1U3FA

Structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
164
Chain Sequence
MDKNALRKQILQKRMALSTIEKSHLDQKINQKLVAFLTPKPCIKTIALYEPIKNEVTFVDFFFEFLKINQIRAVYPKVISDTEIIFIDQETNTFEPNQIDCFLIPLVGFNKDNYRLGFGKGYYDRYLMQLTRQQPKIGIAYSFQKGDFLADPWDVQLDLIINDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methenyltetrahydrofolate synthetase from Mycoplasma pneumoniae (GI: 13508087) at 2.2 A resolution
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Ligase
molecule keywords 5,10-Methenyltetrahydrofolate Synthetase
total genus 44
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 1u3fA00
1U3GA 3HY6A 1U3FA 1YDMA 3HY4A 1WKCA 1SOUA 3HXTA 2JCBA 1SBQA 3HY3A 2G40A
chains in the Genus database with same CATH superfamily
2X0KA 1NQVA 4POAA 5F23A 3M5WA 2TMDA 3E8SA 1W44A 4BNNA 1DAMA 2VHQA 1EVEA 3D6JA 2GJ9A 1EWQA 5JCOA 2XNSA 4WERA 2F1KA 5DOVA 3B9BA 1PT8A 5FT9A 4H1TA 2VUTA 1NQWA 4MW1A 3ZJUA 3C8ZA 1I4LD 1YDMA 4FYPA 5DNWA 1BH2A 3VR0A 1Z5ZA 2HADA 2X9GA 3KELA 4DOMA 1PL8A 3BTUA 1NBMA 4C3UA 3T7JA 2I87A 4GO1A 4AURA 4CEJA 1QX4A 2O2EA 4IGIA 1IN8A 1HT1E 1TX4B 2VBGA 3AHHA 2XT9A 4AP6A 1G6KA 2RGUA 4EMUA 4S2EA 5TGZA 3I8XA 3WGYA 4TS1A 4OXNA 5FWDA 4B2LA 2I2DA 2F1JA 4NNJA 3EXHB 2HEIA 4DJ5X 2DSTA 5EZYA 2PZLA 2RJOA 3EAQA 4QASA 1CYDA 4LCJA 1D2HA 4KVAA 5EXPA 3ZHYA 4AJOA 4BN4A 2MYPA 3R5SA 5H1YA 3X1ZA 2IBTA 1UDRA 2NTNA 1EQUA 3ONVA 3UWKA 4BEWA 1AMOA 4HKTA 4QATA 2ODBA 3GEDA 1UFKA 1UWLA 5DTQA 3NAQA 4CMKA 1M9NA 1NDQA 2DHRA 3PEUA 4X0EA 3B3QA 3Q11A 4KSBA 4ZKDA 1CDEA 1ORIA 2HLDD 3B8HA 3TSCA 1ZRNA 3S2EA 4AYTA 4PN3A 1O2DA 1XPJA 4PQFA 2AFIB 1JA1A 2G0TA 5FLKA 4YXWA 1JU9A 1Z0AA 3T6KA 3KXKA 2AN3A 3BRSA 3KEQA 4WQMA 4NU5A 2QQEA 4Q4DA 5AOBA 1DAFA 2L17A 5LXTF 3VTKA 3U4HA 3PLAE 4FFVA 4BKPA 1EE2A 1Z36A 5EPEA 3DJYA 1FYEA 2P67A 5IAAA 4MUHA 4Q6BA 5FWAA 5DLYA 5CX1A 4ENPA 3ZIUA 4NJOA 2OM2A 4BFVA 3IP3A 1TQ2A 3RIXA 2UUCB 3HFRA 3QJYA 3RVPA 4JP2A 3ICCA 5IMBA 4YACA 2BM1A 1QWOA 4NJEB 4GMDA 1YJ5A 3ZKWB 1L4EA 4FZJA 4PS1A 4CWAA 3OLWA 4LJYA 3D2CA 1XTPA 1S2NA 2BEUB 2IE8A 2IIBA 1IMOA 2XCTB 1PHPA 1RCUA 5DI3A 2BISA 1IQPA 2GB4A 2VHEA 3AL2A 1J23A 4I9GA 4OATA 1SHKA 4QHYA 3HPRA 3UAVA 1RLJA 4RL4A 3OJEA 3UOWA 3HXPA 2C1EA 4PRYA 1HDCA 2Y2VA 3N5KA 4ZIRB 1A27A 3LBAA 4MPRA 3SKXA 1NBAA 2XVXA 3E7DA 1C0LA 4F46A 4X66B 4AJEA 5K0FA 1HSOA 2I8AA 1HMYA 3VNRA 1CUAA 5IT9A 1I5OA 4HJRA 4RQUA 5AJUA 3S0JA 4FMPA 3RJ9A 1G4UR 4PIMA 1U3GA 1OC2A 4IDFA 1DZIA 5ICCA 3PX7A 5CITA 1RPZA 1BHJA 1JQBA 1J90A 3WHLA 3GUCA 5EZQA 5FTJA 3GXOA 3OIGA 5AKGA 3Q9SA 5E9QA 5LUBA 4GMFA 1OY1A 2QJOA 1J9GA 1QHHB 1VJTA 1LQ2A 1R4MB 2ZB3A 3MMNA 3DZKA 4P5EA 3MS7A 4BGEA 2OVBA 3FYUA 4XFJA 4BKRA 2K2WA 3RRZA 4BO7A 2DP4E 1PE0A 4IJ6A 4OQNA 4PAWA 4E5UA 5IZCC 4PGMA 4Q1VA 5HWSA 2XB2A 4Z51A 1O96B 2LZ0A 1VLZA 1NFQA 1SD2A 2B2CA 2WIFA 2ZT8A 3E05A 2GZHA 4K7JA 4D0SA 3L4KA 3VKHA 2XBLA 4HADA 4LI0A 5AFSA 1NMYA 1F4VA 2XJ9A 2PXHA 5I7UA 3QM1A 2Y1GA 1EUDB 1GTMA 3JQAA 1WG8A 3C7AA 5A5DA 5GGXA 5DW3A 5F7ZA 1UKZA 4JBWA 3AR9A 2ZB7A 4AMUA 1WUTA 2P65A 2XHZA 1P73A 2C2ZA 5ALGA 2WQ7A 4R81A 1Z9BA 1W581 2P4HX 3H4IA 3WISA 3ZV3A 4AJHA 5BRJA 4L8LA 5MN4A 1N34B 3H4VA 3WSWA 1AS3A 2PZMA 4LVNA 1WBJB 5FL7D 3VZBA 4FLEA 2V9ZA 3OZSA 3AFNA 1NRJB 4IIBA 2W37A 3NHJA 4LGVA 1Q77A 1TAQA 3ZYCA 5BN3A 4HAUA 2IU6A 5KWJA 4WLNA 3ZVNA 2OHJA 2Y1EA 4MB2A 1LLFA 4OYYA 2BRUA 3B82A 4NFHA 2GAAA 2MYUA 3KUDA 4ND7A 4KFTA 2AMLA 4LJ6A 3NBAA 3DZFA 3FDZA 3GZJA 2FPKA 3ZVRA 6REQB 5K03A 2VJPA 9ABPA 4FOSA 3JQBA 1CP3A 3RAGA 3GX1A 5LQMA 1VYHA 2JS7A 1MOSA 3MGKA 3VXKA 3PWSA 3U13A 1X15A 4COOA 1I13A 1NLMA 2I8CA 2RAPA 3OCYA 1IPFA 3B3FA 3O4GA 4WFIA 3M5DA 2B4TO 1RLUA 3ZU6A 1OJ7A 2Q5IA 4BXOA 2ZDHA 4OK6A 1CR1A 2A1TR 3W2FA 4R1MA 1Q74A 3V4VB 1LDGA 2GXAA 2WWWA 5CCDA 3O26A 1C1YA 3QNUA 2QTVA 3CX3A 4YJGA 4YRSA 2BGRA 3HDTA 3IR7A 1ZIPA 3BUSA 4Q7QA 2WU3A 3TPCA 1LBSA 2WM3A 3KVYA 1M2OB 5TEWA 2RC5A 5CPBA 1GNQA 4CEIB 4YMTA 1RPJA 2FK8A 5FYDA 4UE6A 1NVKA 3CVWA 2JFZA 4LTMA 2UZIR 3UEOA 1MF7A 3TLCA 3F7NA 4PV7A 4CRWB 2EEPA 1NU6A 3IILA 3EFEA 1CZKA 3VYRB 4QGGA 3P0FA 5LQAA 5IBQA 4ZGWA 3TZBA 3D7NA 2O52A 1YTUA 3FKJA 1OWMA 3TW6A 5KNBD 5DLQC 3ZCTA 2C5LA 4WHMA 3H5OA 4TYQA 2FPWA 2VYNA 1Y8ZA 3EY9A 4J9VA 4EHBA 5EKSA 1NAIA 5AKLA 3OCVA 1PK8A 4R9VA 3A4LA 3UOGA 3VYWA 2XYGA 3O4RA 1FIUA 5EEHA 5JISA 3IAXA 1O95A 1JYFA 2I2WA 2QTMA 2ZR8A 5GJCA 1OILA 2IP1A 1ODIA 1UZNA 2FNAA 4D0LB 1VL1A 1SPXA 2RGBA 2CXOA 4FEEA 5DLEA 4ZCQA 2CKDA 1P8AA 2DBZA 2DPMA 2UVPB 5GZ6A 3RFVA 1QGZA 3RVOA 2II6A 1X87A 1XEXB 4IH9A 2QLTA 5EYPB 3KXPA 2J6IA 4FFWA 4L74A 3EJWA 2RGXA 3SLKA 1ZFNA 2YWDA 4P3NA 4TMVA 1DTWA 4D7AA 1CYEA 5KO2A 4HDKB 5DH9A 4A26A 4HN9A 1O89A 1QTRA 4BFSA 4EGCB 3OTQA 5DGCA 5EIXA 3EODA 4YT4A 2NVUA 3LLUA 2C7RA 4I55B 4CV3A 2WUEA 5ARDA 3M1LA 1UCFA 3A05A 1U0LA 2E89A 3CO5A 4FZ3A 2LBPA 4K87A 4ER5A 4XDYA 4GGMX 4NAHA 4JJFA 4LV8B 1XVLA 4KJZA 1TT5A 4NQRA 4XDHA 5LDGA 2NXNA 2NO0A 4AQDA 4D4MA 3I1JA 5L51A 1H1LA 2ZBRA 1PX2A 4WXHA 3HU2A 1NZJA 1GLNA 3DLHA 1Z5WA 4AZWA 4YRFA 5IULC 4FKZA 3QVOA 3RJZA 2VWHA 4KO3S 2O8NA 1KO5A 2QMZA 1U2DC 4FGKA 2NAFA 5J5VA 4J0FA 4I1IA 2AKEA 4LC9A 1ZD2P 1N7GA 4BLVA 2UVDA 5JT1A 2J09A 4CVNA 5K0NA 3S4YA 3D6MA 1IOZA 4EHDA 2OL4A 1YI0A 2VDRB 4IIDA 1YMVA 4JJKA 2DC1A 2XOKD 4WINA 3SZGA 1REQB 2WIAA 3BIOA 3TR0A 1PL0A 4CTKA 1R6DA 4Y9DA 3BD7A 4DV3B 3BA6A 3AT1A 2RGAA 3E9MA 4YONB 1EFHA 1PKXA 1BX3A 4AF7A 1Z7BA 5B12A 1G8HA 1ZM2A 1M34E 2D2EA 4RSRA 2ZDGA 3R76A 4O4LB 3K1AB 1GZ6A 3SQNA 2G77B 2XY4A 3STWA 1NJ1A 1AKVA 4M1OA 4QLOA 3E15A 2JLCA 4KAFA 3RQSA 4ZMRA 5AW4A 2ZIEA 3GR6A 4O63O 3DMPA 4MUKA 3EAGA 3U9LA 4GDFA 4JR0A 4LCEA 1UWKA 4ON9A 4V0ME 1BWQA 3P0JA 3EG9B 3R41A 3GZ4A 4RSGA 1QB8A 2OQ2A 2BFEA 2DWQA 4K9LA 2ZWAA 3F5DA 3RYIA 3GLHB 3CF0A 5AKYA 4K6MA 1TMYA 3PR1A 5BSMA 1GCUA 4LQCA 5FOXA 3ODPA 1HLPA 2CJYA 4JB3A 1RAAA 2ACKA 3HXLA 3EXIB 3K32A 2DWUA 4RTKA 4Y6PA 2RHOA 1E59A 3ZDAA 4BMPB 2ONZA 4LE2A 4W8GA 4DDWA 2JBAB 3LV8A 1K7EB 4J1SA 3IXQA 3QXSA 1GOTA 2FYTA 4CKCA 5BR1A 2OV4A 4V38A 1A95A 4BL5A 4F92B 1NMQA 3B6MA 1NUTA 2P0AA 3LUHA 3H84A 4P3KA 2BEWA 3IA2A 4A23A 4B6JA 2R97A 1HZJA 3OLZA 4IIFA 3H1TA 1Z26A 4IFTA 3ORYA 3IMCA 5L9AA 2A9OA 1MT0A 1GRCA 5TPZD 2GVNA 3RT1A 4EA6A 1Z56C 3C74A 4JB8A 3VKGA 5HUHA 3IT0A 3KS9A 3EIWA 3E9DA 2J41A 3R0XA 3W5IA 3QLVA 2OYSA 3EPJA 3EDCA 1JVSA 1E3TA 4F2PA 3O8QA 4KMSA 5BT8A 4RS4A 5FL7A 3THYB 1FQOA 3CUWA 5DE3A 2MJLA 4RDCA 4QSHA 1FMTA 2B1IA 3GGGA 3TFQA 3WYEA 2BEJA 1Z37A 2JJ2D 2LCQA 3D4OA 4G01B 2F4VB 1YS6A 1LK0A 5AUOB 3F4LA 2E2WA 1XRSB 3G1UA 3ZXUB 1IOWA 2YZNA 3I30X 3MNFA 3PR3A 3U7RA 2QN1A 2CB0A 2RHLA 4CM4B 1B4DA 2A14A 3PHHA 2A2ZA 2IV7A 2O0JA 1K3UB 2RGRA 4REMA 5GY7A 1CQIA 1MV8A 2UZAA 3MTEA 1WB9A 1X38A 3JRWA 2WV9A 4LMBA 2B0CA 3WL4A 4RWEA 4WZBE 2CL0X 3TQOA 2XSZD 4YC7A 5KWSA 4YP9A 3TRFA 3LCMA 3GUHA 4OQZA 3T7CA 1E5QA 2OFFA 2HTEA 2G5CA 1J2UA 2GN0A 4F2HA 4QEKA 4A15A 1M1NA 4ZWNA 4QOSA 1C7FA 2QLBA 4UCFA 4R0MA 2PWYA 1XALA 5C52B 5CFMA 4C6TA 4E51A 1CF9A 2XCLA 1YNOA 3EDRA 2RAUA 2D2IA 2BFCB 4YUWA 3ZBUA 1ZA2A 3QNWA 4LY3A 2GK7A 1UBEA 1ILWA 4RZSA 1P77A 4AF8A 3MQ2A 1VGRA 3EBLA 4AMZA 2YMMA 3AHFA 2ZR0A 1UJMA 1DUIA 3KYBA 3OQPA 3BJIC 4KLRA 2XI4A 1FTGA 2WJZB 5FHRA 1XLVA 1ZMOA 3WLIA 4J0CA 5KOJB 4D80A 1Q50A 3QI2A 4G86A 4OHMA 1BZYA 5D6NA 3VH3A 4H0FA 1L4LA 2LP4Y 2QY6A 4IMRA 2WDZA 1ISHA 4W1SA 3SX4A 2NUBA 2I03A 2HRZA 5HDQA 2IYPA 2WUWE 5AVWA 2NGRA 1JG4A 3DBHA 2G1PA 3KVRA 3VZQA 3AVQA 3P9RA 4PZPA 1FRNA 4GL2A 3ETDA 3G5TA 5EP4A 1QCYA 4NBWA 4MGHA 1PRYA 5BN4B 3RIGA 5HIMA 3WV4A 1Z2PX 3DHVA 4MCHA 1SQFA 3BTOA 4YRTA 1BVRA 2B69A 1IQUA 1SC3A 1Z4QA 3DOHA 3L7DA 1H0HA 5LIPA 2OGWA 3EOZA 1U0EA 2GAJA 3HCWA 4WBNB 5CA1B 4KQXA 2VH5R 1ZK2A 1I4EB 3OQ1A 3PV0A 4GL4A 3RM3A 5HGJA 5L3SA 4FCWA 5LKAA 4H9GA 1CF2O 3HCPA 4P9NA 3TJMA 1TZCA 1ZYUA 2I6UA 2HH9A 2D7DA 2J85A 3OOYA 4WZAE 2PMDA 5L40A 1RBZA 3O8OB 4GZMA 5K3AA 1CUFA 3AHEA 1TDJA 3W9UA 2YYZA 4LF9B 3WGLA 1WOMA 4FJ2A 3H97A 1H6AA 1XTIA 2JGJA 3O0TA 4TVOA 1SCJA 5J2TB 3NAMA 5ICEA 1JF8A 1RXEA 1XZQA 1E92A 2VTVA 3ML1A 1LJ8A 4DLBA 3HY6A 2BE7A 2D74A 2HHJA 2I4TA 1G18A 3S40A 5KYKA 3PS9A 3D5EA 5KTYA 1PW5A 1KDYA 3KUUA 4ABTA 4EAQA 1G8AA 3O93A 1PTJC 1KVRA 2W2NA 3K9NA 4OL0A 1CRLA 2NV2B 4PZEA 4MRPA 3TQHA 4GOKA 3OPYA 3LCVB 5C7YA 1PGJA 1YCDA 2F1HA 4QU8A 2ZJ6A 4LXGA 1EFRA 1UJNA 3H2HA 3OE7A 3LM8A 2C2MA 3PUHA 5LJLA 3E2PA 5DYIA 5GONB 3WKEA 3OJXA 1ISIA 2P9CA 2XZTA 3T7SA 4ESEA 3D7RA 3O74A 4PQYA 1YHZA 3ZZTA 3FWZA 4TROA 2VNKA 4NE2A 5C46F 1NN3A 3ANXA 4AG3A 2HXGA 5EJFA 4KWCA 4B3FX 1K7SN 1V7ZA 2BBWA 1JFVA 4MULA 1FK8A 1JSCA 2I7VA 4P98A 4NXMB 1K5DA 1A2QA 4EMTA 3RANA 4LW8A 4HAIA 4QECA 2ZYHA 5HQJA 1G8GA 2WFLA 4M3NA 3NATA 4FBLA 1UXOA 4O2RA 5E4JA 2A9KA 4EX6A 3OURA 4XUEA 4F56A 4FEAA 4DQUA 4O08A 1ND6A 1T9CA 2WG2A 2AJBA 1JYEA 3W5VA 4EKYA 1ZIYA 3EIOA 1XRPA 2APJA 2AG0A 3OHMA 1P7WA 1XRJA 2J32A 1DKPA 1A8QA 3OLQA 4CCYA 4CUKA 4DCCA 1NY6A 2AR7A 4H0NA 1HORA 4WKOA 2ZUSA 2CMGA 2DSNA 4B4OA 3MXTA 2RBEA 3HJUA 3CS3A 2IQIA 4KN6A 3IUBA 1H4SA 2J3HA 2DOKA 1UOEA 1P19A 2GYVA 3L6DA 4L8VA 4WW0A 1XKLA 4Y2JA 1WKVA 2AMFA 2DY1A 4RTSA 3H9CA 4HZGA 4XPZA 4G0QA 1AZWA 2AQIA 2P90A 1U9IA 3BMNB 1GLGA 1U5CA 2YWHA 3K0AA 1HOTA 2KX7A 3SICE 4ZDJA 3ZYZA 1X39A 4EFDA 1C4OA 3FCEA 1KYQA 2P5SA 2UVPA 3AINA 3JQAD 3Q8WA 3L43A 1DG9A 1H2FA 2FMXA 1N4DA 3DEYX 3LRTA 3TOSA 2X4GA 5SYNA 3HY3A 4CI9A 4TWRA 1ZICA 3OQHA 3PDIB 4HQ0A 1M72A 1E0SA 2IUUA 3W4IA 4AJKA 3JAKA 3RABA 1QQAA 1QRRA 1YZQA 4MUBA 3A9CA 3RYCB 2JAWA 3SHFA 2R6HA 2CYCA 3N7UA 2YXDA 3A37A 1CS0B 3O7MA 1S5PA 3MT0A 4I4IA 4IQGA 1RWBA 2XAAA 4N5IX 4DMKA 1VL8A 3F7MA 4NKRA 3KKKA 1HI9A 1VFNA 2AEMA 4KR0A 5DXAA 4ZRMA 2V7QA 5CLIA 3VDRA 4W5QA 4R54A 4DDHA 3IXLA 3N39C 1K8XB 3U4QA 4HK4A 2P7HA 3AVVA 1UDWA 2OV1A 4IV5A 4R8VA 2AC2A 1NJSA 2XADA 1WL8A 3BM5A 1CZHA 1QZUA 1CQXA 4KO1S 4EJ6A 3LNTA 3EWAA 2L18A 3CPHA 1TYBE 3BPSA 3L9XA 2CLSA 3N6RA 4JBGA 5CLJA 2QTCA 1CRPA 1J8FA 4C4PA 3TRJA 2H4ZA 4PFJA 1TCBA 1I2AA 3L8YA 1NW6A 2JFPA 2VPXA 2PDAA 3HDQA 3KHUA 4IDPA 4NCAA 1UZAA 4ZAGA 3W06A 1KR5A 3PTZA 1NVVQ 4LZOA 4PO3X 4FYJA 5CIQA 4EJMA 1L5LA 3WE7A 2NP7A 3W9YA 2YX1A 2GH1A 4KSCA 1LLCA 4UNIA 3PE6A 1R8XA 5EVCA 5LWQA 2NSDA 5BNZA 1QH1B 1F1JA 4HX5A 3A06A 1U7PA 3FNBA 1IL0A 4DWJA 1IY8A 2YMLA 3PNOA 4JCCA 5KSZA 1N8SA 4FONA 1GCIA 1X13A 1IHPA 2J9RA 1HFEL 3M83A 1Y5IA 4KGZA 4RHXA 4HNVA 1XMPA 2Y9MB 3B38A 2X40A 4DBZA 3UT0A 4UNRA 1FA9A 1WDMA 1Y1SA 4LHXA 2ZANA 3E1KA 3ZCSA 1KQPA 1T5DX 2QYOA 3O8OA 4CMEA 4MVJM 3HUTA 2CMHA 5BSRA 5JAUA 2JEOA 4UHEA 3A9SA 4TTTS 3QSYA 3C48A 4FWTA 1S2MA 3MCVA 1JR4A 2VSXA 4L7VA 3OUUA 4IXWA 1IDN1 4G0MA 1L5NA 2EFHB 3H3FA 4DGSA 2IHKA 5LMUB 4DUPA 4TXJA 3DAFA 3R7WA 3T3OA 2AFIE 3V1TC 2YWEA 5DBOA 1ORRA 1P9LA 3SMQA 4GZ3A 3KDPA 4R2KA 2EF0A 2HA0A 3DA8A 4NX2A 2I3BA 1Y34E 1EBUA 4CDNA 1ESZA 2DHQA 2DPHA 3ZZ1A 4J90A 4OM8A 1XU9A 1GU7A 3MTJA 5ERXA 1XLTC 4HQLA 3ZWXA 3WGUA 1XN1A 1ZCBA 1PJ8A 3LVQE 2WINI 1A04A 3O75A 3IVCA 1NBMD 3DW1X 2HU2A 1V5WA 4PR0A 4RH3A 1BW9B 3KZ1E 3L1IA 1TJ4A 2PUAA 3ETNA 1SBYA 2W6MA 1C7ZA 4MRMA 3C3CA 2ZUCA 4EQ6B 3ZI0A 4TYYA 3K2IA 3OLXA 1ZW6A 4NBRA 4NPAA 2BCJQ 1NXOA 1U4NA 2ZE6A 5L53A 4MMXB 1AM4D 4K88A 5JQGF 2AUMA 1K98A 4JK3A 4LSMA 4NE7A 5KC9A 2RG1A 2WG1A 3I61A 4H1UA 2IF2A 3LYLA 1IE3A 1C7EA 1W49A 2UYYA 3GEPA 1K3TA 5H02A 3VPGA 5FWNA 3FBTA 4DRZA 5JNTA 4DCMA 1KO8A 3IDOA 1GQSA 3WYDA 2D2FA 3FNRA 1DRUA 1YB6A 3AEKB 4KGVA 2OPHA 2ZM6B 4DR2B 3NU1A 4M9XA 4ZIRA 4UFOA 4B7CA 1ZM4A 2ZZKA 1KXZA 4D57A 2JLVA 2NWQA 1QRAA 2D5CA 2BLNA 2ZYIA 2OO5C 1QX3A 4NYJQ 4F5EA 4WUVA 2H8GA 5DMHA 3MELA 1PZFA 2B6NA 1LPNA 4MPPA 4IQ0A 1ZRSA 2J33A 4Z1OA 3PT9A 9LDTA 1YZFA 1N1EA 4M7OA 3O1HB 4Y9UA 4X8MA 2WHRA 1FNNA 3NWEA 1K4KA 1WXDA 1LI5A 3F46A 5FFNA 3Q10A 4D25A 1A8HA 1W1UA 2BUBA 3NT2A 1ISJA 1XAGA 3ABOB 3DT9A 5CM2Z 4MKIA 4P4SA 2BF7A 3TPZA 4GGPA 2FU5C 2WFAA 4KE8A 3CJTA 1YTLA 1ULSA 5CX1B 3DV2A 1CB0A 1G4HA 1Q6ZA 4IWNA 4PFSA 3WXBA 3R09A 3ZCVA 4WNYA 5A04A 5AVZA 4Z53A 2Q6IA 3L7JA 1CR0A 4MRAA 3G02A 3IULA 3OUTA 3OKPA 4KE7A 4R1UA 3W2EA 4XI9A 1SB9A 4NBKA 5JJLA 4ZAXA 2R62A 2JHFA 4KMOA 1RWMA 1XZIA 3C3EA 2PY6A 3GMTA 4JI6B 3KB2A 1SKBA 1JSZA 2VNIA 4RJKA 3RFUA 3RKUA 4AZ0A 4DB4A 3U56A 5IT0A 4I81A 4S1OA 3OOWA 1K2WA 4BRSA 3O3OB 1Y63A 1PIWA 3DZCA 1H8HD 3JQQA 1FUKA 1TZJA 2XYHA 1ZCFA 1PV1A 4RFSA 4TX1A 1FDOA 1MB0A 5T57A 3BWCA 1A9YA 3FHTA 2JJQA 3GFPA 2Z3ZA 4NMLA 1I5EA 1LJLA 3OCZA 3QZUA 4RHCA 5F52A 4UTPA 4ENWA 1N33B 2Q3LA 3O0DA 1YMUA 3O38A 1JAXA 1FFEA 4M7WA 5FEMA 3G8CA 2IWRA 4JWKA 5ICSA 4JJEA 1CNEA 1A7KA 3DLCA 4FI3F 2X6QA 5EHGA 4HNGA 5J5AA 4ERNA 4ZZ3A 5FCDA 1D04A 1D2NA 1OWNA 4LG1A 3VR5A 4B85A 1CVLA 4GZLA 4XYEA 5DBEX 1XIVA 2WU8A 3SX2A 3VBCA 3L01A 4RLQA 3EMKA 1KSFX 2ORED 4Q12A 4ETIA 4OBBA 2O8CB 2WYWA 1L7XA 4FW8A 4WMLA 1YDFA 1DV2A 4FWIB 2ECKA 4XUCA 5FKJA 3Q9LA 5JAQA 3QOFA 1C3EA 2HWWA 2WG0A 4LJAA 3GXBA 5FX2A 1Y37A 1CV2A 1QHGA 1V39A 2NZUG 4NIMA 2R2GA 1UK6A 2ZXUA 4JVNA 2A92A 1QPBA 1T5BA 5ALSA 5DM60 3B8EA 1KNQA 3E7FA 4BMSA 2HAEA 5D5HA 2R1VA 2C99A 5BR4A 2FOLA 4PPGA 3NNSA 4RK7A 5EGNA 3GLFB 3MSCA 2A7XA 4PLFA 4QRHA 2AI3A 2J6CA 2XMDA 2DB3A 2X8WA 1Z18A 1GIAA 3B1FA 3WHKA 4HMQA 1QFYA 1RI1A 5JYDA 4ISBA 2W2LA 2XNCA 4LHWA 5CB4B 2G0NA 3ABQB 1PV2A 3MCZA 1E3QA 4WK0B 2Y68A 3WMRA 5LMCA 2C4NA 4G37A 4WLUA 4AWBA 2BRUC 2JFGA 2HXSA 1AS0A 1GPUA 3KOZA 4G9EA 1E3EA 1B15A 1OFTA 1PT7A 3PXXA 4KDFA 1Z5UA 5IXSA 3VNQA 4S1NA 3TIFA 1AHHA 2O3RA 2AWOA 3AESB 3LUGA 4H3VA 4A8TA 3IEMA 3GRRA 2IXBA 1MDBA 4YRLA 1HV8A 7ABPA 2A9RA 2IFTA 3RRMA 2OSBA 1NLYA 3LTNC 4E70A 1TZ2A 4DAOA 5H3CA 4N82A 1BQ3A 1QH8A 3AI3A 4FW9A 4OKIA 5DX1A 4G1BA 1TYEB 2BSXA 1KFJB 2PL5A 3LNCA 4RKFA 5JD3A 3K96A 4JR1A 3UK0A 4CQLB 1SB8A 2ASEA 2V7XA 3E81A 3RJ5A 5LOVA 3REQA 1L4GA 3VISA 3D3WB 3C3MA 5I9MA 3F6EX 4XCQA 5FBHA 3L0IB 5JAOA 1VHDA 2LW7A 1ZU5A 4AXBA 2GM3A 4LJRA 1T1IA 2IYEA 2PT7A 3ADPA 1WF6A 1X9HA 5ALPA 2Q5CA 1AKEA 3UCFA 3B6ZA 1YUNA 1Q7TA 4KIGA 3LVRE 1UBSB 3EFOB 4E2YA 2BR4A 1CY0A 1Z0SA 3C3XA 2EW2A 1V0JA 4GHWA 5EMMA 5EYPA 4Z3DA 4JI4B 4E5KA 1QGED 1WD5A 5EOVA 3Q0EA 2HSDA 2PX8A 1BW9A 2ZITA 3THSA 3HG7A 5BW5A 5C1OA 1ZN2A 1AHPA 3QV2A 4FYXA 3S2ZA 3DS8A 4L5BA 1JFRA 4XOIA 4I50A 1IQ0A 1ABFA 1TLLA 2EFDB 1OH6A 4B71A 2VFAA 3GLFE 1TK2A 3Q8MA 4P7BA 2IOHA 5LDDC 4ESHA 1TJPB 3IO3A 2ZBEA 4TS3A 3R3ZA 5AT1A 3A27A 1D2GA 4DA8A 3O03A 3R8FA 1U99A 1FYVA 1GR0A 2XUQA 3EQZA 4H7EA 4PYIA 3ERCA 3LUKA 4HDRB 5COAA 1EUYA 2JEZA 2ZWMA 4JXJA 4O2LA 2QMOA 1EU1A 4TMTA 1RKQA 3PWZA 1OLXA 1G8FA 1ZD1A 3R6TA 1HE8B 1VYTA 2QPTA 3QVKA 4A03A 2WJPA 1G20B 4FD3A 4FSHA 1THMA 5P8WA 3MW8A 3P4UA 4GPEA 4CPDA 4DXAA 4QE3A 4M4SA 3TEMA 3UWMA 1B76A 1GT91 1XVTA 1II0A 2ECQA 2EF1A 4D8WA 4L5YA 1MRNA 4RE5A 5KSYA 4A92A 1X7DA 2VXOA 3S1LA 4G89A 5E38A 3B52X 5GZ1A 2PE5A 1HR0B 1WKCA 1OBOA 2HRDA 4LWOA 1W88B 2NPIA 1T4DA 2FZEA 4PG6A 1QFXA 5TPWA 3GJXC 1G20E 4L5CA 3ZE0B 4RTPA 2LNDA 4RBNA 3HO6A 3DUFA 1DEHA 2QJWA 4FX5A 2IEYA 1NC3A 1TMGE 2YDYA 5AM5A 1OFUA 5C8YF 1NI4B 3KUXA 3A6GA 2Z83A 1LPSA 3K0CC 4QT0A 4B3CA 3D8BA 4OCZA 1FX0B 4PXYA 1ADBA 4Q1AA 1H5UA 3SLGA 1PO7A 5B7NA 3RTEA 2NU9A 2GZ3A 1KOFA 2P35A 4IBOA 1W5TA 1DJOA 4MUJA 5D1HA 5I9IA 1GDDA 4EVIA 1P0MA 5K6RA 3NANA 3QENA 4LK3A 1ID1A 3RPEA 4CBVA 1UC4B 4BVLA 1F6BA 2Z04A 1XYYA 3W8NA 4BFTA 3LKZA 1CERA 2HA6A 1OZFA 3AEXA 4FGJA 4IINA 2PGJA 3WLOA 4NCJA 3J81k 1N3IA 3QUQA 4IRUB 2F8SA 1T6YA 3A3PA 1WVGA 1R66A 4AQ7A 1GR1A 2ZBDA 2E4XA 4UZEA 4XCVA 5KNDH 3GLIA 1HE1C 3QE4A 1H2WA 3GZTB 1G21B 3R7AA 3TLBA 1FTWA 1K6IA 5DB4A 1RRMA 2E1PA 3EFHA 5FBRB 2P75A 3RHFA 1FSZA 3VKUA 1G38A 1SKYB 5I3ZA 4NS4A 4OLBA 2JI8A 2W0SA 3JWEA 4JQCA 3JAKB 3U9SA 5EPUA 3UAOA 1SK9A 4DV6B 3ZD6A 5AI0A 3F9RA 4HS9A 1N2EA 2BZGA 3DE4X 1KEEB 1KOJA 2GRJA 3K9FC 1IVNA 4Y2TA 4DM7A 3ZDFA 5IASA 4DJEC 2WD8A 1IZZA 3NYIA 4AS2A 1Y8RA 1GPNA 1N78A 1O6BA 4UVIA 2NUAA 4M46A 1NUQA 1M3SA 1VKHA 1WXHA 1ELOA 3IAUA 3ZKAA 3FYUB 4GKJB 1PSWA 1N77A 1Z88A 4PAQA 1DAOA 4DLWA 4PZDA 3HACA 4BBPA 3ABIA 4EB3A 3EGVA 4HUQB 3JAWB 4R1NA 2YC2C 2VAVA 2V3WA 1X14A 2MSCB 1PQUA 3T61A 3BSFA 2BM0A 3D3WA 4TYNA 2QDXA 3LCJA 4LK2A 4TMWA 3L7BA 2YV5A 3PX2A 3UXYA 2XZLA 3NT5A 1JJ7A 3ASZA 2R6JA 3U39A 3C1OA 1DIOB 2OD9A 1PL7A 2OP0A 1ADJA 3KNZA 3GT3A 2Z0MA 3PQ6A 1CNFA 1S6YA 4P4UA 4B4UA 1ZHOA 2ENWA 2V0NA 4IEEA 1NF8A 5AWFC 2YICA 4X44A 5AQ1A 2WFLB 4IQ8A 4X7PA 2JJ1A 4FR0A 1FNBA 2YV1A 4HBZA 4N5LA 2PKYX 4WD3A 2LDBA 2P1RA 2PBLA 5AM2A 1QZXA 1LS1A 2X4IA 3O8BA 3RHTA 1XMOB 3R9KA 3I28A 3LC2O 4JY7A 1COWD 2XCUA 1EGVB 1IHXA 2VYQA 1XV5A 4GOND 3SF8B 2ZRQA 2ZUUA 3DLTA 4A7PA 4P5DA 3C0KA 4YJ3A 4YR9A 1Y7IA 3JQ9C 1G21E 3IBGA 3A1NA 3P9YA 4II2A 2FZWA 1WB6A 3D5QA 3PXUA 4FZRA 4MH0R 3W6ZA 1XXHE 3NHRA 4GM4A 4IYJA 2GYUA 2NXCA 5EFOA 2W8BB 4BO8A 1U1CA 1PSDA 5CIYA 3GLFA 4ZVPA 1CCWA 2ZRHA 4P0QB 4HNAA 3QY0A 4JEIA 4MV1A 4A0QA 4OL9A 3THXA 3AF0A 3IOYA 1FVXA 4R3UC 13PKA 2AFIA 2BMAA 2VUIB 2H51A 3CTMA 3OX4A 1BN7A 2OGZA 2R8EA 4XWYA 3G59A 1Y1RA 3C8DA 5BMOA 1B73A 3E23A 3IT2A 3RGGA 3ZCQA 2WI8A 1PLJA 4HUTA 1QG6A 1NP7A 2AOTA 3ZHSA 3FOBA 5IWCA 1IMJA 4Q9AA 5CT8A 4TKVA 3D8SA 3W5AA 1UQUA 3E82A 1I6MA 1U3DA 3LBHA 2QLJA 3VJKA 5BORA 1E69A 4A8PA 4U00A 4CM8B 2O57A 3CWZA 4G09A 5IVDA 1L7MA 3AXTA 3H16A 1YOVA 1TQDA 2RK3A 4MSUA 5EJ5A 4XWTA 4L9SA 3STYA 2CLFB 2DUNA 3O8CA 4J3NA 4J07A 2DERA 5L3SB 2QRUA 4G5RA 3EUEA 4K40A 4OMFG 5C31A 1POXA 5CDTA 1SKMA 3KSRA 2XYVA 2VDKB 4DMGA 1ODKA 2VS1A 3DBVO 4I3FA 4DKXA 4Z0TA 1X3SA 2ONKA 3BJEA 3GA5A 1H05A 3OFND 5T4FA 4YPVA 4EUNA 4CMBA 5CH3A 4W5OA 2ZCUA 3GB9A 3THRA 4IDQA 2MR5A 1JLLB 1SUCA 5HMLA 5HJEA 3B1ZA 3CT4A 2IIQA 3RU7A 4C89A 2ZBGA 4LRWA 3FD8A 2AC4A 1J5XA 2VHYA 4MEBA 1WHSA 4ZCIA 3QBJA 1NN5A 1JDBB 5ALKA 5KTPA 4R1OA 3GJTA 4O4LF 4BCDA 2H2AA 2YW9A 2QSJA 1TQ8A 3M6VA 2IPOA 3SYNA 4N65A 4QUGA 5J63A 4A0GA 3V4SA 1SCUA 4GOJA 1SD1A 2AZDA 2RC6A 2Q1YA 4HGNA 4D9HA 3CZ4A 4YN3A 4YRMA 1N5KA 3MRVA 4EA9A 3HSKA 1G5IA 3ANSA 4RVNA 2HQ1A 4ZRNA 5EP1A 3SEAA 4NDNE 1OH8A 3BX1A 4KHPB 2K6GA 1TPYA 4LISA 4DXDA 4RD2A 2YXPX 1HRDA 3PF9A 5DHRA 4YCMA 3ZBQA 1D1SA 3AP3A 1ABEA 5C5IA 2RGWA 3FFXA 5B4TA 1F6DA 2G36A 3X2SA 5ALNA 5JRJA 4DR4B 1A8PA 2OMKA 3I4LA 1IUKA 1RXUA 2QQ0A 1GLVA 3OIDA 4LOHA 5FA6A 3OLCX 4HWPA 4G07A 3ED5A 3TWOA 5KYWA 1A98A 5ESRA 1XD9A 4Y6RA 1JHVA 1R9NA 5EJ4A 5JFOA 3SM3A 5KC8A 1UANA 3WK5A 3JQGB 1NW5A 4MLCA 2OHXA 2QZPA 2CY0A 1GG5A 1RI5A 4TRRA 2LR0A 2V03A 4H08A 1KAQA 2ZI7A 4DLSA 1P4SA 2D1RA 2G09A 2QX8A 2BFNA 3G9XA 3OCUA 1CPYA 2EWVA 2QW0X 4TV8F 4X24A 4Z9AA 3ZK8A 2Y0EA 2HJVA 5A3SA 4CV1A 2PPVA 1MC5A 5FFFA 2J30A 1EDDA 3SYMA 3Q4GA 4Q05A 4Z9BA 1P7PA 1X9IA 3WDLA 1E9EA 1JR2A 3A04A 1A5ZA 1E64A 1SRRA 2YJGA 1YUBA 2V98A 4JC4A 1X7YB 2GEVA 4L4ZA 4CEHA 3TIVA 4GPD1 1WMBA 4HSEA 3K8YA 4I19A 1UAAA 3G17A 1G5QA 4RENA 5HBRA 3ICWA 2IU0A 2JVIA 2XBUA 1CIVA 3N53A 1BXZA 4HAVA 4JUCA 1H23A 4O29A 1RPAA 2ETXA 3V4OA 5JI2E 1MX1A 5GIPE 4M8IA 5I9LA 1U8EA 3R40A 1F0NA 3JXEA 4TMZA 4KYVA 5E4TA 1N25A 4O2BB 5KU1A 4G0WA 2WHYA 4GI3A 1XCJA 1T10A 3TLEA 2CT8A 4BNYA 3MLBA 3ESYA 1U6IA 3WSVA 3PRJA 2VP4A 3FBWA 3B12A 1DQRA 1EYZA 1EK6A 2QIOA 4E30A 2WJ6A 5LQDA 1SCBA 3ILYA 5TQVA 2F6RA 3QQ5A 3PQEA 5B57C 4TVBA 3VVBA 1FU7A 2VATA 2PXAA 3CEJA 3HVHA 3L82B 4KN9S 4QBKA 3CRVA 2MSLA 1T0BA 2O8VA 3PIIA 4G3XA 4DJDC 4NK5A 1U0FA 1QP0A 2DXIA 3PA8A 1G8YA 2OECA 2C1XA 2ZAMA 3U3MA 3FGZA 3LRXA 1SC9A 3NCHA 5TXGA 1FBTA 1I3MA 4EI9A 5KYGA 2WABA 4OHYA 1IN1A 1EBFA 2CFTA 3U61B 2E7ZA 4NJMA 4C4OA 3FJ1A 5IUJC 3DL7A 5C4GB 4C43A 3LBIA 5G1OA 2PAAA 3TCKA 4L8GA 4J1NA 3PI6A 3N2IA 3W4KA 1XCPA 3PCXA 1KEWA 1PR0A 1SCIA 1T5OA 2JC3A 3AJ9A 4CNQA 1JQEA 3QQPA 3T0FA 2R7MA 4OAOA 4PHHA 1FSSA 2DUJA 2FX3A 2HRQA 4CFSA 4KQHA 4ZOAA 1CK4A 2Z6VA 3ND9A 5KTNA 4O4HA 1AKMA 5AM3A 3U48A 2IYVA 2A0UA 3CNNA 4R01A 4F45A 5EHXA 1N75A 2W6OA 4O1IA 1NG1A 4LYFA 4O2AA 4DT1A 3LHKA 2WVJA 5JCJA 3RS5A 1PUJA 1WA5A 1HXHA 1BVUA 2AYYA 2Q27A 1A9OA 3L4EA 3KAPA 4WN3A 4LXXA 2Q0HA 2Y0PA 4DC9A 1G64A 3WZLA 3CEAA 4TL6A 1RSZA 2GPTA 1K75A 4ZDIA 1YQTA 5IC4A 1YUMA 4OHUA 2G9QA 2QN9A 1BFUA 3FX2A 4DEYA 2B4KA 1XJ5A 1A7AA 1RRKA 3L6RA 4R4JA 2PX4A 3OE7D 1B42A 1QDEA 1FC0A 3LGSA 3LLVA 1DT3A 5HX7A 3UGKA 1MAVA 3G2IA 3TLMA 4XLLA 5JS1A 3A6LA 3K2BA 1YGYA 1Y89A 2WSSA 3NEAA 5ED4A 5AVJA 2D4AA 4H16A 1SFRA 4MYSA 3SEQA 2Y1CA 3KD3A 1SBZA 4FMCB 2FHSA 4DPLA 4FB4A 3NVDA 3VDQA 2C03A 3L8GA 5A6SA 1ADYA 2WZDA 3FF1A 1M5TA 3QJGA 1G98A 3Q12A 1JE1A 1EK5A 2GARA 3E9QA 3TH5A 1D3AA 2VA9A 5FLEX 2BE9A 3NWPA 1A9SA 2GF0A 1N2SA 4HFNA 1R9GA 4FK8A 5BQPA 4QUIA 4QC2A 1YR6A 3T1YB 1KPHA 1OHHA 4MEAA 3LRPA 4ZCLA 5EXXA 2RGCA 2GJ4A 4FUTA 3A1UA 3QYAA 2LDXA 3HKDB 3T54A 3UY4A 1VRVA 4OIFA 5IJAA 3A1CA 5A5FA 3NORA 4URZR 5JMTA 5LNK1 2AJTA 4TTJA 1R00A 1Z7WA 4TUYF 1H4QA 2CYBA 5AKZA 1KEVA 2Q3HA 1TIKA 4P6VF 5LBUA 4EKGA 2GBGA 2RAVA 3C98A 3H5TA 3QEBZ 1MC4A 1QS0A 3K9QO 4PGHA 1PJ4A 3B7GA 1QAMA 1RHUA 1ZOIA 1DKLA 1G66A 2VK8A 3IQDB 5IAEA 4FQ7A 5IBPA 1LEHA 1OIVA 2NZYA 2XDWA 2V45A 4UHKA 3U4GA 2GKSA 3IQHX 3M4JA 4RF4A 2FFJA 4HAXA 3TW4A 4Y30A 3HKDA 5AOVA 3OZXA 3GF4A 4K1LA 4Z49A 4BUJA 5CCXA 4KI7A 3TX6A 3VO2A 1F4LA 3KP1A 3NVKI 4MQMA 3B1KA 1MZVA 2Z08A 1PJZA 3H3XA 3CR7A 3JZAA 3PJDA 4QNRA 3WK6A 3CF6R 4ZMSA 3FVWA 3B3GA 5IJXA 1OKKD 4Q3AA 1YIDA 1ECPA 2RHMA 2VT3A 2W2OA 2G71A 1H2HA 1UJBA 2ZULA 3OH8A 4J0DA 4MUAA 1IM5A 1HDRA 5C8XA 3IS3A 2GLTA 2CF5A 2H2IA 5JNVA 2GWHA 1IDOA 5ALOA 5BSTA 1VHQA 1OXVA 1N2XA 3GJYA 1OXTA 4LFBB 3O4IA 5H7XA 2G83A 1EJ6A 4YHHB 3MBIA 3D6HA 4RJLA 4MZXA 5B1DA 4OP3A 4WCFB 2JZNA 1PNTA 2DEUA 1KGSA 1KJ9A 4QUEA 1AOXA 3I5YA 1Y9DA 1EZZA 2LTAA 2ISQA 2Q6TA 1ZVKA 3UCXA 5GGYA 1QFSA 2DFPA 3Q3HA 4S1VA 5ITSA 1ODJA 4KUEA 4FC7A 3O31A 2ZIXA 3O9ZA 5DU2A 5BMVF 4DMCA 5JADA 4UBOA 2GNAA 1G3MA 2ZBQA 3KTFA 4YIHA 1F2TB 3ZJVA 4LDRA 4TLCA 3TZQA 1A9QA 4JLSA 2BFDB 1EQ2A 4HYQA 5EXEA 4CMHA 1YA4A 3FM9A 4GRDA 3TCNA 4CGYA 1NF9A 3KQQA 4G9BA 4AJIA 5HG0A 1ODFA 1PVVA 3HK2A 2RJNA 3KQOA 2QLMA 5BQFA 2Y67A 3A4TA 3HBFA 4HN4B 1Q22A 3EZ9A 2X3YA 4L95C 4XVRA 3SBEA 2D7JA 3DEJA 3MPUA 4N41A 1X0VA 1KY5A 3U4DA 1TCCA 4FJ1A 4D44A 3O4JA 2ZETA 4PX3A 4DIMA 4F8EA 3Q3CA 4FNAA 1RXYA 4GVPA 3DOUA 1I7LA 1F9EA 1J0XO 1F38A 3JQ6A 4KVZA 4P36A 4WLEA 4G5SA 4ZI7A 3IIIA 3L1HA 5CDGA 1BVHA 4L28A 1MW8X 2WU1A 4MI6A 3WO1A 1SXGA 5K3EA 2HF2A 1QYCA 2PX2A 3W1VA 3QJ5A 3H6HA 3NHBA 3GDWA 3L0SA 3QVWA 3ROQA 4HWSA 2BGGA 2CNWA 4K9OA 4F6RA 1FDRA 5JVDF 1RHQA 1SUDA 1NRXA 2FPIA 2ON6A 3IL2A 2CDAA 1HDXA 1GYQA 1MGOA 1U2TA 3DDCA 4F4IA 1KXJA 2OHIA 4FE3A 3EVCA 3AUJB 1SPBS 2PUWA 3EVAA 1HC7A 1PZEA 3U81A 4W63A 2P2DA 5KU7A 2A0WA 2Y8EA 5B55A 1VE7A 1I4TD 2EZ9A 3JAMA 3R6WA 3NTVA 5ERYA 2PYDA 1VYVA 3H04A 4NFSA 2FP4B 3IQXA 3G2MA 3I2JA 1SG9A 1HK7A 3MAGA 3SEZA 3G0DA 1A5TA 3CN9A 3NXKA 5DM0A 2DBVO 1G291 1EUDA 1WXIA 2DAPA 1CZLA 3BMXA 3EOAI 3V8RA 2R5FA 3WK9A 4QTTB 1COWA 3CW2A 2J3KA 4ND8A 1ODSA 5P21A 4C30A 4KP7A 2H59A 3SWWA 2GEDA 4MPDA 4QUAA 1BHQ1 1RJDA 2FWNA 3T1TA 4H31A 2YZMA 1KH1A 3R7LA 4RXMA 2GCEA 2FR1A 1QK5A 1TTHA 3BIFA 3PNQA 4G1MB 4LE0A 2K87A 3DO6A 3IPLA 4WI1A 5SZKB 3A1VA 2O1EA 3UWSA 2PLWA 2WUDA 3SJAA 3WC4A 4DLLA 4CQNA 2ZTUA 4G4GA 3CH4B 2I2BA 3OIWA 3VU0A 1TIBA 4IZIA 2RIPA 1Y4DE 2ACVA 2EX1A 3O90A 1TC1A 2ZSHA 1USKA 3JQRA 3UK7A 1YHNA 3DZHA 3TTUA 4ENVA 5KMGB 1LSSA 2JFWA 1KYWA 4DA0A 2IHTA 4HXGA 4AS1A 3JWGA 4YJ3F 2FQYA 1MVNA 2JFQA 2JIZA 2Z58A 1NNI1 1NYTA 3M33A 3GUYA 3QUSA 4IY1A 1WDTA 3FTPA 4KODA 3B85A 5DFAA 4ZJUA 1I1QB 4Q19A 5IDQA 1X80A 1YR2A 3JARB 1T24A 1SU7A 2J8ZA 4HLUC 1PKEA 1SUWA 3UUGA 2XNKA 3EXFB 3URMA 3ZWDA 3RFXA 2D8MA 3EA0A 4TMXA 1CQIB 3IT3A 4PZZA 4YRCA 1BG6A 3FWYA 4GS5A 4QBIA 5B37A 4BNGA 2DTEA 3FRIA 1PUXA 4MPJA 3SIXA 4Q18A 5KHLB 4LF7B 4NJEA 1JHDA 1IEVA 4NYIR 5K0LA 1GQOA 4JI2B 4DJFC 2YWFA 3IMFA 1P9NA 5F98A 2XMGA 4L50A 4E32A 3UT5A 3D1LA 5K8TA 1BXGA 4MJ3A 1V2GA 3W8EA 4C7OB 1WXGA 5EP2A 4UU8A 3IHKA 1CUYA 1ZAKA 3W79A 4QYWA 3JQFC 5CHYA 5J1SB 3R9XB 3JQ9A 3W90A 2YN2A 2X76A 4OJQA 4JUAA 2PANA 4ESVA 3L0CA 3LPCA 1RYMA 4K2HA 5G0TA 2O6HA 3IAS6 4X20A 1HFKA 1RAGA 1QIKA 1NURA 5EIFA 3S8MA 1L7AA 2ATEA 1UPXA 2WM8A 1I10A 4Q3CA 2NIPA 4QDOA 5FBWB 1U5BA 4ZAWA 3I42A 2I2XB 4L72A 1GAQA 3TQFA 4HB4A 3VPAA 4CKWB 5AHWA 5EKDA 1VG8A 1PTKA 4M0DA 1C30B 5REQA 4I5GA 1T5IA 3FNEA 4GOLD 1VIYA 2JLQA 3AGPA 1EFPB 3P45A 4TM7A 4YMSA 3KZMA 3WLRA 2VP6A 1FLAA 2AK2A 2BDUA 1UBJS 2GFHA 3DR3A 3PVSA 3QVUA 1NT4A 2R3SA 3A6EA 4J2TA 5B3LA 3OZBA 4TLAA 1EFVB 10MHA 2XXAB 2JBAA 1USGA 2ODPA 3F67A 1ZM9A 2C2BA 2E9SA 4FT4A 4HWKA 3VJRA 3BL8A 3FPHA 2BGNA 4N8DA 5DHTA 5KJ1A 3MMSA 1ECLA 2AV6A 1XA3A 2ZI3A 4KKXB 2IGTA 3C8UA 1E7RA 1GG2A 3GD5A 1SU6A 1KI8A 3LY8A 4HATA 2EFGA 1HNNA 1YU6A 2VIIA 4Q7KA 3JVUA 1FTQA 2QI9F 4RVGA 1E32A 1NW4A 4XIFA 3RT9A 4A0FA 5KNBA 3ZNQA 3RYIB 3TK1A 1OIWA 1QXSA 4ND6A 4G0YA 4TTAA 1N0HA 5CVVA 1UMKA 1DTSA 4YJHA 3TSAA 2YBEA 2NVOA 3I04M 5IFLA 2VYND 5G0WA 2ZE5A 2DUWA 4OHPA 1L7BA 3KJEA 4KPYA 4UM8B 1Z28A 4GFDA 4QGHA 1P2BA 1B6RA 3DHYA 1GY8A 3FFTA 4RK0A 5EJ8A 2RHCA 2QMQA 5HGXA 3C3AA 2BHLA 1A8SA 1MC1A 4WESB 1XK7A 2GHIA 3R2JA 4EKIA 2FSUA 4G65A 5KNCA 3WGIA 2Q7XA 1VMDA 3KLBA 2OD2A 5KNBH 1L7RA 4HUJA 5G1PA 3SEFA 1JDJA 3FWHA 3RG2A 4IFBA 4LV6A 3GZNB 1P6UA 1YZHA 2OV6A 4CE6A 1ZNYA 1Q1NA 2Q4EA 3PZBA 3H9QA 1PS0A 4GP7A 3ZWBA 3DF7A 3E27A 1X1DA 1CQWA 1M6EX 2W2KA 3KX2A 3PXGA 4UPEA 4YCCA 3ZIDA 2Z43A 2P9BA 1GCOA 1P5FA 4ME6A 3A70A 1DU4A 1WXFA 2XB9A 1QLHA 1PZXA 4C0KA 1DCTA 2V6IA 1TQ4A 3IAFA 3VPHA 3UUWA 5IWAB 3GEBA 3AKDA 2FLVA 1Z0IA 2WPDD 3MWDB 1E3WB 1MEOA 4FU0A 4MX8A 4EHNA 4IDAA 1M83A 1PF7E 3LLCA 2MT9A 1SC6A 1KH3A 3ORHA 1RM0A 2C9MA 1QFZA 3AONB 1KTVA 2VHJA 4IHKA 5IDVA 1GM5A 2XB6A 2C8KA 5BY2A 4BE7B 3ROMA 1YRYE 2FFHA 5T6MA 3U3JA 3V80A 4NFYA 3ENQA 3VKFA 4AMBA 2O54A 1VJ0A 2BL4A 2BSQA 1XVIA 2X15A 3CZ9A 1KJWA 3OZRA 4HYTA 2JCGA 3QKUA 4OLHA 4Q37A 5HMMA 1NJ6A 3VO9A 3CWCA 1N6RA 2QG6A 1CNMA 2NVUB 2C7VA 1RVV1 1PCXA 2NZJA 3IFSA 2YWGA 4U6NA 4GP9A 3UH1A 2YH2A 4H1VA 5TC4A 3WB2A 4D9FA 3CVXA 4QIHA 5LQJA 4M22A 5AHRA 3D0KA 2JJMA 3IIJA 1Q1ZA 3WHPA 1K6JA 3K1YA 4PR3A 5F21A 2A8YA 2IHZA 2N75A 3HFJA 4K9QA 4NYJR 2W8ZA 2NUAB 2AFHE 3R1IA 2C7GA 4GEKA 2ZPTX 3E53A 5CBKA 4Q4CA 2HLPA 2VDLB 4QWMA 1Z06A 3LLSA 4Y1GA 1PJBA 2OAEA 1V5IA 3IIMA 1WVMA 5SYAA 2JZCA 1QV9A 1J06A 1QIEA 2IUSA 2PZKA 3O92A 3SHVA 2CNNA 4QJIA 1JMYA 2PU7A 3F5SA 1BOOA 3QYJA 1QGYA 3GW8A 3KHTA 3LCRA 3RJMA 3C8MA 4HBGA 3II6X 1MFZA 4B6OA 1CS4C 1PS9A 4JLOA 4D0NA 4A16A 5E3IA 4JI5B 2J3QA 1A72A 4ILKA 3EVFA 5G41A 1X2BA 2HFKA 2PKQO 4MW4A 1FVOA 3BZBA 2OGSA 1Z5VA 3IDSA 5C81A 1FW8A 1RQLA 5KKAA 2X5KO 3NO4A 1JT2A 1OBVA 1ZX1A 3DD1A 1Q92A 2ZDQA 1R0XA 1ZH8A 3DEKA 3MIIA 1KYTA 3ND5A 5K0EA 4DR3B 3FCUB 3Q88A 3VYVA 4F3TA 2O2GA 4A6PA 3BWVA 1EB9A 2OG1A 4MV5A 2C2OA 2ZSKA 5GM1A 2AUTA 3QXGA 4RMGA 1J70A 1OUMA 1I7DA 2ZAGA 2Q4RA 3FVVA 4Y9TA 4URVR 5JDCA 4XR9A 1XQ6A 3FSRA 2KBEA 3FMVA 3P2JA 1Y3DE 2ZBPA 3D43A 4Y2YA 1Z82A 4F9GA 2SCUA 5T3UA 1GVHA 2FUEA 3ES9A 1ESEA 2IJGX 2HF8A 2DTDA 3DOOA 4MA0A 2V65A 4L07A 1X92A 3DXXA 5A0TA 1Y5LA 4ZYVA 3CRNA 3FVQA 2BJWA 4EHAA 2WF5A 1DKQA 4G1VA 4EO9A 2OAQ1 4TMKA 2JFOA 3H5WA 4YJFA 1E4VA 4LSWA 1HG0A 2QN8A 5BNWA 1SRQA 2DHEA 3TEFA 1W48A 2OCGA 4WXEA 1SHLA 2JAOA 2XYRA 2KBFA 3GLGA 5CDYA 2YVQA 3PYXA 4FFLA 2EKBA 4R8KA 4IMIB 3AU9A 5FPTA 3RGWS 1PYOA 2PMKA 1Z0KA 4CDMA 3NP9A 3QFSA 1JN0A 3HBLA 5HFJA 3GEHA 2ZS9A 1HKUA 3QBDA 5K3BA 3H1FA 1CR2A 2NXWA 1Z4OA 5HIAA 4N0MA 2ZVPX 4FDUA 2CL7X 1GPBA 2CN1A 2DQKA 4OBEA 3PXCX 4BQRA 1LA2A 4GQIA 4MIYA 4U39A 1SHUX 1QYRA 3AR4A 1P2GA 2J4CA 1DEAA 2I6GA 3RC8A 1B00A 4CMCA 2H08A 4WACA 3CNHA 2CJWB 4L3WA 1U2RA 4PU0A 4XQCA 2E87A 1VI2A 3OC0A 3PCTA 1NBEA 2Q2QA 1ENPA 3TNJA 4ZA2A 1Q0QA 4EFMA 4I9HA 4IS2A 4GQAA 1RU3A 3A6ZA 1A4IA 3CRQA 4EO7A 4Q00A 3QW2A 1UR5A 1MOQA 1Y1PA 1GKIA 4P35A 3TCXB 2CMKA 3RC1A 2BP7B 4BLRA 1Q1BA 3JQAB 4V0NA 3EPRA 2GZ1A 2QG9A 3COZA 1OPRA 1F8FA 1USIA 5AVKA 1JG1A 1KI3A 2GPNA 3EZLA 2Y0CA 5HQTA 5KX5B 3M70A 3BTSA 3K70B 1V1MB 4WSOA 1TUIA 2C1ZA 2V4UA 4EB6B 4A6XA 2PWPA 3OF3A 4IDCA 5KCMA 3WGGA 5FO1A 3H5VA 3JD0A 1UMBA 2P9JA 3SC2A 4DKJA 4AICA 3CNOA 1S96A 4EF6A 3FETA 5AD1A 1Q0RA 2ZB8A 4MW9A 1SVKA 4BZWA 1OV6A 4QDZA 3H5NA 3V9AA 1PEYA 3ILSA 2Z5GA 4LDPA 2OM6A 4RGVA 5CPFA 1E1KA 4PTYA 4GI2A 1IHUA 1OZHA 2IDMA 4Q4HA 3V8MA 2XLBA 4NR0A 1UMCA 4LFCB 1M7GA 1P4JA 1N4AA 1IZ7A 4AKGA 4RYLA 5JVDB 2QMUA 3D8HA 3EIEA 4OQQA 2GFQA 2GFIA 3DV0A 3LYHA 5AI4A 1LLUA 4S04A 4V0OA 2CK3D 3UAYA 3VOBA 4DG8A 5BWLA 1N2OA 4PYKA 5JU6A 3MWDA 4HXFB 4IIXA 2VDPB 5DI3B 3T0GA 1PNRA 2VDMB 2H00A 2O0MA 4X71A 1QFMA 5CNKA 5ALQA 1G55A 2OB1A 1EFVA 2H07A 1LV8A 5HFAA 3TLGA 4XEUA 3ZC3A 1IIRA 1GUZA 4I08A 3KJNA 2F59A 5AI8A 4MJ7A 4WFQA 3IBCA 2C59A 1PQYA 1TO6A 1TUGA 1WU7A 2C98A 2ZRAA 3BXEA 3MIZA 1EEXB 4IUDS 1VGQA 1B0UA 3C6KA 2VPQA 4ZZIA 5I45A 1BN6A 2F8MA 2WHQA 1N6PA 2GZAA 3NHMA 3TFWA 1BKSB 4C7XA 4PGFA 3KWMA 2G3YA 5B2EA 5JTUA 3QU2A 1AQIA 2HHCA 3LKBA 3MRSA 2GCOA 3VQTA 2FN7A 2Z4SA 2YJTD 5DGIA 2H31A 4ZQBA 4GRAA 1AC5A 5LC1A 5COBA 3VGJA 3G49A 2C77A 3V7FA 4E4RA 2J7PA 1PS8A 3T5MA 5D51S 4ABYA 2P8JA 1D6SA 3KT6A 3OT1A 2ZJ4A 4MARA 1EWVA 2X86A 3STTA 3UGQA 4B76A 2O8CA 2W6ID 4YJKA 1ZU4A 5L3QB 2GBLA 3HWX1 2R85A 1J0DA 3R7BA 3ZTTA 4QDUA 4FMDB 4JQYA 3WQHA 4BB9A 1XTSA 4YX9A 1FZTA 2ZI9A 1HA3A 1I4WA 5HUQA 3P2IA 2XOXA 3DMRA 4PYQA 5A05A 1DI0A 4Y2UA 2IH2A 3Q7PA 1N6IA 3OICA 2ZP1A 1DJNA 4M1MA 4RHUA 3B5JA 4D6XA 2X4LA 1BJKA 1K4YA 3OEHD 5H3LA 5KYVA 3JARA 2QZZA 3G2PA 4GUAA 2FGJA 3DCNA 1ESCA 2AJ8A 4RZ3A 5YASA 4HWOA 5AVVA 1XCGB 1CUJA 3BIJA 4KUGA 1N5OX 4LZAA 1T15A 3MN1A 5KREA 5M29A 2R96A 1L6IA 2VI5A 3A6DA 3G0GA 5LVAA 2UUAB 2G4LA 1LF5A 4KE9A 5JH7B 3HB4X 3ZX4A 1G16A 1YJAA 4XASA 3W7BA 3HL4A 4DAEA 1MD9A 4OUDB 3KETA 2Z6UA 5AI6A 2IYXA 4NNPA 4D3FA 1HT0A 3RBVA 3PF8A 3K8ZA 5B6JA 3M6AA 5L7YA 3G0BA 1E6CA 1Y8QB 3ZWKA 2BGWA 3E8MA 3LY9A 5HOEA 3TRHA 3TG8A 1U5BB 4HG2A 4L8FA 3LQQA 4FD2A 4AKIA 2G1AA 3HHPA 3BE6A 3G79A 3WXMA 16PKA 2HDNB 2P78A 2QTAA 3WGMA 4XJSA 1NZFA 4UEJA 4XXHA 5AIBA 2KLBA 4O4HF 1EVYA 1JU3A 3EEBA 3UTDA 5HVNA 1EM8B 5KTKA 1KH2A 1M75A 1DDOA 3OESA 4PXAA 2O0KA 3OPVA 3NHSA 2JFBA 5JZMA 2NG1A 4XZ3A 3WFZA 3UFXB 3RK4A 3UA3A 5JPIA 3K1JA 4Q3LA 4MINA 5ENDA 4C2UA 5JMOA 1MABB 2BELA 3CH7A 3S5UA 1RWKA 4JKYA 2Z6AA 4R3NA 2JL1A 3PWTA 1A1VA 4N0EA 4PONA 2CLDX 2H2FA 3WIUA 1CR6A 3SYKA 2I54A 1A0OA 2HDWA 3JQBC 4L0MA 1DARA 5B3KA 4BMVA 1RHJA 2FPIB 1AGXA 2RHWA 2Q49A 1HDZA 4HN2A 4OQDA 5F9MA 1G8MA 4ENTA 2IYFA 2LV8A 2W6IA 3AV0B 3V7NA 1BQEA 2QUZA 2XF2A 2V7QD 3AEKA 3LX4A 3IDAA 5CVCA 2B30A 2JGAA 2AXQA 4HLUA 1NVMB 3G6WA 2VEOA 4A8JA 1E2BA 2WAOA 1UINA 3RO7A 1QAOA 1MIHA 5DNCA 3MJ4A 2YMPA 1IBKB 5EE9A 5KKNB 1OLUA 2R1TA 3LQFA 5IMSA 3FLMA 4ARZB 4CYMA 1GGVA 1KFCB 1M8JA 1YZ3A 4P53A 5TRTA 3WLPA 2OILA 3IVRA 5AKKA 1YVRA 4NCBA 4R8MA 1L0BA 4KLAA 1BRMA 3I92A 1GL6A 1OREA 2YDXA 3MJFA 4K03A 3LXUX 1F1BA 2I99A 4KRYA 2UUPA 4LDAA 3HVKA 1KY3A 1PYDA 3IAHA 3QELA 4WNCA 2IPMA 2KI5A 4HMPA 3NMUF 4JELA 4WX2B 1T9KA 3WRXC 1BXKA 3GD7A 3KQUA 1JAHA 4LYEA 2FW7A 5EWJB 1US8A 1JDUA 1MJHA 2QSYA 2XCIA 3GA7A 4XJTA 5DCWA 4BBJA 4TL7A 2XGSA 5ILQA 4FCTA 1AKUA 2AFRA 1EP2B 1PG2A 2FQQA 3HR8A 5A7FA 1FDVA 3IUSA 2W93A 4YRPA 3NTUA 1AV6A 2DLDA 3N0WA 5IEJA 3U9TA 2QAJA 2QW8A 3KWJA 5BOSA 1P18A 1FFBA 1THZA 2Q2NA 2D1YA 1QVAA 4L5IA 4XVUA 3GJ4A 2V58A 2OSVA 2ZVQX 4GR9A 4KMMA 5DNAA 3W7AA 1NYQA 1S1CA 4MDHA 5DRTA 4ED9A 1LRLA 4HGQA 1NU8A 3EVGA 2UYOA 5TVKA 4FC6A 3DEZA 2WT9A 1MIOA 1RYDA 4D2IA 3WYBA 1TM4E 1J25A 2PMCA 1X8KA 4LYYA 1DJPA 3MWEB 5AJYA 4IS3A 1IH8A 3NGMA 3JQCA 4FCVA 4JUBA 4MZDA 4TSKA 1M54A 3KR9A 4H60A 4UUNA 4B4DA 4DRXA 3K2QA 3VR2A 4BBZA 3T1HB 4EA7A 1ZR2A 3TZHA 3PNLA 3TDNA 3VZRA 1CSEE 2WWFA 3O73A 5KQMA 1PL6A 1XTVA 5JE8A 3B6EA 4RHFA 3AVOA 1FQWA 3AUXA 4MUGA 4D0RA 3DLAA 3L5KA 1EJBA 2ECFA 4URWR 1RWVA 2C5GA 3M4XA 3NQ41 2FEMA 2JFHA 3F71A 1KFKB 2VYCA 3ESQA 2JIPA 4KYTA 3UMSA 4EEZA 1Q0HA 1E3MA 2WLSA 3T06B 3CUVA 1RRCA 5E9AA 2CWDA 3VZDA 3U3ZA 1YR9A 1DB3A 3BH6A 5D1NA 3JVEA 3T95A 4PPYA 2R00A 2JGNA 2CVQA 3EQ2A 3MG9A 4ER3A 4PYJA 3ZVMA 2RHHA 3LXXA 4G0XA 1SH7A 4P93A 4KZKA 1P2FA 2EJBA 3W5SA 1EQAA 2J46A 3I9V6 3PITA 4OHVA 2ZZMA 3E18A 3A9RA 3OIVA 4JR2A 3AJEA 4IJQA 1BCSA 3AHDA 2V7EA 2VH1A 5IC6A 2EG9A 3KOWA 4FHDA 4B5LA 4IOKA 3W6NA 3JYOA 3C14C 1UKVY 1GPJA 4E12A 4L6AA 3IYLW 3CLHA 2NTJA 5K0TA 1T6ZA 3QXHA 2X3FA 4FDAA 2IOQA 5DI9A 1M6VA 4YAKA 5JBIA 4LNAA 1XXHA 1Z38A 2Z9CA 2PD6A 2XITA 4G63A 2F8TA 3UHAA 2I7CA 5BPHA 3ITEA 4PVCA 4D6PA 1MJNA 1HTBA 1X1CA 3LSYA 4MR9B 4DDKA 2PJDA 1OI2A 2O2ZA 1ODCA 1YDGA 4GBJA 4BGUA 2CFSA 1W59A 4H6WA 2DFVA 4FEGA 4D3XA 2VF5X 2ZAIA 2ZWOA 1KC1A 2C2WA 3AY3A 4NBSA 3BC1A 2XB8A 5DNEA 4PSVA 3PT5A 4BJHB 3UFBA 1ZVVA 4G24A 2VDNB 4DN6A 2ZJAA 5NLLA 1C0KA 4X3CA 1G5FA 1XD2B 4P2GA 2PT9A 1KRHA 2VK2A 2FMKA 1UPFA 3KZNA 2HFJA 2FW1A 5JDIC 2F1OA 1BHSA 1F48A 5JI3E 3BF7A 3DO5A 4UNPA 5CGQB 3PC8C 3EQ9A 3LZCA 2SHKA 1P80A 3JVIA 3OF2A 1YC5A 1O6FA 2O3QA 1FNMA 1P0FA 3BZUA 3NR2A 5E1DA 2NSHA 3SF0A 3M82A 2CUTA 2HEGA 2VDVE 4XYGA 3ZGYA 2EGUA 2JGEA 2HKIA 1YR7A 3L7IA 1F60A 2PSSA 4M9SA 4U9UA 3SR4A 4FIDA 1CR4A 4BEBA 2V3CC 4M6WB 4TN5A 1FBNA 3I9MA 2O2CA 4BX8A 4HP8A 2DPYA 2PZJA 2FR0A 2H1IA 4R05A 1VL0A 2AHRA 3HH8A 3N2GA 2W83A 4Z4EA 1JG6A 1S8NA 3RSCA 1KQOA 3IDZA 4ND4A 1XI2A 5EIWA 5CB6A 3K0SA 3ABZA 1PGOA 4GPIB 4Y1RA 3PDHA 3PTLA 1L9XA 1Q84A 1X7WB 3L41A 1E60A 4R1PA 4W7SA 4YWJA 5HS6A 9MHTA 3ANYB 4DYHA 1WJGA 1P72A 4RTMA 1YBFA 2JI9A 1PW7A 5AXCA 5CCEA 4ERXA 1TM5E 1GSOA 4JC0A 2G63A 1M7HA 2BKAA 5H4HA 5CMLA 1X7ZB 2BFAA 2FPGA 3FA2A 1TFRA 4X1YB 3L1VA 4XLTA 1QMPA 3OAAA 3VSBA 1AQUA 3ZQJA 5IM4F 3MGCA 3INYA 4AECA 3AG6A 5IUNC 2IY8A 2JK1A 5IJ0B 3OQ6A 5E2AA 1UXKA 2DWOA 1EFDN 1IN6A 1NOIA 2I3AA 5DN6A 5FNVF 5DGHA 1N6KA 2OQIA 1D5CA 1W73A 3A2MA 3I5UA 3QHPA 3TW8A 4QPCA 5BNTA 5KNDD 5EJMA 4JVSB 1AB6A 1CUDA 4DXHA 1QNFA 4IIVA 2O3JA 3GV0A 2G76A 2ZIAA 3PWKA 5KEIA 1B16A 2VUSA 3Q9NA 3QOXA 4IW3B 3C85A 3QFTA 2HMWA 2EFEB 2ZRFA 3P0IA 2QGZA 3LUPA 3EPLA 2FQWA 3CNLA 4O4HB 5ES3A 2I3DA 1EG7A 4EFKA 1JSLA 1YVUA 4EZBA 3HV2A 4OYHA 1Q7RA 2ATXA 2FJPA 4J03A 4Q3KA 4GM1A 3EH1A 3IHTA 1AXEA 1YB2A 3T5PA 4DSUA 4M98A 3TAUA 1RXWA 1QJ4A 4X1IA 3R5FA 4W1RA 1D8AA 1PNOA 1JH8A 4RPKA 1W1WA 1T1RA 3AIKA 2CLLB 3NM6B 5A71A 4J0EA 4P4TA 4PHTA 1BEUB 3IXMA 1UFVA 4LN1A 1RQGA 4E11A 3GUZA 1L5YA 2C3OA 5CA1A 4OHXA 1NNLA 4PX5A 1B3RA 1YB1A 3VDXA 5TY0A 1XG5A 1BDBA 1HKHA 1RP1A 1VLQA 3HZZA 4I1SA 4ILEA 5FUVA 2O8DB 4NZPA 3KPYA 4UFNA 3IPXA 3LUBA 4FS8A 4MW6A 1K9VF 1ICEA 4EUSA 2RONA 4FQ8A 5JDCC 3ZV7A 2FN9A 4MV8A 1VRCA 5EHQA 1OH7A 1ZUIA 2HT6A 2PXXA 2YWRA 4MCAA 4MS1B 1XNRB 3UFXA 3R5KA 4NCHA 1LS6A 1GFWA 1ZPDA 4YO7A 1YFJA 2G9VA 3F6PA 3TSWA 4DS3A 3BMOA 1WNTA 4NV1A 1JQKA 3DDOA 4I66A 5CXSA 2O5CA 1GHTA 3UAGA 1VI5A 2YIMA 3J7AC 3FLEA 2EZUA 3RTGA 3D4NA 1M1XB 1E7SA 2HSEA 2DWCA 3PIRA 3VU1A 5H9WA 4MEJA 5GOZA 1MNAA 3OD5A 4X63A 4HNQA 1AQYA 5L3RA 1W5BA 5M3BA 3DT6A 1M2FA 2XGOA 4YFYA 3CVOA 5F64A 1R4NA 2V97A 3LX6A 4OM7A 3RSQA 3ILHA 1TVEA 5B4VA 5IT5A 1DCMA 2FPPB 1SGWA 3GRZA 3TKYA 5DM4A 1G2IA 3FIUA 1OU4A 4CL2A 4PG5A 3UKJA 5ECDA 1Y9JA 3IESA 1ULHA 3BA1A 4HD8A 3MMZA 2YRWA 2A4KA 1ZIDA 2QRPA 4ZVTA 3OAAD 5LSAA 4DV0B 1G5TA 1V3UA 2ISCA 4U9IS 2RHTA 4OI0A 5HHTA 1PR9A 5G02A 3BMQA 4E3WA 4NZMA 5THQA 4DUZB 4KQGA 4OFXA 4AXXA 1O6CA 2WNSA 4LPKA 2GTPA 4NBUA 1GNSA 1KHHA 1RPNA 1DAKA 2BCEA 2YBDA 5EMLA 4ACAA 4AK9A 1XK6A 2C7PA 3KCNA 1MX5A 4MWTA 4WCDA 3JQ8B 4P83A 2FQ1A 4O4IB 4I2VA 2ZE7A 3ONDA 1B0AA 3AEZA 4QU5A 5NULA 2PVCA 3EOBI 3CYFA 1E1YA 3ITDA 4OJYA 1M2HA 2P9GA 1SIWA 4QDTA 2W6JD 1OW3B 4RV9A 2PRZA 1ACLA 2PVPA 2EJCA 4M1WA 3RUIA 2Q5JA 3CLSC 4RQAA 3EFBA 4H7KA 3ZUGA 4D9CA 3IE2A 4EX7A 3BK7A 3IQIX 3O8QB 4QUJA 4ID9A 5KB3A 5E1OA 2GD1O 3GT0A 2OFOA 3SR3A 2Q9CA 5KSOA 3ANTA 5ALDA 3L8DA 5F78A 3ZD9A 5BUCA 2IX3A 5KCZA 3CX8A 5CVJA 2YR0A 4CF6A 3EIUA 4EGSA 3H1AA 1QR2A 2WHEA 3JQ7B 2IKQA 5JS6A 3IR6A 3T34A 1T3TA 3PFFA 4BIIA 1SU8A 5GOTA 1PD1A 1OD6A 1WOYA 3H5RA 1U80A 3D31A 4U02A 4G0PA 3RV4A 3ADKA 3SU8A 1P1RA 1V9CA 1VLHA 2HUNA 5AJWA 3DV9A 2ZLBA 4JODA 3JX9A 1B2RA 3TLGB 3CZQA 2R68A 3N28A 2DH6A 1JQJC 3BXZA 5HM6A 4FLFA 4ZOEA 1NUSA 1ZVQA 5EWLB 3RYHB 3TMKA 1V1RB 1U0RA 3KZCA 5IK2A 2YZGA 3TUZC 2DPGA 3Q85A 3CHYA 4M0KA 3AFMA 1TAGA 5EE3A 3A7EA 4CG2A 4DY6A 3U49A 1JEOA 1R2QA 2G25A 4D8VA 4K81B 1XGKA 5L45A 2N46A 5IUKC 3DQQA 4ALMA 1VLJA 4L3VA 2O7VA 3DHWC 1M73E 4L5JA 4NG4A 3RTCA 1L7QA 4O25A 1UKCA 2MSEB 1AHNA 2XDYA 4Q4HB 4ZARA 4TVKA 1I2DA 1HYQA 2QUBA 2ROQA 4KDRA 4XARA 1NZDA 1V7PC 1FY2A 4HF7A 4YRKA 5IKMA 2Z2YA 2ODWA 3AJRA 3R3WA 3H1BA 2HM7A 4LMRA 1IN5A 4N3AA 1Q3KA 3SYRA 4B1FA 4EJSA 4HT3B 3TKLA 3UJHA 3PNSA 4Q3EA 3HKCB 4N0PA 4R98A 3P26A 1K3FA 4LS3A 2C7OA 5KDLA 3A9VA 1ISSA 4TTVA 3TTXA 1ES9A 5I7WA 4U6SA 2ZTVA 2JAXA 4LRUA 4RTNA 1QANA 1E7QA 3C5WP 3KAJA 4RCYA 1RACA 1CC1S 5AW6A 1PWHA 3FUUA 2Z2IA 4UTXA 1QVVA 4GWGA 1UBHS 2O05A 2NZ2A 3K31A 3PQ5A 3W04A 4KFCA 3RBZA 1AF7A 3QXXA 4LC1A 2WJJA 1PAUA 4INAA 1E1DA 3UJDA 3C4JA 5BT9A 5LBTA 2O4UX 1Z4IA 2QTHA 2X9LA 1U0BB 2B99A 4UXHA 2VOJA 3AI7A 2HR1A 3BCUA 4J8PA 1YGPA 1U3UA 3FYSA 1EE9A 3QVVA 2Q4TA 1IZYA 3DWIA 3OP1A 1B3BA 1U1DA 2NW6A 4MHTA 1N9KA 4DSZA 4BU1A 1HZZA 1FDTA 3S70A 1W87A 4NBTA 2YASA 4RK1A 5CBPA 3GFFA 3TLZA 1ORTA 1Q95A 4E3ZA 1IAVA 5HKLA 2JGLA 3CKMA 1BE6A 1IWPB 2G04A 4B3XA 2VXBA 1CFZA 2R6GA 3HYRA 1Z6PA 2YL2A 4G8CA 1W5EA 1N0WA 1B43A 1U0SY 2GXQA 1K08A 4GP6A 5J1TB 4PIVA 1JI0A 3IP9A 4XSVA 5FOWA 5AJTA 4CR8A 1Z5NA 3V3KA 1KU6A 2CXXA 3HU3A 2KLHA 2QV0A 4CCSA 3U31A 3FTFA 5K0ZA 3L8EA 1CUEA 3GLGB 1OFUX 2I1WA 3WZ2A 1C81A 4IVPA 3UJ8A 1M2KA 4CU5A 4QYMA 4OGWA 4FILA 4PTLA 2Y6UA 3UICA 4IMJB 3AXSA 4OI1A 3MB5A 1MJ5A 4P5PA 3LO8A 1RWPA 2X2OA 3HCEA 1JAIA 4IRXA 1J0CA 2OXCA 3H99A 4FXPA 2CEAA 2DKNA 2G07A 3IAS1 3OEHA 5J4LA 5JR3A 4MS3B 1SUAA 4MIOA 3EXG1 4BLPA 4M37A 1AHIA 3GLGE 1SCNE 3OJ0A 3FNFA 5D6OA 3UYKA 3V1LA 3KSDO 4D79A 1Q17A 2A0XA 2AIRA 2ERCA 4MQUA 4A8HA 3NOQA 2O7NA 3O3CA 1HM5A 4YUZA 1W2GA 5HJ5A 1RFGE 3C7DB 3PD0A 4RMNA 5ECWA 5LFAA 3R75A 5K8JB 2OBXA 2YMQA 4IWYA 4QGBA 3I6BA 4AKEA 1RM3A 3GJ3A 2WIJA 1NWCA 4NCXA 4OQYA 2YJ5A 5KS2A 1IHOA 1IVSA 1PWZA 2O1WA 5LPNA 1FZQA 3I64A 4ZC8A 5JXHA 4QD3A 2H1VA 2Y27A 2YOFA 2FXIA 4TWBA 2VF2A 4IJUA 2PTHA 3BIWA 4RVUA 1CKEA 1NR5A 2GMWA 4KPFC 2HA4A 5BQ3A 5CA1F 3PYMA 1T35A 4JIGA 2AA3A 1R3DA 1AUXA 4MKRA 3TRIA 2XR1A 2YQ4A 4O5AA 4TKLA 1TLFA 3H2KA 4U9HS 3WA7A 4LEIA 1Y5NA 1QO0D 1U3VA 2VOEA 3IBYA 3LA8A 4XAQA 2HQRA 2B5OA 3F6RA 4GRIA 3GJSA 4DDVA 4BGVA 4IHJF 4LHYA 4U2EA 3AM5A 3VVCA 3WDMA 4C14A 5JSYA 2R1UA 4N47A 4LF8B 2EW1A 4F5DA 2BHRA 1T4CB 4HYEA 3FFWA 4TTSA 4BMYA 4CR6A 1CUCA 2A5GA 2IYUA 5MDHA 3GCGA 3GLVA 3PYLA 1LJUA 1UMDB 5EQTA 3W78A 3C6QA 3HVJA 4A2WA 3OCXA 5B1EA 2OCDA 2CLKB 3DXFA 4N39A 1E61A 4JT8A 3H87A 1B93A 1A4XA 1V6SA 1T2NA 4LX8A 2Q7DA 2HWUA 1U9JA 3WGJA 1ILEA 2X3UA 3CEMA 1W0JA 1J0EA 3MCWA 1IU9A 3VU3A 5CNIA 2VYVD 2KE5A 4QX6A 2CLHB 5ENVA 1VYUA 1ID8A 1EA7A 3MJVA 4L8WB 5BR8B 1KOLA 2YWJA 1M67A 5B53A 4DPMA 3VPSA 5JZBA 2VTKA 1L3BA 2XD9A 1JFFA 1ZGGA 1THTA 3C8HA 3DAPA 1LVHA 2H6EA 3PXDA 3KXDA 1OOEA 4KIUA 2QL6A 1HYHA 4XWWA 5JJBA 3ZWVA 1PEDA 4JITA 1YFZA 3FSEA 1HOXA 2Y4NA 1I4OA 1XVVA 4Q1FA 5A4FS 3Q1LA 2PD3A 4XIJA 2VAWA 1H3NA 3MQFA 1LRKA 5MF6A 4HYYA 3BKXA 4LX0A 5J59A 3CWQA 2R1ZA 2JATA 4RZHA 3NYWA 2D2XA 2GZDA 2JGRA 3IP6A 4MUNA 3QA9A 3RROA 3ZV4A 5A2QA 5K3DA 1TVMA 1Z45A 3IV9A 2GLUA 3SXPA 1NNSA 3T9EA 4E6PA 2OGUA 1FRFS 2I7DA 3F1KA 1RWQA 5A4JA 4B3IA 3F73A 2P3OA 4EF5A 1U2PA 1JPUA 4ML3A 3N0TA 3RK0A 2GPAA 3HADA 1C9NA 3MSXA 3D6AA 3ZJ4A 1JEEA 1VDMA 3D3EA 2QD5A 1PJSA 3G2LA 4EVQA 3A7DA 3KQMA 2ZEJA 1BFDA 2PZAA 2WF8A 3A3NA 4H77A 4C08A 4QXOA 4XGRA 1F8GA 3SAJA 1PLKA 2BMFA 4JXKA 5JXIA 4AJ1A 5BQOA 1ZA1A 3G7UA 3QTTA 1T1EA 4HRAA 2F4NA 3O7WA 3UC9A 4ZOLF 3SJ7A 2NT4A 3RUCA 4X7RA 2R6ZA 2VLIA 3MJRA 1FU4A 2E48A 2GD6A 2IUTA 5AVTA 2GESA 1JGTA 2HB6A 2RK4A 4NVRA 4ZREA 2EQBA 5I3CA 4DCGA 1BU8A 2CBZA 3MCTA 1QIMA 1XNGA 3VVLA 2R47A 2PWBA 5JEEA 1J97A 1IK4A 1H94A 3NGXA 2HA7A 3V4LA 3P19A 1H22A 3AR5A 3R3YA 3WRYA 3GJ0A 5CD9A 3ELWA 5T64A 1Y8AA 1QWSA 1Y1LA 3OTIA 4PLVA 1OTYA 3CKYA 2IODA 1ZI6A 3WKAA 1YACA 4FPXA 4NY1A 2WEKA 1KMHB 3F8TA 5HF8A 4BWYA 2GD0A 1E2PA 4XX0B 4ZZ0A 4JSTA 3G9TA 4DMFA 3HLKA 3EX7C 1XMQB 1QZZA 4RS3A 1YR1A 4KSYA 4BVGA 1ZAYA 4AIRA 1UEJA 1AA9A 4YI5A 1S4QA 4RJJA 3SVLA 5GJBA 5C34B 2HBYA 1FLNA 5TSDA 1GTSA 1OA0A 3FDJA 4DWOA 1JHXA 4KV7A 5FH9A 3WAJA 1SXHA 4CIYA 2VDWA 3EH2A 4N48A 1L7OA 5D84A 2Q3FA 3SIWA 2P2NA 4X20B 2BKLA 4N9QA 2Q6LA 2JIRA 4X1KA 3GYBA 3QVMA 2OHVA 3T3GA 1C9KA 2Z57A 2FFQA 3N05A 2PA3A 3LP6A 4KDCA 3R5TA 5E9WA 2R84A 4FZVA 1IBRA 2NXJA 4C2BA 1BXGB 3QE2A 1KA9H 1U3TA 4L4YA 4PO9A 3H1PA 1YXMA 2QNBA 2XCRB 2VUUA 1MOZA 2XUDA 4B43A 1KVTA 821PA 3IB3A 3K72B 3CZRA 4FFNA 1KVUA 1M6YA 3OZ7A 4IDHA 2X22A 2I9PA 2PSDA 2UZ4A 2E4WA 3MHTA 2CGEA 5KPJA 3OPYI 1OXBB 2HX1A 1KMHA 2IYOA 3HWRA 1W25A 3UPUA 3QE9Y 3AF6A 3VNVA 3BAZA 5DGXA 1A88A 1CZRA 1MQAA 2IUFA 1ZEMA 2VSYA 3ZY3A 5JASA 1PWYE 4I5FA 3EUAA 3CINA 4DNOA 4B40A 4EG5A 1W8IA 5LMNB 2XNDA 1NF2A 3JATA 3I8OA 1FQJA 5HA5A 3RFCA 3KE9A 1MAUA 2B1JA 2ZR9A 3JYQA 2PRYA 4BAUA 4DZTA 4M36A 5FPKA 5L3VA 4DNQA 3IVXA 3AOEA 3M6MD 4Y2SA 5FB3A 4B81A 3MT8A 2EL9A 4TYPA 2W4QA 5CG1A 1P6QA 4DTIA 3DOCA 3M6IA 1OYOA 3D3NA 4FE7A 1MX3A 1WCIA 4H17A 1V11A 2NXEA 5ITVA 1JHAA 1QIDA 4QQKA 3MGBA 1ZN8A 3KBBA 1KSGA 2C84A 4H59A 3KUCA 3RUEA 3BHNA 4YLYA 3AL0C 3S5JA 3BGVA 2WPDA 2D5IA 2PMFA 2B2XA 2EJTA 4QJ3A 2RH9B 2LKDA 3E35A 2AVDA 4JC8A 3V1KA 4CG1A 3PSHA 2BFBA 4EZIA 4C4XA 3ED1A 3SJUA 4RH0A 1DZ3A 4QBHA 5JAMA 3K5IA 3MYYA 2BOVA 3V8EA 4PCVA 1U7WA 3C6ZA 3HB0A 2PS0A 4UEKA 3RD5A 3OA0A 1SWWA 1VLLA 4ITRC 3KXLA 3AUYA 4LMPA 5IF3A 3CF2A 4K46A 1BMFA 1YDHA 4N4AA 2E6KA 4ZCPA 5BUQA 4HO1X 4B82A 2UUOA 2ATIA 3Q3VA 4LZPA 3IUPA 1LBTA 3WB1A 2HJSA 4LGMA 5JHHB 3R7WB 1R3UA <