PIPF 1IUYA 5GPAA 1O3SA 2A6TA 2HPMA 2K4BA 5D4SA 1FIPA 3H3UA 1UG0A 1R1UA 2MC3A 2OCEA 2Y2ZA 4ZYDA 4A0XA 2JZYA 2STWA 4IHSA 5FFZA 2K02A 3NAUA 3DKWA 2Z2SB 3BT9A 4FASD 1WVRA 3HHHA 1BR1A 1D1BA 3BJOA 3CJNA 3LA2A 4IX7A 5CVUA 1ZK8A 1I50J 2VN2A 3GLXA 4M3DA 1K78A 2STTA 5DD8A 2ECCA 3WHCA 1IJWC 2E2IJ 4Y52J 3KLOA 2LLKA 3GWZA 3B6CA 1XC5A 4RAYA 2Z16A 3OYJA 2M45A 1KU2A 2WB1A 2G9WA 3CC7I 3T8RA 5HS7A 2DOEA 1ETKA 1TNTA 2Z1DA 5HNHA 2ZXJA 4BXFA 3BTLA 2PI0A 2LF7A 1XPXA 1G8XA 4E4HA 5ICEA 3QP5A 1USSA 4XLEA 4KISA 5LGNA 3CP2A 2EFNA 2VJ5A 5GAGJ 4KIGA 1BJAA 4P9FA 2HTJA 5E1WA 2V4JC 2VXZA 1AA7A 2KRHA 4E6KG 1MJ9A 1TT5B 1PUEE 2R7SA 2DA2A 5HOOA 1PDNC 3AFHA 4BQQA 1XMXA 2KLOA 2Z9OA 2HQAA 1Z6TA 1FWZA 3FXJA 1VQ9I 5TGTA 1FIAA 2BE5F 3RI4A 2Y0SN 3CDHA 1JKQC 1ZELA 3K1NA 1X19A 3E5UA 3K1PA 5FKNA 1O3TA 3V7RA 4R1HA 2L2OA 4BHPA 4DYCA 2KDZA 1J0RA 1G3WA 3R6SA 2EILH 2GIVA 2F5VA 2RQPA 2OC6A 5EEAA 3GTOJ 4YELA 5F0HA 1BN5A 2QA4I 3O3KA 1MSFC 3J81K 1W1WE 5J47A 3ZMDA 1U5TA 4LG0A 1IN8A 2CQXA 3LSIA 4LJZF 3GUDA 3W2VA 3V8JA 2GM4A 3K1MA 1FP1D 3G2BA 2DYSH 4BAYA 2Z99A 1IRGA 2E1CA 3TDZC 2R7QA 2RC4A 2K9SA 4CGZA 2DT6A 1YI2I 3A0BC 1B4AA 4PZJA 4Q48A 1BJZA 4M9SA 1WCMJ 3E3VA 5TRDA 3JRFA 2CMPA 2PFBA 3GFJA 2PMZA 1V55H 1RKTA 2KIFA 3PL8A 5KK1A 1VQLI 3KFWX 4MTDA 1RC9A 2LYCA 1IUFA 2KHMA 3FXOA 5E8GA 4BY7J 4DQ2A 4WCGA 4FISA 1KYWA 1SAXA 3FWEA 4WXHA 5JHFA 5LRRA 4RB2C 2EB7A 3TMOA 2VQGA 4BS9A 1VQNI 4V2GA 2ADUA 3R61A 1DUXC 5C3EJ 1QNTA 4JX6A 4CYCB 2JA6J 4M9ZA 3OYNA 2N8GA 2ZJQF 2VBWA 1UG2A 1YW8A 2J5OA 2E19A 3H3ZA 4BH9A 2M2EA 4BQNA 1R22A 4IVNA 4WXCA 3IP4B 2XPWA 3L09A 2XF5A 2EIKH 3WE3A 1OKRA 2HZDA 4XLNF 3VYSB 1QRYA 1RETA 3DV8A 3B02A 4LD5A 3S32A 1CF7B 3A2KA 2O7OA 2CO5A 3BY6A 5M5YJ 4XNFA 2IS6A 3RZOJ 3PFIA 4V19K 4E7LA 1ETOA 2IPQX 2HQRA 3LL7A 4Q4ZF 3I56I 4DNCA 1ZR2A 5D5XB 2BY0A 4RM2A 2L9SA 4ZDOA 2EPFA 3CZ6A 2MBFA 2HS5A 3HKZN 2QBYA 5CVIA 2DTRA 3WTTC 4HRIA 2DK5A 3ROUA 5J6XA 2ELJA 1MW7A 1DU6A 2JSCA 3ZQIA 3GBGA 2DA6A 3JAMZ 3DEUA 1HF0A 3GZ5A 3OIQA 1JHFA 3I64A 2JA8J 2K9NA 2R93J 4G7OF 1I3QJ 3VDXA 3AG4H 2CG4A 1F9NA 3TKYA 3IRRA 2DFHA 4HF2A 2BW3A 2E2JJ 2FA5A 3RPUA 5D5UB 2WA0A 1FMVA 3AG2H 1XG1A 2XF6A 4OOIA 2OU2A 3LSKA 3E6MA 2DDAA 3HOUJ 1YIOA 2WV1A 1A35A 3BR1A 1HQCA 3L7WA 4Y13A 1MH3A 1J2XA 3PM1A 3K7AJ 2FEZA 2PJPA 1GXQA 3CCRI 3J7AY 1YHQI 5HDKA 3P9KA 1ITYA 1KU7A 2MD0A 2MW8A 3OWTA 1ORKA 4GGGA 2LBFB 3HSFA 1TQMA 1IPPA 2R92J 3MKZA 1R71A 2ELKA 1ZRCA 3W2WA 2HOAA 2FOKA 3DU6A 3GXOA 4KFCA 3OS1A 3A0HC 3MCZA 2G0EA 3OYDA 3WTZA 4CXFA 2A69F 2QQ8A 1HKQA 1BI0A 5IT9K 2R7ZJ 3HRSA 5FD6A 3ZMSA 1FMWA 4MGRA 4G9YA 2UV1A 1BI3A 3T0YA 2E1NA 4LB6B 5FLXZ 3DTIA 3KP4A 3BG5A 3VFZA 3KZYA 2QEXI 1L0OC 5AIQA 3T1BA 4NB5A 3PIOF 2TCTA 4A0ZA 4BDYA 4A12A 4L9JA 4NDLA 3SFIA 1F5TA 4GFBA 4W1UA 3GVAA 3W6KB 1JT6A 2JK3A 2FBIA 2JVGA 1HSJA 2XIGA 3ZMTA 2R7VA 1WJDA 2HOSA 3JSOA 4DZJA 3KP5A 1WHUA 2DT5A 4LLGF 3OSGA 5LFAA 1X4PA 4QSHA 3K69A 2D1HA 1OJLA 4XORA 3QPHA 4DJAA 1U8BA 2JSPA 2Y48A 4M72A 1R58A 4PSXA 1AKHB 2HVRA 4L5JA 2HU9A 4PFPA 3U21A 1HW2A 3ZQGA 1R4MB 2UUZA 3MFKA 1RIOH 5FJ8J 3CCEI 3VYRB 4BJTA 3BCBA 1LJ9A 4MHGA 3OR2C 3UKGA 3HEFA 3PQJA 1S7AA 3HTSB 2H6CA 4A2UA 1UMQA 3OYBA 3G3ZA 1T33A 4XLFA 3P5JA 4Y15A 1X3WB 3RPQA 2TDXA 2VE9A 2KDOA 1A04A 2QBYB 3AAFA 2MD5A 2F5FA 4L9TA 1D1AA 3IAM2 3DU5A 4PJLA 2M87A 2MC4A 5KNLA 1U6GA 4HQEA 4PJJA 1HOMA 4BJ5C 2DODA 2W84A 4JX4A 3OR1C 3DEWA 1J9IA 5EZGA 5EG0B 1NH3A 3F21A 4ON0A 4A3LJ 1GV5A 5J8FA 2LNBA 5CVVA 2ESNA 5KVRA 4I01A 2G7UA 2IT0A 4Y3OA 2LP0A 2P6SA 5F0CA 5DTDA 1HA8A 3LMMA 4C3JJ 4XLAA 1XS9A 4C9YA 1TC3C 1QPMA 1YTYA 2AXLA 4LK0F 3K6GA 1W36D 2Z33A 4G94A 2QSGX 5ILUA 2IVMA 2ZFUA 5F1JA 4HLYA 1RR8C 2L01A 1BW5A 4AIHA 5BPIA 5DCFA 2ELHA 5CVJA 4C2UA 1EV7A 1N25A 2W00A 1YRNB 3HZJA 4A5MA 5E3OA 3KPHA 4EVIA 2LY1A 2OZ6A 3LSGA 4A3FJ 2HYGD 2DI3A 4KN4X 3HTUA 1Z9CA 2R5ZB 4LLLA 2R5YA 1S9HA 4I6ZA 4KICA 2CV1A 2C6YA 5IYDJ 4RGXA 3RJPA 4UXNA 1PUFB 2DMNA 4E7IA 2CUJA 3CCSI 4WX9A 4HYEA 1S29A 5A2QK 2GXAA 3R60A 1EVWA 1P92A 2XRNA 3OIOA 4ANJA 2DW4A 1HKTA 1OLTA 2E36A 3FBNB 2L7ZA 5EGOA 4AU7A 3CCYA 3LSRA 2OD5A 1STZA 1OCOH 2DMPA 1D5YA 2OV7A 4ZTFA 2LD5A 1Z0XA 3EPZA 4YFXF 4N4NB 1W0UA 2DFEA 2ICWG 5EZHA 2K9MA 2ETHA 5FGMA 1HC8A 3K4MA 2ZFWA 2K4JA 2V1DA 4II2A 2CS3A 4XIDA 1OYIA 4IHTA 3CUQC 2BGCA 5D5VB 2NVQJ 2H1LA 4LOCA 4FTHA 4HNTA 3D5RC 2DYRH 4ZDLA 5JLXA 2FXAA 4EJVA 3FXMA 3OYMA 4LK1F 2VB6A 4ITVA 4QLCU 2ACJA 2CV0A 3EDPA 4M6YA 2A3SA 5JVGF 2W82A 3FKJA 2BV6A 4I0AA 4XSZF 2BHYA 5DV5A 2VBXA 3F8MA 4E7SA 3MKYB 2DTZA 3ZQCA 1F1ZA 2XF7A 3V8LA 2CH0A 5D6FA 4QPOA 3ABTA 1OCZH 1WI9A 4UVCA 1W7PB 4GXOA 1MBJA 4WF2A 2YX7A 3HOWJ 1C0WA 5L3DA 4FX4A 1W36C 2KISA 4D9JA 2H6BA 4OIPF 3CLOA 2KJCA 3R0JA 1MD0A 4KDPA 2L5QA 3CUQB 2ISYA 1BR2A 3RKWA 3SFZA 2NVUB 4BYYA 1YO5C 2R7WA 1G2HA 2HWVA 2IGMA 3FZVA 5F1RA 3BROA 5DD4A 2LFBA 1FPQA 5KAIC 5DCMA 4ZZLA 1IRFA 3LAJA 2ZSIB 1WI3A 1R1TA 4I76A 3LOCA 2EA2A 3HRMA 4U7DA 2NVYJ 3H92A 1SC7A 3K2ZA 3TBIA 3I58A 3FX3A 4UV9A 4UUTA 4UB6C 2QUFA 3T8TA 3V7SA 2D1VA 3VEPA 1FYKA 2WAQN 2HOEA 2RQQA 2IJLA 1S8NA 3M9AA 4U7BA 4KA4A 4HDVA 3KZZA 3KP6A 3EYIA 2F2EA 2CRGA 2W57A 4U0YA 3I4NJ 2WAEA 4XN0A 3HSRA 4MEXF 1ZHFA 2DMUA 5BMZA 2OUMA 2P5LC 2V6CA 2XAJA 1GDTA 1YYVA 4B8XA 1YRNA 2Y0MA 4D7MA 2V6EA 4R8HA 3ZGKA 4A6EA 4RDUA 4PFOA 1G3SA 3KEYA 3RIRA 1OYYA 3IKVA 3IWFA 1X1DA 3WG9A 3WTSC 2VUMJ 3A4CA 4KMUX 4G7HF 5IP7J 1QHHD 2V9VA 1USTA 5D4RA 1IV6A 1MMDA 5D6EA 5IY5H 4E7JA 1U2WA 1K6YA 2FQ3A 4MFDA 3DQVC 5AONA 2DA1A 4H0EA 3X2QH 3ZQLA 3JW4A 4IHVA 2HYFA 1ETQA 2KRCA 1LEAA 2L7MP 2EV0A 3NARA 5EGOB 1BR4A 2P7CB 1YS7A 2KJBA 2JPBA 3E5XA 1IW7F 2M34A 1N78A 3CDLA 1P4AA 2EFPA 2ID6A 2FD5A 3HYIA 5HS9A 4A0YA 3BG9A 3Q9SA 3S1RJ 1EVXA 3WTUC 2W1OA 1VQMI 3ZXSA 4YG2F 1WPKA 2K9QA 4Y17A 5KAFC 1P4WA 1FP2A 5DUKA 3CC2I 4HF0A 3F9KA 1JTXA 2YUSA 3HXLA 3CCLI 3SDBA 2BVMA 4CSWA 3H0GJ 1RUOA 1JKOC 2HOTA 4W97A 5EDNA 1I6HJ 3ML6A 5HLGA 2CJJA 1GV2A 2L9NA 4IRHA 3M8FA 2XPUA 5DUIA 3ABKH 5BOXA 3HOZJ 3JREA 4RGRA 3VPRA 1VQ6I 3K4CA 5FRNA 2OAZA 3A01B 1U5TB 5J40A 2DN0A 1WJFA 1BOAA 2DDBA 3E6BA 4BGDA 2R5YB 2AS5F 5IYBJ 4IJAA 5IT9Z 4BUPA 3ESWB 2HI3A 1ZR4A 5J1UA 2LF8A 4ABZA 3GTJJ 2DU9A 5E17F 3H9GA 4C30A 2M4KA 1Y1WJ 4M74A 4XMYA 1POGA 1G3TA 4DGWB 3G6EI 1K78B 1U78A 1D0YA 2R5ZA 1OR7C 2X6OA 4UUSB 1I1GA 1SFUA 2WADA 5FKKA 1XN7A 2IS2A 1WJAA 2RGVA 4CCMA 3QU6A 2KZGA 2AO9A 3ZP5A 2HDWA 4RM3A 2WC2A 3AKZA 4G6QA 4BNCA 1LEBA 1FJLA 3DEEA 2RKHA 4JBAA 3N4MA 3HRUA 3G73A 1ODDA 1AOYA 3RQIA 5EYRA 4IHXA 1GLNA 2BYVE 2VC1A 3TW6A 1F36A 3M07A 1ETVA 2M8EA 2MSYA 1WKMA 4XBFA 3F22A 4ZC3A 2TRTA 3IRQA 2DA5A 3V42A 3D1NI 3F0CA 3H1CA 1WH7A 4BQOA 4E7HA 1A36A 2FMYA 2MFZA 3MZYA 3ZMVA 1BC8C 4ESBA 4PJNA 4R79A 4EM2A 4IO9F 4XOPA 1FT9A 3AG3H 3C3WA 5F08A 3JRGA 5GAEJ 2K9LA 1VQ5I 2VKEA 3TL4X 3AG1H 1SFKA 4M3EA 4WXDA 2VQCA 4L0YB 1XB4A 1IDZA 2EZHA 4DOZA 3F8NA 3L2WA 2O9LA 3GTPJ 3KEOA 1ZRDA 3ASNH 3GTLJ 3FHNA 1ETXA 2AQFA 3K2AA 1I6XA 5EJCA 3FXRA 3PO2J 5J3LA 2V9KA 3S14J 2I5UA 5IYCJ 3RZDJ 2XGDA 3KYCB 4BY1J 4HSTA 2BY3A 1TT0A 3MEXA 1BL0A 3F23A 2CQ7A 5DCMB 5L3GA 5CYVA 1Y39A 1SVOA 1TBXA 1CZ0A 1RPWA 2M7BA 1XX5A 3I0TA 1QVUA 1WZ2A 3S3MA 1X1AA 1TTYA 4QIWN 1RI7A 3KETA 1YJ9I 2F4OB 3C2HA 2YSRA 3DPLC 3L1PA 3O8HA 1B9MA 4CYDA 3OYFA 4F92B 1X58A 5E18F 3S2WA 3ZOBA 3BCAA 4P1WA 1KA8A 3FXLA 4UB8C 4BXUA 3GZ6A 2FRHA 4J00A 1TW3A 1FBQA 5E1XA 2XAUA 4OMZA 3I71A 2FX0A 5DS9A 4ENMA 3HDDA 4A6DA 3SEQA 2CUFA 3KYDB 3E7LA 4BE2A 2GOXB 1U5TC 3S2DJ 2H1KA 2KIUA 1IXRC 1XDSA 3IAS2 3LWFA 4RBOA 1OCCH 1V54H 3QU3A 1PYVA 2IXSA 2MABA 2NNYA 4KJZA 1XD7A 1ZGWA 4RB3C 5M5XJ 5JLWA 1DQUA 3COAC 1EKEA 1FOYA 4X0GA 3SDGA 5LGTA 3DKXA 1TWHJ 3BJ6A 2VODA 4M6XA 3IHUA 3WODF 1SD7A 2Y31A 5CQEA 1S7EA 3KX2A 2P5KA 4MFEA 1HKSA 3WGIA 3GMEA 3P7NA 4RGSA 1A6IA 4C2MJ 4I0BA 4XKVA 1FY7A 2M30A 2IGKA 1JJ6C 4ZH4F 3BG6A 3GEZA 2ZNZA 2LY2A 4EQQA 3J80Z 1NG6A 5C4XJ 4UUSA 3CMAI 3IWZA 2WWYA 2KT0A 2E2HJ 3CC4I 3VOEA 3OYHA 3BJAA 3TQNA 5TJJA 4ZZDA 4P96A 2P81A 2GAUA 3DBLB 4GO1A 4CCLA 1VQPI 1VQKI 2E1MB 5E79C 4N0BA 4XLHA 3K4KA 4KIFA 1HCRA 1Y8RB 1NHAA 1U3EM 4BACA 4UVBA 3BC8A 3DPTA 4LITA 3ZQ7A 1SMYF 3BR5A 1Q1VA 2E7WA 2DFFA 1U9NA 4S04A 3Q9VA 3FK7A 4FETA 5BQTA 1TWAJ 1A6QA 1AKHA 2LOOA 2PBIA 2HZTA 2CUZA 2LBFA 3AL0B 2X51A 2XSJC 1SEUA 2DA7A 1BC7C 2CGPA 4TV7A 2DLLA 4BEHA 3S3NA 3CD6I 2KQRA 1OR7A 2CW8A 3CCUI 2B9SA 3TP3A 2WAQA 2HQNA 1KU9A 2MLGA 4FX0A 4ENKA 3MAJA 1LB2A 3QODA 1SAUA 5GTHC 1X2NA 1WJEA 3C2BA 2IRFG 4RAGA 2GLOA 2IGOA 1YW9A 1Z1DA 2F4MB 2YPRA 2NS8A 1IXSB 1QZYA 3J7AO 1MNEA 4E7KA 3JRIA 4AYBA 2XVCA 1O57A 2COBA 2X48A 1I5ZA 1IDYA 2XGEA 3VYUB 4A3EJ 4ESJA 4F93B 3BTIA 4LIVA 2HQ5A 4RS8A 4AIKA 5LRSA 4U88A 4P55A 3M8JA 2EFWA 1OPCA 4LMYA 2R7TA 4HBLA 3U9GA 3F72A 2VKHA 2XRLA 3I9V2 2DQRA 1Y1VJ 4XSXF 2HVQA 2VKVA 4GYGA 3GYHX 2XV4S 5GTIC 3G1OA 3S17J 2K85A 4RA2A 4B43A 1HW1A 5CLSA 3CESA 3F3XA 2EH3A 3FDYA 2VKDA 1KQ0A 3ECHA 5E3MA 4MNUA 1SMTA 4ASNA 1T95A 2DMTA 2O5RA 3B73A 2H09A 1TP4A 4OMYA 5ED4A 3M1CA 3A1YA 1BIBA 2IS1A 1IRXA 1MGTA 3LA3A 3OOPA 3VODA 1WJ5A 1MH4A 2EK5A 3RKXA 1B72B 2DMQA 1ZYRF 5HLHA 2E60A 3BG7A 3RDIA 5L3FA 3SZGA 3VYTB 1JUPA 4B44A 3DCFA 2MLKA 5HDNA 4RMNA 3C2GA 3OY9A 1I27A 3WE2A 2YU3A 2PN6A 1FTTA 1LDDA 1RESA 1OCPA 4A3DJ 4AIJA 4KNYA 3KP7A 2QVOA 5L3BA 4MO7A 4Z6YA 3BWGA 4GCVA 4M3GA 4EATA 3BZ6A 3KE2A 2JJ7A 1LVKA 2ZB9A 2QQAA 5FLMJ 5ERIA 4XK4A 1H8AC 4I7HA 2CFXA 1P6RA 1YX3A 2NS7A 4NC7A 4D7NA 1XSXA 4MQVA 3TDUC 1S7OA 3B6AA 4BDZA 4YFNF 2K40A 3SHFA 3QQAA 1ETYA 2VBZA 2W25A 3I4MJ 4XR6A 2J5PA 5H6QA 2Y0SA 3F6VA 4A3JJ 3HUGA 4IRGA 5HVQC 4IPAA 3ZR8X 3Q0VA 3ISPA 3P9CA 4BBSJ 3H9QA 1J5YA 1H89C 3U2RA 4XRMA 2LRDA 5JFRA 3W6VA 2KL4A 4Y7NJ 1NG7A 3A03A 1FOKA 2OCCH 2H94A 3MN2A 2ZSHB 2V1NA 5IOYA 4HEA2 2FNAA 3I53A 3WU1B 2XGXA 1ZGJA 4A93J 5LHHA 1J7KA 5GPCA 3CDIA 2HFHA 1VFCA 3OOUA 2R7OA 3KP2A 3P9IA 4OINF 3F8CA 3U1DA 3J7ZI 2F4IA 4I09A 1RRJA 3RYRA 4Z2YA 1EH8A 2K3FA 1BIAA 3JTHA 2RVCA 2PX9A 5ICCA 1SFEA 2L4MA 2ZXWH 5LGUA 2JQ7A 2ZNYA 3FBIB 1E0EA 1MBKA 1YFHA 3C7JA 2M0MA 3ZN1A 2VT2A 3HIFA 1R9TJ 1QA6A 2A6HF 2VJIA 1MMNA 2PJRB 3RTRA 3HGGA 1ZG5A 2V79A 1Y8QB 4MTEA 2ID3A 3BG3A 3HSEA 1YLFA 1SD5A 4IQ4A 2FJ1A 3TOBA 3D0SA 2VLAA 5DM6F 4WWCA 3RKYA 3HOTA 5LLQA 1P4XA 2DK8A 1LDKB 5CPRB 2CW0F 2XUBA 2P7VB 1YJNI 1DU0A 5FFXA 1K61A 4IF4A 4EGYA 1G59A 1RUNA 2M8GX 2VL8A 1XTAA 4GRIA 3FXUA 2UZKA 4F7ZA 1VF9A 3GTGJ 2FNPA 1ON2A 1JI8A 2QYOA 2VT3A 1T38A 3ZMZA 3C18A 2HTSA 2Q0OA 2R7UA 1RNLA 3LSMA 3MD2A 4M3BA 4HQMA 2XKOA 2MH2A 3HB9A 4EM0B 3CP8A 3K10A 2RNJA 5GAHJ 3K70C 3S3OA 4O3MA 3QYFA 1XGOA 2JPCA 4C2TA 2NVTJ 3BZCA 3WTVC 2GWRA 4AC0A 3GW2A 4A3KJ 1HXDA 4XRFA 1XDUA 1UZCA 1DPUA 3ZN0A 1UELB 5DYMA 3KCCA 1RR7A 2NS0A 5F6FA 2K5CA 1UCRA 4LG0B 3H5RA 1SD6A 3SZPA 5LD2C 3E5QA 2EQRA 1Z05A 4ZYHA 5K1YA 3OYEA 4EJTA 4Q47A 3CCVI 2JA5J 3MKLA 4L9VA 3I3LA 2H27A 2QF7A 2Y75A 2RDPA 5FROA 2AXTC 2LR8A 2BXYA 3EUHA 4N9HA 2Z3YA 1QGPA 4G7ZF 2O0YA 5B1AH 5FKLA 3ZQHA 2EBIA 2E1OA 4PK4A 4CA0A 2WB1N 2LVSA 3OIPA 1ZH5A 2K27A 4HF1A 1HBXG 2IP2A 2P5VA 5D8LB 4F52A 1ZG1A 1UJ8A 4OIQF 1LKXA 1RKWA 5E8IA 3CMYA 2NOGA 4HA8A 4K2EA 1J59A 1IZ1A 2EWNA 2VJ4A 3M4OJ 4I2OA 3WG7H 2B63J 3DP7A 5KCMA 4YIIA 4EM1A 3F6OA 3V8KA 3OV8A 2OQGA 4HG2A 3PNYA 3E0JB 2W24A 3EYYA 1LVAA 1FOWA 2W4SA 5FKOA 5JI6A 4OIOF 5F04A 5K5QA 5FD5A 3R4KA 4YRVA 1E3PA 1D8KA 4XN3A 3RKQA 2IBDA 4NBQA 4OU0A 2HEOA 3G1MA 2EIMH 1FNNA 2VQLA 4JYKA 4OAZA 1QVTA 1P7JA 2D45A 2BEOA 5K7ZA 1KGSA 3K9TA 1D5VA 1YX5A 2H8WA 1B72A 1A31A 1HDPA 4I99C 1WQ2A 3J80K 3L2CA 3GCMA 1FX7A 2NAZA 2E5NA 2WY7Q 1LQ1A 4HNVA 2OTLI 1Y0NA 2CWEA 3WU2C 1I3AA 1SANA 3ZQFA 4JOMA 3ELKA 3FXKA 5HNFA 4XKCA 3LFUA 1IN6A 2EJRA 2QSFX 4RAZA 2QKLB 2L54A 4D0PA 1S5LC 3ULQB 3D5LA 1ONVA 4B4CA 4QTRA 4P9UA 2IS4A 2A05A 3CF2A 3LFKA 2R7RA 1GVDA 1TNSA 4HX7A 2K86A 1JJ8C 2NOJB 1APLC 1H0MA 4AYBN 4IOAF 2VI6A 3NWSA 3RSNA 4HV5A 3V7CA 3PUBA 1JE8A 1T56A 1WGXA 1FTZA 1IN4A 1ZRFA 2DA4A 3EUKL 5ICFA 3A01A 2CU7A 2XAGA 1XCVA 4M73A 2X1EA 3VB2A 1R6RA 3H5NA 3HOXJ 2E35A 2ZCWA 2F5DA 1NK2P 1KONA 1H88C 2X6WA 1TWGJ 1JUMA 2JRTA 2CYYA 3JTGA 1IV8A 3OS2A 3TOAA 1T0FA 3S2HJ 2VQHA 2BBYA 3SYTA 3IUOA 3BQYA 1IAWA 4J01A 4GDFA 3E97A 5IPAA 4HPQA 2E5ZA 3BZKA 2L02A 1QHGA 2DBBA 1IF1A 1P9QC 1B9NA 2Y30A 1V3FA 4IOCF 1ENHA 3FISA 4G6DA 4I98B 4CZZA 5HS8A 1DP3A 2V7FA 2W85A 2GA1A 2PMHA 3CO7C 1REPC 2ZXHA 2XKPA 1W7PD 3FF5A 2CV2A 4HV6A 2ZKZA 1QPIA 4FE7A 5K5OA 1UHMA 5H2FC 2PQ8A 1B59A 3H9JA 2R7FA 4ENNA 1HLVA 2KKOA 5LHIA 1E17A 5JVTA 1D8JA 4D1QA 2WAFA 3RYPA 1ZTRA 1MMGA 4L18B 5K5RA 4JX5A 3DWLE 2IAIA 3CLQA 4XRSA 1GVJA 1O3QA 3N05A 3WGGA 2IEKA 4BBRJ 3SZTA 5GP9A 5TISC 2F6CA 2EINH 2MGQA 5J4VA 5C44J 1KU3A 4MIMA 2ZO4A 4KT5C 4EV0A 2GA2A 1IN5A 3QAHA 1MMSA 2JUCA 2XAHA 5B3SH 2BY1A 3FMRA 4XLPF 3M3YJ 5FB2A 3CO6C 2BVLA 1TW2A 2LREA 3DLAA 5D5WB 4D5FA 3U1KA 2CQNA 2EZIA 2WBMA 3JRAA 4II3A 1K79A 1R00A 3HPHA 4BHBA 4UHTA 4UUVA 1BW6A 1RZ4A 1DGWY 2MYSA 2EZLA 4BE0A 4CHUA 1LFBA 5L3EA 2Q8KA 1FSHA 2HDDA 2P8TA 3R0AA 1F43A 3KLNA 3IH2A 4PDKA 1MBGA 1ZN2A 1U9OA 4AD9A 4Q5SF 2X9DA 2EIJH 4PSWA 1WH5A 1MJBA 2Q2EB 1G3YA 1B1BA 1NK3P 2X1CA 3L2QA 3ZPLA 2XROA 2FMLA 2X0LA 1KQ8A 3S93A 2EFOA 4A5NA 1YE9A 4YIRX 5E3NA 4HDUA 5JR3A 4CICA 2HVSA 2CFOA 2GOMA 2VASA 3LSPA 4F55A 2A6EF 4JK1X 3JR9A 1YQAA 2CQQA 2CQKA 4PCQA 5H20A 4L0ZB 1K7AA 1FEXA 1T8IA 3ONQA 2R4GA 4UY8I 4PUSA 1T6SA 5J8CA 2A61A 2Z5UA 3OYKA 2DT7B 3OYGA 3JRCA 2ZXIA 3K4NA 1O7LA 3LSHA 2M1BA 1NTCA 5CJ9A 3L2UA 4RGUA 2LKXA 3HGYA 1B8IB 2P4WA 1U0JA 2VE8A 5JHUA 4CZCA 2DPDA 2IW5A 3CJRB 1HSTA 3EUAA 4UVAA 3GFMA 4FT8A 4KUMA 2JA2A 3HOYJ 3PNTA 3RQ4A 1O7FA 4IKFA 1OQYA 3BTJA 2EFQA 4XICA 1XGNA 3GZNB 4GYIA 3F8BA 1R1VA 4CCKA 4CUGA 1O3RA 4LG3A 1XSVA 4XL9A 3ABLH 1K6OA 1JGSA 2B0LA 2M4GA 2V26A 4PGGA 1XGSA 4XKBA 5H6RA 4U87A 1KYZA 4U0WA 4WK8F 3QWLA 1IC8A 2P0WA 2R3SA 2M9HA 3E6DA 4QWQA 3PJRA 3S1QJ 1MBHA 1A73A 1MZBA 2VPLA 4YFKF 1XSDA 5FRMA 4HNUA 5C4JJ 5A2QZ 3S16J 1QZEA 2HYJA 1X1BA 2X4HA 2HKXA 2O8XA 1B6AA 5ILVA 2R7DA 1G4DA 2QLZA 4JQFA 1YITI 1O4XA 2DXIA 4RB0A 3OMYA 2KIQA 3KZIC 3HPGA 3DXJF 1I39A 3WTWC 5BPDA 3ASOH 3I55I 5LHGA 2DOAA 3TO7A 5E20A 3BPVA 1R23A 4B3AA 4IXAA 1MNDA 4CCNA 2RN7A 3IH3A 3F8FA 1S6LA 2QSHX 4A69C 5M5WJ 3KIOA 1ACIA 2DAOA 1J75A 2ME6A 2OTJI 2L9RA 1FYMA 1SD4A 1YS6A 3UNGC 4AVPA 2IA0A 5HODA 4N9IA 2JT1A 2DCEA 3LQRA 2QQ9A 1J09A 3CMMA 2OA4A 1H9TA 2Q1ZB 2M7AA 2X6XA 5IOZA 1R5ID 3IV5A 3HOSA 3DF8A 1QBJA 3GX4X 2XDVA 1UB9A 2YS9A 3MZHA 2D2WA 2RAEA 3WGHA 1LPQA 3BTCA 3M8EA 4BEHB 5LBQA 5E3LA 3ECOA 1EH6A 1FBUA 1HDDC 2ZJRF 4I02A 5F64A 1XCBA 3K0LA 1SVMA 2LK2A 2DA3A 3OS0A 2FF4A 2FOWA 4IHYA 1WFXA 2FQ4A 1W5SA 4AWXB 2X85A 2DJIA 3PSFA 1MIJA 1TZLA 1IN7A 4RLFA 2DQLA 2E34A 1TWFJ 2O61A 3Q3SA 2KZVA 2F5EA 3ERED 2LTPA 3DPUA 1ETWA 2GZWA 3DTEA 3CJQB 4O5VA 3W6JB 2KFDA 3QYBA 1VQ8I 4CCOA 3FKIJ 1FSEA 3G1LA 3MZ8A 1R5HA 1DPRA 3PQKA 3FK6A 1M1EB 4KITB 2YU9J 4G6TB 4LLNA 3CCMI 1YIJI 3NWTA 2JUGA 5DM7F 1MKMA 3JAMK 2XSDC 5B1BH 2ZMEA 5BNGA 4A3GJ 3RCOA 1KZHA 3IKTA 3PUFA 2UWMA 2V9PA 3FMQA 2K3PA 2DOFA 3M7GA 3OSFA 1XMKA 4PGHA 5DDGA 4EGZA 3EETA 4BKXA 5CKTA 4DYQA 3OL4A 1PP7U 3RPUD 3I59A 2LDUA 2XASA 1CF7A 3VWBA 2JA7J 3H35A 5HDGA 4D5CA 3FM3A 3HM5A 4XKWA 3FHZA 3LSTA 3CQZJ 5IP6A 3WTXC 3ZCOA 4HZFA 4XRSG 1Q1HA 1YOVB 4LGWA 5J1RA 1MMAA 3GTKJ 1BM9A 3UR3C 3S8PA 1S72I 2OQRA 5AIPA 2HXIA 3CCQI 3MWMA 4A3IJ 3ERMA 1Y0UA 4DZPA 1MDMA 4DYRA 3DBRB 3I54A 1K83J 2M0CA 4KYWA 4B47A 3CTAA 3KP3A 3JRDA 4BL0B 2UXNA 1Z3XA 4KMFA 3PO3J 1A5JA 1L3LA 1UFMA 2A68F 2FBHA 4IEJA 1JGGA 2ISZA 2L3DA 4DW6A 3ZRGA 2ZC2A 3CF5F 2I8DA 3HUGB 3BPXA 1E2XA 4KIBA 2OBPA 3I4PA 3Q0UA 2FBKA 2BW3B 4CDGA 3OYLA 2HKOA 4AUXA 3BP8A 3DKYA 2QKMB 2QQBA 2M3AA 4NQWB 5K7HA 2LMDA 3MKWB 1LFPA 5HLIA 2WY8Q 1KQ9A 3W2AA 4M3FA 1ZREA 5FO5A 2WV0A 2NYXA 4PJ0C 4FCYA 4AM3A 3H0DA 1MNMC 2E7XA 2LKSA 4OAYA 2FU4A 1AHDP 3HOVJ 2V1UA 4CYCA 2O03A 5HLTA 2IA2A 4E7ZA 1GT0C 1PJRA 4EJUA 1B8IA 2H8RA 4ETSA 1K4SA 1IRZA 3TO6A 5F27A 1OMIA 2DFIA 2AHQA 4C3HJ 4RAFA 1T0FC 1VI0A 1BOBA 1BBYA 1P2FA 4YIFA 1EA3A 2EV6A 3HBLA 1ZLJA 4C3IJ 4F3QA 3K4BA 4CO8A 1ERDA 1VZ0A 2GXBA 3OYCA 2VBYA 2QENA 4RB1A 3JSPA 1V5EA 4G8XA 1OFCX 4B09A 5DEQA 2LY9A 3JRBA 3CMEI 1ZLKA 3K4LA 3OL3A 3BR3A 4NNJA 1QQIA 1TQPA 2VJJA 2DJNA 1W5TA 3L9FA 3HC7A 1P7IA 1ZQ3P 3DFGA 1Z77A 1Z67A 3MMYB 1N75A 3J7YJ 3I5UA 3NQOA 2A5YB 4XOTA 5M3FJ 3HHGA 5FLVA 3S1NJ 5GADJ 2OJED 1JHHA 2VONA 2RV8A 3GFLA 2BZTA 2EV5A 2L7KA 4ZYEA 4O6JA 4DBQA 3FMSA 4BQAA 3QOEA 2PJRA 4EJWA 2EZKA 2PMUA 3TP0A 4E70A 4NC8A 4A3BJ 2OF7A 3K4JA 2Y9YA 3S15J 2HR3A 4DIQA 3KEQA 2O8KA 3QPLA 2VIXA 1R49A 1ZARA 1EJ9A 1JKRC 1Z6RA 1UHSA 3QPTA 1LFUP 2VOPA 3V4GA 4BU2A 3KYLA 2R0QC 1V4RA 4HOBA 4H4KC 3TEDA 1W0TA 2KMUA 2O3FA 1FZPB 5LEJA 4HW0A 1D3YA 1LE8A 4HX4A 2VOOA 3K70D 1PP8F 2HPIA 1A74A 3C1DA 4Y4RA 5IT3A 1TLHB 4M6VA 1LNWA 2V1XA 3SEZA 4HX8A 2JWTA 2HGCA 3PSIA 3T5XA 1HW5A 1XGMA 3BDDA 3EUHC 2X6YA 1QO0D 5IP9J 2KIMA 2WTEA 3D5SC 1W4MA 1EF4A 2QCOA 3J81Z 1LUJB 3FM5A 2NRAC 4X6AJ 3H5AA 1FBSA 2NNNA 2L0KA 3BR0A 4EMSA 1UHWA 1IXCA 2MG4A 2PEXA 2ESHA 5KHDA 1VTNC 5M3MJ 5FLXK 1UAAA 3VSKA 2Y9ZA 4ESFA 3PFYA 3CJTB 1SFXA 3AL0C 3ZMUA 2P6TA 3LA7A 1GUUA 4U0VA 5EEHA 4V2FA 1IGNA
chains in the Genus database with same CATH topology
2CSOA 1X3UA 4KN7X 2UXXA 1TQIA 2QWWA 4NQWA 4EJOA 2HDCA 2FSWA 2IA1A 2O6MA 2L4AA 3QP6A 3I59B 3CUOA 1JXSA 2ZMEB 5BS6A 4ENJA 2QZ8A 1AWCA 4ZYGA 3GFIA 1U8RA 2JTVA 1ZG3A 3E6CC 4HAMA 5CVRA 1OYWA 3WTYC 2YX4A 3BOQA 1MJAA 3IC7A 1YG2A 1FC3A 2KRFA 1MDMB 1GXPA 2FE3A 2YR2A 3IL2A 3GO5A 1H9GA 3FXQA 3GF2A 2GQQA 4MQ9F 3N97A 1Z7UA 4UV8A 1S3JA 1YW7A 2XAFA 1T2KA 1BI1A 3Q5FA 1ZAOA 1ON1A 2O6GE 3ABUA 3M1EA 4L9NA 3QRFF 4NHJA 5EEGA 4P5OA 4M71A 1W7PA 1R5GA 4L5IA 2Q2EA 5LEKA 1DP7P 3MQ0A 4LFUA 2XAQA 3SQNA 1G6NA 2LSOA 1ZGAA 2QM3A 2MA3A 3QOPA 1R7JA 1T39A 4FHTA 5ICGA 1WWXA 3NEUA 1WRJA 2M5WA 2DPUA 5ILSA 1FYLA 2A07F 4LB5A 2EA4A 1T98A 1Z91A 1R36A 1XMAA 3REOA 3EQLF 5D8KB 3NRVA 2OZUA 4BHCA 4UNOA 5E1ZB 6PAXA 1I1SA 2COMA 3SXYA 3LAPA 1LDJA 4HLXA 2GXGA 3WU0A 4M9XA 2XHKA 2K7LA 3O6BB 4OIRF 1F4KA 3HRTA 2ZBKA 1FLIA 2LKPA 1GHCA 5L3CA 2G7HA 2ZJ2A 3CUQA 1EH7A 3L00A 1QZZA 2PG4A 2VC0A 2DO7A 4IRIA 3O2PE 2MH9A 3TGNA 3TO9A 2PLYA 1CYQA 1BI2A 1CGPA 1DDNA 2F5CA 1ULYA 3LQQA 1WSUA 4MEYF 4S05A 1IUYA 1O3SA 2K4BA 5D4SA 2MC3A 1R1UA 3H3UA 4ZYDA 4A0XA 2JZYA 2STWA 4IHSA 5FFZA 2K02A 3DKWA 3HHHA 3BJOA 3CJNA 3LA2A 5CVUA 2VN2A 3GLXA 1K78A 2STTA 5DD8A 3KLOA 3GWZA 4RAYA 2M45A 1KU2A 2G9WA 3T8RA 5HS7A 1TNTA 2ZXJA 2PI0A 2LF7A 5ICEA 3QP5A 1USSA 5LGNA 2EFNA 4KIGA 1BJAA 4P9FA 2HTJA 5E1WA 2VXZA 1MJ9A 1PUEE 5HOOA 1PDNC 2Z9OA 1Z6TA 1FWZA 2BE5F 3RI4A 3CDHA 3K1NA 3E5UA 3K1PA 1O3TA 3V7RA 4R1HA 4BHPA 1J0RA 1G3WA 3R6SA 2GIVA 2RQPA 1BN5A 3O3KA 3J81K 3ZMDA 1U5TA 4LG0A 1IN8A 4LJZF 3GUDA 3V8JA 3K1MA 1FP1D 4BAYA 2Z99A 1IRGA 2E1CA 3TDZC 2RC4A 4CGZA 1B4AA 4PZJA 4Q48A 4M9SA 5TRDA 3E3VA 2PFBA 3GFJA 2KIFA 5KK1A 3KFWX 4MTDA 5E8GA 4DQ2A 4WCGA 1KYWA 1SAXA 3FWEA 4WXHA 5LRRA 4RB2C 2EB7A 2ADUA 3R61A 1DUXC 1QNTA 4M9ZA 2VBWA 1YW8A 2J5OA 3H3ZA 4BH9A 1R22A 4IVNA 4WXCA 3L09A 3WE3A 1OKRA 4XLNF 1CF7B 3DV8A 3B02A 4LD5A 2CO5A 3BY6A 3PFIA 2IPQX 2HQRA 4Q4ZF 4DNCA 5D5XB 2MBFA 2HS5A 2QBYA 5CVIA 2DTRA 3WTTC 2DK5A 3ROUA 5J6XA 2JSCA 3JAMZ 3DEUA 3GZ5A 1JHFA 3I64A 4G7OF 2CG4A 1F9NA 3TKYA 3IRRA 4HF2A 2FA5A 3RPUA 5D5UB 4OOIA 2OU2A 3E6MA 1YIOA 1HQCA 3L7WA 4Y13A 1J2XA 2FEZA 2PJPA 1GXQA 5HDKA 3P9KA 1KU7A 4GGGA 3HSFA 1TQMA 1IPPA 1ZRCA 2FOKA 3GXOA 4KFCA 3MCZA 3WTZA 4CXFA 2A69F 1HKQA 1BI0A 5IT9K 3HRSA 5FD6A 3ZMSA 4MGRA 4G9YA 1BI3A 3T0YA 5FLXZ 2E1NA 4LB6B 3KP4A 3VFZA 3KZYA 1L0OC 5AIQA 3T1BA 4NB5A 4A0ZA 4A12A 4L9JA 1F5TA 3W6KB 3GVAA 2FBIA 1HSJA 2XIGA 3ZMTA 3JSOA 3KP5A 2DT5A 4LLGF 3K69A 2D1HA 3QPHA 2Y48A 4M72A 1R58A 4L5JA 1HW2A 3MFKA 1RIOH 1LJ9A 4MHGA 3PQJA 3HTSB 1S7AA 2H6CA 4A2UA 3G3ZA 3RPQA 4Y15A 2TDXA 2VE9A 1A04A 2QBYB 3AAFA 2MD5A 2F5FA 4L9TA 2M87A 1U6GA 4HQEA 2W84A 1J9IA 3F21A 4ON0A 5J8FA 2LNBA 5CVVA 2ESNA 5KVRA 4I01A 2G7UA 2IT0A 2P6SA 1QPMA 1YTYA 2AXLA 4LK0F 2Z33A 4G94A 5ILUA 2IVMA 4HLYA 2L01A 4AIHA 5BPIA 5DCFA 2ELHA 5CVJA 1EV7A 4A5MA 4EVIA 2OZ6A 2HYGD 2DI3A 4KN4X 3HTUA 1Z9CA 4LLLA 4KICA 2C6YA 4RGXA 3RJPA 4UXNA 4WX9A 4HYEA 1S29A 5A2QK 3R60A 1EVWA 1P92A 2XRNA 2DW4A 1HKTA 2OD5A 1STZA 4YFXF 2ETHA 5FGMA 2ZFWA 2K4JA 2V1DA 4IHTA 1OYIA 3CUQC 2BGCA 5D5VB 2FXAA 4EJVA 4LK1F 4QLCU 2ACJA 3EDPA 4M6YA 2A3SA 2BV6A 4I0AA 5DV5A 4XSZF 2VBXA 3F8MA 3V8LA 1F1ZA 5D6FA 3ABTA 4UVCA 1WI9A 1W7PB 4GXOA 4WF2A 2YX7A 1C0WA 5L3DA 4FX4A 2H6BA 4OIPF 3CLOA 2KJCA 3R0JA 1MD0A 4KDPA 3CUQB 2ISYA 3SFZA 3RKWA 4BYYA 1YO5C 2HWVA 3FZVA 5F1RA 3BROA 5DD4A 1FPQA 5DCMA 4ZZLA 1IRFA 3LAJA 1R1TA 2EA2A 3HRMA 4U7DA 3H92A 3K2ZA 3I58A 3FX3A 4UV9A 2QUFA 3T8TA 3V7SA 2D1VA 3VEPA 1FYKA 2HOEA 2IJLA 1S8NA 3M9AA 4U7BA 4KA4A 4HDVA 3KZZA 3KP6A 3EYIA 2F2EA 2W57A 4U0YA 3HSRA 4MEXF 1ZHFA 5BMZA 2P5LC 2V6CA 2XAJA 1YYVA 4B8XA 2Y0MA 4R8HA 4A6EA 1G3SA 3RIRA 1OYYA 3IKVA 3IWFA 3WG9A 3WTSC 4KMUX 4G7HF 2V9VA 1USTA 5D4RA 5D6EA 1U2WA 2FQ3A 3DQVC 5AONA 4H0EA 3JW4A 2HYFA 1LEAA 2EV0A 2P7CB 1YS7A 2KJBA 2JPBA 3E5XA 1IW7F 1P4AA 2EFPA 3HYIA 5HS9A 4A0YA 3Q9SA 1EVXA 3WTUC 4YG2F 4Y17A 1P4WA 1FP2A 5DUKA 4HF0A 1RUOA 3ML6A 5HLGA 4IRHA 3M8FA 5DUIA 5BOXA 4RGRA 2OAZA 1U5TB 1BOAA 3E6BA 2AS5F 4IJAA 5IT9Z 2LF8A 2DU9A 5E17F 4M74A 1G3TA 1K78B 1U78A 1I1GA 1SFUA 1XN7A 2RGVA 3QU6A 3ZP5A 2WC2A 4G6QA 4BNCA 1LEBA 2RKHA 4JBAA 3N4MA 3HRUA 3G73A 1ODDA 1AOYA 2BYVE 2VC1A 2M8EA 1WKMA 4XBFA 3F22A 3IRQA 2FMYA 3MZYA 3ZMVA 1BC8C 4ESBA 4R79A 4EM2A 1FT9A 3C3WA 4WXDA 4L0YB 1XB4A 3F8NA 3KEOA 1ZRDA 1I6XA 3FXRA 3MEXA 3F23A 5DCMB 5L3GA 5CYVA 1TBXA 1CZ0A 3I0TA 1TTYA 1RI7A 3KETA 2YSRA 3DPLC 1B9MA 4CYDA 5E18F 3S2WA 1KA8A 4BXUA 3GZ6A 2FRHA 1TW3A 1FBQA 5E1XA 4OMZA 3I71A 4ENMA 4A6DA 1U5TC 2KIUA 1IXRC 1XDSA 3LWFA 3QU3A 2NNYA 1XD7A 4RB3C 3COAC 5LGTA 3BJ6A 2VODA 4M6XA 3IHUA 3WODF 1SD7A 2P5KA 3WGIA 1HKSA 3P7NA 4RGSA 4I0BA 1FY7A 2M30A 4ZH4F 3GEZA 2ZNZA 4EQQA 3J80Z 3IWZA 2WWYA 3VOEA 3BJAA 3TQNA 5TJJA 4ZZDA 4P96A 2GAUA 4GO1A 4N0BA 4KIFA 1NHAA 1U3EM 4UVBA 3DPTA 3ZQ7A 1SMYF 2E7WA 4S04A 3Q9VA 5BQTA 2PBIA 2HZTA 1BC7C 2CGPA 4TV7A 2DLLA 1OR7A 2HQNA 1KU9A 2MLGA 4FX0A 4ENKA 3MAJA 1LB2A 2IRFG 1YW9A 1Z1DA 2YPRA 1IXSB 1QZYA 3J7AO 2XVCA 1O57A 1I5ZA 4ESJA 4RS8A 4AIKA 5LRSA 4U88A 4P55A 2EFWA 1OPCA 4LMYA 4HBLA 3U9GA 3F72A 2DQRA 4XSXF 4GYGA 3GYHX 2XV4S 1HW1A 5CLSA 3F3XA 1KQ0A 3ECHA 4MNUA 1SMTA 4ASNA 3B73A 2H09A 4OMYA 5ED4A 1BIBA 1MGTA 3OOPA 3LA3A 3VODA 2EK5A 3RKXA 1ZYRF 5HLHA 3RDIA 5L3FA 2MLKA 5HDNA 1I27A 3WE2A 2YU3A 2PN6A 1LDDA 4AIJA 4KNYA 3KP7A 2QVOA 5L3BA 3BWGA 4GCVA 3BZ6A 3KE2A 2QQAA 5ERIA 4I7HA 2CFXA 1P6RA 1XSXA 4MQVA 3TDUC 1S7OA 4YFNF 3SHFA 2VBZA 2W25A 2J5PA 5H6QA 3F6VA 3HUGA 4IRGA 5HVQC 4IPAA 3ISPA 3P9CA 1J5YA 3U2RA 5JFRA 1FOKA 2H94A 2FNAA 3I53A 3WU1B 2XGXA 1ZGJA 5LHHA 1J7KA 2HFHA 3KP2A 3P9IA 4OINF 3F8CA 3U1DA 4I09A 3RYRA 4Z2YA 1EH8A 1BIAA 3JTHA 2RVCA 5ICCA 1SFEA 2L4MA 5LGUA 2ZNYA 1YFHA 3C7JA 3ZN1A 2VT2A 3HIFA 2A6HF 3RTRA 1ZG5A 2V79A 4MTEA 3HSEA 1YLFA 1SD5A 3TOBA 3D0SA 4WWCA 3RKYA 3HOTA 5LLQA 1P4XA 2DK8A 1LDKB 2CW0F 2XUBA 2P7VB 5FFXA 4IF4A 4EGYA 1RUNA 3FXUA 2UZKA 4F7ZA 2FNPA 1ON2A 2QYOA 2VT3A 1T38A 3ZMZA 3C18A 2HTSA 2Q0OA 1RNLA 4HQMA 2XKOA 2MH2A 4EM0B 2RNJA 4O3MA 1XGOA 2JPCA 3WTVC 2GWRA 3GW2A 1HXDA 4XRFA 1XDUA 1DPUA 3ZN0A 5DYMA 3KCCA 2NS0A 5F6FA 1UCRA 4LG0B 1SD6A 3SZPA 3E5QA 1Z05A 4ZYHA 5K1YA 4EJTA 4Q47A 4L9VA 2H27A 2Y75A 2RDPA 3EUHA 4N9HA 2Z3YA 1QGPA 4G7ZF 2O0YA 1ZH5A 2K27A 4HF1A 1HBXG 2IP2A 2P5VA 5D8LB 1ZG1A 4OIQF 5E8IA 4HA8A 4K2EA 1J59A 1IZ1A 2EWNA 4I2OA 3DP7A 4YIIA 4EM1A 3F6OA 3V8KA 3OV8A 2OQGA 2W24A 3EYYA 1LVAA 5JI6A 4OIOF 5K5QA 5FD5A 3R4KA 1D8KA 4OU0A 2HEOA 1FNNA 2D45A 2BEOA 1KGSA 3K9TA 1D5VA 3J80K 1WQ2A 3L2CA 1FX7A 2NAZA 1LQ1A 2CWEA 3ELKA 1IN6A 2EJRA 4RAZA 2L54A 4D0PA 3ULQB 3D5LA 1ONVA 4P9UA 3LFKA 1TNSA 4HX7A 2K86A 1H0MA 4HV5A 3V7CA 1JE8A 1IN4A 1ZRFA 5ICFA 2XAGA 1XCVA 4M73A 3VB2A 2ZCWA 2F5DA 2JRTA 2CYYA 3JTGA 3TOAA 1T0FA 2BBYA 1IAWA 3E97A 2L02A 2DBBA 1IF1A 1B9NA 1V3FA 4G6DA 4I98B 4CZZA 5HS8A 2W85A 2GA1A 2PMHA 3CO7C 1REPC 2XKPA 1W7PD 3FF5A 4HV6A 2ZKZA 5K5OA 1UHMA 2PQ8A 1B59A 2R7FA 4ENNA 2KKOA 5LHIA 1E17A 5JVTA 1D8JA 3RYPA 4L18B 5K5RA 1GVJA 1O3QA 3WGGA 3SZTA 1KU3A 2ZO4A 4KT5C 4EV0A 2GA2A 1IN5A 3QAHA 2XAHA 3FMRA 4XLPF 5FB2A 3CO6C 1TW2A 5D5WB 1K79A 1R00A 4BHBA 4UHTA 4UUVA 1RZ4A 4CHUA 5L3EA 2Q8KA 1FSHA 2P8TA 3R0AA 3KLNA 4PDKA 1ZN2A 4AD9A 4Q5SF 1MJBA 1G3YA 1B1BA 3ZPLA 2XROA 2FMLA 2X0LA 1KQ8A 2EFOA 4A5NA 4HDUA 5JR3A 4CICA 2A6EF 4JK1X 1YQAA 2CQKA 4PCQA 5H20A 4L0ZB 1K7AA 1T6SA 5J8CA 2A61A 2Z5UA 1O7LA 2M1BA 5CJ9A 4RGUA 2P4WA 2VE8A 5JHUA 2DPDA 2IW5A 1HSTA 4UVAA 3GFMA 4FT8A 4KUMA 1O7FA 2EFQA 1XGNA 4GYIA 3F8BA 1R1VA 1O3RA 1XSVA 1K6OA 1JGSA 2B0LA 4PGGA 1XGSA 5H6RA 1KYZA 4U0WA 4WK8F 2R3SA 3E6DA 4QWQA 1A73A 1MZBA 4YFKF 1XSDA 5A2QZ 1G4DA 2X4HA 2HKXA 2O8XA 1B6AA 5ILVA 2R7DA 2QLZA 4JQFA 4RB0A 3DXJF 3WTWC 5BPDA 5LHGA 3TO7A 5E20A 3BPVA 1R23A 4IXAA 2RN7A 3F8FA 1S6LA 2DAOA 1J75A 1FYMA 1SD4A 1YS6A 4AVPA 2IA0A 4N9IA 2JT1A 3LQRA 2QQ9A 2OA4A 1H9TA 3HOSA 3DF8A 1QBJA 3GX4X 1UB9A 3MZHA 2D2WA 3WGHA 3M8EA 5LBQA 3ECOA 1EH6A 1FBUA 4I02A 5F64A 1XCBA 3K0LA 2FF4A 4AWXB 1W5SA 1IN7A 2DQLA 2O61A 2F5EA 3ERED 2GZWA 4O5VA 3W6JB 1FSEA 1R5HA 1DPRA 3PQKA 4LLNA 1MKMA 3JAMK 2ZMEA 3IKTA 2UWMA 3FMQA 3M7GA 1XMKA 4PGHA 5DDGA 4EGZA 3EETA 1PP7U 3I59A 2LDUA 2XASA 1CF7A 5HDGA 3FM3A 3FHZA 3LSTA 3WTXC 4HZFA 1Q1HA 4LGWA 1BM9A 2OQRA 5AIPA 3MWMA 1Y0UA 1MDMA 3I54A 4KYWA 3CTAA 3KP3A 2UXNA 4KMFA 1L3LA 1UFMA 2A68F 2FBHA 2ISZA 2L3DA 3BPXA 1E2XA 4KIBA 2OBPA 3I4PA 2FBKA 4CDGA 2HKOA 3BP8A 2QQBA 5HLIA 1KQ9A 1ZREA 5FO5A 2WV0A 2NYXA 2E7XA 2FU4A 2V1UA 2O03A 2IA2A 4EJUA 4ETSA 3TO6A 1OMIA 2DFIA 1BBYA 1P2FA 4YIFA 2EV6A 1ZLJA 4CO8A 2GXBA 2VBYA 2QENA 4RB1A 3JSPA 4G8XA 4B09A 5DEQA 1ZLKA 1QQIA 1TQPA 1W5TA 3L9FA 3DFGA 3I5UA 3NQOA 2A5YB 3HHGA 1JHHA 2VONA 2RV8A 2EV5A 3GFLA 4ZYEA 4O6JA 3FMSA 4BQAA 4EJWA 2PMUA 4E70A 2HR3A 3KEQA 1ZARA 1Z6RA 3QPTA 2VOPA 3V4GA 1V4RA 4HOBA 2O3FA 1FZPB 5LEJA 4HW0A 1D3YA 4HX4A 2VOOA 1PP8F 1A74A 3C1DA 5IT3A 1TLHB 1LNWA 2V1XA 4HX8A 2HGCA 3T5XA 1HW5A 1XGMA 3BDDA 1QO0D 2KIMA 2WTEA 1W4MA 3J81Z 3FM5A 2NRAC 1FBSA 2NNNA 4EMSA 1UHWA 1IXCA 2PEXA 2ESHA 1VTNC 5FLXK 4ESFA 1SFXA 3ZMUA 2P6TA 3LA7A 4U0VA 5EEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSO A;  1X3U A;  4KN7 X;  2UXX A;  1TQI A;  2QWW A;  4NQW A;  4EJO A;  2HDC A;  2FSW A;  2IA1 A;  2L4A A;  3QP6 A;  3I59 B;  3CUO A;  1JXS A;  2ZME B;  5BS6 A;  4ENJ A;  2QZ8 A;  1AWC A;  4ZYG A;  3GFI A;  1U8R A;  2JTV A;  1ZG3 A;  3E6C C;  4HAM A;  5CVR A;  1OYW A;  3WTY C;  2YX4 A;  3BOQ A;  1MJA A;  3IC7 A;  1YG2 A;  1FC3 A;  2KRF A;  1MDM B;  1GXP A;  2FE3 A;  2YR2 A;  3IL2 A;  3GO5 A;  1H9G A;  3FXQ A;  3GF2 A;  2GQQ A;  4MQ9 F;  3N97 A;  1Z7U A;  4UV8 A;  1S3J A;  1YW7 A;  2XAF A;  1T2K A;  1BI1 A;  3Q5F A;  1ZAO A;  1ON1 A;  2O6G E;  3ABU A;  3M1E A;  4L9N A;  3QRF F;  4NHJ A;  5EEG A;  4P5O A;  4M71 A;  1W7P A;  1R5G A;  4L5I A;  2Q2E A;  5LEK A;  1DP7 P;  3MQ0 A;  4LFU A;  2XAQ A;  3SQN A;  1G6N A;  2LSO A;  1ZGA A;  2QM3 A;  2MA3 A;  3QOP A;  1R7J A;  1T39 A;  4FHT A;  5ICG A;  1WWX A;  3NEU A;  1WRJ A;  2M5W A;  2DPU A;  5ILS A;  1FYL A;  2A07 F;  4LB5 A;  2EA4 A;  1T98 A;  1Z91 A;  1R36 A;  1XMA A;  3REO A;  3EQL F;  5D8K B;  3NRV A;  2OZU A;  4BHC A;  4UNO A;  5E1Z B;  6PAX A;  1I1S A;  2COM A;  3SXY A;  3LAP A;  1LDJ A;  4HLX A;  2GXG A;  3WU0 A;  4M9X A;  2XHK A;  2K7L A;  3O6B B;  4OIR F;  1F4K A;  3HRT A;  2ZBK A;  1FLI A;  2LKP A;  1GHC A;  5L3C A;  2G7H A;  2ZJ2 A;  3CUQ A;  1EH7 A;  3L00 A;  1QZZ A;  2PG4 A;  2VC0 A;  2DO7 A;  4IRI A;  3O2P E;  2MH9 A;  3TGN A;  3TO9 A;  2PLY A;  1BI2 A;  1CGP A;  1DDN A;  2F5C A;  1ULY A;  3LQQ A;  1WSU A;  4MEY F;  4S05 A;  1IUY A;  1O3S A;  2K4B A;  5D4S A;  2MC3 A;  1R1U A;  3H3U A;  4ZYD A;  4A0X A;  2JZY A;  2STW A;  4IHS A;  5FFZ A;  2K02 A;  3DKW A;  3HHH A;  3BJO A;  3CJN A;  3LA2 A;  5CVU A;  2VN2 A;  3GLX A;  1K78 A;  2STT A;  5DD8 A;  3KLO A;  3GWZ A;  4RAY A;  2M45 A;  1KU2 A;  2G9W A;  3T8R A;  5HS7 A;  1TNT A;  2ZXJ A;  2PI0 A;  2LF7 A;  5ICE A;  3QP5 A;  1USS A;  5LGN A;  2EFN A;  4KIG A;  1BJA A;  4P9F A;  2HTJ A;  5E1W A;  2VXZ A;  1MJ9 A;  1PUE E;  5HOO A;  1PDN C;  2Z9O A;  1Z6T A;  1FWZ A;  2BE5 F;  3RI4 A;  3CDH A;  3K1N A;  3E5U A;  3K1P A;  1O3T A;  3V7R A;  4R1H A;  4BHP A;  1J0R A;  1G3W A;  3R6S A;  2GIV A;  2RQP A;  1BN5 A;  3O3K A;  3J81 K;  3ZMD A;  1U5T A;  4LG0 A;  1IN8 A;  4LJZ F;  3GUD A;  3V8J A;  3K1M A;  1FP1 D;  4BAY A;  2Z99 A;  1IRG A;  2E1C A;  3TDZ C;  2RC4 A;  4CGZ A;  1B4A A;  4PZJ A;  4Q48 A;  4M9S A;  5TRD A;  3E3V A;  2PFB A;  3GFJ A;  2KIF A;  5KK1 A;  3KFW X;  4MTD A;  5E8G A;  4DQ2 A;  4WCG A;  1KYW A;  1SAX A;  3FWE A;  4WXH A;  5LRR A;  4RB2 C;  2EB7 A;  2ADU A;  3R61 A;  1DUX C;  1QNT A;  4M9Z A;  2VBW A;  1YW8 A;  2J5O A;  3H3Z A;  4BH9 A;  1R22 A;  4IVN A;  4WXC A;  3L09 A;  3WE3 A;  1OKR A;  4XLN F;  1CF7 B;  3DV8 A;  3B02 A;  4LD5 A;  2CO5 A;  3BY6 A;  3PFI A;  2IPQ X;  2HQR A;  4Q4Z F;  4DNC A;  5D5X B;  2MBF A;  2HS5 A;  2QBY A;  5CVI A;  2DTR A;  3WTT C;  2DK5 A;  3ROU A;  5J6X A;  2JSC A;  3JAM Z;  3DEU A;  3GZ5 A;  1JHF A;  3I64 A;  4G7O F;  2CG4 A;  1F9N A;  3TKY A;  3IRR A;  4HF2 A;  2FA5 A;  3RPU A;  5D5U B;  4OOI A;  2OU2 A;  3E6M A;  1YIO A;  1HQC A;  3L7W A;  4Y13 A;  1J2X A;  2FEZ A;  2PJP A;  1GXQ A;  5HDK A;  3P9K A;  1KU7 A;  4GGG A;  3HSF A;  1TQM A;  1ZRC A;  2FOK A;  3GXO A;  4KFC A;  3MCZ A;  3WTZ A;  4CXF A;  2A69 F;  1HKQ A;  1BI0 A;  5IT9 K;  3HRS A;  5FD6 A;  3ZMS A;  4MGR A;  4G9Y A;  1BI3 A;  3T0Y A;  5FLX Z;  2E1N A;  4LB6 B;  3KP4 A;  3VFZ A;  3KZY A;  1L0O C;  5AIQ A;  3T1B A;  4NB5 A;  4A0Z A;  4A12 A;  4L9J A;  1F5T A;  3W6K B;  3GVA A;  2FBI A;  1HSJ A;  2XIG A;  3ZMT A;  3JSO A;  3KP5 A;  2DT5 A;  4LLG F;  3K69 A;  2D1H A;  3QPH A;  2Y48 A;  4M72 A;  1R58 A;  4L5J A;  1HW2 A;  3MFK A;  1RIO H;  1LJ9 A;  4MHG A;  3PQJ A;  3HTS B;  1S7A A;  2H6C A;  4A2U A;  3G3Z A;  3RPQ A;  4Y15 A;  2TDX A;  2VE9 A;  1A04 A;  2QBY B;  3AAF A;  2MD5 A;  2F5F A;  4L9T A;  2M87 A;  1U6G A;  4HQE A;  2W84 A;  1J9I A;  3F21 A;  4ON0 A;  5J8F A;  2LNB A;  5CVV A;  2ESN A;  5KVR A;  4I01 A;  2G7U A;  2IT0 A;  2P6S A;  1QPM A;  1YTY A;  2AXL A;  4LK0 F;  2Z33 A;  4G94 A;  5ILU A;  2IVM A;  4HLY A;  2L01 A;  4AIH A;  5BPI A;  5DCF A;  2ELH A;  5CVJ A;  1EV7 A;  4A5M A;  4EVI A;  2OZ6 A;  2HYG D;  2DI3 A;  4KN4 X;  3HTU A;  1Z9C A;  4LLL A;  4KIC A;  2C6Y A;  4RGX A;  3RJP A;  4UXN A;  4WX9 A;  4HYE A;  1S29 A;  5A2Q K;  3R60 A;  1P92 A;  2XRN A;  2DW4 A;  1HKT A;  2OD5 A;  1STZ A;  4YFX F;  2ETH A;  5FGM A;  2ZFW A;  2K4J A;  2V1D A;  4IHT A;  1OYI A;  3CUQ C;  2BGC A;  5D5V B;  2FXA A;  4EJV A;  4LK1 F;  4QLC U;  2ACJ A;  3EDP A;  4M6Y A;  2A3S A;  2BV6 A;  4I0A A;  5DV5 A;  4XSZ F;  2VBX A;  3F8M A;  3V8L A;  1F1Z A;  5D6F A;  3ABT A;  4UVC A;  1WI9 A;  1W7P B;  4GXO A;  4WF2 A;  2YX7 A;  1C0W A;  5L3D A;  4FX4 A;  2H6B A;  4OIP F;  3CLO A;  2KJC A;  3R0J A;  1MD0 A;  4KDP A;  3CUQ B;  2ISY A;  3SFZ A;  3RKW A;  4BYY A;  1YO5 C;  2HWV A;  3FZV A;  5F1R A;  3BRO A;  5DD4 A;  1FPQ A;  5DCM A;  4ZZL A;  1IRF A;  3LAJ A;  1R1T A;  2EA2 A;  3HRM A;  4U7D A;  3H92 A;  3K2Z A;  3I58 A;  3FX3 A;  4UV9 A;  2QUF A;  3T8T A;  3V7S A;  2D1V A;  3VEP A;  1FYK A;  2HOE A;  2IJL A;  1S8N A;  3M9A A;  4U7B A;  4KA4 A;  4HDV A;  3KZZ A;  3KP6 A;  3EYI A;  2F2E A;  2W57 A;  4U0Y A;  3HSR A;  4MEX F;  1ZHF A;  5BMZ A;  2P5L C;  2V6C A;  2XAJ A;  1YYV A;  4B8X A;  2Y0M A;  4R8H A;  4A6E A;  1G3S A;  3RIR A;  1OYY A;  3IKV A;  3IWF A;  3WG9 A;  3WTS C;  4KMU X;  4G7H F;  2V9V A;  1UST A;  5D4R A;  5D6E A;  1U2W A;  2FQ3 A;  3DQV C;  5AON A;  4H0E A;  3JW4 A;  2HYF A;  1LEA A;  2EV0 A;  2P7C B;  1YS7 A;  2KJB A;  2JPB A;  3E5X A;  1IW7 F;  1P4A A;  2EFP A;  3HYI A;  5HS9 A;  4A0Y A;  3Q9S A;  3WTU C;  4YG2 F;  4Y17 A;  1P4W A;  1FP2 A;  5DUK A;  4HF0 A;  1RUO A;  3ML6 A;  5HLG A;  4IRH A;  3M8F A;  5DUI A;  5BOX A;  4RGR A;  2OAZ A;  1U5T B;  1BOA A;  3E6B A;  2AS5 F;  4IJA A;  5IT9 Z;  2LF8 A;  2DU9 A;  5E17 F;  4M74 A;  1G3T A;  1K78 B;  1U78 A;  1I1G A;  1SFU A;  1XN7 A;  2RGV A;  3QU6 A;  3ZP5 A;  2WC2 A;  4G6Q A;  4BNC A;  1LEB A;  2RKH A;  4JBA A;  3N4M A;  3HRU A;  3G73 A;  1ODD A;  1AOY A;  2BYV E;  2VC1 A;  2M8E A;  1WKM A;  4XBF A;  3F22 A;  3IRQ A;  2FMY A;  3MZY A;  3ZMV A;  1BC8 C;  4ESB A;  4R79 A;  4EM2 A;  1FT9 A;  3C3W A;  4WXD A;  4L0Y B;  1XB4 A;  3F8N A;  3KEO A;  1ZRD A;  1I6X A;  3FXR A;  3MEX A;  3F23 A;  5DCM B;  5L3G A;  5CYV A;  1TBX A;  3I0T A;  1TTY A;  1RI7 A;  3KET A;  2YSR A;  3DPL C;  1B9M A;  4CYD A;  5E18 F;  3S2W A;  1KA8 A;  4BXU A;  3GZ6 A;  2FRH A;  1TW3 A;  1FBQ A;  5E1X A;  4OMZ A;  3I71 A;  4ENM A;  4A6D A;  1U5T C;  2KIU A;  1IXR C;  1XDS A;  3LWF A;  3QU3 A;  2NNY A;  1XD7 A;  4RB3 C;  3COA C;  5LGT A;  3BJ6 A;  2VOD A;  4M6X A;  3IHU A;  3WOD F;  1SD7 A;  2P5K A;  3WGI A;  1HKS A;  3P7N A;  4RGS A;  4I0B A;  1FY7 A;  2M30 A;  4ZH4 F;  3GEZ A;  2ZNZ A;  4EQQ A;  3J80 Z;  3IWZ A;  2WWY A;  3VOE A;  3BJA A;  3TQN A;  5TJJ A;  4ZZD A;  4P96 A;  2GAU A;  4GO1 A;  4N0B A;  4KIF A;  1NHA A;  1U3E M;  4UVB A;  3DPT A;  3ZQ7 A;  1SMY F;  2E7W A;  4S04 A;  3Q9V A;  5BQT A;  2PBI A;  2HZT A;  1BC7 C;  2CGP A;  4TV7 A;  2DLL A;  1OR7 A;  2HQN A;  1KU9 A;  2MLG A;  4FX0 A;  4ENK A;  3MAJ A;  1LB2 A;  2IRF G;  1YW9 A;  1Z1D A;  2YPR A;  1IXS B;  1QZY A;  3J7A O;  2XVC A;  1O57 A;  1I5Z A;  4ESJ A;  4RS8 A;  4AIK A;  5LRS A;  4U88 A;  4P55 A;  2EFW A;  1OPC A;  4LMY A;  4HBL A;  3U9G A;  3F72 A;  2DQR A;  4XSX F;  4GYG A;  3GYH X;  2XV4 S;  1HW1 A;  5CLS A;  3F3X A;  1KQ0 A;  3ECH A;  4MNU A;  1SMT A;  4ASN A;  3B73 A;  2H09 A;  4OMY A;  5ED4 A;  1BIB A;  1MGT A;  3OOP A;  3LA3 A;  3VOD A;  2EK5 A;  3RKX A;  1ZYR F;  5HLH A;  3RDI A;  5L3F A;  2MLK A;  5HDN A;  1I27 A;  3WE2 A;  2YU3 A;  2PN6 A;  1LDD A;  4AIJ A;  4KNY A;  3KP7 A;  2QVO A;  5L3B A;  3BWG A;  4GCV A;  3BZ6 A;  3KE2 A;  2QQA A;  5ERI A;  4I7H A;  2CFX A;  1P6R A;  1XSX A;  4MQV A;  3TDU C;  1S7O A;  4YFN F;  3SHF A;  2VBZ A;  2W25 A;  2J5P A;  5H6Q A;  3F6V A;  3HUG A;  4IRG A;  5HVQ C;  4IPA A;  3ISP A;  3P9C A;  1J5Y A;  3U2R A;  5JFR A;  1FOK A;  2H94 A;  2FNA A;  3I53 A;  3WU1 B;  2XGX A;  1ZGJ A;  5LHH A;  1J7K A;  2HFH A;  3KP2 A;  3P9I A;  4OIN F;  3F8C A;  3U1D A;  4I09 A;  3RYR A;  4Z2Y A;  1EH8 A;  1BIA A;  3JTH A;  2RVC A;  5ICC A;  1SFE A;  2L4M A;  5LGU A;  2ZNY A;  1YFH A;  3C7J A;  3ZN1 A;  2VT2 A;  3HIF A;  2A6H F;  3RTR A;  1ZG5 A;  2V79 A;  4MTE A;  3HSE A;  1YLF A;  1SD5 A;  3TOB A;  3D0S A;  4WWC A;  3RKY A;  3HOT A;  5LLQ A;  1P4X A;  2DK8 A;  1LDK B;  2CW0 F;  2XUB A;  2P7V B;  5FFX A;  4IF4 A;  4EGY A;  1RUN A;  3FXU A;  2UZK A;  4F7Z A;  2FNP A;  1ON2 A;  2QYO A;  2VT3 A;  1T38 A;  3ZMZ A;  3C18 A;  2HTS A;  2Q0O A;  1RNL A;  4HQM A;  2XKO A;  2MH2 A;  4EM0 B;  2RNJ A;  4O3M A;  1XGO A;  2JPC A;  3WTV C;  2GWR A;  3GW2 A;  1HXD A;  4XRF A;  1XDU A;  1DPU A;  3ZN0 A;  5DYM A;  3KCC A;  2NS0 A;  5F6F A;  1UCR A;  4LG0 B;  1SD6 A;  3SZP A;  3E5Q A;  1Z05 A;  4ZYH A;  5K1Y A;  4EJT A;  4Q47 A;  4L9V A;  2H27 A;  2Y75 A;  2RDP A;  3EUH A;  4N9H A;  2Z3Y A;  1QGP A;  4G7Z F;  2O0Y A;  1ZH5 A;  2K27 A;  4HF1 A;  1HBX G;  2IP2 A;  2P5V A;  5D8L B;  1ZG1 A;  4OIQ F;  5E8I A;  4HA8 A;  4K2E A;  1J59 A;  1IZ1 A;  2EWN A;  4I2O A;  3DP7 A;  4YII A;  4EM1 A;  3F6O A;  3V8K A;  3OV8 A;  2OQG A;  2W24 A;  3EYY A;  1LVA A;  5JI6 A;  4OIO F;  5K5Q A;  5FD5 A;  3R4K A;  1D8K A;  4OU0 A;  2HEO A;  1FNN A;  2D45 A;  2BEO A;  1KGS A;  3K9T A;  1D5V A;  3J80 K;  1WQ2 A;  3L2C A;  1FX7 A;  2NAZ A;  1LQ1 A;  2CWE A;  3ELK A;  1IN6 A;  2EJR A;  4RAZ A;  2L54 A;  4D0P A;  3ULQ B;  3D5L A;  1ONV A;  4P9U A;  3LFK A;  1TNS A;  4HX7 A;  2K86 A;  1H0M A;  4HV5 A;  3V7C A;  1JE8 A;  1IN4 A;  1ZRF A;  5ICF A;  2XAG A;  1XCV A;  4M73 A;  3VB2 A;  2ZCW A;  2F5D A;  2JRT A;  2CYY A;  3JTG A;  3TOA A;  1T0F A;  2BBY A;  1IAW A;  3E97 A;  2L02 A;  2DBB A;  1IF1 A;  1B9N A;  1V3F A;  4G6D A;  4I98 B;  4CZZ A;  5HS8 A;  2W85 A;  2GA1 A;  2PMH A;  3CO7 C;  1REP C;  2XKP A;  1W7P D;  3FF5 A;  4HV6 A;  2ZKZ A;  5K5O A;  1UHM A;  2PQ8 A;  1B59 A;  2R7F A;  4ENN A;  2KKO A;  5LHI A;  1E17 A;  5JVT A;  1D8J A;  3RYP A;  4L18 B;  5K5R A;  1GVJ A;  1O3Q A;  3WGG A;  3SZT A;  1KU3 A;  2ZO4 A;  4KT5 C;  4EV0 A;  2GA2 A;  1IN5 A;  3QAH A;  2XAH A;  3FMR A;  4XLP F;  5FB2 A;  3CO6 C;  1TW2 A;  5D5W B;  1K79 A;  1R00 A;  4BHB A;  4UHT A;  4UUV A;  1RZ4 A;  4CHU A;  5L3E A;  2Q8K A;  1FSH A;  2P8T A;  3R0A A;  3KLN A;  4PDK A;  1ZN2 A;  4AD9 A;  4Q5S F;  1MJB A;  1G3Y A;  1B1B A;  3ZPL A;  2XRO A;  2FML A;  2X0L A;  1KQ8 A;  2EFO A;  4A5N A;  4HDU A;  5JR3 A;  4CIC A;  2A6E F;  4JK1 X;  1YQA A;  2CQK A;  4PCQ A;  5H20 A;  4L0Z B;  1K7A A;  1T6S A;  5J8C A;  2A61 A;  2Z5U A;  1O7L A;  2M1B A;  5CJ9 A;  4RGU A;  2P4W A;  2VE8 A;  5JHU A;  2DPD A;  2IW5 A;  1HST A;  4UVA A;  3GFM A;  4FT8 A;  4KUM A;  1O7F A;  2EFQ A;  1XGN A;  4GYI A;  3F8B A;  1R1V A;  1O3R A;  1XSV A;  1K6O A;  1JGS A;  2B0L A;  4PGG A;  1XGS A;  5H6R A;  1KYZ A;  4U0W A;  4WK8 F;  2R3S A;  3E6D A;  4QWQ A;  1MZB A;  4YFK F;  1XSD A;  5A2Q Z;  1G4D A;  2X4H A;  2HKX A;  2O8X A;  1B6A A;  5ILV A;  2R7D A;  2QLZ A;  4JQF A;  4RB0 A;  3DXJ F;  3WTW C;  5BPD A;  5LHG A;  3TO7 A;  5E20 A;  3BPV A;  1R23 A;  4IXA A;  2RN7 A;  3F8F A;  1S6L A;  2DAO A;  1J75 A;  1FYM A;  1SD4 A;  1YS6 A;  4AVP A;  2IA0 A;  4N9I A;  2JT1 A;  3LQR A;  2QQ9 A;  2OA4 A;  1H9T A;  3HOS A;  3DF8 A;  1QBJ A;  3GX4 X;  1UB9 A;  3MZH A;  2D2W A;  3WGH A;  3M8E A;  5LBQ A;  3ECO A;  1EH6 A;  1FBU A;  4I02 A;  5F64 A;  1XCB A;  3K0L A;  2FF4 A;  4AWX B;  1W5S A;  1IN7 A;  2DQL A;  2O61 A;  2F5E A;  3ERE D;  2GZW A;  4O5V A;  3W6J B;  1FSE A;  1R5H A;  1DPR A;  3PQK A;  4LLN A;  1MKM A;  3JAM K;  2ZME A;  3IKT A;  2UWM A;  3FMQ A;  3M7G A;  1XMK A;  4PGH A;  5DDG A;  4EGZ A;  3EET A;  1PP7 U;  3I59 A;  2LDU A;  2XAS A;  1CF7 A;  5HDG A;  3FM3 A;  3FHZ A;  3LST A;  3WTX C;  4HZF A;  1Q1H A;  4LGW A;  1BM9 A;  2OQR A;  5AIP A;  3MWM A;  1Y0U A;  1MDM A;  3I54 A;  4KYW A;  3CTA A;  3KP3 A;  2UXN A;  4KMF A;  1L3L A;  1UFM A;  2A68 F;  2FBH A;  2ISZ A;  2L3D A;  3BPX A;  1E2X A;  4KIB A;  2OBP A;  3I4P A;  2FBK A;  4CDG A;  2HKO A;  3BP8 A;  2QQB A;  5HLI A;  1KQ9 A;  1ZRE A;  5FO5 A;  2WV0 A;  2NYX A;  2E7X A;  2FU4 A;  2V1U A;  2O03 A;  2IA2 A;  4EJU A;  4ETS A;  3TO6 A;  1OMI A;  2DFI A;  1BBY A;  1P2F A;  4YIF A;  2EV6 A;  1ZLJ A;  4CO8 A;  2GXB A;  2VBY A;  2QEN A;  4RB1 A;  3JSP A;  4G8X A;  4B09 A;  5DEQ A;  1ZLK A;  1QQI A;  1TQP A;  1W5T A;  3L9F A;  3DFG A;  3I5U A;  3NQO A;  2A5Y B;  3HHG A;  1JHH A;  2VON A;  2RV8 A;  2EV5 A;  3GFL A;  4ZYE A;  4O6J A;  3FMS A;  4BQA A;  4EJW A;  2PMU A;  4E70 A;  2HR3 A;  3KEQ A;  1ZAR A;  1Z6R A;  3QPT A;  2VOP A;  3V4G A;  1V4R A;  4HOB A;  2O3F A;  1FZP B;  5LEJ A;  4HW0 A;  1D3Y A;  4HX4 A;  2VOO A;  1PP8 F;  3C1D A;  5IT3 A;  1TLH B;  1LNW A;  2V1X A;  4HX8 A;  2HGC A;  3T5X A;  1HW5 A;  1XGM A;  3BDD A;  1QO0 D;  2KIM A;  2WTE A;  1W4M A;  3J81 Z;  3FM5 A;  2NRA C;  1FBS A;  2NNN A;  4EMS A;  1UHW A;  1IXC A;  2PEX A;  2ESH A;  1VTN C;  5FLX K;  4ESF A;  1SFX A;  3ZMU A;  2P6T A;  3LA7 A;  4U0V A;  5EEH A; 
#chains in the Genus database with same CATH topology
 3QYE A;  2CSO A;  1X3U A;  1T08 B;  1TWC J;  4KN7 X;  2B7E A;  2D5V A;  2UXX A;  1TQI A;  2QWW A;  4NQW A;  4EJO A;  2HDC A;  2W48 A;  2FSW A;  3GLL A;  3JCU C;  2BHZ A;  4EEF G;  2IA1 A;  2O6M A;  3H36 A;  1PVE A;  2A5W A;  1MBE A;  3HL2 A;  4IHW A;  2L4A A;  3WHB A;  1BA5 A;  3QP6 A;  2F48 A;  3I59 B;  4BE1 A;  3CUO A;  1JXS A;  2ZME B;  5BS6 A;  4PJM A;  4MLO A;  3VSL A;  4ENJ A;  3TW7 A;  2QZ8 A;  5J1Y A;  1AWC A;  4ZYG A;  9ANT A;  2XC7 A;  3FIW A;  4B48 A;  3GFI A;  3SJM A;  4XQF A;  2KP6 A;  1U8R A;  2NVX J;  2XB0 X;  4CH7 A;  2BOL A;  4L5E A;  1VQ4 I;  1WJB A;  2PMZ N;  2JTV A;  1ZG3 A;  4ZTJ A;  3S1M J;  1AU7 A;  3L2V A;  1OCT C;  2IGN A;  5EF6 A;  3E6C C;  4HAM A;  2VXD A;  4JP0 A;  1D1C A;  5CVR A;  1OYW A;  4AVZ A;  3BR2 A;  3WTY C;  1X3Z B;  2CW7 A;  2YX4 A;  3BOQ A;  2E71 A;  1MJA A;  1Z3Y A;  2JVH A;  3IC7 A;  1Y6I A;  1YG2 A;  4NUB A;  1V5F A;  1FC3 A;  2KRF A;  2XPV A;  1MDM B;  2FE3 A;  2YR2 A;  3IL2 A;  1GXP A;  3GO5 A;  2ZME C;  1H9G A;  5F0F A;  3LSJ A;  2RNG A;  3FXQ A;  3GF2 A;  3QPS A;  1E3H A;  2GQQ A;  4G12 A;  4MQ9 F;  2NXN B;  3N97 A;  1Z7U A;  4UV8 A;  1S3J A;  1JTY A;  1YW7 A;  2XAF A;  1T2K A;  5K7F A;  1W5C C;  1BI1 A;  5EG0 A;  5B66 C;  3HJE A;  3Q5F A;  3IH4 A;  1ZAO A;  1ON1 A;  2VPR A;  2O6G E;  3ABU A;  3M1E A;  1JT0 A;  1IG7 A;  4L9N A;  3GTQ J;  3QRF F;  4NHJ A;  4F91 B;  3HKZ A;  4J19 A;  5EEG A;  4P5O A;  4M71 A;  4A3C J;  1W7P A;  5CQG A;  2JMW A;  1R5G A;  4L5I A;  1D0Z A;  2ME0 A;  2Q2E A;  5LEK A;  1DP7 P;  4N4O B;  1R4N B;  4BJ6 C;  3MQ0 A;  3W3C A;  1V5G A;  2E1M C;  1OIS A;  2JN6 A;  2AQE A;  4LFU A;  2XAQ A;  2GIZ A;  2GBY A;  3A02 A;  1VND A;  3SQN A;  4B1R A;  1G6N A;  2LSO A;  3G71 I;  4XM3 A;  4ZYA A;  3GTM J;  1ZGA A;  1X2M A;  2QM3 A;  3PNV A;  3HG9 A;  2W7N A;  2ZJP F;  1PUF A;  2MA3 A;  3QOP A;  3DBH B;  4FQG A;  1R7J A;  4NC6 A;  2KPM A;  1X1P A;  4HSR A;  1T39 A;  4FHT A;  1SVL A;  5ICG A;  1WWX A;  3BQZ A;  1WRJ A;  3NEU A;  1SFO J;  2M5W A;  2RRE A;  2DPU A;  2LC2 A;  5ILS A;  1Z21 A;  3LNQ A;  1VQO I;  1FYL A;  2A07 F;  3E1S A;  4ZJZ A;  4LB5 A;  2EA4 A;  4DBR A;  1T98 A;  4S0H B;  1Z91 A;  4XLC A;  3H3V K;  1R36 A;  1XMA A;  4CCJ A;  4A3M J;  1VQ7 I;  3REO A;  3EQL F;  5D8K B;  3NRV A;  2I10 A;  2OZU A;  4FE4 A;  4BHC A;  1ZKG A;  4UNO A;  3BLY A;  1E3O C;  5E1Z B;  3O8G A;  6PAX A;  2JRM A;  4YEJ A;  1I1S A;  2X1D A;  2COM A;  3SXY A;  3OYA A;  3LAP A;  1LDJ A;  4HLX A;  1LE8 B;  5B5E C;  2GXG A;  3WU0 A;  2XGC A;  1X4O A;  4M9X A;  3L2R A;  2XHK A;  1QU3 A;  2L9V A;  2Y69 H;  2K7L A;  2BXZ A;  3O6B B;  4IQJ A;  4IZZ A;  2HXO A;  3DTK A;  4OIR F;  3OYI A;  3DLL F;  1F4K A;  4B3X A;  2ECB A;  2XB5 A;  1DGR M;  1Y56 A;  1TL8 A;  5J4Y A;  4X1E A;  2QGU A;  1JKP C;  1WJC A;  2HNH A;  4LIU A;  3CCJ I;  1D0X A;  2LG4 A;  3HRT A;  4ZDP A;  1MSE C;  1N77 A;  3ABM H;  4XON A;  3BR6 A;  5FKM A;  2ZBK A;  2OPT A;  1FLI A;  1YJW I;  2LKP A;  1GHC A;  2FUG 2;  5L3C A;  1FOX A;  2G7H A;  2ZJ2 A;  3CUQ A;  3MVP A;  3ZQQ A;  1EH7 A;  3L00 A;  1QZZ A;  1CQT A;  2PG4 A;  2VC0 A;  4RLQ A;  3G4S I;  1JUS A;  1X1C A;  2DO7 A;  3Q0W A;  4IRI A;  1OCR H;  3O2P E;  1Z7L A;  2MH9 A;  3TGN A;  3TO9 A;  2CUE A;  2PLY A;  1CYQ A;  3JRH A;  1K4T A;  4QPQ A;  2LH9 A;  1BI2 A;  2L7F P;  4KT6 A;  1MBF A;  1CGP A;  1DDN A;  2BY2 A;  4BXX J;  4Y33 A;  2F5C A;  2R7X A;  4AID A;  1ULY A;  4OWR B;  1IO2 A;  3LQQ A;  1WSU A;  4MEY F;  4IL6 C;  4S05 A;  3PIP F;  1IUY A;  5GPA A;  1O3S A;  2A6T A;  2HPM A;  2K4B A;  5D4S A;  1FIP A;  3H3U A;  1UG0 A;  1R1U A;  2MC3 A;  2OCE A;  2Y2Z A;  4ZYD A;  4A0X A;  2JZY A;  2STW A;  4IHS A;  5FFZ A;  2K02 A;  3NAU A;  3DKW A;  2Z2S B;  3BT9 A;  4FAS D;  1WVR A;  3HHH A;  1BR1 A;  1D1B A;  3BJO A;  3CJN A;  3LA2 A;  4IX7 A;  5CVU A;  1ZK8 A;  1I50 J;  2VN2 A;  3GLX A;  4M3D A;  1K78 A;  2STT A;  5DD8 A;  2ECC A;  3WHC A;  1IJW C;  2E2I J;  4Y52 J;  3KLO A;  2LLK A;  3GWZ A;  3B6C A;  1XC5 A;  4RAY A;  2Z16 A;  3OYJ A;  2M45 A;  1KU2 A;  2WB1 A;  2G9W A;  3CC7 I;  3T8R A;  5HS7 A;  2DOE A;  1ETK A;  1TNT A;  2Z1D A;  5HNH A;  2ZXJ A;  4BXF A;  3BTL A;  2PI0 A;  2LF7 A;  1XPX A;  1G8X A;  4E4H A;  5ICE A;  3QP5 A;  1USS A;  4XLE A;  4KIS A;  5LGN A;  3CP2 A;  2EFN A;  2VJ5 A;  5GAG J;  4KIG A;  1BJA A;  4P9F A;  2HTJ A;  5E1W A;  2V4J C;  2VXZ A;  1AA7 A;  2KRH A;  4E6K G;  1MJ9 A;  1TT5 B;  1PUE E;  2R7S A;  2DA2 A;  5HOO A;  1PDN C;  3AFH A;  4BQQ A;  1XMX A;  2KLO A;  2Z9O A;  2HQA A;  1Z6T A;  1FWZ A;  3FXJ A;  1VQ9 I;  5TGT A;  1FIA A;  2BE5 F;  3RI4 A;  2Y0S N;  3CDH A;  1JKQ C;  1ZEL A;  3K1N A;  1X19 A;  3E5U A;  3K1P A;  5FKN A;  1O3T A;  3V7R A;  4R1H A;  2L2O A;  4BHP A;  4DYC A;  2KDZ A;  1J0R A;  1G3W A;  3R6S A;  2EIL H;  2GIV A;  2F5V A;  2RQP A;  2OC6 A;  5EEA A;  3GTO J;  4YEL A;  5F0H A;  1BN5 A;  2QA4 I;  3O3K A;  1MSF C;  3J81 K;  1W1W E;  5J47 A;  3ZMD A;  1U5T A;  4LG0 A;  1IN8 A;  2CQX A;  3LSI A;  4LJZ F;  3GUD A;  3W2V A;  3V8J A;  2GM4 A;  3K1M A;  1FP1 D;  3G2B A;  2DYS H;  4BAY A;  2Z99 A;  1IRG A;  2E1C A;  3TDZ C;  2R7Q A;  2RC4 A;  2K9S A;  4CGZ A;  2DT6 A;  1YI2 I;  3A0B C;  1B4A A;  4PZJ A;  4Q48 A;  1BJZ A;  4M9S A;  1WCM J;  3E3V A;  5TRD A;  3JRF A;  2CMP A;  2PFB A;  3GFJ A;  2PMZ A;  1V55 H;  1RKT A;  2KIF A;  3PL8 A;  5KK1 A;  1VQL I;  3KFW X;  4MTD A;  1RC9 A;  2LYC A;  1IUF A;  2KHM A;  3FXO A;  5E8G A;  4BY7 J;  4DQ2 A;  4WCG A;  4FIS A;  1KYW A;  1SAX A;  3FWE A;  4WXH A;  5JHF A;  5LRR A;  4RB2 C;  2EB7 A;  3TMO A;  2VQG A;  4BS9 A;  1VQN I;  4V2G A;  2ADU A;  3R61 A;  1DUX C;  5C3E J;  1QNT A;  4JX6 A;  4CYC B;  2JA6 J;  4M9Z A;  3OYN A;  2N8G A;  2ZJQ F;  2VBW A;  1UG2 A;  1YW8 A;  2J5O A;  2E19 A;  3H3Z A;  4BH9 A;  2M2E A;  4BQN A;  1R22 A;  4IVN A;  4WXC A;  3IP4 B;  2XPW A;  3L09 A;  2XF5 A;  2EIK H;  3WE3 A;  1OKR A;  2HZD A;  4XLN F;  3VYS B;  1QRY A;  1RET A;  3DV8 A;  3B02 A;  4LD5 A;  3S32 A;  1CF7 B;  3A2K A;  2O7O A;  2CO5 A;  3BY6 A;  5M5Y J;  4XNF A;  2IS6 A;  3RZO J;  3PFI A;  4V19 K;  4E7L A;  1ETO A;  2IPQ X;  2HQR A;  3LL7 A;  4Q4Z F;  3I56 I;  4DNC A;  1ZR2 A;  5D5X B;  2BY0 A;  4RM2 A;  2L9S A;  4ZDO A;  2EPF A;  3CZ6 A;  2MBF A;  2HS5 A;  3HKZ N;  2QBY A;  5CVI A;  2DTR A;  3WTT C;  4HRI A;  2DK5 A;  3ROU A;  5J6X A;  2ELJ A;  1MW7 A;  1DU6 A;  2JSC A;  3ZQI A;  3GBG A;  2DA6 A;  3JAM Z;  3DEU A;  1HF0 A;  3GZ5 A;  3OIQ A;  1JHF A;  3I64 A;  2JA8 J;  2K9N A;  2R93 J;  4G7O F;  1I3Q J;  3VDX A;  3AG4 H;  2CG4 A;  1F9N A;  3TKY A;  3IRR A;  2DFH A;  4HF2 A;  2BW3 A;  2E2J J;  2FA5 A;  3RPU A;  5D5U B;  2WA0 A;  1FMV A;  3AG2 H;  1XG1 A;  2XF6 A;  4OOI A;  2OU2 A;  3LSK A;  3E6M A;  2DDA A;  3HOU J;  1YIO A;  2WV1 A;  1A35 A;  3BR1 A;  1HQC A;  3L7W A;  4Y13 A;  1MH3 A;  1J2X A;  3PM1 A;  3K7A J;  2FEZ A;  2PJP A;  1GXQ A;  3CCR I;  3J7A Y;  1YHQ I;  5HDK A;  3P9K A;  1ITY A;  1KU7 A;  2MD0 A;  2MW8 A;  3OWT A;  1ORK A;  4GGG A;  2LBF B;  3HSF A;  1TQM A;  1IPP A;  2R92 J;  3MKZ A;  1R71 A;  2ELK A;  1ZRC A;  3W2W A;  2HOA A;  2FOK A;  3DU6 A;  3GXO A;  4KFC A;  3OS1 A;  3A0H C;  3MCZ A;  2G0E A;  3OYD A;  3WTZ A;  4CXF A;  2A69 F;  2QQ8 A;  1HKQ A;  1BI0 A;  5IT9 K;  2R7Z J;  3HRS A;  5FD6 A;  3ZMS A;  1FMW A;  4MGR A;  4G9Y A;  2UV1 A;  1BI3 A;  3T0Y A;  2E1N A;  4LB6 B;  5FLX Z;  3DTI A;  3KP4 A;  3BG5 A;  3VFZ A;  3KZY A;  2QEX I;  1L0O C;  5AIQ A;  3T1B A;  4NB5 A;  3PIO F;  2TCT A;  4A0Z A;  4BDY A;  4A12 A;  4L9J A;  4NDL A;  3SFI A;  1F5T A;  4GFB A;  4W1U A;  3GVA A;  3W6K B;  1JT6 A;  2JK3 A;  2FBI A;  2JVG A;  1HSJ A;  2XIG A;  3ZMT A;  2R7V A;  1WJD A;  2HOS A;  3JSO A;  4DZJ A;  3KP5 A;  1WHU A;  2DT5 A;  4LLG F;  3OSG A;  5LFA A;  1X4P A;  4QSH A;  3K69 A;  2D1H A;  1OJL A;  4XOR A;  3QPH A;  4DJA A;  1U8B A;  2JSP A;  2Y48 A;  4M72 A;  1R58 A;  4PSX A;  1AKH B;  2HVR A;  4L5J A;  2HU9 A;  4PFP A;  3U21 A;  1HW2 A;  3ZQG A;  1R4M B;  2UUZ A;  3MFK A;  1RIO H;  5FJ8 J;  3CCE I;  3VYR B;  4BJT A;  3BCB A;  1LJ9 A;  4MHG A;  3OR2 C;  3UKG A;  3HEF A;  3PQJ A;  1S7A A;  3HTS B;  2H6C A;  4A2U A;  1UMQ A;  3OYB A;  3G3Z A;  1T33 A;  4XLF A;  3P5J A;  4Y15 A;  1X3W B;  3RPQ A;  2TDX A;  2VE9 A;  2KDO A;  1A04 A;  2QBY B;  3AAF A;  2MD5 A;  2F5F A;  4L9T A;  1D1A A;  3IAM 2;  3DU5 A;  4PJL A;  2M87 A;  2MC4 A;  5KNL A;  1U6G A;  4HQE A;  4PJJ A;  1HOM A;  4BJ5 C;  2DOD A;  2W84 A;  4JX4 A;  3OR1 C;  3DEW A;  1J9I A;  5EZG A;  5EG0 B;  1NH3 A;  3F21 A;  4ON0 A;  4A3L J;  1GV5 A;  5J8F A;  2LNB A;  5CVV A;  2ESN A;  5KVR A;  4I01 A;  2G7U A;  2IT0 A;  4Y3O A;  2LP0 A;  2P6S A;  5F0C A;  5DTD A;  1HA8 A;  3LMM A;  4C3J J;  4XLA A;  1XS9 A;  4C9Y A;  1TC3 C;  1QPM A;  1YTY A;  2AXL A;  4LK0 F;  3K6G A;  1W36 D;  2Z33 A;  4G94 A;  2QSG X;  5ILU A;  2IVM A;  2ZFU A;  5F1J A;  4HLY A;  1RR8 C;  2L01 A;  1BW5 A;  4AIH A;  5BPI A;  5DCF A;  2ELH A;  5CVJ A;  4C2U A;  1EV7 A;  1N25 A;  2W00 A;  1YRN B;  3HZJ A;  4A5M A;  5E3O A;  3KPH A;  4EVI A;  2LY1 A;  2OZ6 A;  3LSG A;  4A3F J;  2HYG D;  2DI3 A;  4KN4 X;  3HTU A;  1Z9C A;  2R5Z B;  4LLL A;  2R5Y A;  1S9H A;  4I6Z A;  4KIC A;  2CV1 A;  2C6Y A;  5IYD J;  4RGX A;  3RJP A;  4UXN A;  1PUF B;  2DMN A;  4E7I A;  2CUJ A;  3CCS I;  4WX9 A;  4HYE A;  1S29 A;  5A2Q K;  2GXA A;  3R60 A;  1EVW A;  1P92 A;  2XRN A;  3OIO A;  4ANJ A;  2DW4 A;  1HKT A;  1OLT A;  2E36 A;  3FBN B;  2L7Z A;  5EGO A;  4AU7 A;  3CCY A;  3LSR A;  2OD5 A;  1STZ A;  1OCO H;  2DMP A;  1D5Y A;  2OV7 A;  4ZTF A;  2LD5 A;  1Z0X A;  3EPZ A;  4YFX F;  4N4N B;  1W0U A;  2DFE A;  2ICW G;  5EZH A;  2K9M A;  2ETH A;  5FGM A;  1HC8 A;  3K4M A;  2ZFW A;  2K4J A;  2V1D A;  4II2 A;  2CS3 A;  4XID A;  1OYI A;  4IHT A;  3CUQ C;  2BGC A;  5D5V B;  2NVQ J;  2H1L A;  4LOC A;  4FTH A;  4HNT A;  3D5R C;  2DYR H;  4ZDL A;  5JLX A;  2FXA A;  4EJV A;  3FXM A;  3OYM A;  4LK1 F;  2VB6 A;  4ITV A;  4QLC U;  2ACJ A;  2CV0 A;  3EDP A;  4M6Y A;  2A3S A;  5JVG F;  2W82 A;  3FKJ A;  2BV6 A;  4I0A A;  4XSZ F;  2BHY A;  5DV5 A;  2VBX A;  3F8M A;  4E7S A;  3MKY B;  2DTZ A;  3ZQC A;  1F1Z A;  2XF7 A;  3V8L A;  2CH0 A;  5D6F A;  4QPO A;  3ABT A;  1OCZ H;  1WI9 A;  4UVC A;  1W7P B;  4GXO A;  1MBJ A;  4WF2 A;  2YX7 A;  3HOW J;  1C0W A;  5L3D A;  4FX4 A;  1W36 C;  2KIS A;  4D9J A;  2H6B A;  4OIP F;  3CLO A;  2KJC A;  3R0J A;  1MD0 A;  4KDP A;  2L5Q A;  3CUQ B;  2ISY A;  1BR2 A;  3RKW A;  3SFZ A;  2NVU B;  4BYY A;  1YO5 C;  2R7W A;  1G2H A;  2HWV A;  2IGM A;  3FZV A;  5F1R A;  3BRO A;  5DD4 A;  2LFB A;  1FPQ A;  5KAI C;  5DCM A;  4ZZL A;  1IRF A;  3LAJ A;  2ZSI B;  1WI3 A;  1R1T A;  4I76 A;  3LOC A;  2EA2 A;  3HRM A;  4U7D A;  2NVY J;  3H92 A;  1SC7 A;  3K2Z A;  3TBI A;  3I58 A;  3FX3 A;  4UV9 A;  4UUT A;  4UB6 C;  2QUF A;  3T8T A;  3V7S A;  2D1V A;  3VEP A;  1FYK A;  2WAQ N;  2HOE A;  2RQQ A;  2IJL A;  1S8N A;  3M9A A;  4U7B A;  4KA4 A;  4HDV A;  3KZZ A;  3KP6 A;  3EYI A;  2F2E A;  2CRG A;  2W57 A;  4U0Y A;  3I4N J;  2WAE A;  4XN0 A;  3HSR A;  4MEX F;  1ZHF A;  2DMU A;  5BMZ A;  2OUM A;  2P5L C;  2V6C A;  2XAJ A;  1GDT A;  1YYV A;  4B8X A;  1YRN A;  2Y0M A;  4D7M A;  2V6E A;  4R8H A;  3ZGK A;  4A6E A;  4RDU A;  4PFO A;  1G3S A;  3KEY A;  3RIR A;  1OYY A;  3IKV A;  3IWF A;  1X1D A;  3WG9 A;  3WTS C;  2VUM J;  3A4C A;  4KMU X;  4G7H F;  5IP7 J;  1QHH D;  2V9V A;  1UST A;  5D4R A;  1IV6 A;  1MMD A;  5D6E A;  5IY5 H;  4E7J A;  1U2W A;  1K6Y A;  2FQ3 A;  4MFD A;  3DQV C;  5AON A;  2DA1 A;  4H0E A;  3X2Q H;  3ZQL A;  3JW4 A;  4IHV A;  2HYF A;  1ETQ A;  2KRC A;  1LEA A;  2L7M P;  2EV0 A;  3NAR A;  5EGO B;  1BR4 A;  2P7C B;  1YS7 A;  2KJB A;  2JPB A;  3E5X A;  1IW7 F;  2M34 A;  1N78 A;  3CDL A;  1P4A A;  2EFP A;  2ID6 A;  2FD5 A;  3HYI A;  5HS9 A;  4A0Y A;  3BG9 A;  3Q9S A;  3S1R J;  1EVX A;  3WTU C;  2W1O A;  1VQM I;  3ZXS A;  4YG2 F;  1WPK A;  2K9Q A;  4Y17 A;  5KAF C;  1P4W A;  1FP2 A;  5DUK A;  3CC2 I;  4HF0 A;  3F9K A;  1JTX A;  2YUS A;  3HXL A;  3CCL I;  3SDB A;  2BVM A;  4CSW A;  3H0G J;  1RUO A;  1JKO C;  2HOT A;  4W97 A;  5EDN A;  1I6H J;  3ML6 A;  5HLG A;  2CJJ A;  1GV2 A;  2L9N A;  4IRH A;  3M8F A;  2XPU A;  5DUI A;  3ABK H;  5BOX A;  3HOZ J;  3JRE A;  4RGR A;  3VPR A;  1VQ6 I;  3K4C A;  5FRN A;  2OAZ A;  3A01 B;  1U5T B;  5J40 A;  2DN0 A;  1WJF A;  1BOA A;  2DDB A;  3E6B A;  4BGD A;  2R5Y B;  2AS5 F;  5IYB J;  4IJA A;  5IT9 Z;  4BUP A;  3ESW B;  2HI3 A;  1ZR4 A;  5J1U A;  2LF8 A;  4ABZ A;  3GTJ J;  2DU9 A;  5E17 F;  3H9G A;  4C30 A;  2M4K A;  1Y1W J;  4M74 A;  4XMY A;  1POG A;  1G3T A;  4DGW B;  3G6E I;  1K78 B;  1U78 A;  1D0Y A;  2R5Z A;  1OR7 C;  2X6O A;  4UUS B;  1I1G A;  1SFU A;  2WAD A;  5FKK A;  1XN7 A;  2IS2 A;  1WJA A;  2RGV A;  4CCM A;  3QU6 A;  2KZG A;  2AO9 A;  3ZP5 A;  2HDW A;  4RM3 A;  2WC2 A;  3AKZ A;  4G6Q A;  4BNC A;  1LEB A;  1FJL A;  3DEE A;  2RKH A;  4JBA A;  3N4M A;  3HRU A;  3G73 A;  1ODD A;  1AOY A;  3RQI A;  5EYR A;  4IHX A;  1GLN A;  2BYV E;  2VC1 A;  3TW6 A;  1F36 A;  3M07 A;  1ETV A;  2M8E A;  2MSY A;  1WKM A;  4XBF A;  3F22 A;  4ZC3 A;  2TRT A;  3IRQ A;  2DA5 A;  3V42 A;  3D1N I;  3F0C A;  3H1C A;  1WH7 A;  4BQO A;  4E7H A;  1A36 A;  2FMY A;  2MFZ A;  3MZY A;  3ZMV A;  1BC8 C;  4ESB A;  4PJN A;  4R79 A;  4EM2 A;  4IO9 F;  4XOP A;  1FT9 A;  3AG3 H;  3C3W A;  5F08 A;  3JRG A;  5GAE J;  2K9L A;  1VQ5 I;  2VKE A;  3TL4 X;  3AG1 H;  1SFK A;  4M3E A;  4WXD A;  2VQC A;  4L0Y B;  1XB4 A;  1IDZ A;  2EZH A;  4DOZ A;  3F8N A;  3L2W A;  2O9L A;  3GTP J;  3KEO A;  1ZRD A;  3ASN H;  3GTL J;  3FHN A;  1ETX A;  2AQF A;  3K2A A;  1I6X A;  5EJC A;  3FXR A;  3PO2 J;  5J3L A;  2V9K A;  3S14 J;  2I5U A;  5IYC J;  3RZD J;  2XGD A;  3KYC B;  4BY1 J;  4HST A;  2BY3 A;  1TT0 A;  3MEX A;  1BL0 A;  3F23 A;  2CQ7 A;  5DCM B;  5L3G A;  5CYV A;  1Y39 A;  1SVO A;  1TBX A;  1CZ0 A;  1RPW A;  2M7B A;  1XX5 A;  3I0T A;  1QVU A;  1WZ2 A;  3S3M A;  1X1A A;  1TTY A;  4QIW N;  1RI7 A;  3KET A;  1YJ9 I;  2F4O B;  3C2H A;  2YSR A;  3DPL C;  3L1P A;  3O8H A;  1B9M A;  4CYD A;  3OYF A;  4F92 B;  1X58 A;  5E18 F;  3S2W A;  3ZOB A;  3BCA A;  4P1W A;  1KA8 A;  3FXL A;  4UB8 C;  4BXU A;  3GZ6 A;  2FRH A;  4J00 A;  1TW3 A;  1FBQ A;  5E1X A;  2XAU A;  4OMZ A;  3I71 A;  2FX0 A;  5DS9 A;  4ENM A;  3HDD A;  4A6D A;  3SEQ A;  2CUF A;  3KYD B;  3E7L A;  4BE2 A;  2GOX B;  1U5T C;  3S2D J;  2H1K A;  2KIU A;  1IXR C;  1XDS A;  3IAS 2;  3LWF A;  4RBO A;  1OCC H;  1V54 H;  3QU3 A;  1PYV A;  2IXS A;  2MAB A;  2NNY A;  4KJZ A;  1XD7 A;  1ZGW A;  4RB3 C;  5M5X J;  5JLW A;  1DQU A;  3COA C;  1EKE A;  1FOY A;  4X0G A;  3SDG A;  5LGT A;  3DKX A;  1TWH J;  3BJ6 A;  2VOD A;  4M6X A;  3IHU A;  3WOD F;  1SD7 A;  2Y31 A;  5CQE A;  1S7E A;  3KX2 A;  2P5K A;  4MFE A;  1HKS A;  3WGI A;  3GME A;  3P7N A;  4RGS A;  1A6I A;  4C2M J;  4I0B A;  4XKV A;  1FY7 A;  2M30 A;  2IGK A;  1JJ6 C;  4ZH4 F;  3BG6 A;  3GEZ A;  2ZNZ A;  2LY2 A;  4EQQ A;  3J80 Z;  1NG6 A;  5C4X J;  4UUS A;  3CMA I;  3IWZ A;  2WWY A;  2KT0 A;  2E2H J;  3CC4 I;  3VOE A;  3OYH A;  3BJA A;  3TQN A;  5TJJ A;  4ZZD A;  4P96 A;  2P81 A;  2GAU A;  3DBL B;  4GO1 A;  4CCL A;  1VQP I;  1VQK I;  2E1M B;  5E79 C;  4N0B A;  4XLH A;  3K4K A;  4KIF A;  1HCR A;  1Y8R B;  1NHA A;  1U3E M;  4BAC A;  4UVB A;  3BC8 A;  3DPT A;  4LIT A;  3ZQ7 A;  1SMY F;  3BR5 A;  1Q1V A;  2E7W A;  2DFF A;  1U9N A;  4S04 A;  3Q9V A;  3FK7 A;  4FET A;  5BQT A;  1TWA J;  1A6Q A;  1AKH A;  2LOO A;  2PBI A;  2HZT A;  2CUZ A;  2LBF A;  3AL0 B;  2X51 A;  2XSJ C;  1SEU A;  2DA7 A;  1BC7 C;  2CGP A;  4TV7 A;  2DLL A;  4BEH A;  3S3N A;  3CD6 I;  2KQR A;  1OR7 A;  2CW8 A;  3CCU I;  2B9S A;  3TP3 A;  2WAQ A;  2HQN A;  1KU9 A;  2MLG A;  4FX0 A;  4ENK A;  3MAJ A;  1LB2 A;  3QOD A;  1SAU A;  5GTH C;  1X2N A;  1WJE A;  3C2B A;  2IRF G;  4RAG A;  2GLO A;  2IGO A;  1YW9 A;  1Z1D A;  2F4M B;  2YPR A;  2NS8 A;  1IXS B;  1QZY A;  3J7A O;  1MNE A;  4E7K A;  3JRI A;  4AYB A;  2XVC A;  1O57 A;  2COB A;  2X48 A;  1I5Z A;  1IDY A;  2XGE A;  3VYU B;  4A3E J;  4ESJ A;  4F93 B;  3BTI A;  4LIV A;  2HQ5 A;  4RS8 A;  4AIK A;  5LRS A;  4U88 A;  4P55 A;  3M8J A;  2EFW A;  1OPC A;  4LMY A;  2R7T A;  4HBL A;  3U9G A;  3F72 A;  2VKH A;  2XRL A;  3I9V 2;  2DQR A;  1Y1V J;  4XSX F;  2HVQ A;  2VKV A;  4GYG A;  3GYH X;  2XV4 S;  5GTI C;  3G1O A;  3S17 J;  2K85 A;  4RA2 A;  4B43 A;  1HW1 A;  5CLS A;  3CES A;  3F3X A;  2EH3 A;  3FDY A;  2VKD A;  1KQ0 A;  3ECH A;  5E3M A;  4MNU A;  1SMT A;  4ASN A;  1T95 A;  2DMT A;  2O5R A;  3B73 A;  2H09 A;  1TP4 A;  4OMY A;  5ED4 A;  3M1C A;  3A1Y A;  1BIB A;  2IS1 A;  1IRX A;  1MGT A;  3LA3 A;  3OOP A;  3VOD A;  1WJ5 A;  1MH4 A;  2EK5 A;  3RKX A;  1B72 B;  2DMQ A;  1ZYR F;  5HLH A;  2E60 A;  3BG7 A;  3RDI A;  5L3F A;  3SZG A;  3VYT B;  1JUP A;  4B44 A;  3DCF A;  2MLK A;  5HDN A;  4RMN A;  3C2G A;  3OY9 A;  1I27 A;  3WE2 A;  2YU3 A;  2PN6 A;  1FTT A;  1LDD A;  1RES A;  1OCP A;  4A3D J;  4AIJ A;  4KNY A;  3KP7 A;  2QVO A;  5L3B A;  4MO7 A;  4Z6Y A;  3BWG A;  4GCV A;  4M3G A;  4EAT A;  3BZ6 A;  3KE2 A;  2JJ7 A;  1LVK A;  2ZB9 A;  2QQA A;  5FLM J;  5ERI A;  4XK4 A;  1H8A C;  4I7H A;  2CFX A;  1P6R A;  1YX3 A;  2NS7 A;  4NC7 A;  4D7N A;  1XSX A;  4MQV A;  3TDU C;  1S7O A;  3B6A A;  4BDZ A;  4YFN F;  2K40 A;  3SHF A;  3QQA A;  1ETY A;  2VBZ A;  2W25 A;  3I4M J;  4XR6 A;  2J5P A;  5H6Q A;  2Y0S A;  3F6V A;  4A3J J;  3HUG A;  4IRG A;  5HVQ C;  4IPA A;  3ZR8 X;  3Q0V A;  3ISP A;  3P9C A;  4BBS J;  3H9Q A;  1J5Y A;  1H89 C;  3U2R A;  4XRM A;  2LRD A;  5JFR A;  3W6V A;  2KL4 A;  4Y7N J;  1NG7 A;  3A03 A;  1FOK A;  2OCC H;  2H94 A;  3MN2 A;  2ZSH B;  2V1N A;  5IOY A;  4HEA 2;  2FNA A;  3I53 A;  3WU1 B;  2XGX A;  1ZGJ A;  4A93 J;  5LHH A;  1J7K A;  5GPC A;  3CDI A;  2HFH A;  1VFC A;  3OOU A;  2R7O A;  3KP2 A;  3P9I A;  4OIN F;  3F8C A;  3U1D A;  3J7Z I;  2F4I A;  4I09 A;  1RRJ A;  3RYR A;  4Z2Y A;  1EH8 A;  2K3F A;  1BIA A;  3JTH A;  2RVC A;  2PX9 A;  5ICC A;  1SFE A;  2L4M A;  2ZXW H;  5LGU A;  2JQ7 A;  2ZNY A;  3FBI B;  1E0E A;  1MBK A;  1YFH A;  3C7J A;  2M0M A;  3ZN1 A;  2VT2 A;  3HIF A;  1R9T J;  1QA6 A;  2A6H F;  2VJI A;  1MMN A;  2PJR B;  3RTR A;  3HGG A;  1ZG5 A;  2V79 A;  1Y8Q B;  4MTE A;  2ID3 A;  3BG3 A;  3HSE A;  1YLF A;  1SD5 A;  4IQ4 A;  2FJ1 A;  3TOB A;  3D0S A;  2VLA A;  5DM6 F;  4WWC A;  3RKY A;  3HOT A;  5LLQ A;  1P4X A;  2DK8 A;  1LDK B;  5CPR B;  2CW0 F;  2XUB A;  2P7V B;  1YJN I;  1DU0 A;  5FFX A;  1K61 A;  4IF4 A;  4EGY A;  1G59 A;  1RUN A;  2M8G X;  2VL8 A;  1XTA A;  4GRI A;  3FXU A;  2UZK A;  4F7Z A;  1VF9 A;  3GTG J;  2FNP A;  1ON2 A;  1JI8 A;  2QYO A;  2VT3 A;  1T38 A;  3ZMZ A;  3C18 A;  2HTS A;  2Q0O A;  2R7U A;  1RNL A;  3LSM A;  3MD2 A;  4M3B A;  4HQM A;  2XKO A;  2MH2 A;  3HB9 A;  4EM0 B;  3CP8 A;  3K10 A;  2RNJ A;  5GAH J;  3K70 C;  3S3O A;  4O3M A;  3QYF A;  1XGO A;  2JPC A;  4C2T A;  2NVT J;  3BZC A;  3WTV C;  2GWR A;  4AC0 A;  3GW2 A;  4A3K J;  1HXD A;  4XRF A;  1XDU A;  1UZC A;  1DPU A;  3ZN0 A;  1UEL B;  5DYM A;  3KCC A;  1RR7 A;  2NS0 A;  5F6F A;  2K5C A;  1UCR A;  4LG0 B;  3H5R A;  1SD6 A;  3SZP A;  5LD2 C;  3E5Q A;  2EQR A;  1Z05 A;  4ZYH A;  5K1Y A;  3OYE A;  4EJT A;  4Q47 A;  3CCV I;  2JA5 J;  3MKL A;  4L9V A;  3I3L A;  2H27 A;  2QF7 A;  2Y75 A;  2RDP A;  5FRO A;  2AXT C;  2LR8 A;  2BXY A;  3EUH A;  4N9H A;  2Z3Y A;  1QGP A;  4G7Z F;  2O0Y A;  5B1A H;  5FKL A;  3ZQH A;  2EBI A;  2E1O A;  4PK4 A;  4CA0 A;  2WB1 N;  2LVS A;  3OIP A;  1ZH5 A;  2K27 A;  4HF1 A;  1HBX G;  2IP2 A;  2P5V A;  5D8L B;  4F52 A;  1ZG1 A;  1UJ8 A;  4OIQ F;  1LKX A;  1RKW A;  5E8I A;  3CMY A;  2NOG A;  4HA8 A;  4K2E A;  1J59 A;  1IZ1 A;  2EWN A;  2VJ4 A;  3M4O J;  4I2O A;  3WG7 H;  2B63 J;  3DP7 A;  5KCM A;  4YII A;  4EM1 A;  3F6O A;  3V8K A;  3OV8 A;  2OQG A;  4HG2 A;  3PNY A;  3E0J B;  2W24 A;  3EYY A;  1LVA A;  1FOW A;  2W4S A;  5FKO A;  5JI6 A;  4OIO F;  5F04 A;  5K5Q A;  5FD5 A;  3R4K A;  4YRV A;  1E3P A;  1D8K A;  4XN3 A;  3RKQ A;  2IBD A;  4NBQ A;  4OU0 A;  2HEO A;  3G1M A;  2EIM H;  1FNN A;  2VQL A;  4JYK A;  4OAZ A;  1QVT A;  1P7J A;  2D45 A;  2BEO A;  5K7Z A;  1KGS A;  3K9T A;  1D5V A;  1YX5 A;  2H8W A;  1B72 A;  1A31 A;  1HDP A;  4I99 C;  1WQ2 A;  3J80 K;  3L2C A;  3GCM A;  1FX7 A;  2NAZ A;  2E5N A;  2WY7 Q;  1LQ1 A;  4HNV A;  2OTL I;  1Y0N A;  2CWE A;  3WU2 C;  1I3A A;  1SAN A;  3ZQF A;  4JOM A;  3ELK A;  3FXK A;  5HNF A;  4XKC A;  3LFU A;  1IN6 A;  2EJR A;  2QSF X;  4RAZ A;  2QKL B;  2L54 A;  4D0P A;  1S5L C;  3ULQ B;  3D5L A;  1ONV A;  4B4C A;  4QTR A;  4P9U A;  2IS4 A;  2A05 A;  3CF2 A;  3LFK A;  2R7R A;  1GVD A;  1TNS A;  4HX7 A;  2K86 A;  1JJ8 C;  2NOJ B;  1APL C;  1H0M A;  4AYB N;  4IOA F;  2VI6 A;  3NWS A;  3RSN A;  4HV5 A;  3V7C A;  3PUB A;  1JE8 A;  1T56 A;  1WGX A;  1FTZ A;  1IN4 A;  1ZRF A;  2DA4 A;  3EUK L;  5ICF A;  3A01 A;  2CU7 A;  2XAG A;  1XCV A;  4M73 A;  2X1E A;  3VB2 A;  1R6R A;  3H5N A;  3HOX J;  2E35 A;  2ZCW A;  2F5D A;  1NK2 P;  1KON A;  1H88 C;  2X6W A;  1TWG J;  1JUM A;  2JRT A;  2CYY A;  3JTG A;  1IV8 A;  3OS2 A;  3TOA A;  1T0F A;  3S2H J;  2VQH A;  2BBY A;  3SYT A;  3IUO A;  3BQY A;  1IAW A;  4J01 A;  4GDF A;  3E97 A;  5IPA A;  4HPQ A;  2E5Z A;  3BZK A;  2L02 A;  1QHG A;  2DBB A;  1IF1 A;  1P9Q C;  1B9N A;  2Y30 A;  1V3F A;  4IOC F;  1ENH A;  3FIS A;  4G6D A;  4I98 B;  4CZZ A;  5HS8 A;  1DP3 A;  2V7F A;  2W85 A;  2GA1 A;  2PMH A;  3CO7 C;  1REP C;  2ZXH A;  2XKP A;  1W7P D;  3FF5 A;  2CV2 A;  4HV6 A;  2ZKZ A;  1QPI A;  4FE7 A;  5K5O A;  1UHM A;  5H2F C;  2PQ8 A;  1B59 A;  3H9J A;  2R7F A;  4ENN A;  1HLV A;  2KKO A;  5LHI A;  1E17 A;  5JVT A;  1D8J A;  4D1Q A;  2WAF A;  3RYP A;  1ZTR A;  1MMG A;  4L18 B;  5K5R A;  4JX5 A;  3DWL E;  2IAI A;  3CLQ A;  4XRS A;  1GVJ A;  1O3Q A;  3N05 A;  3WGG A;  2IEK A;  4BBR J;  3SZT A;  5GP9 A;  5TIS C;  2F6C A;  2EIN H;  2MGQ A;  5J4V A;  5C44 J;  1KU3 A;  4MIM A;  2ZO4 A;  4KT5 C;  4EV0 A;  2GA2 A;  1IN5 A;  3QAH A;  1MMS A;  2JUC A;  2XAH A;  5B3S H;  2BY1 A;  3FMR A;  4XLP F;  3M3Y J;  5FB2 A;  3CO6 C;  2BVL A;  1TW2 A;  2LRE A;  3DLA A;  5D5W B;  4D5F A;  3U1K A;  2CQN A;  2EZI A;  2WBM A;  3JRA A;  4II3 A;  1K79 A;  1R00 A;  3HPH A;  4BHB A;  4UHT A;  4UUV A;  1BW6 A;  1RZ4 A;  1DGW Y;  2MYS A;  2EZL A;  4BE0 A;  4CHU A;  1LFB A;  5L3E A;  2Q8K A;  1FSH A;  2HDD A;  2P8T A;  3R0A A;  1F43 A;  3KLN A;  3IH2 A;  4PDK A;  1MBG A;  1ZN2 A;  1U9O A;  4AD9 A;  4Q5S F;  2X9D A;  2EIJ H;  4PSW A;  1WH5 A;  1MJB A;  2Q2E B;  1G3Y A;  1B1B A;  1NK3 P;  2X1C A;  3L2Q A;  3ZPL A;  2XRO A;  2FML A;  2X0L A;  1KQ8 A;  3S93 A;  2EFO A;  4A5N A;  1YE9 A;  4YIR X;  5E3N A;  4HDU A;  5JR3 A;  4CIC A;  2HVS A;  2CFO A;  2GOM A;  2VAS A;  3LSP A;  4F55 A;  2A6E F;  4JK1 X;  3JR9 A;  1YQA A;  2CQQ A;  2CQK A;  4PCQ A;  5H20 A;  4L0Z B;  1K7A A;  1FEX A;  1T8I A;  3ONQ A;  2R4G A;  4UY8 I;  4PUS A;  1T6S A;  5J8C A;  2A61 A;  2Z5U A;  3OYK A;  2DT7 B;  3OYG A;  3JRC A;  2ZXI A;  3K4N A;  1O7L A;  3LSH A;  2M1B A;  1NTC A;  5CJ9 A;  3L2U A;  4RGU A;  2LKX A;  3HGY A;  1B8I B;  2P4W A;  1U0J A;  2VE8 A;  5JHU A;  4CZC A;  2DPD A;  2IW5 A;  3CJR B;  1HST A;  3EUA A;  4UVA A;  3GFM A;  4FT8 A;  4KUM A;  2JA2 A;  3HOY J;  3PNT A;  3RQ4 A;  1O7F A;  4IKF A;  1OQY A;  3BTJ A;  2EFQ A;  4XIC A;  1XGN A;  3GZN B;  4GYI A;  3F8B A;  1R1V A;  4CCK A;  4CUG A;  1O3R A;  4LG3 A;  1XSV A;  4XL9 A;  3ABL H;  1K6O A;  1JGS A;  2B0L A;  2M4G A;  2V26 A;  4PGG A;  1XGS A;  4XKB A;  5H6R A;  4U87 A;  1KYZ A;  4U0W A;  4WK8 F;  3QWL A;  1IC8 A;  2P0W A;  2R3S A;  2M9H A;  3E6D A;  4QWQ A;  3PJR A;  3S1Q J;  1MBH A;  1A73 A;  1MZB A;  2VPL A;  4YFK F;  1XSD A;  5FRM A;  4HNU A;  5C4J J;  5A2Q Z;  3S16 J;  1QZE A;  2HYJ A;  1X1B A;  2X4H A;  2HKX A;  2O8X A;  1B6A A;  5ILV A;  2R7D A;  1G4D A;  2QLZ A;  4JQF A;  1YIT I;  1O4X A;  2DXI A;  4RB0 A;  3OMY A;  2KIQ A;  3KZI C;  3HPG A;  3DXJ F;  1I39 A;  3WTW C;  5BPD A;  3ASO H;  3I55 I;  5LHG A;  2DOA A;  3TO7 A;  5E20 A;  3BPV A;  1R23 A;  4B3A A;  4IXA A;  1MND A;  4CCN A;  2RN7 A;  3IH3 A;  3F8F A;  1S6L A;  2QSH X;  4A69 C;  5M5W J;  3KIO A;  1ACI A;  2DAO A;  1J75 A;  2ME6 A;  2OTJ I;  2L9R A;  1FYM A;  1SD4 A;  1YS6 A;  3UNG C;  4AVP A;  2IA0 A;  5HOD A;  4N9I A;  2JT1 A;  2DCE A;  3LQR A;  2QQ9 A;  1J09 A;  3CMM A;  2OA4 A;  1H9T A;  2Q1Z B;  2M7A A;  2X6X A;  5IOZ A;  1R5I D;  3IV5 A;  3HOS A;  3DF8 A;  1QBJ A;  3GX4 X;  2XDV A;  1UB9 A;  2YS9 A;  3MZH A;  2D2W A;  2RAE A;  3WGH A;  1LPQ A;  3BTC A;  3M8E A;  4BEH B;  5LBQ A;  5E3L A;  3ECO A;  1EH6 A;  1FBU A;  1HDD C;  2ZJR F;  4I02 A;  5F64 A;  1XCB A;  3K0L A;  1SVM A;  2LK2 A;  2DA3 A;  3OS0 A;  2FF4 A;  2FOW A;  4IHY A;  1WFX A;  2FQ4 A;  1W5S A;  4AWX B;  2X85 A;  2DJI A;  3PSF A;  1MIJ A;  1TZL A;  1IN7 A;  4RLF A;  2DQL A;  2E34 A;  1TWF J;  2O61 A;  3Q3S A;  2KZV A;  2F5E A;  3ERE D;  2LTP A;  3DPU A;  1ETW A;  2GZW A;  3DTE A;  3CJQ B;  4O5V A;  3W6J B;  2KFD A;  3QYB A;  1VQ8 I;  4CCO A;  3FKI J;  1FSE A;  3G1L A;  3MZ8 A;  1R5H A;  1DPR A;  3PQK A;  3FK6 A;  1M1E B;  4KIT B;  2YU9 J;  4G6T B;  4LLN A;  3CCM I;  1YIJ I;  3NWT A;  2JUG A;  5DM7 F;  1MKM A;  3JAM K;  2XSD C;  5B1B H;  2ZME A;  5BNG A;  4A3G J;  3RCO A;  1KZH A;  3IKT A;  3PUF A;  2UWM A;  2V9P A;  3FMQ A;  2K3P A;  2DOF A;  3M7G A;  3OSF A;  1XMK A;  4PGH A;  5DDG A;  4EGZ A;  3EET A;  4BKX A;  5CKT A;  4DYQ A;  3OL4 A;  1PP7 U;  3RPU D;  3I59 A;  2LDU A;  2XAS A;  1CF7 A;  3VWB A;  2JA7 J;  3H35 A;  5HDG A;  4D5C A;  3FM3 A;  3HM5 A;  4XKW A;  3FHZ A;  3LST A;  3CQZ J;  5IP6 A;  3WTX C;  3ZCO A;  4HZF A;  4XRS G;  1Q1H A;  1YOV B;  4LGW A;  5J1R A;  1MMA A;  3GTK J;  1BM9 A;  3UR3 C;  3S8P A;  1S72 I;  2OQR A;  5AIP A;  2HXI A;  3CCQ I;  3MWM A;  4A3I J;  3ERM A;  1Y0U A;  4DZP A;  1MDM A;  4DYR A;  3DBR B;  3I54 A;  1K83 J;  2M0C A;  4KYW A;  4B47 A;  3CTA A;  3KP3 A;  3JRD A;  4BL0 B;  2UXN A;  1Z3X A;  4KMF A;  3PO3 J;  1A5J A;  1L3L A;  1UFM A;  2A68 F;  2FBH A;  4IEJ A;  1JGG A;  2ISZ A;  2L3D A;  4DW6 A;  3ZRG A;  2ZC2 A;  3CF5 F;  2I8D A;  3HUG B;  3BPX A;  1E2X A;  4KIB A;  2OBP A;  3I4P A;  3Q0U A;  2FBK A;  2BW3 B;  4CDG A;  3OYL A;  2HKO A;  4AUX A;  3BP8 A;  3DKY A;  2QKM B;  2QQB A;  2M3A A;  4NQW B;  5K7H A;  2LMD A;  3MKW B;  1LFP A;  5HLI A;  2WY8 Q;  1KQ9 A;  3W2A A;  4M3F A;  1ZRE A;  5FO5 A;  2WV0 A;  2NYX A;  4PJ0 C;  4FCY A;  4AM3 A;  3H0D A;  1MNM C;  2E7X A;  2LKS A;  4OAY A;  2FU4 A;  1AHD P;  3HOV J;  2V1U A;  4CYC A;  2O03 A;  5HLT A;  2IA2 A;  4E7Z A;  1GT0 C;  1PJR A;  4EJU A;  1B8I A;  2H8R A;  4ETS A;  1K4S A;  1IRZ A;  3TO6 A;  5F27 A;  1OMI A;  2DFI A;  2AHQ A;  4C3H J;  4RAF A;  1T0F C;  1VI0 A;  1BOB A;  1BBY A;  1P2F A;  4YIF A;  1EA3 A;  2EV6 A;  3HBL A;  1ZLJ A;  4C3I J;  4F3Q A;  3K4B A;  4CO8 A;  1ERD A;  1VZ0 A;  2GXB A;  3OYC A;  2VBY A;  2QEN A;  4RB1 A;  3JSP A;  1V5E A;  4G8X A;  1OFC X;  4B09 A;  5DEQ A;  2LY9 A;  3JRB A;  3CME I;  1ZLK A;  3K4L A;  3OL3 A;  3BR3 A;  4NNJ A;  1QQI A;  1TQP A;  2VJJ A;  2DJN A;  1W5T A;  3L9F A;  3HC7 A;  1P7I A;  1ZQ3 P;  3DFG A;  1Z77 A;  1Z67 A;  3MMY B;  1N75 A;  3J7Y J;  3I5U A;  3NQO A;  2A5Y B;  4XOT A;  5M3F J;  3HHG A;  5FLV A;  3S1N J;  5GAD J;  2OJE D;  1JHH A;  2VON A;  2RV8 A;  3GFL A;  2BZT A;  2EV5 A;  2L7K A;  4ZYE A;  4O6J A;  4DBQ A;  3FMS A;  4BQA A;  3QOE A;  2PJR A;  4EJW A;  2EZK A;  2PMU A;  3TP0 A;  4E70 A;  4NC8 A;  4A3B J;  2OF7 A;  3K4J A;  2Y9Y A;  3S15 J;  2HR3 A;  4DIQ A;  3KEQ A;  2O8K A;  3QPL A;  2VIX A;  1R49 A;  1ZAR A;  1EJ9 A;  1JKR C;  1Z6R A;  1UHS A;  3QPT A;  1LFU P;  2VOP A;  3V4G A;  4BU2 A;  3KYL A;  2R0Q C;  1V4R A;  4HOB A;  4H4K C;  3TED A;  1W0T A;  2KMU A;  2O3F A;  1FZP B;  5LEJ A;  4HW0 A;  1D3Y A;  1LE8 A;  4HX4 A;  2VOO A;  3K70 D;  1PP8 F;  2HPI A;  1A74 A;  3C1D A;  4Y4R A;  5IT3 A;  1TLH B;  4M6V A;  1LNW A;  2V1X A;  3SEZ A;  4HX8 A;  2JWT A;  2HGC A;  3PSI A;  3T5X A;  1HW5 A;  1XGM A;  3BDD A;  3EUH C;  2X6Y A;  1QO0 D;  5IP9 J;  2KIM A;  2WTE A;  3D5S C;  1W4M A;  1EF4 A;  2QCO A;  3J81 Z;  1LUJ B;  3FM5 A;  2NRA C;  4X6A J;  3H5A A;  1FBS A;  2NNN A;  2L0K A;  3BR0 A;  4EMS A;  1UHW A;  1IXC A;  2MG4 A;  2PEX A;  2ESH A;  5KHD A;  1VTN C;  5M3M J;  5FLX K;  1UAA A;  3VSK A;  2Y9Z A;  4ESF A;  3PFY A;  3CJT B;  1SFX A;  3AL0 C;  3ZMU A;  2P6T A;  3LA7 A;  1GUU A;  4U0V A;  5EEH A;  4V2F A;  1IGN A; 
#chains in the Genus database with same CATH homology
 2CSO A;  1X3U A;  4KN7 X;  2UXX A;  1TQI A;  2QWW A;  4NQW A;  4EJO A;  2HDC A;  2FSW A;  2IA1 A;  2O6M A;  2L4A A;  3QP6 A;  3I59 B;  3CUO A;  1JXS A;  2ZME B;  5BS6 A;  4ENJ A;  2QZ8 A;  1AWC A;  4ZYG A;  3GFI A;  1U8R A;  2JTV A;  1ZG3 A;  3E6C C;  4HAM A;  5CVR A;  1OYW A;  3WTY C;  2YX4 A;  3BOQ A;  1MJA A;  3IC7 A;  1YG2 A;  1FC3 A;  2KRF A;  1MDM B;  1GXP A;  2FE3 A;  2YR2 A;  3IL2 A;  3GO5 A;  1H9G A;  3FXQ A;  3GF2 A;  2GQQ A;  4MQ9 F;  3N97 A;  1Z7U A;  4UV8 A;  1S3J A;  1YW7 A;  2XAF A;  1T2K A;  1BI1 A;  3Q5F A;  1ZAO A;  1ON1 A;  2O6G E;  3ABU A;  3M1E A;  4L9N A;  3QRF F;  4NHJ A;  5EEG A;  4P5O A;  4M71 A;  1W7P A;  1R5G A;  4L5I A;  2Q2E A;  5LEK A;  1DP7 P;  3MQ0 A;  4LFU A;  2XAQ A;  3SQN A;  1G6N A;  2LSO A;  1ZGA A;  2QM3 A;  2MA3 A;  3QOP A;  1R7J A;  1T39 A;  4FHT A;  5ICG A;  1WWX A;  3NEU A;  1WRJ A;  2M5W A;  2DPU A;  5ILS A;  1FYL A;  2A07 F;  4LB5 A;  2EA4 A;  1T98 A;  1Z91 A;  1R36 A;  1XMA A;  3REO A;  3EQL F;  5D8K B;  3NRV A;  2OZU A;  4BHC A;  4UNO A;  5E1Z B;  6PAX A;  1I1S A;  2COM A;  3SXY A;  3LAP A;  1LDJ A;  4HLX A;  2GXG A;  3WU0 A;  4M9X A;  2XHK A;  2K7L A;  3O6B B;  4OIR F;  1F4K A;  3HRT A;  2ZBK A;  1FLI A;  2LKP A;  1GHC A;  5L3C A;  2G7H A;  2ZJ2 A;  3CUQ A;  1EH7 A;  3L00 A;  1QZZ A;  2PG4 A;  2VC0 A;  2DO7 A;  4IRI A;  3O2P E;  2MH9 A;  3TGN A;  3TO9 A;  2PLY A;  1CYQ A;  1BI2 A;  1CGP A;  1DDN A;  2F5C A;  1ULY A;  3LQQ A;  1WSU A;  4MEY F;  4S05 A;  1IUY A;  1O3S A;  2K4B A;  5D4S A;  2MC3 A;  1R1U A;  3H3U A;  4ZYD A;  4A0X A;  2JZY A;  2STW A;  4IHS A;  5FFZ A;  2K02 A;  3DKW A;  3HHH A;  3BJO A;  3CJN A;  3LA2 A;  5CVU A;  2VN2 A;  3GLX A;  1K78 A;  2STT A;  5DD8 A;  3KLO A;  3GWZ A;  4RAY A;  2M45 A;  1KU2 A;  2G9W A;  3T8R A;  5HS7 A;  1TNT A;  2ZXJ A;  2PI0 A;  2LF7 A;  5ICE A;  3QP5 A;  1USS A;  5LGN A;  2EFN A;  4KIG A;  1BJA A;  4P9F A;  2HTJ A;  5E1W A;  2VXZ A;  1MJ9 A;  1PUE E;  5HOO A;  1PDN C;  2Z9O A;  1Z6T A;  1FWZ A;  2BE5 F;  3RI4 A;  3CDH A;  3K1N A;  3E5U A;  3K1P A;  1O3T A;  3V7R A;  4R1H A;  4BHP A;  1J0R A;  1G3W A;  3R6S A;  2GIV A;  2RQP A;  1BN5 A;  3O3K A;  3J81 K;  3ZMD A;  1U5T A;  4LG0 A;  1IN8 A;  4LJZ F;  3GUD A;  3V8J A;  3K1M A;  1FP1 D;  4BAY A;  2Z99 A;  1IRG A;  2E1C A;  3TDZ C;  2RC4 A;  4CGZ A;  1B4A A;  4PZJ A;  4Q48 A;  4M9S A;  5TRD A;  3E3V A;  2PFB A;  3GFJ A;  2KIF A;  5KK1 A;  3KFW X;  4MTD A;  5E8G A;  4DQ2 A;  4WCG A;  1KYW A;  1SAX A;  3FWE A;  4WXH A;  5LRR A;  4RB2 C;  2EB7 A;  2ADU A;  3R61 A;  1DUX C;  1QNT A;  4M9Z A;  2VBW A;  1YW8 A;  2J5O A;  3H3Z A;  4BH9 A;  1R22 A;  4IVN A;  4WXC A;  3L09 A;  3WE3 A;  1OKR A;  4XLN F;  1CF7 B;  3DV8 A;  3B02 A;  4LD5 A;  2CO5 A;  3BY6 A;  3PFI A;  2IPQ X;  2HQR A;  4Q4Z F;  4DNC A;  5D5X B;  2MBF A;  2HS5 A;  2QBY A;  5CVI A;  2DTR A;  3WTT C;  2DK5 A;  3ROU A;  5J6X A;  2JSC A;  3JAM Z;  3DEU A;  3GZ5 A;  1JHF A;  3I64 A;  4G7O F;  2CG4 A;  1F9N A;  3TKY A;  3IRR A;  4HF2 A;  2FA5 A;  3RPU A;  5D5U B;  4OOI A;  2OU2 A;  3E6M A;  1YIO A;  1HQC A;  3L7W A;  4Y13 A;  1J2X A;  2FEZ A;  2PJP A;  1GXQ A;  5HDK A;  3P9K A;  1KU7 A;  4GGG A;  3HSF A;  1TQM A;  1IPP A;  1ZRC A;  2FOK A;  3GXO A;  4KFC A;  3MCZ A;  3WTZ A;  4CXF A;  2A69 F;  1HKQ A;  1BI0 A;  5IT9 K;  3HRS A;  5FD6 A;  3ZMS A;  4MGR A;  4G9Y A;  1BI3 A;  3T0Y A;  5FLX Z;  2E1N A;  4LB6 B;  3KP4 A;  3VFZ A;  3KZY A;  1L0O C;  5AIQ A;  3T1B A;  4NB5 A;  4A0Z A;  4A12 A;  4L9J A;  1F5T A;  3W6K B;  3GVA A;  2FBI A;  1HSJ A;  2XIG A;  3ZMT A;  3JSO A;  3KP5 A;  2DT5 A;  4LLG F;  3K69 A;  2D1H A;  3QPH A;  2Y48 A;  4M72 A;  1R58 A;  4L5J A;  1HW2 A;  3MFK A;  1RIO H;  1LJ9 A;  4MHG A;  3PQJ A;  3HTS B;  1S7A A;  2H6C A;  4A2U A;  3G3Z A;  3RPQ A;  4Y15 A;  2TDX A;  2VE9 A;  1A04 A;  2QBY B;  3AAF A;  2MD5 A;  2F5F A;  4L9T A;  2M87 A;  1U6G A;  4HQE A;  2W84 A;  1J9I A;  3F21 A;  4ON0 A;  5J8F A;  2LNB A;  5CVV A;  2ESN A;  5KVR A;  4I01 A;  2G7U A;  2IT0 A;  2P6S A;  1QPM A;  1YTY A;  2AXL A;  4LK0 F;  2Z33 A;  4G94 A;  5ILU A;  2IVM A;  4HLY A;  2L01 A;  4AIH A;  5BPI A;  5DCF A;  2ELH A;  5CVJ A;  1EV7 A;  4A5M A;  4EVI A;  2OZ6 A;  2HYG D;  2DI3 A;  4KN4 X;  3HTU A;  1Z9C A;  4LLL A;  4KIC A;  2C6Y A;  4RGX A;  3RJP A;  4UXN A;  4WX9 A;  4HYE A;  1S29 A;  5A2Q K;  3R60 A;  1EVW A;  1P92 A;  2XRN A;  2DW4 A;  1HKT A;  2OD5 A;  1STZ A;  4YFX F;  2ETH A;  5FGM A;  2ZFW A;  2K4J A;  2V1D A;  4IHT A;  1OYI A;  3CUQ C;  2BGC A;  5D5V B;  2FXA A;  4EJV A;  4LK1 F;  4QLC U;  2ACJ A;  3EDP A;  4M6Y A;  2A3S A;  2BV6 A;  4I0A A;  5DV5 A;  4XSZ F;  2VBX A;  3F8M A;  3V8L A;  1F1Z A;  5D6F A;  3ABT A;  4UVC A;  1WI9 A;  1W7P B;  4GXO A;  4WF2 A;  2YX7 A;  1C0W A;  5L3D A;  4FX4 A;  2H6B A;  4OIP F;  3CLO A;  2KJC A;  3R0J A;  1MD0 A;  4KDP A;  3CUQ B;  2ISY A;  3SFZ A;  3RKW A;  4BYY A;  1YO5 C;  2HWV A;  3FZV A;  5F1R A;  3BRO A;  5DD4 A;  1FPQ A;  5DCM A;  4ZZL A;  1IRF A;  3LAJ A;  1R1T A;  2EA2 A;  3HRM A;  4U7D A;  3H92 A;  3K2Z A;  3I58 A;  3FX3 A;  4UV9 A;  2QUF A;  3T8T A;  3V7S A;  2D1V A;  3VEP A;  1FYK A;  2HOE A;  2IJL A;  1S8N A;  3M9A A;  4U7B A;  4KA4 A;  4HDV A;  3KZZ A;  3KP6 A;  3EYI A;  2F2E A;  2W57 A;  4U0Y A;  3HSR A;  4MEX F;  1ZHF A;  5BMZ A;  2P5L C;  2V6C A;  2XAJ A;  1YYV A;  4B8X A;  2Y0M A;  4R8H A;  4A6E A;  1G3S A;  3RIR A;  1OYY A;  3IKV A;  3IWF A;  3WG9 A;  3WTS C;  4KMU X;  4G7H F;  2V9V A;  1UST A;  5D4R A;  5D6E A;  1U2W A;  2FQ3 A;  3DQV C;  5AON A;  4H0E A;  3JW4 A;  2HYF A;  1LEA A;  2EV0 A;  2P7C B;  1YS7 A;  2KJB A;  2JPB A;  3E5X A;  1IW7 F;  1P4A A;  2EFP A;  3HYI A;  5HS9 A;  4A0Y A;  3Q9S A;  1EVX A;  3WTU C;  4YG2 F;  4Y17 A;  1P4W A;  1FP2 A;  5DUK A;  4HF0 A;  1RUO A;  3ML6 A;  5HLG A;  4IRH A;  3M8F A;  5DUI A;  5BOX A;  4RGR A;  2OAZ A;  1U5T B;  1BOA A;  3E6B A;  2AS5 F;  4IJA A;  5IT9 Z;  2LF8 A;  2DU9 A;  5E17 F;  4M74 A;  1G3T A;  1K78 B;  1U78 A;  1I1G A;  1SFU A;  1XN7 A;  2RGV A;  3QU6 A;  3ZP5 A;  2WC2 A;  4G6Q A;  4BNC A;  1LEB A;  2RKH A;  4JBA A;  3N4M A;  3HRU A;  3G73 A;  1ODD A;  1AOY A;  2BYV E;  2VC1 A;  2M8E A;  1WKM A;  4XBF A;  3F22 A;  3IRQ A;  2FMY A;  3MZY A;  3ZMV A;  1BC8 C;  4ESB A;  4R79 A;  4EM2 A;  1FT9 A;  3C3W A;  4WXD A;  4L0Y B;  1XB4 A;  3F8N A;  3KEO A;  1ZRD A;  1I6X A;  3FXR A;  3MEX A;  3F23 A;  5DCM B;  5L3G A;  5CYV A;  1TBX A;  1CZ0 A;  3I0T A;  1TTY A;  1RI7 A;  3KET A;  2YSR A;  3DPL C;  1B9M A;  4CYD A;  5E18 F;  3S2W A;  1KA8 A;  4BXU A;  3GZ6 A;  2FRH A;  1TW3 A;  1FBQ A;  5E1X A;  4OMZ A;  3I71 A;  4ENM A;  4A6D A;  1U5T C;  2KIU A;  1IXR C;  1XDS A;  3LWF A;  3QU3 A;  2NNY A;  1XD7 A;  4RB3 C;  3COA C;  5LGT A;  3BJ6 A;  2VOD A;  4M6X A;  3IHU A;  3WOD F;  1SD7 A;  2P5K A;  3WGI A;  1HKS A;  3P7N A;  4RGS A;  4I0B A;  1FY7 A;  2M30 A;  4ZH4 F;  3GEZ A;  2ZNZ A;  4EQQ A;  3J80 Z;  3IWZ A;  2WWY A;  3VOE A;  3BJA A;  3TQN A;  5TJJ A;  4ZZD A;  4P96 A;  2GAU A;  4GO1 A;  4N0B A;  4KIF A;  1NHA A;  1U3E M;  4UVB A;  3DPT A;  3ZQ7 A;  1SMY F;  2E7W A;  4S04 A;  3Q9V A;  5BQT A;  2PBI A;  2HZT A;  1BC7 C;  2CGP A;  4TV7 A;  2DLL A;  1OR7 A;  2HQN A;  1KU9 A;  2MLG A;  4FX0 A;  4ENK A;  3MAJ A;  1LB2 A;  2IRF G;  1YW9 A;  1Z1D A;  2YPR A;  1IXS B;  1QZY A;  3J7A O;  2XVC A;  1O57 A;  1I5Z A;  4ESJ A;  4RS8 A;  4AIK A;  5LRS A;  4U88 A;  4P55 A;  2EFW A;  1OPC A;  4LMY A;  4HBL A;  3U9G A;  3F72 A;  2DQR A;  4XSX F;  4GYG A;  3GYH X;  2XV4 S;  1HW1 A;  5CLS A;  3F3X A;  1KQ0 A;  3ECH A;  4MNU A;  1SMT A;  4ASN A;  3B73 A;  2H09 A;  4OMY A;  5ED4 A;  1BIB A;  1MGT A;  3OOP A;  3LA3 A;  3VOD A;  2EK5 A;  3RKX A;  1ZYR F;  5HLH A;  3RDI A;  5L3F A;  2MLK A;  5HDN A;  1I27 A;  3WE2 A;  2YU3 A;  2PN6 A;  1LDD A;  4AIJ A;  4KNY A;  3KP7 A;  2QVO A;  5L3B A;  3BWG A;  4GCV A;  3BZ6 A;  3KE2 A;  2QQA A;  5ERI A;  4I7H A;  2CFX A;  1P6R A;  1XSX A;  4MQV A;  3TDU C;  1S7O A;  4YFN F;  3SHF A;  2VBZ A;  2W25 A;  2J5P A;  5H6Q A;  3F6V A;  3HUG A;  4IRG A;  5HVQ C;  4IPA A;  3ISP A;  3P9C A;  1J5Y A;  3U2R A;  5JFR A;  1FOK A;  2H94 A;  2FNA A;  3I53 A;  3WU1 B;  2XGX A;  1ZGJ A;  5LHH A;  1J7K A;  2HFH A;  3KP2 A;  3P9I A;  4OIN F;  3F8C A;  3U1D A;  4I09 A;  3RYR A;  4Z2Y A;  1EH8 A;  1BIA A;  3JTH A;  2RVC A;  5ICC A;  1SFE A;  2L4M A;  5LGU A;  2ZNY A;  1YFH A;  3C7J A;  3ZN1 A;  2VT2 A;  3HIF A;  2A6H F;  3RTR A;  1ZG5 A;  2V79 A;  4MTE A;  3HSE A;  1YLF A;  1SD5 A;  3TOB A;  3D0S A;  4WWC A;  3RKY A;  3HOT A;  5LLQ A;  1P4X A;  2DK8 A;  1LDK B;  2CW0 F;  2XUB A;  2P7V B;  5FFX A;  4IF4 A;  4EGY A;  1RUN A;  3FXU A;  2UZK A;  4F7Z A;  2FNP A;  1ON2 A;  2QYO A;  2VT3 A;  1T38 A;  3ZMZ A;  3C18 A;  2HTS A;  2Q0O A;  1RNL A;  4HQM A;  2XKO A;  2MH2 A;  4EM0 B;  2RNJ A;  4O3M A;  1XGO A;  2JPC A;  3WTV C;  2GWR A;  3GW2 A;  1HXD A;  4XRF A;  1XDU A;  1DPU A;  3ZN0 A;  5DYM A;  3KCC A;  2NS0 A;  5F6F A;  1UCR A;  4LG0 B;  1SD6 A;  3SZP A;  3E5Q A;  1Z05 A;  4ZYH A;  5K1Y A;  4EJT A;  4Q47 A;  4L9V A;  2H27 A;  2Y75 A;  2RDP A;  3EUH A;  4N9H A;  2Z3Y A;  1QGP A;  4G7Z F;  2O0Y A;  1ZH5 A;  2K27 A;  4HF1 A;  1HBX G;  2IP2 A;  2P5V A;  5D8L B;  1ZG1 A;  4OIQ F;  5E8I A;  4HA8 A;  4K2E A;  1J59 A;  1IZ1 A;  2EWN A;  4I2O A;  3DP7 A;  4YII A;  4EM1 A;  3F6O A;  3V8K A;  3OV8 A;  2OQG A;  2W24 A;  3EYY A;  1LVA A;  5JI6 A;  4OIO F;  5K5Q A;  5FD5 A;  3R4K A;  1D8K A;  4OU0 A;  2HEO A;  1FNN A;  2D45 A;  2BEO A;  1KGS A;  3K9T A;  1D5V A;  3J80 K;  1WQ2 A;  3L2C A;  1FX7 A;  2NAZ A;  1LQ1 A;  2CWE A;  3ELK A;  1IN6 A;  2EJR A;  4RAZ A;  2L54 A;  4D0P A;  3ULQ B;  3D5L A;  1ONV A;  4P9U A;  3LFK A;  1TNS A;  4HX7 A;  2K86 A;  1H0M A;  4HV5 A;  3V7C A;  1JE8 A;  1IN4 A;  1ZRF A;  5ICF A;  2XAG A;  1XCV A;  4M73 A;  3VB2 A;  2ZCW A;  2F5D A;  2JRT A;  2CYY A;  3JTG A;  3TOA A;  1T0F A;  2BBY A;  1IAW A;  3E97 A;  2L02 A;  2DBB A;  1IF1 A;  1B9N A;  1V3F A;  4G6D A;  4I98 B;  4CZZ A;  5HS8 A;  2W85 A;  2GA1 A;  2PMH A;  3CO7 C;  1REP C;  2XKP A;  1W7P D;  3FF5 A;  4HV6 A;  2ZKZ A;  5K5O A;  1UHM A;  2PQ8 A;  1B59 A;  2R7F A;  4ENN A;  2KKO A;  5LHI A;  1E17 A;  5JVT A;  1D8J A;  3RYP A;  4L18 B;  5K5R A;  1GVJ A;  1O3Q A;  3WGG A;  3SZT A;  1KU3 A;  2ZO4 A;  4KT5 C;  4EV0 A;  2GA2 A;  1IN5 A;  3QAH A;  2XAH A;  3FMR A;  4XLP F;  5FB2 A;  3CO6 C;  1TW2 A;  5D5W B;  1K79 A;  1R00 A;  4BHB A;  4UHT A;  4UUV A;  1RZ4 A;  4CHU A;  5L3E A;  2Q8K A;  1FSH A;  2P8T A;  3R0A A;  3KLN A;  4PDK A;  1ZN2 A;  4AD9 A;  4Q5S F;  1MJB A;  1G3Y A;  1B1B A;  3ZPL A;  2XRO A;  2FML A;  2X0L A;  1KQ8 A;  2EFO A;  4A5N A;  4HDU A;  5JR3 A;  4CIC A;  2A6E F;  4JK1 X;  1YQA A;  2CQK A;  4PCQ A;  5H20 A;  4L0Z B;  1K7A A;  1T6S A;  5J8C A;  2A61 A;  2Z5U A;  1O7L A;  2M1B A;  5CJ9 A;  4RGU A;  2P4W A;  2VE8 A;  5JHU A;  2DPD A;  2IW5 A;  1HST A;  4UVA A;  3GFM A;  4FT8 A;  4KUM A;  1O7F A;  2EFQ A;  1XGN A;  4GYI A;  3F8B A;  1R1V A;  1O3R A;  1XSV A;  1K6O A;  1JGS A;  2B0L A;  4PGG A;  1XGS A;  5H6R A;  1KYZ A;  4U0W A;  4WK8 F;  2R3S A;  3E6D A;  4QWQ A;  1A73 A;  1MZB A;  4YFK F;  1XSD A;  5A2Q Z;  1G4D A;  2X4H A;  2HKX A;  2O8X A;  1B6A A;  5ILV A;  2R7D A;  2QLZ A;  4JQF A;  4RB0 A;  3DXJ F;  3WTW C;  5BPD A;  5LHG A;  3TO7 A;  5E20 A;  3BPV A;  1R23 A;  4IXA A;  2RN7 A;  3F8F A;  1S6L A;  2DAO A;  1J75 A;  1FYM A;  1SD4 A;  1YS6 A;  4AVP A;  2IA0 A;  4N9I A;  2JT1 A;  3LQR A;  2QQ9 A;  2OA4 A;  1H9T A;  3HOS A;  3DF8 A;  1QBJ A;  3GX4 X;  1UB9 A;  3MZH A;  2D2W A;  3WGH A;  3M8E A;  5LBQ A;  3ECO A;  1EH6 A;  1FBU A;  4I02 A;  5F64 A;  1XCB A;  3K0L A;  2FF4 A;  4AWX B;  1W5S A;  1IN7 A;  2DQL A;  2O61 A;  2F5E A;  3ERE D;  2GZW A;  4O5V A;  3W6J B;  1FSE A;  1R5H A;  1DPR A;  3PQK A;  4LLN A;  1MKM A;  3JAM K;  2ZME A;  3IKT A;  2UWM A;  3FMQ A;  3M7G A;  1XMK A;  4PGH A;  5DDG A;  4EGZ A;  3EET A;  1PP7 U;  3I59 A;  2LDU A;  2XAS A;  1CF7 A;  5HDG A;  3FM3 A;  3FHZ A;  3LST A;  3WTX C;  4HZF A;  1Q1H A;  4LGW A;  1BM9 A;  2OQR A;  5AIP A;  3MWM A;  1Y0U A;  1MDM A;  3I54 A;  4KYW A;  3CTA A;  3KP3 A;  2UXN A;  4KMF A;  1L3L A;  1UFM A;  2A68 F;  2FBH A;  2ISZ A;  2L3D A;  3BPX A;  1E2X A;  4KIB A;  2OBP A;  3I4P A;  2FBK A;  4CDG A;  2HKO A;  3BP8 A;  2QQB A;  5HLI A;  1KQ9 A;  1ZRE A;  5FO5 A;  2WV0 A;  2NYX A;  2E7X A;  2FU4 A;  2V1U A;  2O03 A;  2IA2 A;  4EJU A;  4ETS A;  3TO6 A;  1OMI A;  2DFI A;  1BBY A;  1P2F A;  4YIF A;  2EV6 A;  1ZLJ A;  4CO8 A;  2GXB A;  2VBY A;  2QEN A;  4RB1 A;  3JSP A;  4G8X A;  4B09 A;  5DEQ A;  1ZLK A;  1QQI A;  1TQP A;  1W5T A;  3L9F A;  3DFG A;  3I5U A;  3NQO A;  2A5Y B;  3HHG A;  1JHH A;  2VON A;  2RV8 A;  2EV5 A;  3GFL A;  4ZYE A;  4O6J A;  3FMS A;  4BQA A;  4EJW A;  2PMU A;  4E70 A;  2HR3 A;  3KEQ A;  1ZAR A;  1Z6R A;  3QPT A;  2VOP A;  3V4G A;  1V4R A;  4HOB A;  2O3F A;  1FZP B;  5LEJ A;  4HW0 A;  1D3Y A;  4HX4 A;  2VOO A;  1PP8 F;  1A74 A;  3C1D A;  5IT3 A;  1TLH B;  1LNW A;  2V1X A;  4HX8 A;  2HGC A;  3T5X A;  1HW5 A;  1XGM A;  3BDD A;  1QO0 D;  2KIM A;  2WTE A;  1W4M A;  3J81 Z;  3FM5 A;  2NRA C;  1FBS A;  2NNN A;  4EMS A;  1UHW A;  1IXC A;  2PEX A;  2ESH A;  1VTN C;  5FLX K;  4ESF A;  1SFX A;  3ZMU A;  2P6T A;  3LA7 A;  4U0V A;  5EEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...