1U3HD

Crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
GDSERHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLERTRAELDTVCRYNYEETEVPTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an autoimmune T cell receptor complexed with class II peptide-MHC: insights into MHC bias and antigen specificity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell receptor alpha-chain
total genus 41
structure length 189
sequence length 189
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u3hD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1u3hD01
4GG6A 3WS3B 5HHXH 3RUGE 5DJAA 1ES0A 3DURB 1HK6A 5A2LH 4MXWL 2HT3C 4ESKA 3ARSA 2OZ4A 5MEOB 4R7NB 2GK0B 4RQQB 2FX9L 4XP4L 1CLCA 1NSNL 4ZPVA 3HE6D 3FB7B 3TO4D 4L4TD 5C71A 1A7QL 4J3SA 1CFSB 3QWRA 3HMXA 1UM5H 3HAEG 4WI6A 3KJ6L 25C8H 3OKMB 2GJZA 3V52L 2F53D 3MBEB 4LCWA 4NRYA 1FGNH 3U36A 3EHBD 5TDPB 1A3LL 1JRHH 4K3HA 3VXNA 4K23L 4TQEL 1JPTL 1MVFA 3DRTA 4D8PA 3D69A 2EDJA 3VXRA 4N8PA 5HYIA 1CE6B 1A1MB 2AXJA 1HILA 3IDJA 3UTZA 4Y19D 3UBXA 1QFWH 4XRCB 4IHOA 5IB5B 2B4CH 1EO7A 1CD9B 1XZ0A 5L8JB 1DN0A 5M95B 3DX6B 5TE7L 4OZGB 3C8KB 2HKHL 4QRSA 1O7SA 2CH8A 2C3VA 2ESVB 3DURA 1KEGL 1LEKB 4OBRA 3LD8C 3T8XA 4ODWA 2HMID 3UROR 5L9DL 5I30L 1A1NB 3RFZC 3VFUB 5IT2L 2ARWA 5FOJA 3RVXC 4GRWF 5SWSA 1OAQH 1TETH 3RVTD 4MLSA 5I8OL 1UWGH 2E7MA 3TYFB 4BSVB 1I9EA 2BFVL 3HRZA 3QNZA 2AGJH 3TJHC 3TO4C 5DZLA 1QSFB 1VPOL 5KVEH 4HUVB 4YEEA 2X4PA 3X3FH 2P8LB 4P4RA 1RUPH 5MEPB 3I3DA 1N8ZA 5I1JH 4O2EA 3I6GA 2HFGH 3U9UA 3V2AR 2YSSB 4X6DA 2BSTB 3QUML 3LVEA 5I74B 1CXHA 3P77B 1QFWL 4DW2L 4MQXC 4O2CA 3QUXD 3ET9F 4GKZA 5LG1A 4BFEA 2ED8A 4LGSB 4OUOA 3B2VH 1CD1B 4P2OC 3O45B 2XN9B 4HIJB 1A3LH 2W0FA 1BFOB 1DANU 2LAGB 2OI9C 2VDQL 1J1XH 4XPGH 5CP3A 4GXUM 2DWDA 3MV8A 3CLEL 3VWKA 5C0NC 1F11A 5D72H 5HPMA 4DZBB 1KIQA 4HPYL 4IDLA 1R0AL 3G6DH 1NAML 4YUEL 1DDHA 3QSKB 1RUKH 4W4NA 4LNVA 4S1DD 5K9OA 3OL2A 4NO0A 4IRZL 2FLRT 4X6DF 4X7TB 5ICXA 3WHE0 4CMMB 4CW1B 1XCQB 1ZLWK 4P99A 5I1IH 1AY1H 3ILPB 4NNPH 1MFBL 4RAVA 3OR7A 2BCKB 1D6VL 1YEIH 3T3PF 5K9JH 4Z7UE 2C9AA 3ARBD 1P7KB 3P9MA 3LS4H 3U4EB 5KSBE 3IDYB 5ALCH 3RWFA 4NQCE 4OKVB 3NFPB 4MWFB 2OL3B 1S9WA 1U8HA 2QSCL 4MJ6A 3TZVC 4HUMB 4MJ5B 1Q0XL 2CIKB 3MV8E 4CADB 1OAKL 3T0XA 3WNKA 4QRPA 1FZJB 1A5FL 1OB1B 2J8UB 5HGBB 2CIIB 2B1AH 1TQCC 3ARDB 4LQ1A 1HHIA 1IM9A 2BX5A 5I8CA 4OCRH 3G5ZA 3RNKB 4NN7C 2ESVD 3MROA 3CDGB 1R3LA 1D5MB 1AR1C 2ATPA 3UZQA 2QSTA 1RZIB 3W11D 3GMOA 1KB9K 5JW4M 4FFYL 2JB5H 1JL8A 5CJ8A 2VNCA 4YFDB 1U8KA 4PJFB 3VFMB 4TN9A 5F6IB 3MJ9L 4QTHB 3ZDXE 5FM8A 5AZEL 1MY5A 4LHUB 2CO7B 2DLIA 3KPSA 3CFBA 3TYGH 2JLLA 5D1XA 5C86A 4OF6A 4TSBL 4RFOH 1T21A 2F5AH 2AXFB 4O2FA 1KSRA 2X1OA 4UNVA 1RIUH 5F88A 1YPZB 3L95A 3UPAA 4LP4A 5K9QI 3WUWG 3P30H 2P5WE 2AK4B 2OR8A 1FJ1A 5SWSE 5E95B 5I30H 2VH5H 3T65A 1U6AL 4LEOB 2ERJC 3S34L 1OGAE 4FG6C 5JIHA 5GGUB 5JUEL 2DQHL 1C16A 4OF5A 1DL7H 5IG7A 2VMFA 3DXAA 1IEAB 1R3LB 5F1OB 4UAOC 3BE1L 4WFHE 3N1QC 3KWWA 2J8HA 2ZUQB 5D1QA 2CLVB 2WUBL 4G6KH 4XCFH 4PY8J 3MJ9A 3KVQA 5IBTH 5DC4B 2Z31B 3VXSA 2W0KA 3MJ7B 5IB2B 4LSSL 2E8ZA 4KQ4H 4P5MB 1A4JA 4OD2A 3SE9H 1DSFH 3RVWD 3DX7A 3QI9B 5T5NG 4U49A 1HEZA 1EBPA 3MLZL 1IKNC 3LHPL 2W92A 1HKFA 2HJKA 5JW3L 5DZNA 3U7WH 2E27L 3ZTNH 1DUZB 2DL9A 2BVEA 1JYNA 3BQUA 4K3EH 2P45B 5AYQA 1FCCA 5ABDE 1YQVL 2APWA 1X44A 3T65B 3U0TA 4XCEB 1CICA 1BFOA 2P48B 4PRIA 2D9CA 4GQ9H 1ZLUK 1AC0A 1FC1A 2FATH 4C56B 4DN4L 4P2YA 4JY6B 4DFIA 3DRQB 4JLRB 3RUGA 3ZDYE 1CLZH 3EOTH 3MV9E 4WHYG 3U36B 4DVRL 4LHQB 2L7UA 4JVPA 1KCKA 4J6RL 5BS0E 3G04B 1IGTA 5HYJD 2A74B 4ZS6C 1TJGH 3K4ZA 4P5TD 4MS8C 3UBXB 4GRWH 4M1GH 3HG1A 1UJ3A 4GG8B 4W4OA 5I75C 1TNMA 1S78C 3U4EA 2AQ1A 3UDWC 4F7TA 4NSKB 3ARYA 2BY2A 3TPUB 5ERWA 3SO5A 3U7YH 3S96A 5IIEA 3RJQB 5HYQB 4JY5L 4OLWL 5I1GH 4GMTH 4U7KA 4AEFA 3LMJH 4NZUL 3CXDL 1CXFA 3L3IB 4D0DB 1OB1A 4NQVB 1GZQB 3BOVA 2EICA 3T0ED 3ULVF 5FB8B 4X4ZA 1CDUA 5K9KB 3NA9H 3MRHA 2X10A 3BXNB 5I71C 1HZHL 1RZ7L 4JY6A 4TNVK 1YNTA 1JGLL 3CH1B 4IIQB 4RZCB 2EC9T 2ICEB 4GRLB 2ESVA 1IM9D 4I3RL 3E6FB 1QA9B 1QLFB 4UI2A 1AFVL 3HC3H 3V4PH 4XCYA 1ZHBA 4RRPA 2V5RA 4G6MH 3QIWA 3MGTA 5JHDE 4EDWL 3ZKQD 1OAUL 3CFDB 1OTTD 3KJ4C 3C8DA 1JTOA 4WCYH 3QNZB 4WFFE 5JOEA 5IM7A 2OX5A 3EYVB 1EEZA 3MNVA 4O2CB 1SEBB 3AS0A 4ZFOB 2X4OA 5DTFA 3VRJA 3DVFA 3NFNA 2IADA 4GKOA 3SCMC 2XZCL 3WIFA 2R69H 3NPSB 3K0WA 5MEPA 2C1PA 5D7IA 2FBOJ 3W11C 3TO2A 1R5VA 3LQZB 5E2WL 5EOTB 4D3CH 5EU6B 2F53A 4U33A 2OQJB 4XX1G 4PYGA 5DUPL 1EVTC 5EOQL 2E8YA 4WV1B 1MLCA 4L8DA 1PBYA 5DLML 3KLHC 1CFQA 1R3IL 3RIFK 2J4WH 5ALBH 3OF6D 1XCQA 2CDFA 2VYRE 1QSEB 2NX5E 3NCFB 3TFKC 1L7IL 4NZRH 4G43A 4LARH 4O51B 3KR3L 1MI5D 1CTNA 3TN0C 4FQJH 1W0YT 3ZDYF 4OFPA 2XICA 1S9VB 1E4KC 1UXWB 5GGRY 2HRPH 2CRMA 5DT1L 1JNNL 3W2DH 1F6LL 1ONQA 5T33H 5DJDB 1IE5A 2YWYA 4NT6B 5J6GB 4XXCC 3HHRB 4M61A 3QH3B 1A7NH 1GGTA 1RZ7H 5EU4A 2X40A 3LN4B 2V5YA 1P4BL 1T3FA 5DVLA 3QT2A 1OARL 1EO8H 1KCVH 3VD9A 1INEL 2GW5A 2HLFC 5LWYL 4R4BB 3HRPA 3PL6C 4NJAH 1OY3B 4R90H 5E8DL 3RPIA 2DKSA 3BIAX 2XA3A 4M7LL 2O61A 4Z7VF 4PS4L 4Q74A 5D8JL 1T1XA 3K3QA 3SQBA 4I0KA 3QDJE 5E2VH 1N0XL 3HMWL 5D1XB 1JGEA 3THML 4NKQB 1GGCL 1KG0A 3P9LA 1BP3B 5FV2A 1IL1A 4C54A 3MFGB 3V6OE 1DVFC 4FZ8L 2OTPA 3INUH 2CRYA 2CK0L 4JPWL 3QH3A 3MV8D 4M9OA 5D1ZD 1MHCB 1RZKC 5TDPA 3EOAB 4ALAH 4X80H 1JN6B 3MXWH 4MS8D 3P73A 2O5ZH 2H32B 5F7NC 2ZUUA 1K8DB 5DXWA 3HC4H 3QIUB 2X4RB 2Y36L 1CR9H 1WGOA 4I18C 4L5FL 4M48H 5CBEB 4RGOH 2FSEA 2YXMA 5LBSH 3R06B 4DKFH 4Y2DD 1S9WB 1U8HB 3N85H 1GGIL 4FP8H 3O6FA 4I2XE 2DYPB 4ZAKA 1CLOL 1W8NA 4LAQH 3TJEH 3QIWB 3VI4F 1K5NA 4WTXA 1ACYL 5CGYC 4FQ2H 4FFWD 1O7VA 1Q9LA 4ZUSA 1JYWA 3C60B 4XCFL 4QHKI 2F8VA 1G7HA 1R3KA 4XMPH 1P84K 1MEXL 3M17A 1JUFB 3BEWA 2Q1EA 1E28A 3P0GB 4AJ0A 1OTUC 3RVWC 2AJVL 3V6OA 1J1PL 2PTVA 2X5PA 3WJLA 1OP5K 1H0DB 3BIKA 1FL3B 1YEFL 2H26B 4UV7H 4H1LB 5E5MA 4HWNA 2R2BB 4CVXA 1I4FA 3ZMRA 5ESVA 3STLA 3ZKNC 3FQRA 4PJEA 4OCSL 1AHWA 4JM2A 1JGUL 1PW3A 3BMVA 4L8CA 1MJUH 4G8GD 4PJ5B 3B9AA 2LVEA 3IXAA 3MOAH 1I3UA 2C7UA 2X4UB 3TM6A 3SE4A 5FHBH 2GITA 3E3QC 4Z8FH 4X5WB 3T3ME 1H3TA 5ITBH 4MXQC 2KUTA 5MEQB 1ZAGA 4W6XB 4Z7WB 1KJ3L 2VISA 5HHNA 3U30C 3FRPG 5IBLC 1MI5B 3JWDH 3EW3B 4R2GC 5JPNA 2PYFB 3OKLA 3S36H 1A4JB 3O3EA 4POUB 4FS0A 4WJ5A 2VDPH 4I3SL 1ITCA 3WHXA 3E2HB 2HA1A 4H8WC 4KK5D 1P53A 4F58H 3MR9B 3BPCB 3MJGX 3FT3A 2R8SH 4DOHB 3GMPB 1RIVL 4LVHC 4C4KO 3CVHL 4OV6F 4Z0BH 1ZS8A 2N1KA 4N0FA 1S9KC 2VO5A 1PGRB 2BVYA 4LRNH 5IMLB 4MJ5A 5F7HA 3EYVA 1F4WH 5CP3H 3GSVA 1LE5B 5FUZL 4GOSA 3AREB 4P59L 3NIDE 4ELKA 5I1EH 1I1YB 2AKRB 1J87A 1PZ5B 2DLTA 2GAZA 2PO6B 5EC1A 3RY4A 3UTOA 4Z7NE 1KACB 3H2WA 1LP9F 2VLJD 5BVPL 5SWZA 3TPKA 3QIWD 1OD9A 3GMQB 1K4CB 3MSPA 5D2NB 3PDOB 1INDL 5IFJB 3VFMA 3B2VL 3VD3A 3G04A 2RQ8A 3O0RH 1TJIH 3S96B 3RVUD 2AABL 4J3XA 5C0EA 2VQTA 4I77H 4JHAH 1RV6X 2DTMH 3MRMB 3MNWB 5CMAB 4F7MB 4UDUB 3EYSL 4I77L 3ULUH 4DCQB 1FNSH 3LH2H 1AQKL 5F7YC 4BSWA 1EEQA 3QHFL 2Q7NA 2XXMB 3S37L 1QKZL 4ZG1A 1F6FB 4FTVA 1FNHA 5C0GA 4DAGL 4Z78A 4MCZA 5BJTB 5HGDA 5C07B 4FNLL 4GAGL 2AJUH 4G7VL 1EMTH 1Q9KA 2X9WA 3T2QA 5EC1B 5GGUA 4LSRH 2AGJL 3P4LA 4Y4HD 4W68A 3FCTB 3N1GC 4PJIE 1GPOL 1RZFH 1TIUA 1LK3H 1NGYB 3V4UL 1GAFH 4LSUL 3QCTH 2J4WL 5ALBL 1OAYH 5ICZA 3V6ZA 1YJDH 4LPVA 4ODXB 4BKLA 3TCLA 5DUPH 5KSBB 2OTUA 4D3CL 1RI8A 1FG9C 3OXRB 4PGJA 3MUGA 2Q8BH 2NPLX 4UOJA 5DQ9A 1U95A 4NUGL 2C4XA 3D2UB 3GMNA 4JKKA 1MHHA 4YR6A 3VFUA 5I1KH 3HUJE 3TZVB 5E0QA 3MV9A 2J8UE 3I6KA 3JWDL 3LCYA 1T6WA 4U6XB 3ZLQC 4CMMA 1IKFH 4B7LA 4JM4H 2RHEA 4LCUA 1CGWA 4AT6A 4BK5A 4S0TD 5HYJB 5BXFB 4Q9QH 3GJFB 4PRPB 2A73A 5KTEH 1ZHNB 4YDIL 2QSVA 1BZ9B 4D9LL 1MELA 4EI5D 1U8OA 4Q9BA 3QJHA 5DMGD 1KIPB 3I2CH 4OKVA 5E1HB 3QI9C 5I15L 1IT9H 3TA3D 1FHGA 2RJMA 3M1BA 4FZ8H 1X5HA 4LSQH 5CSGA 5FF6A 3UX9B 1JZ5A 2DLHA 5E99H 2EYSB 3R4DA 1H8OA 2Z31C 5EO0A 3WNNA 5GRVL 1KIRA 3MCLL 3S98A 3ARGC 4OTXH 3D2UA 2OI9B 3ULSB 3LPGA 3H7BB 1OGTA 4N8VA 4UAOB 1JGDB 3LRGA 5DS8A 1VSCA 1QLRB 2CJUH 3OAZH 5JQ6H 4FQXA 2ERJB 4XPBH 3C09C 4JJ5B 4X7DC 5FECB 2VDML 1II4E 3KPQB 5I9QC 1M71B 4JFDD 3UZEA 4F9LC 2NXZB 3VFRB 4NKOA 4APQA 3WEXA 4K9EC 1OLLA 3WFHB 2EDHA 1SM3H 4RAVB 4W6WB 2DQEH 4QF1B 2VLJE 2P4AB 2IPUK 4PJ9D 2XTLA 1P7KA 3P9MB 4RDQG 3TO4B 3UTSB 1QFOA 5KBNC 1ED3A 5F6IC 4MDIB 1T0MA 4LCIH 5DUMH 3B83A 3ZTJG 3WNMA 2A6KA 4OZGA 5F21B 5DJZB 1IGFL 2BY0A 1ZGLA 4Y8AA 3QIBA 2D4FA 3MOBH 4OFVA 5C9KA 4NGHL 3ARDC 5BRZD 5CD3A 2R2CA 3TNMA 1FGVH 5EIIA 3FQWA 3WXVH 4HDIB 4N1EA 4Z7QE 1YEHL 4HK3J 4ZUTA 1NUFA 5AWNL 3B5HA 3N9GH 4WEBH 3KXFB 3T4YB 5LGJA 2YC1A 1GGCH 4FQQB 4PJIA 3EO1B 1FVDB 1JNHA 1EZVY 5B8CA 5FYJL 1E27B 4IOIA 5ITFA 3IFOB 1UB5A 4X5XB 3HLAB 4EBQH 2NY5H 5CEXA 5I8EB 2Y5TB 5FM5O 1KJVA 4D9RE 4R90L 1TZHA 4AQ1B 5DK2A 3MRIB 2DKMA 3QUYC 3L7FA 3OQ3B 2MCPL 3R8BB 4LHUG 2FZ3B 1AGEB 1FAIH 2B1HL 4ENEC 2P8LA 2VZVA 3WXWL 4DN3L 2VQ1B 1FN4A 5KVFL 3TH3T 3VH8A 3MBXH 4OFYD 4JDTL 1E4WH 5J1SC 1WIUA 3GKWL 4PRIE 2VSDA 4HLJA 3ARDD 4EI5A 4G5ZL 5DT1H 3W2DL 3WE6B 4PJ8B 4LAJH 4X99A 5DR5L 5IMKB 3RA7H 3BH9B 3CUPA 1UEYA 4TNWF 3VMPA 1E4JA 4GO6B 4N0FB 1OCWL 1Q9WA 4QCIB 1CF8H 5EU6D 4ODHL 4N0YL 2DI8A 4WFED 1FYTD 3T04D 4J3VA 4HK0A 2EE2A 1G7MA 3BPOC 4WY7L 4XAKD 3WXWH 1EZVX 4WFFD 1KB5H 4PG9B 1MJJA 3QO0B 2GITB 4PUBL 1I8IB 1YEDB 5F7DA 5GPRA 4MNQE 3UJIL 2EYRB 5DQJA 1J5OL 3P9LB 2HLAA 3CCHA 3FRUB 1NBVL 3QP3A 2JJSC 3T0WA 4JB9L 4X98B 5KZCB 4PJGA 1F2QA 3VA2C 2IG2H 3KPLA 4X7SL 3EJZC 5EBLB 4RIRB 1IILE 4YPJA 4QXTB 2E3VA 5D7LB 5EBWB 2ZZUT 1CICD 4IHOB 2YSSA 2BNRD 4O5LH 5CJ5A 3OV6A 4Q7DA 3SDAB 3W39B 2Y07H 2OTWA 1CTOA 1S7RB 4PJ7E 1IT9L 2GUOA 2XA8H 3O2DL 3QEGH 4KK8D 3TT3L 3WDIA 4RFNC 4OI7A 4L4JA 4V1DB 4YHNA 1MJ8H 2QTEA 3FB8A 1G1YA 3OSKA 3DHJA 3CNKA 4P3WA 3QHTC 4D9LH 3H0TB 4PJ9A 2AAVA 1N8ZB 1SBBA 5CKGA 3MXVH 4HH9B 2GK0A 1K85A 3IXTA 3GI8H 5HVGB 3HC0A 2ZCKH 3U4AA 2VXSH 3QIUD 3BEWB 4P4KD 1Z5LB 2GIYA 3MA7B 3KYKH 4YDKH 1HZHH 4NPYB 2V7HB 4JQVC 1JV5B 5FB8A 1YEJL 2OK0L 2R9HD 1ZMYA 2Q76B 5DJXB 1CXKA 2DN7A 3VWJD 4YX2H 1RUPL 3MV7A 4TUOB 1RZGA 5T1MB 3WIIL 3FZUC 4HBCH 1GH7A 3RVVC 2GUOB 5JPMB 3AU1A 4WUKH 4JFEE 4XPBL 2P1YA 5IK3A 1XGRA 2GTZA 3REWA 1BJ1H 2MKWA 1WTGT 2E7BA 5EZOL 1F90H 2YD9A 4FMKA 5LGKA 1TQBC 3OPZL 3U79A 1FNEA 2BVOB 3CXHK 4OUUA 5C8JB 2YD1A 4RMTA 3MCLH 3S35X 1MUJA 3ULUC 4LSRL 5KVGH 3D25A 1EEZB 3MNVB 4NQCB 4YDLC 3PGCB 1NAMA 3UPRA 3DUSB 1DQJB 2X9XA 3QNXB 2BERA 3OR6A 1V3JA 1UG9A 1IC5L 1CICB 3SE4C 2WUCH 5FO8B 5FKPB 4HKJA 4LVOB 1T7VA 4JAMA 4LBEB 5HI5D 5C9JA 4AYFA 1YY9C 3L3HA 1J0KA 4N8CH 1AJ7H 1P4IH 4HK0B 1SY6A 4KJYA 1XGPB 4FQ1H 4F15B 1FAIL 1HXMA 4JM4L 1BQLH 3T0DA 4P0DA 3NCCB 4PJFE 2BP3A 1JVKA 3FZUD 4HGWA 3V52H 4M5YH 5F9JA 5HDBE 1ED3B 4PJHB 3VXQA 4HS8L 5D6DC 3FKUS 1WWAX 1J88A 3LS4L 4UIKL 1CU4L 3S37X 3PHSA 4YBQC 5CEZH 2ITDB 3O11A 2K1MA 1CLYL 2HWZL 2GEEA 5BZWA 4G42A 4K8RH 2DQDL 1ONQB 4LRNL 4P5TB 4NNPL 4XNMB 1DFBL 4GKSB 4UDTA 3H9HB 3W9EB 1UB6B 3BZFA 4OGZA 3KPRD 2IPKB 5IHUL 3RDTB 1MY7A 4YO0B 2ICWB 1RIUL 2UVFA 4S0SD 1RUKL 2R56H 2WIIB 3NABL 5MENA 1VESA 3ISWA 3AMKA 4J8RB 4HULB 2ID5A 5GS0L 1IZJA 4ZUSB 4HXAL 4RRPG 4XWOC 1C1EH 3WD5L 5CCKL 4LCIL 2YMXH 3QFDB 1I3RB 3NGBC 4YHNB 3ZYZA 2AEIT 3QXVA 2IBZY 2RGSA 3WLBB 2VJXA 3HC0B 3P0YL 3S3PA 4G6AD 2HYMA 4LP5A 3TBYA 5IMMA 4PJ5D 2BMKB 2IGFL 4J4PD 2DBLH 1K2DB 4Z7WE 3WFEL 5L0QB 4I48A 1VADB 1MCEA 2FEDC 2NY0C 3A6CH 3AXLB 2HFEB 5DRNB 1JGUH 5DK0B 5D1ZA 5DJYB 5IESH 4PGZA 5HGGS 2QSCH 1GXEA 1VPOH 4ZFOL 1PG7L 1B0RA 4HV8B 4R4FL 5KVEL 1TMCB 4H1LG 3D3VD 4N0UE 4NQCD 2YR3A 1OAZH 4F7PB 1DLFL 4X7CC 5CJXC 5IW6B 5BS0B 3L5XH 1ZGLB 4WFHD 1CL7H 5DHXB 5ESAA 4NQVA 4HUNB 3H42H 4KDWA 4JDVA 3VWJB 5EBMB 4PV8A 3ULVE 2FEEI 1N6UA 3BFOA 5C0BE 3JBG7 3FB5A 1LGVA 3CH1A 4IIQA 4RMQA 1ZLVH 1RURH 4GW5A 4YPGB 1AKJB 4F58L 3WN5A 3K4DA 1NC2A 1QQDB 1A6ZB 3I75B 2A1WL 4E41B 1RZKL 5DWUH 4HFUH 2Q87A 3MV8B 1UM6H 1MFAH 4KI5E 1MHPL 1NGWB 2D0FA 3TA3B 1CGTA 3DHMA 1U8IB 2UWEB 4XNUL 1F00I 4K23H 4HV8A 1B0RB 1I7ZA 1YYLH 5DEFA 4Y4HB 4DKFL 1KULA 4NJ9L 1PDKA 4P5KB 3PWPE 4JPKH 1ORQB 4JRWA 4XAKE 1XF4B 3IGAB 2JCCF 1EX0A 5FHBL 4OT1L 5LXGH 3HS0B 1FYTE 2O5ZL 1FBIL 2I07B 1I7UB 1VGEL 1WZMA 4JDZB 1RURL 1IC5H 3RL2B 3GGWB 3VH8B 1DUZA 2CKBA 4U1JB 2AW2A 1H3PH 4ODTL 5H37H 3F58L 3FB5B 1KLFA 2B20A 4MNQD 4LPYA 1QSFA 3QWOA 2DM2A 1YPZE 4YC2B 3HCVA 3MLXL 3TZVD 3G5YB 2Y06H 5B21A 5CZVH 4RGND 1S9YB 2HG5B 3FQTA 4LEXL 2B2XL 5HHMD 5BZWB 4MHHI 2DLFL 3NAAH 3RTQC 1G7MB 3EJZD 1LE9B 5CEZD 2QHRL 4EN3C 1A7PH 3MO1A 2SEBA 4AMKH 1U93A 1CFNB 3DO7B 1YEKL 1DQLL 5J9PB 4KUZH 5L2KB 5TE7H 4MGXA 1AXTH 2AI0L 2ZSVA 1OL0A 1RHFA 3HNVH 1I7UA 4MDIA 5HI4C 3TT1H 5KW9L 4JRYE 4XNZC 4NCDA 1T03H 1NAKH 2A9NH 4MAYB 3HPJB 2XNAA 1VB9A 4PRHA 4L8SC 5IMMB 4ZNCD 2VXSL 1T21B 3TBWA 5T3XL 1BM3H 1ETZA 4HZAA 1RUMH 2QQNL 4Y5YC 4CN4A 4GXVH 3P9WB 3HCVB 4WENB 2D0HA 2FJHB 3QIBC 5GZOC 1AGDB 1PFCA 1W0WA 4Y2DB 5GS0H 4F37K 2ENSA 3BHBB 5EU5A 4ELMA 1OWWA 4IEFB 3UTTA 1F8TL 3ZZ1A 3WFCL 3DX8A 5MEOA 4PRPD 4I5BB 2ZUWA 4XVUD 2EE3A 3QXUA 4MAYC 1ADQL 2A2QT 4HKBA 3VDAA 4N0CD 4LGRB 4XNZB 3QCVH 1Q8MA 4BSWB 3IJSB 1AIFB 1VHPA 1HHKB 5J1TC 3LQAL 1JPGB 2EDYA 4JGJA 1EXUA 4R4NC 3TBTA 3BRDA 5IW6A 1OP3H 3ULUE 3TEUA 5HHME 1RUQL 3GMRA 3U82B 4RMRA 4H20H 3Q0HA 2D4DA 3QQ3B 3EZ8A 4EN3B 3ARFD 3RVTC 2RCSL 4M5ZL 4RGNC 4OQTL 2Q76A 2YN5A 2EKSB 1BOGA 3WO3B 3QXAA 2CD0A 4DGIL 4CVZB 1JHKL 3CMOH 3P4MA 4GW5B 4OFYA 2VIRA 4LU5H 4ZS7H 5M7QA 4OD3H 4YC2C 4PLNC 1KCVL 2X7LB 2LFGA 4QRTB 5EC2B 2VAAB 4UT9L 2VLJB 1I8LC 2B5IC 3EYOA 5L7XL 4NWUL 5CHNB 4G6ML 1UWEH 2DICA 4M6AA 2UZIL 1MSPA 3SOBL 1KEMH 4PRHD 1MRDH 3BQUB 1OAXL 5J89A 2EDNA 2Y06L 2A77H 3PWUB 5HYSA 2VN4A 32C2B 2I5YL 4MAYD 4XAWH 4ZAKC 4DUXA 3GBLA 4ZTPH 4U3CA 1FORL 5DVKA 4ZFFA 1X5YA 4EUPG 4RWYL 4OQTA 5ID1B 4LFHG 4XZUB 1FE8L 1KN4L 4NO2B 2YD2A 1MCPL 5I15H 1AH1A 2O93L 2JIXB 3MRBA 2BDNH 1FDLL 3WLBA 4KKCD 3ME0A 4DN3H 3P4NB 3KPRA 4DGYL 3QUZB 4MNQA 3PP3H 3VXMD 1CXIA 2DWDB 4M8VA 1OTSC 3TA3C 2H32A 1YC8A 4AL8H 2IH1B 4KJQD 4NC1C 1BFSA 4P57B 3OKEA 3TBVA 3CFEA 3U0PA 4P2QA 3WIIH 3GDBA 3CMOL 5C08B 2HJLB 2AJZA 2KH2B 3BKYL 2YKLH 2XACC 3SY0B 4OQTH 2NNAB 3F6IA 1NKOA 5F88B 1RZKH 1WFOA 2KL6A 5DWUL 3RZCB 1SY6L 2WLYA 4U31A 1QSEE 1VACA 2NLJB 3HR6A 3SKOB 4XNQB 1E28B 4CVXB 5D70H 5AAMA 1T2JA 3EO0A 3QYCA 4MD0A 3S35L 4CL7A 4HF5H 4Y5XB 1NBZB 2H8PA 3RAJH 3WHE1 5D96C 1DN2A 2X1WL 1EEYA 2NY0B 3I3EA 1CL7L 5CLWA 2XT1B 5D70L 3FT2B 1WBYB 1XR8A 1KLGA 2XV6B 4P3CH 1MREL 4APQD 2HLFD 3IU3B 4PP1D 1QYGH 2C3VB 3T4AB 2EZ0D 4DKEH 3F12B 4I3GA 4MNHB 3QFJE 1OW0A 2YPLA 5JLZB 2QQLH 4JN2B 4Y5XC 3QUXB 4FQHB 4WTWA 2I27N 2ADJA 2BNQD 3HMWH 5HDLA 4RGMB 3LEYH 3T2NH 1S8DA 1AXTL 2XQYG 1TFHA 4LK4A 5CD5C 4HGKC 4O00A 2CSPA 3U7YL 1W2KT 4Y7MA 3MYJA 5ISZA 4N5EC 3JXAA 7FABH 4G9FB 2ADFH 4Z6AT 1GOGA 1TITA 4WTZA 1G7JA 3RWGB 3OR6B 1GGBH 5D7LE 4HSQA 1X7QB 1C1EL 3BT2H 1HOCB 2BVQB 4P46A 4HDIA 2QHRH 2F5AL 3D0VA 1IGYB 1I9JL 1FORH 5JMRA 5CHNA 3BPNB 1F11B 3T0EB 4HLZG 1P6FA 5JORA 3GRWA 3W0WE 5GXBB 3QHZL 3IDMB 1VGEH 4R4BA 1VFMA 1OTSD 2ZKHL 3V5HB 2ARJB 4OD1H 2EDXA 4Q9QL 1NGXA 1WC7B 5I6XC 3CZJA 1WITA 1NMCC 1MWAB 4NJ9H 4OBSA 2LU4A 1FN4B 2ADIA 5EIQA 2B1AL 1U8LB 1UYWL 3ZDZF 4I2XB 2MCPH 4KK6C 1KLUA 5F8RC 2I25N 3MYZA 4I0CC 3RQ3A 1MHPH 4QWWD 3RBSA 1Q0XH 4N1CA 1CGXA 3GSNB 1JHTA 2PYEB 4G8EB 4I4WB 2Q8BL 4HUVA 3UJJL 5INDA 3SKUD 1A14H 4X6EB 2WUBH 2BSSA 1L0QA 4GUPA 4YDJA 3IRZA 4ZFZA 1DL7L 4ODUB 4ELMB 4OZHE 3O41A 3V6OC 2P5WB 4DKDC 2P24A 4HKXA 4NQDB 2BSED 4BZ1H 1AY1L 2MKLC 5DUBA 1I8IA 4KAQL 2HJLA 5IEHA 2VLRA 5FECA 1KXQE 5H2BB 4EJ1C 5C92A 2VKXA 5E08L 1EAPB 2NY3D 4G6JH 1R3JA 2CKNA 3F7YB 4JFDB 3E0GA 1U2CA 3CFIC 5KOVC 3DGCR 3DETC 3KLAA 2M26A 1K3IA 4GSDH 1AD9A 5B3JF 2VZUA 5D4QA 4PJGF 1RUML 2QQNH 3VCLB 5IEKA 1QKZH 2CQVA 2MFNA 4QT5A 1UH4A 3OX8B 1BWWA 2BNQB 2HTLC 5TJWK 1BIHA 5EZOH 5IBUG 1P84J 3FO2B 2JB5L 5BW7C 2DQJL 4HX1A 4QRPD 3EDJA 4UBDC 3MLPA 3EYSH 1EXUB 3MREB 1S7VA 4M6NH 1WWWX 3ZTJH 3QIBB 4PRPE 5FXCH 3TT1L 2Z93A 1Y0LB 4U1NB 2RAMA 1AGBB 2CPCA 4ZXBC 3W39A 2DQTH 2X89A 2VDNL 4UT6H 4BFIB 2NY6C 3WNLA 3HMXL 2GCYB 2ZG3A 2PTTA 2ICEA 2QADB 4FFWC 2G60L 2M2DA 1TPXB 2VE6A 2EDEA 4DOHE 1YMHA 5CEYA 5I1AA 3QEUB 4JCMA 4Z7WF 3MXVL 3QRGL 5E94A 4TUJA 1NLBH 1P6AB 3TC9A 1JV5A 3HC4L 2PYED 1HSBA 3MRRB 3VWKC 4YHML 4JFEA 1BAFL 3VD4A 4OZHF 3MRQA 4ONFH 2VLKD 4ZNEA 1U42A 1XCTA 4UTAH 4KRPB 1CDJA 1NAMH 2Y07L 1E6OL 3EOYG 4OT1H 4K3EL 4XBGA 3KYNB 2YK1L 4KZDH 1TVBB 2H6PB 2HWZH 1XF4A 1JYVA 1J9CT 4ZQKA 4N0UA 4D0BB 1CVRA 3BPOB 1ADQA 5EIIB 2G2RA 5L88L 2F9BT 4GG8A 1Q72H 2W07A 3D18A 4MSWB 1AI1H 4PJBE 5F9WC 3SO3C 5IHZB 3SJVD 3QFDA 3QPQC 5IFAL 1JRHI 5ISZE 2F54D 4JFQB 5JMOC 2XKNA 3MCKB 4L3CA 4N0YH 1WLHA 1J1OH 3FT2A 3H42L 1RJZB 1I3VA 2GK2A 5EFIA 1N3NA 3HE6B 3A6BH 4Y8DC 2HFEA 2WBKA 3DNKA 2A6KB 5BV7H 2DB8A 1NUGA 4LLAA 4PR5A 1FFPA 2HJFB 4K7PY 3JVGA 4PJGE 4RFOL 3HPLB 4FNLH 5E1AB 3I50H 3K74B 3MBXL 1CFVL 2P5EE 5TQ2H 3VGHA 5C3LD 3S37H 2E6PA 2FNBA 2NTSP 3MODH 2DQTL 2FGZA 3B4NA 3QDME 43CAA 3HNSL 3HA0A 4DGIH 3FB6B 4DEPC 3LKRA 1ACYH 4PJEE 4JFZL 4OZ4B 3S36X 5CMAA 4LLYA 1MAJA 5JIKA 2IWGA 4JHBA 3WIHA 5EBGA 3GUTA 3RVUC 4QF1A 3W9EA 1MVUB 2PR4L 2VTFA 4QRPE 3KJ6H 4L5FH 4M48L 1X3DA 4GRMB 4U7SA 4KKCC 2Y72A 2DRUA 5E8EA 3DXAD 1NFDA 5DRZB 3C9NA 4HS6B 4QY8A 5FHAL 2E9IA 4AG4H 1H3UA 2XXCB 1NSNH 4JGUA 5D1QD 3MCG1 4LF3B 4WO4B 4YPGA 3E3QE 2C1OB 2AXGA 5B38G 2C1PB 5D7IB 3REVB 4OZIF 5C07D 4LLUB 1IKNA 1ZKAA 2CK0H 4JPWH 5CILH 3KPMB 4WVRA 5EH1A 1ACZA 3RAJL 4MD5B 5DHVA 3WDJA 5BQ7B 3WSQL 5C0FB 2AV7A 3MRCA 5CEZE 5DURB 4XC3H 2VITA 1CLYH 2NXZC 4Y4HA 4JG1L 5I9QB 3LRHA 4PP1C 4OGAC 4OJFH 3C2AL 3G6DL 2R0KL 4JZJB 2OR9H 1MCSA 5GSVB 3DUUA 4OLZH 3RI5K 3MRRA 1DP0A 3ZL4L 1C8PA 1B90A 1VA9A 5IB4B 4FQLH 5DQ9B 4P5TC 3G08B 3QDMA 5GS0C 1CE1H 5T1KB 1INEH 2YPVL 4JFFA 4UT7H 1ZS8B 5I8EA 1ZA3A 2R15A 5K9OB 4L8SA 4S1RL 1YNTB 3MBED 1P4BH 1RAMA 1YN7B 4UMGA 4OF3A 4NC0B 3FQUA 2CJUL 3IJYA 3KPNA 5FM4A 1NGZB 3QAZC 1OVZA 2MTPA 5CWSB 3SDXF 1R3HA 3HB3C 4B41A 1S9YA 5DZOA 2JB6B 3FO9B 1PSKH 4PREA 2EZ0C 1EJOH 5DRWB 4XVUC 4G9FA 4QLRA 5F3HA 3QA3B 4ZS6D 3LKSB 5HHNB 1DQQB 4PGCA 4GKNA 2QKIB 2BJML 2NW2A 2X4NA 4H26B 4HS3B 4IMLA 5F9JB 3ESVF 2HP4A 1ZA6B 3RU8L 4BYHA 4M7KL 1R3IH 3U9UB 1AGCA 4L3ED 5CLTA 1BQHG 1XF3B 2DM3A 4G8IB 1KYOK 1A6AA 1NBYA 4GMSL 1I7RA 2ZUXA 2CUHA 2B1HH 2E6QA 5GIRA 2IH3B 2R0WH 1S78D 1TQBB 3KS0H 3CVHA 2QEJA 5I1KL 4OM1H 3KYKL 4YDKL 5BXFA 4ZUUA 5TDNA 3B9EA 2MPAH 1D7FA 5F7WC 5F96H 3LN4A 3V7AG 1I1YA 2ICCA 3BSZH 4FXKB 3LEXB 4JQXA 3QDMD 1HQRA 2LU7A 1LWRA 4H0IA 3M17B 4YHYB 1HNGA 2QV2A 4PFEA 1ZLSH 4PJXF 5DRNA 3FFCD 1OWRM 3FQTB 2WBWB 5AWNH 2X42A 4PRNA 6FABH 1FYHB 4YXLH 5IFJA 1YNKH 4XXDB 2D7MA 4KJWC 1CE6A 2AKRA 1FCGA 3O2DH 3OJDA 3QEGL 1QFWI 3QUKB 3FOLA 5H35B 1IM3A 4PGEB 5JO5A 2IQAB 2AJUL 4L3EE 4NHCH 4A6YB 5DK0A 4P23C 4XNYH 5IEKB 3OJMB 1EO5A 2LV4A 4PJXE 3MRDB 1RK1B 3L3KB 5FYLL 2EDRA 3C5JB 5D2NC 4X7SH 1MCWM 4HD9A 3H9HA 4I18A 5C6PB 4HXBL 5T3ZH 3GBML 1FLRH 4OB5H 4UDUA 5CIPH 5INCA 5ACMA 2IC2A 4IOIB 5KN5A 3C8HA 1S7QA 1KIQB 1T66C 1AP2B 1GIGL 2CMRL 1NCUA 1BF2A 2WWKT 5KW9H 1K8DA 1XGTA 4WNQA 2VWEE 3M8OL 5F1IB 5EBMA 4M62H 5IJVA 5I73C 4M6ML 5E8PA 3ULVC 2I60L 1T20A 4CKVX 3MODL 4JFPA 5AUMB 4NBXB 4ORGB 2ZOKA 2ESVE 4WW1A 2IEPA 1A02N 5EWIL 1FE8H 1KN4H 3I50L 1N7ML 4NQTA 5J3HC 3LN9A 1KPVA 1MCRA 3BP7B 4ODHH 1CLZL 5IUSA 1RMFH 4OJFL 5F3BA 2BSTA 2DIAA 3VXSD 5IHUH 4R97C 3WS6C 3RGVC 4P57A 3ARBC 4X99B 5IMKA 4QXWA 3ARFA 3C6LC 2DMCA 1ZHLA 4YDIH 4GBXB 1N6QL 1FV1A 4R2GB 1JWUB 5E4IA 3U7WL 3CVHH 5J11B 3D9AL 3CFCL 1CXEA 4M93C 3SDXB 4BFBD 3DX9B 4NT6A 2LTQC 1PJ9A 4YUEH 4G9FD 3F62A 1X4XA 4XB7A 1GZQA 1X5LA 1MJJB 2CO6B 5BRZB 1BVLB 3CFKA 4X9IA 1WWCA 1F42A 5TQ0H 3BMWA 4XPGL 1SYVA 2QL1A 5TE4L 3V0WL 1LEIB 5D7JA 2OL3H 1BQLL 3I85A 4MA7L 3U48A 1NEZA 4DFHA 3X11B 4X98A 4JVWA 4ZD3L 3BKML 1Z6JT 3BZ4A 2V5SA 5EUOB 4PJIB 5DJ0B 4ZYKA 1NEUA 5EBWA 1HINH 3IF1B 4KROD 3VG9B 4J4PA 4HUWA 1A9EB 1X4YA 4QOKB 3MLTB 3BYTA 2Y23A 1C7TA 3MGOA 3M1BB 4H25A 3VXNB 2HMIC 3WFCH 1W72H 4JCLA 3UJTH 5SX4H 5L2KD 3GBNL 2W60B 1T04B 5ICYB 1Q9WB 2ADJB 4E41E 4XCYB 4XRCA 3ARRA 5TDOB 3QRGH 3VXSE 4JREC 1KCRH 1RU9H 5KS9F 3C60C 1DLFH 1I7TB 3W0WB 5FCUL 2ZCHL 2VZ3A 2AJVH 5DFWH 3WJLC 7FABL 4GH7B 5HGAA 1LEIA 4GAGH 5HHPA 3TO4A 3FONB 2A9NL 4QHMA 4BZYA 1FQ9C 3BJ91 5HYJE 3UTQA 4JHAL 4Y5VC 2GSGA 3ZKMC 4KMQA 3CC5A 4IJ3B 3O0RL 2CDFB 3MJ8A 4GRLD 2IPUG 1UCBL 3QIUC 1YEKH 1ZE3C 2R23B 3S5LG 5J1AB 1WCQA 2QQLL 4PLJC 3Q3GA 1OT2A 4EZMA 5BVPH 5I17A 3DIFA 2PYEE 4LVNC 3EO0B 4O51A 4IM8A 5GS0D 5BOZG 4TTDC 5F71A 1YMMD 1GGIH 1S5HA 4L4TE 1J7VR 1HNFA 4NKMA 4EQ2A 4J12A 4YK4C 4EEEA 4Z76A 3SKNA 5KSVA 2Y9RT 5TDOA 4KTDL 2NY3C 5F9OH 4PLKC 4HXAH 4WGVB 1OPGL 2MWCA 3M07A 1ZA6A 3QEQE 1HILB 3GBNH 3GJFA 3QQNA 5ADOL 2FDBP 5D1XC 4P59H 5I1EL 2XFXB 2ZP0T 1I85C 3O3UN 4ZUVA 1F02I 4BH7B 1JWMA 1ZLWH 3WIHH 1DBJH 4YFEA 4LPTA 4U6XA 1NCWH 3FN3A 4HQQL 3SDAA 5L2KE 3PWUA 5HYSB 5DK2B 5T3XE 1S8DB 1YYML 2X4SA 5FYKU 4AM0A 3IAQA 5L6YH 1NLBL 3F6LA 5CBAA 4XZUA 3BKYH 3BP4A 2WAHA 2JIXA 1DR9A 3H9SE 3MRMA 4HEPG 1JF5A 5DO2D 5GSRB 4D0CA 2G9HA 4F57L 5EO1B 4I3SH 5HI4D 3MLRH 3JV4A 1WZ1L 2HFTA 4PD4J 32C2A 1J5OH 4KWUA 4XHQA 2DTSA 5E8DH 3S36L 4ZOAA 4XI5D 2A1WH 1KOAA 1IAOB 5IB4A 3P0VL 5EULV 3BE1H 2X44D 1RHHA 4OI8A 1UXSA 2OTUB 4Q58C 4AENB 1RZJL 3TO2B 5ILTH 1XGUA 4I0PC 2L0DA 1ZA3B 5JIIA 1I8MA 3BH8A 1M7IB 5DS8B 3D87B 1TVHA 1MQ8A 1RJCA 4Z7VB 3TIDA 1UJ3B 4NP4L 5D1XD 4ZO8A 5CBEA 3RZCA 1U58B 4Z78B 5C0GB 1SEBA 4CAGA 3L5XL 1M71A 4GAYB 3QNYB 3NFNB 3PXJA 4LCUB 3VFTB 1MCQA 1GCFA 3JV5A 3FFCA 1F13A 5C08D 4PJIF 3TBYB 1VERA 3TLRA 4M6OL 1Z3GL 2ADGB 4JRXB 3RNQA 3BT2L 3T77A 5HDQH 4RDQF 1DVFD 1ZXQA 3NPSC 1W8OA 3MRFA 1U8OB 4KAQH 4FXLA 4D9QD 5E4EB 4MB3A 4PRDA 2YD5A 2F54B 5IIEB 1I7RB 4I0PA 2DBLL 5DJZA 4P46D 4BKLB 4X4YB 3JTSB 1W72A 1RULL 4U6YA 1CLOH 1GC1C 2H32H 2O61B 3AREA 5HPMB 1A14L 3IVKB 5D5MF 3C5SB 3SEPA 1RUQH 5D7KD 1MAKA 3H7BA 4HGMA 3ELAT 4N8VB 4M8QA 2MHAA 5LBSL 4Q2ZA 1MRCL 5FOBB 1EHAA 2F58L 3WCYA 3PABB 5BV7C 1LNUB 2G5RA 3IAGC 5BV7B 3AFLA 4OV5A 4E9LA 5J06A 1D5BA 4MA3A 4NOBA 1N59A 2CDEB 3BGFB 1J12A 2FECL 4TTGA 4QHNA 3LY6A 1CD0A 4LVEA 4P3CL 4NQXA 3UTTE 1OAUH 2E7HA 3TJHD 4UIMB 1BPVA 1YYMH 5I0ZA 3V4PL 4JFFE 1PY9A 3MJ7A 5IB2A 3S35H 2J5LC 1MJ8L 1IGFH 3ES6A 4M9PA 4TVPL 3T0AA 1P5UA 2CLZA 3JVGC 3BN9C 3AREC 2UV3A 1P7HL 1F6AA 1P69B 1YPZF 2Y6SC 2CR3A 4WHCA 4HT1L 3CX2A 3PWPD 1T03L 4E5XB 1ZANL 1OGTB 3OKYA 4KK8C 2HKFL 2Q6WB 4F7CB 3O3AB 1KXTB 5CGYD 2I60H 1NC2D 3U0TB 4MWFA 2AI0H 4NZUH 1ZTXH 5L2JA 2VUYA 1UJ3C 4NKIH 4FQXB 2G9HB 4RMWA 5ETUB 4G9DA 1QP1A 1S7WB 3MLTA 3V8CA 1JNLL 3QG7H 4U1LA 5KJRH 5I1LB 4L1HA 3UJIH 1S5IH 5F9AC 2IAMB 4XCNB 4HXBH 2VL5B 5D1QC 1GYAA 5I1JL 2B2XH 3ZHLA 3KLDA 1L7TH 1YPZA 3L95B 2CLVA 3JV6B 2QBWA 4WY7H 4YZFF 4J7RA 4F7TB 5KANI 1S7SA 1KN2H 5JXEA 2MOVA 3ULVH 4HAGA 2Q20A 4Z5RA 2H6PA 1K4CA 5D2NA 3UTTD 1MRFL 5C0ND 3S88L 4K71C 1J10A 3GSVB 1NFKA 1FYTA 1F3DJ 5EZIH 1E6JH 4OZFG 4PRPA 2WP3O 5E9DA 2HJKB 3ULVD 4F7MA 3HE7B 4KKLC 3K2UL 1Z9OA 2R2EA 4GBXA 2A0LC 4BQ6A 3SDAD 5E2WH 1JHKH 2YPVH 3QDHA 4K2UH 2MPAL 3MRFB 5F96L 3IDUA 4PJ5A 4OM1L 1FVCA 4PRDB 4LSSH 4ODBD 1D9KD 2FD6H 3RNQB 4LRIA 1HE7A 4LLWB 1ZWIB 4XNXL 2NY3B 4QXGL 3VFVB 3IRPX 4YK4B 4JZNB 1CFTA 2PN5A 2VISB 3Q48A 4X4XB 1CD8A 1B0WA 4QT5B 4QNPF 2QQKL 5TFSH 4HUWB 2KQNA 2P44B 1KTRL 1NJ9B 2ICES 4JG0L 2UUDK 4N9GA 4QRUA 5D2LF 4OZHA 3MXWL 3QCTL 1NBQA 3IXAB 4PJAE 1HI6B 1DEEB 2J6EA 5ISZD 3MREA 4RBPH 1NGPL 4NGHH 4LRIC 1B9ZA 3MR9A 2BJMH 2QSQA 5GGQL 2A6DB 5HHXL 2W9DL 3FTGB 4KMTL 2ZPKL 4OGAD 3KYOA 2FO4A 1UACH 2DWEB 3FFDB 3C6SA 5FO9A 1KLGB 5E03A 1I3RA 1PYWA 2AK4A 5DQJB 4DAGH 3MJ9H 4DWHA 4Z18A 4NDMA 1N0XH 4KI5C 5C09B 2R29H 3LMJL 3L7EB 5ADPH 1F6AB 1EAPA 5A1AA 3WFEH 2A6JB 4XVTL 3O9WC 5I1HL 1MUJB 1VFAA 4JPVL 3K8KA 3EHBC 3S97C 3P0YH 5IQ7L 4LPUA 4PRHE 5CSBA 5LCVH 1Z2KA 3T3MF 5TH2A 2HT2D 5DK3A 2GJ6B 4HHAA 3Q1SL 1EO8L 1AXSA 2CMRH 4HBQA 3EYQD 3FQRB 4NRZB 4L4VA 4X6FA 4XVTH 5HHOB 1XR9A 1HHGB 4LOUC 3X12B 4XI5C 2APXA 4WWKA 3MOQA 1CF8L 4PG2A 1IJ9A 1V7NH 3KPSE 1NKRA 4LEXH 3PL6B 1KT2B 2FBJL 4KKBD 3TBSB 4OTXL 1MFEH 3O9WA 3QFJD 4ZDHA 4LKCA 1FNFA 4G5ZH 4XPHH 5E5RB 1AO7D 2OXGA 1UACL 5C0JB 5A40E 4DVRH 4BA8A 1DFBH 1FLTX 3T2PA 5A43C 1UQSB 4KMTH 4EIGB 3U2SA 5HPOA 3B8YA 2ZG2A 3JWDC 1OGAD 2XWTB 4IRZH 3RIAK 3UBXG 2OZ4H 3DI3B 3DRTB 2X4PB 4RAHA 4NO2A 5C0EB 2DQFB 2D0GA 5EZJB 4YXLL 1G7LB 4K7FB 1KTLA 5LXGL 1LVEA 5IB5A 1TNNA 3EIFA 5I1CH 3TN0B 2J8OA 1IL1B 3MV01 2MQ0A 3QZWB 4PJ8A 3ARBB 3RGVB 1NAMB 3O6KH 5T3XH 2CXGA 3LKSA 1SJXA 3OTTA 5DJ6B 1B6UA 5DD6B 3ARDA 1UM6L 2EDWA 5IVXE 3C5JA 4TSCH 4KI1A 2BVOA 2ORBH 4LHUD 2A83B 2DQUL 5C0JA 3UYRL 3GHBH 1E6OH 3AM8A 4GBXD 4RQQA 4YQXL 1T22A 3D39D 3ZKND 1X6LA 5CD5D 4U0QB 4WFEE 2FO1A 3TNNA 5T5FH 5K59E 2MNUA 2FYYA 1A6TB 5IK3B 1U36A 2MQ3A 5DEGA 5JUEH 3CCHB 3DYOA 1BGXL 4GG6B 3L5HA 2DYPA 4KMLB 1DQTA 1MF2H 1E4KA 2OLDA 4LSUH 1YEFH 3CU7A 5C1MB 1YECH 3CDYA 3I6GB 5AZEH 3B2UD 1EUUA 4HIEA 4YDVA 1UEMA 1VEOA 2J2ZA 1JK8B 3PGDB 3D0LB 4IS6B 5E70A 3DVNA 4NO0B 4IMKC 3BUYA 1S7RA 3IXTB 2AK4D 2ZOKB 5LGHL 1I3GH 4OCWH 3DUHA 3ULSA 1UZ6F 5KJRL 3LSOA 5GS2D 1WAAF 2VXVH 4R96A 3REVA 3SDXA 4FXGB 2A9MH 3B9KD 3ZDXF 2KDGA 5GRZA 4X0KA 1SJHB 1A9BA 1U3HC 3QPQD 2YPKB 5EU6A 5ESVB 5ANME 1GL4B 1IGCH 2R4RH 3WFBL 5KSAD 1WZLA 5L2JB 4NM8L 2HKFH 4U6HA 3RVVD 4I9WE 4HFUL 2C7UB 1WBZA 1IFHL 4NQEA 1H8NA 1EDQA 3P4NA 4Q97A 3W5NA 1I85A 3DYMA 3H9ZA 3X11A 4PGEA 3ARUA 2X9YA 3KXFD 2PW1B 4NM4L 1CL7I 3BUYB 2AP2A 4PJCB 4M93B 2FGWH 2X6MA 2NZ9C 3EYQC 3NIFE 3LV3A 3SGEI 4XMKL 3HE7A 1HHGA 4NFBA 4Y4FB 3EFFA 5MERA 4J3WA 5IV2A 3CFJA 4OI9A 4JRYB 4POZC 1EPFA 3LQAC 1T20B 4OLUH 4N0RA 4YIQB 3GMLA 2QR0A 5FFLA 1ITBB 3KPNB 4G8FA 3QISA 3WFDH 3QDGE 2VLJA 3DETD 4WUUE 4LPCA 5F89B 5EU4B 3D3VE 4JB9H 4LLWA 2HH0L 3ECBA 3SPVB 4ERSL 2JF1A 1B4JL 3GSOA 5K93A 3HMXH 4CVZA 5TE6H 3CVIL 4MQSB 1TVHB 3UXFA 5LWYH 5T1DH 3JUYA 1BVZA 3V79C 5DD0L 3CH8A 5GIRB 4RFEA 2EYSA 1Z9MA 1RULH 4V1DA 1JWUA 4N8CL 2B7DT 4OLVH 1K8IB 3VFVA 5KSBF 1A7NL 4FRWA 3T0BA 2K3TA 2Z9TA 2VH5L 3BWUC 4L4TB 2XOTA 2NY1D 1HHHA 4M1DH 4X6CF 5F97E 1QEWB 4KZEH 2XTJC 1JPSH 5C0RL 3VXPA 1MCFA 3MLYL 2VZ1A 2IBGA 2ZUQC 5EU7C 5E5UB 3O3DB 5ID1A 5CUSH 5LQBH 5D7JB 2BFVH 3B5TA 4XCCL 1IM9B 1V3MA 5I8CB 2VLRD 5T5FL 1ZVYA 3L3JB 3ZE0F 4NP4H 3PP3K 1HDMB 2PETA 1AQKH 5E9DB 5EOCH 1YEDA 1ETZB 5F1KC 1QFHA 3HAEB 1A47A 2XKUA 4YHYC 1UVQA 4P2RB 1J05B 4NQSA 2NY5L 1BX2B 2HN7A 2V2TB 1U8QA 3V6FB 2Q3AA 1UH2A 3PWJA 3LEYL 1LE5A 3GSNL 2C4FT 2XZCH 4C83A 1WFNA 4P4RB 4HG4K 15C8L 5I1CL 3MLRL 3IFNH 1A7QH 3BKCH 3N50A 2ZCKL 4YHOH 4IBLT 1OQXA 1LDPL 1FGNL 3MRGB 4GKNB 5HHOA 2GT9B 2QADD 4OD1L 1SJEB 2NYYC 1KNOA 1IAOA 3PQYB 3H8NA 2WUCL 4EN3D 5KSUB 2BOBB 1D5XA 4N1HB 3D1MC 4ZOBA 2D7QA 5EUKA 2Q6WA 3RX8A 3ARVA 1BAFH 3FTGA 2R8SL 3LEXA 3TPUA 4XBPA 2VABA 5ADOH 1V7NL 1R0AH 4KK9D 4APQC 1DDHB 3LDBB 1I9JH 4ZSOA 1N2RA 4HUUA 4Y2DA 5E2TL 5GS1C 1JZ4A 1JI1A 4GAJH 3BGAA 1QHOA 2Z8WC 4X8XA 4NM8H 3DUUB 4M6MH 3C6SB 4AIZA 3SGKC 1WUNT 4R26L 2FX8H 3L6FA 1S5HB 2F54E 3KAAA 2OQJA 1VCAA 1A6AB 4YHZL 5H35A 1T1YB 2XFXA 4WUKL 5ITBL 2VLRB 4M1CC 4IRSD 1TENA 1ZV5A 3L9RA 4G8FB 3VU2A 1C5CH 5T3ZD 2R29L 4OSUH 3HR5B 5D93B 1AGFB 3SBWA 1QQDA 1DCLA 3O4LE 3QUYA 4E41A 2NTFA 4RGNE 5I1AB 3X3FL 3U1SL 2HVKB 1MCPH 4EUPB 4KUCD 4DKEL 3V9FA 4XBPB 3S8WA 5E1AA 3LEVH 2P5ED 2KKQA 4PRIB 3FMGL 1JNNH 3CMGA 1CWVA 4MZ2A 2E7CA 3KPOB 1G84A 1QEWA 1PLGH 4HIJA 4J3TA 4Z95H 4APQB 1JJUA 4MVBC 4FA8A 2UZIH 5FKPA 2OXHA 1S7VB 2XN9D 3OXRA 5GS3A 1CK0L 3IAPA 3IVKA 4ELKB 1T1YA 5LKNA 4R7DA 5FGRA 4QOKA 1LNUA 2DQUH 3OKKB 3QXAB 2B4CL 3SQOH 5DLMH 5JA8B 4Z7VA 1XGQB 5HHVL 4M1CD 1FNEB 1DBBL 2W60A 2BMKA 1N4XH 5HDOA 1WQVT 4R7NA 1QSFE 1RUAH 3CX5K 2AXFA 2EKJA 2HN7B 4JFDA 4O2FB 1QTYT 2V2WA 2VUOA 2AV1B 3K2UH 2VZSA 4F9PC 3AXLA 2DQHH 5I0DA 4NZDA 4DEPB 1X5GA 1IEHA 1KELL 3ILPA 1T89C 4LFHD 1KJ2B 1U91B 4KY1L 2EH7L 2NY6B 1DQML 4CU6A 3WXVL 2IQ9L 2XWJB 3V95A 3CFCH 4BUHA 1S7WA 4YE4L 3SDXE 1C7SA 3MNWA 2XRAL 1FNGB 1P7QD 3MOBL 2BRRL 3MV7D 3GIZH 3VFOA 2FYYB 1XZ0B 1I1FA 3HG1E 4JDVB 4OCNC 1QUNA 5IGXL 1EIBA 1BWMA 3C8KA 5DYOB 5EORL 1OTTC 1QZ1A 4GXVL 5DUML 4XNMA 5BRZA 2CIKA 4MQ7A 4CADA 4ZAKD 1N5YH 5JO5B 1IAIH 3MX0A 1JWMB 4H5SA 3HE6C 4N90E 3VJ6B 1JGLH 4KK6D 5F9DC 2NXYC 2ICWA 3F7PC 3RNKA 4UT9H 5L7XH 3LKRB 2DQEL 2DTML 1A6UH 2ARJA 5EUOE 1MCKA 2GY7B 3GSQA 4J4PC 4KTEH 4S1QL 3Q1SH 4OF8A 4WU5A 3PWVB 5CBAB 2OJEA 3MV9D 4KK9C 3EYFB 4XP5L 5SWZE 2VXUL 5F9WB 3RKDD 2A0LD 3AB0C 4JFEB 1UA6H 4MB4A 3EJYD 3EOBB 4HT1H 3LKQB 4CBPA 1QLEH 3HZVB 3BO8A 4NQDD 3X13A 3T2NL 4H20L 5B8CC 5FYJH 3WHXB 5FYLH 4JG1H 3G5YA 3IT8D 3CPLB 3C60A 1WBZB 1C5BH 1F3DH 1IARB 4HEME 1EJ6A 3O4LA 4YGVB 4XHJC 3RP1A 2BNQE 3SDCC 3EDFA 4UV4H 3DUSA 3Q5OA 2JCCB 5BOPA 5I1IL 1DLHA 2VZOA 5DI8A 3T0EE 5DDHB 3F58H 1IC1A 3MGOB 1EBAA 2BNRE 1EFXB 3I2CL 1D5ZB 5IQ9A 1DQMH 4X6EA 5H2BA 4LBEA 5C9JB 4M61B 4YHLH 3FO1B 3VWKB 4GAYA 4BQ8A 2X4UA 1GOHA 4KJWD 2YWZA 4PV9B 3K7UA 5DC0A 2F58H 2P5WA 3DLQR 3HAEH 3VXRB 4X4XA 2J6EH 3ECBB 3BSZL 3QJFB 4XNUH 1SY6H 3OX8A 3HKFA 4ZPTB 3CK0H 4PRID 4YFLF 3T0EC 1T2QH 4Z9KB 4PJHA 1NCDL 3AY4A 4NUGH 4MDJB 4FQHA 1UKQA 4WGWB 3V5HA 1F97A 2WZPD 4K94L 4PJHE 2CDGA 4LLDA 4G6KL 1JGEB 1KBGL 3I02B 1I1RA 2KPNA 4MA8L 4S10A 5F7UA 4ONGL 5D7SH 1ZGLM 2HT2C 4Y16D 1U6AH 2NY1C 1YN6B 2F19L 3V4UH 1N5AA 3L5WA 4PY7A 4Z7NF 4ZTOH 1T1WA 1G9EA 1GPOH 1RZFL 3T1FB 3WIFB 4ISVB 3L3KA 4FZEH 1NBZA 1YMHB 4RGMC 5GRVK 5IT2H 2NZ9D 4U1IA 1XF5A 1M05B 2RFXB 4ONHA 2EYTA 1MWAA 4DVBA 5IVZB 3T0EA 3U4BH 2APVA 1VACB 2NLJA 1RZJH 5ILTL 1QPXA 1AIFA 1AXSB 1LP9B 1YMME 1BLNB 1ZWIA 5D6DA 3GSNA 1NJ9A 5KTEL 1J11A 3ULUL 5EBLA 5D96B 1A1MA 1L9MA 2AXGB 5INCB 2X89D 2DD8H 1QR4A 1KJ2H 3MBEA 3LN5A 1S3KH 2YMXL 3HZYA 5GGTH 1WCBA 1T1WB 2YOCA 4HWUA 2NW3B 3R1GL 1IQDB 5FO9B 3ZL4H 2YK1H 5L6YL 4KZDL 5IW1A 5DVNA 3EOTL 4PJGB 3S6CA 1W0VA 4HC1H 5E6YA 5JHDA 3WIHL 4P2QE 5K9JL 1RY7B 1T5WB 3LQAH 2WQ8A 1NFDE 4YHIA 1OP5H 3IKCB 4OD2B 1IC4L 3QDMB 4EI5B 1BECA 4LSPL 1AR2A 3R0MA 2DI7A 3RX7A 5F9OL 1XGRB 2E27H 3ZTNL 3FL7A 3HE7D 4K8RC 1HH9A 4JPIB 4LPWA 1VFAB 1LO4H 1MQKH 4MJ2A 1F8TH 5E24E 3GMRB 4OM0L 1EMTL 1QVOA 5DJXA 3CSYB 4J3OC 2VDPL 2WWMC 3ESUF 3IFLL 4JFOB 4ZUUB 2M1KA 3BEVB 3LKOB 4WUUA 1MWAH 1H3XA 3SE8L 1P4LA 4YJZL 3VCLA 3WE6A 5IW3A 2H3NB 4KRMB 1BOGB 1KLUB 2E9JA 1DE4B 3DJ9A 1RJZA 1V7ML 1DJSA 4WNQB 4GW1B 3FO1A 4RWHA 1FNSL 2VLME 4LSTL 5JHDB 3MRKA 3EOAA 1IC7L 1SBSL 4ODSL 4PJBB 3UTTB 2EDKA 2EE6A 5MHSD 5ANMB 4OCLC 2D2OA 3VWKD 4R0LA 3IKKA 5IFHL 5JXAH 4NCC2 4QRRE 3VXUE 1V7MH 1KENH 1VEPA 1INDH 4PLJD 4HPOL 3RIFF 3FN0H 5HDQL 3GUTB 4OCYL 4LDEB 4LKXA 3ROOA 2Z92A 3V5DA 3DBXA 3MRNB 3NCYP 3UEZA 2XZAL 2IF7A 4PJCE 3C08L 5I8OH 3MLXH 3HN3A 3NTCL 4Y1AE 5MEND 3OPZH 3QUZA 1VFUA 1AR1D 3A6BL 1G6RA 3V0VB 5F6HJ 3V0AC 1ZT4B 2FL5A 4LL9A 4BZ1L 3EUUA 3IU3A 4Z0BL 1VENA 1JZ8A 12E8H 5CZXD 3U0WH 3ZT5A 4Y4FD 3WYRA 2I24N 3DXAB 3CLFL 3D3VB 5HVHB 3V7AE 1EGJL 2R39A 2D7NA 3BAEL 1H3VA 5C0AA 5DGQA 5DJ2B 4W70A 4Y2DC 5GS1A 2V6HA 1OSPL 3MA9L 1MJ7L 2X70A 3MCKA 4MVBD 5IVOA 3PL6D 1NFIA 2GKIA 3BVNB 4G9DB 3UO1H 1JPFA 1QO3A 5GRJL 4L8SB 3L1OL 5AZ2H 1HHIB 2QQQA 2V17H 4KRNA 1U91A 5E7BA 5IVNA 1PG7X 3SY0A 2Z93B 4MXVE 3PP4L 3QHZH 3A0OA 2EIZB 4HUXA 3QQ3A 1T66D 5IB1B 1XGYL 2R1XB 5IVXA 4OIBA 3WL9A 3IDNA 4JR9H 4NO3B 4WV1A 5I2IA 4YHMH 1G7PA 4IRSB 4R3SB 3VE0B 4JZNA 1PY4A 2P8PB 2PW2B 4S2SB 5ACZB 1MPAL 4GW4A 5FAAA 2VC2H 4LEOA 4PBVC 2O5XH 1BFVL 3GSUB 1ULVA 4P23D 5FA4A 1GHFH 3MACH 4H88H 2DQIL 1OAZL 1TDQA 3BQUC 3VDCA 3CXDH 4LASH 1E27A 1RJYA 1MCJA 4PS4H 3NN8B 1J8KA 4EVNB 3ZYJA 4P2RE 4YXKH 1JP5A 4P9HL 1Q94A 3DIFB 4JKPH 3VWJA 4MNGA 2R1YA 5T5NF 4OB5L 3LKPA 43CAB 2IAMC 1IGJA 4M4RA 4BSJA 1RZ8A 4PJXA 4NO0D 2DJUA 2H8PB 3QBTB 3QQ9D 2GSGB 4WEUD 4J23A 1YUHB 3FFCB 3G5XA 5IBLD 1OSZB 4K9EL 4RMVA 5BVJB 3BPLB 3O6ML 4NUJB 3OMZA 4JO1H 4C55A 2YUWA 4PV8B 2NXYD 4ZOEA 3B5GA 3SDCD 5FA4B 2R1WA 1X5AA 5E8EB 3DPBA 4H1LH 4NNYB 1KIRB 5CFHA 4JFYA 4MJ6B 3ZE0E 4OF0A 4F7PA 2V2TA 3OBAA 2FX7L 3L3GB 4Y19E 1T83A 3IDIA 2AXHA 1OHQA 2ADGA 3GMMA 1ZSDB 4JRXA 2W1NA 1FZKB 4BK4A 4G6FD 3INUL 2IMNA 2IH1A 4UUJB 5HHQA 1JGVL 4M03A 4MAUH 1BZQK 3WNPA 5DRWA 4I13B 4Q2ZB 3VGAB 2DQDH 4D94A 4OZIB 1CDYA 4Y5YB 3U46B 4EBQL 2R0WL 4UIKH 4EUPH 2NW2B 2X4NB 4P9ML 3MLVH 4QGTA 3HUJF 4DGVH 4NUJA 2BSSB 2VDKL 2YD4A 4M7LH 5GZNC 3G6JA 1BIIA 3HPLA 4XPFL 2YN3A 5TQ0L 1NGWA 4IS6A 2ICWJ 5CINH 1VEMA 5FA3B 3W0WA 2PO6D 4M7KH 3NACL 3D3VA 1CYGA 5AD0A 4WCYL 2OZ4L 1XF2B 4ORZC 1UWXK 3NZ8A 3MRJB 2KBGA 5E4EC 2ZKHH 3SGJA 1IBGH 5GGSA 3KYNA 3GGWA 4YZFE 5SWQA 5B39B 1UC6A 2DIBA 5HYJA 4M43H 2GJZB 4XWOD 1GGUA 7CGTA 5SV4A 3LIZL 4I9WD 1RMFL 4GRWB 4KGLA 4HIIB 1BQHB 2OYPA 4PJ7A 5KSAB 4S2SA 2BC4A 2EO1A 1R3JB 2PXYD 4LARL 4WO4A 4RA3A 1D9KC 5D2LA 1QR1B 2IQ9H 3CGTA 4S1RH 4R4ND 5IVXB 1MFCH 4OD3L 5FA3A 1KUMA 1Y0LA 3GB7B 4U1NA 2Y6SD 3B6SA 1VKXB 1KIUA 2Z0BA 4YHKH 4NQDA 3MNZB 5BMFH 3HTLX 5ANMA 3LV3B 3T77B 1RFDH 5C6TH 4L3CB 4M5ZH 1F4YH 3DV4B 5EPMB 2P49B 4PG2C 4BUGA 3N06B 4NKMB 1ZT7A 4OLZL 4U3HA 1ND0B 2YD3A 4KROC 3NIGF 5T3ZL 3C2AH 2Z35B 5GHWH 3C5ZA 1HOCA 2BVQA 4P46B 5SX4I 5FIEA 2W9EH 1IGJB 1J0YA 1T6VN 1BBJB 1E4XL 1WFUA 3ULUF 2AEPH 5FYKL 3OXSB 2FLBT 4LLVA 5IOPB 4BELD 3MRLB 3OGCB 3TBSA 4XPTH 1U8LA 1YEHH 5IHLB 2X09A 4OLXH 5CSZB 5IWLA 1CK0H 2WINA 4KI5D 1SMOA 4O9HH 1MAMH 4JG0H 1QSED 4O2EB 4WW1B 4ZO6A 3TESA 3SDYH 1WBXA 4RBPK 1G6RH 4XPAH 2AJ3A 2YD8A 1J1XL 4OLXL 5CGMA 2XA8L 3TT3H 4I2XA 5DHYA 1CICC 3H3PH 3CSYA 3O6FC 5F3BB 3C6LD 4XNQA 1Z9SA 4XB8A 4BH8B 5BRZE 2YEZA 4YDLB 2H3NA 1HXYB 1SM3L 3KLSA 4JAMB 1QBLL 3CFJB 3BEVA 3LKOA 1R24B 3QEQB 1GVIA 2GJ6E 3NVQA 1C5CL 3PE9A 3PV7A 1MHEA 2DAVA 3Q6FB 2WQRA 4W4OC 1GRWA 1HXMB 5B39G 5IWLC 5JQHC 4D8PB 4HIHA 3PGCA 4Y0GA 5TQ2L 1A7PL 1JUFA 3AVEA 3S9DB 5EU7E 3EYUH 5FUOH 3P4MB 4NQDE 1FFNA 2PF6A 1U8PB 3RWDA 4FQXD 2FHFA 1GAFL 2P7TA 4H88L 1MCWW 1AQDA 1TJGL 3WO4C 3JTTA 4Q6IB 4U6HB 4Y5VB 3UMTA 1UWGL 3MGAA 3UTZB 3V6FA 5D2LE 4HKZA 1A4KB 1QRKA 3MRNA 3IFPB 4FHBD 4JFDE 5DTFB 3VRJB 5HXMA 5IJKC 4JM2C 4M7ZB 5IB1A 5BZDB 3RDTC 1J0HA 1H3PL 4ODTH 4FTVB 1G6RB 3DMMA 1QRND 4QO1A 1BD2D 3JSSA 3V5KB 2DLGA 2PCPA 4L29B 4YNYA 3L3OA 4NHUA 5EUOF 2DDQL 4PRNB 1E4WL 3QG7L 3SKNB 1AKJA 3BDXA 1NCCL 3X13B 5JW3H 5BW7A 2V5TA 3VXRE 1IGYA 5EN2A 1TJIL 3VRIA 3KLHD 4JFXB 1YYLL 4TUOA 1MNUH 5JR1H 4RMSA 2MMXA 1FL6A 5GGRA 4POYA 1L6XA 3NCEB 4JVUA 3BD4A 4RAUA 3ZKMD 4PG9A 3IDMA 4AEEA 2H2PC 1WIOA 1B0GB 2HT4D 5E8PB 4Y5XA 1U92A 2A6IA 1Y18A 4DGVL 4ZPTA 1DUYB 1FL5A 4QHLA 5AEAA 3OAYK 4EDXB 1YJDL 2NX5A 1S7QB 4GG6E 4X9HA 2AK4E 5FYJE 35C8H 4WU5B 5C2UB 4N9OB 1KJVB 3UAJD 2OR7A 1I1CA 3OB0K 3TIEB 1KGCE 4N8VG 3WUWB 4WWID 4CRPA 2IALB 5J11C 5CS7A 1CBVL 5KS9B 2XQBH 3FJTA 1NPUA 2GSIB 3BN9D 2COQA 3S7GA 1JNHB 3Q2CA 5B8CB 2OTWB 4UTBL 5D72L 3D48R 3L7EA 4JN1H 4LLVB 3H9SA 5IOPA 4A2MA 3QXDB 5GJTL 4KXZI 1T0NA 5FDWA 4GG6F 2VDQH 5C7XL 3EDEA 3A6CL 4I8DA 2ILLA 4PJDE 4FQIH 4WHYH 3QEQD 1I9IL 4MXVF 3F12A 4U2YA 1D5IH 1H9VA 3GM8A 3GSRA 2YD7A 4PJ8D 2WIMA 5DDHA 4JZJA 2MQCA 4FN0A 4FTVD 3GK8L 5IP4A 1CS6A 5DHYB 2H2SD 3H0TA 5HJ3B 4HJGB 3ARZA 2ENYA 2HFGL 4FQIL 4KU1A 5T1DL 4KUZL 4Y4KC 1IQWL 1KCSH 1R24A 3QEQA 3O2WH 1ROWA 2NR6D 3CVIH 4UQ2B 4BZ2L 4ZXBA 1BVLA 1OAKH 3CFKB 5E8OB 5DHVB 1FH5H 4PB9L 5BQ7A 2V2WB 4JN1L 2GSIA 3LQZA 3QDJA 4OM0H 3P4OA 3QJFA 3PGFH 2BOCA 4O58L 2PNDA 4PR5B 4L4VB 4X6FB 4XXDA 3W82A 1AQDB 3ARXA 3SGKA 2O5XL 3KPLB 1Z0NA 4TVPE 1SMAA 2OSLB 2IAMD 5KSBA 2ZOLB 1JBJA 2R2EB 4JR9L 4XMLH 8FABB 3FT4A 3MNZA 3PHQB 1LO3L 3RPKA 3B9KC 1G7HB 1IGIH 3OKNA 4XMPL 3G6AA 1FBIH 4X8JA 3ARQA 1YQ2A 3SDAC 4QY8B 2VLMD 1QR1A 3K80A 3VFGL 4LAQL 3TJEL 1XEDA 3VFOB 5J13B 2NY2D 1KTKE 3N85L 3QUMB 4AIOA 3I3BA 4K3JH 3NZHH 3NMEA 3H9YA 2DIJA 2YHGA 3HZMA 25C8L 1KB5B 4L9LB 4K7PX 3QO1A 1XIWB 2HT3D 1EGJH 1AGDA 1W0WB 3QUXA 4FFZH 3CLFH 4F3FA 1M7XA 4UNUA 1MJUL 2W91A 4RSVA 1FRGH 5JNYB 1HYSC 1JF1A 1LD9B 1J0IA 1RZGB 5B4MD 3HFMH 5T1MA 4PRAB 5E2UL 4PTUB 1D5XB 3S4SB 2ED7A 1BZ7B 4JFFB 5C2BH 4Z7OF 3ARWA 4KTDH 2VLKA 1RK0A 1GGBL 2P5EA 4JFED 4U1SB 3SGDI 2QHLA 5D93C 1DBAH 3AUVA 1MF2L 1R5VB 2VLLB 1CDHA 1WICA 4LLQB 5A16B 1G9NC 2IPKA 4TRPH 4D0CB 3VXTA 2GCYA 3FN0L 4U1JA 4TSAL 2F74A 3TZVA 3BH9A 2XIDA 4GKSA 1ZT4A 5HI5C 4HMDA 4AZ8A 4URTB 2F5BH 5EIVA 3MFFB 2YPLE 3QWQB 4EXKA 4HCRH 4QOKD 2IGFH 4P9HC 3GJEB 3OKOA 3EYOB 3FO0H 5ERWB 2EXWC 2XN9A 1LD9A 3LDBC 3SGEH 3VXMA 4AEIH 5GGSY 4LLYB 4ACPA 2E6JA 3IFPA 3ZE1F 3NH7L 2FL5B 2Q7YA 1S9VA 1X5IA 2XZQH 4LQFL 5C0DA 4XPAL 4I0PD 1I1FB 3DVGB 3PQYE 4FQJL 5JXED 3IFLH 2VKWA 4LLMA 5ESQB 1CIDA 2NY7H 5TPWH 1IAII 1RD6A 4LLQA 1FO0B 4NQSB 3NCBB 3BWAB 1A2YA 1IGML 3EGSA 5HVWA 1AXIB 3WN5C 3GEWB 4LOUD 4KJPC 5LGJB 2XNAB 4PRHB 3QJHB 3ARPA 3QDJD 5J0BA 1MVUA 1FFQA 1OM3H 3HI5H 1MFEL 3TP4A 4DCQA 1M6OB 4Y16C 5E2VL 5HTSA 1AO7B 4F7EA 4KI5F 4NBZB 4HC1L 3FT4B 4HS8H 1FVDA 1DEEA 4M7LT 4ZMAT 3O81A 3QQ9C 2NR6C 1IVLA 1OF2B 5CZXC 3AS1A 5JOFB 5BMFL 3PWVA 4JY4A 3WN5B 5C0FA 2J88L 4P5TA 4BQCA 1YEGL 2JCCE 3VE0A 1OARH 1PVHA 1AE6H 4XP6H 1BD2E 2ARJQ 1P4IL 4GW4B 1FDLH 1T0PB 1WWBX 4MCYA 5I8KL 4Z8FL 2NXZD 2VQ1A 4F37F 4LIQL 1PX4A 4ZO7A 2QR0B 3U9PH 5ICZB 1RZ8B 3RWIA 1KNOB 3PQYA 1MLBA 2I5YH 4XAWL 3D5OF 4KKLD 3NBNA 3VG0L 4I3RH 4F3FB 3RA7L 3ARGB 5D5MA 5EORH 3QO1B 1KEML 3V7MA 1JF1B 2HTLD 5D6CA 4UV7L 4EOWL 1KCUL 1LEGB 1NANH 4L3EB 5IMOA 1Q9OA 2XRAH 1L7IH 4NZRL 4WHDA 2JJVA 4PJXB 1DQDL 3I6KB 2FCBA 2ADFL 4U1MB 4RNRA 4XBGB 4I48B 3KDMA 4WW2F 3DMMB 1CZ8L 3S4SA 1IEAA 4KVNH 4OZIE 3CU1A 2APTA 4JFOA 3GMMB 3DSFL 1C5DA 4PY8I 2VDKH 5DJYA 3RWEA 1MEXH 1WT5C 4IOFC 3JWOL 5IVXF 3PNWB 1H15B 3NCJL 3T2OA 4JFFD 5MI0B 5TF0A 1B88A 4CVUA 2A73B 4KC3B 3GMQA 5FO7A 4RIRA 4U1KA 3N9GL 4WEBL 3LZFH 1UM4L 2F74B 4PJBA 2P8PA 2PW2A 5ACZA 3G6JE 3PWJB 1ZSDA 1PQZB 2Z31D 4JO3L 4EDXA 1K9TA 1MREH 1QBMH 2XKNB 4HWBA 3BP5A 1U8IA 1FGVL 4JRXD 1DE4A 1Y18B 4NN5B 1G6RL 5C0CE 5T1LB 1G9MC 1XIWC 4MJID 3VGBA 3FQNA 1X7QA 3SN6N 1IQDA 1A6ZA 3I75A 1G7QB 2VDLH 5C0AD 4R6UA 5DD3L 1Q0YH 1XAUA 3LHPH 4LCYB 5JHLL 1S7UB 1WIPA 1QLRA 2I9TB 1PKQB 5KSUA 4X9FA 4TPRL 4XWGL 4O5LL 4QYOB 1LHZA 2BNUA 3NIFF 3MLWH 1PAMA 2XTJE 3THMH 3B9KB 4NNXA 2N7BA 3VXOB 5HYFA 4DZ8A 3IGAA 1A3RL 2W65A 3HNTH 1FZOB 1JN6A 1T0NB 4HWBL 4ODWB 4R8WL 3E6HA 1P9MA 3TGXA 3IDIB 1IM3B 5JPMA 4NKIL 1A9EA 5F93C 4ZXBB 3ROLA 4CNIA 3HZYB 4I4WA 4PB0L 1CFSA 2VN7A 1DVFA 3N1PC 4ZSOB 1JTTA 4MNGE 3VRLF 2VR9A 1BFVH 3QEUA 3QDGB 1ND0A 2VL4A 1ZEAH 4N5UA 4LSVL 4KRPD 5ACLA 1CDIA 1RJLA 2DKUA 5A2FA 5JHLH 2EDLA 4Y4KB 4HKJB 3OKMA 2R23A 5DD3H 5J1AA 1HDMA 5GZOD 3WO4B 3AROA 1JIBA 3G6JF 2IBBA 4P4KA 3FOMB 1OLZA 3UTQB 5JDJA 4JPKL 3X3GL 4LVHB 1G0YR 1QBML 1NLDH 4ZODA 1U92B 5ENWB 2ZSWA 5T1LD 3RPIB 2EH8H 2VLLA 3L3DB 2R4SH 1S9XA 2LU3A 3E2HC 3O8XA 5IROC 1XF3A 5BCAA 4KQ4L 2C4FU 1TZHB 1DVFB 1MRCH 5E56A 1JYXA 2P8MB 2NY2C 4AH2A 3DROA 5D9SA 2ITDA 5CAYB 3PJSA 3U30B 1BEYL 4DJMA 1Q9KB 3EDDA 1WK0A 2VDRL 4Q9RL 4B50A 2JIXD 4EKXA 3CFEB 3U0PB 3DGGB 3OR7B 1NCAL 1XFPA 1KJMB 3F7VB 5JDSB 1R6VA 5CILL 4IOFD 4CVWA 3IF1A 1MLCB 4L8DB 1DQDH 5EO1A 5B38B 5HDBF 5FKAA 5D2LB 5I6XB 1Z3GH 2YEZB 1Q38A 5EG6C 2AJXL 4YO0A 4G7VH 5ELIA 1U41A 4Z95L 5INDB 1QPPA 1INQA 1LO0H 1UH3A 3HG1D 2NNAA 4FQPA 4MDJA 5E2JA 4HIEB 5F7DB 4JO1L 1KENL 3O41B 2BVUA 4WUUB 4KROB 4OGYL 1B3JA 4PJCA 4KHXH 1CFTB 4FFYH 3GSXA 1PZ5A 4LIQH 3FRUA 4ETQA 4DTGH 3MRLA 3OGCA 1A22B 4U1HA 2FSEB 4DUWA 3MPCA 3ZHDA 5J6GA 3WUZA 4GLRH 4OCRL 1AE6L 1ZHLB 2VRAA 4GW1A 4JFYB 4H5SB 1FV1B 3KYMA 3AY4C 3EDKA 1BZ9A 3TH4T 3L5WB 4PY7B 1DQLH 5KVDH 2CDGB 3KPRB 1IEBB 1ORSA 4M7ZC 5SWZD 5TE6L 4X5LA 1D9KB 4J1UB 2AJYL 4X0KB 1TJHL 4FXKA 5KSAC 5I17B 1HQRB 4WU7A 4R26H 2DLFH 3NAAL 4M1GL 3MGTB 3RY6C 1KV3A 4Q6IC 1MQKL 4P2QB 2JELL 5DI8B 3VXQB 4RISH 4NZTL 4ZO9A 4RAUB 2VR4A 3QRFM 4CN1A 1KCLA 4JANB 1P7QA 4X7FC 2R0ZH 1NCWL 4HQQH 5IHBA 5GJSL 2XYCA 2GYSA 4LIQE 3TV3H 4L4VD 1FRGL 1RIVH 3D0LA 3TBVB 2DBJA 4YAQB 3DX6A 2VERN 2GJ6A 4HHAB 1HH6A 2Z4QA 1H5BA 4MD4A 4HFWA 4OIIL 2V17L 5DMGC 3FB6A 2B0SL 5GRJH 2G5BB 2A6JA 1P5VA 1FC2D 2CKBH 4UINH 3O6FB 3DO3A 4WI5A 3FFCE 5GGSB 1IKFL 2H2PD 2WWMD 1MCLA 3RZCC 3AU1B 4GRLC 3R06A 1A7OH 15C8H 3O6LL 3MTRA 1NCTA 4CGTA 3P2TA 5DYOA 2AK1H 4HJJH 3G9VA 1PEZA 3DV6B 2BY3A 3IU4L 3AS2A 4UTAL 4YXHL 1R3HB 5JOFA 1TXKA 3LRSB 5KG9B 4GJTB 5CD3B 2V2XA 4XMLL 3TVMD 1YNLL 1OAYL 4U3XA 3B3IB 2VZTA 1DTUA 4LCYA 3I02A 4KPHL 3MQIA 4TVSa 3ARGA 2J1KA 4YBHA 1LK3L 3QUZC 4PJBF 5JW5B 4L4VE 2Q8AL 1BOYA 2O5YH 2VQUA 1KCRL 2YC1B 5J56B 1OAQL 1L0XA 3A67H 3GNML 1KC5H 2H41A 3OHXA 4RMUA 3BPLC 2X2YA 5D1QB 2WLZA 5HY9B 1BX2A 3L3GA 3RWCA 5GS2H 4NRXB 4LNRB 3HLAA 1BBDL 5DQDL 1U3JA 5D7LD 1KEGH 1KB9J 3UTPD 1F2XK 4P5MA 3JV6A 1MCNA 2ZUTA 4YXHH 4QRRD 3VXUD 1KBGH 3MRIA 3KNBB 5I76A 4JO2L 5DFVC 2H1PH 2AK1L 4HJJL 3VD7A 5C0DB 4RZCA 5EO0B 3IDXH 3C87A 3OKKA 5C0CA 2ZNWA 3MRBB 4QTIL 4WI4A 3ZE2E 1W72B 1I9IH 1BREA 4EI6B 4C56A 1HKLL 3MLUL 3MRPA 3O4OC 4IMKA 5HI3D 3QPXL 3O4LB 4MX7A 4PREB 4YGVA 1SVZA 5DA4A 4RGNB 3SCMB 3FFDA 3QQ4B 2DWEA 1T4KB 3U6RB 2FWOA 4JFHD 2EO9A 4L4TA 1L0YA 2AV1A 5F7LB 4MMXC 3G5VA 1MAML 3IETB 4Y88A 4KXZH 3FQUB 2Z8RA 4QNPE 3MRGA 3IJYB 4ALAL 4MXWH 3UTSA 1LK2A 1XIWD 1YEIL 3KJ4B 3O2VH 2L4OA 2CIIA 4KFZC 4R9HA 2WANA 1IC4H 3BGFC 4NC2B 4G9FE 5CKAA 3MUHL 3TFKD 3OG6B 4LLDB 4LKCB 2DMBA 1T5XA 1PEWA 1M7IA 1C5BL 4OKDA 3GMOB 4RISL 2F53B 4LCCC 1CU4H 3TNMB 4KTYA 3RGHA 4PTUA 5DMKB 4HPYH 5D8JH 4IIQC 1XR9B 1N6VA 2XY2A 3QDJB 2EDFA 3QNYA 3VJ6A 3GHEL 5JA9A 1RFDL 5C6TL 4M5YL 1U3ZA 5EA0L 4G3YH