1U3EM

Dna binding and cleavage by the hnh homing endonuclease i-hmui
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
174
structure length
174
Chain Sequence
MEWKDIKGYEGHYQVSNTGEVYSIKSGKTLKHQIPKDGYHRIGLFKGGKGKTFQVHRLVAIHFCEGYEEGLVVDHKDGNKDNNLSTNLRWVTQKINVENQMSRGTLNVSKAQQIAKIKNQKPIIVISPDGIEKEYPSTKCACEELGLTRGKVTDVLKGHRIHHKGYTFRYKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA Binding and Cleavage by the HNH Homing Endonuclease I-HmuI.
pubmed doi rcsb
source organism Bacillus phage spo1
molecule tags Dna binding protein/dna
molecule keywords 36-MER
total genus 43
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF07463 NUMOD4 NUMOD4 motif
M PF13392 HNH_3 HNH endonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u3eM02
3.90.75.20 Alpha Beta Alpha-Beta Complex Homing Intron 3 (I-Ppo) Encoded Endonuclease; Chain A Homing Intron 3 (I-Ppo) Encoded Endonuclease; Chain A 1u3eM01
1SFEA 4KFCA 1BM9A 3FM5A 5LHHA 1HXDA 3F8CA 4LK1F 2JRTA 4AIHA 1IW7F 5ILSA 1OMIA 2L4AA 1FY7A 4OIOF 5F6FA 1W4MA 3ZMTA 2FEZA 3TKYA 4L9JA 5L3EA 4QLCU 4CYDA 3M1EA 1KU3A 1UHWA 4BHBA 3VEPA 3MFKA 5AIQA 2EV0A 4XSXF 2YR2A 2V1DA 1Y0UA 2YSRA 3N97A 3CUQC 5K5RA 2XHKA 2RNJA 4I0BA 1J0RA 4BNCA 1UB9A 4R1HA 2ZKZA 2HOEA 4RGSA 1Z7UA 4BHCA 5LEKA 2QZ8A 1OPCA 1YFHA 5CVIA 4IRHA 5DDGA 2FMLA 2MLGA 4KMUX 2GZWA 4MEYF 5FD6A 2NNYA 1YYVA 4L5IA 2W57A 1F5TA 4CICA 2IT0A 4LMYA 1FT9A 5DYMA 2DQRA 2R3SA 4UV9A 2BEOA 2H27A 2VBXA 5DD4A 4G8XA 3SQNA 3CTAA 2RC4A 4M9SA 4OMZA 4AIJA 3WGHA 1T0FA 4UNOA 3DKWA 4ZYEA 5K1YA 1WQ2A 5CLSA 2MA3A 4QWQA 4YIFA 3WTXC 2PJPA 1O3TA 4ESFA 4A5MA 2AS5F 4XLPF 4EM1A 1O7LA 2GAUA 2MBFA 2WTEA 1XMKA 4I01A 5F64A 2D2WA 2K27A 4CDGA 1R00A 3BY6A 2HFHA 2WV0A 3IKVA 1HW5A 1QZZA 3CUOA 4EGZA 4EJUA 3RKWA 2Z33A 1ZAOA 1FYLA 3D0SA 1B9NA 1RI7A 5BS6A 2FBKA 1OYWA 1K6OA 1FOKA 1S7AA 2R7FA 2NAZA 4Y13A 3KZZA 3BWGA 1SAXA 1IN6A 4LLNA 3EETA 3RTRA 2EFQA 3IWZA 2HTJA 1U5TA 3MZHA 3E6MA 3HRMA 5D8KB 1S29A 1XCBA 1LVAA 3WTWC 2GA1A 1J2XA 1XGMA 3ZMUA 3GF2A 3O3KA 2PN6A 2XIGA 2OQGA 1R1UA 2QQAA 4IXAA 4KUMA 2EJRA 4PDKA 4MTEA 2H94A 4S05A 3T0YA 3RIRA 3KLOA 3FWEA 2CYYA 1D8KA 1K78B 3K9TA 4LB5A 1DPUA 5BPIA 3L00A 4RB1A 1YS7A 1PDNC 1KYWA 2ZCWA 3KP4A 1SD4A 3HRTA 1W7PA 5HS7A 1GHCA 1OKRA 3GFIA 3TO7A 4XLNF 3ZP5A 3RDIA 1WKMA 3TO6A 2O6GE 2JPCA 4ZZDA 1E17A 2GIVA 3P9IA 2ETHA 4GGGA 2FBHA 3LQQA 1MZBA 3L7WA 3GYHX 3H92A 3ROUA 2XUBA 3I54A 2ESHA 2YX7A 3LA3A 1FNNA 1SMYF 5LHIA 4OOIA 5A2QZ 1BI2A 1BBYA 5FD5A 4L9NA 3V7SA 4HQEA 3EYYA 3W6JB 3C1DA 2PMUA 4IHSA 2VBYA 4BAYA 4HV6A 1ON2A 1T98A 1FBSA 5LGUA 1OYYA 3F3XA 3O2PE 3D5LA 4LK0F 1F9NA 5ED4A 2BE5F 5KK1A 5K5QA 4MQ9F 2PMHA 3JAMK 4UVBA 2XGXA 1TW3A 1BIBA 1B4AA 2DQLA 2FRHA 1T2KA 2KIFA 3CLOA 4H0EA 2M87A 4IHTA 3VODA 2VC0A 2KIUA 3KFWX 3BP8A 1CF7A 2O03A 1XN7A 2CG4A 3VFZA 4NHJA 5L3DA 1P4XA 2HQNA 4GCVA 5FO5A 2FF4A 2XKOA 1O3SA 2JPBA 4D0PA 3K1MA 3EYIA 1D5VA 2UWMA 4L5JA 2RKHA 2V9VA 5EEHA 5TJJA 3K69A 4ON0A 2K4BA 1R36A 1ZG1A 3CDHA 4RB2C 2W24A 1C0WA 1LNWA 1IXRC 2LF8A 3QU6A 2QBYB 4RGXA 5E17F 3I59B 3M8EA 3I59A 4ESJA 2P5KA 3EQLF 1O57A 4EQQA 3FMRA 3MEXA 4YIIA 4BYYA 3GUDA 1XD7A 3R4KA 2ZBKA 1CF7B 2FSWA 3W6KB 4ESBA 4EJOA 5D8LB 4I09A 5D6EA 4G6QA 1KYZA 5A2QK 1WRJA 2L4MA 2A69F 3BJ6A 2IVMA 4M6XA 3R0AA 4R79A 3K1NA 4ENNA 5DUIA 4N9HA 2H6BA 1ZLJA 2ELHA 1GXQA 2STWA 3I4PA 3SFZA 1BI3A 4WCGA 2ZXJA 1EH7A 5DD8A 3J7AO 1BN5A 4A6EA 3H3UA 1U3EM 2L01A 2YX4A 3WU1B 2Y75A 1FZPB 3QRFF 4Y17A 5HLGA 3I71A 2XVCA 4MGRA 3FF5A 2VXZA 4G7OF 3OV8A 1KU9A 1JGSA 3SXYA 3E6CC 5LGNA 1B6AA 2NS0A 2M1BA 1MJBA 5J6XA 2RDPA 2P6TA 3RYPA 1KQ0A 5LHGA 3C7JA 1L0OC 4OINF 4O3MA 2Q8KA 2WC2A 4YG2F 1QNTA 2MH9A 2B0LA 3CO7C 4M71A 5HLHA 1I27A 1TW2A 1IN8A 2LF7A 3U1DA 3QP5A 4UXNA 1MD0A 4U0WA 3SHFA 4KT5C 3G3ZA 4KIGA 5IT3A 4IPAA 2FE3A 2IA1A 1IUYA 4WWCA 5LEJA 4A12A 3HRSA 3WGGA 3KP6A 1QBJA 4CGZA 1T6SA 1BJAA 3HSRA 3CUQA 3FMSA 5BOXA 5K5OA 2BV6A 5D5UB 2X4HA 1G4DA 2FOKA 4ZYDA 2DBBA 3ZMZA 2FXAA 1ZGAA 2IP2A 3TO9A 3WODF 1MKMA 2QENA 1WI9A 4ZZLA 4ENJA 1ZLKA 4PGHA 1KA8A 5F1RA 1F1ZA 1YW7A 4YFXF 3LWFA 2IW5A 2QBYA 1DP7P 4L9VA 1R22A 3KEOA 1FSHA 2E7WA 4EM0B 1I1GA 3DP7A 1R5GA 4AD9A 2NNNA 3F8BA 3IRRA 3PQJA 2EV5A 4XBFA 3JSOA 3J81K 2FBIA 4AWXB 4LG0A 2ADUA 1RZ4A 5HS8A 3LA7A 4U7BA 2K4JA 3TDUC 1YW8A 1PP8F 1IRGA 2FMYA 3HTUA 2QVOA 1J75A 3QU3A 1ONVA 3FXQA 1ZRDA 3BJAA 3IHUA 3RKXA 1U8RA 5FLXK 1BC8C 2OAZA 3BJOA 1XGSA 4B09A 4KA4A 2O8XA 1USSA 1OYIA 2KIMA 1XB4A 4BHPA 3WTYC 2OQRA 1LDDA 2Y0MA 4ENMA 2F5EA 3FMQA 3KP7A 2EFNA 3GZ6A 4I2OA 4B8XA 1B1BA 5AIPA 4HV5A 3JSPA 1ZG3A 1E2XA 2VONA 3HIFA 4HBLA 3V8JA 2MH2A 1RNLA 4Q5SF 2Z5UA 4BH9A 2K02A 3T8TA 4I98B 2ZNYA 2DI3A 3HYIA 4KIBA 1W7PD 3LAJA 4Y15A 1FPQA 1HSJA 1Z1DA 3E5QA 1P6RA 3E5XA 2XV4S 2GXBA 2Y48A 4IF4A 2O3FA 1BI1A 3BDDA 2VT2A 2WWYA 2DTRA 3MZYA 3FM3A 4GXOA 5CVJA 2IJLA 2EB7A 1EV7A 2DLLA 1LQ1A 2A68F 4HAMA 4UV8A 3FXUA 4BXUA 2CFXA 1W5TA 2OA4A 2NRAC 1NHAA 3DPTA 3ERED 4M6YA 1TLHB 4IRGA 4LJZF 1G3SA 2LNBA 2GWRA 2VOOA 2JZYA 5CVUA 1W5SA 1R7JA 4XRFA 4LD5A 2M30A 4M9ZA 4PZJA 1OR7A 5LBQA 3CUQB 4OIPF 3P9KA 5FLXZ 2PBIA 1SMTA 1R1TA 3V8KA 1ZRFA 4RGRA 1R58A 2R7DA 3QOPA 2XRNA 2RQPA 5ILUA 3PQKA 3GO5A 4YFKF 2IA2A 3K2ZA 5TRDA 3CO6C 1FP1D 1AWCA 2G7HA 3BPXA 3HHGA 4LB6B 3IRQA 1S8NA 1XDSA 1ULYA 3MAJA 1SD5A 2MLKA 4HX4A 5E18F 3FHZA 3KP2A 4UVCA 2ZMEA 4L18B 1R5HA 1YO5C 3BZ6A 5LLQA 4GYGA 2HWVA 2VOPA 3ABTA 5FFZA 4A0XA 2Z99A 2DK5A 2KKOA 4KMFA 2F2EA 3E3VA 4CZZA 5JFRA 4HW0A 4WK8F 3ZN1A 4LG0B 1QZYA 2KRFA 4A0ZA 2PI0A 2LKPA 1GXPA 1BOAA 3EDPA 1XSDA 3F6OA 4RB0A 4EJVA 4KN7X 1AOYA 1ZYRF 3LAPA 1DDNA 1I1SA 4ENKA 1REPC 2GXGA 4ETSA 1MDMA 2A6EF 4FX4A 5JR3A 3C18A 2ZMEB 5L3FA 1FC3A 1PUEE 4BQAA 1HKSA 3JTHA 3ZN0A 2DW4A 2HQRA 3J80Z 5E1ZB 2HR3A 5D5WB 1XCVA 2L02A 5FFXA 2HYGD 3F8FA 1ZG5A 3F23A 5ERIA 4MTDA 3EUHA 3HSEA 3WTTC 2P7VB 4Q48A 4RAZA 4P55A 3MQ0A 4OMYA 3E97A 2XASA 4KIFA 2PFBA 2ZJ2A 2H6CA 2BGCA 5HDGA 2YU3A 2V1UA 5LRRA 2HZTA 2QUFA 3IC7A 2M8EA 3RYRA 3DQVC 2E1CA 4ASNA 1T39A 1TTYA 5L3GA 1V4RA 4EGYA 4Z2YA 3GZ5A 2ISZA 3F21A 2W25A 2F5CA 1G6NA 2D45A 5H6QA 2XAHA 1XGOA 1H0MA 4HA8A 2CGPA 1IZ1A 5J8FA 1Z6TA 5DEQA 1IXCA 3L2CA 4JBAA 4HF1A 1SD7A 1FX7A 4HZFA 1FLIA 4HX7A 1HW2A 3GX4X 1YIOA 2QWWA 3HUGA 4UHTA 2COMA 1IRFA 4HF0A 1TQMA 3MCZA 2STTA 2QQ9A 1S6LA 1FSEA 1RIOH 4OIQF 4WF2A 2ZO4A 3KETA 2FA5A 5J8CA 5CJ9A 4DQ2A 2FNAA 5E8IA 3T1BA 4HF2A 1UHMA 2V1XA 5CYVA 4I0AA 4A2UA 1ZREA 4G94A 4WXHA 4LGWA 3ECHA 4EJTA 2RN7A 3GLXA 4JQFA 3T5XA 1O3QA 1J7KA 3J81Z 5E1WA 1YLFA 1ZN2A 3KZYA 4I7HA 1KQ8A 1IXSB 5CVRA 1ON1A 3GFMA 2HS5A 2HYFA 2DFIA 4YFNF 2V6CA 3RI4A 2VE8A 4HDVA 1K7AA 4Q4ZF 6PAXA 5E8GA 5JVTA 1D3YA 2HTSA 1WSUA 5FGMA 3GW2A 4G7HF 5L3BA 4KICA 5HLIA 4GYIA 2A3SA 3DV8A 1SD6A 3HOSA 1X3UA 3GFJA 5IT9Z 1IN7A 2G9WA 4AVPA 1I5ZA 2Q0OA 1IF1A 1SFUA 2DPUA 1A04A 2DT5A 3ZMVA 2UXXA 1XGNA 3DPLC 2D1VA 2KJCA 4G6DA 4MEXF 2CO5A 3HHHA 3JAMZ 5D4RA 4RB3C 4M72A 2QLZA 3CJNA 3GEZA 2MC3A 2RGVA 2VODA 2RV8A 4PGGA 3S2WA 1JHHA 5D5XB 1U6GA 5JHUA 1J9IA 4FT8A 2QQBA 1V3FA 4LFUA 2OD5A 3KP3A 2XAJA 3ULQB 1FBQA 2VC1A 1J59A 3B73A 5HVQC 1K78A 1XSXA 5H20A 2EFWA 1ODDA 1XSVA 1KU2A 2P6SA 1MGTA 4EV0A 3R61A 2VBWA 3ZMDA 3V7CA 1P4AA 5BPDA 3LA2A 1D8JA 4ZYHA 1TNSA 1P4WA 3DFGA 1JXSA 1W7PB 3F8MA 4CXFA 4P96A 3NQOA 1USTA 4A0YA 2EFOA 3PFIA 3TDZC 1LEAA 3ML6A 2EK5A 2JSCA 2BYVE 2HKOA 3IWFA 4O5VA 4HLYA 1QQIA 3F8NA 4ZH4F 3WTVC 3COAC 3WU0A 1HSTA 4HLXA 1BI0A 1Z05A 1QPMA 3BOQA 3QPHA 2AXLA 1RUNA 3B02A 4L9TA 1LB2A 1HKTA 1K79A 2HKXA 4ZYGA 3ZQ7A 3F22A 2W84A 2VN2A 1YW9A 4GO1A 4CHUA 3ZMSA 2XROA 1YS6A 4LLLA 4U0YA 5ILVA 1VTNC 1HW1A 1Z6RA 4EMSA 4DNCA 1FYMA 1B59A 1L3LA 4RAYA 2FNPA 3I58A 1TQIA 2LDUA 2TDXA 4NB5A 3KE2A 2M45A 2E1NA 1U5TC 4IRIA 2OU2A 4M9XA 1Q1HA 2QYOA 1YQAA 2VBZA 4WX9A 4MQVA 2A61A 3TGNA 5AONA 3TQNA 2Z9OA 1S3JA 2PQ8A 4UVAA 4A5NA 5FB2A 1HKQA 4WXCA 1J5YA 3ZPLA 1G3WA 3KEQA 1P92A 5H6RA 3C3WA 4KDPA 3VB2A 1FYKA 2E7XA 4RS8A 2XAGA 1PP7U 3KCCA 4M73A 4E70A 1BIAA 1SFXA 3LFKA 4PCQA 4KNYA 1MJAA 1ZARA 2O0YA 3L09A 3WGIA 1QGPA 2J5OA 4K2EA 3ISPA 3V4GA 3WTUC 3ABUA 3OOPA 3NRVA 4O6JA 3ECOA 4KYWA 3WG9A 1G3YA 1Z91A 3ELKA 4U0VA 3GVAA 2QM3A 2L54A 3BROA 1ZH5A 2W85A 2HDCA 3AAFA 2L3DA 5HDNA 3V8LA 2RVCA 2BBYA 2C6YA 3REOA 3RPQA 2EFPA 3I53A 1F4KA 4P5OA 4A6DA 5DCFA 2JTVA 3TOBA 3FZVA 2P4WA 1LEBA 2VE9A 1TBXA 2G7UA 2ESNA 3HSFA 3F72A 3U9GA 1IN5A 2UZKA 1I6XA 3M7GA 3JW4A 4HX8A 2OBPA 2F5DA 4N9IA 2ACJA 2V79A 2ZFWA 3QPTA 1H9GA 1Z9CA 4MHGA 2X0LA 4P9FA 2Q2EA 1H9TA 5JI6A 4I02A 1MJ9A 1FBUA 2P8TA 3H3ZA 1U2WA 3WTZA 4HDUA 5IT9K 1LDJA 2CSOA 5ICFA 3I64A 2O61A 5HOOA 3E6DA 4U88A 3L9FA 1HBXG 3DXJF 2PEXA 2Z3YA 5DCMA 2GA2A 2P7CB 3R60A 1KGSA 2GQQA 3K1PA 3WTSC 1G3TA 3KP5A 4G9YA 1EH6A 1ZHFA 2LSOA 3IL2A 2OZ6A 3DEUA 3O6BB 3I5UA 4AIKA 3FXRA 2A5YB 2XAFA 3LSTA 2CW0F 4EJWA 3LQRA 1YTYA 2MD5A 5D6FA 2EV6A 2D1HA 5EEGA 2ISYA 2P5LC 4L0YB 3SZPA 5ICCA 1ZGJA 1EH8A 3I0TA 3E6BA 1DUXC 2P5VA 4EM2A 4Q47A 3K0LA 1DPRA 3WE3A 3QAHA 2FQ3A 2XKPA 3TOAA 3IKTA 4JK1X 3GXOA 4OU0A 5CVVA 2UXNA 2KJBA 4KN4X 3J80K 4WXDA 1S7OA 3R6SA 1ZRCA 2DU9A 2JT1A 4FX0A 1HQCA 1CGPA 5LGTA 1WWXA 1QO0D 2DPDA 3RPUA 4IVNA 2F5FA 3E5UA 3NEUA 2EA2A 3Q5FA 5E1XA 3VOEA 3F6VA 2NYXA 3HOTA 2OZUA 1BC7C 1UCRA 1KQ9A 3M8FA 1XDUA 2DO7A 4HQMA 2VT3A 3G73A 3V7RA 3BPVA 3JTGA 3WE2A 4UUVA 4U7DA 5ICEA 1STZA 1T38A 1P2FA 5DV5A 1IN4A 1GVJA 3RKYA 4P9UA 1O3RA 4FHTA 1R1VA 3HRUA 5BMZA 5HS9A 4XSZF 2A07F 4MNUA 1R23A 5HDKA 2A6HF 5E20A 4TV7A 2CQKA 2IPQX 4CO8A 1FP2A 2PG4A 3QP6A 5BQTA 3R0JA 3DF8A 1UFMA 2EWNA 4R8HA 3KLNA 4M74A 4G7ZF 1IAWA 4S04A 4N0BA 2DAOA 4OIRF 2J5PA 1JE8A 1TNTA 1YG2A 2ZNZA 2IRFG 3GFLA 2HGCA 3T8RA 5D5VB 2IA0A 2XAQA 1TQPA 3GWZA 3Q9SA 5DUKA 1LDKB 2HEOA 1U5TB 4LLGF 1FWZA 3FX3A 1XMAA 5L3CA 1O7FA 3U2RA 4F7ZA 3RJPA 5KVRA 1RUOA 5D4SA 1MDMB 2K86A 1B9MA 5DCMB 1KU7A 2CWEA 3MWMA 3SZTA 3P7NA 4L0ZB 1U78A 2H09A 4RGUA 4NQWA 2PLYA 2FU4A 5ICGA 2EA4A 2DK8A 2K7LA 2YPRA 5LRSA 2M5WA 3M9AA 3HTSB 1LJ9A 4HYEA 3N4MA 4IJAA 4EVIA 4HOBA 1JHFA 3Q9VA 3P9CA
chains in the Genus database with same CATH superfamily
1SFEA 1XG1A 4KFCA 3OYGA 2IGNA 2M8GX 3U21A 4B47A 1BM9A 3FM5A 5LHHA 1HXDA 1ACIA 1WJ5A 3F8CA 2LK2A 4LK1F 1OR7C 2JRTA 2M0CA 4AIHA 1P9QC 1IW7F 5ILSA 1OMIA 2L4AA 3FBNB 3MD2A 1FY7A 2EPFA 4OAYA 4OIOF 1SVLA 2Z1DA 5F6FA 1W4MA 3L2QA 3ZMTA 2FEZA 3TKYA 2DOFA 4L9JA 4PJ0C 1OCZH 3QOEA 2R92J 1UJ8A 3HOZJ 5L3EA 4QLCU 3KYCB 4CYDA 1LFBA 3A1YA 3M1EA 5CQEA 2D5VA 1KU3A 1R5ID 1SANA 1UHWA 3VEPA 4BHBA 3MFKA 5FRNA 3FKJA 5AIQA 3I9V2 2EV0A 3CCQI 4XSXF 5F0CA 2AO9A 2YR2A 3BR3A 2V1DA 2VKEA 3H9JA 1Y0UA 3LSRA 2YSRA 3RCOA 3N97A 5JVGF 3CUQC 5K5RA 2KQRA 2CQXA 2XHKA 2RNJA 4I0BA 4V19K 1TWAJ 1J0RA 3E1SA 4BNCA 5IYDJ 1UB9A 4R1HA 2ZKZA 2HOEA 4RGSA 1D1CA 1Z7UA 4BHCA 5LEKA 2QZ8A 2HVQA 1OPCA 2K3FA 1YFHA 5CVIA 4IRHA 1HOMA 3G1MA 3M4OJ 3OR2C 5DDGA 2FMLA 1AKHA 4PFPA 2MLGA 1H8AC 1VF9A 2DJIA 2E34A 3VYTB 4KMUX 4A3EJ 2KPMA 2GZWA 3K4JA 4MEYF 5FD6A 2NNYA 1YYVA 4L5IA 2W57A 1F5TA 4C30A 4CICA 2IT0A 2WBMA 2EBIA 1PJRA 3JREA 3BQZA 4LMYA 1FT9A 3M07A 5DYMA 2DQRA 5GADJ 3DPUA 1H88C 1EF4A 2R3SA 4UB8C 4UV9A 2BEOA 2DA3A 2H27A 3SDGA 5DS9A 4A3JJ 1T0FC 3K4NA 2VASA 2EH3A 2VBXA 5J4VA 5DD4A 2P81A 4A3FJ 2EZHA 2OC6A 4G8XA 3SQNA 3CTAA 4Y3OA 2RC4A 4M9SA 5IY5H 1VQPI 4OMZA 1MNMC 1BW6A 3P5JA 4AIJA 3WGHA 4A3MJ 1XC5A 4E7ZA 3DEWA 1T0FA 2K40A 1UMQA 4UNOA 3DKWA 3PNVA 4ZYEA 3TW6A 2EQRA 5K1YA 1WQ2A 2CU7A 4MIMA 2W48A 2XB0X 5CLSA 2MA3A 4I6ZA 4QWQA 3TW7A 4YIFA 3WTXC 4BE2A 2XGCA 2ZSHB 4NC6A 2PJPA 4PFOA 1WH7A 2HDDA 1O3TA 1Z0XA 4ESFA 5J3LA 4J19A 4B43A 4A5MA 2PJRA 3M8JA 4NC7A 1B8IB 4XLPF 2AS5F 4EM1A 1O7LA 2GAUA 2R5ZA 3SZGA 5TGTA 2MBFA 2WTEA 3PO2J 1XMKA 4I01A 5F64A 3CF2A 2XGEA 3HG9A 2D2WA 1OCCH 2K27A 4CDGA 1F36A 1R00A 3BY6A 1Y1WJ 3MVPA 2HFHA 1MBFA 4XORA 2WV0A 3IKVA 5J4YA 1HW5A 1QZZA 3NWTA 1IDZA 3CUOA 1P7JA 5IP7J 2PX9A 4EGZA 4RMNA 3FK6A 4EJUA 3W6VA 3RKWA 4NC8A 2Z33A 3JRDA 2Q1ZB 3PFYA 1ZAOA 4N4NB 3D0SA 1FYLA 1B9NA 3OYBA 1D0YA 1DQUA 1RI7A 5BS6A 3S1RJ 2FBKA 1TL8A 1OYWA 1K6OA 2XRLA 3LSIA 1FOKA 3I4MJ 1S7AA 2R7FA 3MZ8A 1POGA 3OSFA 2NAZA 2L2OA 3FIWA 4Y13A 3X2QH 4E7KA 3KZZA 1FTZA 3BWGA 5KHDA 5F27A 1SAXA 2CQNA 1W0UA 1IN6A 3DEEA 4LLNA 3EETA 1KZHA 3A2KA 1CQTA 4XKCA 1VZ0A 2LKXA 1QZEA 3RTRA 2EFQA 3IWZA 2HTJA 1U5TA 1HCRA 4PSWA 2F6CA 3MZHA 2F4OB 3E6MA 1NG6A 3HRMA 2QGUA 5D8KB 1S29A 4A3IJ 1XCBA 2I5UA 1LVAA 2LMDA 3WTWC 2GA1A 1WJDA 1J2XA 1YE9A 1XGMA 4E7IA 3ZMUA 3GF2A 3O3KA 5EZHA 1X1BA 2PN6A 4M3FA 1W36C 2LFBA 2XIGA 3S14J 2JA2A 5GAEJ 2X85A 2OQGA 1R1UA 4Y7NJ 2K9MA 2QQAA 4IXAA 4KUMA 2NVXJ 3GTGJ 2EJRA 2E19A 4PDKA 2LBFA 2LC2A 2X51A 4MTEA 1A36A 3S17J 3GTKJ 2H94A 4XRSG 3IH4A 2XF6A 4S05A 1B72B 3QYBA 3T0YA 3RIRA 3KLOA 3FWEA 2IGOA 2CYYA 2XSDC 1D8KA 2FQ4A 2GBYA 2LY9A 1K78B 3K9TA 3MKLA 3FXOA 3CMMA 4DYQA 1VQ9I 4M3GA 3IP4B 3ZQLA 4LB5A 1DPUA 5BPIA 2ZJQF 3L00A 3OYJA 4RB1A 3QQAA 1YS7A 2HQ5A 1PDNC 1KYWA 1IRZA 5EG0B 1NK3P 4DW6A 2ZCWA 3KP4A 2E2HJ 3BG7A 5M5YJ 4KT6A 4IHYA 1SD4A 3IH3A 2VQLA 4HRIA 3S32A 3HRTA 1W7PA 5HS7A 1GHCA 1OKRA 3GFIA 3BG9A 1RRJA 3TO7A 3JRGA 1YJNI 4XLNF 3CC2I 3H35A 3J7AY 3ZP5A 3RDIA 1WJAA 1WKMA 3TO6A 2O6GE 2JPCA 4ZZDA 1E17A 1MBEA 2GIVA 3P9IA 4DGWB 2GOXB 3LSMA 1UELB 2ETHA 4GGGA 2FBHA 3LQQA 2JA6J 1MZBA 1OLTA 3LL7A 3L7WA 1A6QA 4CZCA 3GYHX 1LPQA 4NQWB 3H92A 3ROUA 2XUBA 2DOEA 3I54A 2ESHA 3I4NJ 2YX7A 3LA3A 4PK4A 2ID3A 1FNNA 1SMYF 5LHIA 2K3PA 4OOIA 1BI2A 1BBYA 2KDOA 4XOTA 5FD5A 5A2QZ 2IXSA 2NVTJ 3ZOBA 4L9NA 3V7SA 2L7ZA 4HQEA 1ENHA 3EYYA 3W6JB 4F52A 3RQIA 2GXAA 2WY8Q 3ZQHA 3EUAA 2ME6A 3H5AA 2DA6A 1ZGWA 3C1DA 3OIOA 5J1YA 2PMUA 4IHSA 2EIJH 2VBYA 4BAYA 4BXFA 2DXIA 4HV6A 1ON2A 5GP9A 3SFIA 4BQQA 1T98A 4DYCA 3OY9A 2H1LA 2XGDA 2HXIA 1FBSA 5LGUA 3BLYA 1OYYA 2M2EA 2UV1A 2HZDA 2B7EA 5KCMA 3F3XA 4EATA 2QKLB 3O2PE 3D5LA 4DJAA 4LK0F 1Z77A 2LTPA 1F9NA 3ABLH 5ED4A 4CCNA 2LY1A 2BE5F 5KK1A 5K5QA 4MQ9F 1QHGA 2PMHA 1APLC 5EJCA 3JAMK 4C3JJ 3HDDA 1MNDA 2XGXA 4UVBA 3UR3C 2W7NA 3CP2A 1TW3A 1BIBA 1B4AA 1RESA 2DQLA 3IAM2 5EEAA 2Y0SN 2FRHA 4ZJZA 2WY7Q 1MMSA 3HXLA 1T2KA 2KIFA 2ZJPF 3CLOA 5GPAA 4H0EA 1X3WB 2JA5J 2M87A 4CCKA 4IHTA 3VODA 2VC0A 3SEQA 2KIUA 2WAQA 3AFHA 2VXDA 4FETA 5CPRB 1WVRA 3KFWX 3BP8A 4CA0A 2V7FA 2K85A 4JYKA 1CF7A 2DN0A 2O03A 1XN7A 1OCPA 3EPZA 2CG4A 3VFZA 1MBKA 2KRCA 1M1EB 2JUCA 1T56A 5FLVA 3DKXA 1RKTA 4NHJA 3VDXA 2L5QA 5L3DA 1P4XA 2HQNA 4GCVA 5FO5A 5EDNA 2FF4A 2XKOA 3FXLA 1O3SA 3J7ZI 4AC0A 2ECCA 2JPBA 4D0PA 1X1DA 4HNVA 1A74A 3K1MA 2H8RA 3EYIA 5LD2C 1D5VA 2M34A 4IKFA 2UWMA 2RREA 3OYAA 4L5JA 2RKHA 2V9VA 5EEHA 5TJJA 2DMUA 1RC9A 3G6EI 3K69A 2V4JC 4ON0A 2K4BA 1R36A 1ZG1A 3CDHA 3H5NA 1T33A 2W1OA 2HNHA 2W24A 2OV7A 1LNWA 4RB2C 1C0WA 1IXRC 2NVUB 2LF8A 3QU6A 1TWFJ 2A6TA 3H9GA 2QBYB 2GIZA 5M5XJ 1U9NA 4RGXA 1JTXA 3I59B 5E17F 1WCMJ 3I59A 3M8EA 4ESJA 4IOAF 2P5KA 1IUFA 3EQLF 2HVSA 1O57A 2VJ5A 4EQQA 3FMRA 3OYCA 3MEXA 4YIIA 4BYYA 4XMYA 3GUDA 3HZJA 1XD7A 1W1WE 3R4KA 3A0HC 4BDZA 2ZBKA 1UG2A 1CF7B 2FSWA 3W6KB 3DTIA 4ESBA 4EJOA 3A01A 5D8LB 4I09A 5D6EA 2DTZA 4G6QA 1KYZA 2EZLA 2BY0A 3ZQFA 5A2QK 2MW8A 1IPPA 1K4TA 1WRJA 1OCRH 4OWRB 2VUMJ 2L4MA 3CJRB 2A69F 3BJ6A 1LE8B 2IVMA 3OS1A 4M6XA 3TEDA 4DIQA 3R0AA 1WJFA 2IAIA 4R79A 1MNEA 2GM4A 3K1NA 4C3IJ 5CKTA 3J7YJ 3GTOJ 4ENNA 5DUIA 3LSGA 1SFOJ 3C2GA 4HG2A 3TL4X 2P0WA 4N9HA 2NXNB 2H6BA 3OYDA 1IDYA 4KITB 2Z16A 1ZLJA 2CV0A 2ELHA 4MFEA 1CYQA 1GXQA 2STWA 3N05A 3KX2A 5K7HA 3I4PA 4ZDLA 3SFZA 1IV8A 1BI3A 5IP9J 4WCGA 1FIAA 2ZXJA 2KFDA 1EH7A 2E36A 5DD8A 4IHXA 4B44A 2W4SA 1ITYA 1I3QJ 2BXZA 1X4PA 3J7AO 1BN5A 4A6EA 3GTLJ 1LVKA 1T08B 4E4HA 1VI0A 3H3UA 2TCTA 1U3EM 2L01A 2YX4A 3M1CA 5K7ZA 4RA2A 3WU1B 2OPTA 2Y75A 1I6HJ 1FZPB 3QRFF 4Y17A 5HLGA 3I56I 4UY8I 3I71A 2VKDA 2GLOA 1GVDA 4BEHA 1PUFB 2XVCA 1ZKGA 4BACA 4MGRA 3FF5A 2VXZA 1ZTRA 3FKIJ 3KIOA 1XS9A 3OV8A 4G7OF 2V9KA 3CMYA 3K6GA 4ZDOA 1KU9A 2KISA 1JGSA 3ABKH 3SXYA 3E6CC 5DM6F 4OAZA 5F0HA 5LGNA 2DA7A 1IG7A 3AL0C 1B6AA 2JSPA 3IV5A 3FHNA 2NS0A 2M1BA 2Q2EB 3OS2A 3OYFA 4BE1A 1MJBA 5J6XA 2RDPA 2P6TA 3RYPA 3DU5A 1KQ0A 5LHGA 3C7JA 1L0OC 3A02A 3PIPF 4BE0A 2V1NA 1JT6A 4OINF 4O3MA 2OJED 2OCCH 2Q8KA 1TWHJ 1Z3YA 2R7XA 3K2AA 1FOYA 2WC2A 3HM5A 4YG2F 3HL2A 1QNTA 3BTCA 5FLMJ 2MH9A 1RKWA 2FJ1A 2B0LA 3MMYB 4RLFA 3CO7C 4M71A 4AU7A 3S3MA 5HLHA 1I27A 1TW2A 2CW8A 1IN8A 2LF7A 5J1RA 2NVQJ 3U1DA 3QP5A 4UXNA 1MD0A 2DT6A 3TP0A 4U0WA 3SHFA 3G2BA 4KT5C 4CCJA 4ABZA 3G3ZA 4KIGA 5IT3A 4IPAA 4F55A 4B4CA 3JR9A 2HI3A 3AG1H 1MSFC 9ANTA 2FE3A 2IA1A 1IUYA 4WWCA 3BT9A 5LEJA 2LR8A 4A12A 3FDYA 3HRSA 3IAS2 2CUJA 3KP6A 3WGGA 3OIPA 4G12A 1QBJA 4CGZA 5KAFC 1YRNB 2R7SA 1T6SA 1BJAA 2JVGA 3HSRA 1O4XA 3CUQA 3FMSA 5BOXA 3CMEI 1G8XA 4PUSA 5K5OA 2BV6A 5D5UB 2X4HA 1G4DA 1HC8A 2FOKA 4ZYDA 2DBBA 2L7KA 2R7OA 2XPUA 3ZMZA 2FXAA 2FD5A 5CQGA 3ESWB 1ZGAA 2IP2A 3TO9A 3WODF 3BCAA 4CH7A 1MKMA 2JVHA 2L9VA 3S2HJ 2QENA 1WI9A 4ZZLA 3DLLF 4Y4RA 5FKOA 4ENJA 1ZLKA 4PGHA 3BQYA 1V5FA 1ZQ3P 3DBHB 4AYBN 2QKMB 1KA8A 5F1RA 4D1QA 1ZR2A 3DLAA 1F1ZA 1YW7A 1X1PA 4YFXF 3LWFA 2IW5A 1SVMA 1Y1VJ 2QBYA 5KAIC 1DP7P 3S16J 4XLFA 1XMXA 4L9VA 1R22A 3KEOA 1F43A 1FSHA 2E60A 1BA5A 2LD5A 2HPMA 3CJQB 3GTPJ 2Y69H 2E7WA 4XM3A 2M0MA 4EM0B 1I1GA 3DP7A 1Y39A 3FBIB 1R5GA 4XONA 3OOUA 4AD9A 2AQEA 2NNNA 3F8BA 3IRRA 5JLWA 3PQJA 2MG4A 2CV2A 2EV5A 2RAEA 4XBFA 1WH5A 1BOBA 3JSOA 4RM2A 3J81K 2FBIA 4AWXB 4LG0A 3NAUA 1X2MA 2HDWA 5F04A 4E7HA 2KT0A 2Y31A 3PNYA 4F91B 2QF7A 2ADUA 1E3PA 1RZ4A 2DA4A 3S8PA 5HS8A 3LA7A 4U7BA 2K4JA 3TDUC 1H89C 5DTDA 1YW8A 2X1EA 2ZMEC 1PP8F 1IRGA 2FMYA 3HTUA 2QVOA 1J75A 3QU3A 4M3DA 5TISC 2IBDA 2WB1N 1ONVA 1V5GA 3FXQA 1JT0A 1ZRDA 3BJAA 4ZTFA 2X9DA 4HEA2 1QPIA 1B8IA 3IHUA 4Y52J 1LKXA 3RKXA 1U8RA 4F92B 5FLXK 2O6MA 1GDTA 3HKZN 2R7UA 2ZB9A 1BC8C 2OAZA 3BJOA 1XGSA 4XL9A 4B09A 4KA4A 2O8XA 1USSA 1OYIA 2W00A 2KIMA 3B6AA 1XB4A 4BHPA 3OS0A 3WTYC 2OQRA 1JJ6C 5HNHA 2R0QC 2LVSA 3FXMA 2LKSA 3O8HA 1LDDA 2OCEA 4P1WA 3L2WA 3BR2A 2Y0MA 4ENMA 2F5EA 1JJ8C 3FMQA 3ERMA 2V9PA 3KP7A 2EFNA 3CDLA 1Y8QB 2TRTA 1QVTA 4L5EA 3GZ6A 2VI6A 4I2OA 4B8XA 1B1BA 5AIPA 5H2FC 3L1PA 4HV5A 3JSPA 1ZG3A 3CD6I 4XLAA 1E2XA 2VONA 3HIFA 4BUPA 4HBLA 2WADA 3V8JA 2MH2A 4XK4A 1RNLA 4Q5SF 1WGXA 2Z5UA 4BH9A 2K02A 3T8TA 4I98B 3TMOA 3PIOF 1K6YA 2X6WA 2ZNYA 1EVXA 4PJMA 3CZ6A 1V55H 4BL0B 2DI3A 3HYIA 4KIBA 1W7PD 1QHHD 3LAJA 4Y15A 4CYCA 1FPQA 1HSJA 1Z1DA 3E5QA 5IOZA 1DGRM 1P6RA 3E5XA 2XV4S 4DBQA 1N78A 5EZGA 3MKYB 2GXBA 1PVEA 2Y48A 4IF4A 2O3FA 1TWCJ 1BI1A 3BDDA 3ONQA 5J1UA 4XLHA 1W5CC 2VT2A 2WWYA 2DTRA 3MZYA 4DOZA 3FM3A 4YELA 1TT5B 3I55I 4GXOA 3BCBA 3CCMI 1VFCA 4MO7A 4A69C 5CVJA 4BJ6C 2IJLA 4D9JA 5FROA 3PUFA 2EB7A 1EV7A 2DLLA 3A03A 3DTEA 1LQ1A 2A68F 5E3MA 3JRAA 3HC7A 3UKGA 4HAMA 4UV8A 3FXUA 3Q0WA 4AUXA 4BXUA 2CFXA 4CUGA 1W5TA 3RQ4A 1MMDA 3TBIA 2OA4A 1YJ9I 2NRAC 1NHAA 3DPTA 3ERED 3IUOA 1DU6A 2GOMA 4M6YA 1TLHB 4IRGA 2ICWG 1IV6A 4LJZF 1QA6A 1G3SA 2LNBA 3A4CA 4XIDA 2GWRA 3BTLA 1A31A 1VNDA 2N8GA 2VOOA 2JZYA 5CVUA 1W5SA 1R7JA 4XRFA 4UUSA 1IRXA 4LD5A 1Z7LA 2M30A 1LUJB 4M9ZA 3KEYA 4PZJA 2PJRB 1X4OA 1IJWC 1OR7A 5FJ8J 3ZR8X 5LBQA 3CUQB 1HLVA 4OIPF 3P9KA 1SC7A 2AXTC 1R4MB 5FLXZ 1JKRC 2PBIA 1SMTA 1R1TA 2NS8A 2Y0SA 3V8KA 1ZRFA 4RGRA 2VJJA 2WV1A 5C44J 1R58A 2R7DA 3QOPA 2XRNA 4C3HJ 2RQPA 1JKOC 2B9SA 3LSPA 2BHYA 5ILUA 3GBGA 3PQKA 3GO5A 4N4OB 4YFKF 2IA2A 3MN2A 4LIVA 4YEJA 2O9LA 4BXXJ 3K2ZA 5JLXA 5TRDA 5FKLA 3CO6C 3WU2C 1FP1D 2G7HA 3BPXA 3HHGA 4LB6B 3IRQA 1AWCA 1S8NA 1XDSA 2HQAA 3RPUD 1ULYA 3MAJA 4AVZA 1SD5A 2MLKA 3G71I 3A01B 4HX4A 5E18F 3FHZA 2VPLA 3KP2A 4UVCA 2ZMEA 4L18B 1DP3A 2L9NA 1R5HA 4XQFA 1YO5C 3BZ6A 2DODA 3GMEA 3S1QJ 5LLQA 4QPQA 1D5YA 4GYGA 2HWVA 2VOPA 3ABTA 5FFZA 3GTQJ 4A0XA 2Z99A 2DA2A 3K4MA 1K4SA 2DK5A 2KKOA 4KMFA 2F2EA 3E3VA 4U87A 2IS2A 2EZKA 1S7EA 4CZZA 2E35A 4DZPA 5JFRA 4HW0A 3OYMA 4WK8F 3ZN1A 2F5VA 4LG0B 2QSGX 4RAFA 1QZYA 3VPRA 3K4LA 2KRFA 4A0ZA 2PI0A 1R9TJ 2LKPA 2LOOA 3K4CA 1GXPA 1BOAA 3EDPA 1E0EA 1XSDA 1IO2A 2VQCA 1JTYA 3F6OA 4RB0A 5B1BH 4EJVA 1FTTA 4KN7X 3O8GA 1AOYA 1ZYRF 3K7AJ 5FKMA 3BG5A 4FASD 5B1AH 1AKHB 3LAPA 1DDNA 3MKZA 1I1SA 1RETA 4ENKA 1NK2P 2L0KA 3CDIA 1REPC 2GXGA 4ETSA 1MDMA 3OL4A 1X19A 1KONA 2A6EF 5JR3A 4FX4A 1I39A 2CUZA 3CCYA 3D5SC 4B48A 2XPVA 4CCMA 5C3EJ 3C18A 2M4KA 3M3YJ 1BR2A 1OCOH 2ZMEB 4LG3A 5L3FA 3HBLA 2K9QA 1FEXA 1ZELA 3BG3A 1FC3A 1T95A 2CUEA 4LITA 5M3MJ 1PUEE 4BQAA 2L9SA 1HKSA 4I99C 4ANJA 3F9KA 3JTHA 3CCJI 3ZN0A 3D5RC 2XF7A 2DW4A 3H1CA 2HQRA 2R7QA 2V6EA 3J80Z 4RM3A 1SEUA 3ASOH 2HR3A 5E1ZB 5D5WB 1XCVA 1ERDA 2L02A 5FFXA 3U1KA 3Q3SA 4CCOA 3EUKL 2YU9J 3VYUB 2HYGD 3F8FA 2LH9A 1ZG5A 3F23A 5ERIA 2DYRH 1VQ6I 2F48A 2Y9YA 3BTJA 4MTDA 1BR1A 3EUHA 3HSEA 3WTTC 4IO9F 2P7VB 4Q48A 4RAZA 3A0BC 4Y33A 4P55A 3MQ0A 5IOYA 5C4XJ 4IEJA 1EVWA 3D1NI 3HUGB 3BZCA 3HOYJ 3AG3H 2CUFA 4BY1J 4OMYA 3E97A 2XASA 1E3HA 4FE7A 2K5CA 3QYEA 2XF5A 2NVYJ 2KL4A 3FXJA 4KIFA 1GV2A 2PFBA 2ZJ2A 2H1KA 2R93J 4D7MA 2EINH 1FMWA 2H6CA 2BGCA 2E71A 3HPGA 4BGDA 4A3BJ 2XC7A 5HDGA 2YU3A 2V1UA 5LRRA 2HZTA 2QUFA 3QODA 3IC7A 2M8EA 3RYRA 3DQVC 4JX5A 2E1CA 4RLQA 5GAGJ 1UHSA 4ASNA 2IS4A 2NS7A 1T39A 2KMUA 2WAFA 4IZZA 1TTYA 5L3GA 3PJRA 1V4RA 4EGYA 2KLOA 4Z2YA 3GZ5A 3SDBA 2ISZA 5C4JJ 3F21A 2W25A 1R6RA 1G6NA 2F5CA 2D45A 5H6QA 2XAHA 3S3NA 2XAUA 1XGOA 3VYRB 2WAEA 4BJ5C 2DOAA 1H0MA 2ELKA 4F3QA 1TT0A 4HA8A 2R5YA 2CGPA 4II3A 2X1CA 1IZ1A 5J8FA 1Z6TA 5DEQA 3DWLE 1IXCA 3L2CA 3RKQA 4ZTJA 4JBAA 4HF1A 1SD7A 1FX7A 2E5NA 3I3LA 2M7BA 4HZFA 2E2JJ 1FLIA 2MC4A 4HX7A 2VL8A 1HW2A 3PO3J 3GX4X 3GZNB 3CC4I 1YIOA 2QWWA 3HUGA 4ZC3A 2CRGA 4UHTA 2K9NA 2COMA 1IRFA 3HJEA 4HF0A 1TQMA 3MCZA 2STTA 4BY7J 2QQ9A 1S6LA 2HXOA 1D1AA 1FSEA 1RIOH 4OIQF 1IC8A 4WF2A 2ZO4A 3KETA 3S1MJ 4NUBA 2FA5A 3BC8A 5J8CA 5GPCA 5CJ9A 1MW7A 1JI8A 4DQ2A 4QIWN 2FNAA 2X1DA 5E8IA 2VLAA 3T1BA 1ETKA 4HF2A 1UHMA 2V1XA 4MLOA 5CYVA 4I0AA 4A2UA 1ZREA 2QCOA 4G94A 4WXHA 3HOXJ 4LGWA 3ECHA 1PYVA 4DBRA 4EJTA 2ME0A 2RN7A 3GLXA 4JQFA 3T5XA 1O3QA 2HVRA 4UUTA 3L2RA 4AYBA 1J7KA 2ZFUA 2BW3B 3J81Z 3PM1A 5E1WA 1EA3A 1YLFA 1ZN2A 3E0JB 3KZYA 4I7HA 1KQ8A 2LY2A 1IXSB 3QPSA 5CVRA 1ON1A 3GFMA 4D5CA 2HS5A 3UNGC 2ELJA 4HSTA 4CYCB 1JUMA 2HYFA 2OF7A 4ITVA 3PUBA 2DFIA 2FX0A 3F0CA 3SEZA 1VQ7I 4YFNF 5B5EC 2V6CA 3RI4A 3RSNA 3CCEI 2VE8A 4HDVA 1UAAA 1VQMI 1K7AA 1WJEA 2R7WA 4Q4ZF 6PAXA 2EIKH 3HOWJ 5E8GA 3TP3A 5JVTA 1D3YA 2HTSA 1WSUA 1MH4A 2XB5A 2BXYA 5FGMA 3GW2A 4G7HF 1WJBA 1G2HA 5L3BA 4KICA 1Y56A 4GYIA 1MMGA 5HLIA 2KZGA 5LFAA 2A3SA 2RNGA 3DV8A 1SD6A 1MBHA 3HOSA 1VQKI 1X3UA 1AA7A 3GFJA 3QWLA 4D5FA 3BR1A 2HYJA 1VQNI 5IT9Z 1DGWY 1IN7A 3VWBA 4BEHB 1PUFA 1OCTC 2G9WA 1NH3A 1YX5A 1YIJI 2LYCA 4AVPA 1I5ZA 4JP0A 2UUZA 3BR0A 4E7SA 1HF0A 2LREA 2Q0OA 4F93B 4RAGA 1IF1A 1SFUA 5IYBJ 2DPUA 1A04A 3DU6A 2DT5A 1VQOI 3ZMVA 3AKZA 2UXXA 2I10A 2HPIA 1XGNA 3DPLC 4G6TB 1YJWI 2D1VA 4H4KC 2KJCA 4G6DA 5EF6A 1XPXA 3LSHA 2X6YA 2QSFX 4MEXF 2L7MP 4XRSA 2CO5A 3HHHA 2VKHA 3HEFA 1WJCA 3JAMZ 2BVMA 5D4RA 4RB3C 4M72A 3PL8A 4XLCA 2QLZA 5FRMA 3CJNA 1S72I 1GV5A 2BOLA 4DYRA 1Z21A 3GEZA 2MC3A 2RGVA 2VODA 2RV8A 4PGGA 3SJMA 2ZSIB 2MGQA 2X6OA 3S2WA 4IOCF 1JHHA 1ETOA 4EEFG 5D5XB 4AM3A 5F08A 1U6GA 4BDYA 4PSXA 5JHUA 1N77A 1J9IA 1JKPC 4FT8A 5F1JA 3BG6A 3WHCA 2QQBA 1V3FA 4LFUA 3KZIC 2OD5A 4RDUA 1S5LC 4BKXA 1V54H 3IH2A 3LFUA 3KP3A 2XAJA 3ZQIA 3OYKA 4M3EA 3G4SI 1A35A 3ULQB 1MBGA 1FBQA 2VC1A 1YX3A 1J59A 3B73A 5HVQC 1K78A 3ZQCA 1NTCA 1XTAA 1J09A 1XSXA 5H20A 2EFWA 1ODDA 1XSVA 4JX4A 2LG4A 1KU2A 2P6SA 5K7FA 1MGTA 2BY3A 4EV0A 2VJ4A 3R61A 2VBWA 3ZMDA 4E7JA 2VB6A 4BJTA 3V7CA 1P4AA 2IS6A 2A5WA 3CJTB 5BPDA 3S3OA 3LA2A 2DFFA 5EG0A 2CJJA 2R7TA 1D8JA 4ZYHA 1TNSA 3HPHA 1P4WA 2M9HA 4X6AJ 3DFGA 3CCRI 1JGGA 2XDVA 1JXSA 5B3SH 1W7PB 3BR5A 3F8MA 4CXFA 3C2BA 4P96A 3NQOA 2DFEA 4Z6YA 1USTA 4ZYAA 1MH3A 4W97A 3CQZJ 4A0YA 5J40A 2EFOA 3PFIA 3TDZC 1LEAA 2VJIA 3ML6A 2EK5A 3CP8A 3H0DA 2JSCA 3RZOJ 2BYVE 4B3XA 2HKOA 1RR7A 3IWFA 2R7VA 1A5JA 4O5VA 1QQIA 2BZTA 3F8NA 4ZH4F 3WTVC 5EYRA 3COAC 4HLYA 1LFUP 3WU0A 4I76A 5F0FA 1HSTA 4PJNA 3ABMH 4HLXA 1BI0A 5E79C 2NOJB 2F4MB 2EIMH 1Z05A 1HDDC 3KYDB 1QPMA 3BOQA 3QPHA 2AXLA 1RUNA 1WI3A 2IGKA 2Y9ZA 2BVLA 4D7NA 3B02A 4L9TA 1LB2A 4HSRA 3GCMA 1HKTA 2BW3A 1K79A 2WB1A 2HKXA 4ZYGA 4QSHA 3ZQ7A 4KISA 4V2FA 4XKWA 2E2IJ 3F22A 3OR1C 2W84A 2VN2A 1YW9A 3GLLA 1Y6IA 2JUGA 4GO1A 4CHUA 2DMTA 3BR6A 1U0JA 3K4KA 2I8DA 3ZMSA 4IQ4A 4E6KG 2DFHA 2DT7B 1YS6A 4U0YA 4LLLA 2XROA 5ILVA 1VTNC 1HW1A 4V2GA 1LFPA 4XLEA 1Z6RA 4EMSA 4DNCA 2X48A 3ZGKA 1FYMA 1WFXA 2RQQA 1B59A 2KP6A 2JJ7A 4C2UA 1L3LA 4RAYA 1IGNA 4XOPA 4A3CJ 3GTMJ 1RR8C 2FNPA 3I58A 1TQIA 2LDUA 2TDXA 4NB5A 3JRCA 3KE2A 2M45A 2E1NA 1U5TC 4IX7A 3V42A 1OISA 3OL3A 4IRIA 1YI2I 2ZC2A 2ZJRF 1WHUA 2OU2A 4M9XA 2DDAA 1Q1HA 2LP0A 1MMNA 2QYOA 4HPQA 1YQAA 4BS9A 2VBZA 1ETQA 1XX5A 4WX9A 4MQVA 2A61A 4RBOA 3CCLI 3CCUI 3TGNA 5AONA 2R5ZB 1G59A 3DBLB 3TQNA 2Z9OA 5FKNA 4C9YA 3DBRB 1S3JA 1W36D 2PQ8A 4UVAA 4A5NA 2KIQA 1ETVA 4NNJA 3OMYA 5FB2A 5HODA 1AU7A 4B1RA 1HKQA 2DDBA 4WXCA 4XRMA 3H0GJ 3AG2H 1E3OC 1J5YA 3ZPLA 2HOSA 1G3WA 2VIXA 2LRDA 3KEQA 1A6IA 1P92A 3C3WA 5H6RA 3CC7I 4KDPA 4A3DJ 2M4GA 3VB2A 4HNTA 2MABA 1FYKA 2CQQA 4FTHA 4HNUA 3ASNH 3JCUC 3PNTA 2E7XA 5IP6A 2DMNA 4RS8A 2XAGA 3BTIA 1PP7U 3KCCA 3MKWB 1Z67A 4M73A 4E70A 5M5WJ 1BIAA 3CCSI 1SFXA 3LFKA 3H3VK 4PCQA 4KNYA 3B6CA 2DYSH 4QPOA 1MJAA 1ZARA 1MMAA 2ID6A 2O0YA 3L09A 3Q0VA 1WZ2A 3ZXSA 2Y2ZA 3OWTA 3WGIA 3G1OA 1Y8RB 5B66C 1QGPA 2J5OA 4K2EA 3ISPA 4XKBA 3V4GA 2XSJC 4FQGA 4XICA 3QYFA 3WTUC 1QU3A 4UUSB 3ABUA 3OOPA 3NRVA 2KDZA 2O7OA 1ETXA 3LOCA 3LNQA 3CF5F 4O6JA 1D0XA 3ECOA 3W2VA 4KYWA 2AQFA 3VSKA 3WG9A 3JRFA 1G3YA 1Z91A 1I3AA 3ELKA 4U0VA 3WHBA 2O5RA 4BBRJ 5BNGA 4LIUA 2K9SA 3GVAA 4NDLA 2BHZA 2BY1A 2QM3A 1Q1VA 2L54A 3BROA 4PJJA 1ZR4A 1R71A 2W85A 1ZH5A 2JA8J 2HDCA 4MFDA 3K10A 3AAFA 2L3DA 3OYLA 5HDNA 1OJLA 2RVCA 3V8LA 2BBYA 2JRMA 2C6YA 3REOA 3RPQA 2E5ZA 3PSIA 2DJNA 1GUUA 2EFPA 3I53A 1F4KA 1QRYA 1DU0A 4JOMA 2MYSA 4P5OA 4A6DA 5DCFA 2JTVA 3TOBA 2L9RA 3FZVA 2P4WA 4X0GA 1LEBA 2CFOA 2IEKA 1TBXA 4PJLA 2VE9A 1TZLA 1MIJA 3HKZA 1X2NA 4E7LA 5JHFA 2G7UA 2ESNA 4BBSJ 3OYNA 3HSFA 5M3FJ 3F72A 3NARA 3U9GA 2ZXHA 1IN5A 2A05A 2L7FP 2UZKA 1I6XA 2CQ7A 3M7GA 3JW4A 4HX8A 2OBPA 2F5DA 4N9IA 2ACJA 2V79A 1JUSA 2ZFWA 3QPTA 1H9GA 3HOVJ 1Z9CA 4MHGA 2X0LA 1VQLI 3S93A 4CCLA 4P9FA 2Q2EA 2R4GA 2WA0A 1H9TA 5JI6A 4I02A 4FISA 1MJ9A 1FBUA 2P8TA 3H3ZA 3Q0UA 3KYLA 1U2WA 3WTZA 4QTRA 4HDUA 5IT9K 1LDJA 2CSOA 5ICFA 3I64A 2O61A 3KPHA 1V5EA 5HOOA 1VQ5I 3E6DA 3SYTA 4U88A 2QEXI 3L9FA 1HBXG 2VQHA 3DXJF 2PEXA 5IYCJ 2Z3YA 5DCMA 2GA2A 2JA7J 2P7CB 3R60A 1KGSA 5E3LA 2GQQA 3L2UA 3K1PA 3WTSC 1G3TA 3KP5A 4G9YA 1EH6A 5EGOB 1ZHFA 3S2DJ 2LSOA 3IL2A 4C2TA 3FISA 4CSWA 2M3AA 4XNFA 1U8BA 2OZ6A 2AHQA 3DEUA 1D0ZA 3O6BB 1SAUA 1B72A 2COBA 3I5UA 4AIKA 1BJZA 2CS3A 3FXRA 5E3NA 2XAFA 1OFCX 2A5YB 4M6VA 3HGGA 1BW5A 4A3GJ 1FOWA 3JRIA 3LSTA 2V26A 1ETYA 2R5YB 2CW0F 2O8KA 1WPKA 4EJWA 2YUSA 3LQRA 5GTIC 5E3OA 1YTYA 1YRNA 1K61A 2MD5A 1X1CA 1R4NB 2DA1A 3CLQA 5D6FA 2F4IA 4M3BA 2LLKA 2ZXIA 3AL0B 2HOTA 2HU9A 4FE4A 2EV6A 3FXKA 2ECBA 2D1HA 1D1BA 1X58A 4W1UA 5EEGA 2ISYA 2P5LC 2W82A 4L0YB 3SZPA 3CMAI 5ICCA 1ZGJA 3LSJA 2YS9A 4XN0A 1EH8A 3I0TA 3W3CA 2K9LA 1A73A 4A3LJ 4BU2A 1Z3XA 3E6BA 1DUXC 2P5VA 4EM2A 2EILH 4Q47A 3K0LA 2VQGA 2FOWA 3H36A 5IPAA 1DPRA 3WE3A 1CZ0A 1X1AA 3DKYA 3QAHA 2FQ3A 3C2HA 4KJZA 2JN6A 3DCFA 3HB9A 3W2WA 2XKPA 2PMZA 1Y0NA 3OIQA 4C2MJ 2DMPA 1OQYA 3OYEA 1FMVA 3TOAA 3IKTA 1N75A 2CMPA 4JK1X 1T8IA 3W2AA 3JRBA 3S1NJ 2IGMA 2WAQN 3GXOA 4OU0A 5CVVA 2UXNA 2KJBA 4KN4X 3J80K 4B3AA 1VQ8I 4WXDA 1S7OA 3H9QA 2R7ZJ 1MSEC 3R6SA 3WG7H 1ZRCA 2DU9A 2JT1A 3HGYA 2FUG2 3HOUJ 4FX0A 5KNLA 1HQCA 3G1LA 1CGPA 5LGTA 1WWXA 3ZCOA 1R49A 1FIPA 1QO0D 2KHMA 2VPRA 3RPUA 2DPDA 4IVNA 4YRVA 2F5FA 3E5UA 3AG4H 3NEUA 1YOVB 3ZRGA 2EA2A 2Z2SB 4IL6C 1GLNA 3Q5FA 5E1XA 3VOEA 2JMWA 2CV1A 3F6VA 2NYXA 3HOTA 2OZUA 1BC7C 1S9HA 1UCRA 1KQ9A 1X3ZB 1XDUA 2DO7A 3M8FA 3LMMA 2VT3A 4HQMA 3G73A 3V7RA 3ZQQA 1VQ4I 3RZDJ 4ZDPA 3PSFA 3OSGA 3BPVA 3JTGA 3WE2A 3K70D 2JQ7A 1MBJA 3EUHC 4U7DA 5ICEA 4UUVA 1STZA 1FJLA 3GTJJ 3K4BA 1P2FA 4JX6A 5DV5A 1IN4A 2PMZN 1T38A 4IHWA 1GVJA 3RKYA 1I50J 4P9UA 1O3RA 4FHTA 1ZK8A 2H8WA 2E1MB 1R1VA 1UG0A 3BZKA 2B63J 3HRUA 5BMZA 5J47A 5HS9A 4XSZF 2A07F 2R7RA 1TWGJ 4MNUA 1R23A 3FK7A 5HDKA 1FOXA 2A6HF 5E20A 2OUMA 1K83J 4TV7A 3JRHA 1P7IA 5GTHC 3S15J 2CQKA 2IPQX 4IQJA 1N25A 3LSKA 1ETWA 4CO8A 2IS1A 2MSYA 1EJ9A 2M7AA 1FP2A 2PG4A 3QP6A 2BY2A 5BQTA 3R0JA 3DF8A 4GRIA 1UFMA 2DCEA 2EWNA 4R8HA 1QVUA 1W0TA 3KLNA 1GT0C 4M74A 4G7ZF 1IAWA 1NG7A 4S04A 4N0BA 2DAOA 3E7LA 4OIRF 2JWTA 5HLTA 2J5PA 1SFKA 1SVOA 1TNTA 2CH0A 1JE8A 1HA8A 1YG2A 2Y30A 2ZNZA 2IRFG 2CW7A 3GFLA 2HGCA 1JKQC 4J01A 1JUPA 2QQ8A 4II2A 3T8RA 5D5VB 2IA0A 2KRHA 2XAQA 4UB6C 3OYIA 3ZQGA 1AHDP 1TQPA 4BQOA 3GWZA 2G0EA 3Q9SA 5DUKA 1LDKB 3NWSA 2HEOA 1U5TB 2MD0A 1ORKA 4LLGF 2MFZA 3QPLA 1UZCA 2HOAA 4YIRX 1RPWA 1FWZA 1YHQI 4XKVA 3FX3A 4XN3A 4XR6A 2QSHX 1XMAA 3H5RA 5L3CA 4GDFA 1O7FA 3CCVI 2QA4I 2DMQA 2JK3A 3U2RA 4F7ZA 2VKVA 3RJPA 3K70C 5KVRA 4A3KJ 1RUOA 1TC3C 2E1OA 5D4SA 1MDMB 2KZVA 2K86A 1BL0A 1B9MA 5DCMB 2XPWA 2X6XA 4FCYA 3VYSB 3L2VA 1KU7A 2CWEA 3MWMA 3SZTA 4AIDA 2OTJI 3P7NA 4L0ZB 1YITI 3DTKA 2LBFB 5EGOA 1U78A 4A93J 2OTLI 4J00A 2H09A 4RGUA 4NQWA 3VSLA 2ZXWH 4LOCA 1TP4A 2FU4A 2DA5A 5ICGA 3OYHA 2PLYA 1LE8A 4GFBA 2EA4A 2DK8A 4S0HB 5GAHJ 2EZIA 2K7LA 2YPRA 5FKKA 5HNFA 5LRSA 4DZJA 4NBQA 2E1MC 1U9OA 2M5WA 3M9AA 1LJ9A 3HTSB 4HYEA 2NOGA 4BQNA 3N4MA 4IJAA 4EVIA 4HOBA 3CESA 1HDPA 5DM7F 1JHFA 3Q9VA 4IHVA 4X1EA 1BR4A 3P9CA 1EKEA
chains in the Genus database with same CATH topology
1SFEA 4KFCA 1BM9A 3FM5A 5LHHA 1HXDA 3F8CA 4LK1F 2JRTA 4AIHA 1IW7F 5ILSA 1OMIA 2L4AA 1FY7A 4OIOF 5F6FA 1W4MA 3ZMTA 2FEZA 3TKYA 4L9JA 5L3EA 4QLCU 4CYDA 3M1EA 1KU3A 1UHWA 4BHBA 3VEPA 3MFKA 5AIQA 2EV0A 4XSXF 2YR2A 2V1DA 1Y0UA 2YSRA 3N97A 3CUQC 5K5RA 2XHKA 2RNJA 4I0BA 1J0RA 4BNCA 1UB9A 4R1HA 2ZKZA 2HOEA 4RGSA 1Z7UA 4BHCA 5LEKA 2QZ8A 1OPCA 1YFHA 5CVIA 4IRHA 5DDGA 2FMLA 2MLGA 4KMUX 2GZWA 4MEYF 5FD6A 2NNYA 1YYVA 4L5IA 2W57A 1F5TA 4CICA 2IT0A 4LMYA 1FT9A 5DYMA 2DQRA 2R3SA 4UV9A 2BEOA 2H27A 2VBXA 5DD4A 4G8XA 3SQNA 3CTAA 2RC4A 4M9SA 4OMZA 4AIJA 3WGHA 1T0FA 4UNOA 3DKWA 4ZYEA 5K1YA 1WQ2A 5CLSA 2MA3A 4QWQA 4YIFA 3WTXC 2PJPA 1O3TA 4ESFA 4A5MA 2AS5F 4XLPF 4EM1A 1O7LA 2GAUA 2MBFA 2WTEA 1XMKA 4I01A 5F64A 2D2WA 2K27A 4CDGA 1R00A 3BY6A 2HFHA 2WV0A 3IKVA 1HW5A 1QZZA 3CUOA 4EGZA 4EJUA 3RKWA 2Z33A 1ZAOA 1FYLA 3D0SA 1B9NA 1RI7A 5BS6A 2FBKA 1OYWA 1K6OA 1FOKA 1S7AA 2R7FA 2NAZA 4Y13A 3KZZA 3BWGA 1SAXA 1IN6A 4LLNA 3EETA 3RTRA 2EFQA 3IWZA 2HTJA 1U5TA 3MZHA 3E6MA 3HRMA 5D8KB 1S29A 1XCBA 1LVAA 3WTWC 2GA1A 1J2XA 1XGMA 3ZMUA 3GF2A 3O3KA 2PN6A 2XIGA 2OQGA 1R1UA 2QQAA 4IXAA 4KUMA 2EJRA 4PDKA 4MTEA 2H94A 4S05A 3T0YA 3RIRA 3KLOA 3FWEA 2CYYA 1D8KA 1K78B 3K9TA 4LB5A 1DPUA 5BPIA 3L00A 4RB1A 1YS7A 1PDNC 1KYWA 2ZCWA 3KP4A 1SD4A 3HRTA 1W7PA 5HS7A 1GHCA 1OKRA 3GFIA 3TO7A 4XLNF 3ZP5A 3RDIA 1WKMA 3TO6A 2O6GE 2JPCA 4ZZDA 1E17A 2GIVA 3P9IA 2ETHA 4GGGA 2FBHA 3LQQA 1MZBA 3L7WA 3GYHX 3H92A 3ROUA 2XUBA 3I54A 2ESHA 2YX7A 3LA3A 1FNNA 1SMYF 5LHIA 4OOIA 5A2QZ 1BI2A 1BBYA 5FD5A 4L9NA 3V7SA 4HQEA 3EYYA 3W6JB 3C1DA 2PMUA 4IHSA 2VBYA 4BAYA 4HV6A 1ON2A 1T98A 1FBSA 5LGUA 1OYYA 3F3XA 3O2PE 3D5LA 4LK0F 1F9NA 5ED4A 2BE5F 5KK1A 5K5QA 4MQ9F 2PMHA 3JAMK 4UVBA 2XGXA 1TW3A 1BIBA 1B4AA 2DQLA 2FRHA 1T2KA 2KIFA 3CLOA 4H0EA 2M87A 4IHTA 3VODA 2VC0A 2KIUA 3KFWX 3BP8A 1CF7A 2O03A 1XN7A 2CG4A 3VFZA 4NHJA 5L3DA 1P4XA 2HQNA 4GCVA 5FO5A 2FF4A 2XKOA 1O3SA 2JPBA 4D0PA 1A74A 3K1MA 3EYIA 1D5VA 2UWMA 4L5JA 2RKHA 2V9VA 5EEHA 5TJJA 3K69A 4ON0A 2K4BA 1R36A 1ZG1A 3CDHA 4RB2C 2W24A 1C0WA 1LNWA 1IXRC 2LF8A 3QU6A 2QBYB 4RGXA 5E17F 3I59B 3M8EA 3I59A 4ESJA 2P5KA 3EQLF 1O57A 4EQQA 3FMRA 3MEXA 4YIIA 4BYYA 3GUDA 1XD7A 3R4KA 2ZBKA 1CF7B 2FSWA 3W6KB 4ESBA 4EJOA 5D8LB 4I09A 5D6EA 4G6QA 1KYZA 5A2QK 1IPPA 1WRJA 2L4MA 2A69F 3BJ6A 2IVMA 4M6XA 3R0AA 4R79A 3K1NA 4ENNA 5DUIA 4N9HA 2H6BA 1ZLJA 2ELHA 1CYQA 1GXQA 2STWA 3I4PA 3SFZA 1BI3A 4WCGA 2ZXJA 1EH7A 5DD8A 3J7AO 1BN5A 4A6EA 3H3UA 1U3EM 2L01A 2YX4A 3WU1B 2Y75A 1FZPB 3QRFF 4Y17A 5HLGA 3I71A 2XVCA 4MGRA 3FF5A 2VXZA 4G7OF 3OV8A 1KU9A 1JGSA 3SXYA 3E6CC 5LGNA 1B6AA 2NS0A 2M1BA 1MJBA 5J6XA 2RDPA 2P6TA 3RYPA 1KQ0A 5LHGA 3C7JA 1L0OC 4OINF 4O3MA 2Q8KA 2WC2A 4YG2F 1QNTA 2MH9A 2B0LA 3CO7C 4M71A 5HLHA 1I27A 1TW2A 1IN8A 2LF7A 3U1DA 3QP5A 4UXNA 1MD0A 4U0WA 3SHFA 4KT5C 3G3ZA 4KIGA 5IT3A 4IPAA 2FE3A 2IA1A 1IUYA 4WWCA 5LEJA 4A12A 3HRSA 3WGGA 3KP6A 1QBJA 4CGZA 1T6SA 1BJAA 3HSRA 3CUQA 3FMSA 5BOXA 5K5OA 2BV6A 5D5UB 2X4HA 1G4DA 2FOKA 4ZYDA 2DBBA 3ZMZA 2FXAA 1ZGAA 2IP2A 3TO9A 3WODF 1MKMA 2QENA 1WI9A 4ZZLA 4ENJA 1ZLKA 4PGHA 1KA8A 5F1RA 1F1ZA 1YW7A 4YFXF 3LWFA 2IW5A 2QBYA 1DP7P 4L9VA 1R22A 3KEOA 1FSHA 2E7WA 4EM0B 1I1GA 3DP7A 1R5GA 4AD9A 2NNNA 3F8BA 3IRRA 3PQJA 2EV5A 4XBFA 3JSOA 3J81K 2FBIA 4AWXB 4LG0A 2ADUA 1RZ4A 5HS8A 3LA7A 4U7BA 2K4JA 3TDUC 1YW8A 1PP8F 1IRGA 2FMYA 3HTUA 2QVOA 1J75A 3QU3A 1ONVA 3FXQA 1ZRDA 3BJAA 3IHUA 3RKXA 1U8RA 5FLXK 2O6MA 1BC8C 2OAZA 3BJOA 1XGSA 4B09A 4KA4A 2O8XA 1USSA 1OYIA 2KIMA 1XB4A 4BHPA 3WTYC 2OQRA 1LDDA 2Y0MA 4ENMA 2F5EA 3FMQA 3KP7A 2EFNA 3GZ6A 4I2OA 4B8XA 1B1BA 5AIPA 4HV5A 3JSPA 1ZG3A 1E2XA 2VONA 3HIFA 4HBLA 3V8JA 2MH2A 1RNLA 4Q5SF 2Z5UA 4BH9A 2K02A 3T8TA 4I98B 2ZNYA 1EVXA 2DI3A 3HYIA 4KIBA 1W7PD 3LAJA 4Y15A 1FPQA 1HSJA 1Z1DA 3E5QA 1P6RA 3E5XA 2XV4S 2GXBA 2Y48A 4IF4A 2O3FA 1BI1A 3BDDA 2VT2A 2WWYA 2DTRA 3MZYA 3FM3A 4GXOA 5CVJA 2IJLA 2EB7A 1EV7A 2DLLA 1LQ1A 2A68F 4HAMA 4UV8A 3FXUA 4BXUA 2CFXA 1W5TA 2OA4A 2NRAC 1NHAA 3DPTA 3ERED 4M6YA 1TLHB 4IRGA 4LJZF 1G3SA 2LNBA 2GWRA 2VOOA 2JZYA 5CVUA 1W5SA 1R7JA 4XRFA 4LD5A 2M30A 4M9ZA 4PZJA 1OR7A 5LBQA 3CUQB 4OIPF 3P9KA 5FLXZ 2PBIA 1SMTA 1R1TA 3V8KA 1ZRFA 4RGRA 1R58A 2R7DA 3QOPA 2XRNA 2RQPA 5ILUA 3PQKA 3GO5A 4YFKF 2IA2A 3K2ZA 5TRDA 3CO6C 1FP1D 1AWCA 2G7HA 3BPXA 3HHGA 4LB6B 3IRQA 1S8NA 1XDSA 1ULYA 3MAJA 1SD5A 2MLKA 4HX4A 5E18F 3FHZA 3KP2A 4UVCA 2ZMEA 4L18B 1R5HA 1YO5C 3BZ6A 5LLQA 4GYGA 2HWVA 2VOPA 3ABTA 5FFZA 4A0XA 2Z99A 2DK5A 2KKOA 4KMFA 2F2EA 3E3VA 4CZZA 5JFRA 4HW0A 4WK8F 3ZN1A 4LG0B 1QZYA 2KRFA 4A0ZA 2PI0A 2LKPA 1GXPA 1BOAA 3EDPA 1XSDA 3F6OA 4RB0A 4EJVA 4KN7X 1AOYA 1ZYRF 3LAPA 1DDNA 1I1SA 4ENKA 1REPC 2GXGA 4ETSA 1MDMA 2A6EF 4FX4A 5JR3A 3C18A 2ZMEB 5L3FA 1FC3A 1PUEE 4BQAA 1HKSA 3JTHA 3ZN0A 2DW4A 2HQRA 3J80Z 5E1ZB 2HR3A 5D5WB 1XCVA 2L02A 5FFXA 2HYGD 3F8FA 1ZG5A 3F23A 5ERIA 4MTDA 3EUHA 3HSEA 3WTTC 2P7VB 4Q48A 4RAZA 4P55A 3MQ0A 1EVWA 4OMYA 3E97A 2XASA 4KIFA 2PFBA 2ZJ2A 2H6CA 2BGCA 5HDGA 2YU3A 2V1UA 5LRRA 2HZTA 2QUFA 3IC7A 2M8EA 3RYRA 3DQVC 2E1CA 4ASNA 1T39A 1TTYA 5L3GA 1V4RA 4EGYA 4Z2YA 3GZ5A 2ISZA 3F21A 2W25A 2F5CA 1G6NA 2D45A 5H6QA 2XAHA 1XGOA 1H0MA 4HA8A 2CGPA 1IZ1A 5J8FA 1Z6TA 5DEQA 1IXCA 3L2CA 4JBAA 4HF1A 1SD7A 1FX7A 4HZFA 1FLIA 4HX7A 1HW2A 3GX4X 1YIOA 2QWWA 3HUGA 4UHTA 2COMA 1IRFA 4HF0A 1TQMA 3MCZA 2STTA 2QQ9A 1S6LA 1FSEA 1RIOH 4OIQF 4WF2A 2ZO4A 3KETA 2FA5A 5J8CA 5CJ9A 4DQ2A 2FNAA 5E8IA 3T1BA 4HF2A 1UHMA 2V1XA 5CYVA 4I0AA 4A2UA 1ZREA 4G94A 4WXHA 4LGWA 3ECHA 4EJTA 2RN7A 3GLXA 4JQFA 3T5XA 1O3QA 1J7KA 3J81Z 5E1WA 1YLFA 1ZN2A 3KZYA 4I7HA 1KQ8A 1IXSB 5CVRA 1ON1A 3GFMA 2HS5A 2HYFA 2DFIA 4YFNF 2V6CA 3RI4A 2VE8A 4HDVA 1K7AA 4Q4ZF 6PAXA 5E8GA 5JVTA 1D3YA 2HTSA 1WSUA 5FGMA 3GW2A 4G7HF 5L3BA 4KICA 5HLIA 4GYIA 2A3SA 3DV8A 1SD6A 3HOSA 1X3UA 3GFJA 5IT9Z 1IN7A 2G9WA 4AVPA 1I5ZA 2Q0OA 1IF1A 1SFUA 2DPUA 1A04A 2DT5A 3ZMVA 2UXXA 1XGNA 3DPLC 2D1VA 2KJCA 4G6DA 4MEXF 2CO5A 3HHHA 3JAMZ 5D4RA 4RB3C 4M72A 2QLZA 3CJNA 3GEZA 2MC3A 2RGVA 2VODA 2RV8A 4PGGA 3S2WA 1JHHA 5D5XB 1U6GA 5JHUA 1J9IA 4FT8A 2QQBA 1V3FA 4LFUA 2OD5A 3KP3A 2XAJA 3ULQB 1FBQA 2VC1A 1J59A 3B73A 5HVQC 1K78A 1XSXA 5H20A 2EFWA 1ODDA 1XSVA 1KU2A 2P6SA 1MGTA 4EV0A 3R61A 2VBWA 3ZMDA 3V7CA 1P4AA 5BPDA 3LA2A 1D8JA 4ZYHA 1TNSA 1P4WA 3DFGA 1JXSA 1W7PB 3F8MA 4CXFA 4P96A 3NQOA 1USTA 4A0YA 2EFOA 3PFIA 3TDZC 1LEAA 3ML6A 2EK5A 2JSCA 2BYVE 2HKOA 3IWFA 4O5VA 4HLYA 1QQIA 3F8NA 4ZH4F 3WTVC 3COAC 3WU0A 1HSTA 4HLXA 1BI0A 1Z05A 1QPMA 3BOQA 3QPHA 2AXLA 1RUNA 3B02A 4L9TA 1LB2A 1HKTA 1K79A 2HKXA 4ZYGA 3ZQ7A 3F22A 2W84A 2VN2A 1YW9A 4GO1A 4CHUA 3ZMSA 2XROA 1YS6A 4LLLA 4U0YA 5ILVA 1VTNC 1HW1A 1Z6RA 4EMSA 4DNCA 1FYMA 1B59A 1L3LA 4RAYA 2FNPA 3I58A 1TQIA 2LDUA 2TDXA 4NB5A 3KE2A 2M45A 2E1NA 1U5TC 4IRIA 2OU2A 4M9XA 1Q1HA 2QYOA 1YQAA 2VBZA 4WX9A 4MQVA 2A61A 3TGNA 5AONA 3TQNA 2Z9OA 1S3JA 2PQ8A 4UVAA 4A5NA 5FB2A 1HKQA 4WXCA 1J5YA 3ZPLA 1G3WA 3KEQA 1P92A 5H6RA 3C3WA 4KDPA 3VB2A 1FYKA 2E7XA 4RS8A 2XAGA 1PP7U 3KCCA 4M73A 4E70A 1BIAA 1SFXA 3LFKA 4PCQA 4KNYA 1MJAA 1ZARA 2O0YA 3L09A 3WGIA 1QGPA 2J5OA 4K2EA 3ISPA 3V4GA 3WTUC 3ABUA 3OOPA 3NRVA 4O6JA 3ECOA 4KYWA 3WG9A 1G3YA 1Z91A 3ELKA 4U0VA 3GVAA 2QM3A 2L54A 3BROA 1ZH5A 2W85A 2HDCA 3AAFA 2L3DA 5HDNA 3V8LA 2RVCA 2BBYA 2C6YA 3REOA 3RPQA 2EFPA 3I53A 1F4KA 4P5OA 4A6DA 5DCFA 2JTVA 3TOBA 3FZVA 2P4WA 1LEBA 2VE9A 1TBXA 2G7UA 2ESNA 3HSFA 3F72A 3U9GA 1IN5A 2UZKA 1I6XA 3M7GA 3JW4A 4HX8A 2OBPA 2F5DA 4N9IA 2ACJA 2V79A 2ZFWA 3QPTA 1H9GA 1Z9CA 4MHGA 2X0LA 4P9FA 2Q2EA 1H9TA 5JI6A 4I02A 1MJ9A 1FBUA 2P8TA 3H3ZA 1U2WA 3WTZA 4HDUA 5IT9K 1LDJA 2CSOA 5ICFA 3I64A 2O61A 5HOOA 3E6DA 4U88A 3L9FA 1HBXG 3DXJF 2PEXA 2Z3YA 5DCMA 2GA2A 2P7CB 3R60A 1KGSA 2GQQA 3K1PA 3WTSC 1G3TA 3KP5A 4G9YA 1EH6A 1ZHFA 2LSOA 3IL2A 2OZ6A 3DEUA 3O6BB 3I5UA 4AIKA 3FXRA 2A5YB 2XAFA 3LSTA 2CW0F 4EJWA 3LQRA 1YTYA 2MD5A 5D6FA 2EV6A 2D1HA 5EEGA 2ISYA 2P5LC 4L0YB 3SZPA 5ICCA 1ZGJA 1EH8A 3I0TA 1A73A 3E6BA 1DUXC 2P5VA 4EM2A 4Q47A 3K0LA 1DPRA 3WE3A 1CZ0A 3QAHA 2FQ3A 2XKPA 3TOAA 3IKTA 4JK1X 3GXOA 4OU0A 5CVVA 2UXNA 2KJBA 4KN4X 3J80K 4WXDA 1S7OA 3R6SA 1ZRCA 2DU9A 2JT1A 4FX0A 1HQCA 1CGPA 5LGTA 1WWXA 1QO0D 2DPDA 3RPUA 4IVNA 2F5FA 3E5UA 3NEUA 2EA2A 3Q5FA 5E1XA 3VOEA 3F6VA 2NYXA 3HOTA 2OZUA 1BC7C 1UCRA 1KQ9A 3M8FA 1XDUA 2DO7A 4HQMA 2VT3A 3G73A 3V7RA 3BPVA 3JTGA 3WE2A 4UUVA 4U7DA 5ICEA 1STZA 1T38A 1P2FA 5DV5A 1IN4A 1GVJA 3RKYA 4P9UA 1O3RA 4FHTA 1R1VA 3HRUA 5BMZA 5HS9A 4XSZF 2A07F 4MNUA 1R23A 5HDKA 2A6HF 5E20A 4TV7A 2CQKA 2IPQX 4CO8A 1FP2A 2PG4A 3QP6A 5BQTA 3R0JA 3DF8A 1UFMA 2EWNA 4R8HA 3KLNA 4M74A 4G7ZF 1IAWA 4S04A 4N0BA 2DAOA 4OIRF 2J5PA 1JE8A 1TNTA 1YG2A 2ZNZA 2IRFG 3GFLA 2HGCA 3T8RA 5D5VB 2IA0A 2XAQA 1TQPA 3GWZA 3Q9SA 5DUKA 1LDKB 2HEOA 1U5TB 4LLGF 1FWZA 3FX3A 1XMAA 5L3CA 1O7FA 3U2RA 4F7ZA 3RJPA 5KVRA 1RUOA 5D4SA 1MDMB 2K86A 1B9MA 5DCMB 1KU7A 2CWEA 3MWMA 3SZTA 3P7NA 4L0ZB 1U78A 2H09A 4RGUA 4NQWA 2PLYA 2FU4A 5ICGA 2EA4A 2DK8A 2K7LA 2YPRA 5LRSA 2M5WA 3M9AA 3HTSB 1LJ9A 4HYEA 3N4MA 4IJAA 4EVIA 4HOBA 1JHFA 3Q9VA 3P9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFE A;  4KFC A;  1BM9 A;  3FM5 A;  5LHH A;  1HXD A;  3F8C A;  4LK1 F;  2JRT A;  4AIH A;  1IW7 F;  5ILS A;  1OMI A;  2L4A A;  1FY7 A;  4OIO F;  5F6F A;  1W4M A;  3ZMT A;  2FEZ A;  3TKY A;  4L9J A;  5L3E A;  4QLC U;  4CYD A;  3M1E A;  1KU3 A;  1UHW A;  4BHB A;  3VEP A;  3MFK A;  5AIQ A;  2EV0 A;  4XSX F;  2YR2 A;  2V1D A;  1Y0U A;  2YSR A;  3N97 A;  3CUQ C;  5K5R A;  2XHK A;  2RNJ A;  4I0B A;  1J0R A;  4BNC A;  1UB9 A;  4R1H A;  2ZKZ A;  2HOE A;  4RGS A;  1Z7U A;  4BHC A;  5LEK A;  2QZ8 A;  1OPC A;  1YFH A;  5CVI A;  4IRH A;  5DDG A;  2FML A;  2MLG A;  4KMU X;  2GZW A;  4MEY F;  5FD6 A;  2NNY A;  1YYV A;  4L5I A;  2W57 A;  1F5T A;  4CIC A;  2IT0 A;  4LMY A;  1FT9 A;  5DYM A;  2DQR A;  2R3S A;  4UV9 A;  2BEO A;  2H27 A;  2VBX A;  5DD4 A;  4G8X A;  3SQN A;  3CTA A;  2RC4 A;  4M9S A;  4OMZ A;  4AIJ A;  3WGH A;  1T0F A;  4UNO A;  3DKW A;  4ZYE A;  5K1Y A;  1WQ2 A;  5CLS A;  2MA3 A;  4QWQ A;  4YIF A;  3WTX C;  2PJP A;  1O3T A;  4ESF A;  4A5M A;  2AS5 F;  4XLP F;  4EM1 A;  1O7L A;  2GAU A;  2MBF A;  2WTE A;  1XMK A;  4I01 A;  5F64 A;  2D2W A;  2K27 A;  4CDG A;  1R00 A;  3BY6 A;  2HFH A;  2WV0 A;  3IKV A;  1HW5 A;  1QZZ A;  3CUO A;  4EGZ A;  4EJU A;  3RKW A;  2Z33 A;  1ZAO A;  1FYL A;  3D0S A;  1B9N A;  1RI7 A;  5BS6 A;  2FBK A;  1OYW A;  1K6O A;  1FOK A;  1S7A A;  2R7F A;  2NAZ A;  4Y13 A;  3KZZ A;  3BWG A;  1SAX A;  1IN6 A;  4LLN A;  3EET A;  3RTR A;  2EFQ A;  3IWZ A;  2HTJ A;  1U5T A;  3MZH A;  3E6M A;  3HRM A;  5D8K B;  1S29 A;  1XCB A;  1LVA A;  3WTW C;  2GA1 A;  1J2X A;  1XGM A;  3ZMU A;  3GF2 A;  3O3K A;  2PN6 A;  2XIG A;  2OQG A;  1R1U A;  2QQA A;  4IXA A;  4KUM A;  2EJR A;  4PDK A;  4MTE A;  2H94 A;  4S05 A;  3T0Y A;  3RIR A;  3KLO A;  3FWE A;  2CYY A;  1D8K A;  1K78 B;  3K9T A;  4LB5 A;  1DPU A;  5BPI A;  3L00 A;  4RB1 A;  1YS7 A;  1PDN C;  1KYW A;  2ZCW A;  3KP4 A;  1SD4 A;  3HRT A;  1W7P A;  5HS7 A;  1GHC A;  1OKR A;  3GFI A;  3TO7 A;  4XLN F;  3ZP5 A;  3RDI A;  1WKM A;  3TO6 A;  2O6G E;  2JPC A;  4ZZD A;  1E17 A;  2GIV A;  3P9I A;  2ETH A;  4GGG A;  2FBH A;  3LQQ A;  1MZB A;  3L7W A;  3GYH X;  3H92 A;  3ROU A;  2XUB A;  3I54 A;  2ESH A;  2YX7 A;  3LA3 A;  1FNN A;  1SMY F;  5LHI A;  4OOI A;  5A2Q Z;  1BI2 A;  1BBY A;  5FD5 A;  4L9N A;  3V7S A;  4HQE A;  3EYY A;  3W6J B;  3C1D A;  2PMU A;  4IHS A;  2VBY A;  4BAY A;  4HV6 A;  1ON2 A;  1T98 A;  1FBS A;  5LGU A;  1OYY A;  3F3X A;  3O2P E;  3D5L A;  4LK0 F;  1F9N A;  5ED4 A;  2BE5 F;  5KK1 A;  5K5Q A;  4MQ9 F;  2PMH A;  3JAM K;  4UVB A;  2XGX A;  1TW3 A;  1BIB A;  1B4A A;  2DQL A;  2FRH A;  1T2K A;  2KIF A;  3CLO A;  4H0E A;  2M87 A;  4IHT A;  3VOD A;  2VC0 A;  2KIU A;  3KFW X;  3BP8 A;  1CF7 A;  2O03 A;  1XN7 A;  2CG4 A;  3VFZ A;  4NHJ A;  5L3D A;  1P4X A;  2HQN A;  4GCV A;  5FO5 A;  2FF4 A;  2XKO A;  1O3S A;  2JPB A;  4D0P A;  3K1M A;  3EYI A;  1D5V A;  2UWM A;  4L5J A;  2RKH A;  2V9V A;  5EEH A;  5TJJ A;  3K69 A;  4ON0 A;  2K4B A;  1R36 A;  1ZG1 A;  3CDH A;  4RB2 C;  2W24 A;  1C0W A;  1LNW A;  1IXR C;  2LF8 A;  3QU6 A;  2QBY B;  4RGX A;  5E17 F;  3I59 B;  3M8E A;  3I59 A;  4ESJ A;  2P5K A;  3EQL F;  1O57 A;  4EQQ A;  3FMR A;  3MEX A;  4YII A;  4BYY A;  3GUD A;  1XD7 A;  3R4K A;  2ZBK A;  1CF7 B;  2FSW A;  3W6K B;  4ESB A;  4EJO A;  5D8L B;  4I09 A;  5D6E A;  4G6Q A;  1KYZ A;  5A2Q K;  1WRJ A;  2L4M A;  2A69 F;  3BJ6 A;  2IVM A;  4M6X A;  3R0A A;  4R79 A;  3K1N A;  4ENN A;  5DUI A;  4N9H A;  2H6B A;  1ZLJ A;  2ELH A;  1GXQ A;  2STW A;  3I4P A;  3SFZ A;  1BI3 A;  4WCG A;  2ZXJ A;  1EH7 A;  5DD8 A;  3J7A O;  1BN5 A;  4A6E A;  3H3U A;  1U3E M;  2L01 A;  2YX4 A;  3WU1 B;  2Y75 A;  1FZP B;  3QRF F;  4Y17 A;  5HLG A;  3I71 A;  2XVC A;  4MGR A;  3FF5 A;  2VXZ A;  4G7O F;  3OV8 A;  1KU9 A;  1JGS A;  3SXY A;  3E6C C;  5LGN A;  1B6A A;  2NS0 A;  2M1B A;  1MJB A;  5J6X A;  2RDP A;  2P6T A;  3RYP A;  1KQ0 A;  5LHG A;  3C7J A;  1L0O C;  4OIN F;  4O3M A;  2Q8K A;  2WC2 A;  4YG2 F;  1QNT A;  2MH9 A;  2B0L A;  3CO7 C;  4M71 A;  5HLH A;  1I27 A;  1TW2 A;  1IN8 A;  2LF7 A;  3U1D A;  3QP5 A;  4UXN A;  1MD0 A;  4U0W A;  3SHF A;  4KT5 C;  3G3Z A;  4KIG A;  5IT3 A;  4IPA A;  2FE3 A;  2IA1 A;  1IUY A;  4WWC A;  5LEJ A;  4A12 A;  3HRS A;  3WGG A;  3KP6 A;  1QBJ A;  4CGZ A;  1T6S A;  1BJA A;  3HSR A;  3CUQ A;  3FMS A;  5BOX A;  5K5O A;  2BV6 A;  5D5U B;  2X4H A;  1G4D A;  2FOK A;  4ZYD A;  2DBB A;  3ZMZ A;  2FXA A;  1ZGA A;  2IP2 A;  3TO9 A;  3WOD F;  1MKM A;  2QEN A;  1WI9 A;  4ZZL A;  4ENJ A;  1ZLK A;  4PGH A;  1KA8 A;  5F1R A;  1F1Z A;  1YW7 A;  4YFX F;  3LWF A;  2IW5 A;  2QBY A;  1DP7 P;  4L9V A;  1R22 A;  3KEO A;  1FSH A;  2E7W A;  4EM0 B;  1I1G A;  3DP7 A;  1R5G A;  4AD9 A;  2NNN A;  3F8B A;  3IRR A;  3PQJ A;  2EV5 A;  4XBF A;  3JSO A;  3J81 K;  2FBI A;  4AWX B;  4LG0 A;  2ADU A;  1RZ4 A;  5HS8 A;  3LA7 A;  4U7B A;  2K4J A;  3TDU C;  1YW8 A;  1PP8 F;  1IRG A;  2FMY A;  3HTU A;  2QVO A;  1J75 A;  3QU3 A;  1ONV A;  3FXQ A;  1ZRD A;  3BJA A;  3IHU A;  3RKX A;  1U8R A;  5FLX K;  1BC8 C;  2OAZ A;  3BJO A;  1XGS A;  4B09 A;  4KA4 A;  2O8X A;  1USS A;  1OYI A;  2KIM A;  1XB4 A;  4BHP A;  3WTY C;  2OQR A;  1LDD A;  2Y0M A;  4ENM A;  2F5E A;  3FMQ A;  3KP7 A;  2EFN A;  3GZ6 A;  4I2O A;  4B8X A;  1B1B A;  5AIP A;  4HV5 A;  3JSP A;  1ZG3 A;  1E2X A;  2VON A;  3HIF A;  4HBL A;  3V8J A;  2MH2 A;  1RNL A;  4Q5S F;  2Z5U A;  4BH9 A;  2K02 A;  3T8T A;  4I98 B;  2ZNY A;  2DI3 A;  3HYI A;  4KIB A;  1W7P D;  3LAJ A;  4Y15 A;  1FPQ A;  1HSJ A;  1Z1D A;  3E5Q A;  1P6R A;  3E5X A;  2XV4 S;  2GXB A;  2Y48 A;  4IF4 A;  2O3F A;  1BI1 A;  3BDD A;  2VT2 A;  2WWY A;  2DTR A;  3MZY A;  3FM3 A;  4GXO A;  5CVJ A;  2IJL A;  2EB7 A;  1EV7 A;  2DLL A;  1LQ1 A;  2A68 F;  4HAM A;  4UV8 A;  3FXU A;  4BXU A;  2CFX A;  1W5T A;  2OA4 A;  2NRA C;  1NHA A;  3DPT A;  3ERE D;  4M6Y A;  1TLH B;  4IRG A;  4LJZ F;  1G3S A;  2LNB A;  2GWR A;  2VOO A;  2JZY A;  5CVU A;  1W5S A;  1R7J A;  4XRF A;  4LD5 A;  2M30 A;  4M9Z A;  4PZJ A;  1OR7 A;  5LBQ A;  3CUQ B;  4OIP F;  3P9K A;  5FLX Z;  2PBI A;  1SMT A;  1R1T A;  3V8K A;  1ZRF A;  4RGR A;  1R58 A;  2R7D A;  3QOP A;  2XRN A;  2RQP A;  5ILU A;  3PQK A;  3GO5 A;  4YFK F;  2IA2 A;  3K2Z A;  5TRD A;  3CO6 C;  1FP1 D;  1AWC A;  2G7H A;  3BPX A;  3HHG A;  4LB6 B;  3IRQ A;  1S8N A;  1XDS A;  1ULY A;  3MAJ A;  1SD5 A;  2MLK A;  4HX4 A;  5E18 F;  3FHZ A;  3KP2 A;  4UVC A;  2ZME A;  4L18 B;  1R5H A;  1YO5 C;  3BZ6 A;  5LLQ A;  4GYG A;  2HWV A;  2VOP A;  3ABT A;  5FFZ A;  4A0X A;  2Z99 A;  2DK5 A;  2KKO A;  4KMF A;  2F2E A;  3E3V A;  4CZZ A;  5JFR A;  4HW0 A;  4WK8 F;  3ZN1 A;  4LG0 B;  1QZY A;  2KRF A;  4A0Z A;  2PI0 A;  2LKP A;  1GXP A;  1BOA A;  3EDP A;  1XSD A;  3F6O A;  4RB0 A;  4EJV A;  4KN7 X;  1AOY A;  1ZYR F;  3LAP A;  1DDN A;  1I1S A;  4ENK A;  1REP C;  2GXG A;  4ETS A;  1MDM A;  2A6E F;  4FX4 A;  5JR3 A;  3C18 A;  2ZME B;  5L3F A;  1FC3 A;  1PUE E;  4BQA A;  1HKS A;  3JTH A;  3ZN0 A;  2DW4 A;  2HQR A;  3J80 Z;  5E1Z B;  2HR3 A;  5D5W B;  1XCV A;  2L02 A;  5FFX A;  2HYG D;  3F8F A;  1ZG5 A;  3F23 A;  5ERI A;  4MTD A;  3EUH A;  3HSE A;  3WTT C;  2P7V B;  4Q48 A;  4RAZ A;  4P55 A;  3MQ0 A;  4OMY A;  3E97 A;  2XAS A;  4KIF A;  2PFB A;  2ZJ2 A;  2H6C A;  2BGC A;  5HDG A;  2YU3 A;  2V1U A;  5LRR A;  2HZT A;  2QUF A;  3IC7 A;  2M8E A;  3RYR A;  3DQV C;  2E1C A;  4ASN A;  1T39 A;  1TTY A;  5L3G A;  1V4R A;  4EGY A;  4Z2Y A;  3GZ5 A;  2ISZ A;  3F21 A;  2W25 A;  2F5C A;  1G6N A;  2D45 A;  5H6Q A;  2XAH A;  1XGO A;  1H0M A;  4HA8 A;  2CGP A;  1IZ1 A;  5J8F A;  1Z6T A;  5DEQ A;  1IXC A;  3L2C A;  4JBA A;  4HF1 A;  1SD7 A;  1FX7 A;  4HZF A;  1FLI A;  4HX7 A;  1HW2 A;  3GX4 X;  1YIO A;  2QWW A;  3HUG A;  4UHT A;  2COM A;  1IRF A;  4HF0 A;  1TQM A;  3MCZ A;  2STT A;  2QQ9 A;  1S6L A;  1FSE A;  1RIO H;  4OIQ F;  4WF2 A;  2ZO4 A;  3KET A;  2FA5 A;  5J8C A;  5CJ9 A;  4DQ2 A;  2FNA A;  5E8I A;  3T1B A;  4HF2 A;  1UHM A;  2V1X A;  5CYV A;  4I0A A;  4A2U A;  1ZRE A;  4G94 A;  4WXH A;  4LGW A;  3ECH A;  4EJT A;  2RN7 A;  3GLX A;  4JQF A;  3T5X A;  1O3Q A;  1J7K A;  3J81 Z;  5E1W A;  1YLF A;  1ZN2 A;  3KZY A;  4I7H A;  1KQ8 A;  1IXS B;  5CVR A;  1ON1 A;  3GFM A;  2HS5 A;  2HYF A;  2DFI A;  4YFN F;  2V6C A;  3RI4 A;  2VE8 A;  4HDV A;  1K7A A;  4Q4Z F;  6PAX A;  5E8G A;  5JVT A;  1D3Y A;  2HTS A;  1WSU A;  5FGM A;  3GW2 A;  4G7H F;  5L3B A;  4KIC A;  5HLI A;  4GYI A;  2A3S A;  3DV8 A;  1SD6 A;  3HOS A;  1X3U A;  3GFJ A;  5IT9 Z;  1IN7 A;  2G9W A;  4AVP A;  1I5Z A;  2Q0O A;  1IF1 A;  1SFU A;  2DPU A;  1A04 A;  2DT5 A;  3ZMV A;  2UXX A;  1XGN A;  3DPL C;  2D1V A;  2KJC A;  4G6D A;  4MEX F;  2CO5 A;  3HHH A;  3JAM Z;  5D4R A;  4RB3 C;  4M72 A;  2QLZ A;  3CJN A;  3GEZ A;  2MC3 A;  2RGV A;  2VOD A;  2RV8 A;  4PGG A;  3S2W A;  1JHH A;  5D5X B;  1U6G A;  5JHU A;  1J9I A;  4FT8 A;  2QQB A;  1V3F A;  4LFU A;  2OD5 A;  3KP3 A;  2XAJ A;  3ULQ B;  1FBQ A;  2VC1 A;  1J59 A;  3B73 A;  5HVQ C;  1K78 A;  1XSX A;  5H20 A;  2EFW A;  1ODD A;  1XSV A;  1KU2 A;  2P6S A;  1MGT A;  4EV0 A;  3R61 A;  2VBW A;  3ZMD A;  3V7C A;  1P4A A;  5BPD A;  3LA2 A;  1D8J A;  4ZYH A;  1TNS A;  1P4W A;  3DFG A;  1JXS A;  1W7P B;  3F8M A;  4CXF A;  4P96 A;  3NQO A;  1UST A;  4A0Y A;  2EFO A;  3PFI A;  3TDZ C;  1LEA A;  3ML6 A;  2EK5 A;  2JSC A;  2BYV E;  2HKO A;  3IWF A;  4O5V A;  4HLY A;  1QQI A;  3F8N A;  4ZH4 F;  3WTV C;  3COA C;  3WU0 A;  1HST A;  4HLX A;  1BI0 A;  1Z05 A;  1QPM A;  3BOQ A;  3QPH A;  2AXL A;  1RUN A;  3B02 A;  4L9T A;  1LB2 A;  1HKT A;  1K79 A;  2HKX A;  4ZYG A;  3ZQ7 A;  3F22 A;  2W84 A;  2VN2 A;  1YW9 A;  4GO1 A;  4CHU A;  3ZMS A;  2XRO A;  1YS6 A;  4LLL A;  4U0Y A;  5ILV A;  1VTN C;  1HW1 A;  1Z6R A;  4EMS A;  4DNC A;  1FYM A;  1B59 A;  1L3L A;  4RAY A;  2FNP A;  3I58 A;  1TQI A;  2LDU A;  2TDX A;  4NB5 A;  3KE2 A;  2M45 A;  2E1N A;  1U5T C;  4IRI A;  2OU2 A;  4M9X A;  1Q1H A;  2QYO A;  1YQA A;  2VBZ A;  4WX9 A;  4MQV A;  2A61 A;  3TGN A;  5AON A;  3TQN A;  2Z9O A;  1S3J A;  2PQ8 A;  4UVA A;  4A5N A;  5FB2 A;  1HKQ A;  4WXC A;  1J5Y A;  3ZPL A;  1G3W A;  3KEQ A;  1P92 A;  5H6R A;  3C3W A;  4KDP A;  3VB2 A;  1FYK A;  2E7X A;  4RS8 A;  2XAG A;  1PP7 U;  3KCC A;  4M73 A;  4E70 A;  1BIA A;  1SFX A;  3LFK A;  4PCQ A;  4KNY A;  1MJA A;  1ZAR A;  2O0Y A;  3L09 A;  3WGI A;  1QGP A;  2J5O A;  4K2E A;  3ISP A;  3V4G A;  3WTU C;  3ABU A;  3OOP A;  3NRV A;  4O6J A;  3ECO A;  4KYW A;  3WG9 A;  1G3Y A;  1Z91 A;  3ELK A;  4U0V A;  3GVA A;  2QM3 A;  2L54 A;  3BRO A;  1ZH5 A;  2W85 A;  2HDC A;  3AAF A;  2L3D A;  5HDN A;  3V8L A;  2RVC A;  2BBY A;  2C6Y A;  3REO A;  3RPQ A;  2EFP A;  3I53 A;  1F4K A;  4P5O A;  4A6D A;  5DCF A;  2JTV A;  3TOB A;  3FZV A;  2P4W A;  1LEB A;  2VE9 A;  1TBX A;  2G7U A;  2ESN A;  3HSF A;  3F72 A;  3U9G A;  1IN5 A;  2UZK A;  1I6X A;  3M7G A;  3JW4 A;  4HX8 A;  2OBP A;  2F5D A;  4N9I A;  2ACJ A;  2V79 A;  2ZFW A;  3QPT A;  1H9G A;  1Z9C A;  4MHG A;  2X0L A;  4P9F A;  2Q2E A;  1H9T A;  5JI6 A;  4I02 A;  1MJ9 A;  1FBU A;  2P8T A;  3H3Z A;  1U2W A;  3WTZ A;  4HDU A;  5IT9 K;  1LDJ A;  2CSO A;  5ICF A;  3I64 A;  2O61 A;  5HOO A;  3E6D A;  4U88 A;  3L9F A;  1HBX G;  3DXJ F;  2PEX A;  2Z3Y A;  5DCM A;  2GA2 A;  2P7C B;  3R60 A;  1KGS A;  2GQQ A;  3K1P A;  3WTS C;  1G3T A;  3KP5 A;  4G9Y A;  1EH6 A;  1ZHF A;  2LSO A;  3IL2 A;  2OZ6 A;  3DEU A;  3O6B B;  3I5U A;  4AIK A;  3FXR A;  2A5Y B;  2XAF A;  3LST A;  2CW0 F;  4EJW A;  3LQR A;  1YTY A;  2MD5 A;  5D6F A;  2EV6 A;  2D1H A;  5EEG A;  2ISY A;  2P5L C;  4L0Y B;  3SZP A;  5ICC A;  1ZGJ A;  1EH8 A;  3I0T A;  3E6B A;  1DUX C;  2P5V A;  4EM2 A;  4Q47 A;  3K0L A;  1DPR A;  3WE3 A;  3QAH A;  2FQ3 A;  2XKP A;  3TOA A;  3IKT A;  4JK1 X;  3GXO A;  4OU0 A;  5CVV A;  2UXN A;  2KJB A;  4KN4 X;  3J80 K;  4WXD A;  1S7O A;  3R6S A;  1ZRC A;  2DU9 A;  2JT1 A;  4FX0 A;  1HQC A;  1CGP A;  5LGT A;  1WWX A;  1QO0 D;  2DPD A;  3RPU A;  4IVN A;  2F5F A;  3E5U A;  3NEU A;  2EA2 A;  3Q5F A;  5E1X A;  3VOE A;  3F6V A;  2NYX A;  3HOT A;  2OZU A;  1BC7 C;  1UCR A;  1KQ9 A;  3M8F A;  1XDU A;  2DO7 A;  4HQM A;  2VT3 A;  3G73 A;  3V7R A;  3BPV A;  3JTG A;  3WE2 A;  4UUV A;  4U7D A;  5ICE A;  1STZ A;  1T38 A;  1P2F A;  5DV5 A;  1IN4 A;  1GVJ A;  3RKY A;  4P9U A;  1O3R A;  4FHT A;  1R1V A;  3HRU A;  5BMZ A;  5HS9 A;  4XSZ F;  2A07 F;  4MNU A;  1R23 A;  5HDK A;  2A6H F;  5E20 A;  4TV7 A;  2CQK A;  2IPQ X;  4CO8 A;  1FP2 A;  2PG4 A;  3QP6 A;  5BQT A;  3R0J A;  3DF8 A;  1UFM A;  2EWN A;  4R8H A;  3KLN A;  4M74 A;  4G7Z F;  1IAW A;  4S04 A;  4N0B A;  2DAO A;  4OIR F;  2J5P A;  1JE8 A;  1TNT A;  1YG2 A;  2ZNZ A;  2IRF G;  3GFL A;  2HGC A;  3T8R A;  5D5V B;  2IA0 A;  2XAQ A;  1TQP A;  3GWZ A;  3Q9S A;  5DUK A;  1LDK B;  2HEO A;  1U5T B;  4LLG F;  1FWZ A;  3FX3 A;  1XMA A;  5L3C A;  1O7F A;  3U2R A;  4F7Z A;  3RJP A;  5KVR A;  1RUO A;  5D4S A;  1MDM B;  2K86 A;  1B9M A;  5DCM B;  1KU7 A;  2CWE A;  3MWM A;  3SZT A;  3P7N A;  4L0Z B;  1U78 A;  2H09 A;  4RGU A;  4NQW A;  2PLY A;  2FU4 A;  5ICG A;  2EA4 A;  2DK8 A;  2K7L A;  2YPR A;  5LRS A;  2M5W A;  3M9A A;  3HTS B;  1LJ9 A;  4HYE A;  3N4M A;  4IJA A;  4EVI A;  4HOB A;  1JHF A;  3Q9V A;  3P9C A; 
#chains in the Genus database with same CATH topology
 1SFE A;  1XG1 A;  4KFC A;  3OYG A;  2IGN A;  2M8G X;  3U21 A;  4B47 A;  1BM9 A;  3FM5 A;  5LHH A;  1HXD A;  1ACI A;  1WJ5 A;  3F8C A;  2LK2 A;  4LK1 F;  1OR7 C;  2JRT A;  2M0C A;  4AIH A;  1P9Q C;  1IW7 F;  5ILS A;  1OMI A;  2L4A A;  3FBN B;  3MD2 A;  1FY7 A;  2EPF A;  4OAY A;  4OIO F;  1SVL A;  2Z1D A;  5F6F A;  1W4M A;  3L2Q A;  3ZMT A;  2FEZ A;  3TKY A;  2DOF A;  4L9J A;  4PJ0 C;  1OCZ H;  3QOE A;  2R92 J;  1UJ8 A;  3HOZ J;  5L3E A;  4QLC U;  3KYC B;  4CYD A;  1LFB A;  3A1Y A;  3M1E A;  5CQE A;  2D5V A;  1KU3 A;  1R5I D;  1SAN A;  1UHW A;  3VEP A;  4BHB A;  3MFK A;  5FRN A;  3FKJ A;  5AIQ A;  3I9V 2;  2EV0 A;  3CCQ I;  4XSX F;  5F0C A;  2AO9 A;  2YR2 A;  3BR3 A;  2V1D A;  2VKE A;  3H9J A;  1Y0U A;  3LSR A;  2YSR A;  3RCO A;  3N97 A;  5JVG F;  3CUQ C;  5K5R A;  2KQR A;  2CQX A;  2XHK A;  2RNJ A;  4I0B A;  4V19 K;  1TWA J;  1J0R A;  3E1S A;  4BNC A;  5IYD J;  1UB9 A;  4R1H A;  2ZKZ A;  2HOE A;  4RGS A;  1D1C A;  1Z7U A;  4BHC A;  5LEK A;  2QZ8 A;  2HVQ A;  1OPC A;  2K3F A;  1YFH A;  5CVI A;  4IRH A;  1HOM A;  3G1M A;  3M4O J;  3OR2 C;  5DDG A;  2FML A;  1AKH A;  4PFP A;  2MLG A;  1H8A C;  1VF9 A;  2DJI A;  2E34 A;  3VYT B;  4KMU X;  4A3E J;  2KPM A;  2GZW A;  3K4J A;  4MEY F;  5FD6 A;  2NNY A;  1YYV A;  4L5I A;  2W57 A;  1F5T A;  4C30 A;  4CIC A;  2IT0 A;  2WBM A;  2EBI A;  1PJR A;  3JRE A;  3BQZ A;  4LMY A;  1FT9 A;  3M07 A;  5DYM A;  2DQR A;  5GAD J;  3DPU A;  1H88 C;  1EF4 A;  2R3S A;  4UB8 C;  4UV9 A;  2BEO A;  2DA3 A;  2H27 A;  3SDG A;  5DS9 A;  4A3J J;  1T0F C;  3K4N A;  2VAS A;  2EH3 A;  2VBX A;  5J4V A;  5DD4 A;  2P81 A;  4A3F J;  2EZH A;  2OC6 A;  4G8X A;  3SQN A;  3CTA A;  4Y3O A;  2RC4 A;  4M9S A;  5IY5 H;  1VQP I;  4OMZ A;  1MNM C;  1BW6 A;  3P5J A;  4AIJ A;  3WGH A;  4A3M J;  1XC5 A;  4E7Z A;  3DEW A;  1T0F A;  2K40 A;  1UMQ A;  4UNO A;  3DKW A;  3PNV A;  4ZYE A;  3TW6 A;  2EQR A;  5K1Y A;  1WQ2 A;  2CU7 A;  4MIM A;  2W48 A;  2XB0 X;  5CLS A;  2MA3 A;  4I6Z A;  4QWQ A;  3TW7 A;  4YIF A;  3WTX C;  4BE2 A;  2XGC A;  2ZSH B;  4NC6 A;  2PJP A;  4PFO A;  1WH7 A;  2HDD A;  1O3T A;  1Z0X A;  4ESF A;  5J3L A;  4J19 A;  4B43 A;  4A5M A;  2PJR A;  3M8J A;  4NC7 A;  1B8I B;  4XLP F;  2AS5 F;  4EM1 A;  1O7L A;  2GAU A;  2R5Z A;  3SZG A;  5TGT A;  2MBF A;  2WTE A;  3PO2 J;  1XMK A;  4I01 A;  5F64 A;  3CF2 A;  2XGE A;  3HG9 A;  2D2W A;  1OCC H;  2K27 A;  4CDG A;  1F36 A;  1R00 A;  3BY6 A;  1Y1W J;  3MVP A;  2HFH A;  1MBF A;  4XOR A;  2WV0 A;  3IKV A;  5J4Y A;  1HW5 A;  1QZZ A;  3NWT A;  1IDZ A;  3CUO A;  1P7J A;  5IP7 J;  2PX9 A;  4EGZ A;  4RMN A;  3FK6 A;  4EJU A;  3W6V A;  3RKW A;  4NC8 A;  2Z33 A;  3JRD A;  2Q1Z B;  3PFY A;  1ZAO A;  4N4N B;  3D0S A;  1FYL A;  1B9N A;  3OYB A;  1D0Y A;  1DQU A;  1RI7 A;  5BS6 A;  3S1R J;  2FBK A;  1TL8 A;  1OYW A;  1K6O A;  2XRL A;  3LSI A;  1FOK A;  3I4M J;  1S7A A;  2R7F A;  3MZ8 A;  1POG A;  3OSF A;  2NAZ A;  2L2O A;  3FIW A;  4Y13 A;  3X2Q H;  4E7K A;  3KZZ A;  1FTZ A;  3BWG A;  5KHD A;  5F27 A;  1SAX A;  2CQN A;  1W0U A;  1IN6 A;  3DEE A;  4LLN A;  3EET A;  1KZH A;  3A2K A;  1CQT A;  4XKC A;  1VZ0 A;  2LKX A;  1QZE A;  3RTR A;  2EFQ A;  3IWZ A;  2HTJ A;  1U5T A;  1HCR A;  4PSW A;  2F6C A;  3MZH A;  2F4O B;  3E6M A;  1NG6 A;  3HRM A;  2QGU A;  5D8K B;  1S29 A;  4A3I J;  1XCB A;  2I5U A;  1LVA A;  2LMD A;  3WTW C;  2GA1 A;  1WJD A;  1J2X A;  1YE9 A;  1XGM A;  4E7I A;  3ZMU A;  3GF2 A;  3O3K A;  5EZH A;  1X1B A;  2PN6 A;  4M3F A;  1W36 C;  2LFB A;  2XIG A;  3S14 J;  2JA2 A;  5GAE J;  2X85 A;  2OQG A;  1R1U A;  4Y7N J;  2K9M A;  2QQA A;  4IXA A;  4KUM A;  2NVX J;  3GTG J;  2EJR A;  2E19 A;  4PDK A;  2LBF A;  2LC2 A;  2X51 A;  4MTE A;  1A36 A;  3S17 J;  3GTK J;  2H94 A;  4XRS G;  3IH4 A;  2XF6 A;  4S05 A;  1B72 B;  3QYB A;  3T0Y A;  3RIR A;  3KLO A;  3FWE A;  2IGO A;  2CYY A;  2XSD C;  1D8K A;  2FQ4 A;  2GBY A;  2LY9 A;  1K78 B;  3K9T A;  3MKL A;  3FXO A;  3CMM A;  4DYQ A;  1VQ9 I;  4M3G A;  3IP4 B;  3ZQL A;  4LB5 A;  1DPU A;  5BPI A;  2ZJQ F;  3L00 A;  3OYJ A;  4RB1 A;  3QQA A;  1YS7 A;  2HQ5 A;  1PDN C;  1KYW A;  1IRZ A;  5EG0 B;  1NK3 P;  4DW6 A;  2ZCW A;  3KP4 A;  2E2H J;  3BG7 A;  5M5Y J;  4KT6 A;  4IHY A;  1SD4 A;  3IH3 A;  2VQL A;  4HRI A;  3S32 A;  3HRT A;  1W7P A;  5HS7 A;  1GHC A;  1OKR A;  3GFI A;  3BG9 A;  1RRJ A;  3TO7 A;  3JRG A;  1YJN I;  4XLN F;  3CC2 I;  3H35 A;  3J7A Y;  3ZP5 A;  3RDI A;  1WJA A;  1WKM A;  3TO6 A;  2O6G E;  2JPC A;  4ZZD A;  1E17 A;  1MBE A;  2GIV A;  3P9I A;  4DGW B;  2GOX B;  3LSM A;  1UEL B;  2ETH A;  4GGG A;  2FBH A;  3LQQ A;  2JA6 J;  1MZB A;  1OLT A;  3LL7 A;  3L7W A;  1A6Q A;  4CZC A;  3GYH X;  1LPQ A;  4NQW B;  3H92 A;  3ROU A;  2XUB A;  2DOE A;  3I54 A;  2ESH A;  3I4N J;  2YX7 A;  3LA3 A;  4PK4 A;  2ID3 A;  1FNN A;  1SMY F;  5LHI A;  2K3P A;  4OOI A;  1BI2 A;  1BBY A;  2KDO A;  4XOT A;  5FD5 A;  5A2Q Z;  2IXS A;  2NVT J;  3ZOB A;  4L9N A;  3V7S A;  2L7Z A;  4HQE A;  1ENH A;  3EYY A;  3W6J B;  4F52 A;  3RQI A;  2GXA A;  2WY8 Q;  3ZQH A;  3EUA A;  2ME6 A;  3H5A A;  2DA6 A;  1ZGW A;  3C1D A;  3OIO A;  5J1Y A;  2PMU A;  4IHS A;  2EIJ H;  2VBY A;  4BAY A;  4BXF A;  2DXI A;  4HV6 A;  1ON2 A;  5GP9 A;  3SFI A;  4BQQ A;  1T98 A;  4DYC A;  3OY9 A;  2H1L A;  2XGD A;  2HXI A;  1FBS A;  5LGU A;  3BLY A;  1OYY A;  2M2E A;  2UV1 A;  2HZD A;  2B7E A;  5KCM A;  3F3X A;  4EAT A;  2QKL B;  3O2P E;  3D5L A;  4DJA A;  4LK0 F;  1Z77 A;  2LTP A;  1F9N A;  3ABL H;  5ED4 A;  4CCN A;  2LY1 A;  2BE5 F;  5KK1 A;  5K5Q A;  4MQ9 F;  1QHG A;  2PMH A;  1APL C;  5EJC A;  3JAM K;  4C3J J;  3HDD A;  1MND A;  2XGX A;  4UVB A;  3UR3 C;  2W7N A;  3CP2 A;  1TW3 A;  1BIB A;  1B4A A;  1RES A;  2DQL A;  3IAM 2;  5EEA A;  2Y0S N;  2FRH A;  4ZJZ A;  2WY7 Q;  1MMS A;  3HXL A;  1T2K A;  2KIF A;  2ZJP F;  3CLO A;  5GPA A;  4H0E A;  1X3W B;  2JA5 J;  2M87 A;  4CCK A;  4IHT A;  3VOD A;  2VC0 A;  3SEQ A;  2KIU A;  2WAQ A;  3AFH A;  2VXD A;  4FET A;  5CPR B;  1WVR A;  3KFW X;  3BP8 A;  4CA0 A;  2V7F A;  2K85 A;  4JYK A;  1CF7 A;  2DN0 A;  2O03 A;  1XN7 A;  1OCP A;  3EPZ A;  2CG4 A;  3VFZ A;  1MBK A;  2KRC A;  1M1E B;  2JUC A;  1T56 A;  5FLV A;  3DKX A;  1RKT A;  4NHJ A;  3VDX A;  2L5Q A;  5L3D A;  1P4X A;  2HQN A;  4GCV A;  5FO5 A;  5EDN A;  2FF4 A;  2XKO A;  3FXL A;  1O3S A;  3J7Z I;  4AC0 A;  2ECC A;  2JPB A;  4D0P A;  1X1D A;  4HNV A;  1A74 A;  3K1M A;  2H8R A;  3EYI A;  5LD2 C;  1D5V A;  2M34 A;  4IKF A;  2UWM A;  2RRE A;  3OYA A;  4L5J A;  2RKH A;  2V9V A;  5EEH A;  5TJJ A;  2DMU A;  1RC9 A;  3G6E I;  3K69 A;  2V4J C;  4ON0 A;  2K4B A;  1R36 A;  1ZG1 A;  3CDH A;  3H5N A;  1T33 A;  2W1O A;  2HNH A;  2W24 A;  2OV7 A;  1LNW A;  4RB2 C;  1C0W A;  1IXR C;  2NVU B;  2LF8 A;  3QU6 A;  1TWF J;  2A6T A;  3H9G A;  2QBY B;  2GIZ A;  5M5X J;  1U9N A;  4RGX A;  1JTX A;  3I59 B;  5E17 F;  1WCM J;  3I59 A;  3M8E A;  4ESJ A;  4IOA F;  2P5K A;  1IUF A;  3EQL F;  2HVS A;  1O57 A;  2VJ5 A;  4EQQ A;  3FMR A;  3OYC A;  3MEX A;  4YII A;  4BYY A;  4XMY A;  3GUD A;  3HZJ A;  1XD7 A;  1W1W E;  3R4K A;  3A0H C;  4BDZ A;  2ZBK A;  1UG2 A;  1CF7 B;  2FSW A;  3W6K B;  3DTI A;  4ESB A;  4EJO A;  3A01 A;  5D8L B;  4I09 A;  5D6E A;  2DTZ A;  4G6Q A;  1KYZ A;  2EZL A;  2BY0 A;  3ZQF A;  5A2Q K;  2MW8 A;  1IPP A;  1K4T A;  1WRJ A;  1OCR H;  4OWR B;  2VUM J;  2L4M A;  3CJR B;  2A69 F;  3BJ6 A;  1LE8 B;  2IVM A;  3OS1 A;  4M6X A;  3TED A;  4DIQ A;  3R0A A;  1WJF A;  2IAI A;  4R79 A;  1MNE A;  2GM4 A;  3K1N A;  4C3I J;  5CKT A;  3J7Y J;  3GTO J;  4ENN A;  5DUI A;  3LSG A;  1SFO J;  3C2G A;  4HG2 A;  3TL4 X;  2P0W A;  4N9H A;  2NXN B;  2H6B A;  3OYD A;  1IDY A;  4KIT B;  2Z16 A;  1ZLJ A;  2CV0 A;  2ELH A;  4MFE A;  1CYQ A;  1GXQ A;  2STW A;  3N05 A;  3KX2 A;  5K7H A;  3I4P A;  4ZDL A;  3SFZ A;  1IV8 A;  1BI3 A;  5IP9 J;  4WCG A;  1FIA A;  2ZXJ A;  2KFD A;  1EH7 A;  2E36 A;  5DD8 A;  4IHX A;  4B44 A;  2W4S A;  1ITY A;  1I3Q J;  2BXZ A;  1X4P A;  3J7A O;  1BN5 A;  4A6E A;  3GTL J;  1LVK A;  1T08 B;  4E4H A;  1VI0 A;  3H3U A;  2TCT A;  1U3E M;  2L01 A;  2YX4 A;  3M1C A;  5K7Z A;  4RA2 A;  3WU1 B;  2OPT A;  2Y75 A;  1I6H J;  1FZP B;  3QRF F;  4Y17 A;  5HLG A;  3I56 I;  4UY8 I;  3I71 A;  2VKD A;  2GLO A;  1GVD A;  4BEH A;  1PUF B;  2XVC A;  1ZKG A;  4BAC A;  4MGR A;  3FF5 A;  2VXZ A;  1ZTR A;  3FKI J;  3KIO A;  1XS9 A;  3OV8 A;  4G7O F;  2V9K A;  3CMY A;  3K6G A;  4ZDO A;  1KU9 A;  2KIS A;  1JGS A;  3ABK H;  3SXY A;  3E6C C;  5DM6 F;  4OAZ A;  5F0H A;  5LGN A;  2DA7 A;  1IG7 A;  3AL0 C;  1B6A A;  2JSP A;  3IV5 A;  3FHN A;  2NS0 A;  2M1B A;  2Q2E B;  3OS2 A;  3OYF A;  4BE1 A;  1MJB A;  5J6X A;  2RDP A;  2P6T A;  3RYP A;  3DU5 A;  1KQ0 A;  5LHG A;  3C7J A;  1L0O C;  3A02 A;  3PIP F;  4BE0 A;  2V1N A;  1JT6 A;  4OIN F;  4O3M A;  2OJE D;  2OCC H;  2Q8K A;  1TWH J;  1Z3Y A;  2R7X A;  3K2A A;  1FOY A;  2WC2 A;  3HM5 A;  4YG2 F;  3HL2 A;  1QNT A;  3BTC A;  5FLM J;  2MH9 A;  1RKW A;  2FJ1 A;  2B0L A;  3MMY B;  4RLF A;  3CO7 C;  4M71 A;  4AU7 A;  3S3M A;  5HLH A;  1I27 A;  1TW2 A;  2CW8 A;  1IN8 A;  2LF7 A;  5J1R A;  2NVQ J;  3U1D A;  3QP5 A;  4UXN A;  1MD0 A;  2DT6 A;  3TP0 A;  4U0W A;  3SHF A;  3G2B A;  4KT5 C;  4CCJ A;  4ABZ A;  3G3Z A;  4KIG A;  5IT3 A;  4IPA A;  4F55 A;  4B4C A;  3JR9 A;  2HI3 A;  3AG1 H;  1MSF C;  9ANT A;  2FE3 A;  2IA1 A;  1IUY A;  4WWC A;  3BT9 A;  5LEJ A;  2LR8 A;  4A12 A;  3FDY A;  3HRS A;  3IAS 2;  2CUJ A;  3KP6 A;  3WGG A;  3OIP A;  4G12 A;  1QBJ A;  4CGZ A;  5KAF C;  1YRN B;  2R7S A;  1T6S A;  1BJA A;  2JVG A;  3HSR A;  1O4X A;  3CUQ A;  3FMS A;  5BOX A;  3CME I;  1G8X A;  4PUS A;  5K5O A;  2BV6 A;  5D5U B;  2X4H A;  1G4D A;  1HC8 A;  2FOK A;  4ZYD A;  2DBB A;  2L7K A;  2R7O A;  2XPU A;  3ZMZ A;  2FXA A;  2FD5 A;  5CQG A;  3ESW B;  1ZGA A;  2IP2 A;  3TO9 A;  3WOD F;  3BCA A;  4CH7 A;  1MKM A;  2JVH A;  2L9V A;  3S2H J;  2QEN A;  1WI9 A;  4ZZL A;  3DLL F;  4Y4R A;  5FKO A;  4ENJ A;  1ZLK A;  4PGH A;  3BQY A;  1V5F A;  1ZQ3 P;  3DBH B;  4AYB N;  2QKM B;  1KA8 A;  5F1R A;  4D1Q A;  1ZR2 A;  3DLA A;  1F1Z A;  1YW7 A;  1X1P A;  4YFX F;  3LWF A;  2IW5 A;  1SVM A;  1Y1V J;  2QBY A;  5KAI C;  1DP7 P;  3S16 J;  4XLF A;  1XMX A;  4L9V A;  1R22 A;  3KEO A;  1F43 A;  1FSH A;  2E60 A;  1BA5 A;  2LD5 A;  2HPM A;  3CJQ B;  3GTP J;  2Y69 H;  2E7W A;  4XM3 A;  2M0M A;  4EM0 B;  1I1G A;  3DP7 A;  1Y39 A;  3FBI B;  1R5G A;  4XON A;  3OOU A;  4AD9 A;  2AQE A;  2NNN A;  3F8B A;  3IRR A;  5JLW A;  3PQJ A;  2MG4 A;  2CV2 A;  2EV5 A;  2RAE A;  4XBF A;  1WH5 A;  1BOB A;  3JSO A;  4RM2 A;  3J81 K;  2FBI A;  4AWX B;  4LG0 A;  3NAU A;  1X2M A;  2HDW A;  5F04 A;  4E7H A;  2KT0 A;  2Y31 A;  3PNY A;  4F91 B;  2QF7 A;  2ADU A;  1E3P A;  1RZ4 A;  2DA4 A;  3S8P A;  5HS8 A;  3LA7 A;  4U7B A;  2K4J A;  3TDU C;  1H89 C;  5DTD A;  1YW8 A;  2X1E A;  2ZME C;  1PP8 F;  1IRG A;  2FMY A;  3HTU A;  2QVO A;  1J75 A;  3QU3 A;  4M3D A;  5TIS C;  2IBD A;  2WB1 N;  1ONV A;  1V5G A;  3FXQ A;  1JT0 A;  1ZRD A;  3BJA A;  4ZTF A;  2X9D A;  4HEA 2;  1QPI A;  1B8I A;  3IHU A;  4Y52 J;  1LKX A;  3RKX A;  1U8R A;  4F92 B;  5FLX K;  2O6M A;  1GDT A;  3HKZ N;  2R7U A;  2ZB9 A;  1BC8 C;  2OAZ A;  3BJO A;  1XGS A;  4XL9 A;  4B09 A;  4KA4 A;  2O8X A;  1USS A;  1OYI A;  2W00 A;  2KIM A;  3B6A A;  1XB4 A;  4BHP A;  3OS0 A;  3WTY C;  2OQR A;  1JJ6 C;  5HNH A;  2R0Q C;  2LVS A;  3FXM A;  2LKS A;  3O8H A;  1LDD A;  2OCE A;  4P1W A;  3L2W A;  3BR2 A;  2Y0M A;  4ENM A;  2F5E A;  1JJ8 C;  3FMQ A;  3ERM A;  2V9P A;  3KP7 A;  2EFN A;  3CDL A;  1Y8Q B;  2TRT A;  1QVT A;  4L5E A;  3GZ6 A;  2VI6 A;  4I2O A;  4B8X A;  1B1B A;  5AIP A;  5H2F C;  3L1P A;  4HV5 A;  3JSP A;  1ZG3 A;  3CD6 I;  4XLA A;  1E2X A;  2VON A;  3HIF A;  4BUP A;  4HBL A;  2WAD A;  3V8J A;  2MH2 A;  4XK4 A;  1RNL A;  4Q5S F;  1WGX A;  2Z5U A;  4BH9 A;  2K02 A;  3T8T A;  4I98 B;  3TMO A;  3PIO F;  1K6Y A;  2X6W A;  2ZNY A;  1EVX A;  4PJM A;  3CZ6 A;  1V55 H;  4BL0 B;  2DI3 A;  3HYI A;  4KIB A;  1W7P D;  1QHH D;  3LAJ A;  4Y15 A;  4CYC A;  1FPQ A;  1HSJ A;  1Z1D A;  3E5Q A;  5IOZ A;  1DGR M;  1P6R A;  3E5X A;  2XV4 S;  4DBQ A;  1N78 A;  5EZG A;  3MKY B;  2GXB A;  1PVE A;  2Y48 A;  4IF4 A;  2O3F A;  1TWC J;  1BI1 A;  3BDD A;  3ONQ A;  5J1U A;  4XLH A;  1W5C C;  2VT2 A;  2WWY A;  2DTR A;  3MZY A;  4DOZ A;  3FM3 A;  4YEL A;  1TT5 B;  3I55 I;  4GXO A;  3BCB A;  3CCM I;  1VFC A;  4MO7 A;  4A69 C;  5CVJ A;  4BJ6 C;  2IJL A;  4D9J A;  5FRO A;  3PUF A;  2EB7 A;  1EV7 A;  2DLL A;  3A03 A;  3DTE A;  1LQ1 A;  2A68 F;  5E3M A;  3JRA A;  3HC7 A;  3UKG A;  4HAM A;  4UV8 A;  3FXU A;  3Q0W A;  4AUX A;  4BXU A;  2CFX A;  4CUG A;  1W5T A;  3RQ4 A;  1MMD A;  3TBI A;  2OA4 A;  1YJ9 I;  2NRA C;  1NHA A;  3DPT A;  3ERE D;  3IUO A;  1DU6 A;  2GOM A;  4M6Y A;  1TLH B;  4IRG A;  2ICW G;  1IV6 A;  4LJZ F;  1QA6 A;  1G3S A;  2LNB A;  3A4C A;  4XID A;  2GWR A;  3BTL A;  1A31 A;  1VND A;  2N8G A;  2VOO A;  2JZY A;  5CVU A;  1W5S A;  1R7J A;  4XRF A;  4UUS A;  1IRX A;  4LD5 A;  1Z7L A;  2M30 A;  1LUJ B;  4M9Z A;  3KEY A;  4PZJ A;  2PJR B;  1X4O A;  1IJW C;  1OR7 A;  5FJ8 J;  3ZR8 X;  5LBQ A;  3CUQ B;  1HLV A;  4OIP F;  3P9K A;  1SC7 A;  2AXT C;  1R4M B;  5FLX Z;  1JKR C;  2PBI A;  1SMT A;  1R1T A;  2NS8 A;  2Y0S A;  3V8K A;  1ZRF A;  4RGR A;  2VJJ A;  2WV1 A;  5C44 J;  1R58 A;  2R7D A;  3QOP A;  2XRN A;  4C3H J;  2RQP A;  1JKO C;  2B9S A;  3LSP A;  2BHY A;  5ILU A;  3GBG A;  3PQK A;  3GO5 A;  4N4O B;  4YFK F;  2IA2 A;  3MN2 A;  4LIV A;  4YEJ A;  2O9L A;  4BXX J;  3K2Z A;  5JLX A;  5TRD A;  5FKL A;  3CO6 C;  3WU2 C;  1FP1 D;  2G7H A;  3BPX A;  3HHG A;  4LB6 B;  3IRQ A;  1AWC A;  1S8N A;  1XDS A;  2HQA A;  3RPU D;  1ULY A;  3MAJ A;  4AVZ A;  1SD5 A;  2MLK A;  3G71 I;  3A01 B;  4HX4 A;  5E18 F;  3FHZ A;  2VPL A;  3KP2 A;  4UVC A;  2ZME A;  4L18 B;  1DP3 A;  2L9N A;  1R5H A;  4XQF A;  1YO5 C;  3BZ6 A;  2DOD A;  3GME A;  3S1Q J;  5LLQ A;  4QPQ A;  1D5Y A;  4GYG A;  2HWV A;  2VOP A;  3ABT A;  5FFZ A;  3GTQ J;  4A0X A;  2Z99 A;  2DA2 A;  3K4M A;  1K4S A;  2DK5 A;  2KKO A;  4KMF A;  2F2E A;  3E3V A;  4U87 A;  2IS2 A;  2EZK A;  1S7E A;  4CZZ A;  2E35 A;  4DZP A;  5JFR A;  4HW0 A;  3OYM A;  4WK8 F;  3ZN1 A;  2F5V A;  4LG0 B;  2QSG X;  4RAF A;  1QZY A;  3VPR A;  3K4L A;  2KRF A;  4A0Z A;  2PI0 A;  1R9T J;  2LKP A;  2LOO A;  3K4C A;  1GXP A;  1BOA A;  3EDP A;  1E0E A;  1XSD A;  1IO2 A;  2VQC A;  1JTY A;  3F6O A;  4RB0 A;  5B1B H;  4EJV A;  1FTT A;  4KN7 X;  3O8G A;  1AOY A;  1ZYR F;  3K7A J;  5FKM A;  3BG5 A;  4FAS D;  5B1A H;  1AKH B;  3LAP A;  1DDN A;  3MKZ A;  1I1S A;  1RET A;  4ENK A;  1NK2 P;  2L0K A;  3CDI A;  1REP C;  2GXG A;  4ETS A;  1MDM A;  3OL4 A;  1X19 A;  1KON A;  2A6E F;  5JR3 A;  4FX4 A;  1I39 A;  2CUZ A;  3CCY A;  3D5S C;  4B48 A;  2XPV A;  4CCM A;  5C3E J;  3C18 A;  2M4K A;  3M3Y J;  1BR2 A;  1OCO H;  2ZME B;  4LG3 A;  5L3F A;  3HBL A;  2K9Q A;  1FEX A;  1ZEL A;  3BG3 A;  1FC3 A;  1T95 A;  2CUE A;  4LIT A;  5M3M J;  1PUE E;  4BQA A;  2L9S A;  1HKS A;  4I99 C;  4ANJ A;  3F9K A;  3JTH A;  3CCJ I;  3ZN0 A;  3D5R C;  2XF7 A;  2DW4 A;  3H1C A;  2HQR A;  2R7Q A;  2V6E A;  3J80 Z;  4RM3 A;  1SEU A;  3ASO H;  2HR3 A;  5E1Z B;  5D5W B;  1XCV A;  1ERD A;  2L02 A;  5FFX A;  3U1K A;  3Q3S A;  4CCO A;  3EUK L;  2YU9 J;  3VYU B;  2HYG D;  3F8F A;  2LH9 A;  1ZG5 A;  3F23 A;  5ERI A;  2DYR H;  1VQ6 I;  2F48 A;  2Y9Y A;  3BTJ A;  4MTD A;  1BR1 A;  3EUH A;  3HSE A;  3WTT C;  4IO9 F;  2P7V B;  4Q48 A;  4RAZ A;  3A0B C;  4Y33 A;  4P55 A;  3MQ0 A;  5IOY A;  5C4X J;  4IEJ A;  1EVW A;  3D1N I;  3HUG B;  3BZC A;  3HOY J;  3AG3 H;  2CUF A;  4BY1 J;  4OMY A;  3E97 A;  2XAS A;  1E3H A;  4FE7 A;  2K5C A;  3QYE A;  2XF5 A;  2NVY J;  2KL4 A;  3FXJ A;  4KIF A;  1GV2 A;  2PFB A;  2ZJ2 A;  2H1K A;  2R93 J;  4D7M A;  2EIN H;  1FMW A;  2H6C A;  2BGC A;  2E71 A;  3HPG A;  4BGD A;  4A3B J;  2XC7 A;  5HDG A;  2YU3 A;  2V1U A;  5LRR A;  2HZT A;  2QUF A;  3QOD A;  3IC7 A;  2M8E A;  3RYR A;  3DQV C;  4JX5 A;  2E1C A;  4RLQ A;  5GAG J;  1UHS A;  4ASN A;  2IS4 A;  2NS7 A;  1T39 A;  2KMU A;  2WAF A;  4IZZ A;  1TTY A;  5L3G A;  3PJR A;  1V4R A;  4EGY A;  2KLO A;  4Z2Y A;  3GZ5 A;  3SDB A;  2ISZ A;  5C4J J;  3F21 A;  2W25 A;  1R6R A;  1G6N A;  2F5C A;  2D45 A;  5H6Q A;  2XAH A;  3S3N A;  2XAU A;  1XGO A;  3VYR B;  2WAE A;  4BJ5 C;  2DOA A;  1H0M A;  2ELK A;  4F3Q A;  1TT0 A;  4HA8 A;  2R5Y A;  2CGP A;  4II3 A;  2X1C A;  1IZ1 A;  5J8F A;  1Z6T A;  5DEQ A;  3DWL E;  1IXC A;  3L2C A;  3RKQ A;  4ZTJ A;  4JBA A;  4HF1 A;  1SD7 A;  1FX7 A;  2E5N A;  3I3L A;  2M7B A;  4HZF A;  2E2J J;  1FLI A;  2MC4 A;  4HX7 A;  2VL8 A;  1HW2 A;  3PO3 J;  3GX4 X;  3GZN B;  3CC4 I;  1YIO A;  2QWW A;  3HUG A;  4ZC3 A;  2CRG A;  4UHT A;  2K9N A;  2COM A;  1IRF A;  3HJE A;  4HF0 A;  1TQM A;  3MCZ A;  2STT A;  4BY7 J;  2QQ9 A;  1S6L A;  2HXO A;  1D1A A;  1FSE A;  1RIO H;  4OIQ F;  1IC8 A;  4WF2 A;  2ZO4 A;  3KET A;  3S1M J;  4NUB A;  2FA5 A;  3BC8 A;  5J8C A;  5GPC A;  5CJ9 A;  1MW7 A;  1JI8 A;  4DQ2 A;  4QIW N;  2FNA A;  2X1D A;  5E8I A;  2VLA A;  3T1B A;  1ETK A;  4HF2 A;  1UHM A;  2V1X A;  4MLO A;  5CYV A;  4I0A A;  4A2U A;  1ZRE A;  2QCO A;  4G94 A;  4WXH A;  3HOX J;  4LGW A;  3ECH A;  1PYV A;  4DBR A;  4EJT A;  2ME0 A;  2RN7 A;  3GLX A;  4JQF A;  3T5X A;  1O3Q A;  2HVR A;  4UUT A;  3L2R A;  4AYB A;  1J7K A;  2ZFU A;  2BW3 B;  3J81 Z;  3PM1 A;  5E1W A;  1EA3 A;  1YLF A;  1ZN2 A;  3E0J B;  3KZY A;  4I7H A;  1KQ8 A;  2LY2 A;  1IXS B;  3QPS A;  5CVR A;  1ON1 A;  3GFM A;  4D5C A;  2HS5 A;  3UNG C;  2ELJ A;  4HST A;  4CYC B;  1JUM A;  2HYF A;  2OF7 A;  4ITV A;  3PUB A;  2DFI A;  2FX0 A;  3F0C A;  3SEZ A;  1VQ7 I;  4YFN F;  5B5E C;  2V6C A;  3RI4 A;  3RSN A;  3CCE I;  2VE8 A;  4HDV A;  1UAA A;  1VQM I;  1K7A A;  1WJE A;  2R7W A;  4Q4Z F;  6PAX A;  2EIK H;  3HOW J;  5E8G A;  3TP3 A;  5JVT A;  1D3Y A;  2HTS A;  1WSU A;  1MH4 A;  2XB5 A;  2BXY A;  5FGM A;  3GW2 A;  4G7H F;  1WJB A;  1G2H A;  5L3B A;  4KIC A;  1Y56 A;  4GYI A;  1MMG A;  5HLI A;  2KZG A;  5LFA A;  2A3S A;  2RNG A;  3DV8 A;  1SD6 A;  1MBH A;  3HOS A;  1VQK I;  1X3U A;  1AA7 A;  3GFJ A;  3QWL A;  4D5F A;  3BR1 A;  2HYJ A;  1VQN I;  5IT9 Z;  1DGW Y;  1IN7 A;  3VWB A;  4BEH B;  1PUF A;  1OCT C;  2G9W A;  1NH3 A;  1YX5 A;  1YIJ I;  2LYC A;  4AVP A;  1I5Z A;  4JP0 A;  2UUZ A;  3BR0 A;  4E7S A;  1HF0 A;  2LRE A;  2Q0O A;  4F93 B;  4RAG A;  1IF1 A;  1SFU A;  5IYB J;  2DPU A;  1A04 A;  3DU6 A;  2DT5 A;  1VQO I;  3ZMV A;  3AKZ A;  2UXX A;  2I10 A;  2HPI A;  1XGN A;  3DPL C;  4G6T B;  1YJW I;  2D1V A;  4H4K C;  2KJC A;  4G6D A;  5EF6 A;  1XPX A;  3LSH A;  2X6Y A;  2QSF X;  4MEX F;  2L7M P;  4XRS A;  2CO5 A;  3HHH A;  2VKH A;  3HEF A;  1WJC A;  3JAM Z;  2BVM A;  5D4R A;  4RB3 C;  4M72 A;  3PL8 A;  4XLC A;  2QLZ A;  5FRM A;  3CJN A;  1S72 I;  1GV5 A;  2BOL A;  4DYR A;  1Z21 A;  3GEZ A;  2MC3 A;  2RGV A;  2VOD A;  2RV8 A;  4PGG A;  3SJM A;  2ZSI B;  2MGQ A;  2X6O A;  3S2W A;  4IOC F;  1JHH A;  1ETO A;  4EEF G;  5D5X B;  4AM3 A;  5F08 A;  1U6G A;  4BDY A;  4PSX A;  5JHU A;  1N77 A;  1J9I A;  1JKP C;  4FT8 A;  5F1J A;  3BG6 A;  3WHC A;  2QQB A;  1V3F A;  4LFU A;  3KZI C;  2OD5 A;  4RDU A;  1S5L C;  4BKX A;  1V54 H;  3IH2 A;  3LFU A;  3KP3 A;  2XAJ A;  3ZQI A;  3OYK A;  4M3E A;  3G4S I;  1A35 A;  3ULQ B;  1MBG A;  1FBQ A;  2VC1 A;  1YX3 A;  1J59 A;  3B73 A;  5HVQ C;  1K78 A;  3ZQC A;  1NTC A;  1XTA A;  1J09 A;  1XSX A;  5H20 A;  2EFW A;  1ODD A;  1XSV A;  4JX4 A;  2LG4 A;  1KU2 A;  2P6S A;  5K7F A;  1MGT A;  2BY3 A;  4EV0 A;  2VJ4 A;  3R61 A;  2VBW A;  3ZMD A;  4E7J A;  2VB6 A;  4BJT A;  3V7C A;  1P4A A;  2IS6 A;  2A5W A;  3CJT B;  5BPD A;  3S3O A;  3LA2 A;  2DFF A;  5EG0 A;  2CJJ A;  2R7T A;  1D8J A;  4ZYH A;  1TNS A;  3HPH A;  1P4W A;  2M9H A;  4X6A J;  3DFG A;  3CCR I;  1JGG A;  2XDV A;  1JXS A;  5B3S H;  1W7P B;  3BR5 A;  3F8M A;  4CXF A;  3C2B A;  4P96 A;  3NQO A;  2DFE A;  4Z6Y A;  1UST A;  4ZYA A;  1MH3 A;  4W97 A;  3CQZ J;  4A0Y A;  5J40 A;  2EFO A;  3PFI A;  3TDZ C;  1LEA A;  2VJI A;  3ML6 A;  2EK5 A;  3CP8 A;  3H0D A;  2JSC A;  3RZO J;  2BYV E;  4B3X A;  2HKO A;  1RR7 A;  3IWF A;  2R7V A;  1A5J A;  4O5V A;  1QQI A;  2BZT A;  3F8N A;  4ZH4 F;  3WTV C;  5EYR A;  3COA C;  4HLY A;  1LFU P;  3WU0 A;  4I76 A;  5F0F A;  1HST A;  4PJN A;  3ABM H;  4HLX A;  1BI0 A;  5E79 C;  2NOJ B;  2F4M B;  2EIM H;  1Z05 A;  1HDD C;  3KYD B;  1QPM A;  3BOQ A;  3QPH A;  2AXL A;  1RUN A;  1WI3 A;  2IGK A;  2Y9Z A;  2BVL A;  4D7N A;  3B02 A;  4L9T A;  1LB2 A;  4HSR A;  3GCM A;  1HKT A;  2BW3 A;  1K79 A;  2WB1 A;  2HKX A;  4ZYG A;  4QSH A;  3ZQ7 A;  4KIS A;  4V2F A;  4XKW A;  2E2I J;  3F22 A;  3OR1 C;  2W84 A;  2VN2 A;  1YW9 A;  3GLL A;  1Y6I A;  2JUG A;  4GO1 A;  4CHU A;  2DMT A;  3BR6 A;  1U0J A;  3K4K A;  2I8D A;  3ZMS A;  4IQ4 A;  4E6K G;  2DFH A;  2DT7 B;  1YS6 A;  4U0Y A;  4LLL A;  2XRO A;  5ILV A;  1VTN C;  1HW1 A;  4V2G A;  1LFP A;  4XLE A;  1Z6R A;  4EMS A;  4DNC A;  2X48 A;  3ZGK A;  1FYM A;  1WFX A;  2RQQ A;  1B59 A;  2KP6 A;  2JJ7 A;  4C2U A;  1L3L A;  4RAY A;  1IGN A;  4XOP A;  4A3C J;  3GTM J;  1RR8 C;  2FNP A;  3I58 A;  1TQI A;  2LDU A;  2TDX A;  4NB5 A;  3JRC A;  3KE2 A;  2M45 A;  2E1N A;  1U5T C;  4IX7 A;  3V42 A;  1OIS A;  3OL3 A;  4IRI A;  1YI2 I;  2ZC2 A;  2ZJR F;  1WHU A;  2OU2 A;  4M9X A;  2DDA A;  1Q1H A;  2LP0 A;  1MMN A;  2QYO A;  4HPQ A;  1YQA A;  4BS9 A;  2VBZ A;  1ETQ A;  1XX5 A;  4WX9 A;  4MQV A;  2A61 A;  4RBO A;  3CCL I;  3CCU I;  3TGN A;  5AON A;  2R5Z B;  1G59 A;  3DBL B;  3TQN A;  2Z9O A;  5FKN A;  4C9Y A;  3DBR B;  1S3J A;  1W36 D;  2PQ8 A;  4UVA A;  4A5N A;  2KIQ A;  1ETV A;  4NNJ A;  3OMY A;  5FB2 A;  5HOD A;  1AU7 A;  4B1R A;  1HKQ A;  2DDB A;  4WXC A;  4XRM A;  3H0G J;  3AG2 H;  1E3O C;  1J5Y A;  3ZPL A;  2HOS A;  1G3W A;  2VIX A;  2LRD A;  3KEQ A;  1A6I A;  1P92 A;  3C3W A;  5H6R A;  3CC7 I;  4KDP A;  4A3D J;  2M4G A;  3VB2 A;  4HNT A;  2MAB A;  1FYK A;  2CQQ A;  4FTH A;  4HNU A;  3ASN H;  3JCU C;  3PNT A;  2E7X A;  5IP6 A;  2DMN A;  4RS8 A;  2XAG A;  3BTI A;  1PP7 U;  3KCC A;  3MKW B;  1Z67 A;  4M73 A;  4E70 A;  5M5W J;  1BIA A;  3CCS I;  1SFX A;  3LFK A;  3H3V K;  4PCQ A;  4KNY A;  3B6C A;  2DYS H;  4QPO A;  1MJA A;  1ZAR A;  1MMA A;  2ID6 A;  2O0Y A;  3L09 A;  3Q0V A;  1WZ2 A;  3ZXS A;  2Y2Z A;  3OWT A;  3WGI A;  3G1O A;  1Y8R B;  5B66 C;  1QGP A;  2J5O A;  4K2E A;  3ISP A;  4XKB A;  3V4G A;  2XSJ C;  4FQG A;  4XIC A;  3QYF A;  3WTU C;  1QU3 A;  4UUS B;  3ABU A;  3OOP A;  3NRV A;  2KDZ A;  2O7O A;  1ETX A;  3LOC A;  3LNQ A;  3CF5 F;  4O6J A;  1D0X A;  3ECO A;  3W2V A;  4KYW A;  2AQF A;  3VSK A;  3WG9 A;  3JRF A;  1G3Y A;  1Z91 A;  1I3A A;  3ELK A;  4U0V A;  3WHB A;  2O5R A;  4BBR J;  5BNG A;  4LIU A;  2K9S A;  3GVA A;  4NDL A;  2BHZ A;  2BY1 A;  2QM3 A;  1Q1V A;  2L54 A;  3BRO A;  4PJJ A;  1ZR4 A;  1R71 A;  2W85 A;  1ZH5 A;  2JA8 J;  2HDC A;  4MFD A;  3K10 A;  3AAF A;  2L3D A;  3OYL A;  5HDN A;  1OJL A;  2RVC A;  3V8L A;  2BBY A;  2JRM A;  2C6Y A;  3REO A;  3RPQ A;  2E5Z A;  3PSI A;  2DJN A;  1GUU A;  2EFP A;  3I53 A;  1F4K A;  1QRY A;  1DU0 A;  4JOM A;  2MYS A;  4P5O A;  4A6D A;  5DCF A;  2JTV A;  3TOB A;  2L9R A;  3FZV A;  2P4W A;  4X0G A;  1LEB A;  2CFO A;  2IEK A;  1TBX A;  4PJL A;  2VE9 A;  1TZL A;  1MIJ A;  3HKZ A;  1X2N A;  4E7L A;  5JHF A;  2G7U A;  2ESN A;  4BBS J;  3OYN A;  3HSF A;  5M3F J;  3F72 A;  3NAR A;  3U9G A;  2ZXH A;  1IN5 A;  2A05 A;  2L7F P;  2UZK A;  1I6X A;  2CQ7 A;  3M7G A;  3JW4 A;  4HX8 A;  2OBP A;  2F5D A;  4N9I A;  2ACJ A;  2V79 A;  1JUS A;  2ZFW A;  3QPT A;  1H9G A;  3HOV J;  1Z9C A;  4MHG A;  2X0L A;  1VQL I;  3S93 A;  4CCL A;  4P9F A;  2Q2E A;  2R4G A;  2WA0 A;  1H9T A;  5JI6 A;  4I02 A;  4FIS A;  1MJ9 A;  1FBU A;  2P8T A;  3H3Z A;  3Q0U A;  3KYL A;  1U2W A;  3WTZ A;  4QTR A;  4HDU A;  5IT9 K;  1LDJ A;  2CSO A;  5ICF A;  3I64 A;  2O61 A;  3KPH A;  1V5E A;  5HOO A;  1VQ5 I;  3E6D A;  3SYT A;  4U88 A;  2QEX I;  3L9F A;  1HBX G;  2VQH A;  3DXJ F;  2PEX A;  5IYC J;  2Z3Y A;  5DCM A;  2GA2 A;  2JA7 J;  2P7C B;  3R60 A;  1KGS A;  5E3L A;  2GQQ A;  3L2U A;  3K1P A;  3WTS C;  1G3T A;  3KP5 A;  4G9Y A;  1EH6 A;  5EGO B;  1ZHF A;  3S2D J;  2LSO A;  3IL2 A;  4C2T A;  3FIS A;  4CSW A;  2M3A A;  4XNF A;  1U8B A;  2OZ6 A;  2AHQ A;  3DEU A;  1D0Z A;  3O6B B;  1SAU A;  1B72 A;  2COB A;  3I5U A;  4AIK A;  1BJZ A;  2CS3 A;  3FXR A;  5E3N A;  2XAF A;  1OFC X;  2A5Y B;  4M6V A;  3HGG A;  1BW5 A;  4A3G J;  1FOW A;  3JRI A;  3LST A;  2V26 A;  1ETY A;  2R5Y B;  2CW0 F;  2O8K A;  1WPK A;  4EJW A;  2YUS A;  3LQR A;  5GTI C;  5E3O A;  1YTY A;  1YRN A;  1K61 A;  2MD5 A;  1X1C A;  1R4N B;  2DA1 A;  3CLQ A;  5D6F A;  2F4I A;  4M3B A;  2LLK A;  2ZXI A;  3AL0 B;  2HOT A;  2HU9 A;  4FE4 A;  2EV6 A;  3FXK A;  2ECB A;  2D1H A;  1D1B A;  1X58 A;  4W1U A;  5EEG A;  2ISY A;  2P5L C;  2W82 A;  4L0Y B;  3SZP A;  3CMA I;  5ICC A;  1ZGJ A;  3LSJ A;  2YS9 A;  4XN0 A;  1EH8 A;  3I0T A;  3W3C A;  2K9L A;  1A73 A;  4A3L J;  4BU2 A;  1Z3X A;  3E6B A;  1DUX C;  2P5V A;  4EM2 A;  2EIL H;  4Q47 A;  3K0L A;  2VQG A;  2FOW A;  3H36 A;  5IPA A;  1DPR A;  3WE3 A;  1CZ0 A;  1X1A A;  3DKY A;  3QAH A;  2FQ3 A;  3C2H A;  4KJZ A;  2JN6 A;  3DCF A;  3HB9 A;  3W2W A;  2XKP A;  2PMZ A;  1Y0N A;  3OIQ A;  4C2M J;  2DMP A;  1OQY A;  3OYE A;  1FMV A;  3TOA A;  3IKT A;  1N75 A;  2CMP A;  4JK1 X;  1T8I A;  3W2A A;  3JRB A;  3S1N J;  2IGM A;  2WAQ N;  3GXO A;  4OU0 A;  5CVV A;  2UXN A;  2KJB A;  4KN4 X;  3J80 K;  4B3A A;  1VQ8 I;  4WXD A;  1S7O A;  3H9Q A;  2R7Z J;  1MSE C;  3R6S A;  3WG7 H;  1ZRC A;  2DU9 A;  2JT1 A;  3HGY A;  2FUG 2;  3HOU J;  4FX0 A;  5KNL A;  1HQC A;  3G1L A;  1CGP A;  5LGT A;  1WWX A;  3ZCO A;  1R49 A;  1FIP A;  1QO0 D;  2KHM A;  2VPR A;  3RPU A;  2DPD A;  4IVN A;  4YRV A;  2F5F A;  3E5U A;  3AG4 H;  3NEU A;  1YOV B;  3ZRG A;  2EA2 A;  2Z2S B;  4IL6 C;  1GLN A;  3Q5F A;  5E1X A;  3VOE A;  2JMW A;  2CV1 A;  3F6V A;  2NYX A;  3HOT A;  2OZU A;  1BC7 C;  1S9H A;  1UCR A;  1KQ9 A;  1X3Z B;  1XDU A;  2DO7 A;  3M8F A;  3LMM A;  2VT3 A;  4HQM A;  3G73 A;  3V7R A;  3ZQQ A;  1VQ4 I;  3RZD J;  4ZDP A;  3PSF A;  3OSG A;  3BPV A;  3JTG A;  3WE2 A;  3K70 D;  2JQ7 A;  1MBJ A;  3EUH C;  4U7D A;  5ICE A;  4UUV A;  1STZ A;  1FJL A;  3GTJ J;  3K4B A;  1P2F A;  4JX6 A;  5DV5 A;  1IN4 A;  2PMZ N;  1T38 A;  4IHW A;  1GVJ A;  3RKY A;  1I50 J;  4P9U A;  1O3R A;  4FHT A;  1ZK8 A;  2H8W A;  2E1M B;  1R1V A;  1UG0 A;  3BZK A;  2B63 J;  3HRU A;  5BMZ A;  5J47 A;  5HS9 A;  4XSZ F;  2A07 F;  2R7R A;  1TWG J;  4MNU A;  1R23 A;  3FK7 A;  5HDK A;  1FOX A;  2A6H F;  5E20 A;  2OUM A;  1K83 J;  4TV7 A;  3JRH A;  1P7I A;  5GTH C;  3S15 J;  2CQK A;  2IPQ X;  4IQJ A;  1N25 A;  3LSK A;  1ETW A;  4CO8 A;  2IS1 A;  2MSY A;  1EJ9 A;  2M7A A;  1FP2 A;  2PG4 A;  3QP6 A;  2BY2 A;  5BQT A;  3R0J A;  3DF8 A;  4GRI A;  1UFM A;  2DCE A;  2EWN A;  4R8H A;  1QVU A;  1W0T A;  3KLN A;  1GT0 C;  4M74 A;  4G7Z F;  1IAW A;  1NG7 A;  4S04 A;  4N0B A;  2DAO A;  3E7L A;  4OIR F;  2JWT A;  5HLT A;  2J5P A;  1SFK A;  1SVO A;  1TNT A;  2CH0 A;  1JE8 A;  1HA8 A;  1YG2 A;  2Y30 A;  2ZNZ A;  2IRF G;  2CW7 A;  3GFL A;  2HGC A;  1JKQ C;  4J01 A;  1JUP A;  2QQ8 A;  4II2 A;  3T8R A;  5D5V B;  2IA0 A;  2KRH A;  2XAQ A;  4UB6 C;  3OYI A;  3ZQG A;  1AHD P;  1TQP A;  4BQO A;  3GWZ A;  2G0E A;  3Q9S A;  5DUK A;  1LDK B;  3NWS A;  2HEO A;  1U5T B;  2MD0 A;  1ORK A;  4LLG F;  2MFZ A;  3QPL A;  1UZC A;  2HOA A;  4YIR X;  1RPW A;  1FWZ A;  1YHQ I;  4XKV A;  3FX3 A;  4XN3 A;  4XR6 A;  2QSH X;  1XMA A;  3H5R A;  5L3C A;  4GDF A;  1O7F A;  3CCV I;  2QA4 I;  2DMQ A;  2JK3 A;  3U2R A;  4F7Z A;  2VKV A;  3RJP A;  3K70 C;  5KVR A;  4A3K J;  1RUO A;  1TC3 C;  2E1O A;  5D4S A;  1MDM B;  2KZV A;  2K86 A;  1BL0 A;  1B9M A;  5DCM B;  2XPW A;  2X6X A;  4FCY A;  3VYS B;  3L2V A;  1KU7 A;  2CWE A;  3MWM A;  3SZT A;  4AID A;  2OTJ I;  3P7N A;  4L0Z B;  1YIT I;  3DTK A;  2LBF B;  5EGO A;  1U78 A;  4A93 J;  2OTL I;  4J00 A;  2H09 A;  4RGU A;  4NQW A;  3VSL A;  2ZXW H;  4LOC A;  1TP4 A;  2FU4 A;  2DA5 A;  5ICG A;  3OYH A;  2PLY A;  1LE8 A;  4GFB A;  2EA4 A;  2DK8 A;  4S0H B;  5GAH J;  2EZI A;  2K7L A;  2YPR A;  5FKK A;  5HNF A;  5LRS A;  4DZJ A;  4NBQ A;  2E1M C;  1U9O A;  2M5W A;  3M9A A;  1LJ9 A;  3HTS B;  4HYE A;  2NOG A;  4BQN A;  3N4M A;  4IJA A;  4EVI A;  4HOB A;  3CES A;  1HDP A;  5DM7 F;  1JHF A;  3Q9V A;  4IHV A;  4X1E A;  1BR4 A;  3P9C A;  1EKE A; 
#chains in the Genus database with same CATH homology
 1SFE A;  4KFC A;  1BM9 A;  3FM5 A;  5LHH A;  1HXD A;  3F8C A;  4LK1 F;  2JRT A;  4AIH A;  1IW7 F;  5ILS A;  1OMI A;  2L4A A;  1FY7 A;  4OIO F;  5F6F A;  1W4M A;  3ZMT A;  2FEZ A;  3TKY A;  4L9J A;  5L3E A;  4QLC U;  4CYD A;  3M1E A;  1KU3 A;  1UHW A;  4BHB A;  3VEP A;  3MFK A;  5AIQ A;  2EV0 A;  4XSX F;  2YR2 A;  2V1D A;  1Y0U A;  2YSR A;  3N97 A;  3CUQ C;  5K5R A;  2XHK A;  2RNJ A;  4I0B A;  1J0R A;  4BNC A;  1UB9 A;  4R1H A;  2ZKZ A;  2HOE A;  4RGS A;  1Z7U A;  4BHC A;  5LEK A;  2QZ8 A;  1OPC A;  1YFH A;  5CVI A;  4IRH A;  5DDG A;  2FML A;  2MLG A;  4KMU X;  2GZW A;  4MEY F;  5FD6 A;  2NNY A;  1YYV A;  4L5I A;  2W57 A;  1F5T A;  4CIC A;  2IT0 A;  4LMY A;  1FT9 A;  5DYM A;  2DQR A;  2R3S A;  4UV9 A;  2BEO A;  2H27 A;  2VBX A;  5DD4 A;  4G8X A;  3SQN A;  3CTA A;  2RC4 A;  4M9S A;  4OMZ A;  4AIJ A;  3WGH A;  1T0F A;  4UNO A;  3DKW A;  4ZYE A;  5K1Y A;  1WQ2 A;  5CLS A;  2MA3 A;  4QWQ A;  4YIF A;  3WTX C;  2PJP A;  1O3T A;  4ESF A;  4A5M A;  2AS5 F;  4XLP F;  4EM1 A;  1O7L A;  2GAU A;  2MBF A;  2WTE A;  1XMK A;  4I01 A;  5F64 A;  2D2W A;  2K27 A;  4CDG A;  1R00 A;  3BY6 A;  2HFH A;  2WV0 A;  3IKV A;  1HW5 A;  1QZZ A;  3CUO A;  4EGZ A;  4EJU A;  3RKW A;  2Z33 A;  1ZAO A;  1FYL A;  3D0S A;  1B9N A;  1RI7 A;  5BS6 A;  2FBK A;  1OYW A;  1K6O A;  1FOK A;  1S7A A;  2R7F A;  2NAZ A;  4Y13 A;  3KZZ A;  3BWG A;  1SAX A;  1IN6 A;  4LLN A;  3EET A;  3RTR A;  2EFQ A;  3IWZ A;  2HTJ A;  1U5T A;  3MZH A;  3E6M A;  3HRM A;  5D8K B;  1S29 A;  1XCB A;  1LVA A;  3WTW C;  2GA1 A;  1J2X A;  1XGM A;  3ZMU A;  3GF2 A;  3O3K A;  2PN6 A;  2XIG A;  2OQG A;  1R1U A;  2QQA A;  4IXA A;  4KUM A;  2EJR A;  4PDK A;  4MTE A;  2H94 A;  4S05 A;  3T0Y A;  3RIR A;  3KLO A;  3FWE A;  2CYY A;  1D8K A;  1K78 B;  3K9T A;  4LB5 A;  1DPU A;  5BPI A;  3L00 A;  4RB1 A;  1YS7 A;  1PDN C;  1KYW A;  2ZCW A;  3KP4 A;  1SD4 A;  3HRT A;  1W7P A;  5HS7 A;  1GHC A;  1OKR A;  3GFI A;  3TO7 A;  4XLN F;  3ZP5 A;  3RDI A;  1WKM A;  3TO6 A;  2O6G E;  2JPC A;  4ZZD A;  1E17 A;  2GIV A;  3P9I A;  2ETH A;  4GGG A;  2FBH A;  3LQQ A;  1MZB A;  3L7W A;  3GYH X;  3H92 A;  3ROU A;  2XUB A;  3I54 A;  2ESH A;  2YX7 A;  3LA3 A;  1FNN A;  1SMY F;  5LHI A;  4OOI A;  5A2Q Z;  1BI2 A;  1BBY A;  5FD5 A;  4L9N A;  3V7S A;  4HQE A;  3EYY A;  3W6J B;  3C1D A;  2PMU A;  4IHS A;  2VBY A;  4BAY A;  4HV6 A;  1ON2 A;  1T98 A;  1FBS A;  5LGU A;  1OYY A;  3F3X A;  3O2P E;  3D5L A;  4LK0 F;  1F9N A;  5ED4 A;  2BE5 F;  5KK1 A;  5K5Q A;  4MQ9 F;  2PMH A;  3JAM K;  4UVB A;  2XGX A;  1TW3 A;  1BIB A;  1B4A A;  2DQL A;  2FRH A;  1T2K A;  2KIF A;  3CLO A;  4H0E A;  2M87 A;  4IHT A;  3VOD A;  2VC0 A;  2KIU A;  3KFW X;  3BP8 A;  1CF7 A;  2O03 A;  1XN7 A;  2CG4 A;  3VFZ A;  4NHJ A;  5L3D A;  1P4X A;  2HQN A;  4GCV A;  5FO5 A;  2FF4 A;  2XKO A;  1O3S A;  2JPB A;  4D0P A;  1A74 A;  3K1M A;  3EYI A;  1D5V A;  2UWM A;  4L5J A;  2RKH A;  2V9V A;  5EEH A;  5TJJ A;  3K69 A;  4ON0 A;  2K4B A;  1R36 A;  1ZG1 A;  3CDH A;  4RB2 C;  2W24 A;  1C0W A;  1LNW A;  1IXR C;  2LF8 A;  3QU6 A;  2QBY B;  4RGX A;  5E17 F;  3I59 B;  3M8E A;  3I59 A;  4ESJ A;  2P5K A;  3EQL F;  1O57 A;  4EQQ A;  3FMR A;  3MEX A;  4YII A;  4BYY A;  3GUD A;  1XD7 A;  3R4K A;  2ZBK A;  1CF7 B;  2FSW A;  3W6K B;  4ESB A;  4EJO A;  5D8L B;  4I09 A;  5D6E A;  4G6Q A;  1KYZ A;  5A2Q K;  1IPP A;  1WRJ A;  2L4M A;  2A69 F;  3BJ6 A;  2IVM A;  4M6X A;  3R0A A;  4R79 A;  3K1N A;  4ENN A;  5DUI A;  4N9H A;  2H6B A;  1ZLJ A;  2ELH A;  1CYQ A;  1GXQ A;  2STW A;  3I4P A;  3SFZ A;  1BI3 A;  4WCG A;  2ZXJ A;  1EH7 A;  5DD8 A;  3J7A O;  1BN5 A;  4A6E A;  3H3U A;  1U3E M;  2L01 A;  2YX4 A;  3WU1 B;  2Y75 A;  1FZP B;  3QRF F;  4Y17 A;  5HLG A;  3I71 A;  2XVC A;  4MGR A;  3FF5 A;  2VXZ A;  4G7O F;  3OV8 A;  1KU9 A;  1JGS A;  3SXY A;  3E6C C;  5LGN A;  1B6A A;  2NS0 A;  2M1B A;  1MJB A;  5J6X A;  2RDP A;  2P6T A;  3RYP A;  1KQ0 A;  5LHG A;  3C7J A;  1L0O C;  4OIN F;  4O3M A;  2Q8K A;  2WC2 A;  4YG2 F;  1QNT A;  2MH9 A;  2B0L A;  3CO7 C;  4M71 A;  5HLH A;  1I27 A;  1TW2 A;  1IN8 A;  2LF7 A;  3U1D A;  3QP5 A;  4UXN A;  1MD0 A;  4U0W A;  3SHF A;  4KT5 C;  3G3Z A;  4KIG A;  5IT3 A;  4IPA A;  2FE3 A;  2IA1 A;  1IUY A;  4WWC A;  5LEJ A;  4A12 A;  3HRS A;  3WGG A;  3KP6 A;  1QBJ A;  4CGZ A;  1T6S A;  1BJA A;  3HSR A;  3CUQ A;  3FMS A;  5BOX A;  5K5O A;  2BV6 A;  5D5U B;  2X4H A;  1G4D A;  2FOK A;  4ZYD A;  2DBB A;  3ZMZ A;  2FXA A;  1ZGA A;  2IP2 A;  3TO9 A;  3WOD F;  1MKM A;  2QEN A;  1WI9 A;  4ZZL A;  4ENJ A;  1ZLK A;  4PGH A;  1KA8 A;  5F1R A;  1F1Z A;  1YW7 A;  4YFX F;  3LWF A;  2IW5 A;  2QBY A;  1DP7 P;  4L9V A;  1R22 A;  3KEO A;  1FSH A;  2E7W A;  4EM0 B;  1I1G A;  3DP7 A;  1R5G A;  4AD9 A;  2NNN A;  3F8B A;  3IRR A;  3PQJ A;  2EV5 A;  4XBF A;  3JSO A;  3J81 K;  2FBI A;  4AWX B;  4LG0 A;  2ADU A;  1RZ4 A;  5HS8 A;  3LA7 A;  4U7B A;  2K4J A;  3TDU C;  1YW8 A;  1PP8 F;  1IRG A;  2FMY A;  3HTU A;  2QVO A;  1J75 A;  3QU3 A;  1ONV A;  3FXQ A;  1ZRD A;  3BJA A;  3IHU A;  3RKX A;  1U8R A;  5FLX K;  2O6M A;  1BC8 C;  2OAZ A;  3BJO A;  1XGS A;  4B09 A;  4KA4 A;  2O8X A;  1USS A;  1OYI A;  2KIM A;  1XB4 A;  4BHP A;  3WTY C;  2OQR A;  1LDD A;  2Y0M A;  4ENM A;  2F5E A;  3FMQ A;  3KP7 A;  2EFN A;  3GZ6 A;  4I2O A;  4B8X A;  1B1B A;  5AIP A;  4HV5 A;  3JSP A;  1ZG3 A;  1E2X A;  2VON A;  3HIF A;  4HBL A;  3V8J A;  2MH2 A;  1RNL A;  4Q5S F;  2Z5U A;  4BH9 A;  2K02 A;  3T8T A;  4I98 B;  2ZNY A;  1EVX A;  2DI3 A;  3HYI A;  4KIB A;  1W7P D;  3LAJ A;  4Y15 A;  1FPQ A;  1HSJ A;  1Z1D A;  3E5Q A;  1P6R A;  3E5X A;  2XV4 S;  2GXB A;  2Y48 A;  4IF4 A;  2O3F A;  1BI1 A;  3BDD A;  2VT2 A;  2WWY A;  2DTR A;  3MZY A;  3FM3 A;  4GXO A;  5CVJ A;  2IJL A;  2EB7 A;  1EV7 A;  2DLL A;  1LQ1 A;  2A68 F;  4HAM A;  4UV8 A;  3FXU A;  4BXU A;  2CFX A;  1W5T A;  2OA4 A;  2NRA C;  1NHA A;  3DPT A;  3ERE D;  4M6Y A;  1TLH B;  4IRG A;  4LJZ F;  1G3S A;  2LNB A;  2GWR A;  2VOO A;  2JZY A;  5CVU A;  1W5S A;  1R7J A;  4XRF A;  4LD5 A;  2M30 A;  4M9Z A;  4PZJ A;  1OR7 A;  5LBQ A;  3CUQ B;  4OIP F;  3P9K A;  5FLX Z;  2PBI A;  1SMT A;  1R1T A;  3V8K A;  1ZRF A;  4RGR A;  1R58 A;  2R7D A;  3QOP A;  2XRN A;  2RQP A;  5ILU A;  3PQK A;  3GO5 A;  4YFK F;  2IA2 A;  3K2Z A;  5TRD A;  3CO6 C;  1FP1 D;  1AWC A;  2G7H A;  3BPX A;  3HHG A;  4LB6 B;  3IRQ A;  1S8N A;  1XDS A;  1ULY A;  3MAJ A;  1SD5 A;  2MLK A;  4HX4 A;  5E18 F;  3FHZ A;  3KP2 A;  4UVC A;  2ZME A;  4L18 B;  1R5H A;  1YO5 C;  3BZ6 A;  5LLQ A;  4GYG A;  2HWV A;  2VOP A;  3ABT A;  5FFZ A;  4A0X A;  2Z99 A;  2DK5 A;  2KKO A;  4KMF A;  2F2E A;  3E3V A;  4CZZ A;  5JFR A;  4HW0 A;  4WK8 F;  3ZN1 A;  4LG0 B;  1QZY A;  2KRF A;  4A0Z A;  2PI0 A;  2LKP A;  1GXP A;  1BOA A;  3EDP A;  1XSD A;  3F6O A;  4RB0 A;  4EJV A;  4KN7 X;  1AOY A;  1ZYR F;  3LAP A;  1DDN A;  1I1S A;  4ENK A;  1REP C;  2GXG A;  4ETS A;  1MDM A;  2A6E F;  4FX4 A;  5JR3 A;  3C18 A;  2ZME B;  5L3F A;  1FC3 A;  1PUE E;  4BQA A;  1HKS A;  3JTH A;  3ZN0 A;  2DW4 A;  2HQR A;  3J80 Z;  5E1Z B;  2HR3 A;  5D5W B;  1XCV A;  2L02 A;  5FFX A;  2HYG D;  3F8F A;  1ZG5 A;  3F23 A;  5ERI A;  4MTD A;  3EUH A;  3HSE A;  3WTT C;  2P7V B;  4Q48 A;  4RAZ A;  4P55 A;  3MQ0 A;  1EVW A;  4OMY A;  3E97 A;  2XAS A;  4KIF A;  2PFB A;  2ZJ2 A;  2H6C A;  2BGC A;  5HDG A;  2YU3 A;  2V1U A;  5LRR A;  2HZT A;  2QUF A;  3IC7 A;  2M8E A;  3RYR A;  3DQV C;  2E1C A;  4ASN A;  1T39 A;  1TTY A;  5L3G A;  1V4R A;  4EGY A;  4Z2Y A;  3GZ5 A;  2ISZ A;  3F21 A;  2W25 A;  2F5C A;  1G6N A;  2D45 A;  5H6Q A;  2XAH A;  1XGO A;  1H0M A;  4HA8 A;  2CGP A;  1IZ1 A;  5J8F A;  1Z6T A;  5DEQ A;  1IXC A;  3L2C A;  4JBA A;  4HF1 A;  1SD7 A;  1FX7 A;  4HZF A;  1FLI A;  4HX7 A;  1HW2 A;  3GX4 X;  1YIO A;  2QWW A;  3HUG A;  4UHT A;  2COM A;  1IRF A;  4HF0 A;  1TQM A;  3MCZ A;  2STT A;  2QQ9 A;  1S6L A;  1FSE A;  1RIO H;  4OIQ F;  4WF2 A;  2ZO4 A;  3KET A;  2FA5 A;  5J8C A;  5CJ9 A;  4DQ2 A;  2FNA A;  5E8I A;  3T1B A;  4HF2 A;  1UHM A;  2V1X A;  5CYV A;  4I0A A;  4A2U A;  1ZRE A;  4G94 A;  4WXH A;  4LGW A;  3ECH A;  4EJT A;  2RN7 A;  3GLX A;  4JQF A;  3T5X A;  1O3Q A;  1J7K A;  3J81 Z;  5E1W A;  1YLF A;  1ZN2 A;  3KZY A;  4I7H A;  1KQ8 A;  1IXS B;  5CVR A;  1ON1 A;  3GFM A;  2HS5 A;  2HYF A;  2DFI A;  4YFN F;  2V6C A;  3RI4 A;  2VE8 A;  4HDV A;  1K7A A;  4Q4Z F;  6PAX A;  5E8G A;  5JVT A;  1D3Y A;  2HTS A;  1WSU A;  5FGM A;  3GW2 A;  4G7H F;  5L3B A;  4KIC A;  5HLI A;  4GYI A;  2A3S A;  3DV8 A;  1SD6 A;  3HOS A;  1X3U A;  3GFJ A;  5IT9 Z;  1IN7 A;  2G9W A;  4AVP A;  1I5Z A;  2Q0O A;  1IF1 A;  1SFU A;  2DPU A;  1A04 A;  2DT5 A;  3ZMV A;  2UXX A;  1XGN A;  3DPL C;  2D1V A;  2KJC A;  4G6D A;  4MEX F;  2CO5 A;  3HHH A;  3JAM Z;  5D4R A;  4RB3 C;  4M72 A;  2QLZ A;  3CJN A;  3GEZ A;  2MC3 A;  2RGV A;  2VOD A;  2RV8 A;  4PGG A;  3S2W A;  1JHH A;  5D5X B;  1U6G A;  5JHU A;  1J9I A;  4FT8 A;  2QQB A;  1V3F A;  4LFU A;  2OD5 A;  3KP3 A;  2XAJ A;  3ULQ B;  1FBQ A;  2VC1 A;  1J59 A;  3B73 A;  5HVQ C;  1K78 A;  1XSX A;  5H20 A;  2EFW A;  1ODD A;  1XSV A;  1KU2 A;  2P6S A;  1MGT A;  4EV0 A;  3R61 A;  2VBW A;  3ZMD A;  3V7C A;  1P4A A;  5BPD A;  3LA2 A;  1D8J A;  4ZYH A;  1TNS A;  1P4W A;  3DFG A;  1JXS A;  1W7P B;  3F8M A;  4CXF A;  4P96 A;  3NQO A;  1UST A;  4A0Y A;  2EFO A;  3PFI A;  3TDZ C;  1LEA A;  3ML6 A;  2EK5 A;  2JSC A;  2BYV E;  2HKO A;  3IWF A;  4O5V A;  4HLY A;  1QQI A;  3F8N A;  4ZH4 F;  3WTV C;  3COA C;  3WU0 A;  1HST A;  4HLX A;  1BI0 A;  1Z05 A;  1QPM A;  3BOQ A;  3QPH A;  2AXL A;  1RUN A;  3B02 A;  4L9T A;  1LB2 A;  1HKT A;  1K79 A;  2HKX A;  4ZYG A;  3ZQ7 A;  3F22 A;  2W84 A;  2VN2 A;  1YW9 A;  4GO1 A;  4CHU A;  3ZMS A;  2XRO A;  1YS6 A;  4LLL A;  4U0Y A;  5ILV A;  1VTN C;  1HW1 A;  1Z6R A;  4EMS A;  4DNC A;  1FYM A;  1B59 A;  1L3L A;  4RAY A;  2FNP A;  3I58 A;  1TQI A;  2LDU A;  2TDX A;  4NB5 A;  3KE2 A;  2M45 A;  2E1N A;  1U5T C;  4IRI A;  2OU2 A;  4M9X A;  1Q1H A;  2QYO A;  1YQA A;  2VBZ A;  4WX9 A;  4MQV A;  2A61 A;  3TGN A;  5AON A;  3TQN A;  2Z9O A;  1S3J A;  2PQ8 A;  4UVA A;  4A5N A;  5FB2 A;  1HKQ A;  4WXC A;  1J5Y A;  3ZPL A;  1G3W A;  3KEQ A;  1P92 A;  5H6R A;  3C3W A;  4KDP A;  3VB2 A;  1FYK A;  2E7X A;  4RS8 A;  2XAG A;  1PP7 U;  3KCC A;  4M73 A;  4E70 A;  1BIA A;  1SFX A;  3LFK A;  4PCQ A;  4KNY A;  1MJA A;  1ZAR A;  2O0Y A;  3L09 A;  3WGI A;  1QGP A;  2J5O A;  4K2E A;  3ISP A;  3V4G A;  3WTU C;  3ABU A;  3OOP A;  3NRV A;  4O6J A;  3ECO A;  4KYW A;  3WG9 A;  1G3Y A;  1Z91 A;  3ELK A;  4U0V A;  3GVA A;  2QM3 A;  2L54 A;  3BRO A;  1ZH5 A;  2W85 A;  2HDC A;  3AAF A;  2L3D A;  5HDN A;  3V8L A;  2RVC A;  2BBY A;  2C6Y A;  3REO A;  3RPQ A;  2EFP A;  3I53 A;  1F4K A;  4P5O A;  4A6D A;  5DCF A;  2JTV A;  3TOB A;  3FZV A;  2P4W A;  1LEB A;  2VE9 A;  1TBX A;  2G7U A;  2ESN A;  3HSF A;  3F72 A;  3U9G A;  1IN5 A;  2UZK A;  1I6X A;  3M7G A;  3JW4 A;  4HX8 A;  2OBP A;  2F5D A;  4N9I A;  2ACJ A;  2V79 A;  2ZFW A;  3QPT A;  1H9G A;  1Z9C A;  4MHG A;  2X0L A;  4P9F A;  2Q2E A;  1H9T A;  5JI6 A;  4I02 A;  1MJ9 A;  1FBU A;  2P8T A;  3H3Z A;  1U2W A;  3WTZ A;  4HDU A;  5IT9 K;  1LDJ A;  2CSO A;  5ICF A;  3I64 A;  2O61 A;  5HOO A;  3E6D A;  4U88 A;  3L9F A;  1HBX G;  3DXJ F;  2PEX A;  2Z3Y A;  5DCM A;  2GA2 A;  2P7C B;  3R60 A;  1KGS A;  2GQQ A;  3K1P A;  3WTS C;  1G3T A;  3KP5 A;  4G9Y A;  1EH6 A;  1ZHF A;  2LSO A;  3IL2 A;  2OZ6 A;  3DEU A;  3O6B B;  3I5U A;  4AIK A;  3FXR A;  2A5Y B;  2XAF A;  3LST A;  2CW0 F;  4EJW A;  3LQR A;  1YTY A;  2MD5 A;  5D6F A;  2EV6 A;  2D1H A;  5EEG A;  2ISY A;  2P5L C;  4L0Y B;  3SZP A;  5ICC A;  1ZGJ A;  1EH8 A;  3I0T A;  1A73 A;  3E6B A;  1DUX C;  2P5V A;  4EM2 A;  4Q47 A;  3K0L A;  1DPR A;  3WE3 A;  1CZ0 A;  3QAH A;  2FQ3 A;  2XKP A;  3TOA A;  3IKT A;  4JK1 X;  3GXO A;  4OU0 A;  5CVV A;  2UXN A;  2KJB A;  4KN4 X;  3J80 K;  4WXD A;  1S7O A;  3R6S A;  1ZRC A;  2DU9 A;  2JT1 A;  4FX0 A;  1HQC A;  1CGP A;  5LGT A;  1WWX A;  1QO0 D;  2DPD A;  3RPU A;  4IVN A;  2F5F A;  3E5U A;  3NEU A;  2EA2 A;  3Q5F A;  5E1X A;  3VOE A;  3F6V A;  2NYX A;  3HOT A;  2OZU A;  1BC7 C;  1UCR A;  1KQ9 A;  3M8F A;  1XDU A;  2DO7 A;  4HQM A;  2VT3 A;  3G73 A;  3V7R A;  3BPV A;  3JTG A;  3WE2 A;  4UUV A;  4U7D A;  5ICE A;  1STZ A;  1T38 A;  1P2F A;  5DV5 A;  1IN4 A;  1GVJ A;  3RKY A;  4P9U A;  1O3R A;  4FHT A;  1R1V A;  3HRU A;  5BMZ A;  5HS9 A;  4XSZ F;  2A07 F;  4MNU A;  1R23 A;  5HDK A;  2A6H F;  5E20 A;  4TV7 A;  2CQK A;  2IPQ X;  4CO8 A;  1FP2 A;  2PG4 A;  3QP6 A;  5BQT A;  3R0J A;  3DF8 A;  1UFM A;  2EWN A;  4R8H A;  3KLN A;  4M74 A;  4G7Z F;  1IAW A;  4S04 A;  4N0B A;  2DAO A;  4OIR F;  2J5P A;  1JE8 A;  1TNT A;  1YG2 A;  2ZNZ A;  2IRF G;  3GFL A;  2HGC A;  3T8R A;  5D5V B;  2IA0 A;  2XAQ A;  1TQP A;  3GWZ A;  3Q9S A;  5DUK A;  1LDK B;  2HEO A;  1U5T B;  4LLG F;  1FWZ A;  3FX3 A;  1XMA A;  5L3C A;  1O7F A;  3U2R A;  4F7Z A;  3RJP A;  5KVR A;  1RUO A;  5D4S A;  1MDM B;  2K86 A;  1B9M A;  5DCM B;  1KU7 A;  2CWE A;  3MWM A;  3SZT A;  3P7N A;  4L0Z B;  1U78 A;  2H09 A;  4RGU A;  4NQW A;  2PLY A;  2FU4 A;  5ICG A;  2EA4 A;  2DK8 A;  2K7L A;  2YPR A;  5LRS A;  2M5W A;  3M9A A;  3HTS B;  1LJ9 A;  4HYE A;  3N4M A;  4IJA A;  4EVI A;  4HOB A;  1JHF A;  3Q9V A;  3P9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...