1U3FA

Structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
164
Chain Sequence
b'MDKNALRKQILQKRMALSTIEKSHLDQKINQKLVAFLTPKPCIKTIALYEPIKNEVTFVDFFFEFLKINQIRAVYPKVISDTEIIFIDQETNTFEPNQIDCFLIPLVGFNKDNYRLGFGKGYYDRYLMQLTRQQPKIGIAYSFQKGDFLADPWDVQLDLIINDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-Methenyltetrahydrofolate Synthetase
publication title Crystal structure of methenyltetrahydrofolate synthetase from Mycoplasma pneumoniae (GI: 13508087) at 2.2 A resolution
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Ligase
total genus 44
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 1u3fA00
1WKCA 2JCBA 1SOUA 1YDMA 3HY6A 1SBQA 3HY4A 1U3GA 2G40A 3HY3A 3HXTA 1U3FA
chains in the Genus database with same CATH superfamily
5CFNA 3ER9A 3ZX5A 2BOVA 3Q40A 4BFCA 3F4LA 3ZCRA 1ISIA 3HO6A 3VGJA 3QLJA 3CLSC 4RCVA 1I24A 3IC5A 4PZPA 5AKXA 5CHEA 4C14A 4RXMA 3VPFA 3CEHA 3H5RA 1PU2A 1X7HA 1XELA 4W5NA 1FVFA 2IUSA 4K6GA 2UXDB 4IDOA 2GK3A 1CZUA 3QVTA 1WB6A 3LYAA 3PZRA 1AE1A 1L7DA 3HYRA 4JBHA 5CLQA 1XLTA 4OQEA 1M6WA 4C4YA 3T7KA 2Q2OA 4JXXA 2Q5CA 3E53A 1I4WA 1RPAA 5JWRA 5C2JB 4MRVA 3D54D 1YVDA 4YUVA 2FZWA 1MNQA 3NHLA 2EX1A 2OCAA 5G1NA 3W5AA 3R41A 2I71A 4IW3B 2GEVA 1EK0A 4QTUB 3LWBA 1G18A 4TL8A 1G0OA 2VYQA 4OGGA 4TV8B 4H7JA 4YJKA 2YMLA 2OZPA 3W8FA 2QTTA 5HIMA 4ALLA 1QGOA 3L8ZA 1C3XA 2IYYA 4U2BA 5IANA 2WMOB 1SBYA 3DMTA 2CLFB 4K9LA 4M9RA 2JLVA 1G1MA 1CNFA 4OY3A 1IB0A 4I9UA 3TZKA 1W4AA 1IPHA 4BMCA 1W73A 2GT1A 5DCLA 1RXIA 1P4GA 4BEWA 3AXTA 1LQUA 4PLHA 4ZMSA 4KR7A 1RI4A 2BHTA 1IXKA 3JZIA 3SZUA 2MR6A 2H1WA 4GPEA 3SBXA 1ZNZA 2FOLA 3UK0A 2ISQA 3W7AA 5KU1A 3U4IA 4KQEA 1U28A 4OK6A 3GRRA 4DR4B 1YS7A 2A9RA 4FXPA 4Q9HA 1FJHA 1I80A 1K6IA 4MJ7A 3ZH2A 1U3CA 1LVHA 2Q41A 4O1IA 3V7UA 4LE1A 2IHTA 3BSWA 1P2GA 4U02A 3ZY3A 1P60A 3B12A 5EJ9A 1L7OA 3R7DA 4MHTA 4BVKA 2ZJYA 4MKHA 3DZFA 4MUGA 1VHTA 3AETB 1PS9A 4UATA 4DCVA 1C80A 5FWNA 2Z6QA 1YVEI 5EY5B 3IGFA 5G53C 4ENPA 1VI2A 1NXPA 3GN1A 1GG2A 3ZVRA 5E4TA 3SZMA 4KPYA 4U4AA 3GARA 4G5RA 2NO5A 4OSOA 4CI0B 9ATCA 1JI3A 4MPJA 2GUGA 4YTEA 3RVOA 2YWEA 4MW5A 2GM4A 2B82A 1VKOA 2JZCA 4NAVA 1WMDA 2ENWA 3ZUPA 7MDHA 2V1UA 3TJZA 4PIVA 1NBEA 4C6RA 5HYVA 2FUEA 1ZUNA 3GLUA 5AHOA 2O19A 5ESRA 1NV8A 4YYEA 4HGYA 1LDYA 1ABEA 3RPEA 4BKQA 1W59A 1QRRA 2SNIE 3Q1LA 4Q3CA 2FRDC 1JHVA 3LHSA 2WK1A 2CB9A 2MMCA 1MQSA 1BN6A 2I7VA 4M0UA 2I34A 3QHQA 4LKOA 4I1IA 1CK4A 5TV2A 2QLBA 1HT0A 3NHYA 2ZTVA 5FPQA 4QEZA 1JXMA 4YPFA 4BIMA 2I7CA 6REQB 5J43A 3WFZA 3FNHA 2PH3A 2R751 1WHSA 3FUWA 4QFDA 3OCWA 2GHQA 3IV7A 3KPWA 3COJA 4TTSA 2V7GA 3D02A 1FEZA 4C6TB 1ZM2A 1U2GA 2D13A 4Z51A 1H0SA 1E5XA 1U0TA 3UCEA 2RGNA 5UKDA 5EQJB 1TMKA 1OI4A 3L0ZA 2GLXA 4P3KA 4PR0A 1JLRA 5LDGA 1P4SA 2QD1A 1UJ5A 3DOUA 1FNMA 4RADA 3VPCA 4DSUA 2GEUA 1FYVA 2H63A 2VA9A 2JKVA 4MWZA 3RFTA 3L7DA 4XWTA 4M9ZA 4UM7A 1UJNA 1W75A 2PS3A 2J5BA 1Z6TA 3DKVA 3KKLA 4WOKA 3ZW9A 3I3SR 5HRAA 1M0TA 5K0ZA 2DWCA 4IF6A 1DV1A 4C2BA 1ECBA 1OWPA 2GTIA 3BH7A 1CV2A 3DE5X 2IYPA 3NCHA 3MGKA 4M99A 3Q1KA 4W5HA 5HZGA 5J47A 1NVWQ 2C78A 4ZVTA 1GRCA 3OLZA 1M6HA 1OBHA 4D9NA 5LB4A 2EF0A 3E7DA 3T9CA 4OMDA 1DCMA 1XN4A 3T9DA 1YFJA 3X0DA 2O5CA 1KEEB 3SG0A 4D0SA 2EW1A 3H9JA 1YE8A 1ZCFA 2NQ8A 3HB7A 3PNSA 2Z1DA 1HETA 4RE6A 3T3GA 4LRSB 5CFLA 4Y0AA 4YRFA 3IJEB 4DJTA 2O8FA 2IW1A 3DZJA 3OTHA 5CH5A 4BOYA 2YV3A 4GOXA 1U1DA 1IBRA 2SCUA 3NC1C 5EJAA 1EH5A 1B3BA 2VYND 3OE5A 3R0JA 2QNBA 1DQZA 3BRSA 1EYZA 4BJ6A 1FDTA 4KLAA 3BZWA 3N3BC 1KH1A 3HVRA 1RBYA 2OPHA 1JN0A 3PK0A 1CRPA 3KOMA 3QZUA 2VSNA 1CUXA 3NASA 4MPPA 4A1FA 3LPAA 5C7YA 1SKQA 1WSDA 1VMIA 4URVR 3TFOA 4RU1A 5DB4A 1DRJA 1P6XA 3R24A 5PGMA 1G3MA 3RRBA 1X7YB 4I14A 4DLBA 1UXIA 1ZI9A 5JS6A 2WPNA 4A6EA 1PJ3A 2O57A 4UEQA 1JAYA 1ZOSA 3K53A 4H6VA 3DMYA 2ZCJA 2IH4A 2Y0PA 3DJYA 4PZAA 3CVOA 5BMVA 2WNHA 3CIFA 3QKIA 2OHIA 3O8QB 5JS1A 2N75A 5CDSA 1L5KA 1NR5A 3OC6A 2ZTHA 5B3JC 3IP1A 1AKNA 4GE0A 2H11A 3JQ9A 3EIWA 4RORA 3NBQA 1CEQA 3KB8A 4I4TB 3GUHA 3PEUA 2R7AA 2Q4OA 2CXQA 2A1UB 3DP9A 3JZFA 3L7MA 4ZMRA 3D8TA 1HDYA 1WHSB 1UAAA 5AJVB 4FOSA 2UU9B 1NRIA 1AJEA 1Q5PA 4U00A 1GL3A 1NZDA 3TO5A 3BS4A 3AXSA 3TSWA 4HWRA 1PG5A 3OHPA 4LECA 4UXHA 5ALUA 3DZDA 3ZQ6A 2C92A 4EHHA 4OJYA 2CXUA 3HBAA 4FYIA 3INYA 3U1VA 4CN9A 5IFKA 2PUDA 2BM9A 3K9NA 4WLEA 4U0JA 4KMMA 1SIWA 5ALMA 4ABYA 2QG6A 1QKKA 5TSDA 3GD5A 2EFCB 1KYYA 2IHZA 1BN7A 2I2CA 3COYA 1WTCA 4WKGA 3EDRA 4IUCS 1T3ZA 2QRLA 1GVHA 2O50A 4V0RA 5JNVA 1VPVA 1BYUA 1WW3A 4HDCA 5KJCA 3OQNA 3SR4A 3OCYA 4Z99A 1TLLA 5FPTA 4DR1B 1JR3D 2G9ZA 2VJKA 1UBRS 1UXHA 3OJXA 3OPYI 1E1LA 3ENZA 1TI7A 6Q21A 2FPMA 1HE5A 4TM8A 3CCFA 4ZZ2A 3FHOA 2ZT8A 5AM0A 1Q22A 1R88A 2HWKA 4LYJA 4QARA 3AIMA 1XT6A 2W5UA 3FG9A 4YRAA 4L5BA 1E5DA 4I1OA 1L7QA 3ZHSA 5JOQA 2O8FB 1XZCA 5D7BA 3O95A 3AUTA 5D86A 2NIPA 5FDFA 1V7CA 4YC7A 1TEVA 1CQJB 4MIOA 4BTVA 5I8WA 4GBED 3VDXA 2HADA 4BHTA 3KOWA 1ZCAA 4OXNA 2HSZA 4K9KA 3T3PB 1G4UR 3NYIA 4MUXA 5C53B 1SCUA 4F1WA 3LZCA 4FOOA 1THZA 3DHNA 3QHPA 2VT2A 3KPJA 4CKBB 1J25A 3OECA 2WZDA 1RWQA 5TQ0A 4UTRA 2F3PA 1NJ2A 1Z33A 2EKPA 1SHLA 4YQEA 3W5VA 2VJMA 3DOHA 3E3NA 3AB7A 3QJYA 2G08A 4IGKA 4DBZA 4QA9A 2H2HA 3UB4A 3VR6A 4HD8A 3L1KA 2O3JA 2XODA 1P33A 2O2IA 2YBDA 1FXUA 1EBBA 4M1MA 1FFXA 2NUTB 2QP4A 3CF4A 4GOMD 1UBKS 3ASVA 4Y1RA 3V4ZA 1JT2A 1BFKA 1F7UA 5JQGF 1VZ3A 4MQUA 3S7ZA 3PQFA 4BLTA 1GQFA 4JGIA 2Q5FA 4IVNA 1OPXA 2HA5A 5DOZA 2QRNA 1HFWA 2Z0MA 3A3YA 3H3FA 5A3QA 4K6CA 2D59A 4LF4B 3VJLA 2CKDA 2R8BA 2AI2A 3CQ9A 4U7GA 3V97A 3WZLA 3H5WA 4Q4AB 4R01A 5EEHA 3RNOA 3KETA 3ZU6A 3C97A 1VJ1A 1ZN2A 4YCNA 2JHGA 1N2XA 4XDYA 5AVYA 3RYTC 5CDTA 4XRGA 4O2AA 4ENQA 1ZK1A 3NOOA 4FYKA 3DAFA 4HFMA 1NRXA 2W2PA 4JWKA 4L4ZA 4PCUA 4W5WA 2Q45A 1XIVA 3IH5A 4FYYA 3AFIA 1ZUWA 2WQZA 4S12A 5GIOE 1X74A 3IAS6 3IBTA 3O8RA 2MR5A 4ETIA 2W22A 4RCYA 3ACBA 1DJMA 3OEHA 5P21A 4L0MA 2IWRA 5LD2B 2FQXA 5JDCC 2WF6A 4QAQA 1I2MA 3Q7RA 2XDQB 4B0OA 3VO9A 3WIBA 2G5GX 2JCYA 3JD0A 4HLQB 1GGHA 1O97D 4DY6A 5LVAA 3RIYA 3I6BA 1T0PA 3BFPA 3KWLA 2ZOSA 4X94A 5T4FA 2X0EA 1ZSNA 3CNLA 3GRAA 4NXMB 2WSIA 3Q9NA 4RY2A 1GAEO 2QM7A 1MC4A 4JCOA 2FETA 1K6XA 3GPIA 1T9BA 3EZNA 3L7LA 2HBYA 4ZAGA 4HYTA 5J58A 4W7HA 4YMWA 1E1QD 1JPNA 1T4MA 2P8JA 5K3FA 5T8KA 3WWZA 4NRDA 1PJ8A 4PAWA 2OORC 5B1SA 1SCUB 1KTVA 4XCVA 2O2JA 3SFTA 4O4HF 5L3VA 1LBEA 3SDZA 1ODKA 4FP9A 1VP3A 4RDIA 3H2ZA 3QA3E 4U9UA 1QP7A 3K7EA 3I73A 3R9XA 3D6AA 4XGIA 1VYTA 4OYYA 1I3LA 1S5PA 4YBRA 2FZCA 2CFTA 5H8WA 4QPNA 1U1IA 4AQ7A 3DZ8A 5JO0A 3UM9A 4EGQA 3OWHA 2F1RA 4KXYA 3LWZA 1H8HA 1U4NA 1UJBA 1T2UA 4S0ZA 1M8KA 2GARA 1P0CA 3GRKA 1OREA 3NKLA 2W2NA 1IBKB 4Q7EA 1FFXB 1AOXA 1H6DA 1BH2A 2YASA 2BFEB 5AVTA 2I4MA 4Y1RB 4HDKA 1KI3A 5EPUA 1K3TA 4BATA 2EBWA 3PD1A 4FFVA 5F77A 2Q2VA 5CFZA 1G5HA 1ZJ6A 4CETA 3UJ7A 2Y0BA 3VKUA 3HJTA 4JK3A 4H0CA 2J59A 4W5OA 2ZSFA 2PKQO 3TUJC 2WUWE 2KBFA 1JG7A 4FUQA 3B2NA 4PF1A 3ENNA 4XE5A 3TN7A 5U9CA 2JLZA 1NQTA 2BSXA 2EFHB 2PR7A 3JTMA 421PA 5L8VA 3AX6A 3UW3A 1DRVA 4F2PA 1TD1A 4KBGA 2I1VB 1KTIA 4FIDA 4OHBA 4ABTA 5GY7A 4JT4A 2WWRA 4O2AB 3NJ8A 4ML3A 4RENA 2XPCA 5FPYA 3STWA 2FFQA 4NZMA 4MUHA 3ROTA 3MQ4A 1HX7A 5BVGA 4G2TA 1Y1KE 4CLOA 2OHJA 1MOPA 1BAPA 3CPSA 3IO5A 2IEYA 5F33A 3KYBA 3RYFA 3VAZA 5EERA 1U6KA 2KJQA 3R3JA 3W1WA 3GMDA 3SOZA 4OGFA 4I2VA 4CYMA 1QOZA 4MR8A 4TXHA 5CYGA 1P1IA 4JHLA 5DO9A 3PTAA 4DCCA 2QGNA 3DCYA 4O3FA 3LE8A 1FA9A 4XEHA 1JYEA 5EPOA 1Z7YA 4AWBA 4C3UA 1JHMA 4G0UA 4R6WA 1UKEA 2KMLA 2NZ2A 1S2IA 1G16A 2PCLA 2PKRA 2QTHA 4TQAA 3ZXUB 4E21A 5KREA 4OK5A 4CV0A 4Z5XA 3B3AA 4N0MA 5F9FA 5FEMA 2PGAA 3OZAA 2VFAA 2H4HA 3M0EA 3UWPA 3I61A 4DCSA 1QPGA 3RDPA 1G9TA 1Z6GA 3B52X 3OCVA 5L95A 1PQPA 2CVFA 3EZFA 3SXJA 1NNSA 1YWGO 2XW6A 3B1JA 3HI6A 3ZZ0A 2WJIA 5EMHA 4YUYA 2QJWA 2F43A 1XTQA 2YVUA 4F6CA 1SVOA 3NOQA 4L8GA 5DISB 4FBMA 4Z7QB 2WAMA 2VRCA 1QH1B 2P9FA 3CVXA 1FJXA 2YYYA 4EBBA 4LGYA 3MLEA 2OK8A 2QNRA 3OA0A 1IZ7A 2RKOA 4GZMA 1YQQA 3ANXA 5KYYA 2SBTA 3KZNA 5JDIC 1Z6AA 1NQUA 3C70A 4D0NA 1DC3A 4J6EA 3K9GA 3KL2A 3QBDA 4CQNA 4QQRA 4UEOA 2X76A 2RI0A 3BSYA 3FYUB 4HDMB 3D8UA 3I5MA 3JAKB 1DBIA 1C2YA 4G4SO 3ZHRA 4EUEA 2WVJA 3LYUA 4L9AA 2ZUTA 4ALKA 3BGSA 1P2SA 2LE0A 1N5JA 3E8XA 2IVZA 2XTJA 1YDWA 3LKBA 2B4QA 1BWSA 2QX7A 3LYLA 4HDKB 1AQLA 5SZKB 4A26A 2DM6A 5HKAA 4TKMA 1NYLA 1YJ8A 4GECA 2LUOA 2W6MA 1KEPA 5ALLA 3LPDA 4A03A 2X0IA 5BQFA 3E2MA 4DV7B 1SZCA 4NQRA 4MP8A 2ACWA 1KPIA 4RKQA 1NOKA 4XQEA 2ZB4A 5IKPA 1AQIA 2XRFA 3U3MA 4LJAA 4CFYA 3SWWA 1W1WA 1V41E 3S2GA 1JH9A 3CUSA 1IHDA 2JLBA 4P82A 5FPKA 2FWMX 2Z2YA 2FDCA 5LIRA 1G66A 3URKA 1P44A 1UADA 3AHFA 1L1RA 5FO0A 4E1AA 4E51A 1NW7A 2WWIA 4BX0A 2QEQA 5LP6F 3QEAZ 2HD4A 4F8YA 1YDFA 1YV9A 2WJHA 4AKTA 1Y33E 2PKQP 3ULKA 3GLIA 1G5IA 2AN1A 2FMTA 3RYFB 2O0MA 2WWXA 1KH3A 4RL4A 3LY9A 4BNDA 3THYA 2EX0A 2RB4A 1CVLA 3AF2A 5DPMA 2IDJA 2CJFA 3I9JA 4M0LA 1TCVA 4WUVA 2C84A 1M2KA 4KXNA 3FRJA 5T6MA 5FAKA 5IG2A 2W37A 5J5AA 3ZZUA 5AJTA 4ZFNA 3P2IA 3PXDA 3W7VA 2Z6VA 4ZHQA 1LXCA 2IWHA 2IYXA 3EVBA 3P26A 4J43A 4U2GA 4QO7A 3AMVA 1LA2A 5FPSA 5AIBA 3F67A 1UEJA 2ZIEA 4FZVA 1QFYA 4UDXX 5DM4A 1Y4DE 3ZXYA 1IU9A 2G7ZA 4ILEA 4E46A 4BV9A 1QF7A 1FMTA 5CB4F 2G6BA 2GF0A 3QXSA 4UZEA 1PSWA 2GPNA 1I36A 1NULA 2J9ZB 2AC7A 3PQ5A 4H1WA 1FDRA 1T13A 1X9GA 3VOBA 1L5NA 5BWLA 2JDIA 2F43B 3AUSA 3SDSA 5E95A 4ZVSA 3MMSA 2V7QA 1PR4A 3CF2A 1J0EA 2EKQA 4XR9A 1YVRA 4JLAA 4K03A 4C9BA 4JB2A 4N0DA 1QP0A 3PE3A 1ZWLA 2O20A 3HB4X 4JYCA 4RPHA 5F1YA 4ZEVA 2HX1A 1YL6A 1X1CA 3G6KA 4G5GA 4LVCA 2EFJA 3ESZA 2XB4A 1GADO 5HVNA 5HZKA 2J67A 3IB6A 1VLQA 4J16C 3SM3A 3LK7A 5LMUB 4PZ0A 1LC0A 1GPBA 1D7AA 5JO9A 3PJEA 4E1VA 7REQB 1BFUA 1JZSA 3F3KA 4LNAA 2D0PB 3CWZA 2XJ9A 2VL7A 4OVKA 4YN3A 4DHEA 1DUVG 3M4NA 3I9KA 1XZBA 2AOXA 3QM1A 4FFPA 4KBYA 1ZD5A 2GHRA 2FW6A 1IULA 5IVDA 4AKHA 4MB2A 2HPAA 4E15A 3KRTA 4LY6A 4OTZA 3OEHD 2J0SA 3IP8A 4HTFA 4NDAA 3W5HA 2PQ2A 1SA0B 3JWPA 1NVTA 5FT9A 1NLMA 2JFHA 3A1VA 3CBQA 1SXQA 4F1KA 1E2DA 2GYWA 5K6RA 3MXTA 4TYWA 4YBZA 4PG8A 3L79A 3CH6A 3C14C 4NARA 1EQ2A 4G4SP 1YNSA 3IUBA 4AZ3B 2O5RA 1EMDA 1VIMA 1Y98A 2XGMA 2Z58A 3W05A 2GR9A 1LNZA 2DC1A 2FEXA 4D3FA 1QIHA 2J6CA 1X14A 1JTVA 4C89A 4ZZ1A 5K45A 1C0LA 4QU0A 2C1EA 2V9PA 5D2CA 3FGPA 2H9YA 2OD9A 1MA3A 4BWFB 1OZFA 1DQYA 3HZOA 3KEFA 2R0QC 2DH5A 4NE9A 1E59A 1WE2A 3GLIB 3T0IA 4ZVVA 4DLXA 3H8VA 4BFYA 2HWXA 1IG0A 1MX9A 2YHIA 4BNDB 5TY0A 5JAIA 1B8PA 3N58A 1G17A 3D6NB 3CA8A 3EARA 5BV7A 2P1RA 2DH6A 2RHCA 4FE4A 5EOVA 3KUCA 2NPFA 1YHZA 3GD7A 1JAHA 1IEVA 3KQVA 1N8NA 1M34E 3QX7A 1ZGAA 2ISSD 3I23A 4K8RB 4W7SA 5AI6A 3A2NA 3CZCA 3KSZO 3A6GA 4ZHQB 3RU2A 4LJ6A 3QITA 1ADYA 3BRWA 3K31A 2Q0QA 4B6SA 2W8ZA 4HAVA 3S2EA 4JC8A 1SEVA 1EPUA 1EE9A 1ZGBA 4L5AA 1Z16A 4P0TA 1LK0A 2JIMA 5G1OA 7MHTA 1R5JA 2NXCA 1PNTA 3L4EA 3OQIA 5EZ6B 3DEKA 3MN1A 2TMYA 2CMFA 2OAP1 1X80A 2A4MA 3WB1A 4E0BA 5JC1A 1PT5A 4KK4A 2RAVA 1J2YA 1M6NA 2C9CA 1WD7A 1DJLA 2W8BB 4PS0A 3WMWA 1L1QA 4R1UA 5FJIA 5K0GA 5K7SA 3HKDA 2I55A 3R20A 3HCBA 4PV7A 1PR2A 1KSHA 3IAM6 5C80A 3L8YA 1OI7A 3M5PA 4NZZA 4QLAA 4I9FA 1K4KA 2LTAA 3IDFA 3M3HA 1BS9A 1K66A 1ODCA 1X3LA 3L6RA 4LGVA 4C3OB 1JFLA 4QD3A 1GA4A 5ES4B 1V7PC 4C0KA 1HQYE 1YL7A 1ZD8A 2YR0A 4QHTA 4XGRA 1APBA 1D1PA 3AG6A 4QVKA 4AZSA 1CG6A 3LPLA 1O94A 3SZ3A 3V7YA 4IDPA 3WTCA 4V0ME 4DMRA 2A14A 3HU3A 5IWAB 1E2HA 4FS8A 2IHUA 1IZ9A 5LQAA 5TMPA 1HC7A 3GPLA 1I2DA 4DEVA 2YKGA 2YW2A 1Z45A 2W42A 1W85A 3HB1A 5BSUA 4ZAYA 3TMYA 3MC1A 1DX4A 3OF3A 1R0LA 2VP3A 1DP4A 2VVTA 4J1TA 4HPXB 4AJ4A 2AYYA 3HFGA 5F2EA 4TLLB 3WJ7A 2QN9A 3OIDA 3W2TA 3KB1A 3OQ6A 4B7UA 1SZJG 4G8JA 1SUCA 4QGAA 1O87A 3MPUA 1X8XA 4BX8A 1G8MA 2FWIA 2LCFA 2OQ2A 2CJWB 2QT1A 4YRQA 4D97A 3U40A 3DDWA 1QHGA 1FTYA 2WV9A 2XIQA 4Q9AA 5KAMA 3UAXA 1BD4A 3M9WA 3EZ2A 1Y5NA 2GAIA 2XUPA 1VQ1A 4FU0A 3LUAA 1P75A 5FWYB 3W79A 3LX5A 3WKEA 1BQ4A 1QTNA 5D01A 1US8A 4CMJA 4D9IA 3GZJA 1GLGA 4I1VA 4Q15A 2H65A 3MUOA 4R2XA 4RVFA 4BX3A 3UCXA 2CJPA 1N75A 5EIBC 5HK9A 1KU6A 2IZZA 3AHDA 3PLNA 4N49A 4NZ9A 1CUJA 1FP2A 3SS9X 3BCUA 3ZGYA 2IIPA 4L74A 2GBLC 2JBWA 2P4EA 4K6KA 1S9DA 3EH1A 1N25A 5FH9A 1QYXA 1G2QA 1F4LA 1UEIA 1SXJB 2XUOA 1XWIA 1CZOA 4OM8A 4Y6PA 5I3ZA 1Y82A 2IOFA 4DG5A 3CB4A 1IG3A 4WIAA 1WDWB 3OCCA 4HL6A 3L1JA 3CLRD 3JWEA 3LVRE 4V3CA 2XOEA 3UGKA 3JQ8A 1VHLA 1TUEA 5DIZA 1JEDA 3NPMA 1X80B 3OLYA 3VNVA 2YRFA 1NMYA 2RGRA 2WFAA 5AXCA 5IH3A 3DTVA 4BB9A 2F3RA 2ZSJA 2B5WA 2Z1MA 4LYEA 4WNCA 3SEZA 3SYKA 5C35A 2B7BA 3R2JA 3Q98A 1CY8A 3GYBA 1K63A 3HKDB 4CIDA 2B78A 3WGJA 2XYVA 1V4BA 3ONDA 4YACA 1YZNA 3VV3A 1RWNA 3MT0A 5AT1A 3EXHB 3V46A 5D1NA 2RGBA 4V0KA 4MV9A 4EY8A 3KXPA 3OTOB 3D4BA 3I72A 3DAGA 3M33A 1VLVA 4F38A 3ADKA 4CQJA 2ZYDA 4JUFA 4AY4A 5HPYB 5LZ2A 1ADCA 2ZEJA 1GPWB 1FMJA 2EWVA 2SICE 3TB4A 4EI9A 1JP7A 4JUIA 2AUMA 1ZGHA 5DLYA 1WU8A 2CL6X 3F74A 1ZYUA 4LDJA 4MDYA 4KR2A 5GTDA 4OI2A 2VOEA 4L4XA 4MYHA 1W85B 1QU3A 3ETDA 3RRZA 3DMRA 5M7EA 4C30A 1EFRA 3DE7X 3KHTA 2O7NA 2ZTLA 4JSRA 4K8OA 3R3WA 4KWEA 3H5IA 2COEA 4NAHA 4IDNA 4QDKA 4JYZA 1GQRA 2GFHA 3VR4H 3U4QA 2XMSA 4WLOA 4RESA 4DPLA 4HLDA 1GSHA 3DT9A 4RK0A 2OAQ1 4BWGA 1RRGA 3Q7TA 5IARA 3MHTA 3H9BA 1V8DA 4Y1FA 1I3KA 1GOTA 2CMDA 2IPOA 1KO4A 2YHSA 2Z2KA 3DF7A 3K09A 4Q3DA 3T5CA 3VKGA 5LMNB 1OZAA 2ZYGA 4NMHA 2X41A 4LBYA 1J90A 4J0HA 3AVTA 1PR0A 4YALA 4RV5A 4C7JA 5CXSA 5JZ9A 4RYDA 4X7PA 3ROQA 4UEWA 5IT0A 2HHAA 1TJYA 3KKMA 4KXWA 3RS7A 3M4YA 4KNYA 1EM8A 2JDID 1M6EX 2DEUA 5A9SB 3RK4A 2XWSA 3NZEA 2QSUA 3SBOA 4P4LA 5EWMB 2AX4A 1AB6A 2IC5A 3FSGA 3RIMA 2JFNA 1SBNE 3AR7A 1W4CA 3EIOA 4Q16A 1U8FO 4KW7A 5C8ZA 5KHOC 1GARA 1CJKC 2E6KA 4HCJA 4Q4DA 4R84A 4TWIA 1NDQA 1SVWA 1RZ3A 5F2OA 3SXUA 1ILWA 2QUIA 4RETA 4Y6OA 3KKKA 1SVNA 1RJDA 2GFQA 3FPBA 4GT1A 2P6PA 1DKRA 1JKJA 1V2GA 2OG1A 4TTRA 5CJ2A 1OYWA 2W0SA 3F8SA 2NZWA 3ICPA 3JQ6A 5KYWA 1BDHA 3R77A 3QH4A 1L3IA 2DUMA 2GBCA 3W4JA 2G28A 3LUFA 3ZS8A 2XDAA 4X8HA 1CPYA 4PRKA 1W2WB 2XB6A 3C98A 4IFEA 1GILA 1E1RA 2WV7A 4ZYXA 1I3MA 4AWAA 1F9AA 2AA3A 1C9DB 2NSYA 3CR3C 3GBVA 4HS4A 4MQLA 4P80A 3K0FB 4BNHA 2EKBA 1EVYA 3C1AA 4RJTA 4RWZA 3TR5A 4BVHA 3V2GA 3BWEA 4BBJA 5C5CA 2ZT6A 2O7RA 3WMFA 1J2UA 2HDOA 3L0BA 2ODQA 4GPBA 1S2NA 3PE4A 3RHSA 3L1HA 4A4DA 4CIWA 5KSPA 3DEIA 1E5TA 1RCFA 1YDHA 3DEJA 3HGTA 1F4VA 4FQ7A 3ZXXA 5HKBA 1YKFA 1U9YA 1ND6A 4TMZA 3V80A 2EARA 2E9SA 1UPCA 3AJDA 3V7WA 1RS0A 2JI9A 3NBKA 3F9IA 1W5EA 3OHMA 2GEBA 4MJLA 2GZDA 2ZUSA 4ISCA 4F3CA 2EIXA 4YCDA 3L0YA 1WQ3A 2H51A 2JFXA 2Q3BA 1RI2A 1PJ4A 1EJ6A 5TXGA 3R6DA 4DA9A 1JYFA 3C39A 3CW9A 2IYAA 2WWHA 1NG9A 3RS9A 4A92A 1M67A 3D7MA 3MZ0A 4RLHA 3U4QB 8OHMA 5IDWA 1P3JA 1P4HA 2ZRGA 1PQ4A 2AF4C 3HYLA 3R76A 2ZZNA 2HNAA 2VHTA 3B6JA 3ZLTA 1MVLA 2I4TA 3GJ0A 1RYBA 2FZLA 2Q2WA 2Q62A 3DMGA 3BJIC 1JIVA 1IMOA 4RFSB 3IJPA 4AL4A 4MA4A 5KHLB 3PJRA 1MJGA 4PRZA 1EJBA 4X63A 3IUJA 2C07A 2H08A 4YRIA 1JKIA 4V39A 7YASA 3G9ZA 3IP7A 2P91A 2PHZA 4Y2HA 3IXLA 4F4DA 1X2BA 4G6ZA 1EM8B 2NXWA 5T6BA 3SHWA 3E35A 4YT8A 2PFSA 2YVAA 4BXOA 2R62A 3AR8A 3W9UA 1MG0A 1GPH1 2HDWA 1XRQA 1FSSA 4BB5A 1FDSA 5FP0A 1U2EA 1VE1A 2DFPA 1T8SA 3ZCXA 3GHYA 4UCXA 1YCDA 5AM1A 3WADA 3B7WA 3UBTA 5HTOA 3I37X 2OGZA 4KR0A 4NNJA 4QAJA 4S35A 1T2VA 3IO3A 3OE4A 1SXHA 5TS3A 4JL5A 1YZLA 1E6MA 1R3DA 2C5FA 4C21A 5BSHA 5IULC 2G0AA 3E5NA 4HO1X 5AHKA 2HO5A 1O94D 1FPQA 1A7KA 3UWSA 1KI1A 1NPYA 3B3JA 3C5EA 1LY1A 4NCKA 1C3VA 2V6BA 3GVPA 1Y5LA 5I9SA 3VPXA 3ZWKA 5A6VA 2OBMA 3AB8A 1OF1A 1Y37A 5GVRA 2WF9A 4BKRA 5BMVF 2ODEA 3PXGA 3QFCA 5L4LA 2YV4A 4OHRA 5FHRA 1CJCA 1FS5A 1FSGA 1EE1A 2REQA 1L5FA 1Q12A 2XE7A 3N05A 3PWKA 4Q05A 5ER9A 2CE2X 3SK0A 4DJAA 4FQ8A 2GETA 1YS6A 3F4BA 4Q3LA 1KERA 1N77A 3VA7A 3TRIA 5F7JA 5BR1A 5CLGA 1D2MA 1OZGA 2HA2A 4FTWA 4Q4HB 2YZGA 5FCDA 5CTJA 1KI8A 1MORA 5SY6A 1PVOA 1UM9A 2H2IA 1RLMA 1KK1A 4BVJA 2EERA 4JVNA 1KL7A 2WAYA 4BLRA 3PNPA 5JISA 2VJLA 1P1KA 1I4OA 1U2DA 3CVYA 5HGJA 1QZTA 1T6YA 1USGA 1IE3A 1BCSA 3K2IA 1XVUA 2QAJA 5CYOA 2PPVA 3MS4A 2Q07A 3O74A 2D2VA 2QUHA 3WGYA 3L07A 5AI8A 4X7MA 1BXGB 5ADWA 1NX9A 5F76A 2HEIA 4JNCA 4GMGA 3E3MA 5KS2A 1SBQA 1VJRA 3K0EA 3SHFA 3QENA 3VR5H 3DLHA 4NF2A 1J2EA 3FFXA 5KEIA 2EWMA 2V58A 1ULTA 1G20B 1YDEA 3OWOA 1E5QA 1M1XB 1Z3CA 1ZKDA 3BK7A 1SN7A 3GA5A 3IMGA 2VUSA 3EGWA 4KQXA 4QBGB 2QLMA 5FTJA 4DQ0A 4YRKA 2H1IA 4S24A 4X20A 2XGSA 2JLWA 2GOYA 5AKJA 1A9ZA 2P77A 1N33B 5CLJA 2JRCA 2O3QA 5CDFA 4OHVA 4QPDA 5DCWA 2VEOA 2CLHB 2YOHA 1WF3A 1OH5A 3AESA 4HGOA 1V43A 2B61A 1LDNA 2WILA 3PGLA 1SUIA 2IV3A 2X1LA 4YJFA 1Y1PA 3DTVD 1VKNA 4LN1A 3V2HA 1H4QA 1P0FA 4JZKA 3TNYA 1FYDA 4LOLA 5IJXA 4JLDA 4CR8A 3RKRA 2EATA 3DAOA 3FKQA 3HSKA 3ME5A 4B31A 2II6A 3IMCA 4D9GA 4GM1A 4EEXA 5YASA 1UT8A 1EXNA 3C85A 1ZESA 2H4FA 5EHQA 4HLNA 4R2LA 3ANLA 4D9EA 2B5VA 2XE8A 4LDZA 3DJFA 4C1BA 4FI3C 2Q1TA 3KIPA 1PJAA 3VO8A 1P3DA 3EQ9A 1WULS 2X5XA 4NMMA 4PX2A 4LF6B 1PJQA 3DOFA 2FSHA 1DFIA 2DHEA 2QR2A 2WD7B 3KYCA 1OWMA 1FMFA 1U2SA 1XTBA 3IKLA 2G9RA 2N42A 2O52A 3KPUA 4OUDB 4X60A 3V1KA 5DNCA 4MI6A 2CD7A 3USZA 1KHTA 1Z4IA 3WGUA 5KJFA 5G4KA 2QP9X 2RGXA 4JUBA 3SIRA 1VMEA 3I2FA 1J8VA 3QBTA 2FZGA 3RAGA 1O96A 2Y92A 4D44A 4BQRA 1RQNA 1RNLA 3GRZA 3MJFA 4IMIB 3VUEA 5KYKA 3A1NA 2E2WA 3RVJA 4BLVA 3EMKA 1ZRNA 2KWIA 2O8BB 1KOFA 3ET5A 4QFBA 3CTMA 5CYPA 4QDJA 2BBOA 1IN4A 2TYSB 4P5EA 3WRXA 1BFDA 3U3DA 1HRDA 1R1DA 2HMTA 4GLBA 4LNUA 4CM9A 1IHPA 1XDGA 2YQ5A 1OA0A 5TDHA 3ZCTA 1UM9B 2AQKA 3FMOB 3AO0B 1NBAA 1BVYF 3VM6A 3ORRA 4YDQA 3B48A 5IVPA 1L4BA 1XZAA 3GLFE 2IZ7A 3DPUA 4AF8A 5AJHA 1S02A 6ABPA 1H2XA 1KS9A 4O2AF 4PLVA 1V1MA 1X94A 1UKZA 3IEXA 5IT4A 3FSGD 3IIMA 3MT9A 3O26A 3AM4A 3INTA 3FKSA 1Z2CA 3FAZA 2C57A 1W4LA 3P0FA 3T3OA 1A5AB 2V03A 4A0GA 1WU7A 4OL0A 2H4WA 4L8VA 3M82A 1XZEA 4R16A 1N6OA 1BX3A 1TMOA 3IQGX 1A9RA 1E9EA 2WHRA 4EOGA 2HV8A 1MMFB 1PEAA 3KVOA 3PEFA 4EKDA 2IZ1A 2PMCA 3ES9A 2WHQA 3GFFA 3LXXA 5EMMA 4DXDA 3AF4A 4LOHA 3VSAA 4B4WA 4DVGA 4EDFA 4O59O 2E5FA 2P2NA 2OCLA 3AESB 1E1RD 3CSDA 2W48A 2DR3A 4YWHA 3U4AA 1Y34E 2GK6A 3BCRA 5DGDA 2W4IA 2FHPA 2BY4A 3GDOA 1DTWA 3QWHA 4S1PA 4U1RA 5DXAA 4XVCA 4D26A 1AKWA 2B4YA 1Q6ZA 5BSGA 1KI2A 2C04A 2DT8A 1GSOA 1S01A 2HAEA 1LDGA 2BGJA 2JBAA 1NJ5A 1T4CA 2PQ0A 1A9YA 1SHZA 3BWYA 3VZRA 2E21A 3KZCA 1H9AA 3WWPA 2ZUFA 3WLHA 3FCEA 1UJMA 3EEBA 2OZEA 5HCNA 3SJUA 4JCCA 5F4BA 3RROA 1M7HA 1RQ7A 4ZU3A 3H5AA 3QFTA 3UFXB 2FWNA 1FUKA 1DT5A 2IYQA 3NX4A 5HE9A 3ESCA 1QO7A 3F0TA 4QXQA 3I1IA 2O2HA 5MFZA 1SCKA 3CH7A 4FFLA 4XLLA 1O5OA 1IDOA 1IVSA 1QR6A 1Q0LA 1RW4A 3A6HA 2OFWA 3EN0A 4GMFA 2WDZA 3LBFA 3HWRA 4XQCA 1JIJA 1T4BA 5EZQA 3WTBA 4S04A 2Y2UA 3W8NA 4MUJA 2PFGA 4MLCA 4JBYA 1KK0A 4MZXA 1TGYA 1HK7A 1S9HA 2OGSA 2V8BA 4YXWA 1O6FA 1KE1A 4EUSA 5AVUA 4NZYA 2ZYIA 3BUSA 1S8FA 4ACAA 1OX4A 5TPWA 4EUNA 2CHUA 4WLUA 1Z12A 4RA6A 4YV0A 1XQVA 1GL7A 3H8WA 1WXEA 4R8SA 2IXTA 4KRFA 4RV9A 4N5MA 5F9MA 4ZEMA 4FS3A 2H07A 4WHMA 3IP6A 2Y9PB 2CNKA 3EXFA 2GSDA 1KR2A 1GO2A 1N4AA 4QBKA 5AICA 5I8PA 1EX9A 2GVNA 1V1MB 2IFTA 3D6TB 4Z49A 4JI4B 4YK7A 2G09A 3BM5A 4I9GA 4B3HA 3PL1A 5LDDC 2YW9A 4K2AA 4D02A 4EJ6A 3HN2A 4UBJA 3ACDA 1R8SA 5ILOA 3C4QA 2ZIXA 1GAWA 1T1EA 3GX1A 3VR3D 4Y2XA 2GF9A 1U02A 4CCWA 1Y48E 1L3CA 4Y0VA 1DAGA 2IUEA 2WHXA 3MJCA 1GKKA 1LQTA 2I54A 5CU7A 2RAFA 3ZE9A 3BYZA 2YWCA 5BQ5A 1E9VA 1N3BA 1FDUA 1PSDA 1P1BA 5AW4A 3ERCA 4BNNA 2QDXA 4B82A 4MKFA 3NHSA 2IUYA 4L76A 4MV5A 1SAYA 4GX5A 3TOCA 2BMAA 4J7AA 4LZAA 4NBUA 2RHWA 3AKEA 3GFRA 2QZ9A 1EGMB 4KLRA 1C3JA 1GQYA 5KYNA 1WZ2A 1DTWB 1T10A 3GNQA 3JQAA 3NIFB 4R8RA 3UAGA 3MLAA 1Q83A 4FN4A 1X39A 1T25A 1VBKA 3PLRA 4WEOA 2NUBA 4XVRA 1PVDA 4KN8A 4MV6A 5AKLA 3QEMA 4BMVA 2JBAB 1T4CB 2ZYWX 2BGGA 3WQQA 1U2QA 1VL1A 4HNAA 1GU1A 4RNDB 1X87A 4R31A 2VK1A 4J1NA 2DGDA 3S44A 3R5SA 2QW8A 2G8NA 3OSZA 4RK6A 5DBEX 3TIXB 3LLSA 3BFXA 5ED0A 1JBKA 3ZHVA 3EGDA 1IWBB 3P71T 4XWGA 4QLBA 2HXYA 4AUNA 3TMAA 1H22A 4RKFA 4D3ZA 1HFJA 3R8CA 2M32A 1LDEA 1WMSA 3EGCA 4XDZA 4Y1EA 5E8RA 3C5CA 4D5GA 4BO0A 1K7SN 2ZKLA 4Y6SA 3TEJA 3ZE1B 2IBTA 4MRSA 4LXTA 2XZLA 3CLHA 4HPJB 1JQ5A 4ARUA 5F9HA 3DBRA 3CFYA 2AFVA 1V3UA 1H3NA 3PXCX 2ANBA 2EJUA 3R5HA 4ONEA 2JGAA 1V9SA 3HE3A 4V38A 3BXZA 2NXEA 4Q1AA 2Z56A 5TPWB 3TPFA 1RXCA 5HOQA 1T4GA 1D9ZA 4GU5A 1EHIA 2ACVA 4BKOA 10MHA 2GM3A 1Z63A 3IIJA 2PAFA 1J20A 2QM8A 3IBGA 1DOZA 4FYWA 2C5HA 1KEUA 1R6VA 1X7GA 4HAUA 4M87A 1A2QA 4A2WA 4ENUA 3RF7A 1EFHA 1E89A 2J4CA 3O1HB 1Z7WA 4BJHB 4GC9A 4GUDA 3HTXA 1T36B 1QQ5A 3ZD7A 4EMSA 4ZO6A 3TIGA 5HJEA 3L84A 2GQ0A 3HKBA 4PG4A 3RVMA 1ZBQA 4JI6B 2HU5A 2XNSA 4F71A 1SNYA 3T9EA 4LVOA 5DNDA 2ZIXB 3KWFA 3WMXA 3WISA 2QYSA 5LLTA 5DW3A 3OOHA 4YRSA 2AQ8A 2EZ9A 2Q7DA 1UBTS 1UT6A 2HJWA 3PF8A 2FRVA 2NVUA 1DKLA 4QT4A 2O2YA 5EIOA 2FN4A 4ZHQF 1F7VA 3LUPA 4KJZA 4LTMA 4JJGA 4EFDA 2OPBA 5BSFA 3IVMA 1X70A 3NWPA 1Q1GA 1VIDA 1E6EA 2EXXA 1GU7A 2TRSB 4XM1A 1J8YF 3OSUA 4DY4A 2PUCA 2IU6A 3NDBB 3TVYA 1FFSA 1UT5A 4ER3A 3GUCA 4HXYA 4CG0A 3LQRA 3UPDA 4B87A 2F3UA 1BYIA 2YN2A 2NXJA 5C8YB 4CMIB 4ZTZB 1N34B 4EK9A 3D9QX 2AQIA 2CLEB 5JG7A 1H6AA 2H1CA 5ECYA 5IHPA 3IELA 4LG1A 5KTRA 3VBEA 3SU8A 2HXGA 4CM9D 3B60A 1UBUS 2X86A 4C5BA 2WYWA 4UTXA 1XVIA 2XWQA 4XB6B 5IPFA 3OTGA 3GGPA 2WD8A 4CMAA 2Q7OE 1WUJS 1XNRB 4LRQA 2DPHA 3UMCA 3KDSE 4J9VA 4UVIA 4Y2YA 5KNBA 3THWA 4LSZA 2GD1O 5EP1A 3EGDB 1Z8FA 2J7KA 4C0WA 4UUNA 2QXTA 1BVRA 5JT1A 1S4MA 2OD7A 4KPUA 1AQNA 4IEEA 3AP1A 2WIDA 1FE8A 3EBOA 2PWBA 1KMCA 3IOMA 1X2EA 1WLYA 1JHRA 2X7JA 1J7JA 5ALZA 2BYTA 2QL5A 3B1WA 2B6NA 1FTQA 2Y8EA 5GM1A 4KHPB 3WLTA 2Q6IA 4L85A 2VTEA 2O54A 3C5VA 3PDHA 4NMWA 1XB2A 4ZT7A 3DBRB 1DARA 2Y27A 3JVVA 3M1YA 5LKAA 5ALFA 1L7XA 3PNMA 3AUJB 2DFTA 3WNQA 4MGKR 3ZJ5A 3P0EA 4ZT4A 5GOZA 1Z2EA 4FLMA 4M8NE 3LCRA 2HA6A 2P6OA 4TYPA 4OJTA 5L9AA 3O7WA 2GEFA 1PSZA 4U2KA 2GH1A 3SC2B 2PUEA 3EZ6A 3M81A 2RKWA 3HS3A 2IYUA 2W83A 2XMCA 3KEGA 4FILA 5GJBA 1ARZA 2FXVA 4NCHA 3SE7A 3I5YA 3W9SA 4G5QA 1JHXA 2GSWA 1RMYA 2YNMA 4R2JA 1H65A 4OI4A 3IE0A 2CCJA 3FWNA 5K03A 4PZCA 4XA8A 5A1TA 1E3WA 5BSTA 2FMKA 4YRLA 3REFA 3AIKA 3VR2A 4YYZA 3O3NB 3HKBB 4B3RB 2OBLA 1G21A 4C2UA 1TCAA 4B76A 5HIJA 3HXOA 2R6DA 4EQ6B 5BNFA 4J0JA 2FV8A 4PYKA 1QB8A 2XUKA 1OAKA 3AW8A 2BGLA 1N2HA 2XKBA 1NW4A 2NN3C 4RH0A 2FW7A 5AVXA 3H0CA 3FCXA 2NVUB 1CUUA 1JEOA 4BO8A 2J0UB 1D8AA 3CJQA 3HUUA 3MSXA 1MFZA 4PLZA 1XMQB 2Q0SA 3GGSA 2BE9A 1KDZA 2VRWA 2AMLA 1I2CA 1TW2A 5AVOA 5BR7A 3PUIA 3HL0A 1NI3A 2CUNA 2HH9A 4PINA 2PUAA 1P2UA 2GAJA 3WGZA 4BWVA 2WIAA 3LDFA 1KQNA 4NYIQ 1ZK2A 1VRWA 2CYAA 2P2GA 3UG6A 3ON5A 4YXWD 1JR3E 1KJWA 1M1YE 1RJ9B 2OBNA 2OWEA 3Q8MA 2P1DA 2QBYA 1M72A 1WOMA 2HV9A 2Y0DA 2ZR9A 1I4TD 2BEKA 3FMIA 4NECA 1VCNA 1QGDA 1AIPA 3AGPA 3EVDA 1I6MA 2Q2QA 1AHPA 1GP2A 1S3IA 1PBNA 3E1SA 3AKCA 1ORWA 5CT9A 3X1WA 1HM5A 3WAKA 3DL7A 4V3BA 4UTPA 1E4OA 3AVYA 2ZJ8A 4JT2A 1K75A 1WY5A 1CJVC 4WJLA 3MS2A 1BKSB 4C4RA 5AUPB 4Z7OB 1ANKA 4O4IB 2K5UA 2QMUA 3PNKA 3NRCA 1KY3A 4A5SA 2ZB8A 3HWSA 1I3OA 4RBNA 3CKMA 3VNRA 3AJAA 1DC6A 3WGOA 1MB0A 4R7TA 5EGNA 3GQBA 3S2IA 3V1NA 2QRJA 3GL9A 4D81A 4HUJA 2HHCA 4IIYA 3T1YB 1JEQA 3PR2B 4PPNA 1QGUA 2ZE6A 2ADFA 1H1DA 5E2AA 4BVFA 5I5EA 2EEPA 3N53A 2HL6A 1RXYA 5F4ZA 3T52A 2W11A 1YR6A 2NV6A 2TMGA 5JI3E 2EGHA 2F1OA 2VT7A 3NU1A 5HG0A 2XCSB 4INZA 5ARBA 3KAQA 4YDRA 1VC2A 3KQPA 3UT5A 1CC1S 5K8LA 3SYTA 1Z8DA 3M8KA 4HNTA 1NQXA 1LPPA 4MI3A 1C1XA 2Y93A 2DERA 1EVKA 3JQAD 2WZQA 2WJ6A 4BZPA 2DU8A 1VG1A 1X1RA 2Q6VA 1IJKA 1WG8A 3IIEA 2DLCX 1JDNA 4TTAA 1F1JA 1A1VA 1G21B 3FOEC 3L4BC 3TRFA 1TQHA 3B6IA 2Q46A 3FZEA 3SQMA 4NDZA 1BKDR 2XD4A 4HY3A 1ITZA 4PZ9A 1FP7A 1TLTA 2Y68A 1FFYA 3NHBA 2OCGA 4G0YA 2HK7A 2PG3A 4IKPA 1G5RA 1J09A 3NBAA 3GVHA 4N5HX 3OLQA 4P7GA 1IB6A 4ZP1A 4DQDA 4U7TB 1M33A 3ER6A 4JP2A 2J9RA 4A6PA 4MW0A 1JDUA 3PUXA 2PT7A 1D5WA 2B83A 2NM0A 2F8MA 4GF5A 2OAGA 4X1IA 4JB0A 4O08A 1JB9A 5FFFA 4LCJA 1AX9A 3KYDA 2PZKA 3PGMA 2QR5A 5B53A 3WO0A 4Y18A 4XTCS 1XU7A 3A9RA 4QE3A 2H0AA 3RSZA 2ZZMA 1G2PA 1LLUA 1QOPB 4FSXA 2LWIA 4KYVA 1IQPA 1GEEA 5E0KB 5NULA 3U81A 3NETA 2IYFA 2XT9A 3TNFA 1K6JA 4RPJA 4HVLA 3F9RA 4TLBA 1H9CA 4FHEA 4NZPA 4LHZA 1GM5A 5K2OA 4WBSA 1KZ7B 1UQUA 2AN4A 3ZY2A 4QL3A 1MJGM 5EL0A 4MMZB 3T7EA 2BGNA 3BT7A 2GNPA 1UBMS 2WKPA 1H5NA 4N7RA 4NEHB 5C5EA 4MH0R 2YJ4A 3IL2A 5SYNA 4JLJA 4M60A 1H2YA 1RC0A 1W8IA 3CJTA 2ZM6B 4BFVA 3NNNA 2OO5A 3NBXX 4PVDA 4AJ1A 4DGQA 4CEIA 5K05A 2OD2A 2ADOA 3GF4A 1PIWA 3SX0A 2ZI9A 2OYRA 1RRFA 1F2UA 3HJBA 4K40A 1EFVA 3LA8A 1C8VB 4UW9A 5JH7A 1Q91A 1WPRA 5EZYA 4IV8A 3ZK8A 3K72B 2WWVD 4L78A 2Y1EA 1PN3A 1XK7A 3OTWA 5B3KA 1NW8A 4D4MA 4QELA 1M9NA 1H8EA 4J8PA 4HR7A 1G19A 4MLZA 5DM2A 3M2TA 4DMKA 1QGUB 2JGDA 2YJTD 5DK4A 1J00A 5LQUA 2FPSA 3E7WA 1CF9A 1E0SA 2XDYA 4UCFA 5ERYA 4WXRA 5LYJA 1QVAA 3V4FA 1G291 3QLTA 1G5QA 1YD7A 2Y76A 3A14A 3BF7A 3BULA 4TRNA 3ZLVA 1SCAA 5BPHA 5A6SB 4ZPJA 1EUCA 3P4UA 4LX8A 3JZAA 4PLFA 2WDPA 4LC9A 3H04A 4BQSA 3AEXA 4I8XA 4MHSA 2YXLA 2GRJA 1C1XB 4P83A 4DLWA 3FYHA 4MW6A 4CDRA 5KOHB 1FTWA 4INPA 4C05A 2OC4A 2I4LA 3N76A 4R1MA 2RHOA 4N3GA 4QGGA 2PS9A 5HGXA 1JDTA 5GP1A 2K7FA 5DHPA 2FCRA 1AZTA 1R6AA 1Z08A 4XLTA 4MULA 4L50A 3RTDA 3KM0A 4WLFA 5FL3A 4E5UA 3LUGA 1XOIA 2BD0A 2VJPA 2HTFA 3LBYA 3PIIA 4MUKA 4AW9A 5E7JA 1HLPA 4BMDA 2EGGA 5DYNA 5CCXA 1NJ8A 1SU6A 2C2YA 2QTZA 4HB2A 5AOVA 1QFJA 3DLBA 4MPTA 4C7MA 2XMPA 4DW8A 1A8IA 3OC0A 3KYDB 3L4JA 3ZKWA 5AK0A 3VPBA 4DCUA 1U7DA 1TU4A 2H52A 2O14A 4MVJA 2IBMA 1NW6A 2HU8A 1V35A 3IOBA 1SD2A 3Q8XB 2Y3IA 4JLNA 4C4PA 3V3KA 1AUVA 1MAHA 3X3HA 1K7FB 4KWCA 2Q5JA 3NWEA 4EYOA 2A5FA 2X6QA 3PHIA 2CCKA 1D2AA 3VNAA 2F8SA 1VE3A 5I7EA 1S7GA 3T7IA 1G2IA 4FFSA 3OWXA 3TQTA 1G59A 1M2HA 1Z29A 5IABA 4FE3A 1XMVA 2XUFA 4XPIB 5C31A 1U6JA 1OXBB 1PWZA 2AH5A 1PJCA 2K2QB 3SP1A 4B3DA 2GZSA 2GXSA 3A06A 5FUXA 3C7CB 4NFSA 1F2UB 1XJ0A 5BSWA 3T54A 3NYQA 1EFVB 1BE1A 3AU8A 3EXEA 3AWIA 3QU5A 1HQDA 4J3JA 1AUQA 1BW9A 2AIRA 2H1VA 2BKUA 2UZIR 3NVAA 4IS2A 5AKEA 5EZYB 4F2HA 1SHKA 3HCRA 4LOAA 4GP7A 5DGCA 3MJEA 3AEKB 4DSTA 3ITNA 2ECOA 5A3JA 2ZBEA 3BGOS 3BD8A 1ECFA 2D4HA 1D3AA 4RPCA 4DLYA 3T3MB 1F2TA 4G63A 4OHFA 1U0HC 2E37A 2GPYA 4L6CA 4OEHA 4TTTS 1PT8A 5E7IA 2OFFA 4GUAA 5A1JA 2H4ZA 3JASA 1VKHA 3ISJA 1EUCB 1LS6A 2M9MA 3G1UA 4PCLA 3S81A 1RYMA 1Z13A 3G9QA 4JXZA 3O73A 4X0EA 1L4MA 1V25A 3QA9A 2OFXA 2IJGX 4XTRA 4TM7A 3TOXA 1QCZA 2V3CC 1NSYA 2H2GA 3E0XA 2P9HA 3D8RA 4QTZA 4Y9TA 4K9SA 3M3DA 2E49A 1D04A 1A2BA 2CW5A 4OM7A 5M29A 5K3SA 3BMOA 5KKCA 4EFLA 2B1IA 3L1VA 2VDWA 4M7RA 3ZQ4A 4EJSC 4D9FA 4XYBA 1NBHA 1ZVJA 4KZKA 1Z68A 2ZIWB 1JILA 2YRXA 3WOVA 1NP3A 2COUA 1KDVA 1YBHA 4AIRA 3TW8A 1UK9A 2X0JA 4NU0A 1I7DA 4A10A 1EQUA 4ETMA 4JT8A 5I7HA 2C9BA 2B36A 1ZU5A 4DDTA 3RG2A 4GXTA 4LOIA 1JR6A 4HXFB 1AXRA 1F0YA 1N7HA 1OU4A 1Z28A 1QS0A 3H84A 4J3FA 3S70A 3VGPA 1KMMA 2NZVG 1Q7CA 3N7AA 4HZUB 3AFHA 4HQ0A 1KS2A 3K70D 3P96A 1QTRA 2ORVA 2TMKA 3K0CA 4RGBA 4YRDA 1AM4D 1Z4KA 4GO1A 5JVDB 5B1DA 4D56A 3ZDBA 3QXHA 3C43A 1UBGA 1ULSA 3PQDA 3ZWMA 2I99A 2QRHA 4RSHA 1L1FA 3VYTB 3ONNA 2VBCA 4UVDA 2IE8A 2C20A 1YL5A 1FB5A 1OGYA 4GZ5A 2JIOA 4O4LA 4ZDWA 3HRIA 2QV7A 4ZVNA 3ROKA 3W6OA 3R0VA 2FYTA 5BNWA 3LQ1A 2GKSA 4LMAA 3T12A 1S2MA 1Y4SA 2FP4B 4HBGA 3LPCA 4RHUA 3TGLA 1VSVA 3GUVA 4MP3A 1DELA 5F2KA 3PA8A 1OFHA 1PCXA 3EMDA 5KOJA 2IF2A 3IDSA 1CW2B 3OIUA 1EXVA 2JVIA 2RBKA 4NG5A 5B3AA 3PC8C 4ODIA 1U7WA 2QLJA 1VYHA 4XGKA 4DQXA 1RYHA 2RGCA 4QOHA 3GXBA 1GCAA 3RSQA 1HL7A 1JSZA 3FOBA 3R6GA 4GM0A 3WJ1A 1KJ9A 2GZHA 2MSKA 3KKQA 1NN1A 1TFUA 4HNUA 1EA7A 5JNLA 2AE2A 4QUJA 2IIVA 3EMVA 4R2HA 4KX3A 1UBSB 1KI6B 1GAQA 1AMOA 3DVQX 3GA0A 1RSZA 2IZ6A 2A78A 1R16A 4DNQA 2OM2A 1IWPB 4MYUA 4UKDA 1S3SA 3RC8A 5JJKA 2I62A 1OGIA 4RZQA 4FYPA 1G98A 1R00A 3B53X 1AK1A 1NOJA 4B4DA 1TFRA 2B7LA 3K0SA 5DE3A 3ZVKA 4LYDA 3KUKA 3T3HA 3IAEA 2XXAA 1ONSA 3T7RA 1AKVA 1LUAA 1Y3AA 2V54A 1CZLA 3NAGA 4AURA 3DUWA 4QJIA 2VDWB 3OKFA 4DIUA 5BSKA 1Z4QA 2I66A 2ZWVA 1TB4A 1JG4A 2R8PA 1HZZC 4BY9E 4O25A 1B2LA 2WTAA 2ZREA 4O2BB 3BL5A 2BKLA 2YV5A 4JP3A 2YIMA 3C41J 1B8NA 3RW9A 3QV1A 3G0OA 3Q3HA 3A3KA 3A6EA 1UJCA 4AJOA 3AOEC 3BFJA 5A0VA 1CERA 2DECA 2VP6A 3R8XA 4Z3OA 1K3UB 5BQXA 2QMYA 3ZQUA 3R6TA 5ALOA 2HT1A 1H8ED 2BHNA 1QE3A 2HJGA 1YQXA 1GTMA 2FPOA 3E05A 2R4TA 3LA6A 3MM4A 4LXXA 4MRMA 1P77A 2NO4A 2NTEA 1KJYA 1PEYA 3BGVA 3Q7SA 3ZG6A 1K0FA 3DS8A 5LMZA 2V4ZA 4PPQA 3CISA 3IESA 3N74A 1QYDA 4WLNA 2J9YB 2RB5A 5CJPA 1GKIA 1EP9A 4G9GA 3HJHA 1LGYA 5EAIA 4P93A 3T1OA 2WMDA 2VAVA 5CAEA 4F97A 1ZUHA 4BWYA 2QX9A 3FNBA 1I9GA 1U3DA 1UMBA 4JEIA 4Q4JA 5JLAA 4O3MA 4W6QA 4DEYA 2PGDA 2VBGA 2WP0A 3E7XA 4I50B 4LJ9A 3ASZA 2C98A 1U04A 2ZU6A 2Z4TA 3F6BX 4NFYA 1ORHA 4WWHA 4NYJQ 1AO0A 1SURA 3JZDA 2NTYC 1XD2A 1DO8A 1L7AA 1J5PA 2A9FA 3LP5A 3LS2A 3ZW8A 3WGHA 3D6HA 3KZOA 1LKZA 5JHGB 2QRGA 1A7UA 4ZQHA 1KE2A 4TQUS 1A8HA 2IS1A 2EJWA 1UAGA 4J03A 1N0VC 4A23A 1T2DA 2B20A 4CCYA 2GMWA 2FPKA 1VFPA 2YY7A 4GLJA 2HNKA 2NZ8A 4C0HA 2NUPA 2Y1FA 5NLLA 3G9TA 2AMJA 2R6AA 2G4VA 2AZTA 1QG6A 2X8JA 1HQCA 1XR3A 4J0FA 4DDWA 1SXPA 2W6PA 3SFZA 4UREA 3FFTA 4ZOCA 1I4LD 2GWHA 2DQZA 3ORYA 5LJLA 4LX0A 5K8UA 3MEQA 3DE2X 3H2JA 1VGRA 4L9RA 2NU8A 2JF0A 3H16A 2IY9A 3O93A 1U0SY 1D6NA 4QXPA 1KY2A 1EGHA 1U7HA 3MYRA 4HX9A 3TBKA 1D03A 1VZ2A 2B1GA 2QENA 2UUPA 3LYHA 3DCJA 2B9VA 1F6WA 3OURA 4OYLA 4E6EA 3L4KA 1XVVA 2E1PA 5FUWA 5DJ5A 2IS2A 1GCIA 1ZVQA 1E3DA 3PL5A 2J6HA 4HRVA 3PIRA 3DBHB 4HNSA 1NM5C 2BT4A 3GLHE 2A1IA 4INJA 1ML4A 4LRYA 4X24A 4WZBB 1ISJA 2GVDC 2QUJA 4B3MB 1NE7A 3S1LA 4E13A 1Q95A 3A4MA 4NX2A 4RF5A 5BV2P 1YVPA 1XHEA 3TCKA 1MKYA 3ITKA 3GO4A 2LDXA 5E7QA 3JARA 3AUXA 3P9PA 1DQSA 2YX1A 2E4YA 3BB1A 1U2ZA 1P5ZB 2OSBA 3CHYA 3GN2A 1FFCA 2PBLA 3EH2A 3VPAA 1F17A 2BI4A 3DD1A 1LDMA 1VDMA 2QX4A 3KKZA 2D8MA 2VH5R 2ZE8A 2RKBA 1IBSA 1E2JA 3JQPA 4MRMB 5DW0A 1RP7A 3ET4A 4ZXFA 3WL3A 2H5JA 4UFOA 3E2IA 4NWIA 1E58A 4HEHA 2RI1A 1M2OA 4C3VA 1NBMD 1VBNA 3SBDA 1JVNA 5A4AA 3KU4A 4C0XA 1HKUA 4H3VA 5EG5A 5FIUA 5FBKA 4EG3A 5B6JA 1HURA 3Q12A 5M5BA 1UMBB 2IXDA 4Q4JB 1F8UA 3K9HA 1RPZA 5ABPA 4LQLA 3HY6A 2OLJA 3IQZA 3D3NA 2JFZA 1XGKA 4UZSA 1NXSA 3EDOA 1MXFA 1QCDA 3BREA 3A1EA 2O05A 2RG1A 3K20A 4Y2PA 3ZDAA 2QHXA 3DAHA 1ODFA 1JA1A 4Q3NA 1UKBA 1ZX1A 1QC5B 2FSFA 3UBMA 4ZDKA 2CXOA 3DFZA 1LFAA 1K7EB 3OUTA 1V16B 3CUEF 3D43A 5A03A 1Q74A 1G7RA 3SIWA 4CCYB 3MBIA 3WLPA 5DT9A 2QJFA 2ZQZA 5C4GB 1WXWA 4FFOA 4WEQA 1RLTA 2NUPB 4WK4B 4J0IA 3CV3A 4RTLA 3HSSA 5IKXA 1A5ZA 3AONB 5E7MA 3VOAA 4KI0A 1CDZA 1EEXB 3GEHA 5JXWA 4ER5A 3X2EA 2RIRA 5ITZB 5JMTA 1PQYA 1U8TA 1Q2UA 1LPSA 5B7QA 2X4IA 4YJDA 4KYUA 2YWGA 1JLHA 3QE0A 4KQ6A 4DUGA 5AKYA 4IUYA 2V9ZA 5B12A 2J3IA 3F1KA 3IAFA 3HJCA 5DXJA 4WBNA 4MW7A 3RSHA 1R8JA 4CMEA 1GPDG 1YZUA 3IDQA 4ZT6A 4CM7A 2X9QA 5LZ4A 1FK8A 4AY5A 1U80A 3OT5A 4Q7JB 2AFHA 3O8OA 5T67A 4F04A 3MT7A 1SBHA 2ZYHA 3RUCA 3GJRA 1AKRA 3B8HA 5EUQB 5KYUB 1R4ZA 5IC6A 4IIVA 4BMSA 1PFUA 4R9NA 3TNJA 3WC4A 3QMWA 3T5BA 3QEKA 3TSCA 3JQFA 3WLNA 4R0VA 2FPLA 3UENA 1SUFA 4HRAA 5EE3A 1RQLA 4E2ZA 1E79A 2V5UA 1F0KA 3ZE7A 4CFZA 2RHGB 4Y2GA 2I03A 4GZLA 4P8RA 2H3EA 2V65A 4CMCA 1KC3A 2BGUA 3C1OA 3WLOA 4KN6A 4KNVA 2GHTA 2JFOA 1Z0SA 1W36D 2NUAA 5IW8A 1RWWA 2VTDA 1A71A 3BIFA 4TUYB 4YXFA 3L77A 1J0DA 2UZ1A 1YZHA 3DW1X 2J7PA 1INLA 2A0XA 2HF9A 1JV2B 4BMPB 4ARCA 4D74A 3P19A 2VF4X 4NCXA 1YAJA 2JD1A 3EIQA 4YA6A 1COZA 1V8FA 1JRLA 1M2OB 2ATVA 2FI1A 2YXDA 1QF6A 4FSHA 4IJ6A 2V4UA 1DNPA 1QV9A 1Y7IA 4KEAA 5KAPA 5DBHX 5DBGA 3WK6A 2PWAA 2XXAB 2C83A 4YY3B 4MWOA 1AS2A 2VAWA 1VL2A 3CWCA 3LNCA 5DFAA 3MXOA 5KINB 3C6BA 2HREA 4U9IS 4EX6A 4NENB 1PZGA 2X0FA 1BXRA 2WUVA 3QSGA 5B30A 1NN3A 2NU7A 4F4HA 1VPEA 2VO1A 5K8JB 3MSCA 4IHKA 2I4OA 1MOSA 2GN1A 3EQ7A 4KWIA 4YMHA 1XNQB 4YRMA 4N0PA 4XSGA 2JK0A 3FZGA 2D62A 2HC9A 4NAUA 3OP4A 1P18A 3GFGA 4LYGA 2MYNA 5ALPA 3V55A 3MQFA 4QASA 1CKEA 1KQ3A 2PIDA 2ZIFA 4MUMA 1X6VA 2A92A 5G02A 1MAUA 3WLQA 5F1KA 1MV8A 1NTRA 3ZU4A 3OZ7A 4NDNE 3OQ1A 4IDHA 2CZCA 2ZUWA 4MQEB 4NJMB 2I3GA 3HU5A 4EFNA 2JI4A 4JJ7A 4MA5A 4RVSA 4WY8A 1IEXA 4ARBA 4P36A 3Q5GA 2RHRA 4JBGA 4QOSA 4GOND 3CR8A 4I55B 4MICA 4RFVA 4Q01A 1XZDA 1VXOA 5CT8A 1UWLA 1Z17A 2JHFA 4AY6A 1DMSA 4I1SA 2BJHA 1QV6A 3BZBA 3D2AA 5L3QA 3IQHX 2XQFA 1Z5OA 3B85A 5AJYA 1RAIA 5IXSA 4NC9A 1L8XA 2O3TA 3KCNA 5CVUA 3U6KA 2PBRA 4U2CA 1DOAA 2CFCA 2HZ7A 4IYJA 1TK2A 4BCBA 2EYQA 2Y77A 1KBZA 5HFAA 3SIXA 4EHLA 1YS1X 3G0IA 1A04A 4XYGA 4WAUA 3GFOA 2I3DA 3D3QA 1DSSG 3O8OB 2FMUA 2VUHB 5EUBA 4BS9A 1R64A 1UANA 1ZK4A 3K6RA 4UOEA 2X1HA 1TKRA 1XTKA 2EQAA 1U99A 3RUAA 1JECA 2V7BA 3GAMA 4JASB 3SSOA 4EARA 1OXXK 4YRTA 3QI7A 1WHTB 2PKYX 3X2SA 4A2CA 3FCCA 3SNHA 2EBFX 2VNKA 3PUKA 1JSXA 1N1MA 1VLZA 3R0IA 3NUQA 2OVFA 1OZ0A 1ZVKA 2F1IA 4JOBA 1CRZA 2CMKA 2NU6B 3U7EB 1FYFA 2F00A 3DE1X 1WAMA 1MOQA 2OO3A 1BMDA 2IUFA 5DRTA 1FRNA 1V26A 3L6EA 1NAHA 2YIJA 3UMJA 3W2GA 5CPBA 1MX5A 2JFQA 4HDRA 3VU3A 2G63A 1GUDA 4BMOB 1Y8RB 3AVWA 1CYEA 4ES6A 5TGDA 1MCZA 1YJXA 3TLCA 3LW8A 1IUNA 4OKIA 4P9NA 1PFQA 3DV2A 4ZVLA 4B43A 5A0TA 4PFSA 1IC6A 1Y5MA 4CTKA 1YK0A 2R1TB 2GS9A 5IF9A 5IXJA 3IDZA 4CHGA 4PC2A 4AMUA 1WCIB 4YP1A 2ZATA 4MS3A 1MF7A 4XUCA 5FOUA 2VQ3A 5CG2A 1M2NA 2B9EA 1YBAA 4CG1A 4ZI2A 4JKYA 2BR3A 4HNRA 3BDAA 4BNTA 3EPJA 5BP7A 3DVAA 5EIXA 3ICEA 2QW0X 1BXRB 3F96A 3FCYA 1ND5A 1K8XB 1HEUA 2NU7B 2RMKA 2XQGA 2C5AA 4FJ0A 4W6ZA 5IC5A 3TKYA 3GAFA 3QUTA 4QGFA 4ZYTA 1H6BA 4KFSA 1EP1B 1SVUA 4B2YA 4TRJA 4JI0B 3FVRA 3EA5A 1R0CA 3KJZA 5ALVA 2AR9A 5ALSA 3R3YA 3TAXA 1D0IA 1V8ZA 3CYFA 3ESXA 3EPLA 2J3MA 3W1VA 4MK4A 1MIHA 5B36A 1PT9A 1N7IA 2APJA 3LL4A 5F5XA 3Q3IA 4TKVA 3HFJA 5FTWA 2FSUA 4UEJA 4PZLA 2FR8A 1V5WA 4DR6B 2JW5A 4R05A 1ZR2A 4D79A 3VR6H 1L0BA 4NP6A 1MXHA 3EW7A 4NK4A 5M3BA 5I7AA 3NB0A 3VHLB 1OYVA 1SOVA 2BFBB 5CR9A 3HNPA 3MOIA 1DC5A 1T9GR 3LDGA 2Z4RA 4BZQA 1XQ1A 3KXIA 2GJSA 3ZGZA 3GVCA 2VQSA 4N4AA 3WWEA 2W7TA 1JMVA 3LT4A 4OHOA 4LVNA 2IX9A 2GN0A 3C4VA 5AUQA 5K3BA 4F92B 2MMGA 4IZOA 1TGVA 4HGQA 1NI5A 1TM3E 3IKMB 3MCAA 2X9GA 3DSRA 3MBOA 2C4HA 4I1PA 4LZNA 3W78A 5F98A 3PFWO 1G63A 2C1ZA 1ESMA 4L02A 2QPTA 3SEAA 3QLEA 3OF5A 4FXOA 3WK9A 2DFNA 3PSAA 1GG9A 2R8YA 1A5TA 1GFSA 1DBRA 1MLDA 1XVAA 5CCDA 1R15A 2ZULA 4IDGA 2OESA 4C0JA 2G9NA 5JJBA 3MOSA 3SF8B 2MSLA 1VJ5A 1AGPA 3AFMA 2QT9A 3D4LA 4MWSA 4HDRB 4NV0A 4F06A 4XIIA 3ZPXA 3O83A 3GJZA 3TLMA 4BVAA 1PW5A 2V7VA 3CO5A 3NOXA 2AJBA 3FWYA 2Q4EA 4Q3AA 4B5LA 5BV1A 3PDIB 4L6AA 1UEXC 2REOA 1SVSA 2XCLA 3RT1A 4JB8A 3RS4A 2BF7A 3M5WA 4G01B 4QFCA 3EYAA 3U7RA 3BXGA 4Y1GA 5JQWA 5JJLA 3D3JA 3MTIA 4MS3B 3AGQA 4G0VA 5KSZA 4QODA 4RIFA 3DE3X 3ZHBA 4EZEA 4LYAA 2WJJA 3L46A 4MVJM 1BWRA 4OGWA 3S2ZA 2YMPA 3AINA 1SGWA 2A7QA 2HLPA 2EDCA 3IHWA 3F71A 3L43A 3WNVA 1GUFA 3VFDA 3EA0A 3CG0A 1MC5A 3QW4B 1WUYA 5F78A 4ZVUA 4JJAA 3JV7A 4B8ZA 5KCMA 1Z5UA 1JZTA 4KWTA 4YV2A 3BL6A 3HACA 2QVYX 3AEQA 2PK3A 3EVAA 2A0KA 2JAHA 3W2IA 4AJPA 3IKTA 5ALTA 3OQVA 1AUXA 5F12A 5DYTA 5G4LA 5LP6C 4DA8A 1T9DA 1MH9A 4PN3A 2IA5A 2V59A 1UDWA 2XBMA 1X7XA 1SCQA 1SPBS 2POCA 4BUZA 1L8OA 3QX3A 4IOJA 2ZSIA 2VUTA 4BGEA 4ND6A 1TYAE 5KYVA 3VSEA 4E30A 2UUOA 5CEEA 1BX1A 2WT4A 1I7PA 1I14A 2OCBA 2QJRA 3HNOA 2QRVA 4EKEA 3PNOA 2ZZKA 4JYMA 3T38A 3USCS 3ZCVA 5IFLA 2NP7A 1PS8A 5H68A 2RIPA 3VZCA 1B0PA 1XPOA 4CEHA 1XMPA 4BNMA 1I7LA 1CY1A 4DLVA 1ZIYA 2W6JD 1ZL0A 2CXSA 1HYBA 2J7PD 2PX2A 2Q99A 3AY0A 3Q6IA 4JBXA 2G4LA 3TBFA 5AW5A 4DLKA 1OE0A 2OXTA 3JAMA 1NF3A 3CLKA 3O0DA 4M4SA 2KQUA 3I62A 1VPTA 1ZMTA 2H06A 4CFSA 4M9QA 1SZDA 5JV5A 4C6HA 2X0DA 4EHNA 1ZHHA 3IPXA 2GN2A 2OEPA 3AJRA 5COBA 3CMMA 4RCZA 1QWSA 3A58B 5AW7A 4RWEA 2ONKA 1E2KA 2AG1A 5EQTA 5F5NA 4DPKA 5K3DA 4L5JA 4Z8YA 4Q03A 4M1QA 2WD9A 3WDMA 1CNEA 2WJAA 1OJLA 4LOJA 1Z34A 3V1LA 4RNCA 3RTGA 5KWEA 1Q7BA 2VXCA 3ILVA 5JH7F 4COOA 4PZDA 1OXUA 4HDQB 1ZJYA 2ARKA 5EZYF 1NP6A 1USVA 2YWHA 3RREA 1PKEA 4INAA 5KKAA 3T6KA 4QGBA 1H69A 3MRTA 2YFHA 2Q3HA 3EJWA 4QEDA 1ZR4A 1H4VB 1QWOA 1KWGA 2BEWA 4HNHA 2BP7A 3G2QA 4DDUA 4JLKA 4KYTA 5FWDA 3KBOA 5LYJF 1XRRA 5ALJA 4H4DA 4ACBA 2Y05A 1TKAA 4BYGA 1HR0B 4FW8A 1CYDA 1QRSA 4XEUA 1V6SA 1GTSA 3UJHA 2IS6A 2AB0A 2CUZA 2BEUA 4RD3A 1KYVA 4P38A 1O3YA 2XMBA 4HOYA 1XNGA 2CFOA 5DSZA 4BASA 1JQAA 5C4IA 3UOWA 2ZUBA 3PPIA 1CXZA 2BHSA 4MS1B 4WN9A 1M6VA 5THKA 2O7SA 4J49A 5LZ7A 1EUQA 1JHAA 3U3ZA 4N9QA 3UQYS 3AJEA 1YMQA 2Z30A 4AF6A 3H1TA 4RQTA 1NJ1A 4AK9A 2D06A 4G1MB 1WXDA 3GEEA 1DAOA 4U3JA 2EIHA 4MVJI 1YQ9A 3GFBA 4OOFA 5ALRA 4IILA 4F8JA 4OQFA 1E2BA 3MERA 4ANFA 3NEJA 4CIYA 5BRAA 5EP2A 3E1KA 4JX8A 1CQPA 1VI6A 3M2PA 2Z09A 4R98A 4Q00A 3JYHA 4RV4A 2ASEA 4X7RA 2FOXA 2H1FA 3LDHA 4MVJF 2IUTA 4C08A 2GYVA 3I05A 4EPVA 1AXGA 1U3VA 1EVZA 1QONA 2NYVA 1H2HA 2ZG6A 3HXPA 3E9MA 2UUBB 2PH5A 5CDUA 3JYLA 4KTVE 1U94A 4LHVA 2YJZA 3FI9A 2AE1A 3DQPA 4BC0A 1DX6A 4E5YA 3WSTA 5HM6A 4GGMX 2R84A 1ENOA 3ETJA 5CLLA 5AW1A 1CZRA 1BWQA 1SB9A 2VJDA 2WJWA 5IAEA 2OA0A 1OV4A 3EUFA 3RFUA 4LFBB 1C4WA 5DI3B 1HDXA 1OKKA 2FDRA 3O9ZA 4QPZA 3EVTA 2PH1A 6CHYA 3A36A 3STXA 4FN5A 3TZCA 5EIEA 4WJZA 3LK6A 3H4IA 3TLZA 5BT8A 4BFLA 1AKQA 1XQWA 3ONEA 2BCJQ 1USIA 3EHDA 5JSUA 3KJFA 2XCIA 3DKIA 4IDFA 3M6AA 2FRDA 3AY3A 3DOCA 3I34X 2PRZA 2Y1WA 2ZSHA 4P4SA 4BO9A 3UB2A 3KTFA 2QTRA 1YB7A 1AKMA 3KC2A 5KJ6A 2UZ3A 4EMBA 1LF0A 3W8RA 2JIZA 1JKXA 5CXUA 2BVNA 2VDNB 4V1CA 4DV6B 3ZVMA 3VKWA 2HSJA 3JD4A 1SC4A 1OLSB 1ZH4A 2DLDA 1AGRA 3Q6MA 2ADMA 1NX6A 4U5QA 1C81A 1TCUA 1JEJA 1RWXA 4JQOA 3UJ6A 1R0KA 1G60A 1JJAA 2VPWA 3QYFA 5I7RA 4FJ2A 3TB6A 3TGPA 3D3WB 1Z88A 3GYGA 4Q02A 3PX3A 1XTPA 2FE1A 3GP8A 2LIVA 2BEUB 3NS7A 5F51A 4DDKA 5FWXA 3E82A 4AU1A 1HE2A 4CV1A 4DV1B 1FNDA 3BICA 3CE6A 1HE3A 2PCJA 2VHJA 4E7OA 5KTKA 2ACEA 3D0KA 3LOPA 3Q4GA 2KX7A 2G5CA 1YKGA 2PSFA 2R6FA 1K8RA 2PLRA 1KYTA 5AI4A 1DI0A 4O1MA 2DWUA 1LS1A 3N0VA 4N39A 4QUDA 1G6HA 5K0FA 4RY0A 1ETHA 3U3KA 1OTYA 5BV8A 4YAJA 4MROA 5GV8A 13PKA 3L05A 1PUXA 4IQGA 1E1DA 3HZZA 2VPYA 2BFPA 4DLZA 5CCEA 1VRCA 1H3FA 4X1YB 3STYA 4E70A 2R96A 3B1FA 3E8MA 2Q0XA 2R1VA 4JL6A 3FBGA 4I4LA 1P2TA 1AS3A 1TQ2A 1Y8CA 2AQHA 2XQKA 2YINC 1KZYC 2YHAA 3E5MA 3K4HA 3MWYW 4AX8A 3GCXA 2CUKA 5IJ9A 3EXIA 3NC4A 4DANA 1DIGA 2AX3A 2CC2A 3DT8A 5CGQB 2WI8A 4QBIA 3VTZA 3VKHA 2QSZA 3QKSB 3OE7A 1YIAA 3HGMA 4ZEWA 4GI5A 4R1OA 1MABB 1NL3A 3ND6A 1RWOA 5K0SA 4YR7A 2JK1A 1GWNA 1M7GA 1IRXA 5D5PA 1N5OX 5I7WA 1BEUB 3KJGA 1O0CA 4NMXB 5ETJA 4O4LF 1HG1A 1ZKMA 3GUZA 2W2MA 2Z1NA 2PD4A 3K1AB 4QGHA 4UVHA 4ZCTA 1F06A 5K0BA 3EXG1 1I94B 3W06A 4X91A 3F5MA 2Z83A 4M7WA 4QQNA 3IP5A 4KXQA 3UMMA 3HDJA 3SJCA 2Z3WA 2IEAA 1V5GA 5GGYA 1T4DA 4N5IX 3SEFA 4GHWA 2AFIE 1NT2A 2GBFA 3HBMA 4C01A 1SXIA 3CRZA 1J5EB 5A4KA 1EHCA 1QHIA 1R9GA 3RHZA 3LVBA 5CFMA 5EKSA 1H3EA 1E9BA 5G0WA 4HDNB 1XJWA 2UDPA 2R1UA 5DNYB 3GI1A 3HEMA 4KXLA 4UBOA 5JCOA 1EAMA 4RVHA 1HT2E 3T3NA 1ZMRA 1U3WA 2OP0A 4Q82A 1K1EA 4N18A 4FDTA 4M76B 1V48A 3F6YA 5K0EA 4TQ9A 1G4AE 3R0QA 5HMMA 1J97A 3IEIA 4JLMA 2ORYA 3PTLA 4OQPA 1KDYA 3HO8A 4B85A 4DM3A 4EAQA 1ZITA 3GDWA 4K9NA 2W2XA 1VHWA 5LC1A 3GCWA 5BN1A 3JD2A 1BMQA 4MUFA 5FWXB 2HMWA 3V5NA 1G8YA 1AZLA 3EQZA 3GG9A 3IQXA 3TTXA 1Z6PA 3GLGA 3L9XA 1ZHOA 4A36A 1JF8A 2JD2A 3IRUA 5FORA 3EGEA 1H2FA 2A9KA 2IYSA 2Q5EA 2AJ8A 4XOIA 2CHQA 3LO5A 4CVNA 2DR0A 1PYOA 3G7SA 1TCCA 3RU7A 3JQ7A 4POOA 4P92A 4EVSA 4F4JA 3QWBA 3QU2A 4CF4A 5J23A 2AI1A 2ZVDA 2A6PA 4LJSA 3K2EA 3OZRA 4M22A 4Q7QA 3HY4A 4YJ2A 2YXNA 3GP3A 5TMEA 1YR2A 5KPJA 4H0FA 4MRPA 4XVHA 3GZTB 3WLRA 1I7NA 4RHXA 3VDMA 4P84A 2GZ3A 2H5IA 3BJRA 4UCWA 2OQIA 1Z0JA 2PRJA 3ZDYB 1YMUA 5AM2A 9LDBA 4LJ5A 2P62A 5H83A 1K9SA 3KQNA 4LZJA 5G1PA 3HVIA 2HNBA 4A16A 3HP1A 4NYIR 4GOJA 2EW2A 2OV3A 2R25B 1LVUA 4HKTA 5DP1A 4OK3A 3CLSD 2WFLB 1O97C 2FLWA 3QLVC 4I3FA 2YS7A 1REQB 4AJLA 4FEYA 4MCHA 2IHVA 4N6OA 3RTAA 3EY4A 4ZIRA 5HM8A 1IK4A 1Y8QA 1PWYE 5LBUA 4QFMA 3M6LA 3EAGA 2SKCA 2XEDA 4BTEA 5KX5A 3JRXA 2WUDA 2ECFA 5ISMA 1Y4ZA 2JFGA 1TADA 2XA9A 4YCJA 3U1BA 1RD4A 2LGJA 3GLQA 1L5GB 1ZSYA 3AERA 3TS1A 3MJSA 1EU1A 1GNQA 1MO5A 2I2WA 3FLMA 2P4QA 3AVQA 4L9WA 4OU4A 4BE7B 4BKMA 4F2WA 4R1PA 1PJRA 3Q3CA 4LF8B 1KBOA 2H6EA 3ESRA 3EAFA 3VR1A 5KSWB 1BE0A 1LZKA 4GBGA 4Y2QA 4RJKA 4PLTA 1N5IA 1G8AA 1Z5ZA 1Z0KA 4GR9A 4JVLA 5DGTA 3UOGA 3WVNA 5IZ4A 2RGNC 5CHYA 3SVZA 1OMOA 2XQVA 5I5GA 2PXXA 4NATA 2UKDA 3PPXA 2PA3A 4MWDA 3UAWA 3G49A 1GYQA 3T3EA 2UYYA 1ISPA 3ANTA 4QREA 3N2ZB 4CU2A 2IS4A 1TZKA 1GDDA 4Q3KA 4B8WA 1X8JA 4GMHA 2ZB2A 3U7HB 6LDHA 3HKCA 4FMDB 1HUQA 3EIEA 1SQSA 4Q9IA 3B5JA 1QKIA 1E8DA 2P9BA 3GW8A 1M66A 2OGWA 2PT6A 4DIFA 2B2CA 2YXEA 1XZFA 4NJEB 1IFXA 3U9LA 5DTIA 2AN5A 3TLYA 4Z1MA 1HXHA 4CLRA 5KVQA 1X1TA 3GLGB 3SM9A 3DZBA 3R4CA 2FK8A 1WXGA 4M0MA 3N6RA 1DB3A 1YZFA 4S1TA 4WL0A 1QYRA 4WE3A 3SGLA 1M34A 4FBGA 3SMQA 1BJTA 1MA0A 2B34A 3JQ7B 2E4VA 1X92A 2Q2NA 3EK2A 3RG8A 2V7UA 3K6SA 4CQMA 4LXQA 2C77A 1NVKA 2QN8A 1XWFA 1SVIA 5IC4A 1R0WA 2H7XA 2NVWA 2PGOA 4YJ2B 3NANA 4WTOA 4PGGA 3WGGA 2Q28A 3PX2A 2I8LA 4Z86A 4WZAE 5H9WA 2GJ4A 3I4FA 2UVQA 1XZJA 4Q47A 2AWNA 3HRKA 2XX3A 1A82A 5DK6A 4FT4A 3TZLA 1C14A 4FQ5A 2PV7A 1XD8A 2P5YA 3VV2A 4NFLA 4JJ4A 2QW1A 1DXYA 3O8DA 3B89A 3ELYA 4N3CA 4Y6LA 2WJZB 1LW7A 3NIGB 3OY2A 2B4AA 3ADCA 1YTLA 2BFAA 2FJPA 4ZGGA 1C0KA 4MKZA 3BTUA 3ROFA 5JR3A 2JGNA 4EEZA 5JZBA 2A88A 2XTNA 2LCIA 1Y8QB 3VRHA 3EXAA 4IIJA 4X6LA 1UPFA 2CKMA 5CB0A 4GH5A 5JALA 2W58A 2Y4OA 1GPNA 1QLHA 3KPVA 3PEVA 5LN1A 1G8FA 3MTEA 4RE5A 3CVVA 1TUBB 2VNAA 1DIBA 3H11B 4I5DA 2JCXA 1VGVA 3KOZA 4V0MA 4QWWA 4XB1A 1NKTA 4XASA 3S5UA 1Q1EA 3O5AA 1DRWA 5A5FA 3O3OB 4GKVA 3V3TA 3ABIA 5CB8A 1AMNA 4HXEB 2IODA 2JIPA 3DZIA 3EZGA 5DVZA 1LU9A 1C7FA 3W77A 4C2AA 4EW1A 1IATA 5LOVB 5DHSA 1P7ZA 1DC4A 4NU8X 3EEFA 4V2UA 5JZSA 4N82A 3GT3A 4ZV7A 1ESEA 2I80A 3NVDA 2AS0A 4UTZA 4INOA 3W5IA 3FF4A 2H7CA 5LSAA 4F72A 4C7VA 2M6RA 4OATA 4DYVA 3D7RA 4RA9B