1U3GA

Structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
164
structure length
164
Chain Sequence
MDKNALRKQILQKRMALSTIEKSHLDQKINQKLVAFLTPKPCIKTIALYEPIKNEVTFVDFFFEFLKINQIRAVYPKVISDTEIIFIDQETNTFEPNQIDCFLIPLVGFNKDNYRLGFGKGYYDRYLMQLTRQQPKIGIAYSFQKGDFLADPWDVQLDLIINDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methenyltetrahydrofolate synthetase from Mycoplasma pneumoniae (GI: 13508087) at 2.2 A resolution
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Ligase
molecule keywords 5,10-Methenyltetrahydrofolate Synthetase
total genus 49
structure length 164
sequence length 164
ec nomenclature ec 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01812 5-FTHF_cyc-lig 5-formyltetrahydrofolate cyclo-ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10420 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NagB/RpiA/CoA transferase-like 1u3gA00
1SOUA 1U3FA 3HY4A 2G40A 1U3GA 3HXTA 1SBQA 2JCBA 1WKCA 3HY3A 1YDMA 3HY6A
chains in the Genus database with same CATH superfamily
1G7SA 1U6IA 3KHSA 2O8NA 3MTAA 4PX9A 1EZZA 2HRZA 3LC0A 4II3A 2BM9A 1DRJA 1YFKA 2ZSAA 4UNIA 3THYA 3CZCA 5FPHA 2RGWA 4K5QA 3REFA 1VXRA 2QJFA 3OURA 1J07A 1SWVA 1TU0A 3AUYA 3NHFA 4KV9A 3BG5A 3R7NA 2IOYA 5YASA 3WIEA 3QLVA 5KCZA 3PJGA 3E3OA 5F2NA 5FPKA 3AR9A 4Z3OA 3VO1A 2HM7A 1KH3A 3SIWA 3CV3A 1H0SA 4OUDB 4ENVA 1N5DA 5EWJB 1EVQA 1SHJA 1XELA 3R0IA 2NXNA 1AQ6A 3AJEA 3DZBA 3Q0IA 3M3DA 4CCWA 4CM5A 5AKYA 4FSXA 5FNVB 1CS4C 3RFXA 1C8LA 4QU9A 1P2GA 2O54A 4FR5A 1H3NA 1VMKA 4CIAA 1V16B 3K2BA 1GNVA 1Y9DA 1ZH8A 2ZJAA 3DXXA 2VP5A 3LCJA 4WPGA 2JFBA 4J9UE 3TB4A 3WKDA 4N5LA 1I5EA 4N39A 4DEXA 3KQKA 1H1LB 1CUWA 2HFKA 3P9CA 4GLOA 1TJ4A 4MTLA 2BHTA 4Q4HB 4QREA 3DZGA 4G89A 1X7XB 3QMMA 2B3TA 4HYYA 1A1SA 3QYJA 2PUHA 3C97A 4II7A 4JJGA 4J1QA 4PLGA 4AY2A 2W8BB 5EQFA 3FRJA 3PJFA 1B8UA 1J24A 1AN0A 4AJOA 4LJAA 1YDHA 2AVNA 4XPIA 3TW8A 3V7UA 4PN3A 1A9XB 1F8GA 4JI2B 4LF7B 1H9BA 2ACKA 2BIFA 4EW6A 1ZHOA 1M1ZA 2C3YA 1GCGA 3IXLA 2GXSA 5DOZA 3T7JA 4CLRA 1Q7TA 3V3TA 1DQZA 3C3MA 3GOQA 1LPPA 2YXDA 1QMGA 2FEXA 4J2HA 4UTNA 3JAMA 1SR8A 2BISA 4QUBA 1BE6A 1V25A 4C0BA 5IVPA 3ZJ4A 4L85A 1J33A 1SIWA 2G71A 2QDXA 4CZ2A 4UEKA 4B6RA 5G53C 4XH9B 3UO8B 1KKMA 4KUGA 1K1EA 3DFKA 2Y1LA 4AF7A 2BH2A 1WCWA 1QO7A 1P2VA 2CD7A 3W4KA 4PX3A 5B12A 1LRJA 1J39A 4RJ2A 3TQOA 5HYVA 4I08A 1SU7A 1XMJA 4Y2JA 3RRYA 1OAOA 2A1IA 1T9HA 4IGKA 2HLDD 1OYYA 2QTVA 4KYTA 5CJPA 3RJZA 5KTSA 3RG8A 5EESA 4FKBA 2HQBA 2WWXA 4KRXA 2ZM6B 2W43A 4OHWA 1KZHA 4RGYA 3BIFA 2C04A 3T52A 3SF8B 1MOSA 1W87A 2C9YA 4IMRA 5HS4A 3GBVA 1JDBC 1I2MA 3U9LA 1WUTA 3FH0A 2KQUA 1EQ2A 3PFFA 2HD4A 3HJRA 4ZOQI 5BR4A 2R8ZA 2VAXA 2A9QA 4RYLA 4W8GA 4ESHA 3IIKA 1KDYA 2QYTA 4GT1A 1XVUA 1XRPA 1PTKA 1VB3A 3LC7O 1Z25A 5DBIA 1GWNA 4ZI3A 3GRRA 1AMNA 3FAKA 4H3SA 1K06A 1E0DA 1NF2A 4OLFA 2DETA 3ZD7A 2FXIA 1L4MA 5JSHA 2D2FA 1ZVVA 2ZM5A 2ZWAA 4LXUA 4YMSA 4EABA 5KJEA 1MHPA 1WP4A 5FWAA 2IHZA 1Z8DA 4DEVA 2DFKB 1JRLA 3QIAA 4BVKA 1EDDA 4Z4CA 4MWCA 1VDZA 2D74A 3FRHA 1RE0A 2WZQA 3K3PA 2X8JB 1V2HE 3CSUA 3K9FC 1U2GA 3U6BA 1C4OA 2CXHA 2XCOA 2XVZA 5KX5A 4CDGA 3GV0A 1L7MA 3A4MA 4ZO7A 2F9FA 3CURA 2FR8A 3IAEA 3H5TA 1IQUA 1LXCA 1QV9A 2ADMA 2E5FA 4ZCRA 3DR3A 4XYEA 3TW6A 4ZHQA 4B44A 3HBLA 3HCDA 3KLOA 3P0FA 4KNVA 3BE6A 4KPGA 3EDRA 1C81A 2JFVA 3EEYA 4HGOA 5LUAA 4KSCA 5HE8A 3UA4A 1M6YA 1FUEA 4UDYX 4OHRA 2JI9A 4RPHA 5E2BA 5IC6A 4ZN6A 5ARBA 1T4MA 3NYRA 3QTBA 1TK9A 2ODAA 3QPCA 4IIJB 4YUVA 4ARZA 4V2UA 5JXWA 2I7XA 2I4OA 1P7YA 1YR9A 2YJ3A 1A71A 1XVIA 3K73O 4HDKA 4P93A 4BNTA 1L4GA 1A9RA 2EFGA 4WGGA 1AK9A 3OLCX 1CEQA 2COKA 2JLYA 4JLNA 2GJ8A 1YQWA 1Q16A 3W5VA 4YMIA 5CLQA 4YV0A 2M1ZA 2PTHA 4IO1A 2YV5A 1OWPA 2OP0A 3AFNA 1VIYA 3EN0A 1SD1A 4P36A 5FKJA 3U09A 2V6GA 2ZBDA 3BXZA 3P5BA 5JVDB 2J31A 2W6QA 3QKRA 3PXDA 4V0SA 5BNTA 5C1OA 3SR0A 1A7AA 1CJVC 2F62A 4H08A 4JLVA 4BYGA 2V9CA 3TPFA 1I4OA 2Q21A 3UAXA 1I30A 1KDPA 4DDMA 8LDHA 3U4QB 1M2OB 1PEAA 4JI1B 3KPUA 1GPBA 3NANA 3SFVA 4S1NA 3ZLUA 1Y1QA 3OWXA 1SELA 1SIUA 2WM2A 4YGXB 5JW6A 5E9QA 1NU8A 4ZT3A 1UQRA 2JIZA 4QYMA 1Z2EA 4BJ3A 2Z43A 3ANLA 2V9PA 4JQCA 3PC6A 3WXMA 5JO0A 4NEHB 3AV3A 3HGTA 2XMBA 4WK0B 4XQ0A 2UZ1A 2OPHA 4M76B 4BDTA 4HWRA 1JX6A 1RAGA 3U7JA 3FNHA 1PUJA 2BLNA 3ONVA 3PDCA 4HGPA 5E38A 4US2R 5JNWA 1KEKA 2B78A 1JHVA 1BXZA 1VJDA 1AHIA 2B83A 3EQ6A 3OAAD 3NBFA 1J42A 2H9AA 1RWKA 2FEMA 5KYGA 3KPYA 1YV9A 1N78A 1LPOA 1Q57A 1RAFA 3GDOA 3NWOA 3PTZA 3EVNA 4XASA 2E6UX 5TEVA 4ENTA 3R3WA 7REQA 2LDBA 2MHCA 3T5DA 3GGOA 3LY5A 4A1FA 2NNWB 1FTQA 1OGIA 1N7IA 2MTBA 5EE0A 3QRWA 2O50A 4GXQA 4LTNA 1XMOB 4OPMA 3ZJUA 5JDCA 3DV9A 2HDWA 2W6CX 3WAKA 2F1OA 2R6FA 2FY8A 3G68A 4RZUA 4FYKA 1N2EA 4KPUB 2YCLA 3FX2A 4J16C 3PE3A 4Z4IA 2BTEA 3PLNA 1IZ7A 5CVVA 4AXXA 1KMHA 1JDVA 4Q9LA 4ETIA 5DGTA 3D4BA 4YLYA 1CY0A 3MGKA 3BJMA 3LDUA 3QHPA 4AZ0A 3IV6A 3PX3A 1N5OX 1WQ3A 2PGXA 4RX1A 1LLQA 3ZWPA 4ZRNA 3UT5A 1JEYA 3ZCTA 1MC1A 1PL8A 1RRVA 1ZGAA 2ZBRA 1I6MA 2DBVO 3V7NA 3IILA 3PNVA 1UDXA 3CPJB 3HVUA 1QQAA 2D54A 4KOAA 5BSTA 5JJBA 1YWGO 3KRTA 3JWEA 4GRDA 3L06A 2H1RA 4RF4A 4TKVB 2R7MA 1QGED 3OO1A 5EN4A 4E03A 3ZQJA 3KQUA 2WT8A 3LF2A 4LE0A 4AF8A 3B89A 1XLVA 1QNLA 4F6LA 1F4PA 2R1ZA 4FW9A 4GOMD 2R5WA 1Z15A 5KNDA 4B73A 1ZZEA 4DR1B 5JG7A 4LSGA 1F9EA 1JS1X 1QDLB 4PHHA 2YVAA 4HKTA 4RQBA 1CZUA 3WO1A 4MHSA 4Y98A 1R9GA 3WRYC 3T9AA 1G3RA 2A9OA 4JUDX 3HCFA 5TQVA 3UCXA 2XMDA 4JUIA 1EFKA 1SG9A 1MC4A 2B36A 3D3QA 2G7MC 3DV0A 4X91A 4C21A 3LUBA 2VSOA 1X2BA 2AYZA 1NNSA 2EJCA 2H07A 2IZ5A 3FR7A 1QHEA 2G5TA 4Z9BA 1QFZA 3QW2A 4N8SA 1CUYA 3STTA 4AU1A 3IURA 4PC3A 1I51A 5AJUA 1W4ZA 1LA2A 1XI2A 5D86A 3VH1A 1J1UA 3ZG6A 3ELWA 2QRVB 2B7CA 3L0YA 4IKPA 3WYDA 3Q8MA 1GOTA 3KR1A 3WGTA 2PIAA 3CX7A 5AJVB 4Q3LA 821PA 3QA9A 1Y8QB 4ZQBA 3I61A 1V26A 4JT2A 4YPFA 4JOSA 2CUNA 3OTHA 5D2CA 3RRXA 1DQNA 2D2XA 1KKUA 5LDDC 3NB0A 1K63A 2W0SA 1Q1GA 3PCXA 3HBMA 1KF0A 1UPCA 4DARA 5IFKA 3RI3A 2NVUA 4CMIA 3ILYA 4G25A 1ZA2A 2FWAA 1TVMA 5LIPA 1Q15A 1E5DA 3IMKA 5DO9A 1WPRA 5IN4A 3DG9A 3BXEA 5EEHA 5JNUA 3PQCA 2IJGX 1YQXA 3KVOA 4HRVA 3WMRA 4RVNA 1I7SB 4ND4A 4P33A 3ELDA 1VYVA 5ECWA 5GIPE 4NK5A 3KFLA 4JVNA 3T3OA 3MERA 1QU3A 1T3HA 3DEKA 1WV0A 3DOJA 2QI9F 1TD9A 4Q39A 1TF7A 5G0VA 1OC2A 2Q9BA 1TZ2A 2ZI3A 3FPSA 3LUJA 4GPAA 3ZUPA 3KZVA 4PLHA 3U19A 4D98A 4G1EB 1YJ8A 5KNCD 2KSQA 1L7AA 2WU3A 4GP7A 4W5TA 2Q50A 3COVA 3D1LA 1FJXA 3DA8A 2R87A 3H7AA 1HEYA 3OZBA 3FI9A 3SIXA 3T95A 2PL1A 4IHKA 1GV1A 2M6LA 3W2FA 3CY6A 3IP1A 3X2EA 1ZKMA 2XMQA 3OC0A 1Q50A 3HB5X 3K4HA 5GOTA 4A3SA 4ZYLA 2OBLA 4F7DA 5JNRA 4G0VA 2NTJA 3QKWA 4KBGA 4JJZA 4ZVMA 2W11A 1H2BA 3WSVA 1B93A 1LSSA 4UNRA 3BD7A 4R84A 4U2FA 3MCZA 4PPQA 5DHSA 2DFNA 1EE9A 2OHIA 3K6KA 1FP7A 3B5IA 1D7AA 3C1UA 4UTZA 4KQHA 3UJ6A 4F0JA 4E5KA 7ADHA 4K9LA 2EHDA 2I4NA 4FFRA 1G20B 1XJ5A 1M8GA 2P6NA 4CHTA 2NVUB 3B6JA 3QU9A 2GN1A 4M1MA 5DGIA 5TGDA 5GADl 1QOQB 3RS2A 2YN0A 1M2VB 2EG5A 3V34A 2O8DB 2AE2A 2RKWA 3T7SA 5U9CA 3LHDA 1JE1A 2WU8A 2PMFA 4I4NA 1GGJA 2RH8A 1GFSA 4OUKX 4QVIA 1U7XA 2RHRA 3C8UA 1NY5A 4XSGA 1J5EB 1MGPA 3AESA 2AF4C 4P53A 4CG1A 1ZIOA 2O19A 3T5CA 3EF3A 4IJWA 4DDUA 1XTBA 5EWMA 5IJ0A 4PG8A 2VT6A 3UUGA 4DDTA 4L4YA 3PC3A 2CWDA 5DDIP 1OYOA 2HZ7A 3LYLA 4MRVA 4OHKA 1V6SA 2ZJ4A 2WSSA 4HCJA 3G3EA 4UM7A 2HXGA 3ZY5A 2Z6AA 5I4IA 1RDFA 4NLLA 2UUPA 1F5SA 3EMKA 1W85B 3OIGA 2HQRA 3KB1A 5FV4A 1HFJA 2X14A 1HE4A 1X86B 2C7GA 4OOEA 4Z4EA 4NC9A 3QNWA 4BFVA 2UU9B 2W4QA 2JFQA 1N5MA 1XMQB 1LFAA 1O57A 2AGVA 4L50A 3SKXA 1FFXB 4Q19A 3DLHA 3FHCB 3JW8A 5BUZA 4MVJI 5JSUA 4ZU1X 5MN4A 1RWVA 2IHTA 2VH2A 3A0UA 5L3ZA 2BRUA 4A82A 1V1MA 2QLNA 6NULA 4ZODA 3RKSA 5TGZA 2LIVA 1PHRA 3QEMB 3G2KA 3SLGA 2P4SA 2ETVA 1QGYA 1QIJA 1SRRA 1JT9A 2PUTA 4BVFA 5BV8A 5GINE 1K5HA 1Y3DE 2IDMA 2WVGA 2V1UA 5EQDA 4J7AA 1ZMXA 2FG5A 3PC7A 3KM0A 1MW9X 2PM8A 2BOVA 3THRA 2G77B 1D2CA 2Y2UA 3DZJA 3AO0B 2IOHA 5CA0F 2HYIC 4NXNB 3K2QA 5EIBD 4JFAA 1S7CA 4C4YA 3BXOA 4PG5A 4MR8B 3BIOA 4RACA 1CY4A 2W9XA 2X2FA 4C5CA 2I1LA 3WDMA 1E1RD 2Q4EA 1D0IA 1XTVA 2QM0A 3HCPA 2NYVA 3W4IA 3ECCA 4ZEVA 1Q0TA 3KJXA 4IYRA 1JFFA 2EFDB 3WGMA 4F2WA 1I6KA 2M98A 2VPTA 4LZZA 4BMPB 4A92A 3R6LA 1KK1A 2YNMD 5K99A 2X86A 3U1BA 1ULSA 4CMGA 2HEGA 4L8LA 1H1TA 1QRDA 3A1UA 3C3BA 3D6MA 4I0WB 4Q3KA 3T1NA 2IV2X 1IHUA 1LBEA 3P4UA 4JQYA 4P5PA 5KKCA 5HGXA 3AF6A 2J48A 4AJNA 4XRGA 2Z6QA 1C9MA 3DMRA 3T1YB 3DAGA 3O82A 2DHDA 4YYZA 3EIXA 3FBGA 5DYIA 3HXTA 1EDBA 1A5ZA 3H9EO 1UMCB 4UD2A 3ND5A 4BMNA 1GPH1 4YVFA 1K3FA 2PKQP 4IXMA 3STVA 2TRSB 3BMQB 3CN7A 1MT3A 3GBSA 1DFIA 2QD5A 1E58A 1O94D 1P9RA 2EOAA 2I3BA 3C5HA 3I2IA 4KQJA 5AW8A 2IYXA 4N6GA 3FSGA 1WXGA 1RC0A 2HIHA 4Y18A 2OFWA 2OCXA 3U0BA 3K15A 4NJEB 4O4JF 3V8EA 1XHFA 1TW3A 1KFEB 2CK3D 5KYUA 5IRCD 1STOA 2GVDC 2PSDA 2J87A 1GAWA 2P9ZA 2PSHA 2QRLA 4PFQA 5E0KB 5J23A 3EXG2 1ZU5A 2JLZA 1NBMD 1OXKB 4KLAA 2IDZA 3VR6D 5EP4A 1DIBA 3UGKA 3U60B 5D5QA 4WA8A 2FPOA 3FLBA 1J2YA 1GRRA 4ZQEA 3UYKA 4Z7OB 1VM6A 2WD7A 3HKEA 3RABA 3AEKA 2ZUEA 1ZZGA 5KO2A 4TPKA 2CE7A 1S1CA 2RHOA 2WILA 3P26A 4UEOA 3C8MA 1XPUA 1OKKD 2Z9DA 3M6WA 1F2DA 2B8JA 1AKNA 3FDZB 4YA6A 2FV8A 1QG4A 4UZSA 3W6ZA 5A5EA 5IK2A 2GKGA 3KG2A 4IWYA 3GHYA 1Z45A 2OFXA 3EZ7A 2L17A 3IMFA 2DX7A 3K0FA 4PCVA 5G2OA 4O3FA 16PKA 4A03A 1E3SA 5T3YA 1W5TA 5C4GB 1A5BB 2JGIA 5CLHA 1O6ZA 3D54D 3KELA 4HGZA 3WGYA 5THQA 4Y1FA 1IRXA 4AO6A 2RARA 3OF3A 1N9GB 2HN9A 2O8FA 4XUDA 1LQTA 5JZ9A 3G49A 4MDYA 3HR7A 1Z06A 3GVCA 4DPKA 1FP6A 4MQBA 4RVDA 1LQ2A 4HH0A 1HYQA 1TA4A 4DCMA 2HQ1A 1OZFA 3BRCA 3OT1B 1Z6AA 4FLFA 2X3YA 5EUBA 4HI0E 4QYIA 3AG6A 4TTJA 2V3CC 1RMYA 2OV3A 1ZGHA 4IBOA 2AC4A 3OPYA 5IPFA 3CLKA 2X0EA 1RI2A 2GCOA 2O1EA 2RB5A 3I9FA 4LOHA 4ZIRB 4ARIA 1JSCA 1R6UA 1FS4A 3SF0A 3L8DA 3WX0A 2OESA 4ND3A 1TPZA 2JBAA 2HIMA 1KSGA 4BXOA 3QQPA 2OV6A 2QJRA 2R751 2BFEA 2XMSA 4Y9SA 4G26A 1V96A 4IVQA 2C2OA 3K53A 1B41A 5CTJA 3NKLA 2NYUA 3UYLA 3DW3X 1QHGA 2J7KA 2Y1KA 3JQQA 4LDQA 1FJ2A 1ZCFA 5G4LA 3SEAA 4E2WA 3M2PA 4WZAB 4FDVA 3DLAA 5H3CA 1WW3A 2JJMA 1SBTA 4M8NE 1QU2A 1T3TA 2C31A 4RKYA 4MS1A 4YP6A 2G28A 2RCNA 2CY0A 4A8PA 2W2TA 5GWXA 4MROA 3WQQA 1EJ6A 3BTVA 2MYTA 4MO9A 4ZHSA 5KREA 4YYEA 5C1PA 3QFSA 4P92A 2QTVB 4HWGA 5DE3A 3QBJA 4N3NA 3U5ZB 4FOOA 1P9LA 4IM7A 5ADVA 4RFLA 3VR2A 2G04A 4WLOA 3OFSA 1WDWB 3CVJA 3IVMA 4LHYA 4NEGA 2G17A 4RK1A 5CD9A 4XYLA 2XVYA 3IAFA 2B6NA 1UQTA 4ZCLA 4KWIA 3CVYA 4C89A 1AQIA 2P11A 2Y77A 4J1TA 4EUNA 1L8LA 3KPVA 4A5SA 3PT5A 1OX5A 4PBTA 4C3VA 3FVVA 3NNDA 4RKQA 1KY2A 3PCRB 3V6MA 3LWDA 4NQZA 4XLLA 3RIGA 1OXTA 3ZDAA 3IB6A 3H8WA 3K0FB 4PX2A 1R88A 1YBVA 4NOKA 5JY6A 1G7CA 3QJGA 2P9YA 3CUTA 2H2DA 1M7GA 1WOYA 5KJFA 1S01A 4FCTA 2FN8A 4YEDA 3QX9A 4G37A 1WTAA 4CEIA 1VE1A 1CY7A 3OPYI 5JARA 3DZHA 2GBIA 3B13B 3GGSA 1JVNA 1Q1AA 1VKZA 3LXXA 4PR3A 3HTXA 1EVYA 3SZGA 1XB2A 1VJ0A 2CNDA 3T3EA 4GZ3A 1W36B 1Z82A 4LY6A 1PJ3A 5AM2A 4K6HA 4RJTA 1YCDA 4P80A 4JASB 4N5HX 3ME5A 5G1OA 4N3AA 3D4LA 4YMLA 3BKWA 1NVFA 2FP4A 3T7AA 2VQEB 2W2XA 3UW3A 2RONA 1ZM3A 5HQJA 1A8SA 4RK5A 3OTWA 4OHYA 3RSCA 3PWSA 4LY9A 4HRAA 1C9JA 3MCAA 5CFPA 1D1QA 4NKRA 4JOBA 3L9WA 1JBQA 2WP8J 1FZQA 5FV7A 4PZLA 5AW0A 2PUCA 4LCBA 3ZS9A 1U1DA 2IT1A 3L8ZA 4I5GA 3GA5A 2VBGA 4E88A 1FFYA 1CUAA 1W2GA 3KCNA 4RSMA 1JDSA 4PQFA 2R2GA 1SPXA 1IB0A 4NYIQ 3NH9A 4JL5A 2C0CA 3LVRE 5GY7A 1D2HA 3KKQA 4M9ZA 5BXYA 2CW5A 4E5VA 4R05A 1S8OA 1YCHA 4O02B 4R2MA 4RMIA 1QOPB 3DNMA 3O1JC 3T1QA 1CQJB 3T15A 1NQOA 4BGIA 1NRWA 1U1EA 2IZZA 1U6JA 3VPGA 2BWJA 1KI2A 4ZQCB 2O3JA 1XX6A 2XUIA 3ZWBA 3C8HA 3KHUA 3AYXB 5FFFA 5J5VA 3VDXA 2VATA 4U8HA 1IQRA 1P9NA 5KQGA 1JKJA 3JQ7B 2QY6A 3A0RB 5HSGA 4TV9A 1QVAA 1WZCA 2QMOA 3SPXA 3ANNA 4O4HF 3UBMA 4LRYA 1J99A 3EPLA 1PGPA 3NC0C 1I7PA 3WGZA 1BWRA 2M6KA 3UJ7A 4KRFA 3L6EA 2JLCA 3WGJA 3LHKA 2A57A 1H0HA 4QEZA 1DEHA 1FYFA 1GRCA 1OBHA 5AVTA 5GJWC 4R9VA 5FBWB 2XZDA 1OLUA 1CRZA 1NQVA 1IEXA 1PNQA 2G9VA 3AVQA 3KJIA 4FGUA 1FNCA 4PV7A 4RZ2A 1GNQA 3GJ5A 4X1YA 4J2OA 3TM4A 2G1PA 2QVBA 4MUGA 1YB2A 3NYIA 5P21A 5LQCA 3C6ZA 5AM4A 1F4VA 3PTLA 4C5AA 2ZCUA 3ZVKA 3OECA 5IAKA 1A8UA 2AMVA 1OGYA 2OG1A 1RWWA 1NXVA 1T8UA 1YDEA 2V7EA 3GEIA 5DGXA 3UFBA 4X7MA 4GC9A 1B8PA 5AQEA 5JYBA 2N47A 1X42A 1D04A 4L5IA 4CDNA 4F1JA 5HM6A 1SY7A 4B6FA 4UBNA 3CSSA 2ZIXA 4EWLA 3ADKA 3ILVA 1WXDA 4LISA 5A4FS 4CIYA 1CP3A 4UFNA 3W4JA 4FFVA 4A6EA 3N0TA 3BEOA 2P7IA 5CAEB 3LT4A 2P77A 1R0XA 2IQIA 3B9PA 4FGSA 2HZBA 3CVVA 3CR7A 4LHEA 3EODA 3RFFA 5BRJA 4H77A 2CVPA 3FLMA 3ZXYA 1U28C 4BQOA 2BN4A 2EWWA 1TCVA 2P27A 2E1RA 1QGZA 2ZT7A 1A2QA 5LQJA 3U61B 1Q7EA 1EXMA 1T3GA 1VPEA 1A5TA 4O4LB 1T8TA 4LHVA 4YASA 2YKGA 1XLUA 4CQMD 4JJKA 2VSFA 5T67A 4UTRA 4WGFA 4KLNA 3ZU3A 3KUXA 4CM8A 4QO8A 2DKFA 4EF5A 3IB3A 2ZVDA 1UBEA 4EPYA 1HTTA 2F8LA 1A4UA 1OQAA 1YQDA 2WHXA 3N58A 3NHYA 2BSAA 2WNSA 5AKXA 4Z54A 3ESDA 2HU7A 2Z1DA 2BI7A 3W34A 3Q88A 5HR5A 5JQGF 3R2JA 3EEOA 1VBFA 1YB4A 5CDFA 3WLRA 4Z3KA 3RG2A 3TNLA 3TRFA 5THKA 2B4QA 2O8EA 3ELBA 1DC4A 5A6SA 3PLAE 4OO3A 4EENA 3HJCA 4UAUA 1E2HA 1RYYA 4KMMA 1FB5A 2K4MA 3OA2A 1RMTA 3M49A 4DQKA 3P0RA 1YVRA 2QUAA 4L2IA 4QQFA 5AYVA 1CRQA 4CN9A 1H66A 5IANA 2JPDA 1RJGA 1F6DA 1RSZA 5AICA 3L4JA 5KWIA 3L02A 4NHOA 5FD8A 4AKSA 1KRHA 3JARB 3RKUA 4C22A 1VYHA 5CBKA 2BYTA 2PRIA 2ZWOA 2C5AA 1VG0B 2JGKA 2O1SA 1Z29A 3IAAA 1JFVA 5EEGA 3V00A 4NENB 4HJXA 4IH9A 2G08A 4ID9A 4AIRA 3FGPA 3IP7A 4I8IA 2W2QA 3Q5GA 1ONNA 2B6HA 3UTDA 3VH2A 4NCKA 1KU6A 2BPOA 2O2SA 1CS0B 1JIJA 2F48A 1NIJA 1EDEA 4OD0A 1ZA1A 1SOMA 2E4YA 1UM8A 1IY0A 3LQYA 2J45A 1XXLA 4RADA 4I2NA 3IUQA 3DW1X 3MTDA 5BV7A 3TOCA 1M0SA 2EAUA 3QU4A 5CPBA 5B3JC 3AOEA 4A5OA 5J3JA 3F9RA 2PMWB 1ZFNA 2WG1A 3AEQA 2AG1A 3I4FA 4PHFA 1JGTA 1JHXA 1KKLA 4O1MA 2Q9AA 5CCDA 1HE5A 2QNRA 1BXGA 1RFLA 1QX3A 1PG2A 3I32A 1AJEA 1W59A 3BMOA 2AD5A 4ALIA 3HR8A 4K7JA 1DDGA 1F1JA 2HNAA 1HE1C 3NM4A 3L7MA 3JZFA 1GLNA 3LC1O 4IV5A 4RU1A 4WE3A 3RF7A 2YV4A 1KXZA 5L3RA 3AM5A 2OR3A 3EW7A 3DO6A 4G5YA 2I8LA 3FSJX 2IEAA 2ZB8A 2W58A 3H2JA 3FUXA 3ZIUA 4B8ZA 1EFLA 2Q4BA 1PIWA 1T1SA 3CEPB 3DHVA 1DEKA 5D3KA 3HYSA 3STWA 1D7OA 4RNDB 1Z3IX 1ZK4A 4TKLA 3RC2A 1GZ6A 1DJQA 1CF2O 3HDQA 4X90A 1KBZA 5GONA 3I28A 3WV4A 1RXWA 2VJQA 3RAGA 2WEKA 1IB6A 3GUCA 3MRVA 4XTRA 4KR2A 1FQWA 3R6WA 4BNLA 3JATA 3B20A 4QUHA 1NW9B 4KXWA 1P2BA 3IH5A 4CE6A 4JD5A 2CXRA 1ZVQA 4EHLA 4LF9B 4H60A 4X44A 1GXSA 1VOTA 2R8YA 1C0EA 3E58A 1KEEA 5M3BA 3KO8A 4CLOA 2Z5LA 1JHQA 4LWPA 4Z99A 5I9LA 1B16A 3BCUA 4ZAYA 1PNRA 5L95A 1WP9A 3K30A 2VK1A 2IF0A 2J0SA 4Y2PA 4RHEA 3H9UA 1IOLA 4HS9A 2OFFA 4MB2A 1U02A 1CUBA 3ZVNA 3KJZA 3NASA 1WR8A 2C9DA 3V2IA 3RANA 4CM3A 5BUQA 3RUCA 4TRMA 1XXHA 2OCIA 2X23A 3DBHB 1QR2A 3QG5A 4CL2A 1XQ1A 3IO3A 2E7ZA 4YAOA 3O92A 1QHNA 4Y2TA 5D7NA 5K0GA 4B4VA 1K3UB 5HRCA 1LBHA 2OB2A 2GPSA 5EUMA 3VZRA 2R4QA 5EYPB 4LK2A 5AKZA 1G2QA 1KDTA 2OK8A 2YOGA 2Z09A 4RMHA 5MHTA 3C3WA 1K5GA 3LGAA 5JS2A 4PSDA 3MPUA 1D1TA 3AR3A 1UM9A 1KAOA 2GFHA 3QVSA 5ITWA 2C42A 3SIRA 4BAGA 3PUYA 3CB2A 4L3WA 3JWIA 2MSWA 4PZCA 1QG6A 1UOEA 1WKBA 1X8XA 2ZI9A 4EY5A 1ODCA 1HC7A 4A8JA 4CU5A 4TTPA 5JJLA 2IHUA 2UVPB 8ABPA 5LXTA 3TZEA 4MQUA 3IIIA 1PGJA 2YY7A 2NU9B 4FWTA 1FFXA 4FLMA 5LNK1 2AG8A 2CBGA 3HADA 3IDFA 1V8FA 4DADA 3KSAC 4PZ0A 4BFLA 1H2WA 1SU8A 2COUA 3FNRA 2PT5A 4F8YA 4Z51A 2VYCA 4U9IS 4A4DA 1QUFA 4NV1A 2YCBA 5K3FA 3DQPA 1JEQA 1UFOA 1OOEA 1XWFA 3IAXA 1X8KA 1WNTA 3FPKA 3PT9A 5LDGA 1I9CA 2HF8A 4ALJA 1B7GO 3WGHA 4BNFA 1UJ2A 3GZJA 2HV9A 2PZJA 5JH7B 1YVEI 1ZNYA 2R11A 3UPUA 1WHTB 1FUIA 3EY9A 5AW4A 2G67A 5H3LA 2WUEA 3D6HA 2BGWA 3NDJA 4OY3A 1ZH4A 2NV2B 1IJEA 1CY6A 1OI2A 1Z75A 2OV2A 2V58A 4RVCA 5IASA 3EGIA 1Z6ZA 1E1RA 2FN9A 5ALLA 1JSRA 1T5BA 1YL6A 4RA9A 2BJVA 2I6TA 3DO8A 4BX9A 5F3WB 4M1ZA 1CLUA 3ED5A 1ZVJA 2PPVA 4D4HA 4D7AA 3JD4A 3DMGA 2FEKA 4WESA 5GOZA 3WGIA 1AKWA 3CO0S 2UZAA 3NUGA 4AX8A 5BVHB 1MGOA 2AFHA 1M2JA 1DXQA 2FJ0A 2YMQA 2YY5A 5BW8A 3HUTA 1RJFA 3H1BA 4BRZA 1K9SA 1GKKA 1G20E 1SKMA 3A4IA 3LOPA 4FP9A 4NOJA 1W44A 2FPGA 3LS2A 5K03A 2AH5A 2REQB 2FI1A 2ZATA 1M34A 3AX6A 3IERA 4KLRA 4BNKA 2D7DA 4R41A 1CETA 2PLWA 3E9NA 4MRNA 5E95A 4C4ZA 3M5WA 3ZGLA 5C8YF 2WT4A 4BX3A 5FDFA 1XZEA 3MBKA 3ZWCA 2DFPA 2IDJA 2QL5A 3KOZA 4JB3A 4L3OA 4MWDA 4EGCB 4FZVA 1VRVA 2AOUA 3ZY3A 2AXNA 4CQLB 3R75A 3B2NA 4G0ZA 2BMEA 1T1RA 3VNRA 1TJNA 1VB5A 2PCJA 1EUDA 1EK6A 3ABIA 3FG9A 4G84A 1XJCA 4AJHA 2BEJA 2DULA 2NACA 2WSBA 3G9XA 1D6NA 2HLPA 3KALA 1JVSA 4ZAWA 3B2QA 3OZCA 4U00A 3MHTA 2G40A 1YASA 3AM1A 1T5LA 1KE1A 3LPMA 4XB2A 3F74A 1MF7A 3P0HA 4FEYA 4WFJA 3R7WA 3ZWOA 1DAKA 1GO2A 1LWNA 2K7ZA 3K16A 4QQKA 4PHCA 2C3MA 1GUZA 4YP1A 2QVXX 1IPEA 3IP6A 4TXJA 5JYCA 5ARCA 1WMSA 4H59A 1E6KA 1KK3A 5HTKA 4BO8A 4HPWA 4ZYWA 5K0EA 2HEIA 3F6BX 1L3CA 1Q5PA 1RD4A 1VJCA 5EP2A 2A5YB 2O5EA 4EG6A 1U9JA 2CJWA 3F97A 3FPBA 4R9SA 2H51A 3QTTA 4RVSA 1GUBA 2C2HA 2HK8A 4IZOA 2K87A 2ZK7A 3IA2A 2ET6A 3RSZA 2W2KB 3LFUA 2BFFB 4L5JA 1WKCA 4M1WA 3O9VA 4KXFB 3ZWXA 1O95A 4Q9HA 2X3UA 2IHVA 3FPFA 3BGSA 1XHEA 2AL7A 3TOXA 5JCJD 3JU3A 4QOGA 4N82A 4ZEWA 1T9DA 1M8KA 2QVCA 1I8TA 1PDVA 3VR6H 3NM5A 2JHCA 1LSOA 4WCDA 1QE0A 3LKZA 4LDAA 4DV1B 3PC4A 3QTLA 3WWOA 4LC1A 4JGBA 1ZPDA 5FQOA 3Q12A 1QRSA 1PEKE 1YSCA 2BR4A 4MW1A 5I9MA 5HM8A 4NU8X 2PX5A 3LDFA 4RLSA 5J5CA 5JV5A 3DV0B 4FQ8A 2LV8A 3CU5A 1KZ6A 1NOKA 1U9IA 1UKYA 4KBFA 3K8OE 2OLJA 4KWCA 4U63A 5I7FA 1Z2OX 3LP6A 4C4OA 4IINA 3ANXA 5F21A 4O33A 3K4PA 4DSUA 4DR4B 3ZGOA 2V6MA 5D1NA 4DA0A 1E18A 1GNSA 3LPDA 4EIWA 2ZEJA 3NBMA 3QMPA 1GTVA 2BGTA 2HO4A 1AY0A 2GPJA 2HLDA 2IRWA 2NTYC 2P2NA 2Q3BA 2RCYA 3A6GA 4PAMA 5KEIA 2VP9A 2W6IA 3VGPA 1QG2A 2GEDA 3K4QA 3I2GA 1UBGA 3TZQA 3C6MA 3RRMA 4A0RA 3TG8A 4EY7A 1TJ3A 1VI2A 3PEVA 4ZZ3A 1V7PC 2YJ6A 2HIAA 4H7FA 5IXSA 2QLFA 2JAXA 3QEOA 2GI4A 5LYJF 3AK4A 4U9UA 1H65A 1I7QB 3DCJA 1EE2A 3EY4A 1FP1D 2OLEA 4JLBA 4M9CA 4BNMA 4RGQA 3K1AB 3R76A 3D7RA 1F51E 1ZRMA 3MJCA 1H23A 3ZDZB 2R1TA 4J0FA 3BB1A 3HWX1 5F51A 5A6SB 1M1NA 3GRFA 1VLLA 5JDIC 1T9ZA 2VO1A 4XM0A 2ID8A 5E6RA 1WUHS 1FXWA 4D4IA 3HH8A 3GRZA 3OX2A 1MABB 1UMDA 4NK4A 2ZXFA 2XXAA 3BZWA 5EMKA 2EJVA 4YJ3A 1Z22A 2CXUA 3G2NA 3L0ZA 4UVIA 3ZZUA 1Z39A 4IUCS 4Q16A 3DL0A 1BMTA 3B2EA 3L0CA 2JCYA 4GE3A 3U44B 3ACBA 3QX8A 3BL8A 5ER6A 5ERGB 1A5AB 3AHDA 3H86A 3HFJA 3PJEA 2AJBA 4OQFA 3ABOB 1UBLS 4DDHA 4PONA 3H2IA 1PT5A 3TW4A 1EPUA 1HPLA 1U9ZA 1Y3BE 1X9HA 5JZBA 5KX5F 3LCMA 4W5JA 4XWOA 3OZDA 2BBSA 4P08A 1IIRA 1L7VC 1H8HD 2QAGC 2ZBGA 3JATB 4M7OA 2LCQA 4D79A 4BWVA 4DKJA 4EL5A 3BFPA 3K92A 3GFOA 3PQ3A 4DV7B 1I33A 1FVHA 1GSIA 2LDXA 2H1SA 4N9QA 1Z18A 3BCHA 1SBCA 2A6PA 2QAJA 2FJPA 2ZUSA 3NBZC 3U48A 3VHRA 4QLBA 2D0DA 3BB4A 1IEVA 1KR2A 3OA0A 2AHOA 2XTMA 2OO3A 4F46A 4Q1DA 5SYAA 4F4HA 2JI4A 5H59A 1ACMA 3RPEA 4A91A 2M2IA 3KP1A 4RTKA 5DN6D 4TRNA 5EJMA 2QYHA 3RFUA 5KWVA 3TR0A 3BSYA 2EJBA 5BSKA 3LAWA 2E4WA 1IVNA 3TPCA 2A0YA 4K8OA 2R1VB 3S7TA 3IJEB 1SB8A 1T5IA 3RRZA 5C7YA 3TL2A 5G0UA 1GPKA 2VXYA 1GTJ1 3G1TA 5AVJA 1GADO 1Z13A 4L57A 4AIIA 4BLRA 2VDWB 4PO3X 4RFSA 1OD6A 2R84A 1I2ZA 2FZ5A 1ZGJA 4DYDA 4K6GA 3I73A 2I71A 2RC5A 2QROA 1R3UA 1XA0A 1TVCA 2VG8A 1HL7A 1ULTA 1XP8A 3TI9A 3EBLA 4PYMA 1GL9B 1X1BA 2OTCA 1SWWA 1TZJA 3BORA 4U2DA 4HAYA 3GNSA 5EWLA 3NUZA 3M4ZA 5L3VA 3ACDA 4L27A 2J3QA 2FW0A 4MVYA 1M2EA 1PP4A 2WFAA 3NEAA 4ZOCA 4C6RA 4PN7A 4CKEB 3Q7SA 4YCNA 3WP0A 4XCQA 1E4OA 3KSZO 3PUVA 3LYUA 4RHFA 4AKEA 3ND9A 4O8CA 5HUHA 2IP4A 4GI1A 1S8AA 5H16A 3UMRA 4PANA 1CQJA 1NW8A 3IQFA 1F20A 3SHOA 4AICA 1CDEA 5PNTA 2PX4A 3LHIA 2Q3JA 3HI6A 3K9CA 4KO3S 3UBTA 3VH4A 4H7IA 1UPUA 5JLJA 2ZTMA 3BAFA 3UCFA 5JPCA 5C34B 4U7DA 2B99A 3Q5EA 1GRQA 1LY1A 1RJDA 4KQXA 5JDIA 4GDFA 5LMZA 2F8TA 1AZSC 1J0XO 2I22A 4WA7A 2I2WA 3WZ2A 3DMPA 4RC9A 4R9RA 3KZXA 3ZYZA 5CHYA 2NVOA 4TL6A 5I7WA 5IMSA 4KLZA 5A7FA 4G0XA 1W52X 2R8RA 1Z0IA 4JBGA 2PMKA 1D1PA 2EKLA 2FUEA 4Q93A 1W46A 1D09A 2UAGA 1HDXA 1P5HA 2CYAA 3CG0A 3I9V1 1QKJA 3T4XA 4A16A 4BVBA 5BWCA 2C5BA 1ONOA 2Y9MB 1MPTA 3EGXA 3UHAA 2BGGA 2QUZA 3IQDB 4R01A 4TMWA 2G72A 4HQRA 3CRW1 1WA5A 1GPNA 1XF9A 4QASA 1UJBA 1C0IA 3R20A 1PG5A 4PG4A 3V8RA 2Y1CA 5IAEA 3DOOA 4HDRA 5ALEA 5JC8A 1GDTA 4CI9A 3FNIA 121PA 3U3ZA 1LX7A 1F60A 1YZNA 1TMKA 2FFQA 2VZ9A 2QRGA 3HFRA 3INRA 5ALTA 1DMSA 3N8NA 4YR7A 3S68A 2W4IA 5E3IA 5B5SA 4EUSA 2D13A 2FG6C 4AURA 2CLFB 3JYNA 4MQEA 3NYQA 1NVTA 1Y4UA 2ERXA 3SZLA 3N8KA 5KTOA 3DVAA 3OD1A 4J9VA 1JLKA 3JZIA 3AI1A 1GGHA 5EGNA 5GJVC 4ZAFA 2X76A 1A3CA 3EWNA 4LV8B 3V1UA 4POOA 2RJOA 2PYZA 2ZT5A 1UBUS 3L8MA 4MGZR 4QBKA 4RDHA 4XB6B 2DUNA 2UYYA 1YR8A 2BMVA 1KK2A 2JIZD 3G6WA 2NZ2A 1AA6A 1KRXA 1I4DD 4KE6A 3QPVA 5F1YA 4J4TA 1P44A 1VSQA 2ID7A 4NVRA 4AYWA 5KU1A 5JZSA 4YCJA 1DMRA 3BD9A 4PCAA 3AV0B 1HE2A 2NSDA 3FZEA 5KU7A 4O3MA 4LG1A 2LPMA 1TTTA 2E18A 3D7KA 4RV5A 2FZVA 3B53X 3LGSA 4TN5A 1G8FA 3UWKA 5FWDA 1ENYA 5EVJA 4HNAA 1GU0A 1FU7A 3ZK9A 2AI1A 3VC3A 1V9CA 3DCYA 3L1IA 2FN4A 3GQVA 3LW8A 3MT8A 4D82A 5JRZA 1QBGA 4Z5XA 3FB4A 4OA8A 2DQYA 2TECE 2B20A 4UMDA 3TLAA 1HTBA 1XZKA 2YR0A 1R50A 2ZRDA 4EH1A 4F8JA 2P2SA 3L6BA 4X5OA 5KUTA 4WXRA 1NSYA 2BZGA 4MV1A 2HJRA 3RIHA 1JFRA 5IWAB 3U3JA 2UZ4A 1N0HA 1DAMA 3QEBZ 3E6AA 4F6CA 2FF7A 1NN1A 3TQHA 2WB2A 4K9NA 5A3SA 1YZGA 4MKHA 1OVMA 1VJRA 1E3QA 3F71A 4ZVVA 3PDUA 4L4ZA 1JTFA 2ADFA 1NI3A 3DVSX 1LSJA 3IA7A 5KNLA 2WJ4A 1PZFA 1RPNA 3OEWA 2OMKA 1TIPA 2P2DA 1P81A 4M9QA 4E11A 4B47A 3HSKA 2O4UX 3FVQA 4IMJB 2OHVA 3TD9A 1Y9JA 1QYXA 5FPYA 1H2FA 3EIQA 1WMAA 3NCHA 3A1SA 4IZ6A 1DJLA 4KIFA 3V32A 3G1UA 4HDMB 2FZCA 3UHFA 5JXJA 2IWRA 5JPIA 4DXDA 1F1BA 5SZKB 1SUFA 1TZBA 3FOEC 1FK8A 4F96A 3DFIA 1U04A 3NTOA 4BZXA 1XD2A 2H9IA 4NMLA 4UU8A 2R5FA 2R85A 1S3IA 2GFQA 4KXYA 1DPFA 2J5XA 3WB1A 4A2QA 3PGVA 2YY6A 4GM0A 4XZ3A 2VDUE 1UKAA 3WLSA 3L8CA 3I8OA 4RZSA 3ZDCA 4MS3B 1DO2A 1QVVA 3LO8A 5D00A 3EFOB 1DT3A 4OK5A 5BQ5A 3ZJVA 2J4DA 3DLPX 5FPTA 1RZVA 2HB6A 3ZDQA 5JYEA 3T5MA 5KNBA 5EJGA 3BTSA 1U7PA 4IIEA 4V0OA 3T5PA 3O1LA 1NNLA 3AMVA 2WD7B 2R1VA 3OZSA 4C0XA 4YPOA 1BFKA 3GRVA 5HE9A 4ZDKA 1FFHA 3EVDA 4KBYA 4MJLA 4N7RA 1R37A 1J2UA 4B7ZA 1SQSA 3EB9A 5ELXA 2E37A 3EUAA 3HBFA 4YONB 1DT5A 2VPWA 3B1JA 2XBMA 3D8HA 4GMGA 2ONKA 1BCRA 1G8MA 3MEQA 5KMGB 4D3FA 2XQFA 3ZCUA 2ATEA 2AG5A 1N9KA 5CIWA 5J2TF 1QAMA 4EHDA 4ND8B 4TN1A 3D2LA 3RVPA 2XUJA 4MR7A 4JN6B 2XLCA 1G5HA 5FLEX 1H2HA 1DBRA 3S70A 1UXGA 3FOBA 1V1RB 1ZCBA 3MTBA 1N3LA 1V4BA 4JYMA 1FFDA 4EQZA 3IL2A 2WABA 2FWIA 2DFDA 2HCFA 2R6ZA 3L5OA 4L07A 4MCHA 1XAGA 4JUBA 1X7ZA 1W36D 1E4EB 2AJ8A 2EF1A 4WVLA 1FRFS 5DWDA 1U1FA 2VQ6A 3O93A 2ZSUA 5H9VA 2OD2A 3ID6C 1L1FA 2VJAA 3LLSA 1ANKA 2PQ6A 3KBBA 3ST7A 1JTVA 1SXJC 2E5WA 1G5FA 3CPHA 1UDCA 1T3ZA 1EIWA 3GFQA 4AYTA 3F1LA 1J21A 1VHTA 1YZVA 3IUYA 4MDHA 3OQIA 1CR0A 1N2IA 1TAGA 3AGPA 3MQFA 2JCVA 3GWGA 3ICCA 4NDAA 1TCBA 4P54A 1PT9A 4WOKA 3F47A 1IUNA 1BZYA 5BT9A 3SK0A 2FR0A 3KVRA 3N70A 4Y2YA 3S81A 1SBYA 2I62A 2ZU0C 3BBPA 5TS3A 1C4KA 1QVRA 4M36A 2I9PA 3LHSA 5NULA 2DBRA 2GCOB 1VI5A 1EXNA 2VJNA 4LRTB 3P4YA 1B6GA 3Q3HA 3W6UA 3QPDA 1GG9A 1OIXA 1SG6A 4I55A 4IZHA 3L6CA 2CL5A 2XW6A 5IH3A 3ZZ0A 2RHLA 2XBUA 3OUZA 1KFCB 4EKDA 5TPZA 1D5WA 4I2VA 2QG4A 3N2KA 5ALDA 4ALMA 3BWCA 1M2FA 1G98A 4M0CA 5G4KA 5BYJA 3WWEA 4LZPA 1KO1A 4YRMA 4YDQA 2E4XA 1XQVA 2GAFA 3AVPA 2DY0A 3P9XA 2C20A 2J59A 2X0JA 4BUJA 4DSOA 2H2GA 1T10A 2CKDA 3AU9A 3M6MD 2WK1A 3AG5A 3PIIA 1RVV1 3UAOA 5TMPA 2PUEA 2CNLA 5EMMA 4I1OA 4ZV4A 1XXHB 2J0UB 4QRDA 3C24A 4BTEA 4CIXA 4FC7A 3A8TA 4B6JA 5HTOA 7AT1A 3CONA 4BZWA 1R0WA 4N5MA 5K1ZA 3IDOA 4UEQA 1XK7A 1K7SN 4X6XA 4HQ0A 3KB6A 1OROA 1YE5A 3OM1A 1QWOA 3MUOA 3DMYA 4ZDIA 1JKIA 4RVGA 4JITA 1HK7A 3G85A 1LKZA 1QIDA 1UUFA 4MOWA 4ENQA 5BOVA 4F06A 2WM3A 4UHDA 1N75A 1D0SA 3PQFA 3ZZ1A 2GTIA 3QVTA 4I4IA 3R9XB 4EPTA 4RLFA 3X2SA 2IYEA 1ZP6A 5DVZA 3NW9A 5TGTA 3RADC 2ZETA 1OFGA 1WG8A 2BFBB 1JR2A 3U7GA 4QXQA 2VYVA 1CR6A 4UNNA 4EQ6B 2BKUA 4CCYA 2IODA 4Z9XA 3QXSA 2CXXA 4CXMA 4BKPA 2BMJA 4FMDB 3B5JA 3RGWS 2WJGA 4I9UA 4BAUA 3PF8A 1F2UB 4Z4QA 2P6RA 1TFRA 2PRJA 1UF9A 3RC8A 3U16A 1A98A 4AECA 1J2JA 1UAYA 1WBJB 1ZN7A 2CDNA 2HNBA 3OZVA 3D7MA 1ONBA 4TM8A 4TTTS 3V33A 1ZH6A 2W2LA 4E2XA 5J2UF 3F5FA 5KSWB 5GQSA 1FF9A 3DH0A 4JYCA 3FOCA 3OETA 4PPGA 1MOZA 4MW7A 4UD6A 2CJXA 3UMCA 9ABPA 4PXSA 3GP5A 3SQOA 5IS2A 4H7PA 4QJ3A 5CFMA 5EHGA 2FZGA 3RVSA 4BVJA 5KDOA 2BZ0A 2NZJA 2W2MA 3HYCA 1GQFA 3A3PA 4Q1FA 1KR5A 3NHKA 6GPBA 8GPBA 2YL2A 4O1IA 5KOJB 4RIIA 1DWQA 2H5JA 4YP5A 1KP2A 3WBKA 4ECEA 2X5JO 5HKOA 1QDUA 5I8WA 2JK0A 4OK3A 1ICEA 4NENA 2PR7A 3IEIA 2ZR9A 1VZ2A 3FSRA 3EH1A 3FCOA 3FYTA 1HDYA 3KEQA 4FQ5A 1NSFA 1PG0A 2WAAA 1XHLA 3C3AA 3JARA 1L5WA 3OI7A 4A0HA 5EOVA 4BEJA 2I1VB 5T64A 3M4JA 4RD4A 3UQYS 4PVCA 4E15A 5LP1A 2II6A 2D3WA 4KXXA 4B48A 4BO9A 5LZ7A 1ISIA 5LJLA 2JASA 3C3KA 1IU9A 3NOQA 4R8RA 3RFCA 2DFTA 2Q6LA 2VDMB 1OV6A 3CX6A 1M8PA 2JRCA 2RHBA 4RKRA 3VR6A 2GRAA 4AYXA 2JEYA 3RJ9A 1IM8A 5CT8A 4H1HA 3OJCA 4XGKA 1KQ3A 4YJ3F 4DSTA 1NXWA 4KWTA 3DKVA 3G0OA 2AYXA 4EGQA 2YJGA 3SYNA 4IX1A 4EYGA 5EHXA 1A76A 5JCXA 1BD4A 3VU1A 4OQEA 1YKGA 1VDMA 4DXHA 1KH2A 3THWA 1X0XA 3AR4A 4ETWA 2PUAA 1VBKA 3PDIB 2QU7A 3KT0A 3LSYA 3OBIA 1AKMA 1WZUA 3MWGA 5TQ2A 5LQUA 1TCAA 1UPTA 4EA7A 3SQXA 4CYMA 3KZKA 1JR3A 3CKLA 3ADBA 3HQ4O 5BPHA 3L7YA 2BTOA 2SKCA 3LK7A 5GPBA 5KYKA 1YUMA 1KO4A 3W5DA 3KWLA 3Q9LA 4G5RA 4LRUA 4C4XA 2IS2A 1W0JA 3V8VA 4XFKA 4CMKA 4EKYA 5K3OA 5A04A 2VAVA 3ELYA 1ZVMA 4QEKA 1V8BA 1RWQA 2ODPA 2O9JA 3LKVA 5HZGA 4RXUA 3ZBPA 1GGFA 1R7RA 2F00A 1ORHA 3R5TA 1K4YA 3D43A 2I4LA 3QK7A 4J75A 1RKXA 2DM6A 4R0VA 5GONB 3P2EA 3WNCA 1Z2NX 4KLCA 2RHWA 3X1XA 1BEUB 5ICCA 1Z6GA 3EIEA 3OEYA 4ERXA 1SAYA 1WWKA 4PZAA 4EB6B 1A1VA 3KUUA 4Y2RA 3LUFA 3K94A 4C5BA 2WA1A 2CSXA 5JIBA 3KIPA 3KE8A 3CT6A 1XF1A 2BEWB 3GRAA 3QQ5A 3ROKA 1UK6A 5L4SA 4J8PA 5ADHA 1IJBA 3OIWA 4G63A 2PZBA 4ZXPA 2GNPA 1C8BA 4C29A 3STUA 3JQBC 3EA4A 2FDRA 2RK6A 1BVRA 3GC6A 1D2MA 4EFLA 4NJMB 4KZPA 2PUFA 2UZ3A 1JJIA 2QLLA 1COZA 2QLMA 2RGYA 4EYKA 1TCCA 4NCIA 3SD7A 3WOVA 5CH3A 1DADA 2RGUA 1YOVA 2M9MA 3CF4G 4Y6PA 3REOA 3VRHA 1FW8A 2FW1A 2Q1XA 4ZC1A 2O7VA 5ES4B 1XP5A 3MMXA 4TVOA 1ADBA 1EQAA 4X6LA 3VDQA 5A1TA 3SXUB 4FFMA 4N5IX 3HDTA 2REXB 2W6ID 1ECLA 2ZAIA 4B0PA 1TNDA 1T3SA 1X7HA 2CFOA 1Q3TA 3UJCA 2CDCA 3P9SA 1C3XA 1PD1A 1X7DA 3BBLA 1NP6A 3LRXA 3N1UA 4RE6A 4BNDB 1BKDR 2AXQA 3GBPA 1F3LA 4MS4B 4L28A 1RLUA 2CXNA 4MXDA 3OMWA 1ZOIA 4M1SA 5I5GA 3SCZA 4NE2A 4D43A 4MQFA 3ZI0A 3GRCA 3BILA 2J6IA 4R5HA 2BFWA 3QXJA 1AB5A 2I7TA 4X85A 5AXBA 5IT0A 3CT4A 3JQGA 2XDWA 3ORYA 4CIWA 3KR0A 4FU0A 3QLJA 3AEUB 4GMHA 1X13A 3LNCA 3VMFA 4DPLA 2HSGA 1NJ1A 4E7OA 2W00A 2G5PA 3I6ZA 4EK9A 1L1RA 3U7EB 2PJZA 4B46A 1I4LD 1E2IA 2PBFA 3TNFA 3MS4A 3RKRA 1S4QA 1MXHA 4MV6A 4OGLA 3BWVA 3TCKA 3USCS 5JXHA 2ST1A 1QAQA 1ZDMA 5JVDA 4QFDA 3W6PA 3ZWMA 2D7CA 1O95D 2JC3A 3E27A 4LDZA 4JKIA 1VA4A 2AN5A 4ZOEA 3U3RA 3UMJA 1AT1A 2XXBA 4ZZ1A 4Z8XA 4HY3A 1FXSA 3BFXA 3UWOA 4N47A 4XXHA 3SJZA 4LN1A 1L9XA 1R5NA 3FIJA 4OCZA 4UVGA 3HJHA 3F2IA 3N6VA 4F4FA 2B92A 4R2LA 2Q5QA 3ZDFA 4IIBA 2PKXA 1UXJA 4R9UC 4IIJA 4ARZB 3VVMA 2CXTA 1MO2A 1F6BA 1OZHA 2Q3MA 4IQ0A 2FPXA 2GM5A 2HW8A 4GKJB 2F3PA 2W2LD 3CF6R 1U0SY 1YFZA 1NWCA 2DUUA 2X2OA 2A14A 2X6RA 2ZRGA 3T3PB 4ENWA 4GPZA 3KEMA 1CZKA 5ICFA 2H4ZA 1PNTA 2VP2A 4HUJA 1Y0BA 2VNHA 2HMYB 3F6CA 5EE1A 4OMFG 2HBQA 4AC9A 1JDBB 2JNWA 3FLAA 1GAQA 1ITZA 2W6MA 4MAMA 4C2UA 1VKRA 4X1IA 1H2XA 3UAVA 1UBHS 4DWWA 1MO4A 3TLMA 3WLMA 2FGJA 2PG3A 4PTZA 1OH7A 3GT7A 2R3SA 1R8XA 1HT0A 2ZJBA 1CHDA 1VJ5A 3IIJA 3Q85A 1Q7RA 1ECGA 2CZQA 3JTMA 5SYNA 2BBOA 1XKLA 2I2CA 1DFHA 1WS6A 5AVRA 3IFSA 4GUDA 4KAJA 5D5PA 5KYTA 3FZNA 2YDYA 1SVSA 4IG9A 4DWVA 2RD2A 1O5IA 4MWBA 3N53A 3TXXA 4YRBA 3EXHA 4FYVA 4GH5A 3AJ9A 4ZCMA 3HACA 1O03A 3PA6A 1MLDA 3SYTA 3O8BA 4BS9A 3LMKA 1QLJA 3M4YA 4D1YA 5BWNA 3G8DA 5AW1A 1X1AA 4NG4A 1YJQA 1WMBA 1A4RA 4WL0A 1O6BA 3EHEA 3IR7A 2QL9A 3EXEB 3RUPA 3I3SR 3R5SA 4XLTA 4JU9A 2XD9A 3TKLA 3IP3A 3UVEA 2VYND 4LCJA 4DY4A 1EUCB 1YJ5A 1O8CA 1HE8B 4KR7A 4Z4HA 1Z7YA 1LVHA 1MNQA 4M0DA 5ITZA 2B1GA 3KR2A 5IULC 3K9GA 3TLCA 5JPDA 5LQNA 3IVAA 2AOWA 5CDGA 4KK3A 1TZCA 4PFJA 4DLYA 5L3SA 1GFZA 1Y89A 5D87A 5JAQA 4UCFA 3WRWA 4OXKA 4GKAA 4Q9NA 5B58C 3ULKA 1JHYA 1ZRSA 1WKVA 1EHIA 4CEHA 1U2ZA 2EL9A 4BGUA 3G0GA 2Q46A 4LYGA 9ATCA 2P41A 3FPLA 1N36B 4D6YA 4M60A 3L4BA 2XB9A 3KFXA 2WMNB 3D6VA 1N32B 3FPEA 2ZTHA 3FFAA 4INPA 1E92A 1R66A 2FFJA 2G6TA 1KFJB 3E22B 4FE4A 2YWEA 1QTQA 2JGDA 3TTXA 4CEIB 3OP1A 3SJUA 5KJ6A 1P8JA 2QSJA 2O7RA 3JQEA 3MMZA 3G9QA 2NU7A 3IOMA 1QFYA 4P7GA 2RK3A 3KSMA 4MDEA 2FE1A 5T6MA 2HT1A 3LRTA 3MA0A 2XRZA 4MEAA 4ITRC 2EFEB 1HZZC 3Q9NA 4AK9A 3VAZA 2P8SA 4E22A 3GY0A 1O87A 1EUZA 4OQLA 4PY2A 4DDKA 5KQMA 3N6RA 1JUDA 4XUCA 3BQNB 3ZWKA 1LJUA 1CEXA 4DV3B 1CUZA 4IIJF 4BEVA 4G36A 3D8UA 4FR2A 3EGDB 4LJ8A 4C7JA 3PK0A 3AUXA 1W9MA 2J3MA 5C53B 3TQIA 3IC5A 5B57C 2GHIA 2MYNA 3KXLA 4JXKA 4KXQA 1VECA 3NKVA 5ITZB 1OTYA 1MAAA 3T1HB 5DBOA 2FQYA 2A7XA 2OQIA 2EZTA 2G70A 3DMFA 4O59O 1SKYB 1WDLA 2P5UA 3MLEA 3P2JA 3PB3A 2VBIA 3PQ4A 3KDPA 1ABEA 1YHZA 2NTNA 4M89A 4R8KA 1TMOA 2I2AA 3LX4A 1VHQA 3L79A 1IY8A 4LSZA 3SXJA 2V54A 4TQUS 4GRAA 2UUOA 1FMLA 4X20A 1PFQA 2XSZD 3SZMA 4MS1B 3GLIA 1G5IA 2EHJA 3B8HA 3EVGA 3ZH2A 3E7XA 3BVPA 5A3QA 3D6JA 3FKJA 1ZMBA 2CFSA 2XQJA 5LM3A 3GUZA 4RLHA 2OXRA 3W2HA 4MUJA 2VJMB 4JIGA 1VG8A 4O2BB 3BE4A 3EVTA 4OBXA 4TLCA 5E2AA 3GZTB 4DUGA 1P18A 2VPZA 1ES9A 4MZDA 4E32A 4D80A 4DLVA 4OK6A 1DCTA 4Z2AA 4FOPA 5LB4A 4RCZA 1KPIA 3T94A 1E2QA 1WCV1 3AY6A 2XDQB 3CQ9A 3D6UA 1JSXA 3JQRA 3QXCA 3UF0A 1V2GA 3W7AA 1SHLA 4JLDA 2PKEA 1DAGA 2OZEA 3KOXA 3VNQA 4I1PA 3DOEA 1YH3A 4LKOA 4XVCA 3TGLA 3WBJA 5AI4A 1PRYA 1EFRD 4U7JA 4I66A 4D45A 1I2CA 3W8EA 4D3DA 2RJNA 4EMBA 4QYIB 1JAIA 2QZ9A 4MVWA 3NTQA 5E1BA 4MB0A 1E7QA 3UOWA 5AXDA 5LBTA 2Y1EA 1W4AA 1RWNA 2C3UA 1N6RA 2HU5A 4HG2A 4EHAA 2WTBA 3OCUA 3VDRA 3ZHTA 1G21A 1JDPA 3BIXA 3LX8A 3R24A 4I99A 3SQWA 1DOZA 4RY0A 1BQEA 1OXUA 3RSQA 2OO5C 1OWOA 1Y33E 3KKOA 3OLYA 4NRDA 2IXAA 2C8JA 2QTMA 4TV8A 2NO5A 3MMPA 1K6EA 3C6YA 3MFYA 1ZW1A 1E3WA 1D6SA 1E96A 3B1ZA 1HTWA 3ET4A 2HA4A 4PZEA 4RF2A 4A36A 4HB3A 3Q7EA 2G4LA 3HA3A 1SUWA 3VM6A 4V1CB 4LDNA 4XSHA 1D5CA 3AYZB 1RHJA 3N8DA 4YQEA 2J3LA 3N74A 2HA5A 1JN0A 5FAKA 1O7JA 1CLEA 1IBRA 5AI8A 4Y3UA 3WRVA 5IKXA 1YF3A 4YO8A 1HF3A 1P0IA 1JLSA 5EHIA 3LDGA 1ZNQO 3ANSA 1FNBA 4MVJA 5DLDA 1RKUA 1SCKA 1X7XA 2PGNA 5AM0A 5A9RA 2JB9A 1U0JA 4KUHA 2QQ0A 5A4KA 1IPFA 4REQA 2KE5A 2XWJI 3B8EA 4WHMA 4DREA 4TZ6A 4WEQA 3MJ4A 1Q77A 3HO6A 2I4TA 3UUEA 1KYYA 2OM2A 3AJDA 1DTWA 1V6CA 3GIWA 4LXXA 2EKBA 3VSBA 5U4XA 3OKCA 5BMVA 1EWVA 4UUBA 1J7KA 3HN7A 5L7YA 1U8AA 1I7DA 1DTSA 2PYIA 5KZMB 1RHKA 3C16C 3FOAA 4Q3OA 2IXDA 5CIQA 1DRUA 3CLHA 2PYDA 4V0NA 2AI3A 4FN4A 4Q7QA 3AVTA 3JZMA 3L46A 3NI2A 3RS9A 2B2XA 2A3RA 4PO1A 3S2ZA 3ZNNA 1BRTA 1KVTA 2IELA 2P3SA 3DXYA 4PPFA 3RQIA 3RREA 3SMVA 2O0KA 3QXHA 1ZD5A 3V4FA 3K1ZA 1R8SA 4MA0A 4R3WA 5COQA 1JPUA 2XCUA 1MJHA 4I7EA 3FMIA 1T5HX 3WGNA 2IYNA 4AJ9A 3IXQA 1J5PA 2IF2A 3WNDA 4MGKR 2WLTA 4KH0A 2B1IA 2Y0BA 3G2IA 3NGXA 4BC1A 4XVUA 5CLFA 1MA0A 2YIDA 1JHMA 5ALQA 2MSEB 1XJQA 4BNDA 1WQ4A 4KIGA 3WGUA 2DR2A 3HKBA 2QGFA 4M3NA 3I8XA 1N8TA 4PO8A 3T8YA 1U7OA 2CUKA 4U0JA 2JAWA 4MR9A 2OCDA 3HWRA 4MGHA 2QMEA 4QQNA 3N39C 1U8ZA 1WPXA 3KE9A 3OZFA 4HEJA 4IGAA 4PFKA 4C7XA 5TS2A 2NU6B 4HBGA 1HNNA 3MAJA 4P3PA 2PLFA 3DLCA 3TVDA 4JDUA 1XA4A 4N03A 1VLHA 3ZCVA 3QELB 1XO1A 4BE4A 2OUKA 2PKCA 4AKTA 2LD4A 4B3SB 4ENRA 4C87A 1VFNA 1QRRA 2C00A 4MINA 4U2CA 4PF1A 4LNUA 4ASUD 4ZEMA 4KN5A 1JXQA 1SQ0A 2ZT8A 4NJMA 4TWJA 3RSLA 2ODNA 1BDIA 1NPDA 2JFYA 3N0XA 2N9UA 1JJAA 2QXYA 1C3EA 1J49A 1RE1A 1ZYUA 3HJUA 4UAJA 1FYWA 4ZVTA 2FVYA 3UUFA 4BNJA 4D8XA 4WVFA 3JYOA 1QF7A 1ADGA 4UTOA 5FPPA 2ZI4A 1A9YA 1T8PA 1G3MA 3PRHA 3PRYA 4H2DA 5DTRA 4CG3A 3A6EA 4FNOA 1R8JA 2J5RA 1EFPB 1M2KA 4RH0A 1J70A 2OUIA 3ENVA 3ZOKA 1DAIA 2XYVA 3DZKA 2GNAA 4CQMB 1XBTA 1HFWA 1AHPA 1DCKA 1IOWA 3OZUA 5FO0A 2GEKA 1KYWA 5BSFA 4R7GA 2Y71A 1UPBA 1CQWA 3IS3A 1KWGA 2VYNA 1YC5A 3GX1A 5ED4A 3QWHA 2CB0A 2NSHA 2KM1A 5A03A 5T7BA 3GDHA 4FFBA 4LFCB 2ZYDA 1Z6TA 3PYXA 1IHYA 4JMLA 5CTAA 1X3LA 5ED0A 3R74A 4RMNA 4EUKA 1ZWKA 3MQ2A 4L76A 3K72B 1HNXB 1V8ZA 3A27A 4YP7A 5TF0A 4NFYA 5A6VA 4R2JA 2H7XA 5CB8A 3PKZA 4FD2A 2ZJ2A 2P3QA 1Q0PA 1XRJA 2XEDA 1ZJYA 2J9GA 3L0IB 3S8YA 1TMYA 3DGEC 3U9SA 5IXJA 2Q1YA 3QENA 5JZVA 2J0QA 4ZOLF 1CUCA 1J6UA 1LI4A 5ECDA 5EZ6B 4E30A 1JEOA 5TB5A 4CIBA 5JD5A 1R18A 1JA0A 4QM7A 4TLAA 1KSFX 2PX3A 2YXLA 4IFIA 2H08A 2VHZA 3MTGA 4DANA 2EQBA 1DKLA 1DBIA 4CJXA 1BVUA 1XZNA 4JI8B 5I48A 1Q74A 4X3PA 1GPAA 4JWKA 3MJEA 2ABWA 4PTLA 3ZTTA 2QWXA 2BJWA 5AR1A 5L8VA 4NPHA 1OX6A 2RGGA 3U49A 5CD1A 1OB2A 2DECA 3DE5X 2C2GA 4URWR 4AG5A 3JVIA 3R3JA 1U0EA 1RS0A 3SSAA 2FFHA 2BE9A 4BWGA 5JQGB 4M37A 2WIKA 1V5WA 1U8TA 2DTXA 4AJLA 1TE2A 2DBZA 1X8JA 1BJTA 2BGUA 1V5GA 2IXFA 4YCLA 2HF2A 4ZT6A 1IN4A 3CJTA 5LYYA 4P2BA 3VFDA 3RT1A 5JEEA 1QR6A 3CPEA 4FXPA 2DWUA 4L9WA 1D8TA 1UJNA 5ITSA 2Y1DA 1ST2A 2XQKA 1VHJA 2X0IA 1XD8A 1DHTA 1ZG3A 3TAUA 1Z4MA 1H22A 3I53A 3E3AA 1N4AA 2G9NA 4HAXA 5FTWA 1K8RA 4M9RA 3TFOA 3NCTA 3LCRA 1GNPA 4NNPA 3G2HA 3AW9A 3BXGA 3ONFA 2QAGA 2NO0A 4XGNA 4X64B 3DONA 3DWFA 1A9ZA 2LP4Y 3LUHA 4CLOB 4TYNA 1N2GA 2O0LA 2Q49A 3SGLA 1XJWA 3N2GA 4EX7A 1YE3A 1ISRA 3OQNA 3IIMA 3PFBA 4NARA 3CRQA 3W8FA 4B9EA 1I6WA 4K88A 1O89A 3GLFA 2XB2A 2UYGA 3GFTA 3UQZA 3AI7A 5JHGB 2J5BA 1Y98A 3ITKA 3NG1A 3QP9A 4C20A 1X7WB 1Y1RA 4URZR 4TT8A 2RBEA 2FUNB 3FGOA 2PGLA 1QYDA 5G02A 2P2GA 1MFPA 3MCUA 2A9FA 5F9FA 4KX5A 1Y6FA 4AMYA 3WK4A 1M2VA 1EP9A 1P0QA 1BXKA 2QN3A 3OE4A 4GMKA 4EBFA 5I51A 3ZGZA 1IXKA 3LKDA 1HT2E 4RW0A 3R77A 2A5JA 2VUUA 2FX2A 3GUUA 4HDNB 2IXEA 4J3JA 5F5LA 1OBCA 3ZIAD 2DH5A 3OQHA 4J91A 4CPDA 4UM9B 4E5UA 4I46A 4O4IB 1ZKDA 2BT4A 3PGMA 3P9QA 4X3CA 3I09A 4YC7A 3PX2A 4QNNA 3SOPA 3WLEA 5AK5A 1VE6A 1UWCA 2AFIA 3K0CA 2V98A 2ZIWB 3CFYA 3DTVB 3JCZA 1YQEA 1UR5A 2Q9CA 1N25A 1ECPA 4EW2A 3AHEA 3UT6A 1QQ6A 3WGQA 1GPYA 1MJNA 2GJ9A 1UOQA 1WB6A 2FMHA 4UASA 3TO5A 3P20A 3GLQA 4KTVE 1UBOS 2OWEA 4X54A 5A7HA 1V41E 4BMCA 2Z8YM 3D8TA 1BHQ1 1UZAA 3CEMA 1X3SA 4AJKA 2YUTA 2PU7A 2VA9A 1SNYA 3P0JA 3GLUA 4Y2XA 2FPKA 3WNVA 3WGVA 2C2KA 3PYLA 4R9NA 2VWGA 2FRDA 4CIVA 1Q92A 1Q11A 1XDBA 2QRKA 3LWZA 4XVHA 5G4KB 3DNFA 3TTSA 1L7RA 1YS1X 2JA1A 1ZGCA 2KB0A 1TPYA 3B1XA 3GH1A 1NDHA 2R25B 2XNJA 3OAAA 4N18A 4ALNA 4YRPA 4B3RB 3CJRA 3O90A 5A3JA 4PWZA 2EBHX 4CF5A 5FHQA 5H68A 1T2CA 2HK9A 1QCYA 3FN4A 2P2YA 3DMTA 4JC4A 4HDSB 3UANA 2CUTA 3BERA 1J9ZA 4HUQA 3OFNA 5KTTA 1YFJA 1DOAA 1IM2A 3WISA 1N9ZA 1QYIA 2GGSA 3PPYA 5CXXA 2J8ZA 3WC4A 1HH4A 3NHJA 4NMXB 4LXQA 1C9NA 4GX0A 1ODTC 1FRNA 2KBEA 3M9XA 4FCCA 1KIMA 2XNSA 2Y9PB 1EVKA 4HN4B 3OQIB 4OGKA 3VSCA 5ICEA 1T9CA 1Y8QA 2HJSA 1VP9A 3UAWA 2DZDA 1E94E 4HB0A 2YV1A 3TH5A 3V4OA 2CLHB 3COJA 4S1WA 1AO3A 4UQLA 4DF3A 3F98A 2H7YA 1CUEA 1MTZA 1PS8A 1SKAA 1YU6A 1P7ZA 2NVWA 2OBMA 3LIPA 4JIMA 3MJVA 4EEXA 5JWRA 5H83A 1I3MA 2O1XA 2CBZA 2I65A 1Z7EA 4MAFA 2LCIA 4HATA 4NMHA 2WWHA 4DCNA 4ZMBA 1XVLA 1GVNB 1TB4A 5DNWA 1FFAA 1A9OA 1DUIA 4ZQFA 2PANA 3ZE7A 5KQRA 1KAQA 2RSLA 1ECCA 4ZGBA 4L08A 3WYEA 4WASA 3FOZA 1UIMA 3CX8A 4QTZA 4TS3A 3PQ7A 4RA6A 4X8HA 5BMVF 1IAQA 3C3CA 2ASEA 3AM4A 3GW8A 5E4FA 2ZE8A 5DRYA 2CZCA 1T2UA 3V42A 1Q7CA 1UKCA 3KSRA 1EK0A 3IRUA 1NC1A 5CMLA 3LBAA 3KVYA 4XB1A 4ZU3A 4FI3C 4J6EA 1VMDA 1G9SA 1GIAA 3EOZA 3QVOA 5DJ5A 3FROA 1KJIA 2F3SA 4KIWA 5LCXA 3ZGNA 1CUHA 3LJKA 2PBZA 2WQ6A 5FUVA 1H5NA 1O6FA 1CY8A 3NDRA 3STXA 2OQVA 1B0UA 4R8SA 2HK6A 2XKJE 2A33A 2O5VA 3K6JA 2O2EA 2DERA 1MV8A 1TO1E 2PCLA 3OEEA 2AJDA 3O1IC 1P4SA 3QVGB 1E8NA 1SHZA 1ZHFA 5J5AA 3WS7A 2FZLA 4BO3A 1ATZA 2OBNA 5EQJB 4EVRA 4PRLA 1XROA 3C4QA 1GR1A 3KYCB 4EI8A 5LMCA 3Q3VA 2E1PA 3AHJA 4LPSA 4RHTA 1AUXA 1SC1A 3AB3A 4DMCA 1KZ1A 3EC7A 1DV2A 4M88A 4C1NA 1V6AA 4X45A 4B6PA 2HBYA 3E70C 2X1VA 1HT1E 1IZYA 2Y92A 3CKKA 1O9HA 3QU5A 5TQ0A 2PWZA 3TD2A 4RZ3A 4IUBS 5KMGA 3FTEA 3P0IA 2WWWA 5JTUA 1WY7A 3U4IA 3N8GA 3H5WA 2P8JA 1LRKA 2WYVA 4FMDF 2ENUA 3AHCA 2XGOA 5GGXA 4B82A 2XITA 1BOFA 3CLTD 1EFCA 2VYFA 4JHLA 3ZV3A 1A9QA 3VPBA 3B9RA 1NKTA 1WVGA 3UK1A 3SHVA 1XLTC 4H0FA 1J8QA 1IPHA 4UOEA 3BHJA 1W88A 5HPYB 4G4GA 4CUJA 2VTEA 3W1WA 1PQWA 2POQX 1LBIA 3DL4A 4LOKA 3G7SA 3IAUA 1BMFA 1MB4A 3K2IA 1IN5A 1FOEB 1ZK1A 4EF6A 5AVQA 3T6KA 1KZGB 2WJJA 1RR6A 2DQ4A 1ZI9A 4Y6OA 3V5NA 4IJKA 4XIYA 3BCSA 1USIA 2ZJ5A 3PQ2A 4HZGA 2IYRA 5FEUA 3G8YA 5DGHA 4MYTA 2WPDA 4NAUA 2OCBA 1OXBB 3TW0A 1LS1A 1IHPA 1HLFA 3KQNA 1DELA 2EQ5A 2ONZA 1FU8A 3FTQA 1CQIB 4UUNA 2QG9A 1AM4D 3GPBA 3DP7A 5IC4A 4NBRA 1C0LA 2ZIGA 3I9MA 4ARVA 4HNVA 4BO2A 2MR6A 1SOWA 4D56A 3R0XA 2GARA 1UH5A 2FH5B 1LNSA 2WOJA 3AEQB 3LI2A 3H13A 2DPLA 3P2KA 1XVAA 2OEPA 3ZCXA 3MJRA 1U3FA 4D3XA 3R5HA 2MSLA 4HDQB 1NUUA 2Q7XA 4FWBA 4EYSA 5A5VA 4RK6A 3VYRB 3KTOA 4OLAA 4L5CA 3E4CA 2QS9A 4YK7A 2ZRQA 3RFVA 1NE2A 3T38A 5EKTA 2PT7A 5I9NA 5FWXA 1MKYA 4GE0A 1H6CA 4BTVA 3SWWA 3UAGA 3GNLA 2NU6A 2ZR0A 3G2JA 1RQNA 4D0GA 2GZDA 1DWOA 5CNJA 1U7TA 3VO2A 4Y1RB 3BM5A 2PS1A 1TM4E 3IEUA 3NFRA 3OMLA 4P7FA 4TL9A 4CTOA 2H59A 3M6XA 1A4IA 2ZBFA 4K28A 3PGA1 1TAQA 3MLBA 2J0EA 5AK3A 3ZXIA 4YV2A 3FYHA 2AN9A 4BE9A 3QPWA 4CVNA 4Q4AA 4KQIA 5BP7A 1JZTA 4G5FA 4TQ9A 1N0VC 1PE0A 4D9NA 4UTPA 4H16A 3IHKA 2HR1A 4IZIA 1CVIA 3UG6A 5DMHA 1OLSB 1OTHA 2EYQA 1EGVB 1X92A 1HYGA 3JX9A 1VHWA 3WL7A 1YTLA 2V7VA 3C41J 4XEHA 5LQDA 3ER9A 1WM1A 3ER6A 4P84A 1NW6A 4G9EA 3E4DA 2OZPA 4P5EA 2KS6A 5FNVA 4L0QA 3PD0A 4E14A 2X40A 4TKUB 2YWRA 2BDEA 1HETA 1GUFA 4O2BA 4L15A 1PYGA 3I83A 3B6MA 5FI5A 3RW9A 2WKQA 1BQ4A 1AGRA 1RABA 2BLLA 2HCTA 2HHJA 5BRAA 4TTAA 4JXJA 2OSVA 1BKSB 4PXYA 2XT0A 4ZC8A 1E6WA 3M6LA 1B42A 2O8VA 4K8RB 4OLBA 1JZQA 1NI4B 2X4IA 3B7PA 3MBOA 1C80A 3P9IA 3AVYA 2VA8A 5KWEA 1S5PA 3V8MA 2F9LA 2QN7A 3AETA 4WQMA 1YGYA 4YRCA 2VT2A 5BNZA 1N4DA 5HF5A 2VYQA 3MRTA 2EV9A 5GZ6A 4EFKA 4LVCA 1CZOA 5FFMA 3BTUA 5CFNA 2FFBA 4QL3A 2ZIZA 2H1CA 3A6HA 4C3ZA 4WBNF 2AUTA 1C3OB 1R4AA 4MQ4A 3W8DA 2GXAA 4FKMA 4WT7A 5BW5A 5BN5B 2FMTA 3T7CA 3PLRA 1ORVA 1W94A 1NQ5A 1Z2DA 3PL5A 2WAXA 3VJRA 1Z7WA 4TVKA 4B7XA 1Y1SA 2Q0HA 3HI4A 3N7AA 4LHXA 1UBCA 3GYGA 4B7CA 1BEZA 3FRIA 3DUFA 2GBGA 4OAOA 5B36A 2XE8A 3UZUA 1AK2A 4MW2A 5K6AC 4NY1A 4H0CA 1WLYA 3TEFA 4OF4A 1O9GA 1UOPA 5KC8A 1FYVA 1G21B 2GF2A 3ICOA 4LA4A 1ZC3A 1PBNA 2XJ4A 3ADPA 5DYTA 2AXEA 5DM4A 1XMXA 3K0AB 3E7WA 4C04A 2Q0XA 3L41A 1BEEA 3VU9A 5FR2A 2YOFA 3EPKA 2QD1A 4WN3A 4X24A 3ZD9A 5B4UA 4URVR 2YN2A 5ALWA 2J9RA 3HE3A 2YFQA 3WA6A 3HKEB 5LB2A 4KODA 5T4HA 1ZJ4A 1I9GA 3AEZA 4R3UC 5HKKA 5IAOA 1GNRA 3EZXA 2QE7A 1GFIA 2RHHA 3EE6A 3FVWA 2FPUA 3RGGA 4EZIA 1I5OA 2R4UA 5NLLA 1WO8A 1JQDA 4HJRA 4M1EA 3QSGA 4H15A 5LP6A 3HVJA 4DMRA 1E9RA 2XTJA 2FTKE 3MUFA 3OOYA 3PEUA 4I5DA 1W1WA 4FB5A 1YKSA 3HXOA 4XWWA 5CNIA 1CPYA 4BWYA 621PA 4M1OA 2QUJA 3CEAA 4TTQA 4X84A 3SFTA 3BL6A 2DG2A 2C5HA 3C5CA 1TRHA 3LSTA 5AVWA 2CLOB 1U3GA 1YA6A 2FLWA 1NUAA 2PH5A 2W0MA 2YRXA 4R68A 4PLYA 4E70A 3ESXA 5LU9A 1KY3A 4GGMX 1RYNA 2A5GA 2ZPAA 3UAZA 5ENVA 5LZ4A 4QGBA 1HG0A 1PJ4A 2PVCA 4G9GA 1BSVA 3DOHA 2V03A 4D3YA 2F3TA 1MV5A 2QX6A 2UVDA 1H4TA 3IQWA 4N0DA 3RU3A 4BQRA 3TIGA 3O8QB 4IDQA 4LY0A 2A0UA 1EFUA 2MSNA 2BFAA 1ISGA 3DZ8A 3O4RA 1E66A 3LDAA 1KP3A 4MYCA 1XMIA 3O4GA 2NTVA 3WNBA 3AFHA 1JQ3A 1KS9A 3AP1A 3NAZA 2H2WA 4PRZA 1SKUA 3A1WA 4KQKA 4F4CA 4QOHA 4CL8A 4ARUA 4LMAA 4J3NA 3RSSA 3P2IA 4XLZA 3ITNA 4NBTA 4RL4A 4QYXA 3V8BA 4PYRA 4GSKA 2QRUA 5HIKA 1BU5A 4RH1A 2ZBPA 5DT9A 5FTLA 3SSMA 2VLIA 4PQEA 5IJZA 1C8VB 1QO9A 1JIVA 1HDZA 4DQLA 5JEDA 3DE7X 4BQSA 2PL3A 3BGOS 4DLBA 5KVSA 2W6NA 1NMQA 2E85A 2IIPA 2R1TB 3QKSB 4DRXB 4MLDA 3EA0A 3IBGA 4F9GA 1P0CA 4MLPA 4BFYA 2O20A 1CG6A 2IU6A 3KYCA 3ES9A 5DTEA 2Q28A 3DAPA 3SICE 1L3BA 1QANA 3M6FA 1M72A 3QIVA 1OASA 1TYCA 5E2IA 3W7BA 4NP6A 2V0NA 2MWMA 4HQNA 4FYYA 1CT9A 4YJHB 2ZE6A 4D4LA 1MD9A 2OK7A 4W5QA 2Z8YA 5A9TA 2PSEA 5AM1A 3R9IA 1RQXA 1G8SA 3HCEA 3JS5A 3ZXUB 5KJCA 5FI1B 3GMDA 1N3YA 3VQTA 1Z68A 2JAHA 2GBPA 5AKJA 2D4HA 1DIOB 3HUDA 1Z7BA 2MT9A 2IGTA 4K6CA 3K5IA 1ZD3A 2C4WA 1OW3B 2FMKA 2CXOA 1F9AA 2PXAA 2WUGA 1YK0A 1HE3A 2MINB 2DKNA 3X43A 3HCRA 1ECBA 1CY1A 5L4LA 3SP1A 1L5KA 1QQTA 2ZP1A 3DBRA 1S8FA 4QBGB 3RRBA 3ZNQA 4BKQA 4O29A 3WWYA 4WOBA 2FUG1 2QN8A 3NIBA 3CC8A 1N2ZA 1I5RA 3ZY2A 5EJ9A 4KB5A 1B1AA 5DTQA 4Y6QA 3Q87B 5B7GA 3OFVA 2Q4DA 2XDQA 3Q0TA 1AV6A 1QLWA 2R00A 4FPXA 5D84A 5CA1B 3BE8A 5JATA 1UJ6A 4HNRA 2ETXA 2H1LA 2XUPA 4OB7A 4YT5A 2ZTVA 5TARA 2J6HA 1KMCA 4DNQA 2IUTA 1QCDA 3GB9A 4L4XA 2F8MA 4IF6A 4YT2A 4CUZA 3OD5A 2BM1A 3EFBA 3L6OO 5IAJA 4RY8A 2D5BA 3U2QA 3WDSA 4I50A 3PUZA 2HSZA 1E98A 3K8YA 3Q11A 2TS1A 3WHLA 1XTJA 2Q8NA 3PRKE 5JDCC 1NJGA 5M5BA 2H57A 4B7AA 4Z0HO 1BNCA 4P4SB 3DTVD 4R2WA 1FSPA 1ESNA 4ZYXA 3ZZNA 3FF1A 2Y99A 4LXTA 2X0DA 1D2EA 3S2SA 3TQFA 1N3IA 3LBNA 3QEKA 1YONA 2WF6A 1N1EA 5FWYB 1U0RA 4MUNA 3TFQA 3MXTA 5HKAA 1YUNA 2V7PA 1ZUIA 2R79A 2XUFA 1I01A 3MNFA 3RVOA 2J07A 4TLBA 4YAUA 4M54A 1Z36A 1ZBDA 2HI0A 2O3UA 2LTAA 1N5IA 2I3ZA 2OQ2A 3EMBA 3GH3A 1TECE 1VE7A 2H85A 4HLCA 1TL7C 4ZCIA 4DLLA 5JAUA 2EKZA 5ALMA 2DMRA 2K2WA 3FUCA 1SHUX 5JAPA 2XMZA 2PZLA 1UBNA 4TYWA 4Z9FA 4EMUA 1CERA 2XCIA 3R3VA 4I6EA 1RPJA 3P2MA 4PNZA 4R98A 1L5LA 1HRKA 1ZGZA 2ATCA 5K5EA 3V3KA 5LL6P 1AE1A 3DAYA 4C9BA 3A1VA 1GFWA 2FXVA 3QE2A 4IWNA 4M1TA 3P0EA 4QDXA 4I8XA 2NU7B 4JSTA 3TCXB 4IEFB 3UB3A 4L51A 3VKWA 1F7UA 5EIHA 4DWOA 3NBXX 1MO5A 2C58A 3IPLA 4AG3A 1SZDA 6Q21A 4NICA 1IOVA 3HYNA 3VR5D 2H4HA 5BV1A 3AERA 3EUEA 4PRYA 4QUIA 3OF5A 4KWHA 2BFCB 2ZT6A 1ZD1A 3EAQA 4IGFA 4OFZA 1GRVA 2DYKA 1JWBB 3E9EA 3TBFA 3WYFA 2E4VA 1X7YB 1ZBQA 3H4VA 1KI4A 1US8A 3Q72A 4UXIA 3CLUD 5G0TA 4JZYA 4EBBA 1XG5A 5DFAA 3H1GA 3IPYA 5DNVA 2WUFA 4Y6LA 3BKXA 4DVJA 3PQDA 3K32A 1SVUA 5IUKC 4F6RA 3I45A 4RTNA 2GEVA 4LC0A 1W75A 2OHXA 4MRSA 2JLAA 3UHPA 2AG6A 3NOVA 3HYTA 3EVZA 1YRAA 3Q3JB 5EZYB 3GGJA 4FS3A 5SV2A 1HUQA 3RHFA 3IAHA 3RV4A 4GOLD 5FBQB 4AMUA 4HAVA