1U3FA

Structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
164
Chain Sequence
MDKNALRKQILQKRMALSTIEKSHLDQKINQKLVAFLTPKPCIKTIALYEPIKNEVTFVDFFFEFLKINQIRAVYPKVISDTEIIFIDQETNTFEPNQIDCFLIPLVGFNKDNYRLGFGKGYYDRYLMQLTRQQPKIGIAYSFQKGDFLADPWDVQLDLIINDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methenyltetrahydrofolate synthetase from Mycoplasma pneumoniae (GI: 13508087) at 2.2 A resolution
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Ligase
molecule keywords 5,10-Methenyltetrahydrofolate Synthetase
total genus 44
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 1u3fA00
3HY6A 1SBQA 2G40A 2JCBA 1WKCA 1U3FA 3HY3A 1YDMA 3HY4A 1SOUA 1U3GA 3HXTA
chains in the Genus database with same CATH superfamily
4NU5A 1M2VA 2HBYA 2JEYA 3D6MA 1Z4QA 3FIUA 3K3PA 4AS3A 1B26A 3LWNA 3RUEA 1LBIA 4LYEA 3C6MA 4JUBA 4IIJB 3FETA 3M5PA 3LUDA 4I6GA 2PU5A 1X6VA 3UV7A 5HUHA 1SC1A 4P9NA 3QLUC 4TLMB 2W6NA 3LF1A 3GLFA 4GKKB 5GM2A 3GA0A 1RYFA 2WNHA 4HMQA 3MGAA 1QH9A 4M8SA 1FYWA 2DBQA 2EFGA 2F7SA 3HU2A 2OCYC 3JZDA 4I5GA 1RWQA 2IPOA 4JN6B 4D4IA 3N74A 3RS0A 2R6ZA 4LXQA 3F3KA 4D42A 3K09C 5AVSA 5DX1A 2Q6OA 1L7EA 3A0UA 2AFVA 2C78A 3GLIE 3ZZ1A 4Y2PA 4DRZA 4A92A 8AT1A 1S2GA 3AFNA 3TRDA 1XB2A 3G8YA 3L43A 1KGDA 5JAHA 3RAFC 2O6LA 2VT2A 3K8ZA 2CLDX 1NONA 4N6OA 2V7PA 3ZCRA 5DTEA 2H2IA 1D5WA 1XCOA 4KQMA 2OGTA 2NQTA 4R3UC 3ZQUA 4OYHA 2TS1A 5JRDS 1BHQ1 1ZGJA 3HPQA 1U63A 1E89A 1A1VA 3MXOA 3OMWA 3HRIA 3WX0A 3NBZC 2Q9CA 3NGLA 5FPTA 2HA3A 3UY4A 4DANA 2HJWA 1DAPA 4M1MA 3LHDA 2F3SA 4QOJA 1UJBA 1TL7C 2Q4EA 1PVOA 2TMKA 2B2NA 4MJXA 3OD5A 5AVKA 2RH4A 4ZCQA 2VXCA 3VTKA 4BGVA 4OHKA 3VAAA 1NVEA 4IDNA 1IK4A 4K9LA 1GZHB 5E6SB 4RTNA 2SKEA 4LX8A 2CFTA 3DCYA 4MKHA 1YTLA 3DEJA 1U8EA 3WDSA 3T7AA 5MN5A 2FH5B 3IT0A 4GXQA 5IJ9A 1POWA 2KBEA 4RS4A 1FPMA 3ZJYA 4AX8A 2WG1A 1V4NA 3LECA 2PKXA 1O6ZA 5EUQB 3SVLA 3LPCA 4G09A 1R9NA 4XKJA 3WNZA 1T2DA 4H3VA 4JL8A 1K7CA 1GV0A 1TO2E 4KO1S 3ROMA 3U1TA 2WFZA 2G0NA 4O5AA 3O92A 3UM9A 2Z2ZA 5F5NA 1U2SA 4BQFA 1KDPA 2GARA 3HFJA 3KB2A 3ED5A 2E89A 1SBHA 1SHJA 2L0XA 1I3LA 2CL0X 1OH6A 2FFHA 2HO5A 3DBHA 3QMVA 5K51A 1L8LA 1BHO1 2QTCA 3TQCA 4BO7A 4KO3S 4BKOA 3NX4A 1XQ6A 1DOHA 3C4VA 4YRKA 3EF0A 2LDBA 2XCLA 3O26A 5FI3A 4AG3A 4IG9A 2PKQO 5K7SA 2JHAA 3D5EA 4R7TA 4ZRMA 3GMSA 3GVPA 5SZJA 5KWIA 2FTKE 2VAPA 2PZMA 3PQ3A 4QEKA 3DH0A 1DADA 2ZYSA 2NO7A 2W6JA 2PQ6A 4S2EA 4Z1MD 1Z45A 1SKQA 1FTQA 1WZNA 2MSDB 4IDHA 3SAJA 5BSFA 2WU8A 1ZGCA 4ZOCA 1P1HA 5EJ5A 2ZZNA 1YJCA 3AM3A 4IJKA 2I2AA 3BS4A 5C4IA 5IXYA 1BWRA 3DBOB 2FSVC 1G8YA 2OY0A 4JOSA 2Y92A 4RK0A 1B7GO 2QL7A 4CT4B 3FCCA 2HHLA 3I30X 4ZT2A 3U4DA 2I67A 4C3UA 1CDDA 3BSSA 1NW3A 1JMKC 1M2OA 4JBHA 4RAOA 4Y6OA 4O6VA 4NBVA 2P40A 4OQZA 3K0BA 1KRWA 2AOVA 2WF7A 4WKPA 5I9BA 4IV0A 5EWMB 5JYCA 1S3FA 1P5HA 3UHPA 5F73A 4GMKA 4DDTA 3HCRA 1UEJA 2DGDA 4TT3D 3BFPA 1ZONA 4OFZA 5H68A 1IEWA 3N0VA 5ISMA 4WUVA 3DQPA 2RJOA 1PYGA 2WSBA 3AQ4A 4N6GA 1UIMA 1CQPA 2AG6A 1F0KA 2VKTA 2O7QA 3KEGA 3JQFA 4ZVPA 4BKRA 4BEWA 2DBYA 2GKOA 4KQ1A 2CDNA 1NE7A 2YZNA 4TXMA 1HOTA 5FPPA 5HIKA 2BKUA 5E6RA 5I4IA 1G291 1MLDA 1U0TA 2Z43A 1ECFA 1NN0A 4W8HA 2F43A 3MTDA 5BV7A 1V95A 1KJNA 1N0VC 3EIEA 1KQPA 1THMA 1OWPA 2FPIA 3VHXB 5FUWA 1P1FA 4ZVKA 4ENRA 3OF2A 4K28A 4YVFA 4DMRA 3I28A 2R1VB 1E6UA 1ES9A 4LSGA 3UH0A 3PDIA 2GCOA 4IR7A 4HUQB 3PHIA 4AN4A 3BWDD 3U7JA 1CQIA 4BCDA 2X2PA 2OV1A 3KWLA 4ME6A 5KC9A 3I9V1 5FYQA 4G0OA 3FFXA 1V7QA 3Q7QA 4CM9D 1PK8A 3TNYA 2D54A 1RWMA 3FUWA 4MRNA 3KR9A 5EOVA 5SZHB 1K08A 2PZJA 1YB2A 3DZCA 2E3JA 2V9PA 3Q98A 3H1TA 4ZEWA 2ZIVB 1Z68A 2C61A 3GBPA 3KEOA 5IC6A 3UBMA 4B32A 1G6KA 2VDWA 2DOKA 4KQFA 2BEUB 4ZT6A 5JFTA 5KSZA 2FEPA 4X94A 5C1BA 8ABPA 3C1UA 3C6XA 2WHQA 5F1PA 5T4BA 1KHHA 3B52X 3HJUA 4MZXA 3TAXA 4G5FA 1DRUA 4QFDA 3HS3A 2ECPA 3K53A 5I7VA 1BC5A 3G8DA 1Y33E 2FN4A 4FS3A 4D02A 1R0YA 4HNAA 4N76A 2GETA 3LKVA 3M0EA 4G5XA 5LB2A 4ZOBA 1ID1A 1Y6RA 2VN8A 1W5BA 2XX3A 3JPYA 4R83A 3S1SA 4JJ7A 3CVUA 2FEKA 2ZJ2A 3CPHA 1PTJA 1QHYA 1Y3CE 3TD6A 3VKWA 4D98A 5F64A 2UUAB 4CMHA 1R3DA 5HEKA 1MB9A 1GSHA 4K9KA 2KQUA 1CJVC 1H66A 1U8ZA 1EVIA 1OGJA 3P2KA 3MGCA 4JMPA 3KB1A 5CLHA 3WNBA 5MGNA 1VFNA 4KKXB 4QXAA 5EPUA 2KS6A 2D2IA 3NKLA 3W5VA 4O1MA 1G98A 1AS2A 4FB4A 1XJ5A 3CJRA 1UOOA 4HDNA 1KAQA 3FMFA 3TSAA 3VNRA 5B3KA 5TNXA 3FNIA 4RULA 3G7UA 1L9KA 2QD3A 4ZHQA 2OESA 4IIEA 5HZHA 5DU2A 4PCLA 1JLLA 3GP3A 3OIGA 2DFDA 1U28A 3KO8A 2OXTA 2WA2A 3O47A 5J3JA 2WIFA 1OI3A 1N32B 2ZBQA 3IPXA 4HRVA 1TJPB 1SUSA 3HR7A 1N36B 3DXYA 3QGMA 4DIUA 1JR2A 1LDEA 3QXXA 2Q9AA 2IDZA 5H81A 5DWDA 3TMAA 2B21A 1GARA 1T5TA 4J1TC 4NE7A 4ZRNA 4AF7A 1ZOPA 1F5NA 1Z08A 3ZWDA 4KR3A 2BHLA 4XH9B 3I6IA 5JPCA 3HBJA 5FQNA 1QIGA 2Q3BA 3ELUA 4ZAGA 3HE3A 5L9AA 1EUDB 3WRYC 2ZUFA 1O9BA 3ZCPA 2ZR9A 2ZRDA 1Y8RB 3EZNA 3M6UA 1M1XB 3ZU5A 1YZQA 3T95A 2UXBB 4WZAE 3TQOA 3IPYA 1CW2B 1Y1KE 1ZQ9A 3AF0A 4HDKA 4UUMA 1PUXA 1TIPA 1FK8A 3K31A 4HFJA 3EXIB 4CFZA 1K27A 2C95A 3FH0A 3KOWA 5YASA 3C1TA 3GU3A 4ZVUA 4ZPJA 3HWSA 1FTWA 1C3EA 4B75A 1VCOA 2GEFA 1FFEA 1CR0A 4XEHA 5EQTA 1XZJA 3RK1A 4RPLA 1O1YA 2YFHA 2CJWA 2PM8A 3THRA 3B2QA 4JZKA 2B4RO 4DGQA 2AG8A 4BGEA 4LXUA 3M9LA 1Q7TA 4KMMA 4MDHA 1J70A 3RODA 1DV2A 1RT9A 2E4WA 3RLFA 4CZ2A 4GOKA 2HSDA 2ZM6B 5F3DA 4B7CA 1ZBDA 1R0WA 2JNWA 2P90A 5CFPA 1YQUA 1JPVA 1X77A 5JD6A 3ADKA 4A8JB 5EJ6A 5CX1B 3Q1KA 4AUEA 1A5TA 4RJKA 3E05A 1J8MF 1WHSA 4P8RA 4CLDA 1PR1A 1UC8A 3UJ8A 5HKKA 2NU6B 2CYCA 1ZGAA 1NMYA 2QRNA 2O2SA 3DB2A 2KLHA 3TZBA 2E85A 3V42A 1FBTA 1GCGA 5CVCA 4TX1A 1TLLA 1ICEA 1XZLA 1LDBA 2C7GA 4YBRA 1KOJA 1E1RD 2I9PA 1DZIA 4OGLA 3RRMA 3OM9A 4FT2A 4B3CA 2CB9A 4MS3A 3P9PA 5DNAA 4DXHA 3CH7A 1PLLA 1M9NA 1QAOA 3GBVA 3IQXA 4X7RA 3UK0A 1P9RA 3WWZA 3UMSA 4K2HA 3GC6A 3LX8A 2XQKA 1MEOA 3TBHA 1C3LA 2GRUA 2JLUA 1NRJB 1L8XA 3DBLB 2M6KA 4E6EA 3Q11A 1II8A 4LN1A 4N5NA 4M0UA 4FS8A 4KLNA 3OEYA 3TPFA 1I01A 4ER5A 1RNLA 1BKDR 3E9RA 1T3LA 2II6A 2ZUTA 1CWUA 3C39A 3OSZA 1L7BA 2O8CA 2W4IA 3PDIB 3BL8A 1NXTA 4M1EA 3MCAA 4OHOA 4U02A 3ZGZA 1GN9A 5A4DA 5DK6A 3AUSA 3UKOA 1AQIA 1U0SY 4GSKA 4ZANA 3MMZA 2HU2A 1HDXA 2EARA 2UVPA 3DA8A 1FY2A 4PWYA 5F52A 4G1MB 3DCIA 2BMDA 2WUWE 2XA9A 4HAXA 4MJLA 4XVRA 5DB4A 3T9DA 3DLIA 2QJWA 4DCPA 1EUCB 3B2EA 5H16A 5IT0A 4OQEA 4WA8A 5DP1A 1S02A 1G20E 1GZ7A 2D0OB 4O4LA 1X8JA 3GMTA 4L8FA 5AHXA 2PUEA 2R62A 3WZMA 5KPDA 1VE6A 1VP9A 4BZZA 4XOUA 2JBAA 3U3KA 5IUJC 1UT6A 4DREA 2QVXX 4H27A 2H8GA 4Q7EA 3UWSA 3OJWA 3V2UA 2VJQA 3BJZA 1MB2A 3GO4A 5FFNA 4L3OA 4DYVA 4EVRA 1EFLA 2FF5A 5AI6A 3B7PA 4PG6A 2G9ZA 2ODEA 2R7NA 5ALMA 4FMDF 3QQPA 1VE7A 1VA5A 3CW8X 5BUCA 1BD4A 3BRQA 1QJCA 4M1YA 5D6OA 2Y27A 4A6EA 1IH8A 2W42A 1MT3A 3I9JA 5A3SA 4CYMA 3UJBA 4E51A 1QCYA 4YYZA 1I7NA 1LBSA 1EJ2A 2CDRA 3AIMA 3ONDA 4H1TA 3CWZA 4MB0A 4NH0A 5F51A 3UAOA 3OQIA 4IILA 4L7VA 4DLSA 4JT4A 3U09A 2GAIA 3R41A 3AEYA 2GILA 4UCFA 4U4AA 2C5BA 1J23A 1R0ZA 1TM1E 4IKEA 4FLEA 1C8KA 2Z6QA 1NF3A 1CEXA 3DL7A 1UJMA 2FK8A 3HCFA 4OFBA 5CPBA 4BNVA 1OLSB 1BA2A 4LWPA 3RG2A 3R09A 1FW6A 4KR6A 4N3NA 4K6MA 4KOEC 2NN3C 3A37A 1EG2A 2GUGA 1ONNA 5EZQA 2NUBA 1QYIA 3JQ7B 4EF6A 4RGYA 4R2JA 5BT8A 3D3WA 2A0KA 2JAOA 1G5QA 2JFBA 5KYWA 1U8UA 1OZ0A 2P2NA 1P74A 3ADDA 5F4ZA 4P4NA 1EA7A 4HADA 3D1VA 4UCQA 5T5QA 2CMHA 4XD7D 3I61A 3B9BA 3TK1A 4K3VA 2SECE 3NOXA 1V7PC 2MOKA 4LJSA 3RHZA 1G21E 1S3SA 1ZK4A 3D6VA 5ARDA 3U7QA 3N6VA 4QGAA 3SVTA 2AFIB 3IOBA 4P36A 3EAQA 2C31A 4MP6A 1NVWQ 2BGRA 1YZYA 2E6KA 2IC5A 2XUHA 1ZNYA 2ZAOA 1N8TA 2IPAB 4RZSA 5C31A 4AECA 3LKZA 1C7ZA 4MRAA 3AEKA 4J3NA 2ZJBA 3T7KA 1BMFA 1RHQA 2JD0A 4LHVA 1KEEB 2ZATA 1NRXA 1E3LA 1GPH1 2QRGA 5IAKA 1FX0A 1XWFA 2HADA 4HTFA 1YA8A 5A62A 1DEHA 1NRIA 1U0NA 1ZOOA 3KKOA 2FFRA 3BH6A 4LDZA 4R8MA 3P94A 2BKLA 3TFWA 4M7PA 3EVCA 1OW3B 4R7ZA 3ZE8A 4G2TA 1UDCA 3NV9A 3GNLA 1E5VA 5ALTA 4MS4B 4URHA 4HEJA 1NXWA 1WRBA 5IBQA 4RF4A 1W8IA 4M0LA 1F2TB 3P9KA 3VDNB 1BO6A 2H65A 2BM1A 3NETA 2XA2A 3OQIB 3KTDA 4X1OA 5LU8A 4NE2A 2H1HA 3W4IA 3TNLA 5GJBA 2WJJA 4C6TA 3UK7A 1UKVY 4UM7A 3Q6NA 1QOPB 1B15A 2I4IA 1M7HA 2D1SA 5JCJD 3SBOA 5AI4A 2IJGX 3L0DA 1KYTA 2XMQA 3EBPA 3OPXA 1PX2A 3ONWA 2PNFA 3E7WA 1M75A 1PYOA 2NXCA 4K86A 3QUCA 2WT9A 1E5XA 4JB2A 5F1OA 3TE6A 1OYWA 4M54A 2FG7C 1FCJA 1ZFNA 4PFQA 3K8OE 4WAUA 3UMVA 3K2BA 4RU1A 1I7DA 4FGSA 4LRYA 3C5HA 5ILGA 2DWCA 4PPYA 4Q0MA 3PGVA 4PAOA 3PKZA 1P7YA 3HBFA 3TZEA 4V0KA 3WLEA 5FR2A 1PGNA 2CJFA 2ZROA 4O4IA 5CBKA 2JC3A 1MF7A 5REQB 1H93A 3WRXA 3HHEA 4QE3A 4TYNA 1XNQB 4UNNA 1WMSA 4ENTA 4RPCA 5LQUA 4CQMB 1D2AA 5JAPA 3PHLA 4URZR 5HE9A 5A02A 4B3RB 1UANA 4PE5B 4S1WA 1KF0A 2C9DA 5CDGA 2H18A 1AKWA 2ACVA 4TVKA 5TV2A 3W7BA 2WAOA 2PUCA 3MRXA 3HO1A 4OQFA 4LK2A 4TMVA 4YLYA 4AWXA 5DWQA 3FGZA 1T8UA 5K8VA 3CZQA 1FLVA 4CLEA 2N9UA 4EKDA 4TTTS 2VAVA 1KJJA 3GAAA 2BGGA 1DAKA 3WQSB 4YLEA 4IGEA 4QYMA 1JT9A 3GT0A 1FZTA 4KPEC 4XPIB 2BF4A 4P4UA 1NJ8A 2DSTA 2O0KA 1WUJS 3ABSB 4RZXA 5DM1A 3PWTA 5T4HA 3AJEA 2Q7OE 3ZGOA 1YB6A 2ORIA 5F5XA 1KRHA 2JD2A 3COSA 2HREA 3ZV4A 1RXYA 2JFYA 2OD2A 2BC9A 1IOLA 4D0RA 2XTNA 3DB1A 3JZIA 5A7HA 4WBNF 3NHWA 2W2PA 4F9GA 1OR8A 1CD5A 1S2OA 3ENWA 4EYEA 1CDEA 2AQ8A 2QM3A 4MCHA 5CCDA 3VMMA 3EXG1 1GAXA 2NX2A 3A3OA 2Z58A 3HU3A 3IEXA 4HWGA 3CPJB 2XKAA 1E9BA 3QVKA 4BEBA 5LCXA 5TVKA 1JJVA 2J5RA 2GZHA 4BV9A 1HEYA 5FNVA 1HLPA 1YQWA 1U3DA 3QA9A 3L04A 1XX6A 1JJBA 4REMA 2XYVA 1JLMA 3M2TA 3QEKA 5C4MA 2JRCA 3KIPA 4NE9A 4TSFA 5B7QA 4K46A 4KOAA 3X1XA 1MORA 4KFTA 1AXRA 5CHEA 4UDOA 2VC2B 3BH7A 2OUKA 2OVBA 3KALA 1MRNA 1R0SA 3KL4A 2CBGA 2G5PA 2W8BA 1Z36A 2PGIA 3NJRA 1V5WA 1M34A 3QPVA 5FUYA 10MHA 3FDXA 4LZLA 2QGZA 3GGSA 4NDZA 1EFRA 1T9ZA 3HWWA 5EMKA 4AULA 4DXAA 5AM4A 5AICA 1QHEA 4IGFA 2V9CA 3R5HA 1OGYA 1WULS 1B8VA 3CU5A 1FDUA 3LVBA 3PDHA 4LJ5A 4LOHA 3TM4A 2QKYA 2QORA 3LUCA 4PLGA 1YK0A 3O8LA 1ZSNA 2WYIA 3GLGB 1S6YA 3NTLA 4XR9A 3JD0A 3R5JA 2DWPA 1RJWA 3FFTA 4WCDA 2AUMA 3N87A 4WZBA 1QWSA 2JGRA 1X9IA 4RL6A 3V1MA 1H69A 4M9CA 2Q7XA 1JIVA 4FYMA 5I5EA 3A70A 5DGCA 1BDHA 1KO5A 2WTNA 4WHMA 5JBQA 4JUAA 3SYNA 4JP1A 2XF2A 4MR9B 4PS0A 4LWZA 1Z7WA 3KV1A 4OHYA 3TX2A 1U5BB 1X9HA 1P1IA 1GITA 1MABB 2ZEJA 5MGBA 2R7LA 4TL6A 1CZUA 1Y8RA 5FL7A 3FCAA 4UZEA 3JQ7A 1E2GA 2ZRGA 3LGSA 3MB5A 1ZAKA 4HWKA 3U2QA 1AKNA 1O95C 1VKNA 2ZUWA 3FVVA 2OR3A 4EZBA 5HJ5A 3UJHA 4YWJA 4O2BA 1DKUA 1MVOA 2MR5A 4BFUA 1S0UA 1U4NA 2X0KA 4DDVA 1Y5IA 3H7AA 5CBPB 2WWHA 2QG4A 3GRCA 1H0SA 2E5FA 2HEIA 1UF9A 3BMQB 4R5MA 1VHJA 2AOTB 3X2SA 1GUYA 1PDOA 1W4CA 2CMGA 4KJZA 4G0NA 4R3NA 3WLHA 1N3YA 1IBSA 5ULLA 4RIFA 5AVQA 1AKRA 1ZJZA 2BFFB 4EAAA 5IARA 4A2PA 4DKXA 4LOIA 4KREA 1FDRA 2J0VA 3EQZA 1FBNA 1LTHR 1S3GA 4D8TA 1ZR2A 1PZXA 4I50B 1IWBB 4QATA 4UULA 3REOA 4FYHA 3RFFA 1CYEA 1AS3A 1CLUA 1VJRA 1WHSB 1JRLA 3ORFA 1VIMA 3TTVA 5BOSB 2F3UA 5ALWA 1SK9A 1MTOA 3ZH2A 1KI7A 3TD9A 4DLWA 2PVSA 5EJ7A 3TZHA 5KNBA 1KIAA 1NLFA 3QVWA 1II0A 1OSNA 1TM5E 4M3NA 4P4SB 1UMKA 1CQZA 4WTOA 1PAUA 3A7DA 4G1BA 2R8OA 4EFNA 1Z33A 3C0KA 4FYPA 4JROA 3IO5A 5K6AC 1AF7A 3U6BA 1OIXA 1PR9A 2OM2A 4JLKA 4NFLA 3ZD9A 1Z4KA 1M6EX 3EIOA 2YJ4A 3IT1A 3K0HA 2AI3A 1YZKA 3L8GA 1IHPA 3FROA 4ZYXA 5E6UB 2FPIB 4AK9A 1GDHA 1N4DA 5FTJA 5IVHA 2X86A 1Y4SA 3H2IA 3IRVA 3EOAI 4ALKA 3QX3A 4K5QA 1TT5B 3LW7A 2Q3CA 3T7EA 2IDJA 2ECQA 1N6LA 2JA1A 2O0MA 3MTJA 4YJKA 3FYDA 5EJFA 2IV7A 4C04A 1KP9A 5AHRA 3FHLA 2JIDA 3HUTA 4AU1A 4D6XA 2ZU0C 2RH5A 1MO2A 3SC3A 1Z47A 1GNPA 1Z83A 5GP1A 1FVFA 3P9CA 3P9RA 2M32A 2H85A 3WLQA 4E7PA 3FOEC 4BP1A 2XV1A 4O5OA 2JJ1D 1YOVA 4HX2A 3KQQA 1YRLA 3B3AA 1U3CA 3QPUA 1MGOA 2FEAA 1SC9A 3CR7A 4XFJA 3FLBA 5LXTA 2MINA 3ET5A 2ONYA 3OZ7A 4X1IA 1USUA 3UCXA 2E4YA 4KE7A 4IBOA 4RE6A 3KKEA 2Q3JA 3E35A 3P19A 2F9FA 4EVIA 1T0UA 1B43A 1FVXA 3X44A 4QHYA 1QZXA 1K8XB 4YRZA 1ORRA 2D0IA 1P7VA 4KGZA 4HBZA 1XMPA 3JQ9A 1IHDA 3ZZNA 5ICMA 4R5HA 4RCZA 4B7XA 3JWGA 3FTFA 1P4SA 2VPIA 2G7MC 4XX0A 1N2HA 3WC4A 1IN4A 4XUEA 3E3NA 4RGVA 3T9AA 1UBJS 3KU1A 3S55A 2WUVA 2V0CA 1JKXA 4MMZB 5CNKA 2YV5A 1JPJA 4XIJA 1FYDA 3C3XA 3BXZA 1T8WA 4JVNA 4KGDA 3RRXA 2A1UA 4GP9A 3PTAA 5JNUA 2AJDA 2WJ4A 3GIDA 2RGBA 3E5MA 5B5SA 3PHHA 1SZDA 2A14A 4MVJH 2ORVA 5AW0A 1XZMA 3OF5A 4DPMA 4B5KA 4BWVA 2C94A 2NOAA 1GA1A 5LC1A 3GI1A 3A9WA 2GH1A 3R0XA 4KAXA 2C97A 3QOXA 3NHYA 1B6SA 4LVNA 4BNFA 4FC7A 5GZ3A 2EBFX 3AR3A 2OORC 2GZRA 3NO4A 2FQYA 4FJ1A 3WYCA 4D81A 1PS8A 2W0MA 1LW7A 4C4ZA 3L6RA 1OJLA 2OZPA 3Q7EA 1ABEA 4JMLA 1YDMA 2R60A 1QBKC 2B9VA 5HUQA 1U02A 2Y1LA 3AUTA 5FA8A 3T3MB 2XCUA 4TKUA 1E58A 1VPEA 1QVWA 3WGIA 1VIVA 4YO7A 3TFQA 4YDRA 1N8SA 6REQA 3BSWA 3CX3A 4JLBA 1N7IA 4QNNA 4N7JA 2ZULA 4ZAYA 5BSWA 5BV0A 3RADC 4MQ5A 1JKFA 2XCSB 3CCBA 3B36A 1MQSA 2O07A 2DBVO 2JGDB 4A2CA 2AJCA 3BRWD 4OOFA 1WXQA 3SMVA 4RYLA 1UQUA 4HEHA 1TU4A 2VVTA 2H92A 2QTRA 3EGDB 3FUCA 2VIIA 4JGIA 4OKNA 3RROA 2JG3A 2DFKB 2NLOA 1DAMA 5ER9A 4DDKA 4O3MA 5G02A 1OAOC 3O82A 3DMTC 2C2BA 4RWZA 1VOTA 4RVFA 1NOIA 1YASA 1BMTA 3QF4B 4AO6A 5EXSA 1TVMA 1PD1A 3GROA 4UBIA 1JHYA 2R47A 5BQOA 3T4XA 5IN5A 2PZFA 4DVJA 1H05A 2NV2B 5ERXA 2NAFA 3BTOA 1IZ9A 2ILTA 5HK9A 1W87A 4INAA 3BA1A 4RKRA 1AHNA 1XBTA 4ISBA 5EINA 4DV1B 1PL7A 1ZIOA 4HSEA 5FB3A 4M1QA 4CM6A 6YASA 5EUMA 5I7WA 4JP5A 1IRXA 1D07A 3AF3A 4RVUA 5AKXA 2NUTA 3DEFA 4C22A 2HRRA 4PZEA 5C5CA 5TQ2A 3UYLA 1TC2A 3ITKA 3O8NA 4N9QA 2V7GA 2W6QA 4XYLA 1EZZA 1W9HA 3OX4A 5JAMA 4OU4A 3FPLA 1W0KD 2ZT6A 1IM8A 2YL2A 3D54D 3MEQA 1X70A 3CEHA 4FFVA 3ACDA 4OO3A 4S0ZA 1LPPA 4WDRA 1MAUA 3EFOB 2BFNA 2OB1A 3T1VA 1P2FA 1XVUA 1ZA1A 2J9ZB 3OVMA 4U8HA 2X9QA 3G7SA 3GPIA 3BN3A 2PZGA 4HJXA 3U9SA 3ULKA 4ZMSA 3OE7D 3U1BA 2E5LB 2H31A 4U7PB 4BZXA 4EW1A 2FSFA 2VHZA 4F2WA 4JS0A 1TFRA 3MGBA 3SZMA 4NHEA 1XTZA 1FMTA 1Z3CA 3U7RA 3WGNA 2OK7A 1CRQA 1EE9A 1T1GA 3VVCA 4DLKA 4OPMA 1KWGA 2ZAYA 4P7FA 3LYHA 1B8NA 1GUDA 3O91A 1WLYA 1M5RA 5DISB 1YBVA 1BVYF 4D92A 2PTGA 4WLVA 3PUHA 3Q0EA 1UC9A 2JGDA 3DE4X 4AQ7A 4LF7B 1ZGGA 1KWKA 1EFVA 4ER6A 3FY4A 3R1IA 4KX3A 3ZY5A 2QD4A 1VZ2A 3E4DA 2ADMA 3PC4A 2UV8A 1JF8A 2OOKA 4TTQA 2NSHA 3RC3A 1FTNA 2IUSA 3R74A 2HAEA 4HDMB 4CKEA 2EBHX 3VC7A 2YMQA 3KLOA 4CIWA 2B4AA 5ES4B 3V4FA 4BGIA 1VECA 1MENA 4Q4JA 2FMXA 4HWPA 4NZOA 1DCKA 3C43A 3DAFA 4KIJA 3BYZA 3DP9A 2CHVA 3PUWA 3QXHA 2MINB 2PU7A 4X1IB 4CQMD 1DKLA 1J06A 2ZYHA 4FNOA 4XPIA 2O54A 2NZXA 1DWQA 3RFXA 1EWVA 1CZNA 1SVOA 4NNOA 2DERA 2QSYA 5DI9A 1J49A 1A96A 2QRMA 1JFFA 1E99A 1ZHHA 3NPMA 3B89A 2IXEA 1LFAA 4XOIA 4KFUA 3WJ2A 1B6RA 3SE0A 2GHRA 4HL6A 1RE1A 1V7ZA 4BO9A 4DMUB 5ALZA 1L5ZA 1QIFA 4HQKA 4QDTA 3E3LA 1GSOA 1Q11A 4AN0A 5IJXA 1XFAA 1Q1AA 2JLAA 4RTKA 3THWB 1HURA 3RSCA 3QPBA 3L77A 4IM7A 4IJUA 1TPYA 2QRQA 2V4UA 3S27A 3UT6A 1HT0A 3H7IA 2B5VA 1BDJA 2HJHA 4G25A 3PCRB 5D3MA 4ZO6A 2H3EA 3RS8A 4FHEA 4QYWA 1I5EA 1GSIA 2GJ8A 5AJZA 1AHHA 1ZJWA 1Z88A 4V0LA 3RS2A 1T9GR 2KSQA 2PWPA 1KE1A 5B64A 3FYCA 4HQ0A 3H2ZA 4X24A 5CXSA 2MSNA 1TK9A 4EEZA 3DNMA 5GOTA 4QLAA 1YF3A 1G7TA 3PHCA 4AJ4A 3AZOA 1NQOA 3QBJA 2ZS8A 4JWTA 3SP1A 3GCXA 3KYCB 1EAYA 3IOEA 3EZ2A 5CP8A 3QVSA 4G63A 5DGHA 1H2BA 1E18A 3RVMA 2BFWA 4RHUA 2GSDA 1BYUA 3OA0A 1KFEB 2CBZA 5JPIA 4AMGA 1A88A 5CPFA 4DRXA 4X90A 1LDMA 2P9BA 3LX6A 4ENVA 5LYJF 3PEYA 3AIKA 3OLWA 4AJKA 1MA0A 1G6HA 1HE2A 2GRAA 4JIMA 3TOXA 3M4YA 5BN3A 3PPYA 3IVGA 2B6NA 1BZYA 1D7OA 1RCFA 2OSBA 1R8QA 1UZLA 3OT5A 3CQ9A 4L85A 4PNPA 4WCVA 1PEKE 3PJRA 1KZYC 2H06A 2G7ZA 3F5MA 5LB4A 4TPKA 1DZ3A 2WF9A 3EULA 3CLHA 4YUVA 3UK6A 1DP4A 1GNTA 1YMVA 2VCYA 3G79A 3H1AA 4URVR 4G5YA 1WU8A 1IIRA 1Y6FA 2YS7A 1PV1A 5K3FB 1QP4A 3D59A 2VQ6A 1GTL1 2GM9A 3M33A 3DLCA 3HYNA 4WL0A 1BTOA 2YVKA 4B3MB 1B6GA 1M10A 2IPXA 1WY7A 2N42A 3I73A 4KAFA 1Z56C 4PTLA 4FDMA 4GBGA 2XCQA 1W5EA 4PRKA 4FX2A 1ID8A 3GJYA 2ZIAA 3LY5A 1VHLA 2FSIA 4C7KA 3RS9A 3ZW7A 4X61A 1W0JD 4UXIA 1P29A 4POOA 1TZCA 4LFAB 3QEBZ 5DM60 2QZSA 2Y71A 2EDAA 3Q8LA 1I4WA 4WI1A 5DE3A 3T9CA 3O4HA 2BTOA 3TSWA 5J47A 4RMGA 2QUJA 1Z2DA 2OV2A 3WY9A 1NYRA 1RIFA 1NZDA 2RBKA 2JIZA 2FW9A 3FSEA 4GE3A 1M54A 4TL8A 2D13A 5B37A 5LQSA 4YRCA 1DLIA 4K3UA 1I14A 5IJZA 1TUEA 1Z2NX 5EMMA 1BWSA 1AGNA 3QYFA 5JS7A 4YV2A 3BAFA 2OL4A 4Z2YA 2JEOA 1T8YA 2BFFA 4X8HA 2VDUE 3EGDA 4I1RA 4L2IA 1NKTA 3O1JC 4RGQA 5IKXA 4TQ9A 3FPEA 3GXBA 3LFTA 2RKBA 3MFYA 3TQHA 3WBBA 1J7JA 1NNSA 1N2EA 1XD2A 3HFSA 5GV7A 4K2AA 3V1KA 4E11A 2PR7A 5TEVA 2WE7A 3GDOA 1LDGA 2IHTA 2RHTA 5IHPA 1TO1E 4G07A 3KTOA 4UD2A 1GGMA 3DW1X 4MDFA 3KZCA 3UWDA 3USZA 3CFYA 2WWGA 3BJIC 2XE6A 5EG5A 3KVRA 1LV8A 3ZTTA 2R8BA 1Q21A 1ESCA 2CJWB 1PK7A 2DPLA 4QYSA 3IQFA 1FTGA 4RM3A 2I1QA 4DWJA 5JNSA 5DM4A 4TUYF 4UATA 1RP1A 5FCDA 2A7XA 4BIIA 3GEHA 3VPFA 3R3XA 5EHZA 4AG6A 4TKVA 2PH5A 4WZ6A 2ZTSA 3REFA 1T4CA 2HIMA 2QZJA 1JLSA 5ALPA 3H6KA 4ZI7F 1ZNQO 2HL6A 3OUUA 4ZQEA 2DWOA 2E82A 5BPHA 2VH1A 1I1HA 1F38A 1NMXA 4YHBA 3E3OA 1W30A 2CF6A 4ZAZA 5KAPA 5BQFA 3SEZA 5EAIA 4MH0R 2XQVA 4I5IA 4K9OA 4Q24A 4KIGA 4WLFA 1NBIA 5T67A 3RAGA 3HZZA 2BH2A 4KK4A 2XXAB 1EP3B 1O6CA 3ORHA 1S2IA 1GO2A 1BJTA 1EIZA 2R4UA 1O94A 1YRHA 1N9GB 2ZE7A 4S2UA 1FFXA 3SF8B 1OLOA 4KQGA 1HQDA 1NVDA 2FGKA 1ONSA 4L5BA 1K7FB 3I1JA 3PNMA 5B7PA 1EK2A 1KYWA 4DMMA 1E2PA 2C8VA 5LQRA 2CNLA 2DMRA 1OC4A 5EP3A 5C1OA 5DNYB 4C5AA 5EMHA 4RKWA 4IJWA 1KVUA 4LWQA 2CXNA 2ZJAA 4G0QA 4ZKDA 3GEGA 1Y3DE 5JAQA 1XQVA 2BFEA 3ZKAA 2EFJA 1QFMA 3TRKA 3AB3A 1KEUA 4CDRA 1QDLB 2YJNA 3O1LA 4NONA 4BGUA 4E12A 5JJBA 3C74A 2XUDA 5JO0A 3HFRA 1VBKA 3SPXA 3V8EA 1Z8HA 3FWKA 3ZDRA 1I3OA 2JGNA 3UUWA 2Q2QA 1V3QE 1KMHB 2WJ3A 3U16A 2V59A 1JW9B 2GHQA 3D4BA 3UN1A 5ESRA 1MZPA 2YR0A 4B73A 3LPDA 5AVZA 4LOKA 2SCUB 3M6VA 4BEVA 3IA2A 4B3GA 3G49A 1GPUA 3B6JA 3DZHA 3PZRA 1YR3A 1Z2CA 3I23A 4HZUA 3KDSE 3FVRA 3QY9A 1MV8A 5JDCC 3T1QA 1X1RA 3W0LB 1AQJA 1SXJE 1O6FA 1RWNA 2XUJA 3LFHA 3WMRA 2YFKA 3MMNA 3M6WA 2EEZA 4HLUA 4TYMA 1W85A 2K87A 3K73O 4FQ5A 5LQDA 3IQHX 3N2GB 5CDFE 1OZGA 2O14A 5HBGA 4B9AA 1FRVA 3R0ZA 5GGXA 2HJVA 5CH3A 5I9SA 3K7EA 2AHOA 2KB0A 3LXRA 1JIKA 1AHPA 2X15A 2JK1A 5KTSA 2AZMA 3EYAA 3DDCA 2ZJ8A 2Q5HA 4N03A 2NTYC 4OFWA 3WZLA 3UPDA 1N2CA 3WB9A 1FMFA 2IUEA 2P9CA 2X8LA 2CLHB 4LSZA 2ZDQA 1J99A 1DKQA 4HAOA 3Q3EA 4PR3A 3DBRB 3G3EA 1ZLYA 3BJRA 3TSOA 4F04A 1RXVA 3AVVA 3OJXA 4J2OA 1L5MA 1L2TA 5G0WA 3VR0A 2ZUDA 3P27A 4B48A 5CAEB 4EQZA 2R5NA 1BOOA 2E87A 4AY5A 1EE1A 2W6OA 3KAPA 3KDPA 4AMBA 1A7JA 4DEXA 2ID4A 1YC2A 3IUSA 3KQSA 3NFYA 4OCZA 4DJFC 3CZMA 3NKVA 4CEJB 5BSVA 2ZRMA 3ANNA 3C6ZA 3H9EO 4NBRA 2ZWOA 4KQIA 4MV3A 1MIOB 1NUPA 1SD1A 1GKKA 4OI1A 3VPDA 3OJFA 1RACA 1U6IA 3HBNA 4NK4A 2DAPA 4NCIA 4CETA 4W8GA 4JOQA 3UZUA 5G2OA 3NT2A 2CXSA 4U8GA 4X1YB 2FZGA 2OXCA 1N6NA 3B1WA 4J0HA 3UMGA 3HCCA 1XP5A 1KKLA 3VJLA 1UBRS 2AG5A 4IOLA 3DKPA 3TLAA 3R4CA 2QTMA 3I4LA 4I4NA 1Q92A 4UUAA 4R2HA 2X5XA 2G1PA 4EPWA 3L84A 2NZJA 1J0AA 2OMKA 5G3ZA 4EA7A 4Z4QA 1CF9A 2XYRA 2HIGA 3B3QA 3PDWA 3PWKA 5K3CA 4N0QA 3RQSA 2W2VA 3P0FA 3QKSB 3WYGA 4CKEB 3Q7SA 1OV6A 3DD5A 4LC9A 2BEKA 5DGTA 3ILVA 3SFZA 3W4KA 2HF9A 1M1NB 4E3ZA 4F9FA 4PC2A 4UCXA 3ZQ4A 5KBYA 3TW6A 4ZI3A 2Q4OA 1F2DA 1M34E 1EK1A 1UEXC 2ODPA 1Q0HA 1XN4A 4UD6A 3H1BA 2F4VB 3PUJA 3JAWA 2FPSA 2FR1A 5TDHA 4AZ3A 4D4HA 1M8PA 1NMSA 3HK2A 1QE5A 3S28A 2ARKA 1D2MA 2YHUA 3PF8A 4KCGA 2EZ8A 3FLAA 3AIIA 3INGA 1NM5C 3MTIA 5CB0A 2KJQA 1LBQA 1MH1A 2E55A 2FXVA 3EVAA 3ZV6A 5ADHA 5IXSA 4LJLA 1T5BA 2Y9MB 3IOMA 4GQIA 5AKHA 3W04A 1Q0RA 4BRWA 2R6HA 2YXLA 3MWLA 2QLMA 1U1DA 4JLJA 3K9LA 4PLVA 3G0DA 4U2GA 4UEJA 1WUTA 1C3JA 4W6QA 3FCOA 5JTTA 4GXTA 1Q16A 1Q0PA 4GX1A 2O23A 4Q9NA 5JVDA 2BTEA 5HM8A 2YHIA 1PWYE 2P35A 4QXRA 3UTDA 1JLKA 5I7SA 4C7XA 5FNVB 2P9TA 2VK8A 3GFVA 4B8ZA 1VTKA 3U4MA 3A28A 3DR3A 5C7YA 1C4KA 4Q4CA 1GGEA 3LSTA 5DYIA 2XXAA 4GT1A 5DN6A 3I8SA 4RA6A 3VHRA 1PV4A 4NV3A 4AB1A 3BWEA 1ADYA 3LP8A 3O8RA 4YUWA 4OSOA 3F4LA 1AE1A 2CBXA 2CFCA 1P31A 3WP1B 3IUMA 2QXUA 3UA3A 3FSRA 1E4EA 1RKVA 1G63A 1M2KA 4AJHA 3AUYA 5HJEA 1KORA 1XRRA 3K0KA 3ROTA 3T7TA 4M60A 4QLOA 3ZJ5A 4EJSC 1AA9A 3LT0A 4Z1OA 5DBEX 2Z6UA 3NM4A 5F7JA 1Z2EA 1EGAA 4YJHA 5J2UB 3FWZA 4PLTA 2FZCA 5KDDA 1C7RA 4X65B 3GRRA 4X7BA 3FNEA 4PO3X 4OVKA 4QYIB 4Y2RA 1DC8A 2C03A 3B9RA 3R6TA 5HF8A 5A06A 1GTSA 1BGVA 4JFRA 4TWJA 3UIEA 5THQA 4U2FA 3NIBA 4BVEA 2YMMA 3S8YA 2D2VA 1TTQB 3D6NB 2G28A 2FKNA 3PHJA 3Q3IA 1YHZA 3BXFA 1JR6A 1JQ5A 3U62A 1LX6A 1SFRA 2N75A 1MX9A 4IXWA 2Q1XA 3GYGA 4YV7A 5A5DA 2POQX 3I8XA 3NBMA 4YRJA 2QYHA 4N65A 3SZGA 4BNDA 4MRPA 4AZ3B 4JI5B 4ARVA 1J2RA 4LNHA 3NNDA 2K6GA 2XPCA 3OPQA 1TRHA 2FHSA 3X43A 2Q0XA 3VFDA 1I24A 2MYUA 1XHLA 2LRHA 3ID6C 4X8OA 2OZLA 1W85B 2GAFA 4M0CA 3TI7A 5EHQA 5L40A 3CR3C 4ZPXA 2OM6A 4OMDA 1O8CA 3EAFA 4ZAFA 5BV1A 1Z0AA 3BGIA 1GXSB 5FFMA 1MHTA 1ULHA 4UVIA 4B7ZA 4RVDA 3EHDA 4DV4B 1Z9BA 4BZQA 3GEPA 5GGYA 3N0TA 2HMSA 5SV2A 2M6RA 1RPZA 1Z0IA 2IU6A 1ENPA 5B12A 2YV2A 1JDTA 3W8FA 5K3AA 1C81A 5BYKA 5J1SB 4KQ6A 4WNAA 3AOEC 1NBME 1RIIA 2AN1A 3J80A 2X19A 4QYXA 4DCUA 2P5SA 2QUAA 3N8NA 4NHOA 3RDPA 3BIJA 1DCTA 1TOAA 3VR5A 4BAZA 4P7JA 2V6IA 4OAPA 2AZXA 1T3SA 4RX1A 3OCWA 4MYRA 3NW9A 3WHLA 1IY1A 3UUGA 3QFHA 1ZW6A 1G5TA 4RGBA 1YZNA 2BKEA 2YNMA 3BBLA 3HH8A 4UE3S 4Y3UA 1VP3A 4QEDA 2OUIA 1NOJA 1NQWA 3C14C 1QYXA 1FLNA 2JH9A 3AYZB 2X3UA 3UAWA 2DXIA 4D25A 1QO7A 1RE0A 1VLQA 2XE8A 2VHEA 5GWXA 4LECA 4L76A 4FGLA 1QG4A 3U3DA 1VZ3A 3FHCB 4AZ0A 2OILA 2H1OA 3T3GA 2DLCX 2ZR0A 1PZNA 4XQ0A 4QSHA 3N2IA 1KJ8A 5FFFA 4DNOA 1NHGA 3R3WA 1RYHA 1XR3A 1PWXA 1RBQA 1VHTA 3O0TA 4QLBA 1K0UA 1SJ9A 4LRWA 3ZDCA 5DTIA 1RHUA 3KD2A 4ER3A 4RV5A 1K0FA 2A59A 1Y7LA 3FYTA 1W93A 1SOMA 5D86A 5DCUA 4P6VF 1WW8A 2VDVE 3KBBA 1CUAA 2O8FA 1EX1A 2DG2A 4RV9A 5A3RA 1K8RA 1PK9A 2VHQA 2WTAA 3A31A 2PUVA 3DWEX 1SXJB 4MULA 5TRTA 3T3IA 3BT7A 5CYPA 2B69A 4XIYA 4B4DA 3BZUA 4FOPA 3IT2A 1M8FA 1DQNA 1FSZA 3V8MA 3RT9A 1CUVA 3BOSA 5KWEA 3MQFA 2WFLB 2JAWA 3UMMA 2QRPA 2WVAA 3PGMA 5HQJA 2VS1A 4OK3A 5LQAA 3AMVA 1NG9A 3K0CA 4IFBA 4KP7A 4MIKA 4GPAA 2R97A 3O03A 2V55B 3GLSA 1OA0A 1CVLA 3DZDA 3F0TA 3PF9A 1X1TA 3B12A 4A8JC 5AVRA 4QUIA 5ITZB 3IEMA 1UXHA 5DX0A 3IULA 2EKBA 2F62A 1ISFA 3CRVA 2VFAA 4Q1BA 4TV9A 1KARA 3G2PA 3VGJA 4CMIA 5KCZA 2VPZA 1XZDA 1NOKA 2WPNA 1JECA 3DE1X 2H08A 3OUTA 2W5UA 2CMKA 2SHKA 4Q34A 1AK1A 1GZ5A 4C9BA 1NATA 2FN3A 3DFKA 1HZJA 2AKEA 2GCPA 2HDWA 5EY5B 1LTQA 4S05A 2WM9B 2D6FA 4I4LA 2GM3A 2QS9A 4I46A 1GUBA 3HB5X 4K40A 1JV2B 4WMLA 4WWHA 4DM3A 4F46A 4OP3A 4YA6A 1TADA 1ZIDA 2OKCA 2H7YA 5U4QA 1O97C 3PENA 1TZJA 2BCGY 1E5LA 1NSYA 1X9GA 3BEOA 1TE2A 3D3EA 4TRRA 1L5SA 3OQVA 2H9AA 3G2KA 2RAPA 1GRRA 4G0XA 3HR4A 2O2GA 1QHHB 5ETJA 2DFTA 3ZS8A 2I5PO 4YASA 3HKDA 3W3AA 4RZHA 3RYTC 3ZCVA 5KC8A 2PGDA 5ICGA 1SKYE 1VM6A 3AR6A 3G5AA 2O2JA 4B81A 1DXOA 4FLMA 2DLNA 5CEJA 1C29B 2ZITA 3QI7A 3B5EA 1GZ4A 4IW3B 2NSJA 1U99A 1RLIA 3N2LA 2AEMA 3OQHA 5TLSA 3PFWO 4MUKA 4C1NA 4F5ZA 1EGMB 5EIHA 3QLVA 2VPTA 1PFYA 2KBFA 3ZE6A 1T3ZA 4CM4A 2HQBA 4ESEA 2JJ2D 3H1GA 1E4YA 3WA7A 1DSSG 1KY3A 1D6MA 1FRFS 2JZNA 3NHBA 5IFLA 4UAUA 3GCZA 4KBFA 4URWR 3TAUA 1IXKA 1EVLA 3PS9A 3F74A 1KZ6A 3BQMB 4MUAA 1RI4A 3N2KA 1G9XA 4DPKA 3R6LA 3TZKA 1Q0UA 3TLZA 4RTLA 5EIEA 1JG3A 1Q91A 1HG1A 1VB5A 3NRJA 4AIIA 4BJ5A 4KMSA 5K6TA 5KKAA 2O8EA 1QFXA 2ZYVX 2H7CA 4JOBA 4LJ6A 4CV2A 3IUYA 3IILA 3TQRA 3GJ5A 3VO2A 4C3VA 5HKOA 1CQJA 2JI9A 5ALLA 1ZHFA 4QU8A 2YYSA 4JI0B 3LQ1A 3TLCA 3NHKA 4QBTA 4MYCA 1XPOA 1MOZA 3RYCB 1RM4A 4CODB 5EHNA 2QMOA 5KTOA 2ZU6A 3KKQA 3R77A 4HVTA 3A6FA 3D1LA 3PRKE 4XJXA 3S1LA 4CIAA 3N5CA 4C4XA 4L0QA 3GFFA 2VQFB 3KSRA 3TW8B 1SZCA 3FKSA 4JBNA 4DA0A 5HW0A 3L02A 3KTAB 1G18A 4W7HA 3NTXA 5LA6A 2IRWA 3CNOA 1X2EA 1E8DA 2XZOA 2G08A 3DZIA 4FIZA 2H4XA 4R9NA 1ZDMA 1LJLA 2P68A 5IT4A 3HY6A 3LKBA 3O0DA 1HMPA 1ODLA 1P0MA 3AONB 2XEDA 2NU8A 3N2GA 3WGLA 3O1HB 3AL0C 1X1SA 1IN1A 3JWEA 3IIKA 5KSWB 3TLJA 1VCMA 5IULC 3T3OA 1RZRA 3V7UA 1PNVA 3D31A 2WOOA 1FJ2A 1FW8A 4ZTBA 3OFNA 4YDSA 2OAGA 1SUFA 2AOWA 2Z56A 2LGJA 5M5BA 1TUGA 4YPOA 4P81A 1NVMB 2HSJA 3CHYA 4L78A 1XXHE 3AEZA 3NTOA 3LBHA 4I2VA 4KSCA 5EWLB 1OY1A 5DRYA 3SIPA 2VUSA 4M7WA 4ETIA 1TYCA 3EISA 3I9LA 4R1SA 2FOLA 3SEFA 3PKJA 3PC6A 4GX2A 5FI5A 1JE0A 2WYHA 5F77A 4RENA 2OKGA 3TVTA 2QL9A 1PO7A 1HRKA 2Q45A 4MV5A 1QRTA 1NXPA 1YS2X 3DTVB 3HCWA 4B8YA 3Q8MA 3M4JA 5IEBA 1YL6A 4F71A 2UUOA 9LDBA 3P2OA 4BFXA 1ENOA 1IZ7A 2HCRA 3F97A 1XIVA 1IBCA 1NJ6A 1NXVA 3OY2A 4HB4A 4X71A 4BNJA 4CEJA 3MGKA 1TQHA 2RHDA 3WB0A 4PG4A 4P3OA 3NPAA 1O08A 2CE2X 1A95A 3KVVA 4PXAA 4DLTA 1H1LB 3QE4A 4I1YA 1HDCA 1CJTC 1JQLB 5JD5A 1L4UA 3C16C 4X93A 1BG6A 2G9RA 2H29A 1PJTA 3TLYA 3VR2A 4OXNA 2O8DB 1IN5A 2QX4A 3RYCA 1J25A 2UXDB 5JSZA 5KYKA 1SKMA 1ZVJA 3B1YA 4IHKA 3CLRD 5L3QB 4PLPA 4HWOA 4JITA 3FPJA 3A2KA 2P1ZA 1JE1A 1U3GA 2OQVA 4RSRA 1VKRA 4UM9B 2YBEA 2ZTMA 3RVLA 5K09A 1J8QA 4DV3B 4HN9A 2KW5A 1JDSA 3E0QA 2DY0A 5J4HA 3T0IA 4FW9A 2HK8A 4AFNA 3AY3A 1TQDA 3MHTA 3H4VA 2QT0A 1X7HA 4CV3A 2C2KA 4GHWA 1U3WA 2VP6A 1WCXA 1DGQA 2MCFA 2V97A 2C82A 2AR7A 4FR5A 1BGXT 1T6BY 1P44A 3PQ8A 4ZVOA 2J6CA 4F3NA 3P9QA 3UKJA 3B78A 3FGNA 8ATCA 1OV4A 3MT9A 3MPOA 2VUTA 3EFEA 4WOJA 5A0VA 1UDXA 1YQXA 3H9GA 4BU1A 1OI7A 4LZWA 1A3CA 4DCTA 1ZICA 2JIOA 3AW9A 4F12A 3ZZTA 4EL0A 4ZVSA 2H00A 1E62A 2XGOA 4CCYB 2YN0A 5LP6F 3THWA 5A2QA 4RE5A 3REGA 2FEXA 3KSBC 3N8KA 4JB0A 4OBBA 4L0DA 3M9WA 4MW7A 1EIWA 3RFUA 4ZK2A 2ODWA 3MCUA 2WFMA 3H5OA 3IJEB 3UXYA 2R9VA 3CSUA 5K3EA 1OH5A 5AKKA 4QNMA 1XVAA 2Y93A 3ITNA 1ULBA 3LL7A 3NBUA 2XADA 4N7MA 4RELA 5B1SA 3K6RA 1ZN7A 1L5YA 2RHMA 1Y9JA 4ND8B 1OROA 3H8WA 4E6PA 5DLYA 2W4MA 3D5QA 5GPBA 4X63A 4B9EA 4OHMA 1XKLA 2I6SA 4RTJA 1T9BA 4JJ6A 1H5QA 4TV9B 3WWDA 3UMRA 1BGWA 1ZCFA 2BTQB 3L0SA 4JEMA 3LGXA 3V8PA 3WJ1A 3ZHYA 1XTKA 3PQ7A 1XDBA 2EJWA 1RAEA 4FHZA 4MUIA 5BQPA 4YAJA 5PNTA 3RIEA 5EQJB 4EB6B 1D4OA 3ILXA 4EUFA 1EUYA 1FFBA 1U2GC 3EQ2A 1R15A 3WSWA 3EIHA 2PRYA 3PYLA 4D9NA 1HTBA 3IRUA 3KYIB 3QA3E 2GQ0A 4ITUA 4KRYA 1F1BA 3RFVA 4LVOA 3WDLA 4HNAB 3E5HA 1VI5A 4WIAA 2RHBA 2QA5A 5I7HA 5CFMA 2ATCA 3S2IA 2G04A 3CRNA 1EVZA 1SOUA 1TZBA 1EDOA 3HVUA 4F11A 3IOCA 4JVOA 3WZ2A 1M2OB 1CJCA 2PYDA 3GUHA 3NWBA 3KR2A 1Q0SA 2VAMA 2Q2VA 3NC4A 4JP3A 4ND2A 4RJLA 5FTWA 1GKIA 4OHCA 5B2FA 4D9FA 4LDPA 4MA5A 3D6FA 4Q1FA 4HDMA 2F1RA 5JFGA 1VQ1A 2WZDA 4MQEB 4ALIA 3VKGA 3QU2A 4LFBB 5FXMA 2X8JA 1C9EA 1JU3A 5BV2P 2FZLA 3B51X 3GMIA 2GK3A 1ONBA 4CM4B 3T52A 4D7AA 4PZUA 3EVNA 3KOYA 3Q2IA 1Z82A 4GL4A 4A2WA 4J4TA 2IHNA 1SCAA 2XNSA 1EHIA 1BH6A 1D7AA 2XDAA 2VP4A 3G9XA 2O2EA 3CX7A 3L46A 2XJ9A 4HS9A 2WP8J 2G70A 2RHJA 1I1OA 4AMVA 4QZVA 5K3BA 2GLTA 3K5PA 1YQTA 4F8JA 5IWCA 2C9CA 4IMJB 3GUUA 1FB5A 3AM4A 1PEDA 2HA0A 4YV1A 2CNOA 3ZWVA 3O3MB 4Q00A 1TAQA 1VGQA 4XGKA 3ZCTA 2WJHA 3VAZA 4DJTA 1XPJA 2JFFA 5AVVA 1WSWA 5C81A 1ZIYA 2HK9A 4GS5A 1U80A 2JFXA 4I5DA 5K0FA 4JJZA 4EFMA 2WSSA 2ZBUA 3EVZA 4NG5A 5M3BA 3S81A 4BAGA 1WSAA 3L0BA 4I9GA 4BWGA 2YOGA 5AK5A 4B8WA 3ZYZA 2NVUB 2BE9A 4CNQA 2C3YA 1QRRA 3D8HA 3HV2A 4NI5A 5G0TA 4AS2A 2EW1A 2BHNA 2C00A 3GN2A 3INRA 1P8JA 3CF2A 3P45A 4Y2YA 5L95A 5COBA 3ZQJA 3SS9X 2SICE 3SKVA 3ZHSA 3SNHA 3NBFA 1H2HA 2PBZA 3DYIA 5BR7A 4PX5A 2HFJA 4WINA 2CL6X 2GVDC 3JPWA 1Q95A 1DUVG 2I7CA 5E38A 3I6ZA 2J45A 4PPFA 2W6IA 2CFRA 3R7WA 3HJAA 3RSGA 3RSOA 4LRUA 4YALA 4MPPA 5IX8A 3IP5A 5LWQA 3KQNA 4Q9AA 1N5IA 3EZXA 1R9JA 4PFSA 4TT8A 4MKZA 4YRGA 3CISA 2FPGA 4DVGA 3MS2A 4YACA 4RJTA 4LEIA 5CB4F 2PKCA 3BMCA 4KX5A 4NU8X 4HYTA 4B17A 4FT4A 3P8ZA 5TR9A 3K8QA 1RCUA 3USCS 2WFAA 2OWEA 3LZ6A 4BYGA 4KAJA 2W2LD 5L3QA 3P2IA 2RJ3A 3FM9A 1N2BA 3MWDA 3SXPA 5AKEA 4BO5A 3F73A 1K3UB 3LW8A 4PONA 1SXJA 1V4BA 1H8ED 5DGIA 4JYCA 4K03A 4YN3A 3JQAA 1FTYA 5HCNA 1Y6JA 2IITA 2HEGA 3DNPA 3OA2A 4YJ3B 3ZBQA 4DHWA 1V5EA 3FPFA 3SBDA 1X8XA 4V02A 4ESVA 1CEEA 3CE6A 1ZEJA 1RPJA 2FCRA 2G1KA 3SXUB 5LQCA 1SZPA 1SB8A 4KLAA 2IZ7A 2P5TB 2H2DA 4MLPA 1Q3KA 2Q99A 2WHEA 4L15A 4Q9HA 2ZS7A 3C3BA 5T57A 3OHMA 1XFDA 2FAXA 4JFAA 5EA2A 3TINA 5DYNA 3OT1A 4I8XA 4X91A 1QZ3A 4RSGA 4Y2XA 4DYDA 3Q6MA 2FJ0A 4XWWA 3QF4A 4FR0A 4EYQA 4MVJA 2HDOA 2QW0X 3JAKB 5D84A 3KUDA 1AQUA 4HGZA 1VI6A 1MJHA 1SKAA 4JBLA 1ODCA 4DMFA 1SOVA 2JJMA 3BB4A 3E03A 3UICA 4HH0A 3B5IA 2WIBA 4IIYA 1CIPA 4I9NA 3PD1A 1HE3A 2WE8A 5ITWA 3SFVA 4E5KA 3URMA 1OC2A 1I51A 1SBIA 2GEKA 5C8XA 2YV1A 2VJKA 3WIOA 3JYLA 1LPBB 4DADA 2O8CB 1UBLS 4CUKA 1FFWA 3MWYW 1X1EA 1G8AA 2YHIB 2ZUCA 3FCYA 3OESA 4RPIA 2O59A 4DNQA 1FMCA 1U2EA 4LS3A 3TZ6A 2H2AA 1PHPA 3G2NA 1SG6A 1IN8A 1GLGA 1Z6AA 3OZSA 1DLJA 1PDVA 2ZUSA 3D7RA 4W9RA 5J5CA 5AUPB 4KRXA 5T6BA 5BPFA 1OTXA 2I78A 4XIIA 4C89A 2QM7A 5IDWA 2WHPA 4R1QA 5CT6A 2P2DA 2HMYB 1D6JA 1G7CA 2AI1A 2B3TA 5JXJA 4P54A 4JI4B 3K2EA 5TGDA 2PVPA 3K4HA 5JVDF 4YP1A 3NONA 4OBWA 4RESA 2HBZA 1XEWY 1SH7A 3DUWA 3IVMA 3MSCA 4MMXB 5ANRB 4U5QA 5AFSA 4FVTA 5E0KB 1LH0A 4E7OA 3IGFA 5ITSA 2C92A 1KDZA 4LW8A 1V39A 3CF6R 4EWLA 2OXIA 1E6WA 4PLZA 4C78A 2ET6A 4AS1A 3GH3A 4BE4A 3I0NA 3W8DA 3O9MA 3LBNA 1AHIA 4W9MC 1EAMA 2XNDD 4DYHA 1OBHA 1U11A 2P5YA 4BWYA 5KNBD 2JHCA 2GVZC 3DFIA 3V1UA 1K86A 3JQBA 1UWCA 4RLQA 1PL6A 3I2HA 3DEHA 3NNSA 3AJRA 2DULA 2EZ4A 3TE7A 4GPIB 3BKXA 3CUUA 3ACBA 2CLFB 4U7HA 2AV6A 4LY6A 2X8JB 5JWHA 4CBVA 1M2NA 2OC9A 2R4QA 3H19A 3VKUA 2VHTA 3SOPA 1JSZA 1TCBA 5GQSA 5AUQA 2WILA 2OHIA 3BD6A 2FDRA 1U3FA 3I5MA 4X6LA 4BFTA 3G5TA 3MWFA 3IYLW 5B3LA 1E7RA 3M34A 2EX4A 2X1MA 1YQ9A 2QIOA 3H2BA 4H4CA 1PLKA 4LQCA 4OXRA 4RQBA 2C2XA 1I6KA 1WWKA 4OUKX 1TEVA 4J7AA 2GCNA 2BI8A 2GKSA 4YP6A 5LYJB 3VC1A 3B6KA 1OLXB 3JVDA 3N7TA 5J1TB 3I05A 2GJKA 2PGAA 1UBEA 3KYJB 1NLYA 2BLNA 1WAMA 3QVUA 3BE6A 4G24A 4J7CA 3TD2A 4BLTA 1MO6A 4BQNA 6ABPA 2OHJA 1WU7A 3EQ9A 2G76A 2PGJA 3DBLA 4OB6A 1KIFA 1UJCA 4WCFC 3SZLA 1PT9A 4V3CA 1RQRA 2XOKA 3KXDA 3RAPR 5LMNB 4RZ2A 4TMZA 3O7WA 2NU7A 4MR8B 1VG8A 1KP3A 1GTMA 4X1KA 1Z0JA 4ACBA 2EP7A 2HQSA 2IEIA 4FEGA 2XIJA 4L8WB 1I6WA 3NP9A 1DKNA 4YJDA 5GM1A 3MUNA 1D1SA 1U81A 3IPRA 4N5DA 2SCUA 3W9SA 3WK7A 4ZHQF 5CDHA 5LJIA 4RTOA 1NTOA 1LD3A 1MKYA 4LE0A 5DFAA 1SIOA 5TF0A 1NQXA 4ETWA 3MWGA 4HQNA 2FRXA 5ENZA 3HJNA 3WLPA 4N4AA 1NN3A 3VX3A 1TQ2A 1TZ2A 1ZOIA 1WSBA 3GUZA 5DGDA 5HUJA 3W7VA 4QX6A 1N6KA 2F6RA 4MSUA 2YJTD 3ICWA 3SYKA 2XDWA 3DF9A 2FE1A 2LW7A 4ZICA 1UBMS 3SEAA 2Z08A 3WSVA 4TYYA 3L1VA 2R6AA 4I5EA 4O63O 2EOAA 4RK1A 5G1OA 1WS6A 3H9CA 1I6MA 1QGED 2BJVA 3RVDA 5IM4A 1H4VB 2JD1A 2PVCA 5JH7B 4QUHA 3QV1A 1D0IA 1GLNA 1T1EA 1L9XA 5AP9A 5LBTA 4EJ2A 3AW8A 3A6EA 1CNFA 2OPBA 4U7WA 3UUFA 1JB9A 4IL5A 4P33A 4YUXA 1BCSB 4OAQA 1UXOA 1ADCA 1C3VA 1GFWA 3VPCA 4M55A 4WLEA 4PQFA 2IXBA 1AUXA 1DIRA 2IZ6A 2QTHA 3BDIA 3LDFA 4F1WA 5I9NA 5M7EA 3HA2A 3TGPA 3MOSA 3TJMA 3F96A 3PUVA 2W0SA 4XX1A 4WESA 4PX2A 3WIBA 1VPWA 1JDUA 2JKYA 3EEQA 5CCBA 1JAIA 2ZB2A 1NFFA 4FFRA 1XWIA 1O87A 1GAEO 1ZITA 3F67A 4A23A 3KQLA 4RFSB 5L4NA 2C0CA 2V74B 4EF5A 1YR7A 1PJQA 2CXOA 4D74A 4GQBA 2OZEA 4RCVA 1DX6A 3OCUA 4JASB 4LWOA 2QMQA 2UVDA 2CHUA 3DUFA 5CGQB 1T13A 1J09A 3DV0A 3HCBA 5AXDA 5HF6A 2DF8A 3T0FA 3WK6A 4YIHA 4AKIA 3IAAA 2BEVA 4TWZA 5IUKC 4WOKA 2WG2A 4X20B 2PA0A 3UJ9A 1YKGA 4QOEA 4Y2VA 3EVGA 3IVAA 1MJGM 1GJRA 4BQPA 4MP8A 2AVNA 3EC7A 4OHPA 4M0DA 1ISPA 1SXPA 3HUEA 4BQSA 2KLBA 5LZ4A 2HFKA 2G9QA 2YN4A 3AFMA 1RXCA 1UWLA 3DE5X 4AJIA 1G19A 1ORWA 1WQ4A 2V7QD 4PW0A 5ALXA 2AXNA 2ZI7A 5SYMA 4E13A 4E0BA 3SHQA 1G20B 2WABA 4Q21A 3X1ZA 4QPZA 5IYZB 1GAJA 1L5GB 2Q4RA 1O9GA 2B99A 4GE0A 5KSYA 3R75A 4TMTA 4IXDA 5TT0A 1ZKMA 1HDOA 2ACWA 2BGLA 3GVIA 2Q0QA 4J0JA 1Q6YA 2YWFA 1BWPA 3SSAA 3CT4A 3M5CA 1C0LA 3PGA1 4BVLA 1MB3A 2WPDA 4OLFA 3RUDA 1TDJA 3QOYA 4BVFA 2V8BA 2GN2A 1DKPA 2YZKA 4KE9A 2FP3A 4L75A 3EC1A 3BF8A 2VF8A 3P0IA 4KI7A 2E4AA 5EEHA 5G1NA 5DHTA 4F7WA 2YZGA 3O4VA 1QFYA 3OOEA 3A1EA 3THSA 1B8OA 2A58A 4WY2A 3LKDA 3LXMA 4Q18A 3W8RA 3FBWA 3NS7A 1Y9ZA 1CU1A 2R44A 4K6FA 2W2NA 4ARZA 2J41A 5B3JC 2OECA 2B2CA 4CLHA 2DM6A 1IPEA 4U6SA 1D09A 1W96A 4UEQA 4QM7A 1DTSA 2QX9A 1J2UA 3DD1A 1XZIA 1DBWA 1KYZA 2QU7A 3C87A 2XDQA 5C32A 1EWQA 1NUQA 5JBNA 1F8GA 1V3UA 3I2FA 1I36A 4Z1MA 3GFOA 3TTUA 4TMYA 4YXWA 3OQMA 3T5MA 4BO3A 3MOIA 1YO6A 1OBOA 5FR1A 5JEDA 1AK2A 2WU3A 3CS3A 3CVWA 4HP8A 3AVYA 3ITEA 1YRQA 4ALNA 4BLPA 4C0WA 3SZRA 4EUNA 3DEIA 1U2TA 2EKZA 2FZ4A 4BFLA 5IF3A 5JMWA 4MGZR 4KO8A 2DYKA 4MK4A 4YCBA 2CNKA 1NKSA 2X9LA 2H52A 3H2YA 4CUZA 4QDOA 1D5CA 1WE2A 3FHTA 4J0DA 4MLDA 3OZXA 1H2AS 2B1RA 3TEJA 2NO9A 2BJWA 4CVNA 4INJA 3RIMA 2R7KA 3A6JA 2OORA 3A26A 3AEUB 4BTVA 1R6TA 3PFIA 1XU9A 3B6EA 4IUBS 4KIFA 3IMCA 3CH4B 4HQFA 3VUEA 3PTZA 4LXHA 1W94A 1V4VA 4R1OA 1FE8A 2XA1A 3EB9A 1SVMA 2VNJA 4Y2QA 4ZQHA 5LOVB 2O0LA 3GJRA 3L79A 3OKFA 3EDYA 1PZFA 1XZEA 3L41A 5CA0F 2PUJA 3RO7A 1N9KA 2FN8A 4LRXA 2P3QA 1S9DA 4IZIA 5LL6P 2RSLA 1QWOA 1NJ2A 2HWUA 1VHWA 4NU6A 1B0AA 2H4YA 2IYLD 2QVYX 3E9NA 4X95A 4BNUA 2YDYA 2CNWD 2JJ8A 4PHCA 2GJ9A 2UZ0A 3S4YA 5CB6A 1RRPA 3ER8A 4MVJM 4RHFA 1NQTA 4G8BA 3MMXA 3MYYA 3KLMX 1T6XA 1PJLA 1YULA 3PJEA 1IIBA 1L8AA 1XRSB 3C70A 3P71T 2BW0A 2P4HX 4OLHA 3TXAA 2Q5IA 3H9QA 4B2PA 1SVLA 4JKYA 4DTCA 3LU1A 3O75A 4PG7A 3QTLA 2R25B 1YZHA 2KX7A 1N92A 2VDRB 3F6CA 1PGOA 3IMEA 1R6AA 4B3XA 5LIPA 1IMJA 1XV5A 2CVZA 4MYDA 2OLJA 2BSQA 4NENA 4RDHA 4F8YA 1WLSA 1NT4A 5ALJA 1MU0A 2NZYA 4FNMA 4V3BA 3S44A 5JIBA 5BNWA 4OG2A 1JAHA 1KA9H 1K98A 1Z39A 3KLBA 4KR7A 5K0NA 3X2FA 2A0YA 3ORYA 1HE8B 1LRKA 4G1CA 1Q0LA 4D3FA 4HAZA 1Q19A 5IJAA 3B7WA 1Q0TA 4QGBA 1I7PA 1RBZA 2ODTX 4M88A 1SBYA 4M1KA 4ESHA 4JI2B 3ILHA 4CM8B 2C7QA 4X5OA 3CY6A 3H2GA 1MFZA 3CRMA 4RH3A 4A5SA 2XJ4A 2GESA 4JBWA 3P0HA 3DG9A 1QZUA 4L5YA 4PSDA 2Q2OA 4WXHA 3TKYA 4DR5B 2H4HA 4U7FA 3S2SA 3ZE7A 1ZUNB 1VYUA 4NYIR 3M81A 1HQKA 3FIJA 3JRWA 4QTUB 4Y30A 2P7IA 4PQRA 1BW9B 4F9EA 1M1YA 2ORYA 2R5FA 3D2CA 4Y2TA 3QIVA 3UF0A 1R4ZA 3NAZA 3NIGB 1GVNB 5EN4A 4L9RA 4C29A 2QDXA 2JS7A 2ZBVA 2QN6A 3LZCA 4E5SA 5KJCA 4FKMA 4KSBA 2MT9A 3HN7A 1RWOA 3WIEA 4EG1A 3N3AC 1V43A 3SR0A 1GVHA 5C52B 4M8NE 2WHRA 3NXSA 1A8HA 1BFDA 1SBZA 2VJMA 5DBGA 5KYWB 3L7CA 2DE0X 5DBFA 3A7EA 5I6DA 3LWZA 2HT6A 3FF1A 1X7ZA 5JEEA 1DE0A 4L4ZA 1M8JA 1PQPA 2WI8A 2X2OA 5B4TA 1GTRA 4FHGA 2F4NA 2RGAA 2RI0A 3RUAA 3LDGA 4R8RA 1PNOA 3ORQA 1H8HD 1CP2A 1M6VB 1XTRA 4Q4HA 3L6UA 4MQLA 2NUAA 1Q2UA 4NSNA 1E3EA 1GADO 3ENZA 3DT9A 2G67A 1W4AA 3EXFB 2VYFA 2ZM5A 1I2CA 5HJ7A 1HFKA 3PRJA 2FDCA 1LJUA 5JQGA 3RRBA 3KSZO 1QANA 2HSZA 2WU0A 4BN5A 5C80A 3O8CA 1Y5LA 4C4YA 2CHGA 3LA8A 1IG3A 2NVOA 4G8JA 4U39A 3BXPA 1W2HA 4EUKA 2VI5A 3L2OB 2AYZA 2CNBA 1OFTA 3ZOZA 4Z4HA 5JALA 4NYJR 1MPTA 4G0YA 5H59A 3TW0A 3QPAA 5K0CA 1E9FA 4DGSA 2YFYA 3HSKA 3HDYA 3DKKA 1UWVA 1JVSA 1SBCA 4DDHA 4CKBA 5GADl 3JYNA 3KJZA 4HGNA 4YT5A 5CT8A 2DETA 1YDEA 2J4FA 1JX6A 1PLJA 2XSZD 4R1NA 2D1YA 2LIVA 2E18A 2PS1A 5CTJA 5EXEA 2R4TA 1I13A 2AS0A 3KC2A 3IKTA 2V7BA 3H65A 2DH6A 3I1FA 2Q2NA 2PX4A 5JUWA 4F5WA 3MJHA 4PZ0A 2IEYA 2VYNA 4I81A 1DTWB 1E96A 2CSUA 3VDMA 3JQ9C 3OIDA 2JATA 4AO8A 1NBAA 1W2WB 1Y63A 3AI1A 1JEYA 2G07A 2IV2X 1L5HA 4YO8A 3AY7A 5FLXA 4P92A 3RASA 2X4GA 3ZCUA 5EZYF 4RD2A 4BFYA 1JHOA 3OWOA 3VZDA 3DKRA 4H1HA 2H48A 4Y6SA 3I2GA 1QLJA 2VOJA 3RQIA 4BNIA 3AV3A 2I6XA 3BC1A 2YH2A 1DV1A 1EXNA 3A6DA 3LIIA 3FSJX 4HAVA 3IODA 1ADGA 2ZYUX 2Y1KA 3QU7A 5DSTA 1EWYA 2O3RA 4IIJA 3HWX1 3BGDA 4HAIA 1XELA 4HO1X 1HR0B 4JC4A 5T3UA 5JT1A 3T38A 5BNTA 3X2EA 2PSDA 3SHVA 4B4VA 4F4UA 3GLFB 3FDZB 2VK2A 1W9MA 3D7MA 3OU6A 4TM8A 2IY7A 2C2ZA 3LLCA 3TDKA 1K5GA 5I7RA 5KYTA 3NHJA 4C08A 3ZNQA 5SYNA 4J16C 1V9CA 3JVIA 3SSNA 4IOJA 3OZGA 3SJ7A 3T15A 5F98A 4CDGA 3QWIA 5EJMA 1LVHA 3BD7A 4ENWA 5BRNA 4BMDA 3E81A 5E95A 1NI5A 4LNUB 4N39A 3KHSA 3ZR4B 1C1YA 4D9JA 2XZTA 1W4BA 1JJ7A 4ZCSA 1P5ZB 1R64A 1VL6A 3D7NA 3SIXA 3WGJA 5JJCA 5KX5B 3EARA 2BONA 1P1RA 2VDJA 1C3OA 2C8LA 1AB5A 5AJTA 2IV3A 3SQDA 3WLLA 1YOVB 1FMLA 4NZ9A 2WR8A 4P7BA 1OFIA 2DJ5A 2J07A 4PYKA 4ZQBA 1ARZA 2HWXA 4GPD1 5DTQA 5J5AA 3KQKA 4KWTA 4LIPD 1MABA 4DXDA 3V4LA 3LE8A 3M83A 1ADBA 3HHPA 1F6WA 2PD3A 4IXTA 2A6PA 4BFCA 2I03A 4XB2A 1XA4A 1JNYA 2LE0A 1EFPB 4XFKA 2VHWA 1T6NA 5J43A 5KTYA 3E8XA 2ZYRA 5FT9A 4B2YA 1KVQA 3MTQA 5F2OA 3Q9NA 2V6MA 3A9UA 4NYJQ 5DMXA 3QH4A 2IYOA 5TPWA 2ISQA 2IYWA 2ZG6A 1GP2A 3CG4A 3F9CA 3GL9A 5THXA 3TNJA 2HMUA 2WKWA 2WMDA 3IC5A 3KELA 5FP0A 4PYIA 1ZGBA 2C8JA 3C45A 3USES 3VX4A 2EZUA 1E32A 3KR1A 1BD3A 1NXXA 4EOGA 1C9JA 2YVAA 3V33A 1K5PA 3N70A 5AKLA 3PCTA 3F4BA 3N2KB 4RFSA 3TZQA 5F9MA 3BREA 2C9OA 1L4MA 3A05A 3DOJA 3WGYA 4E2FA 2H1LA 4D9BA 3T1HB 2VKQA 3ZV3A 1EH5A 4H31A 3IB6A 2GXQA 4PRYA 2E7ZA 4QGHA 5KKCA 4XJVA 4ZYTA 4X1YA 3AI2A 1M72A 1SUCA 4UQOA 2PK3A 4ZAVA 4COKA 1M34B 4G4SO 3CPSA 2UKDA 4K26A 4X8MA 2WFLA 2AXPA 3GGOA 3KR0A 4PLCA 3STVA 2RBEA 1GPJA 1BU5A 3V4PB 5JSZB 5L6LB 1QP7A 2Q27A 1A4XA 1HO3A 2P79A 1KL7A 3FB1A 4YJ3F 4J0FA 3CVJA 4W9NA 1LNSA 3M2PA 3ZBPA 3ZIAA 1ZCAA 1KY5A 4NCKA 4F4JA 2XOKD 1S2LA 2EHJA 3R0IA 1YNSA 3NALA 2CLCX 3RS3A 2YV3A 1C9MA 2WSIA 3IR5A 1V1RA 4LDAA 2Y6UA 4AUMA 4QQFA 2Y1GA 3DVSX 1L5NA 1CB0A 4MB6A 2PX2A 4HTAA 5EUCA 1FXWF 4HAUA 3JQQA 3QUBA 5E3HA 5FF9A 3QJGA 3I76A 5FTMA 4JELA 4F4IA 1EHYA 3RYHB 1XF1A 2ZTHA 3ED1A 2DQKA 3ETJA 4JJGA 2XB6A 3WIUA 3VJKA 1BE6A 1IJEA 1L6RA 3AF5A 4J3FA 4EKIA 3FKQA 1MQAA 4FP9A 1FLDA 2DHCA 1MOSA 1X0VA 4MIOA 4A9AA 3BERA 2PX3A 5DTJA 2H1CA 3X1YA 4YTEA 2VSNA 4KWIA 3VBEA 4OH1A 3AHFA 1ATIA 2W2TA 5FA5A 2WIKA 3WLIA 4E3WA 1EUZA 2GN8A 2GPTA 2PIDA 3PFGA 1TRKA 1TCCA 2BBSA 2IGBA 4WXEA 7AT1A 5A3QA 2QRUA 2J7PA 4JOCA 5KQSA 4BX3A 3C6YA 4P82A 2HLHA 1Y8ZA 2D7JA 2C2OA 3ETNA 3PQ6A 1A1SA 4UZFA 3TUJC 3ZU6A 1KO8A 2OGZA 2XMDA 5JCXA 1HSZA 3OOJA 1GQRA 1ODTC 1YAHA 2VAWA 1FQOA 1ZUHA 2JW5A 4UXJA 5DHSA 2YN2A 2C7OA 4CM7A 1NNLA 3E7DA 3WTBA 2OWDA 3FNGA 4A3SA 3FOBA 5CYOA 2Z1NA 2FZ5A 5C35A 1QIJA 3D4PA 4AX4A 3HCAA 3MTEA 1E60A 2YRWA 3N86A 2X58A 2UZ1A 5FOWA 1IPFA 2IP1A 1Q50A 1XTJA 3ZDBA 1AKYA 4LG1A 3H2JA 3TG2A 1TEHA 1UXIA 4L51A 5CVTA 4URYR 4WA7A 3L6EA 1Y9DA 1EFVB 4Z9BA 4OLJA 1YU6A 3CM0A 3KXIA 1WIWA 1JALA 3NUZA 4QXPA 2AUTA 2YQ4A 2Z6VA 1Z6YA 4HMOA 3WFJA 4DG8A 1HYGA 1GTG1 2R7AA 1XYGA 1PL0A 2B7CA 3HMKA 4HNQA 3BX1A 4P5EA 3T5BA 5AOBA 2GJAA 1OLUB 2IIPA 2XXBA 4LNAA 3UTCA 2H2WA 1CFZA 1FFSA 1IAQA 1SU4A 2FP4A 2OYSA 2Q1TA 2RC5A 3OZIA 4ATNA 5CG1A 5GVSA 3BE4A 2H57A 3I45A 3KCQA 2FPPB 2H7VA 4K88A 2B2XA 3V4ZA 4DIDA 2JCGA 4J16A 3KEMA 5L3SB 1UBGA 1U0BB 4NQZA 4UUOA 1COWA 1DIBA 3I0MA 3DDWA 1C2YA 5CA1B 5IASA 3DEAA 2WMYA 4JCOA 2WICA 3E8MA 4ZJZA 4DCNA 1P62B 2IW3A 4XDGA 1OT3A 3O8OB 2WQ7A 3RRZA 4CIVA 3OT4A 4DS3A 3RIGA 1N6RA 4TTPA 4M38A 5EZ6B 2HPHA 4AKSA 5I7OA 3V7FA 2IEAA 3B70A 1ZLXA 2CJXA 1ZM3A 2C9YA 2O1WA 5UKDA 4DSNA 2I29A 2NO1A 3DMNA 3NWOA 3PIRA 3T5CA 1E7SA 3WQRA 4DMHA 2P9JA 5FWDA 4B6OA 3ZS9A 5AR1A 2O2HA 3WWYA 4FN5A 4CL2A 3O9VA 3N0XA 5DWVA 4RQAA 1LDYA 3WYNA 5C1DA 3OQNA 2Z6AA 2JI8A 5BWLA 2EG9A 1QK5A 2HJRA 1EBUA 2HO4A 3L0YA 1M6NA 2LKDA 1KDYA 3KKLA 1K6XA 2QY6A 3H5LA 2F43B 4HJRA 5FOXA 3EUWA 3DBIA 4JENA 2CEKA 3CWCA 4L08A 3JZAA 3ADBA 4GP6A 1P2VA 2R1UA 1OYVA 4W5HA 1V37A 2GT1A 1B2LA 3HRHA 5HRAA 3N07A 4JV5B 2JGMA 4WNYA 1GU1A 5WRFA 5CFLA 1JJAA 1VMKA 3Q7TA 3ZD6A 3PC7A 4NARA 4KLRA 2ZJ3A 3DDHA 3HACA 3AUAA 3PLAE 1MB4A 3QJYA 5JH7F 1TIBA 2RK6A 1KZGB 2GAJA 4XM2A 1EXDA 1YR1A 1LK7A 3L1UA 4KXWA 1MOQA 2XCOA 3LCRA 3BWVA 4XQCA 13PKA 1V8BA 1RADA 1V1MB 3A14A 5LZ5A 2INGX 1RVV1 1USWA 2DHDA 3UAYA 4CI0B 3W5DA 2QTGA 4IJ5A 1KFCB 3WGOA 4EI9A 3ESRA 3AXSA 3KE9A 1D1TA 3QUAA 3RBXA 3WRXC 4EVSA 1H6CA 4QJ5A 5CRIA 3HXTA 2V58A 5GV8A 2XZPA 3RREA 3W34A 3ZGLA 5JROA 3PDUA 1M5TA 4OP1A 4ZVLA 2ZZMA 2KMLA 1R66A 3KJGA 4IOMA 1Z63A 3PJDA 4WBXC 1M2VB 1WPXA 4DWVA 4KACA 2Y8EA 4O33A 4WJZA 2ATIA 2H8KA 2G09A 3RTDA 3K0FA 3CYFA 1AURA 1QO0A 2VDNB 3LT1A 1Z5ZA 1PW5A 5FQOA 1NN1A 1D1PA 2G1JA 4FZJA 5D5QA 2PL9A 1NFQA 1QHSA 1YRWA 4IAOA 4BMZA 5HGXA 5KYGA 5HOEA 2J1LA 2MYNA 3GR6A 4TWBA 3SD7A 2DB3A 2ON6A 5KCMA 3A32A 3B3JA 2VHYA 1FP7A 4FD2A 4D6YA 5E9JA 1I32A 1K7YA 1RYBA 2WT4A 4BHTA 4AAYA 3ERCA 1HL7A 4OTZA 1RQXA 1VJGA 4L5IA 3AWDA 2J08A 2KPOA 3KT3A 3DVRX 3BSFA 4OATA 5JNTA 3OD1A 4P0TA 1ORTA 5MFZA 1EDBA 1I6LA 3AVOA 3QEMA 2GZ1A 1YB4A 1SKBA 3T4UA 3O8DA 3W6NA 1XZFA 4DRYA 4FGWA 2BMEA 4XWAA 2IODA 5KHAA 3PYXA 1GUFA 3QKWA 4R7GA 4QUAA 1AD2A 2XUQA 2MSKA 4MUBA 3RANA 4F9TA 4XYEA 4C0SA 5JZOA 3ZK8A 4KAAA 2IHUA 4GKVA 4UHDA 3T9EA 4E5YA 2XDQB 4E31A 3V3KA 5EJ8A 2VXOA 5AUOB 1IONA 2PN1A 3O8QB 4WT7A 1N5LA 2WIGA 1G6Q1 4IH4A 4XPZA 4NCAA 3KJFA 3R24A 4WKNA 1G8PA 3DAGA 3OZRA 3U3MA 5BWNA 3STTA 4BP9A 1JA0A 1Z62A 3G88A 4JY7A 1HYBA 4DIBA 1Z15A 1YR6A 4JEIA 4JC5A 3EUEA 4UM5A 1BKYA 1QH0A 1VJCA 4HDSA 3ICCA 1P3DA 4I3FA 3RUHA 4KBGA 2VOEA 4FC6A 3UYKA 3WLFA 3G1WA 4O4HA 4IGAA 4JR2A 3OLZA 1DWPA 4NBKA 3LO8A 4OAOA 3R76A 1MD9A 3I72A 1RQNA 1YZUA 1EKXA 2NWQA 5DGXA 4TLLB 4IOKA 4A8HA 2LR0A 4NG4A 3NT5A 2A4MA 2LZ0A 4GVPA 2BEWB 2C8KA 5HOQA 1RWKA 1B23P 4CTOA 3A36A 1RFGE 2WAMA 3WJAA 3KHUA 2O1EA 4GP7A 4A91A 1L8QA 3EG5A 3HC7A 3PGXA 3E70C 4JLOA 1JQBA 1B0PA 1N9GA 3OLCX 1I94B 4N12A 1Z5PA 2J9RA 1E20A 2VPYA 3DV0B 1S7CA 1VJ0A 1TMOA 1E9RA 3M1AA 4IVRA 2X9GA 4LYDA 1P2TA 3PA6A 1JWLA 3OJOA 3FUUA 2XUZA 1NSTA 2JZOA 3HU1A 2Z9DA 3RHTA 1P0FA 1SEVA 3UMBA 1YVUA 2V7WA 4UU1A 4UNPA 2WTEA 5DXAA 1SN7A 2BUCA 4QTTB 4BRUA 2Q3EA 4D4KA 3F6SA 3OU2A 2DUWA 1T10A 5AIBA 2VNIA 3WGUA 4C05A 2BJHA 4J2HA 1YL5A 1WXEA 3IJ5A 5JS6A 4NBNA 2O7SA 3UA4A 3AP2A 5B1DA 4GWKA 3AX6A 3C1AA 3OETA 1N5JA 2BZ1A 1J1IA 1NULA 3NR2A 4UCWA 1OCEA 5D1HA 3TVDA 3VPGA 4CMAA 1HNXB 5D5HA 3DONA 3LWBA 3AJDA 4NAUA 5LFAA 2C2GA 4P4LA 3EC2A 1VYVA 4NQRA 4TXLA 2P77A 2W7TA 5JYEA 1PWZA 3B60A 1LLUA 3A1FA 3R0JA 1II8B 5I3CA 2D59A 2JLSA 4BYMA 3AUKA 1ISSA 1N5RA 2D1RA 2RARA 3I9OA 4KGXA 3RFTA 2QVBA 1HYQA 1XMJA 2W2OA 4UDXX 4HG2A 3L5KA 1X7DA 4OMUA 3ZI7A 1U1CA 1HA3A 5LJLA 3IR7A 3I3OA 4KVGA 2X0FA 1YC5A 4QQ8A 5BN4A 1G2IA 4HTFB 5ALSA 1XCMA 3W3AD 1A9RA 1XD2B 4WOBA 3RYFB 1Z5UA <