1U3FA

Structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
164
Chain Sequence
MDKNALRKQILQKRMALSTIEKSHLDQKINQKLVAFLTPKPCIKTIALYEPIKNEVTFVDFFFEFLKINQIRAVYPKVISDTEIIFIDQETNTFEPNQIDCFLIPLVGFNKDNYRLGFGKGYYDRYLMQLTRQQPKIGIAYSFQKGDFLADPWDVQLDLIINDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-Methenyltetrahydrofolate Synthetase
publication title Crystal structure of methenyltetrahydrofolate synthetase from Mycoplasma pneumoniae (GI: 13508087) at 2.2 A resolution
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Ligase
total genus 44
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 1u3fA00
1WKCA 3HXTA 3HY3A 1SOUA 3HY6A 1U3GA 1SBQA 2JCBA 1YDMA 3HY4A 2G40A 1U3FA
chains in the Genus database with same CATH superfamily
2VYQA 1P9LA 5DRTA 3HUEA 1PJZA 4DJDC 4G8JA 2GJKA 4NI5A 4YQYA 2AKEA 5EIOA 3U9TA 4RC9A 2DJ5A 3RROA 3V8QA 5KYXB 3X2EA 1YB4A 1UBRS 4ZANA 2FSSA 1QYRA 2XNHA 2Z5GA 4MHTA 3THXB 1W5SA 3EZ9A 5IANA 1P2DA 4INPA 2JLRA 1WB4A 1DHTA 2GPBA 1TJNA 2H4FA 1VKOA 4MV3A 3HN7A 4HDRA 4WGGA 3W05A 1OI4A 2OQIA 3N3BC 1V5IA 2QN8A 1W4RA 3KFXA 4IX9A 4JC5A 4LXIA 2CY0A 4XIGS 1P91A 1U6KA 4D26A 1K08A 5JISA 1XLVA 4NK5A 4AJJA 2RC5A 2O3UA 2XX3A 4FYXA 3GYGA 1BAPA 5E9JA 1XV5A 3QVVA 1KI1A 3C5HA 3H1EA 3O8OA 5LDDC 3CM0A 3SVZA 2AFHA 2JI7A 3QJGA 1RE1A 4QGAA 1E3LA 2OXTA 4I08A 2WTXA 3EGDA 1X2EA 2HIHA 1DKRA 4CM4A 1N8KA 3EVZA 5DW3A 5FPPA 5A0FA 3U0VA 3U1BA 3CCCA 1CZRA 1BE1A 3FNHA 3PGJA 4JK3A 1UAAA 4BZZA 4ZQFA 3FDFA 4PRYA 2X0FA 1E3EA 3BXEA 2CL7X 4KQIA 4Y6LA 3FHJA 2ZPAA 1E2GA 1A7AA 5AICA 3R3JA 4FZJA 1IZZA 3CBGA 3VMMA 3QX9A 1JEOA 4EJSB 5BSHA 5FWXB 2O1SA 3QQPA 1ZM3A 4PBTA 2DUJA 1EUDA 2P8SA 4AROA 4XGRA 2X0IA 1MNQA 2W98A 3PYXA 4DBLE 1UJBA 1H23A 4R98A 3T5DA 4KBYA 2AJCA 2Q49A 3HMKA 4JS0A 4E5PA 3RT9A 4U2FA 1D2HA 1N8NA 4J3JA 4RA9B 3RK4A 3IP9A 4RTKA 4ERXA 3MCVA 4OQQA 3KCNA 5LDGA 4HEHA 4P34A 5BNFA 2WMDA 3TW4A 4M60A 1XU4A 2QL7A 2QXYA 3NVAA 1R0YA 4RCYA 4TL7A 3IPCA 4GAEA 3GA0A 2G9NA 9ABPA 5JCPA 1FMJA 5E9AA 5ECDA 2Y1WA 1MW9X 1Z4MA 4LYHA 1A7KA 5LYJF 4TN1A 1B0PA 2W2KB 3R75A 4UHDA 1FVHA 2DQSA 1FQWA 1DBIA 1U2EA 2C7GA 5T4EA 1U2DA 4L95C 2W42A 2FPKA 2OG2A 2ZPTX 1GYPA 3QLTA 4G09A 3IQZA 4GGPA 1GAXA 1JBEA 3BRQA 3DEIA 4OG2A 1XMJA 2B5OA 2ZWIA 3NB0A 4UARA 4Z7OB 5K03A 2JGNA 5CCEA 2DXIA 1F8YA 2HCRA 2CJPA 1IJFA 2H52A 4CKCB 4R1UA 1QFSA 4FUTA 5IJXA 3VAYA 4DDHA 5DBGA 2QTVA 3GEIA 4P2GA 3UJ3X 2X0DA 2PKQO 4NS4A 3DOIA 1NVAA 1SUWA 1XTKA 5BSUA 3VHXA 2CUNA 4HDSA 1AV7A 1ML3A 1YC2A 2WU1A 3BMXA 3FZNA 4ROSA 3HA3A 1DKNA 5AKYA 3LWDA 5DN6D 4C0SA 4RV9A 5EESA 5AW1A 4K03A 2XMCA 4KQ9A 5KYXA 2QRGA 3NORA 5ALRA 2CNLA 4N5LA 1MVNA 2AX4A 1IHDA 2W93A 1R15A 3FVRA 4FDMA 2R6DA 1ZMXA 5ARDA 3CNNA 4FINA 5ICSA 3THXA 1NPDA 3G8CA 3STXA 4BGUA 5E9QA 2ZT8A 3P4XA 4EBFA 4M83A 1OFUX 4L4RA 4MRSA 1GKLA 2ZIFA 1DKLA 5I7UA 1ODKA 2BR5A 2C4NA 2GPWA 3IESA 3OICA 2JI4A 3EEFA 1GGVA 1HA3A 3LI2A 4F5YA 1Z45A 4YDRA 5T4FA 2PUJA 1NXVA 2O6LA 1JPUA 3AM4A 1RXIA 2E87A 3HDTA 3IQWA 4IZ6A 3S2IA 2QX4A 4E31A 4UM9B 4QEDA 3RIGA 3K0CC 1H2WA 1SA0B 1MFZA 2DFTA 2GBIA 3FNIA 4J2HA 4PZCA 4WN9B 2XBMA 4D25A 3QXXA 2C9OA 5GGXA 3MWFA 4CG3A 2V6JA 5EJ4A 1SO8A 3VNBA 4JQCA 4L0MA 1YBVA 4WOKA 5DM1A 1Q17A 1IBRA 5TV2A 3T41A 1Z9BA 3QK7A 4WBSA 5F23A 1VKZA 1I9GA 1SD1A 2B1QA 2WSSA 3OM8A 1ZR4A 1E2PA 1N2ZA 1YULA 2PU7A 3IUYA 4LVUA 4J0FA 4KH1A 1KSJA 2GI4A 4LYDA 3RU7A 4EJSA 5YASA 4KFSA 3FPFA 3ORHA 4IZHA 1UBTS 2NXEA 3IXMA 4KREA 1Z29A 4GI2A 1X1TA 2PX4A 3BA6A 5FOWA 1JT9A 3GNSA 4LX0A 5ADVA 1L7VC 1GY8A 1ZMBA 3EZFA 2PX6A 1IQUA 3ILYA 4O4JF 1FXWA 2X8AA 4J76A 2G5TA 1WF3A 2GA9A 1XDDA 4M1TA 1T3ZA 2I2WA 3GCWA 1NE2A 2B7LA 2JS7A 4ZOCA 2OL4A 4RA9A 4ZCLA 4CCYB 1GTRA 2M9MA 2R85A 4CI0B 1RPZA 1CQZA 3UTCA 1U7PA 3LF2A 3L04A 1ACMA 3LLMA 5JCXA 1HDGO 1MJHA 1EUZA 1ZK4A 4GO1A 3EMBA 3T7JA 1NX6A 2P2CA 5CFRA 1VPWA 2VYNA 2J41A 2W2KA 1RYHA 2ZYGA 3KPWA 2RGDA 3DEKA 5KAPA 1Z18A 5HS4A 2R25B 2PJDA 1E9VA 5JUWA 2ZT5A 1E98A 1Z8FA 3KSRA 3AG6A 4BO0A 3DFMA 1BMTA 3H9UA 3NTXA 2C82A 4Q9DA 4QU8A 5TPWB 4YRGA 5MN6A 2WWXA 3CEPB 3C45A 1QR2A 4QGGA 5JYDA 2X2FA 1O7JA 4ZI3A 1QX3A 1PUXA 4MP8A 1BN7A 3ZUGA 3R5HA 3VX4A 2QT9A 1QIHA 2WRZA 4M9SA 2PGAA 3RU9A 2AFRA 1IPEA 1BQEA 3RSGA 5JANA 4KE7A 2R8BA 1COWA 3Q12A 4IDBA 3RQSA 4GM1A 3QW2A 4M38A 2C96A 3W0LB 2CJXA 3LGAA 4KLRA 1NMXA 3A1WA 3OEHA 5JCOC 2J07A 3KTAB 5DYTA 4CTOA 1OBVA 2OMEA 1TIKA 1ZGAA 3CX8A 3Q85A 5BR7A 4B0PA 1K7EB 1EESA 2VPXA 2XOKA 3MHPA 3REGA 4PRLA 2H2IA 1NM5A 4LYJA 4JELA 1EQAA 4NPAA 1JQJC 4KTVE 4P7GA 1IQRA 5HEKA 2H1CA 1J1ZA 5DI9A 1VB5A 3NVKI 4F6RB 3BM5A 5IMSA 2PUFA 3ZQKA 4EZBA 5E7QA 1OFHA 5M5BA 1Y5IA 4YLYA 2O8BA 3OIFA 2OOKA 5K3DA 5L6LB 3O21A 2Q9UA 3MB5A 3N6RA 3EGVA 4M55A 5TF0A 2H1OA 1U3FA 3NHMA 4K1XA 4EJFA 2VHVA 1YFJA 3ZZMA 5D84A 4DWJA 3GLHE 4LDQA 1PVDA 4NZ9A 4W9NC 1L8LA 1VQ1A 2QSYA 1VLZA 2P9JA 4EVQA 1SVSA 4LNAA 3DQZA 1YZHA 4I4CA 1KOJA 3OJFA 4INOA 3W2GA 2HW8A 5IBQA 2P35A 1VBNA 1DBWA 1I7PA 2A92A 1KVSA 2MSEB 2RHRA 5ALDA 4GMDA 3IAEA 2R7AA 3A1VA 2X1LA 3HEAA 1SBCA 3LU1A 2AXEA 4V0LA 2OTCA 3KAJA 2YWBA 4XR9A 1FFSA 4YV7A 4DR7B 2CSXA 3B9PA 3ABSB 1JG1A 5K0BA 2W2LD 1GU1A 3VBEA 3WADA 3HNPA 3N8GA 5B7GA 5C1PA 2TMYA 1V43A 3G2JA 1LLFA 3QLUA 2NQTA 1P5JA 4U7WA 4Y67A 2MTBA 2HPHA 4NU0A 4BN5A 2PBZA 4XFKA 2PE5A 1MG5A 1W1WA 1HE8B 2ASVA 3IELA 4D45A 2D7DA 2EEPA 2YZ7A 5ALZA 4YEDA 2HNKA 3SM9A 2AN1A 3EG9B 2YV4A 1RWVA 1L8AA 2JJ2A 2Q4BA 3ZTWA 1YCFA 2D7JA 1K7CA 4IQFA 3DONA 3AF2A 1O0SA 3LX6A 3MBOA 5KDDA 4QU5A 1E4OA 3DULA 1EVIA 3KKKA 5IM4F 4GOMD 1MIOB 3DLCA 4G0OA 2ZWPA 3LIPA 4UVHA 2OXRA 2OV4A 2DWUA 2XHZA 3QMVA 1E4VA 3S2YA 2OP0A 2CWDA 4V0KA 4CL3A 1BVRA 2HU2A 1ORDA 2GYVA 3OO1A 3PQ3A 1KE1A 3ELWA 4WFIA 1KSGA 1HNZB 4MR7B 1CNMA 4NDAA 3C6KA 3OHMA 4YAGA 1EA7A 1NXWA 2CMHA 1M73E 2I7DA 2WJIA 4NDNE 1F2DA 2AA3A 3TZBA 5TPWA 4FM9A 2HDOA 4JZKA 5HPYB 4U2CA 3RD5A 4ZOLA 1OJLA 2ONYA 2IV2X 4DUGD 3KTFA 4AMZA 1P9NA 5B2FA 1G21B 2R65A 3UGJA 1FEZA 2C83A 3JASB 4HNGA 4OQDA 2XCQA 3PKZA 3BTOA 3UB3A 2LE0A 2KB0A 2YRWA 4QM6A 4OSPA 5CA1F 3RUPA 1N6NA 1OTXA 3ZS8A 2ZI5A 4X00A 1KVTA 1SVOA 3VDXA 3I45A 1D6MA 1WQ3A 3IMGA 4RPHA 3IBTA 2G0NA 1VHLA 1QSGA 3L01A 4DCUA 1E3IA 2LGJA 4KN5A 4L3VA 4HT3B 4JASB 4C14A 4CQJA 1ILWA 1E6UA 2QL5A 4A2WA 1LZKA 4NCBA 1MQ8B 2ZULA 3E1SA 4MJXA 3SJZA 5C1OA 2ZK7A 1E1QD 4JJ6A 3HU1A 1UJ4A 5D3KA 4BNJA 2Z09A 2GSWA 3FGNA 4Q7LA 4QM7A 2OCXA 1X7YB 3I2FA 1KMNA 4C3ZA 4F6RA 1NOJA 5LZ5A 1N2OA 2V03A 4TS4A 1E9EA 4KNYA 1INLA 1GL7A 2OWEA 1CNFA 1AGXA 5LL6P 4PO1A 3T7DA 4BASA 2AZDA 2H63A 3DE5X 2AYZA 3ZCTA 2XGGA 1EP1B 4OGGA 4X41A 2BKEA 1BCRB 4FQ5A 4X7BA 2OLEA 5JWOA 4ENVA 2FZLA 4L8GA 2B20A 2UYOA 2I7VA 2OAGA 3V1MA 1OAKA 4QHYA 3BB4A 1DC5A 3NDIA 2GPTA 4FZVA 2JFQA 4LWPA 4I1PA 3N6VA 5CFOA 1JQBA 1LSSA 2V7WA 1C8LA 3MJSA 3FF1A 4NVRA 4DEVA 1DCTA 2RAFA 3L7BA 2EQ5A 2CLHB 3CUKA 1DG3A 2ZYHA 1ZAKA 4YUWA 5H81A 2R44A 4HDQB 3WLMA 1GZVA 4TQAA 3L1JA 5I01A 3ENZA 4GPTA 3KR0A 4D3XA 4YMUA 4B33A 3TXAA 1KH1A 2QL6A 2WJGA 1C7IA 4WFQA 4ZAZA 1YHYA 4ZVPA 4K7JA 2IHYA 1O77A 2NYAA 4DR1B 1U02A 4PN3A 1KDTA 1OI2A 5KX5B 3GPLA 3RWMB 1YJQA 4B32A 1OB5A 2RB4A 2BGJA 4N0QA 4TT8A 4XQEA 4JC4A 3DWFA 4CKXA 4EBBA 1KPHA 2C2OA 3EG9A 4DQ0A 4GZ6A 4DY6A 4M7RA 5JHGB 1C9EA 3VR3A 4NMLA 1SXQA 1LDNA 3FCSB 2JAWA 3NC1C 5CDYA 1Q44A 4EVRA 3O4FA 2O2ZA 1RRVA 2WWFA 1MIOA 4D4HA 6YASA 1IBLB 3C8DA 2OECA 1HE1C 3EQ9A 3FHLA 4RNDB 4F9EA 2NO1A 4OHUA 3CXUA 2XUGA 1GNLA 1U1GA 2BCGY 3I9OA 1LPMA 4LHWA 3QX3A 4PFJA 4TMFA 3A0RB 3THWA 3D7LA 3Q7EA 4UU1A 1I0LA 1SPBS 4CTKA 2VP3A 1TT5B 4AJLA 4QLOA 3PR1A 3QPBA 4MR7A 4HQLA 3U39A 4RQUA 3AP3A 4DUPA 1OU4A 3TSCA 3AOEC 2FU5C 2BP7B 5ESWA 4I4LA 5JT1A 1JJIA 1ECGA 2PKRA 4LVCA 3CWZA 5DCYA 2GJ8A 3CX7A 3JASA 1NWCA 2IITA 3VR2D 3W2HA 5E1MA 5LN1A 1FP2A 4RDXA 3E7WA 1GPJA 4BLSA 1XLWA 2RAPA 2NUAB 2JFVA 3H1PA 3GLGB 5CK4A 1IN1A 3HQ4O 1XZJA 4Z2YA 4C7OB 2FPPB 5J4HA 1HE3A 3FFBA 3M4NA 4RH1A 2J3MA 2GLUA 3KU1A 2BD0A 4FYYA 1L1FA 1JB1A 2IUFA 3G5TA 3M6UA 1R8SA 4IIXA 2W2QA 3AB7A 4Y18A 5KNCA 3CVOA 5FFMA 1BU5A 3QXHA 4OFXA 2ODTX 1JIKA 3LA8A 1IVSA 5SYMA 5TEVA 1E2DA 1QHNA 5M2QA 1A5SB 3FPGA 4R2HA 1X7YA 2H4ZA 4RAOA 5JAUA 3F0TA 2JI8A 1PK8A 3NUGA 4YBZA 2QU8A 2PA0A 3CB4A 4D74A 1UP4A 4EZIA 4B8YA 1ZHFA 2Q0QA 2ZM6B 1M2JA 3CNQS 4FMPA 3R0XA 3L8MA 4KC0A 1S3FA 3H5OA 3PU6A 3KE8A 4PYQA 2G6BA 3OWXA 4MGKR 4BQOA 1MQ9A 3ZWYA 3D7SA 4KLCA 3P9YA 1BCRA 1M8FA 3L7YA 4Y1GA 1V9SA 2W70A 5K45A 3CLSD 4P4UA 3W5CA 2A7XA 4BGVA 3V7UA 3B5JA 3DGFC 3H5AA 4PX9A 5C8XA 3FYHA 4BNFA 2BFFB 3PQ5A 3QYFA 3UO8B 2O2YA 4U2DA 4ZI5A 2HPAA 2IZ5A 1SHLA 2VLBA 1KERA 1J70A 1SXJD 2AFHE 3VDNB 1ISHA 4TTIA 3W8FA 1PYDA 5ITWA 4WXEA 1PNQA 1W5FA 2JFNA 1E5XA 1EGVB 2VKQA 1Z28A 4RK1A 2VF8A 1BHQ1 2Y0CA 3EZLA 3KPUA 5JU6A 5K1ZA 4DSTA 1TRKA 1KYXA 4URHA 3I12A 4C04A 3O92A 3MC1A 4ALMA 2QUAA 5EP2A 5LUBA 1NJ5A 3AW8A 1WEHA 4WSOA 1WXIA 4MWDA 1PDVA 2VT3A 2V0GA 2O1WA 3MWYW 5KX5A 3JPYA 2GK4A 4H3VA 1CUCA 1Z0FA 4AUEA 4ND4A 4L02A 1RR6A 1KS2A 1LPPA 5ALXA 1J5PA 1XWWA 5AI0A 1UBFA 4QOEA 2H2WA 4W4TA 1W36D 3JWIA 5J1SB 2RH5A 2DCMA 1IY9A 3L0ZA 4GGOA 2FSIA 1KP9A 2GDJA 2CT8A 2V6FA 8LDHA 2VEOA 4ND6A 4P4SB 3T7RA 4BWYA 3CEMA 2V54A 2ES4A 3I5XA 2PMBA 4K3UA 1LNQA 3BULA 1U63A 4CKBA 3B6KA 1U7UA 1KIMA 3I34X 3PC6A 3QVSA 2I2BA 2D4HA 2I6FA 3FN4A 5F21A 2W2OA 2VJPA 3F6BX 1TT5A 4PZAA 3G13A 4UPDA 3G3EA 2BISA 2CLCX 1NYTA 3EE6A 3O38A 3B7GA 4X97A 4AKTA 1EJ6A 4DLZA 2ZB7A 5DW0A 1SD2A 3BS4A 4HAVA 4JDUA 5BMVF 1YTLA 3R4VA 2FWIA 2V45A 2IPOA 2SNIE 1CBUA 2YTZA 3UW1A 3DOCA 3FXAA 4MVJH 3WA7A 1KDVA 1MT0A 1U4OA 2B94A 3O8QB 1E7QA 2Y4OA 1ZN2A 3DE4X 3VVBA 1X77A 1GDTA 3MIIA 1UBCA 4L85A 3ZI4A 4CQMD 3QE0A 4PG6A 3O8BA 3CCBA 4PIVA 4UFNA 3ONDA 2JCVA 2H51A 2NUAA 2Q5LA 4KRYA 2WJVA 3W2IA 4DWOA 3GLGA 4C7OA 3NHSA 3CNLA 4Y2UA 1N0WA 2P4QA 2FPPA 3ZE1B 2ONJA 4RL4A 1ZUHA 1DAEA 2Y9MB 4YJFA 3HY6A 4BVFA 4Z54A 3HPRA 1I2ZA 3QUTA 2PKYX 4PG5A 3HLYA 1WEKA 2QWXA 4DN6A 3GIWA 4JI1B 1TUEA 3SR3A 1TM5E 4TZKA 1TAGA 1CETA 1QU3A 1LW7A 1P2BA 4IL5A 4CV3A 1CZNA 1T0HB 3B1VA 2OGSA 3PEVA 3SZRA 5AQ1A 4I5DA 3EVFA 2DQ4A 3GDWA 4P9NA 3EIWA 2QP4A 4NL4H 4IJMA 1N6IA 1WW2A 4CMHA 3FHTA 1KQOA 2E55A 3DWEX 1PS0A 3OEYA 4JUBA 5JNWA 4DKJA 1NUHA 1M5RA 1KRXA 1JWAB 3SXUB 4A15A 4UUAA 5DISB 1QO9A 1K6MA 1OCEA 4LRWA 2A3RA 2XCLA 1E2NA 3L4KA 5KVQA 2YVLA 4FLEA 5E4FA 3IE2A 1I2CA 3H2ZA 3RTDA 2PSJA 1S2IA 3FW1A 1DKOA 3EF3A 4D9CA 2DP4E 1U9ZA 4DLPA 1P2TA 4BKMA 1E63A 2PX3A 2W2XA 4G67A 3I6MA 1HZZC 5J40A 1ZD3A 1UBOS 4AZTA 4IVRA 3HV0A 2F64A 3JXEA 1ZLXA 2BRUC 4RPIA 2PZBA 1FQOA 2J9RA 1BDBA 1GUBA 1RZRD 4KFUA 4ZI7B 3QOFA 3FCXA 1DWPA 3ANXA 1XEAA 4PHGA 1RAEA 2PYZA 5EJFA 5DK4A 4WXHA 1S96A 1X3LA 1U1DA 4QUHA 3CH5A 1L7PA 2XVYA 1R12A 1UPUA 1N0HA 1ZZGA 3OFJA 3B48A 5I6DA 2NACA 2HRRA 3E81A 4UPVA 2NPFA 4P4SA 4YH1A 1UKCA 1AGNA 3AL2A 3UMYA 1KSHA 4A0QA 2RI1A 3CZ5A 4PV7A 1YBFA 3K30A 4MHOA 4MUFA 5K99A 2IPLA 4ZJPA 1LC3A 1H5NA 3WRXA 1QK4A 4J2TA 4Z9BA 2ZG6A 1IXSB 2O07A 4II7A 4PYKA 3S4YA 2V6GA 3GUVA 2EX4A 3V8NA 3X1DA 5JD5A 3V7FA 4OHRA 1ZXBA 1NW7A 1SULA 1PFQA 2GHRA 4L57A 1WNTA 2WWIA 3C87A 1UWVA 4IKPA 3HUFA 1MENA 2GTIA 2NUBA 4TT3A 5D00A 5ANRB 2B6HA 5F64A 4JEIA 4B4VA 1ARZA 1DB3A 4U9UA 5DLPA 3NDJA 5A7HA 3UG6A 2GHIA 2HI0A 1AK1A 1OBFO 2QN6A 3C16C 3CPSA 3O8QA 4HFJA 2QD5A 3GMTA 4BV2A 1OD6A 3CE9A 2QS9A 4KI7A 2CD9A 4E2FA 1ZR2A 4IRUB 4ZT7A 3K9HA 2X1HA 2A0YA 4H31A 2XADA 5AP9A 4F38A 2R6CA 1FDIA 1N2JA 2YWDA 1GWNA 4NBNA 2F90A 5JI2E 4KPGA 3K6JA 5JVDF 1F3LA 1BX0A 1G55A 3PL1A 4PWYA 2FETA 2W48A 2HK6A 2IDMA 1KMCA 3LHSA 3SR0A 2P3SA 4M49A 3GP3A 2BGGA 3D2CA 2EKDA 3RFTA 3KZKA 4J1TC 5G02A 1UKBA 1KAOA 1VE7A 2CE7A 2IE8A 4J1QA 4XRRA 1C0LA 3N2EA 1RPAA 4ND8B 4CL0A 3ZY2A 1I4TD 3CSDA 5HFNA 3ZHCA 1GUAA 2CLLB 3DOEA 2H1VA 1TCBA 4KWHA 4XQGA 5TVKA 4AMGA 1LTHR 2ATEA 1J23A 1U90A 4MLDA 1SCBA 2I2AA 2ONKA 5ALEA 4GUAA 5BWLA 5BQOA 3SXUA 3AVVA 1E64A 3HS3A 1W5BA 5F35A 4I4TF 4ITRC 3HB0A 3V1UA 1YS2X 2PR7A 2JIQA 4ER5A 1ZLYA 2EL7A 4Y8VA 6PFKA 5HK8A 3HVIA 2HF2A 2NQ2C 4XX1A 3SEZA 1AJEA 3KHSA 1ZHHA 4OXKA 3EPKA 2YXPX 5KHOC 1Z7YA 1B2LA 2GN4A 2VP6A 1FQJA 1RMTA 3HBLA 3OT4A 5EWMB 4DG8A 4B4UA 4N6OA 4KLNA 4W6QA 2QTCA 2OM2A 1PFUA 1PTJA 2EARA 2IP4A 2QV7A 2EJVA 4OOFA 3BHNA 4LQDA 1C8BA 3S8MA 4ZI7A 2FSVA 5MN4A 5AVZA 4KQ1A 5T67A 2VHUA 3RCBA 2V1UA 2Q7XA 3G9TA 1UAYA 2ZJ3A 5E1DA 5IP5A 3ESQA 4ZV7A 1GP2A 1BDMA 1EK1A 2CKMA 5FNVF 3VHRA 1BFUA 1KIAA 4KUHA 1G0OA 2JLBA 1QNFA 3L7IA 5C5DA 1KTIA 1A2OA 4FBMA 4PWZA 3AINA 5IK2D 5IVDA 4UTZA 1UQUA 2YXEA 4JJ4A 4LBVA 3U4MA 2OO5C 4ADSG 3D1JA 4GMHA 3U7QB 3GRUA 3QWIA 3FYUA 1HQYE 4ABYA 4DPKA 1N8TA 1SQ0A 1Q0RA 1C14A 1I8TA 3NHFA 4LVNA 3UA4A 1SB8A 4PY2A 1ZSNA 4XVQA 3I9V6 1CJBA 5BORA 1IXZA 4HNQA 3ISVA 1GRVA 1T1JA 4IV0A 3C8UA 3GO4A 3GCDA 1ZL2A 2HB6A 2O23A 2R8PA 4JT8A 5IYZF 3U7RA 421PA 3ADCA 2Q1SA 3EIOA 3VR4D 3OA0A 4Q05A 3MJEA 2FNAA 3MGCA 3A3KA 3EMKA 1O03A 2AOTB 3L02A 1BXKA 1A50B 2SICE 1O6FA 4BQRA 3G8YA 4X64B 4P3XA 2AEJA 1O95D 3KV1A 4HV4A 3TL6A 3WNCA 4B73A 1UEJA 2GT1A 4QUAA 3WICA 2CYBA 4Z1MD 3CEJA 4E6PA 5CEJA 3UG7A 4PAGA 3CTPA 3RS0A 3QQ5A 4D8TA 4M1EA 4ALLA 3A6FA 3CNOA 3CIOA 1CFJA 1ZVMA 4ZEXA 4TLEA 1HUQA 3SGLA 1N1EA 2O5CA 2BCEA 4Q9KA 5AVJA 4X85A 2VAXA 3O73A 4GHWA 1JECA 5DIZA 2GEKA 4RWZA 1SU8A 2XMQA 1WPGA 1KJWA 1XQWA 1O6BA 4CUZA 4ZCIA 2C88A 1RYNA 2UDPA 2D2EA 3LYHA 4F12A 5LPNA 4ZDIA 2QTMA 4IY1A 1UL1X 3CNEA 1JHPA 4QYTA 3MFQA 4AECA 2OILA 4ER7A 5BSWA 2ZVPX 4PYLA 2WABA 3MD0A 4X45A 2EFEB 4E09A 3GP5A 4IJ6A 5LFAA 1XCMA 4ND8A 4XX0B 3L8YA 2XJ4A 4HZGA 4NEHB 4YROA 2BLLA 5F5NA 3WJ7A 2P2GA 1J49A 1JPNA 4BKUA 1UKAA 1TU4A 2UZIR 3VKWA 5C4MA 4O02B 1G8SA 5FOXA 4I8IA 3PENA 2Y67A 1R00A 3P0IA 3K5WA 1LDMA 2H1SA 2QMUA 4PGFA 1DUIA 1IOZA 3PXEA 1SQSA 1SU6A 3TZCA 2FMXA 2WNHA 1JH8A 1RI1A 3RYIA 2OK7A 4ED9A 3G2QA 3D54D 2B61A 3D4OA 1KZ7B 5EWMA 4G0QA 3E9QA 1T6NA 3LRPA 1S01A 2VSXA 5IC6A 1JL3A 3C3BA 3V9PA 4K3VA 5DLYA 4HVAA 2CNOA 4MIKA 1I3MA 1A88A 1B3BA 3DAGA 3NDPA 4N65A 2EJCA 3HFRA 2PSDA 3FRHA 4C0HA 3N28A 6NULA 3QOXA 3WLNA 2CB9A 1C2TA 1D6SA 2QYTA 4JLUA 2FEMA 1JNYA 1R4NB 4RHXA 4UOEA 1JA1A 3NHLA 2RGGA 4Y1EA 5KNBH 1PJ3A 3Q10A 4XI9A 1VE9A 1X7ZB 5JBIA 5B37A 4OHCA 3LK6A 3FLMA 2ZI4A 4P58A 2GYYA 1P33A 1QE5A 5I7SA 2PZJA 3RNLA 1FFCA 3FDZB 3TLXA 2XY4A 3EDCA 4GKBA 3K9WA 5DT2A 4B0OA 3ASYA 3U7QA 4B3MB 5F2KA 2WG1A 4EKYA 3LPAA 3IO5A 5TGZA 1ORWA 2NU7B 5ERGB 1QANA 3HRIA 1N32B 2ZM5A 1OH5A 4JI2B 3CLTD 4GX1A 4EFKA 1AO3A 2PV0A 4KV9A 1COZA 2N47A 1J2EA 3V97A 4WADA 3NOQA 4C2TA 4FFBB 4MIEA 2AOTA 2HU5A 4KSYA 3IPLA 2IPAB 4U63A 1TKCA 3DXFA 5AJUA 5F1OA 2ZIVB 2SBTA 4K5QA 2L0XA 4OA5A 1SXGA 1USUA 1EAMA 4DEYA 5A9RA 2QIPA 3NP9A 2XYVA 3LQQA 5HKKA 1M33A 2P0YA 1OVMA 5FWYB 3G9QA 4EO4A 4GVXA 1F0YA 1WMAA 4IVNA 4K86A 5KQLA 5J23A 1DEXA 2IS1A 4RU1A 4PFSA 1MAHA 1Z7BA 1Z6QA 2Z9BA 2E82A 4YB8A 4CKYA 3BWEA 3KL4A 4WTOA 4N8EA 3WMWA 2YICA 1AF7A 3PUJA 4YCNA 5IJAA 3FVTA 4LE0A 1HMPA 4KODA 3G49A 5DGHA 4AUKA 3OQIB 3OZUA 1Q7GA 4QOSA 4ALJA 1P7VA 5DV9A 4U39A 3VKUA 5IHPA 1RXYA 1UADA 1W4AA 2ZRLA 3T9DA 1EK5A 2OT3B 4XX0A 3V2HA 1J56A 1ECFA 1QPGA 1PWYE 4OHMA 3WR5A 1EZZA 5CT9A 3LBNA 3QI2A 5LLSA 4LFCB 5I7HA 1H8EA 4D0GA 1U0LA 2ZJAA 2EYUA 3GRCA 4QDOA 3EG5A 4RTRA 3I5YA 3T5PA 4PPFA 3VKFA 1CUAA 4DB2A 4AP9A 2D74A 4K0RA 3BBLA 4N6GA 4Y2RA 4JVOA 4YPFA 4JLBA 5TY0A 3JQ6A 2JIMA 3PRHA 4KIWA 1KSFX 4S1WA 5CYPA 3TDKA 1XAIA 1QYVA 1Z2NX 1X87A 4J03A 3WYCA 1GVNB 2GAAA 2GEFA 3O4VA 1ZICA 4G9GA 2K6GA 4RD1A 5EI5A 5EZYF 1OLSA 4E2ZA 4EPRA 4TMYA 1T26A 3I8OA 2PTGA 3MRVA 3N0VA 4UMVA 3J7TA 1IZYA 3SE7A 6AT1A 4LF9B 3IJRA 1HWYA 4NBSA 4IF4A 1R10A 2YASA 4FJ0A 2I03A 1FTQA 4MJ7A 5DDIP 3OKFA 5EHGA 3O3NB 1FVXA 1Q6ZA 2I34A 3QE4A 4C5BA 1L4UA 5A3JA 4XIJA 3SM3A 3DP7A 5KOJA 3JZIA 4XJTA 5IVIA 3EDRA 3ZY4A 2LUOA 1R4NA 4IIJB 4CKWB 5KTTA 2WJYA 3JSAA 3LDHA 4DRXA 3U4QB 3E3AA 2OKCA 2V7UA 4PQRA 2H18A 4YMSA 1X7ZA 1IJEA 2FR0A 3A58B 1IHYA 3P1JA 3EIXA 5JLAA 4BNWA 3CGGA 4C7KA 4PR3A 4QYIB 3PYMA 4GI5A 2AVNA 2XQVA 4GOXA 2VJKA 1M7BA 4GP7A 4R1OA 1QJ4A 4RTLA 5LZ4A 1F8UA 1RAAA 4IAOA 2VCEA 1QC5B 3DW3X 4TTQA 3WIBA 2W00A 2G09A 1P81A 3CRZA 3ZXXA 3GJ6A 4PHHA 4UTXA 3HDVA 4MITA 4IOJA 4C6SA 4BXOB 4TXMA 2ZITA 1LW6E 5FD8A 3MNFA 1QOQB 3JVDA 5BSMA 1VMIA 4ZXFA 2NU7A 2W6IA 3A7DA 1CUZA 3QVKA 3MT7A 5ALYA 4OK6A 3K9QO 4I5IA 3QSYA 2AOWA 4YRLA 4C1BA 2A5YB 4RQBA 4HD8A 1Z17A 3FVQA 4RVOA 1NBAA 1KHHA 5B36A 3PEFA 1R1DA 2HJGA 2ZAOA 1JFTA 4FFBA 3WK5A 3J81k 3AYXB 1P0MA 5IEJA 2GTHA 3IRVA 4LK3A 4MUGA 1P75A 3L0BA 3IXLA 1EDDA 1FCJA 1PL7A 2PIDA 3KYCB 2AFIA 1LQUA 3UA3A 2BM1A 2IYFA 3EHDA 1E3WB 5G3ZA 3U44A 4X91A 1H0RA 2DBZA 2X40A 4MV1A 4A8TA 3KBBA 1JQ5A 2C2GA 3I2JA 3M70A 5U9CA 1RLJA 2XE7A 3OUZA 4IM7A 3DYVA 3H9BA 3B13B 1MAVA 2X9GA 4QSMA 3EGCA 2J0SA 3GLGE 1LK0A 1M72A 3IUNA 3O75A 4LRYA 1QH1A 1E96A 2R751 4P8RA 5SY4A 1HEUA 1ULBA 2HC9A 4JJEA 3OQIA 3TR6A 4WBXC 2BGIA 2I55A 4MAFA 4PLTA 3AFOA 2HLHA 4WEQA 5GMOA 2OHGA 1I7LA 2RHBA 2XTNA 3AO0B 4L75A 4EA6A 5BUQA 4HXGA 2XZOA 1G8HA 3AY3A 3HSSA 3WMXA 1D9ZA 3PPYA 3F4BA 3ZU4A 1FK8A 1Y9DA 3INYA 1DTWA 2GESA 1A4XA 4NFLA 5EIBD 1JS1X 3FGZA 2O20A 3VNRA 3G2HA 3WL3A 1EWTA 5DEOA 4RD4A 3KJQA 2QAJA 4DWWA 3IAS6 1K4KA 3U4GA 1J0BA 1PNVA 2PFKA 5CT5A 4HX2A 4R1LA 3P0HA 4QSHA 4D02A 3UAGA 3P9NA 1S8AA 3K1YA 5J4KA 3AT1A 5KSOA 1G2IA 3EZ7A 4NPCA 1GR0A 1RWXA 2EAUA 4RMNA 3E7PA 5JSZB 3BPSA 1P1IA 2W0MA 1NQWA 3V3TA 1OC2A 2A9QA 3I30X 4S35A 2PZMA 1HZJA 1ATIA 3DS8A 4X6YA 2RGXA 5KYYA 4F9GA 3I5MA 5KTNA 3RBXA 1DOZA 3ZWWA 1BOFA 2I3GA 2MCFA 1K75A 3CSUA 5CEEA 3FR8A 7YASA 3TG2A 4QO8A 4B2LA 5KNDH 1QAOA 2FJ0A 4DV6B 1OV4A 4TUYB 4PCAA 4WAUA 4IIJA 4CKWA 5AOAA 4UHHA 4ZAXA 4A5SA 4JLMA 1KH2A 1V3UA 5U1PA 4BFZA 3B1ZA 3U4QA 5IF9A 3AILA 1PQUA 3VTKA 4ITVA 3D0KA 1PEDA 1YDGA 3DYIA 1V1JA 4QYIA 3P32A 3Q3VA 4GLLA 2ACEA 4JOSA 3AY0A 3L8EA 3TQCA 2C0CA 5IDYA 1QC5A 4R0VA 1JG7A 1U8EA 3KLBA 3HI6A 4EIWA 5JS1A 3OTWA 4EI8A 3ZE9A 3G2IA 2QEQA 3PPWA 1TUBB 2CXSA 5LQJA 4BXOA 3OFSA 1JFVA 1YRLA 3KKZA 4YWHA 2DX7A 3RSLA 1MOSA 4RHFA 4TOIA 4W9NA 1GQSA 1YT5A 2V98A 3F2IA 1CS0A 1KZ4A 3ZWMA 1Y6QA 1L7EA 4OMFG 2XUQA 1ZD9A 4BO4A 3Q6IA 1PN3A 1VCIA 3WGQA 4B17A 3PUVA 4D41A 2Q2OA 4GM0A 5FWNA 1DPGA 1EFLA 3SSAA 1V95A 4L8YA 5CB0A 3VR6H 4NYIQ 2D6FA 5DNEA 1V4NA 3KVOA 2ZJ7A 2V5VA 2B82A 2IKQA 3IA7A 1XE3A 3P20A 4R9UC 4B75A 3EZYA 3HMQA 1RBYA 3KYCA 5CB4B 1I1NA 2C61A 3C24A 4GOKA 4PHCA 2OHOA 4V0QA 4YT5A 3MF4A 1E3WA 4IDNA 1JI3A 3ZWAA 4EECA 3PNBA 3OZTA 3QFHA 1U3GA 5KPJA 4B44A 2IIPA 2ZKIA 4JT2A 2G8LA 3M8KA 5CVCA 2XYRA 5B7PA 4QNNA 1G2PA 2WM2A 3AHCA 3MUNA 3EIHA 4L7QA 4OSEA 1B42A 2ORVA 3B2NA 4H6VA 5FOUA 3NWEA 3GG9A 1VJGA 1Y82A 2FY8A 1VSVA 1HEIA 2AUNA 3GT7A 3N0WA 4MS3B 5K0CA 5LXTA 4ZRNA 1DUSA 2HUNA 3QG1A 1SC9A 2VJLA 4R2KA 4OO3A 5CX4A 5EUQB 4ZHQF 1U80A 2RI6A 3H04A 2X8WA 3UOGA 1HK7A 4HGNA 4MJLA 4JT9A 4C0JA 2GPYA 1J25A 1N57A 3Q3GE 5FYQA 4ZZ0A 4NCIA 5UKDA 3JQFC 2VDLB 3NRBA 3G0CA 5I7OA 4L5JA 4AO8A 3HVUA 4F4JA 1DADA 4F97A 5JQGF 2PO7A 3Q5GA 4LHZA 1VPTA 2B36A 4O1IA 3SN6A 1GTMA 2R7KA 3WFIA 2IYTA 4IWXA 3V8MA 3ZI7A 4D56A 3DO8A 4GLOA 3ETHA 5CDFA 3OJOA 5CAEB 2YV2A 1JTEA 1QBGA 2JGAA 5B30A 2FR1A 4KP7A 4KN8A 1KY2A 1SHTX 5CNJA 1C80A 3WQBA 1XZEA 4TV8B 2ONZA 3FJOA 2Q07A 3H16A 4GIBA 4Q9AA 2B8WA 2AC2A 4NONA 3WG9A 5KVVA 3TB6A 3D6FA 5HR5A 1M0WA 3G2OA 5HA5A 5LR6A 2IPXA 1I33A 1I3KA 2C9BA 4BMDA 4LSGA 3RK0A 2X14A 4M2LA 4TUYA 5LA6F 1NMQA 1SCUB 3K2BA 1L4BA 3NNSA 2BL4A 1JNXX 4FDVA 2O8FB 3AEKB 4PPNA 1ZBDA 4V2IA 3UJAA 4KAAA 2GERA 3HHEA 5GINE 4OYRA 2MJLA 1QGDA 1ZH2A 3MGKA 3OZCA 4BLTA 4FB4A 2JA1A 2RIRA 4OLJA 3PDIA 1C30A 4CV1A 4BP1A 4O29A 5A3VA 3TJRA 1R3UA 4B7UA 1RQGA 2Q6IA 4EDFA 3IKTA 5EJ6A 4OJQA 1CHDA 1Z6XA 1GV1A 2PKWA 5EUMA 2HFKA 2FMIA 4AQDA 4KDCA 4HEQA 4PXAA 3U31A 4BV9A 2B69A 2GZHA 4JUIA 1DBPA 4NWIA 4D8WA 2A84A 1T2UA 2OZKA 4BX8A 5K0FA 1BHSA 2BVNA 3QBTA 3GQVA 3P2YA 2F1RA 3CZCA 3DZHA 1OVGA 5EQDA 4D9JA 3ZWKA 5IX8A 3W5DA 3AUJB 3LDGA 1TLFA 2PRKA 3QKWA 4LJ6A 2NADA 4IHQA 3MGAA 2B8TA 1V35A 1NQOA 3I9MA 3ABQB 1TTTA 3NBFA 2H17A 2R8EA 5IJ9B 2P4UA 3UJHA 2P1ZA 5AI4A 3AUAA 3DDOA 4H4DA 4IOLA 4RE5A 5AKHA 2ZCJA 4K2HA 5DH9A 5DXFA 3OI7A 3VC2A 1FP4A 2O2SA 3ZHZA 3U3MA 1KVQA 5IT5A 2J0QA 1AC5A 3EXG1 4CMEA 4KIGA 3Q72A 1LBQA 4BDTA 2J09A 1HLFA 1S9DA 3KZCA 2L69A 4DLUA 2RI0A 3TPCA 1CJTC 3HJTA 1H6BA 1E66A 4G2TA 1KS9A 1U9CA 2BTQA 2QZZA 3I1IA 3KQPA 2GJAA 1F14A 1Y8AA 3L7CA 4UXHA 5E0OA 2MIIA 4MS3A 3B6ZA 3UAYA 2R5WA 2OCBA 3E58A 5MGBA 1HI9A 1VRCA 2Q6LA 1E9BA 2VDQB 3KL2A 4IJUA 4J16A 3Q3EA 1YD7A 2WINI 1E1RD 1B4DA 2ZSHA 2WIFA 2ZJ8A 2GBLA 3TI7A 3VC3A 2XAUA 1NF8A 4U8GA 4DIEA 1JLMA 3W3AA 2QTFA 1XMSA 4URYR 3WP1B 1Z74A 3C7AA 3NWBA 4ZKEA 2AIRA 5CNMA 1D7OA 3AGQA 4M0MA 2GWRA 4D9FA 5G4LA 3F3YA 1BYIA 2G28A 3KLPX 1T6ZA 4I1SA 4HHEA 5E4YA 1CJKC 5HF8A 1N7HA 2WVGA 4GYJA 5H7XA 4KQ6A 2GNPA 4IIVA 4E32A 1VC2A 1MB9A 3ZCXA 4AJEA 3H2GA 1PV4A 2QYSA 3CWQA 4RIIA 1UBLS 4UATA 4TV8A 1XZKA 3RUEA 1E0DA 2HQOA 5FI1B 3SBOA 1W6UA 3WWDA 4RJTA 3N75A 1K7XB 1MFPA 1D04A 2GPSA 4JI3B 1W29A 1N2HA 1LLUA 4GP6A 4H4CA 1ODJA 2PWAA 2QSZA 2OXIA 5IAOA 2GM3A 3D3KA 2J87A 2Q21A 4NECA 4AF7A 3AL3A 2YV5A 3WYEA 3HP7A 5F33A 2BR4A 1R4MB 2QD3A 4NU5A 2VJBA 1OH8A 721PA 3A4IA 2ZBQA 3AEKA 3BWVA 3EFOA 3W4JA 4BIMA 1DG9A 4C6TB 2ODPA 3C3XA 2IWHA 4Y2SA 3DCJA 2HQSA 4XVUA 3CF4A 4FMBB 1WLSA 3WE7A 3B5IA 4JQYA 1PR2A 1QHEA 3CH6A 4DHEA 1HOTA 3OFNA 5B6IA 1JHXA 2HDWA 2UYQA 3L6RA 4KG7A 2EF0A 1NV9A 3LM8A 3GRFA 1HFJA 1AB6A 1N1DA 3U5ZB 2FFAA 2H6EA 1PJAA 2BGKA 2PRYA 4RA6B 4XXHA 2GLTA 4M9XA 3FNGA 3RM3A 3F47A 1ABBA 5FTMA 1TQHA 3H2KA 3O8RA 1GPLA 2G5PA 1RSZA 5EL0A 3N7UA 2B0JA 2L42A 2PMCA 4JAVC 3U2QA 3BIWA 3FOCA 1R74A 3MTIA 3N6XA 2F1JA 1LBHA 1XNGA 3E0XA 3OY2A 5IJ9A 4EFDA 2MSCB 4ZA2A 2Z6UA 2W6CX 1E79A 3D02A 4JYCA 3EHEA 4OJNA 3TYXA 5ICGA 4RBNA 4ZMSA 2H9IA 3BIOA 4MUMA 2QRVB 3KZNA 5HXAA 4B3RB 3GJTA 3I61A 4IGKA 4NK4A 5IBRA 2NSLA 5DWVA 3MFYA 1Y1PA 2JB9A 3FSRA 2YN4A 2FUNB 4NZMA 4EHDA 5K0TA 1E69A 1VKNA 2XCOA 2Y1FA 2YIDA 4R8RA 4BQSA 1W25A 3MIZA 3I58A 3E4CA 4BIIA 1BIFA 2WQ7A 3WGHA 2O3TA 3Q15C 1B8OA 2IBTA 4HYTA 3VYTB 1JP7A 4JUFA 2AG0A 4YAIA 4LOHA 5B3KA 2ZJBA 3ROFA 1KAMA 2WM3A 4MKXA 2B9VA 1HDEA 4N7MA 5EMNA 2IDJA 5DX1A 2FTKE 1HKUA 2HLDA 4KV7A 5BRNA 1Y63A 5BNZA 1ULTA 1GPNA 1ZSVA 1JQKA 1YF3A 2O1XA 2MYNA 3NCHA 4BO3A 4ZPJA 1NMEA 1LSUA 1U0EA 1KJZA 1U7ZA 3AHJA 3WB1A 3VJLA 3ERCA 3SP1A 3EIUA 4YQFA 1NJ2A 1TO2E 4JVNA 5TMEA 2X4IA 2HX1A 2PT5A 3F6RA 3JD1A 4PLFA 1BDIA 1YVRA 4EF6A 3U19A 5JXWA 2J9XB 3NYWA 3WLIA 1E0JA 4JB3A 4US1R 4X6UA 2XWPA 5ITZB 3DFFA 5BW4A 3LGSA 4FFDA 4DLXA 2KQUA 2F8MA 5FLYA 2DHCA 1A97A 3HU3A 1G8GA 2XQFA 5TPZD 3VZSA 4ALNA 4I7EA 4UQPA 5CVDA 5J59A 1CJSA 1E9RA 3OJCA 3P5BA 1VHQA 3DZDA 1M8PA 4I9FA 2ZWOA 4K88A 4NX2A 1J0EA 1QZZA 3PKIA 3U4HA 4E14A 4C4XA 3OIWA 2RHTA 4OHFA 3V8RA 3G0OA 4A0RA 4Y3UA 2AOVA 4PS0A 3FDXA 4EPWA 1CR6A 1L5YA 5CITA 3BJZA 1N5JA 2VF7A 5HNKA 3G8AA 1R4MA 2H31A 2HO5A 2IUEA 2XIJA 4QAQA 2D0PB 3AP1A 4MI6A 4L4SA 4G1BA 2WAXA 4R5MA 1SG6A 1A0OA 2ZJFA 4C6TA 2X23A 1ISIA 1UUFA 3M6AA 1QQ6A 1YGYA 1XRLA 4MP3A 4RD6A 1ZN7A 4DNQA 3D8TA 1TD1A 2PUWA 3VVCA 2VAMA 4UTVA 5AUNB 2WVJA 1X2BA 2Q9CA 1NBIA 1JA9A 1QB8A 3G17A 3JD0A 3R8XA 4TTAA 4MO9A 3KSUA 5BY2A 4EHBA 5DNUA 2Z9DA 1E7MA 3CF4G 1NF2A 4TLCA 5JASA 2EZ9A 1CY2A 4WZAB 3HCNA 3S8EA 4RA6A 4AUNA 2FOLA 1C7QA 3NEJA 3HL4A 4L76A 3VJMA 4JFAA 5K3AA 3GFVA 4KW7A 2IQIA 4G4IA 1M0EA 4BE7B 3PPXA 3AMVA 1NW9B 1VTKA 1E0KA 1UBSB 1M5TA 2PV7A 2O8EA 3NC4A 3B1KA 1J21A 2NAFA 4BVLA 3QKSB 4CGYA 2RH8A 2R8XA 4O0MA 4F4FA 4PFKA 4ZYZA 2Q1WA 5EJ2A 1HZZA 2IU0A 2QG4A 2QRVA 4C0XA 5F2NA 2BRUA 2R84A 1NNLA 1G3MA 4EO9A 3RUDA 4KVAA 3ZC3A 2PTHA 2AD1A 4RZIA 4RANA 3GQBB 4QLBA 1GDDA 2AFIE 3F6CA 4XLTA 3WO1A 2ID7A 4LKOA 5LMUB 2A3NA 3ZJTA 1JKIA 4OKIA 5JYCA 4WI1A 5DJ5A 1XA4A 2WILA 1SOUA 2BEKA 2C42A 2X9QA 5SZKB 4ID9A 1MOZA 1TQ4A 4DRZA 2A5DA 1KAHA 1ORHA 1JSLA 4K9KA 4PANA 4PGAA 1P9OA 3OHSX 3VMFA 2QGZA 3M4ZA 1FX0A 1QKIA 2X3YA 1SBQA 1DKPA 3UK6A 1R0CA 3PQ8A 4F3NA 3GL9A 3WHIA 3FUTA 5BW8A 1J20A 1IHPA 5CPFA 2X22A 4BNDB 2YIJA 1QWOA 3TRIA 1KEEA 3QJYA 2GCIA 3MW8A 1LA2A 3REOA 1MLDA 3OQPA 3ELYA 3L6OO 3JQDA 4Q9IA 4IHAA 3H5VA 1AD2A 3RREA 1Z2CA 1JYSA 1UR5A 3KXIA 2VK8A 3G2MA 2B30A 1P2VA 3LT0A 2OORC 4DBVO 5BSGA 3OCCA 3TLBA 3VU9A 2ADFA 3WLRA 1IY8A 2HLPA 5EOVA 3A6JA 4MB6A 1NJ6A 1ONSA 2QE7D 5FAXA 2HJHA 3I8SA 5AJXA 3UWKA 3T99A 4Z7JA 2P6UA 5AJVB 3U7GA 2DCUA 3ZK8A 2WSMA 1Z4LA 1DRUA 3QUSA 3TQOA 2C5BA 1QFZA 5JD6A 4DJJA 4FD3A 3FNBA 2X86A 3BREA 5JZOA 1OZ0A 3LFTA 1XZAA 4MUYA 2PH1A 4JJKA 2O0KA 1JGTA 1IIBA 1SQ6A 1XTQA 2Y0EA 3INRA 3FA2A 4GX5A 2DWOA 1MMFB 4GX2A 3UUWA 1FUUA 1PL6A 1HURA 2YVKA 1JKMA 3PJFA 3DZBA 3O93A 3ZBUA 4DY4A 4C6HA 1VGQA 1MW8X 4XWGA 2NO4A 5JECA 2GN1A 3H83A 4PQYA 2O1EA 2XSZD 4U02A 4KIFA 2HBRA 4ZPXA 1RWQA 3VZQA 2C5LA 3F6PA 3Q4GA 3LVQE 2FDCA 3V4FA 4JI0B 1PLLA 1TA9A 2WUDA 2P27A 5G41A 1ZNWA 3ISJA 4P4LA 4FW8A 4J1TA 4FWIB 2H2FA 3KEFA 3PBKA 5ED0A 2WUWE 2OHXA 3NDRA 5CH3A 2W8BB 1QOPB 3TMAA 5F7ZA 1OXTA 1ZXXA 3PV0A 3Q9LA 4X1OA 3DOJA 1BSVA 3G6KA 1T5TA 1QIDA 1PGOA 1QFMA 1K2WA 4OMUA 2UYGA 1AKVA 1PG2A 4OAOA 1FF9A 4ZZ2A 3AH8A 2IOFK 4ZVLA 5HS6A 1MUUA 3LUCA 4FBGA 4I55F 1VHWA 3A9SA 2XB4A 3KR2A 4G97A 3FPBA 4XDYA 4IIFA 4G0UA 1U1CA 1N6PA 2A9JA 2QLBA 4HDOB 3O31A 3T1NA 5LVAA 1DQYA 1JEDA 4D6XA 2Y1CA 2G7MC 2V4UA 1ANKA 2W4MA 4JUAA 1J0DA 4KK3A 3W79A 4CUKA 2EFGA 2YCLA 4I2NA 3QKSA 4NQZA 3RVLA 1TVKA 5LLDA 2HL6A 2PN1A 1J4AA 4FW9A 1VKRA 2ZSDA 2BFOA 5E38A 5C7YA 2ZCVA 4MO2A 2IHNA 4A1OA 3O0TA 4XARA 4XE5A 2J5QA 4PO3X 3T12A 5I45A 4Y98A 2PKEA 2OLKA 3O3MB 4GGMX 5AO9A 5I9BA 1TEZA 4JHXA 1FSGA 4ZOLF 5JFTA 1U0BB 5K51A 2BKLA 4G37A 4KRXA 5JH7B 3GQBA 2QKYA 4FZ5A 1N1GA 2FQWA 1AKNA 4MIYA 4Y6GB 2XTJA 3GV0A 5EUCA 3K72B 3TRHA 3ZLBA 1PO7A 1FSPA 3NRCA 5EPEA 2FPMA 2H07A 2VK4A 2WMYA 3KVYA 2Q0SA 3KR1A 1KJQA 2W6OA 2AR7A 3R7WA 3OZVA 2XRMA 4J6FA 5ALKA 1FLVA 4X71A 1EQUA 2QRPA 5COQA 2AK3A 1SUBA 3GBVA 4LRXA 2XNSA 1MDFA 2DAPA 2VPIA 3BN3A 4GZMA 4URWR 3CEAA 3O1HB 4J8PA 4TYMA 4BNDA 5ICMA 2OPBA 3KPYA 2QDKA 4O1HA 5BQFA 1NVXQ 1LV8A 3RB8A 1XCBA 2QW0X 3PHGA 1KYWA 3G7UA 4XVHA 1E9CA 5L3RA 2OXCA 2J3EA 1U0FA 4EKNB 2D8AA 3FPCA 4YMIA 1JBKA 1K8QA 4Z86A 3B1YA 4IMRA 1EB8A 2I4IA 5CB6A 3DMTC 5FP0A 3ZE0B 2YNMA 3JZFA 2BEUA 2G06A 4M46A 2L2QA 4BEWA 1LWOA 2W4IA 2IUSA 3U16A 1TYEB 5CDFE 4LZZA 2WLSA 1UQTA 4DCCA 2QN3A 3PT9A 4D9GA 2PMDA 2I2FA 1ZIYA 4RK5A 3BGDA 5L53A 4KXVA 3RBAA 3ISTA 3TX2A 3W5HA 2A1UB 3AB3A 4LJYA 5KSZA 1XZGA 2Q6TA 1JG6A 4PHTA 4XM2A 3KS9A 3R3YA 2HHJA 2WYHA 1W0CA 4HDAA 4N41A 2WAOA 4LSMA 1P0PA 2AMJA 5J58A 3THYB 3NHRA 3ZDXB 2H4WA 3SY8A 2K5UA 3VU1A 1URPA 1TZCA 1QS0A 5DHRA 3SWWA 2WQZA 1RKBA 2JJ1D 3NM5A 1EFRA 4PXSA 2P4EA 5C4GB 4RZ2A 1PWZA 1N7JA 3JQCA 4KXQA 2AYYA 1J07A 3SHOA 4GMKA 2W8BA 4KQKA 4BB5A 1PR5A 3E9MA 3IVRA 1SIWA 1CHNA 1NQUA 3IOBA 1GCUA 1T2CA 3CUUA 1KJIA 4II2A 3K0HA 1LQ2A 4O2RA 3Q8LA 3U3ZA 3RUAA 1X1AA 2Q4OA 2CYAA 5FFFA 1OC4A 3IRUA 2OHIA 3P2JA 1SVWA 5CYOA 1HL3A 3H4TA 5AI9A 4BNZA 2IU4A 1IULA 2YQ5A 4J2OA 2O2HA 4ND1A 1F2VA 4A6PA 4QVKA 2O7NA 4OXXA 4DNFA 5B57C 3I9JA 1U7HA 2QTBA 3B7WA 2R6AA 3IGFA 2GK7A 4HVTA 1R0LA 2RGNA 2J3DA 3OPMA 3HU5A 2P3QA 2FW8A 2J7KA 4D81A 2J6IA 1Q7BA 4OK3A 3CLRD 1IVNA 4QO7A 4F2DA 2J3IA 1ZJZA 1C0PA 4HNAB 1ZIXA 5IF3A 1QLWA 4BLWA 4B7CA 1NQVA 1ZCBA 2IEDA 4RSHA 4B81A 1E2BA 2Y05A 3CLUD 5JH7A 5CDGA 2X2OA 5EJ5A 2P9CA 2Q5OA 3L0CA 3KYDA 3RYHB 2PWBA 3T1TA 3ZLTA 3M5PA 4GXQA 5SY9A 1ESEA 4JCCA 5A71A 1II0A 3V48A 3CMMA 3F9IA 3I53A 3P71T 4KI0A 3LL4A 4MROA 2WICA 3L7KA 5HOEA 1K8YB 1NBOA 4GYKA 2GJ4A 2IYYA 4OHBA 5EIHA 3DEJA 4KHPB 5TARA 3X1WA 4WKPA 1KF0A 1RI2A 4V3BA 2VPZA 5IKXA 2LDXA 3VKVA 1C41A 5H59A 1UT5A 1W30A 1XHEA 2FDRA 4OYYA 4RUKA 2MSLA 2I99A 2TYSB 3CVUA 3LKDA 4FNAA 1DRVA 2PUBA 2W43A 4UHJA 3WOHA 2ACWA 2OFPA 1UWLA 2DFNA 1SK9A 2VZ8A 3ND6A 4UHBA 2O2XA 3NGMA 3OFVA 2NVUB 4XZ3A 4AS1A 4G36A 4JEUA 3L4SO 5IAEA 1TTQB 4WGFA 4F4CA 2O7VA 2QX6A 4G89A 1YKFA 4IQ0A 1BCSB 4C6RA 2Z0MA 5CHEA 3GK3A 4FI3F 3FD8A 2PO5A 3RGGA 3H97A 4B3IA 4CIXA 3OCXA 1L5NA 1Z2OX 2HHAA 3KBOA 4CEIB 2OK8A 3LSYA 5EC8A 4JLOA 3IDFA 3AIKA 1IMOA 5TS2A 5IDXA 5KREA 1JILA 1JF8A 1NW4A 5B3JC 4XTRA 3TR5A 1ZOOA 1FW6A 1SOMA 1T9BA 5G4KA 3QG5A 1VDZA 2CL5A 1SEVA 2ASEA 2BKUA 3COSA 3ABZA 4QULA 3JZMA 1SHZA 4FEAA 3WIDA 2WWTA 3OOJA 4L50A 3ZYZA 2A1UA 2ECFA 5CFMA 1TIPA 4M7OA 4Q7JB 3QUCA 3R3UA 5DWQA 3LCCA 1I4LD 4MW2A 1OA1A 1CIVA 5KU1A 3CZMA 4WE3A 2ET6A 3AUSA 3WGZA 4DMMA 3FUCA 3JZAA 1VL0A 5EZQA 1MB2A 1VJTA 3FCYA 4HVCA 1BJKA 3TIGA 2EW1A 4JN6B 2VDWA 2QJWA 3BORA 4K46A 1H05A 4BAUA 1I30A 3CCFA 2C8VA 4XJSA 1FS5A 5CT6A 1A9XB 1YB1A 3ZDCA 1SKBA 2CXNA 4HNVA 4LPKA 3MGBA 1BFKA 5LB2A 1KDPA 1V0JA 1G7CA 3O9VA 1MG0A 3JQAD 1CDZA 4FGWA 4M36A 3E8XA 3R9WA 4X60A 4K9MA 5A06A 1YS6A 3TLGB 3ZY3A 2JGDB 1OGIA 3IAM6 4AD8A 3GEDA 1SJ9A 3C85A 2D2VA 2F9MA 1Q21A 4HYEA 4M1MA 4WJLA 3C39A 1JTVA 1ORRA 5H1YA 5JDCC 2D5LA 3FTQA 4L8LA 3EOBI 4HGRA 1GPKA 1AZTA 3HXMA 1XQ1A 4G4JA 2G1KA 5TF4A 5AVTA 1ECBA 1V2GA 4TKZA 3NG1A 1LS1A 3CA8A 3PD0A 1N6KA 3HKEB 4CMKA 2DVMA 4HNAA 3FZQA 2BSXA 3ZJVA 4RD0A 1EX9A 1TF7A 4YS6A 3DUFB 3MTGA 1A2KC 2V6MA 3AX6A 1A3CA 1DBQA 5B4TA 4ND2A 2QX8A 4Z3OA 1M6VA 3KUUA 3MT0A 5H0IA 3WGLA 3OZAA 4AULA 2XB8A 2VJDA 4JJAA 3RYHA 2PVPA 3CVYA 3E1KA 4K6FA 3C4QA 4G1CA 1X1DA 1Z3IX 2EEZA 3UAXA 4E21A 4R81A 4UNPA 3BMCB 3NTUA 3PFCA 4BUZA 2GEBA 1DAMA 3GXOA 1SXPA 4UM5A 2BHNA 4MINA 1W94A 2P6RA 1SBYA 2AI1A 4N7RA 4M1ZA 2Y68A 4QXQA 4GR9A 4HR7A 4IUDS 1M5UA 1ZEMA 1QGED 1NAHA 2IXFA 3ETEA 5EE5B 5F5XA 3DDZX 3GZ4A 4QICA 4DCPA 1QV7A 1TM7E 1W73A 3FKJA 3T7IA 3UAVA 2J08A 4QGSA 4CWAA 3BFJA 3IP6A 2NVUA 5JJ5A 3RS2A 4PC7A 4K87A 3EWAA 3TCXB 1O5TA 1X19A 1JLLB 1O95C 3IOCA 4TROA 4NTZA 4ECEA 1BCSA 3MYRA 3IULA 2AJDA 3DZFA 3SHWA 1LPSA 1GTVA 1IBCA 3FROA 2JGIA 3LBYA 1TEVA 4CEIA 1H65A 1THTA 5GOZA 4V0OA 1OAOC 3NT2A 4D79A 4JL8A 4YALA 4YAOA 3NWJA 3FX2A 4MQLA 4F5DA 2BFNA 4IVPA 1SCQA 4HS9A 4OY3A 3CVVA 8OHMA 2AJ8A 3KT6A 4YV1A 1DOAA 2RAVA 4F56A 4A0HA 5ALJA 3ILVA 3O1LA 3CSSA 3I6ZA 4FKBA 4MW9A 1NMZA 5FYDA 5DGIA 1D5WA 1W46A 1AHPA 5E6RB 5I47A 2QY6A 3CRQA 4I6GA 3MUEA 4Y2XA 2W83A 1T6BY 3DLBA 3QYJA 4IJKA 2R8YA 2D1RA 3H5WA 5T64A 1KFCB 3M5DA 1XMVA 3CH7A 1BHO1 3NIDB 1RWBA 1TB4A 5B2EA 1DC4A 5K3OA 2QMHA 2FSPA 4HQ6A 3WDSA 1EFCA 1JAYA 1W6RA 5L4LA 2DH5A 4OMCA 1GRQA 2APJA 1A9XA 1VHJA 2G1PA 4KPYA 3A25A 2C5AA 1WQ4A 2VA8A 4MW0A 5C8YF 3V4LA 3A7EA 1PKXA 4IZIA 4P3PA 2I3BA 2JFUA 4G86A 4KQJA 4RHEA 3RFVA 1LWNA 3ROQA 3C3PA 3UMJA 4FS8A 2DLDA 5ALVA 1DFIA 1GYRA 3TEFA 2VO1A 2Z4TA 5KI6A 3N86A 3TLGA 2JGDA 2I6TA 2Y1DA 2ATXA 4NH4A 3VOSA 3O03A 4BLQA 2B5VA 4FSXA 2WK1A 3MWDB 4I81A 4NENB 1EXDA 1BC5A 3ONNA 1LC0A 3D6JA 4BN0A 4BU0A 2P41A 2PRIA 2FUEA 3EVAA 4TXNA 4XVRA 1U8TA 1S5PA 1F5SA 3KAPA 4DQDA 5CG1A 1RZ3A 4L5BA 4F1KA 5CLGA 4R2LA 2GTPA 3HKEA 1JIXA 2PH5A 3NJ8A 5TJ9A 3X2SA 1MJNA 4OJKA 3CLVA 3QIAA 4HX5A 4R01A 2Q3CA 3OH8A 5EFZA 3DUFA 5BT8A 5J47A 3AKCA 2PXXA 1NW5A 3ANYB 4ZYLA 4RXMA 1ULSA 3RABA 1QIKA 4I3FA 2QZPA 2VOEA 3MMSA 4IF6A 5BYBA 3OSUA 3VU0A 4D92A 2GN6A 4Y0VA 5AM5A 1OW3B 5JMPA 3PD7A 4JBHA 2JFYA 3VSAA 1HPLA 2RGRA 1S8NA 1Z2PX 1K0UA 2IQ5A 3NBZC 4IEEA 2I0FA 4OI1A 4C88A 2C92A 1UK7A 4M22A 3LWZA 4CT0A 4QJ3A 4B79A 5KOHB 1YJ8A 1UMCA 1BS9A 2JFPA 1IZ8A 2BEWB 4RXUA 4FPXA 4MP6A 5IMBA 1Y1LA 2EDCA 3CLTC 3M82A 4JKOA 4INZA 4Q15A 5FA6A 3RC1A 1ETHA 4B48A 4OPMA 2WW8A 2QUZA 3CJRA 1OKKA 4RSGA 1L5KA 1YV9A 1E62A 2I87A 4B3BA 3BSFA 4RZXA 3QX7A 5FDFA 5CIQA 2K2WA 5JJCA 2JCGA 2OCYC 5FQNA 4E7OA 1ZVJA 3L79A 3I4FA 1ZY2A 4TZ0A 1M34A 4EVSA 2E6KA 3LHDA 1Y1SA 2VTDA 1EK0A 3HVHA 1RHUA 3U4CA 3LQ1A 1GZ3A 4RO0A 2CV2A 2Q29A 2IXBA 4DSAA 2JIZD 1KK2A 3FSJX 2DHEA 1HXHA 3NONA 3VU8A 4CE6A 4EKIA 3DVSX 3A1EA 3MJHA 4H3KB 3DMPA 3NYRA 4G01B 5AHOA 2MYUA 4LJ8A 4WFJA 4QREA 1DXYA 4V0NA 3MJVA 2J8ZA 1B00A 2UZ0A 3LT5A 4FYMA 2P3LA 4H16A 4Q00A 5JSKA 1C4XA 4ZDKA 1GADO 1SY7A 4XRGA 3HN2A 1Q1ZA 3BGWA 4MVYA 2NYVA 4TLAA 2QV0A 3AONB 2VP9A 3MZ0A 4H7PA 4UVIA 5E6RA 5BUSA 4QZVA 3N58A 3DFUA 5E3IA 2FFRA 5HWSA 1PZMA 1B8UA 2GAIA 4C9BA 3HB5X 3A9UA 1EFDN 3L7AA 3PNVA 4K0KB 3BFVA 1R50A 3NHYA 1AK9A 3H9GA 4F3CA 2HF7A 4X3CA 4ZVKA 3HGTA 3VR0A 3ZNOA 4MGZR 1F1JA 5AWFC 1YZQA 2ZYVX 4GVPA 1EXNA 5ILGA 1ZIDA 2UKDA 3FWZA 3HYNA 3RTEA 4HUTA 1OFVA 4O33A 2EOAA 5EEGA 1U2SA 3Q40A 3JQFA 5EQTA 1LXCA 1VLQA 2BFCB 4AKSA 1YCGA 2RHOA 3TPFA 3HRKA 4YLEA 5H80A 4EGSA 1Y8QB 2XRYA 4HPWA 4MS1B 4ZALA 1WCIA 5IKOA 3DT6A 4BQPA 2PJRA 2ZDHA 2NU6B 4WOCA 4E13A 3MWDA 2BR3A 3FCUB 2CVZA 1AE1A 1VXRA 3HCDA 4NENA 5DN6A 1FMLA 3RODA 4C4RA 4W5OA 5GAJA 2ZS8A 4QTTB 1HFEL 4AJHA 5LYJB 2MMCA 3REQB 1UC9A 5DSTA 4YVFA 4RULA 5HDBB 3O47A 2LP4Y 4B7ZA 1MV5A 3TQSA 4HOYA 2F3UA 2XQGA 3QU7A 4XGIA 4JSYA 4XUCA 5T6MA 5K4HA 3AF1A 3DTYA 4D43A 1JHRA 4EUEA 1KQNA 3Q6NA 3P0JA 3N87A 2G83A 3I9V1 1GZ4A 4U2KA 1A5AB 3BGSA 3KXDA 2OCKA 1Q1NA 4HB4A 1BTOA 2EXXA 1MJGM 5FJIA 1QIJA 4KHZA 1UXKA 2AMYA 4GG1A 3HKDA 4WLNA 5T4HA 2V5AA 4P5DA 4REMA 4JDPA 5BW5A 5HZMA 4MVWA 4F5EA 3S2SA 3V5NA 4YMTA 1SBHA 3JQRA 3SYRA 2BEWA 3I6QA 4YO8A 3TUZC 2I1LA 3D2AA 1CP2A 4RE6A 2Q8NA 1K88A 2RKBA 5KZMB 4LE2A 4TWRA 4YRNA 1FRQA 1G8KA 1V96A 4QE3A 2DKFA 2V7TA 1B26A 4RK7A 3KB2A 4CM3A 5A3QA 1G8FA 1SGWA 1V8BA 2VF5X 1W4CA 1RBZA 4FFNA 4KQGA 2WUGA 3FPEA 1XEWX 3HBJA 4R40A 2JFFA 1HY3A 3WK9A 3TR0A 4GW3A 4AO7A 4B9EA 4WESB 4NFYA 1EDEA 4BO8A 1Y5NA 4DBLC 1MORA 2HCTA 4TT3D 2QQFA 4TS9A 3UJ7A 1G4UR 4DT1B 3DVLA 1TKRA 3LQ4A 3E61A 3T61A 1N78A 1AKYA 2OBMA 4L16A 3VH3A 4RLFA 4AVYA 4J7XA 2ZQZA 4JLVA 5BVGB 5L7YA 1TZ2A 2EF1A 4IH9A 2J0VA 3DEAA 1EM8B 5JAOA 2ZAYA 3QNWA 2EGHA 1XVTA 1QZUA 3PJDA 2C1ZA 2VI5A 5H83A 1FE8A 1TMOA 2LD4A 1G2OA 4NBTA 1CUBA 3UAZA 2E5FA 1WWKA 4YECA 3W9BA 4ZU3A 4II3A 1I14A 1IZ9A 1YK0A 4XD2A 3WLEA 2IVFA 2VQDA 4WD3A 1MTOA 1U3VA 5JNSA 3KB8A 1BMFD 3DJFA 1GNVA 4TLBA 3WZMA 4BQEA 1XRNA 2EZ4A 4M1KA 4BYGA 1RBMA 2P2SA 4BATA 3R41A 4UMFA 1PX0A 1W4ZA 1G20B 2G7ZA 3PRYA 5EIBC 1SHUX 4UUPA 2FX2A 4A0FA 2PRSA 1Z47A 1TX4B 1F06A 4XYGA 4B7XA 4E1AA 1NV8A 2XV1A 5BMOA 5DK6A 2JANA 2YY5A 1ZUWA 1PGQA 2BFMA 5ALSA 4PC2A 1QVAA 4ENRA 4W1PA 4MTLA 3UMMA 2G9UA 2R7NA 4IXWA 4M0CA 2YWJA 2IBMA 5FBRB 2J0UB 5JJBA 2IYOA 1Z5WA 2FA9A 2C4TA 1IEQA 3QPAA 4IR7A 3HV2A 4S1VA 2LPMA 1X1CA 5KVCA 1YFKA 4HXYA 2PUAA 4O4JB 4R84A 2AF4C 1YB5A 2R4UA 5AT1A 3WGKA 4EHHA 2VQFB 2BFCA 3AR6A 3HCPA 2EWVA 4DFDA 1K7FB 5JRJA 1FFWA 1EFAA 1PNTA 4I19A 4Q66C 4MS1A 4AI6A 3NTVA 1R5BA 2GKGA 1ZITA 4BFCA 2IXAA 2NU6A 1V7ZA 2XITA 1KFBB 1BU8A 2IP2A 2AJLI 2XR1A 4LYEA 4NG5A 2ZJ1A 3UGKA 4UEOA 1GIAA 4K9QA 1ZDMA 5LYJA 4GFDA 1IXKA 2GWHA 1G19A 2WDPA 1J1IA 3I52A 1CUJA 3CW9A 1KO7A 3OG9A 4TTSA 4WY5A 5FUBA 3LT4A 1M6HA 4GDFA 1QHIA 2YMLA 3EAGA 1FDSA 1SPXA 3CW8X 2WAAA 2YBEA 1CSEE 1G6KA 1UFOA 3GGSA 3K8OE 2LBPA 4Z99A 3S2GA 3CKKA 3UHFA 1N6RA 1YE8A 3KJHA 5HW0A 4BZXA 2ERXA 1MX3A 3A3NA 1KDOA 3A1DA 1DIAA 4KWIA 2J4CA 4XH9B 4QJ4A 1T9HA 2C98A 3EXHC 4K6GA 4YV0A 1XCLA 4I4NA 4CR7A 1FLNA 1ODSA 3RWBA 1LBEA 4P84A 3PXCX 1Y7IA 4BNXA 5T5QA 3GJRA 4C3VA 3IPYA 1GUFA 4PG4A 3TQRA 1BEUB 3NT5A 5HBRA 1H4VB 3ADPA 1XKQA 3GA5A 5ESRA 3EDQA 4Q9HA 1NQXA 5ABPA 1Y9AA 4DV7B 4JEMA 5BSEA 1WTAA 1QM5A 4B8WA 4HEA6 3KOUA 2I8AA 3QW4B 4RGBA 4NATA 1KRWA 4DA9A 5A0TA 2CHFA 2ZRIA 1KU6A 2W2LA 1GO2A 2Z98A 3OAAD 1SIUA 2PUHA 3T3EA 2FRDA 2G82A 4GOLD 5IH7A 5EKXA 2O59A 2C07A 3QPUA 2FG7C 1ZW1A 1TM4E 3CF0A 4GQBA 3OWHA 4OI4A 4PVDA 3FAZA 1UF9A 5HRAA 1RI4A 4OBBA 1E2HA 2ATIA 2Q6VA 4K05A 1WD7A 3R0JA 4HAZA 1TM3E 4K6MA 1EM8A 1NF9A 5INTA 4KR3A 3ESRA 1TQDA 4AJPA 4GI3A 4KPFC 1N33B 3KQWA 3N76A 1UBJS 1C3OA 2BC9A 3UB2A 4I5FA 3B60A 4J0JA 4CFYA 3STYA 1OUMA 4FYWA 1U6IA 1U2RA 2QM8A 1N5OX 4IIEA 1I36A 2CFTA 3LC7O 1OXXK 4KYVA 2UU9B 2UXCB 2HJRA 3RLIA 2V9ZA 3JD3A 3IAHA 3IP8A 1TM1E 3KKLA 4X61A 4LZWA 2G08A 4DG9A 1LLDA 1A8QA 3K9NA 3V55A 1ZGHA 3OEWA 2XWSA 1N3IA 3JQBC 3E8MA 3P97A 1ODCA 2BMJA 2WA2A 2J0UA 4OLBA 5DRYA 4DUGA 3OKAA 4XM1A 2YFYA 1U11A 4DZZA 4UNQA 4O4JA 3T3PB 4D6PA 4ZREA 1EX6A 2E4WA 4DZTA 4OKSA 5EAIA 1OAAA 2FW7A 1JEAA 5HM8A 3H13A 4KWEA 5AM1A 3T3DA 2RGUA 4B87A 1UKEA 3RU2A 1E5LA 2W6MA 1IEXA 1YB2A 1PYOA 4I6EA 3TCNA 2WJHA 5CIWA 3D0RA 2DFKB 3R5XA 4QXMA 2PJZA 2YX1A 5LQSA 3ZWCA 1TO1E 1FSZA 2C1XA 3OWOA 2BE9A 1U0RA 2GBGA 3M6IA 1Q15A 2OYRA 5ILOA 1E1QA 4ZAWA 1Z3CA 1Y3HA 5FLEX 2ZS9A 3AHFA 3DZIA 4YRBA 1I1HA 1QV6A 1UWKA 2IVZA 1ZRSA 1NVDA 2DWCA 2J6HA 3LT1A 4QWMA 1QUFA 4V1CI 5EJ8A 1VIMA 3VHQA 2H1LA 5BOSB 2PUDA 2PSSA 3HCAA 5H02A 1IONA 3HUTA 4UVDA 4YP1A 4DYDA 5C32A 4P86A 4CZ2A 4MW4A 1Z5OA 1CR2A 2O3SA 4OGLA 4MPJA 3ZBQA 1C4OA 3JV7A 5CA1B 1E6MA 5IT4A 4YUZA 4IOMA 1KQFA 2IYRA 2ARKA 2YHIB 3L8ZA 4YIKA 2GH1A 3RFCA 3FMOB 4DDKA 2A8YA 4EITA 1KEVA 2ZXFA 1NLYA 1IBMB 1UXHA 3A3OA 1MO3A 3HFGA 1PP4A 2D54A 2XVXA 4RZQA 4WCFC 1V25A 5I7VA 2GAJA 4IZOA 3BXGA 4OATA 1IPHA 1JIQA 2GSDA 3G2PA 4GEKA 4AJOA 4J0GA 5GZ1A 1UDWA 3NFYA 2I7XA 5KOIA 4XGQA 1XC7A 3EPJA 3X43A 4C05A 4DDMA 1D8AA 5JARA 1KMQA 3O94A 4ZK2A 1ZJJA 1TMKA 2JH8A 2JKZA 1ISGA 4N18A 4OAQA 3DV9A 1D07A 5DBOA 4M7WA 3KG2A 3NAQA 3FZGA 4N8DA 5BQ3A 4NU8X 3MT9A 3G7NA 3IR6A 4Y1RA 3ZDAA 3SIRA 2PXHA 1NOKA 2EWWA 3SKYA 1NJGA 3CKMA 3VKHA 5DOZA 4Y7DA 5IN4A 5EQJB 1Y3DE 1FBNA 4CG2A 2IHKA 2Q62A 1W36B 3H17A 3G82C 5A4DA 2XD4A 1QGAA 4EHJA 2J9ZB 3OIYA 4XFDA 5FR2A 3HYSA 4Z0NA 4RGYA 2X0EA 1T2VA 1E5QA 1JZSA 4L5AA 4ODIA 1I3LA 4ZKDA 3IAS1 2C59A 2IEGA 2XMDA 1GU0A 2D3TA 3KQVA 3ZPXA 2E1RA 1Y9JA 2C3UA 4HLNA 4JLAA 4XFJA 3CVWA 1SCNE 5FUQA 2ZSIA 3LUPA 1PJCA 3OMXA 3WLHA 3IEMA 5ERXA 2VHXA 3QSGA 3SYKA 4X24A 3FTPA 4MRRA 1KXJA 1CLEA 4POOA 1QYCA 1I94B 2BONA 2I7TA 3LOQA 1P1KA 1RTTA 1Z63A 1H2ZA 2RH9B 1LVHA 3E53A 1ZU5A 3EBPA 1GD1O 1H8ED 2JRCA 3VUFA 1RRCA 3V1TC 4RIEA 5BV8A 4O3FA 3TE7A 1L7RA 3D2LA 2E9SA 5E8JA 4JWKA 3B85A 3ESCA 4UDOA 5FBQB 4F4IA 4ZCMA 4JI7B 4ZYXA 1F0KA 1VMKA 2QQEA 3VR2A 5I3CA 5F9HA 3HO1A 4AWXA 3DNFA 1WKCA 3A1UA 3H9EO 1HETA 3P19A 4CQMB 5IM4A 1QYIA 1MBZA 2HXYA 2FN9A 5L8VA 3I04A 3NLLA 1A5TA 3MELA 5IAJA 2YUIA 3AZOA 3E48A 1OXMA 3L8CA 1R8JA 4BE9A 1E18A 4B3FX 5E2AA 4LXUA 1QK5A 1RRKA 3QFRA 3OU2A 4PX5A 4WT7A 1EYZA 1PW7A 4YRQA 4PBSA 3SF0A 4BO7A 1WXHA 5CM8B 3T3IA 2R1TA 2O50A 5JAMA 4MX8A 4URVR 3T3MB 1FTGA 3NI2A 1KZ1A 2HGSA 2BJVA 2Y8EA 1P44A 3GD7A 3JARB 2BBOA 2JAOA 4DABA 5CFPA 1JMKC 1BDJA 2VUUA 5BOSA 3EEYA 1GCIA 1Z33A 3NTQA 1US8B 4GICA 4KYIB 4M8IA 2UZ4A 5FFNA 2ZRNA 1KR5A 5CA1A 5I8PA 3AM5A 3OMLA 3QEKA 2OA0A 4GLBA 2VBIA 3KJZA 3D5TA 3DQQA 4X8LA 1USKA 2QG6A 2RHMA 1RW4A 1W4BA 2PUTA 4UD2A 5I8ZA 1RZUA 3PIIA 1KO4A 1L1QA 2HJ9A 2YOFA 3SNHA 3WB2A 4IIDA 4QPNA 3I1FA 4DMCA 3V42A 1DQSA 3KUXA 2A0FA 1SXJA 4TSFD 2DY0A 1LRJA 2HIGA 2E37A 5HCIA 1VI2A 5EJIA 1V7CA 5LXTF 4G9EA 1WCYA 2WM9B 1VL6A 4JZYA 4U7JA 1JJFA 3ZBPA 3LPDA 3A8TA 3IHWA 3CYFA 3GLFA 1NT2A 3R6GA 4A0GA 4OLFA 4EG8A 1LI4A 3IHTA 4PYNA 2FOIA 3DBRB 4LYYA 4FXPA 2HRZA 1KIFA 2B98A 1O6CA 2W2MA 4DOMA 4FSDA 3BQMB 3TVYA 4BMXA 1VCHA 2D1SA 2I2XB 1K8XB 3DEHA 5IVPA 3FOWA 1M34E 1A72A 1XZCA 1JDZA 3EUAA 2NZUG 4IGIA 2ZBUA 1XZNA 2DMRA 2Q3MA 3HC7A 3COPA 3EN0A 2WIBA 5DP1A 2GRUA 2ZQYA 1OZGA 3LSTA 2GJ9A 5REQA 2ZR8A 3FFWA 3O26A 1CUUA 1UDBA 3WGTA 3QWBA 3RSFA 5BVHB 3R20A 2P2ZA 3GVXA 3MM4A 3WV5A 2EYQA 3QFFA 3BH6A 4AYXA 3FPHA 1JFSA 2PMKA 2AR9A 1RXSA 3EVNA 3C4VA 5A04A 3O8DA 2QQGA 4LYAA 2YR0A 3WLJA 4TXLA 3LH5A 4EYOA 2CN1A 4ZI2A 1GSOA 4XOIA 4KPEC 4B46A 3EZXA 5E6UB 3FOBA 4HQRA 2VSFA 2GD0A 3MLEA 2O0MA 1VKHA 3W6OA 5H16A 5KKAA 1XTUA 4ZYTA 3EOAI 1XELA 2QY9A 1H3NA 4X65B 3ACCA 3USCS 3WNDA 2H9AA 4JGGA 3UJPA 5A0VA 4AY4A 4CQMA 1CZOA 4XB6B 3COZA 3F4LA 1FRVA 2F48A 3OZGA 3MN1A 2IY9A 5G0VA 5IAGA 1D9XA 3NEPX 4YRSA 3ETCA 2IHBA 4LJLA 1XDGA 3OA2A 1ADGA 3JQ9A 4L9SA 4JSRA 4L4XA 3HXKA 4M76B 4WZBB 2X13A 3GRVA 2WFMA 4GBMA 2JGKA 1TVCA 4G6ZA 3JQ8B 2X0KA 3R5KA 3ZGVA 4QPCA 3HXPA 4YMLA 3EDOA 3K4QA 5BN4B 3HDHA 4FMDF 3JARA 4ABTA 2J6CA 2QG9A 1DQZA 2V7PA 5BMVB 5JSFA 4YIHA 3WMGA 1M10A 1E7RA 1LS6A 4HFRA 4JGBA 1US8A 3HABA 2VJMB 2YZGA 3PTAA 1C81A 2YYAA 2ETVA 1ODIA 1CD5A 2GD2A 4HWRA 3ZW8A 2OAP1 4P92A 4JI5B 5MDHA 3A14A 3HA7A 4DANA 4PYRA 3ANLA 2FSHA 3LUAA 3NR2A 4I4IA 3WJAA 5FUVA 4CW7A 5KC9A 3A9TA 3LL7A 5A03A 2PY6A 3C8HA 2G25A 1Y8RB 4EGFA 2D5AA 3Q1LA 1S6YA 4NZPA 4W1QA 1T6XA 2ZE6A 2VSOA 3V8VA 1O89A 3N8KA 3PUKA 3CJQA 4JKYA 1AQ6A 1KQPA 1X6VA 4RENA 1YO6A 4YRDA 1JJBA 1GCOA 4ANFA 3ER8A 1GCAA 1NFRA 2JARA 2B83A 4AF8A 1OIVA 1RZRA 5JAZA 2HREA 3B12A 3V4SA 2GM4A 1GARA 1Z4IA 1P73A 4X3PA 3D8RA 4BKRA 3FUWA 1F8GA 3HK2A 5DASA 1TTPB 2LVBA 1G8JA 1RYZA 1QRAA 2CSUA 3ETNA 4EL5A 4UHCA 7REQB 3ZVMA 4FOLA 3KM0A 2I71A 5EXDA 4H1WA 1ZC3A 4JGIA 1JPJA 4OHWA 1T8WA 1OSNA 2FR8C 2HEGA 3DTTA 1JU9A 1H2HA 2IZ6A 3LXUX 2ZRDA 4NZOA 1OFUA 1OBHA 5BVHA 3KVRA 4JBXA 4DIKA 3KFLA 5KQPA 4NV0A 2KYRA 4RH3A 4MPTA 1NL3A 1AGPA 4FZ3A 1EE9A 1VIAA 4NP6A 4WUTA 4TV8F 4C03A 1U8FO 3NIWA 2C7PA 2JVKA 3K8ZA 1Z6TA 3LOPA 3LW8A 2ZIZA 3A04A 3FMIA 2CHVA 2Y0DA 4FQ7A 3ZXSA 1JR2A 1NN1A 2A33A 5EPUA 2QMEA 4MKFA 1MEJA 5E6UA 1ENYA 4YNBA 3DZKA 4G0WA 4E08A 5B58C 3WWZA 1VJ1A 3MTQA 3HJFA 2VP0A 3NJRA 4LHVA 3EMDA 3OC6A 1NSYA 4Q12A 1DQNA 4NF2A 1SHJA 2UVPB 2ZUSA 4HKTA 5KSPA 1PYGA 4F8EA 1L0BA 4RJKA 1L7BA 4M7PA 5KYGA 1PFKA 3A32A 4KPUB 1Y1KE 3FJYA 1WBBA 4Z0HO 1SIBE 4V24A 4Y2HA 3RGWS 3DNPA 3JYHA 3R40A 2Y2VA 4GEGA 1QGZA 4OGKA 3FDIA 3E5MA 3K5PA 2XHEA 1R66A 4XIYA 2OHFA 5ESDA 4AF6A 2WUFA 4WZBA 4FBLA 2JAPA 3OKPA 3PS9A 1BQ4A 2ZP1A 1THMA 2I4MA 3JQ8A 1DAPA 1ESDA 3PPIA 3AETB 1CQJA 4HAUA 5J63A 2Z6AA 1L5RA 4OP3A 3RVQA 1RRFA 3OURA 5BMVA 3FUUA 3U3KA 1BZYA 3Q6MA 5A4MS 5BT9A 1FDTA 1GITA 2VJMA 1HEYA 4JB8A 2V3CC 1X9HA 1IN4A 2CNBA 2EKPA 4AW9A 4ETMA 4C7XA 1E8DA 5AVYA 2BI4A 3HEMA 4RMGA 3STHA 1O3YA 3F49S 3K6KA 1QDEA 2IYVA 1N6HA 1UOEA 3PTLA 2G9ZA 3Q7TA 5AFSA 4IH1A 1NOIA 2DBVO 2WC1A 4KQ