1U3HD

Crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
189
structure length
189
Chain Sequence
b'GDSERHFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLERTRAELDTVCRYNYEETEVPTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor alpha-chain
molecule tags Immune system
source organism Mus musculus
publication title Structure of an autoimmune T cell receptor complexed with class II peptide-MHC: insights into MHC bias and antigen specificity
pubmed doi rcsb
total genus 41
structure length 189
sequence length 189
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u3hD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1u3hD01
6FABH 2A1WH 3S4SB 4YXLL 1I7RB 4OCSH 1MJJB 5GZOC 3V7MA 4LHUG 2YD7A 4WWKA 1CGTA 1UJ3B 4OB5L 2DJ4A 3DECA 3OJDB 1F13A 4CDGC 2HKHL 3UJJH 3BKCL 4PLJC 3BE1L 3WLWD 3BEVA 2Y7QA 3H9SE 4RMUA 4Y88A 4Q6YA 4XAKE 2I9TA 1M05B 2C1OA 5CSZA 5F7EL 2IBGA 3WNKA 1KCSL 4X6EA 15C8H 3FFDA 3QXDA 3CFCH 1HSBB 2CIKA 3F6LA 1KOAA 5DJ2A 1NGZB 4YXHH 5D7SL 5GGTH 3CFEA 4NQSB 2R0LH 1EV2E 5GGTL 1QZ1A 3SDXF 3C6LC 1XIWD 2QSVA 1JPFA 2CR3A 2KH2B 1X5ZA 5KZCD 4DGIL 3FO1B 3U48A 1X4XA 4ZUTB 3NN8B 5SWZD 1HXMA 2VLJE 4UILL 1TJGL 4BUHA 3MFFB 3IJHA 4ZO7A 4F57H 1BIHA 1XGTA 2R23B 2VXTL 1MCCA 3UAJD 3DPBA 1A2YB 2VLKB 4P2CG 5IR1A 4ZO9A 4UZGA 2J6EA 5DJAA 5FYJD 3KHOA 4DN4L 5CBEA 3MGOB 4WI2A 3BQUB 4C56E 1U3YA 4U1KA 4KJPC 4EIGB 1I8KA 1P84J 2V7NA 4AZ8A 1ZHBA 4NBYB 1KCLA 4RGMB 1A1MA 1IQWH 1OM3L 3HI5H 4XH2A 1BP3B 2Y5EA 1G0XA 2PW2B 2A9NH 3QDJA 5CFHA 1J1PL 3RUGE 2HT2D 2VDLL 1FE8L 3DNKA 5IW3A 4KC3B 1ZANL 2VDMH 1OW0C 2OMBA 3FT4A 3L7FA 4JGMA 5F6IB 4J4PC 1N5YL 1NGWB 3C60B 2IALA 3LH2H 4NYLA 3OR7A 3V7AG 4RA3A 1FNGB 3VRJB 3QFJD 3TJEL 1JWSB 2YN5A 4DW2H 3DVNA 3T0EA 1T1YB 3BN9C 4ZTPH 5FA3A 1A14L 3IFLH 3B9EA 3ZDXF 1VADA 2J1KA 3IKCA 2CGRH 4JB9L 5EZJB 3RTQC 1QSEE 3NCYP 1JN6B 4L9LC 2BNQD 4PD4J 3MX0A 1OARH 4M7ZB 1Z9MA 2D7PA 1BQLH 4ERSL 1QQDB 3RWHB 4XCFL 5TDPA 4GUPA 3RWGA 3BMVA 1IGCL 1QFOA 2XG4A 2YMXL 3U0TB 4MVBC 4XWGL 4XBPB 3IKCB 4OLZH 3DX8A 4Z5RB 4W6XB 1AXTH 3HNVH 4XTRD 3S5LB 2R2BA 4KZDL 1LMKA 1ZA6A 2AABL 4R4NC 1QTYT 2VAAA 3W2DL 4BJLA 3DVGB 3F7PC 1VGKB 4XNUH 2ZG1A 4YDJB 4XMPL 5SX4I 1GGCH 3MUJA 1UJ3A 2E7LA 5GS0H 2M1KA 5DMYA 3BYYA 1P6FA 3Q6FB 1ZA6B 1S7UB 3VFGH 4GXUM 4K71B 2UUDH 5HGBB 4G6FD 5I76B 4OD3H 3EGSA 1VFAA 4HUXB 5DHVB 3QEGL 1IFHH 2CK0L 5DT1H 2HJLB 3MV9A 2R2EB 4APQD 3BT2L 3PIQB 5D6CB 4TVSa 3EZ8A 1BJMA 1OM3H 4NIKB 3MV8D 3KPNA 2V17L 4U1SA 1CLOL 1F58H 4BQ6A 3BEWB 2YRPA 4DKEH 3NH7H 5J3HC 4NQVA 4XNXH 5IR1B 3MA9H 4GRMA 4J4PD 4O51A 4JRXB 1LGVA 3HC0B 5E8DL 2XTJB 4FZEH 3S3PA 2B4CH 1AD0A 3BRDA 3K1DA 1G7QA 5F7UA 1JWSA 2BNQB 1IBGL 1QEWA 1T0NB 2VERN 3BH8B 3IRPX 3OJMB 3MREA 4NKMA 3QUZC 3N1MC 2JB5L 4M62L 1DBJH 2EE9A 3CVHH 3SKNB 4E41A 2KL6A 4CN6A 3QHTC 4Y89A 5I1LB 2H26B 1CE6A 4TRPH 5C0EA 1DBAH 5BMFH 3BIKA 1WUNT 4Y4HB 1A02N 4XCCH 3NZHL 1UB5B 3PP3H 4H5SB 4GG6E 1GGUA 1OTUC 2P48B 3O6FC 4I8DA 4WFGE 5DMGD 4PRIB 4O4YH 1DE4B 1DVFD 3RZCC 2BNQA 3MREB 3ZE2E 1JNNH 1NAMA 2V2XB 4JFXB 1DBKL 2CXGA 1UYWH 1Z0MA 3OKEA 4MDIB 3CFCL 3PXJA 3NA4A 3CXHJ 4HKBA 4KPHL 2BFVH 4NKQB 2NY3B 4LSQL 3KWWB 4UT7H 1PGRB 4ZXBC 1DJSA 1R5VA 3HE6A 1I7ZB 5E8NA 1W0VB 4EDXB 1SHMA 4JPVL 2P5WE 1TQCB 3P2TA 3RWJA 3BE1H 3G9VA 5JO5B 3GSVB 4HWZB 1QA9A 3KXFA 5A2LH 1CL7L 5T5NF 1DDHB 3L3JA 3MR9A 1IZJA 4N9OB 1VEPA 4ZTOL 2O26U 3GMLB 3EBAA 3B2VH 4E41E 3GK8H 2CXKA 4PJGB 4RIRB 5F9AC 5FYKL 4EQ2A 5ABDE 2VH5L 1JK8A 1NDGA 1NFDE 5I18H 3UYRL 1ZHLA 3IDGA 1S7UA 4MQSB 3S35H 4O2CB 1CICB 5C08E 3VWJC 1DQTA 2JJTC 4ZUWB 5CJXA 3QBTB 3W11D 4OM0H 5GRYA 1TMCB 2VR9A 3DLQR 5D8JL 1I7ZA 3BJ91 1UWXH 4P5TC 3AY4A 2VABA 5FGCE 4WI5A 5I6XC 1KIUA 1QG3A 3MV01 5ITBL 5TDOA 4F9LC 3NAAH 1ORQA 3RY6C 5F3BA 2CLZB 3QIBA 4FOMA 4QTIH 4YHNB 5HVFB 3BRGC 4JG1L 3GMNB 3KYMB 4PJIB 1EJOH 1WICA 1RK0B 1LEGB 1MHPL 5F9OL 3P4OA 1REIA 2UY7A 4OLWL 2JB5H 4M62H 1N6VA 4TUKL 2X89A 1EXUB 5K9KA 4JFFA 3RX5A 3OB8A 3CXDH 1CFBA 4PP1C 2AKRB 3DGGB 4M4RA 2PN5A 4LCIH 3VWKD 3WXVH 3WUWB 2J88H 2LFGA 4NM4L 5DS8A 2Y06L 4UIKL 1YYMH 1P4IH 3RAJL 4F80A 1Q72H 2CUMA 1I85A 3ME0A 4RFOH 5GGVY 5DSCB 4V1DE 1AGCB 4HXBH 3GJFB 1DBKH 3D3VA 4WWKD 3TNMA 2E7BA 3HMWH 2HRPL 5ICZB 3QUML 3KLAB 1V7ML 4WI9A 3HG1D 1NLBL 2KKQA 1KB5H 3F12A 5KS9F 3MLWH 5JORB 1F00I 1H15A 1R3IH 1O0VA 1S5HB 3OMZA 1KUMA 2A38A 4P4KA 5EFIB 4NKIH 1FGNH 1G7MA 2W9DL 2OJEB 4L1HA 4EDWH 4K23H 3RNKA 1SEQH 5EU7E 4ODWA 3D69B 5BW7A 5JXEA 2P42B 3K8MA 2X4RA 4G6JH 4OIAA 4JFXA 2NY2D 4X6CB 4WTXA 5TDNA 5IMLA 1RUQL 4Z0XA 5I1AB 2CKNA 2F8OA 4G8GE 4UUJA 1J7VR 4X6BA 3BGFC 5EBLA 4IHOA 5AD0A 3T77A 2DWEB 4L4JA 4RX4A 2IEPA 1NEUA 5EU5B 4KI5F 5I15L 43C9A 2VZ3A 4PY8J 1BFVH 1CDJA 4CMHB 2HN7A 2DLFL 5H37H 3AMLA 3D48R 3UBXI 2EIDA 4LNRA 2DYPD 5MI0C 4YHYB 1F4HA 2PCPA 2ZPKL 3TC9A 4R2GB 4M6OL 4E5XB 3GNMH 3PDDA 4QGTA 2A83B 3KPSD 5C9KA 4JDTL 5TF1H 1UEYA 3WO3B 3KXFD 3BPCB 4BK5A 4GAJL 2P8PA 3UDWC 3IU3B 3TN0B 5DZOA 3ZHLA 1AJ7L 4ONGH 4I3SH 4HMCA 5I1EH 5BZWB 3LS4H 3ZSTA 3LQAH 3MJ9L 1U6AH 3ULUE 4FP8H 4LGRB 2WUBL 2OTUB 5D1ZC 2D03H 4U4BA 1OGAE 2MCG1 4BQ9A 2XN9B 3B9DA 5KW9L 1OPGH 4LSUL 1BEYH 4P48A 2X41A 4AMKH 1YPZA 1YEHL 2Q1EA 4M3KB 3UPCA 3JWOC 4JO3H 5HPOA 4LF3B 3GBNL 2JE8A 3BZDA 5KAQF 2Y25A 2Q6WA 1GPOL 3LKRA 4HGWA 5HI4D 4IS6B 2OBGA 2APBA 3KJ6H 1B0GB 1IGFL 3IETA 3PXHA 3IJYA 4YHPA 2AJSH 1MCDA 5FA4A 4MNGA 4NO5B 4ZDHA 3ARBC 4PJCF 3ARFB 1LNUA 3ULVH 3DOSA 4WFFE 3C5ZA 2JKXA 3JTTA 5T1MA 1PKQE 3MRBA 1NFIA 3U1SL 3V0AC 1S9VB 3IFPA 3TIDA 3O2VH 2FX9H 1W0YT 3JVGA 3GEWB 4MA1C 3UTZB 3VWJA 1ITCA 1EEYB 1JV5A 5IB5B 2B8OT 2CLVA 3HZYA 2GJ6B 5H2BA 4EVNB 3V8OA 2Z93B 4C55A 4XPFL 1G0DA 1BFTA 2FECL 2R0KH 3QUXB 4RNRA 3B9VA 1ZVSB 3IDYB 3LN4B 5ETUB 2CKBH 2JCCE 5C08A 1BGXL 2ZOLA 4P2RD 5GS0D 1ULVA 3EFDH 4GRWH 3O8XD 1JPGA 2E9IA 15C8L 4D8PB 1G9NC 5ICYB 5INCA 3DMMA 2WNGA 2O5XL 3GMMA 4Z7WE 5D5MB 4OCLC 4MCZA 4PGJA 5EOQL 3MV9D 2HKFL 1RZKL 3KHQA 1JUFA 3GM0A 3L5XL 5CIPH 1F4YL 4GAJH 1AR1C 1CG9B 2HMIC 4LBEA 4WENB 1EIBA 3GKZA 4ODWB 1GGIL 2OZ4H 1T03L 4AJ0A 3VRLE 4HXAH 5EC1B 2EDTA 4LSRL 3WFBH 3G6DL 5GSRA 4I2XE 4L4TA 1S7XB 1TZHB 3F12B 5GZOD 2M26A 4Y2DC 4XGZA 2VLMD 1UGNA 5C9JA 3QH3B 4JM2A 1WITA 5F3BB 5CUSH 4QXUL 4MWFB 1S7WB 2I07A 4JDZB 1OL0A 4XNZB 5IIEA 1R5WA 4RMTA 1RUQH 3REWA 2R2HB 1RJZB 3DHJA 4XVJL 3EUUA 2NY7L 1U8MB 1FDLL 1OCWL 3BWUC 1CG9A 1P6AB 5CKGA 1V8HA 2YSSA 4LRNH 4ZUTA 5EWIL 4XNMA 2GJ6D 1T0PB 1KB5B 3C8KA 1JK8B 1YN7B 2XNAA 4M7LL 2FIKA 1R5WB 3TZVC 5BRZE 4NQUA 3QDGA 1X5FA 2E7MA 1M7XA 2DLGA 5CJ5A 1ZHLB 2NQCA 3DROB 3DYOA 5C9JB 3C60D 1W0WA 3AU1A 4HUWB 1UADC 1X7QB 5F7YC 1FBIH 1JF1A 5IESH 3VDBA 4PRPD 4DEPB 3QUMH 5ESVB 5L2JA 1N64L 4LHUA 2X4QB 4PIRF 3CX5K 2A0LC 2H2PD 2DLIA 3DVIA 4R4BA 2DQJL 2WUCL 1I1FA 3BVNB 3NPSB 3CGTA 5GGRB 1ZHKB 5LXGH 4XZUB 3VGGA 5HTSA 4UTAL 1FO0A 1QACA 4UINH 3SGKC 2FCBA 4EN3D 4NNPL 3D39B 5KTEL 4GW4A 1OT2A 1U2HA 2R9HC 3FQNA 2ADIB 1ZLVK 5HHMD 1PQZA 2CIIA 3UBXG 2P43B 2Y7QB 3IDJA 2Y06H 1A3LH 1PYWB 5IVXA 4U6XA 3ULVC 1MI5A 4R4ND 1YUHB 4RMQA 1MCPL 3DRQB 1QFUL 1BEYL 4YNYB 4F3FB 4MJ2A 4QYOB 2NTSP 2W0FA 4ZUSA 1Q9KB 3FB5B 1HYSD 3RY4A 2JB6B 1U6AL 1UG9A 3MYZA 1GCFA 3BKMH 1ZT1B 3QUYD 4OCRH 2AW2A 2ADGB 4EKXA 3CIQA 3OHXB 5FA4B 4YJZL 3TZVB 3V0VA 2PYEB 3SY0B 2BJMH 4KDWA 4JKPH 5IEKA 3B9KD 1F3JA 1DQDH 1MCEA 1QEWB 4J1UA 1CD1A 1YEKL 2WWKT 1KIPA 4D94A 2ED7A 2WINB 3HE7A 3MRDA 5AAWA 3QFDB 4GQ9H 2VDPH 5HSFA 2H8PB 3QUMA 3QDMD 5TGBA 5BCAA 2DDQH 3BP4A 4NGHL 5KN5A 4F7MB 4EUPH 3NPSC 2DLFH 3IDMA 1TJIH 5DMJB 3LEVL 4MNQB 2VO5A 3DXAB 4OZFG 4K2UH 5ACZA 3PJSB 4XCEB 1BFOA 4HX1A 2WBJD 3DBXB 3VJ6A 3QP3A 5I1DB 4F2MB 2Q3ZA 1KELL 1MCWM 4YUEL 2QQQA 4APQB 3C9NB 1RULH 1GXEA 1UXWB 1G7LB 4PJ5A 1EO8L 4FQ2H 3EJZC 3L7EB 1ZLWH 5B39B 1DQQA 3RPIA 1SMOA 5HGBA 1ZLSL 3RUGB 2YPLE 4HK3N 5JZ7D 3G6AB 2BFVL 2BK8A 5D2NE 3FRUA 4QCIB 4GG6A 3FHAA 4OZIE 1OF2B 1NEZA 3X3GL 3FCTA 2HLAB 5JIHA 3WO4C 4L8SA 5ITFA 4P3DA 3BAEL 4B53A 2CRZA 4PJAE 4LHUD 3VFPB 5JDSA 1D5XA 4AENB 4DUWA 1FL5B 3ES6B 5T3ZD 1ACYH 1NGYA 5JXEC 4Y4HD 4DTGH 4P5TD 3BPCA 5B8CC 1MF2L 3RWHA 2HJLA 3I02B 4ESKA 4JFEA 3MLSL 4EOWH 4S2SA 4OGXH 2DBJA 4DVBB 5F1IB 4YK4B 3G6JA 4K94H 3VXUA 4BSWA 1P7KB 1U0QA 3FB6B 4J6RH 4HK3J 2V5TA 2HTLD 4JZOB 4E5XA 1CF8H 5AWNH 3CSBA 2BY0A 4WEBL 1D5XB 5I75C 2V7HB 4QHMB 12E8L 1C16A 5I8OH 1MCNA 4MD4B 2E6JA 3GKWH 1JGDB 3D3VB 3BWAA 3DX7B 4QHUA 4BZYA 4YK4C 4OCMC 5ANMA 1MRCH 2EYRB 4L4VB 3QIUC 3STBA 3S5LA 5T1LA 4H26A 3C5ZC 1FLRH 1HQ4A 4MA7H 1CDIA 5ESAA 1XR8B 3QEGH 5T1KD 4OV6F 1VCAA 3KR3L 4HC1A 3MRQA 3FTGB 1U93A 3BZFB 4BELD 4NZJA 1XGUB 5I66B 2EICA 3TT1H 4IOIB 1NUFA 4QTHB 3SE9H 4AQOA 3BKML 3PL6B 1GGCL 1WCBA 1U8NB 2R0WH 2Y9RT 1H9VA 1P69B 3OXSB 4NQED 4LAJH 1U8QB 3L3HA 1ORSA 3TYGL 4LVHC 1P4BH 5CIPA 3MCLH 3AY4C 2C3HA 1ZGLP 5ISZD 5L2KE 4N8CL 3VD5A 2VQUA 5DJCA 5C3TA 1QLEL 2ZSWB 1FVCA 1DUYA 1A6TA 1DQJB 1MPAH 4BSVA 4OLZL 1W8NA 4JZNB 4PLJD 5DWUL 2YZ8A 1JTTA 3IGAA 4K2UL 1GL4B 5IB2A 4EEEA 2VXSL 1MFEH 4R4FH 3WJJC 4GQ9L 1BZ7B 2VWEE 4ZD3L 4Q9RL 2NY0C 5C0IA 4O4YL 5HGDA 1LO2L 4TOYL 1HYRC 2E9WA 4HT1H 3AREC 1N4XL 2VJXA 4FQQA 4KTYA 1DVFA 1MWAH 2A6DA 2X4SB 3CCHB 4XNYL 1BZ9A 5CJQL 3WS3A 1UCBH 1MJ7L 1QKZL 1FCGA 3HPJB 2XTJE 1KG0B 3MPCA 5IM7A 3ZKQD 2IC2A 4LPYA 4UB0H 2CRMA 3LH2L 5MI0B 5IHZB 3BOVA 5BO1H 1U8LB 3PL6C 2XQYK 4MJID 4XC1H 4S1QL 3L3OB 1ZHKA 1S9KC 3IFOB 3O6FA 5CUSL 1FE8H 2ARWA 5IGXH 4NZTL 1FNSL 3T3PF 4EQ3A 4Z6AT 5IQ7L 4DKEL 2NX5E 5DUMH 1EBPA 4HV8B 3TO4A 5J12B 1UVQA 5C09D 3JBG7 3ULUF 3TO2B 3QG7L 4D9LH 5IEHB 5GRVK 2CMRH 4HIEB 3GSVA 4HWZA 3GMLA 3LPFA 3MRCA 4JFYA 1GAFH 5IESL 3JUYA 3GUTA 2L7JA 4LU5H 4X8JA 4AL8L 1U3HC 2ZUSA 3L3OA 4Y1AB 2VXTH 5ALCL 4JN1H 4OLVL 4PJ9D 3V0WH 4BFIA 1C5DA 1U3JA 4GAYB 5IFAL 2P8MA 3BXNB 1NBZA 1DQLH 4QHNA 2EH7H 4GO6B 1JV5B 3BISA 1RZJL 4JRYA 3SDXA 3QEHA 4Q2ZB 5KN5B 5L9DL 5CHNB 4K3DL 3IRZA 3KPSB 1D3CA 2AGJL 2QHLA 2MPAH 4EN3A 5JMOC 3ETBF 3JTTB 3NGBB 1XR9A 4WU5A 2CJUL 4UMGA 3T0VA 5EUOB 4YHIA 2EO1A 4HWNA 3GI8H 35C8L 2H26A 4X4YB 4HS6A 5BOPA 1ZXQA 1D5MA 1BZ7A 4PJBF 3X11B 4UOW0 2DLTA 2EXWC 3WSQH 4WI7A 5DVOA 1H3WM 5BXFB 4MAYC 4C83B 1WBYA 2GSIB 3BP6A 4P23A 2B39A 4JM4L 4L8DA 1PFCA 4HBCL 1T1ZB 3BP5B 3HZMA 4RFEB 4Z7UE 1HSAA 4PGDB 2AJ3A 1AO7E 1IILE 1HH9A 4S10A 3QNXA 5FF6B 3U7WH 4XHJD 5GGVH 5BVJB 5FKPA 3MRNA 3U30B 4X7FC 2MSPA 2WP3T 5JXED 4FMFA 4JFDA 3BQUC 1QBLL 1EMTL 1IC5L 4UQ3A 4DJMA 3O3UN 1J9CT 1U8QA 3P9LA 1WZ1L 4WFFD 4PGEA 1HHKB 5HD8C 2X6MA 3NFSL 4XRCA 4OZHF 4OT1L 4ZNEA 4KI5D 2YD6A 4Z7UF 1T66D 3IU3A 3TN0A 1Z3GH 4J3TA 5DRZB 3VFOA 4D2NA 3V6ZA 3KR3H 5I1GL 2PYEE 5I9QB 3IS0X 3RTQA 1YEHH 3T2NH 1H8NA 5I1GH 4PPTA 1OP5H 3IVKA 4M1GL 3LOWA 5AAMA 4HDIA 3MLYH 5D1QC 3JWOL 4EJ1C 3U0WL 4W4OC 1AI1L 3PGFL 4U2YA 2BP3A 3P30L 3CFKA 4LCWA 2BXYA 1AFVL 1PBYA 3O3AA 5DRXB 5JHLL 4P46D 1TPXC 4WI4A 3GKWL 5I1EL 5C0JA 5DYOA 1MY7A 5LKNA 2G9HB 4LSSL 3I50L 4XWOC 2X4OA 4JDZA 4ODVL 1RIHH 1CF8L 1SQ2N 2NLJA 3O8XB 5AWNL 4AIZB 4X6BB 4LQFL 1M7IA 5C71A 4FABH 4XNZC 2Q6WB 1P7KA 4V2BA 5EU3B 2DRUA 3QULA 4KZEH 3I9GL 4ZS6C 3O45B 1FG9C 4ZAKB 3SE4A 4XWOD 3LQAC 1U8PA 3UJTL 3Q1SL 2FHFA 3O3BB 1QPPA 4DTGL 5I73C 3HE6D 1IGTB 4JDVA 1KGCE 1EERB 3WNLA 3V4UL 5IHUH 3QSKB 3V2AR 1YEEL 3E2HC 2QLVB 3OKDB 4U1JB 5LWYH 4QXTA 4NRXA 3BFOA 3H7LA 1KTKE 2V2TA 2NY2B 5GS2D 1HI6A 1JPSH 1WTLA 2ESVE 4Y5XB 5IW6B 1G9EA 1J88A 4OBSA 1GIGL 4AEFA 3M8OH 1A6UL 4PJHF 1F3JB 4XP4H 2V7HA 4QHMA 3VGBA 4GG8A 5FDWA 3SY0A 3U6RB 3KPTA 4JDTH 2NY6B 1U8NA 3L7FB 3O2WH 2Y5TA 1BX2B 2ICEA 3QQ4A 3LHPH 5KVGH 5IJVA 1SEBB 4XXDA 4QHLA 2GK0A 2P46B 4LDEB 5DI8A 4DCQA 2ICWI 4ODTL 1MAMH 1BF8A 1CK0L 4BFBD 5I1DA 1NMCB 1UACL 3O3DA 4WTWA 2FH6A 4UQ2A 2HVKB 5ACMA 4ELMB 5I15H 4EI5A 1KJ2A 3MGTB 1T20B 1U8KB 1I8KB 1PQZB 1NC4D 1T22A 1PSKL 3CH1A 4HKZB 4LVNB 3EYSH 2G60L 3WLBB 5LGJA 4MJ6A 4F8QA 2XWTA 1OAYL 4WFHD 2VDQH 5DJZA 3CDCA 1MWAA 4M1CD 4PB0L 2F74A 1DQQB 7CGTA 1QSVA 4OFIA 4HUNB 1ED3A 2DQCL 1IQDA 4EDWL 3QIWC 4ZFFB 4PGBA 3UROR 1MRFL 4L9LA 3R0MA 5BVPL 2VUOA 4JHAL 1RMFH 5T3XD 4OD2A 5GRUL 3SCMD 4NZTH 4PJHE 4APQC 2PW1A 2JIXA 4ZD3H 2HRPH 4Q9RH 4KV5E 2N7AA 4JM2C 2IANA 3QI9C 5GS1A 1S5IL 2QEJA 1BFOB 4HX1B 1G6VK 2FB4L 3TZVD 5L2KB 3ZHDA 2HMID 1R5VB 2B5IC 4LMQE 1KPVA 5EORH 2R29L 1C12B 3DSNA 3STLB 2MOVA 4XZUA 2APTA 3S34L 2NYYD 4XNYH 5EBMB 4N8VB 3GSUB 5ADOL 4R97C 1DSFH 3E0GA 5GSRB 1IGYB 2BSRB 4P9HH 4ENED 1I9IL 2DQHH 4GS7C 4PJ5E 1UFUA 2JELL 5ID0B 1GZPA 3RZCB 2B2XL 5D2NB 2VXUL 2X70B 5DUBB 5EOCH 4EI6B 1B0RA 5C6PB 5IVZA 2XKSA 4HDIB 3BKYL 2FJGA 4PRDB 4Z77A 4H8WL 1J18A 3EDEA 1S7VB 1OTTD 2N4IA 3IXAB 4M6NL 4OCNC 3FAXA 3SDXB 3NCJL 5IBTH 2NW3B 4JANA 5DJYB 5DHXB 5E8EA 5FECB 5IUSA 1F2QA 2VKWA 5IROC 4N8VG 4F7EA 4GAFB 5FDYA 3LVEA 3A6BH 2EZ0C 3KYKL 1HOCB 2H2SC 1KCUH 2VL5B 3QO0B 4V1DA 3EOAB 2DM3A 4LHUB 3MBED 4MMXC 4NT6A 1CS6A 5B3JF 4M7JH 4FQPA 2ZUWA 3ABZA 3WE6A 3KYAA 4L3EE 5D7LE 1TVHB 3PDGA 2DM4A 3L3GB 4LSSH 3GFUA 4HHAB 3FO0H 2KQMA 1NAMB 4GMTL 1JGVL 2VSDA 2SEBB 1YN6A 4PRIA 4X5WA 3FB8B 4ZG1A 1MHEB 3QXTA 3P30H 3V79C 4QYOA 3QXAB 1QRKA 1U58A 4R7DA 2ESVD 1XH3B 3VG9B 1H3PH 1MI5B 4QRQB 5D5MF 2DQGH 5F71A 3D85B 1J0YA 3BT2H 1XCQB 4JPWL 2BNUA 5CS7A 4EBQL 2V5SA 4KK8C 1RK1B 3O81A 4FNLH 2Z35B 5FHAH 3KPRA 1TZIB 2DTMH 4ZUUA 5ETUA 4QLRA 3WS3B 4HIIB 5HHOB 3VGAB 3CDYA 3VFGL 3HZKB 4QRUB 3HRZA 4U1MA 4EOWL 2O5YH 4Z7VA 1MNUL 3DUSB 3O2VL 1EEYA 1CLCA 1I1RA 3CVHL 3ZKNC 3S9DB 4XNUL 2OYPA 1RULL 5CEXA 2FIKB 4WHYG 1F90H 1YJDC 2AXHA 4Z78A 1MIML 2PYFA 2M2DA 4XNMB 3PQYE 2FJFB 5JA8B 1HHHA 3WEXA 1UKQA 5FYLD 1XF2B 4XWGH 1KB9J 3OF6A 2A0LD 2H2PC 4ONHB 5F9JB 4D8PA 3IDUA 3R06A 3R1GH 1FNGA 3VRJA 3QA3B 2QSTA 1GGBL 5HGGS 4KTEH 3SE4C 3NCBB 5DR5L 3WS6A 1B0GA 3P0GB 4F9PA 4BK4A 3EYFA 3GI8L 4I3RH 2JK5B 3DSFH 4MCYB 5DK2A 4GJTB 3OL2A 1YDPB 5E8OB 2B0SL 2XN9E 3MV11 1EZVY 1DSFL 4OFYD 5CMAB 2Q8AH 1B0WA 4OUOA 1H3GA 3OAYK 4R26L 2R29H 3RZWA 1EUTA 1VSCA 3UTQA 5JNYA 4OCRL 1IEHA 4JQVC 1PEZA 1FCCA 4XMPH 1CXEA 2FL5B 4TPRH 5HHQA 1DANT 5JUEL 4OLVH 1CGUA 1JRHL 5JMRA 4NNXA 4FQ1L 5DK0B 4Z76B 5TF1L 3TJHC 1G7JA 2E7HA 3P4NB 4I9WE 2J5LC 3TNNB 5D1XA 2EDHA 1CFNB 5DURD 4NFDA 4P4KB 1LO5A 5GGSY 1NBQA 3K4ZA 4PRHA 1MRDH 4MB3A 3I6GB 4XXDB 3WUZA 4YBLC 5DHVH 1IGCH 3I3BA 3ZMRA 5CD3B 3QJFB 3WIHL 3EAKA 4YC2B 3ZKMD 4Q97A 4B7IA 3FB6A 4ERSH 3EKCA 3SE3A 4IRSC 5LGHL 1S7RA 2OMNA 5FV2A 5FUOH 3VFRB 5IQ9A 1HWHB 1BAFL 4G8GB 1IAIL 5DEFA 4Y1AE 1OAXH 4MJ5B 1N0LA 4HIXL 1T22B 4Z8FL 3H3BC 3TT3L 1BWWA 1I9RL 4QHKJ 3O6KL 3CX2A 2EDBA 4ZTPL 5EBGA 1TJGH 5ID1A 3R8QA 5I8CB 3ZYIA 4C4KO 1IGMH 2VLME 4TUOB 4KGLA 1XGQA 4H0GA 3RIFK 5EZLB 4JFFB 5TE6L 2PO6C 1CFSA 3LEYL 4PY7A 1EAJA 3JVGC 4JN2B 1JHKH 4HKJA 1ERNA 1FNEB 2R69L 4JKKA 1KN2H 3FONA 2VKXA 1R24A 3BZ4B 5B4MC 1CTOA 2PCPB 3MYJA 1Q94B 4RCAA 4Y19B 1OWWA 5I19L 5B39A 3TBWB 3BSZH 4U1HA 2DKSA 3DETC 4HXBL 2Q7NA 3BPLB 4HLZH 4EN3C 5B38B 5KS9B 5FUZH 5K9OB 2J4WH 4QRQA 5F1KC 4FQXD 5KSBF 3QEQD 2BVOB 3PWNB 3ZT7A 5EWIH 3ULUH 3BDXA 4K3EH 4QGYA 3BD5A 4M5ZL 2OTUA 1AHWC 1U8MA 4KKLD 1R3JA 2B1AL 2Z4QB 5ESQB 3AC0A 4QKXB 3GHEL 1E6JL 2X5PA 5HPMA 2H6PA 4UIMB 3FAWA 1BBJB 5F9OH 3RGVC 2ENSA 3GJEB 3SE9L 4F7MA 4B5EA 3BN3B 1LE9B 3FFCB 3BHBA 3A6BL 3KYMA 3HLAA 5ITBH 3MXVH 5C70A 1W0VA 4FG6D 1TJHH 1FH5H 4U33A 3MRRA 4OZHA 3EDJA 2VIRB 4HEPG 3O8XC 3MLUH 3PL6D 4BQBA 2VB5A 3FCTB 2VXQH 1IZKA 4ZYKB 4LCCA 2C3VB 3BDBA 3ARUA 1D7FA 1RPQA 4X5XA 4BUGA 1FQ9C 2P5EE 5F7DA 4NRZB 5HDQH 1UWEL 4XP9L 2DQTH 3FB5A 2F54E 8CGTA 1OY3B 1K9TA 4HPOH 4OZGA 5I18L 5I8KH 3L3GA 3PWJB 4JFPB 5DS8B 1KENH 4YNYA 5D1QA 1A7NH 2ILLA 1B4JH 3CFJA 2C3VA 2P45B 3IF1B 4N0YH 4U1GC 2BVPB 4XP6L 4YDVA 4BH8B 2WM0A 1K8DA 4V1DB 2IAND 3RNKB 2P5WB 3L6FB 2YEZA 4I4WB 3GI9L 4J3XA 1J8HE 1HHKA 3MCG1 4H88H 4Q6IC 2VYRE 1JHKL 1H5BB 1P7QD 1TETH 1K5NB 4BM7A 4MXQD 3TN0D 2VDOH 1JHTB 1WWAX 3BKJH 3SBWA 4RGMC 4JRXA 5JW4M 3DX9A 3MRMB 3C5JA 3SGEI 1DEEB 3UPAA 3QEHB 4WVRA 3HNTH 3T8XB 4W81A 4HKBB 3LQMA 3O2DH 5D7IE 5LQBH 1KBGH 3JV4A 1E4KC 2P8MB 2CKBA 2GW5A 2XZAL 1CVRA 2XN9D 1JZ8A 5JW3H 2NY2C 5FUOL 1UZ6F 2NY5H 3Q5OA 1NGQH 5LGHH 1D5MB 2YBRA 4OQ1A 3X11A 5BMFL 2E7LC 3GJFK 3WUWA 4GRLD 2F5AH 3H3PL 2Z0BA 4LSTH 3KJ6L 2HT4D 2PUQT 4JQIH 5CBAB 4L5FL 2HFGL 1XR9B 4WU5B 4WFGD 4FQIH 1KC5L 5AUMB 1CIUA 1MRDL 3GNML 1KN4L 1KYOJ 1P2CA 1DN2A 3EYVB 2ZPKH 3CVHA 2H1PH 3LD8B 4QRTB 4XX1G 5F44A 3I3DA 1G6RA 1RU9L 3P73B 2V5YA 3QAZB 4FFZH 3TA3C 5C09E 4NHUA 2R4SH 5L9DH 5I30H 3CVIH 3WIHA 1RUKL 3DTXA 1I4FA 1FAIH 4ODSL 5LBSL 3ARTA 4P2OC 3S4SG 4HJJL 4MMZC 3EJYC 1DE4A 3RKDC 5C0CD 1Y18A 4RMWA 5ESVA 2Q8AL 4DK3A 2IANB 4KI5C 1XF5B 3PWVA 5C0GB 3LPGA 4HEME 4YHZL 3KNBB 3K4DA 5I74B 3C08H 4ACPA 1FHGA 3D0LA 1SYVA 4LLQA 3QO1B 3FQWB 4ZOAA 2EKSB 4U6HB 1MQKH 1LDPL 4HH9B 3HI1B 1IAKB 4YQXH 3OTTA 5SWSE 5D7KE 3B2UC 3CSYB 3KPPA 2BY1A 4P2QB 1EFXB 1NLBH 2ARJA 2A9MH 1RZGB 2RFXB 2GKIA 4MWFA 1PZ5A 2OTPA 4NQDB 4WI6A 1XGYH 3MLXH 4KKAD 2Q7YA 3EFFA 5TJWK 2VL4A 4RQQA 4G9FD 1FP5A 5GS2H 1Q72L 1PJ9A 4BZ1H 2KQNA 4HWBA 4M8VA 4QHLB 2ICWA 4PB9L 4F58H 2NXZD 4KMQA 5EFIA 3D2UA 3T3PE 3CXDL 4P2OB 5CZVL 4ENEC 4XP6H 2EDJA 3IFLL 3IETB 3HUJA 1AQKH 5HI4C 1L7IL 2EIEA 1MHPH 3PWPD 5D2NC 1AGFB 2F58L 3IJSB 3JTSA 1C7TA 1N5AA 3W9EB 1RZ7L 4LVNC 2HLFC 1NJ9A 3QQ3A 3SKNA 1LHZA 4KWUA 5JHLH 1FVCB 1FVDB 1CZ8H 1FZOA 1YMMA 4Y4HC 1OTUD 4NNYA 5D96C 3AVEA 4NBZB 4XNQB 4Q74A 2UZYB 1G7HB 1N5AB 3C60A 5D5ME 4Z7WB 4LLMA 3MNWB 4LKCA 5IW1A 3FT4B 2YUWA 4HZAA 1WWWX 3TLRA 4MSWB 3QUZB 4P2OA 3MNVA 4CU6A 3KS0H 3T1WA 5BV7L 3UTZA 1BD2A 1IGIH 2Z31D 1KV3A 1VEMA 1E0OB 1S9VA 2OJZH 2FEDD 3WDIA 1WFTA 2HT4C 3O3EA 5F8QC 5TPWH 4X9BA 4WEMB 3AAZA 1KEGH 4L8SB 4NBXB 5ITFB 3U7WL 4Y5VA 4PS4H 4F37F 3L5XH 4UDTB 1AC0A 3QR2A 3RWIB 1YYLH 4ZPTA 4M5YH 2X10A 1I1YB 2LE9A 3WDJA 5DVMA 2AJVL 1KEMH 2ZUQB 1A3RL 4HQQL 1E27A 3WSQL 5B38A 2ID5A 1KACB 2R2BB 5E2TL 3WHXB 3VG9C 4G7YH 4BSWB 5HHME 4D3CH 3SDDB 4TQEL 2D7OA 2EDFA 4BQCA 4M1DL 3EOTL 2R4RH 3MV8A 3D0LB 2F53B 2CJUH 2C4FU 3CU1A 5D7SH 5JHDB 2IQ9H 4S2SB 2KZWA 3H7BB 2LVCA 2NY6D 4MAYD 3SCMC 5B3NA 4JGJA 43CAA 4PB9H 4F58L 2C3WA 2PXYD 4PYGA 4HAFA 4UT6L 5IBUB 4UQ3B 3W39B 4XBEL 2VLJD 4WV1C 5DMKA 4HS8L 3KWWA 5FUZL 5EO9A 4Q9CA 1HH6B 3HNSH 4JPIB 3DJ9A 1IBGH 2QKIB 2ZNWA 3NIGF 4X6DA 1KIQA 2VLRA 2J8OA 1C5DB 3RDTA 3O41B 1NC4B 4PTTB 4OV5B 2A9ML 2EDKA 4O9HL 2X9WA 3QEQE 4FQLL 2PTVA 3HE6C 4HH9A 3F7YA 3VXQA 4NDMB 2VZVA 2Z31B 4AIXA 1JF6A 1MEXH 4UTBH 5T3XH 1MQKL 3GIVB 2BNUB 2YHGA 3EOBB 2JB6A 1O7VA 1J0ZA 3C5ZD 2XACC 3QXAA 4I2XB 4M00A 2KDGA 2MMXA 4KAQH 1TZGH 4NKMB 2G60H 2R8SH 5D4QA 3QCVL 4X6DB 5F93C 2HTKD 5HHXH 3EDDA 1FGVL 3DGCR 1UWXK 5HY9A 2ZWLT 4KUCF 1RFDH 3DX9B 1YQVL 2KBGA 1J1OL 25C8H 4OGYH 4CGTA 4KK9C 3ZE1F 2X4UB 3EOAA 4FTVD 4AY0A 4NGHH 3MBEC 2DDQL 2UUDK 5HYJE 1MCFA 4PJFB 4G7VH 1YC8A 4S1DD 1AXTL 2NMSA 5DVKA 1E4WH 1FZJA 2ATKA 4CVZA 5LAXB 1JTPA 1FYTA 4LHJB 4LSDA 3WDHA 3U4EA 1MFBL 3R1GL 1EEQA 1MREH 2VLJB 5L0QC 2DLEA 2ED8A 1K6QL 1F4WL 1FGVH 3M8OL 4DFIA 2X9XA 3A6OA 1HQRA 1NLDH 3RDTD 1MCIA 2IMNA 4U6TA 5I1CL 2X4PA 5HHPB 3S98A 1T21B 3VCLA 5E1HB 1UB6A 3CK0H 5JZ7C 2YR3A 2D2OA 2XFXB 1NCBL 4CKVX 1OLZA 1AR1D 4PBWD 5DZLA 2W38A 3SO3C 4F15C 5TFSH 3QRFM 5EO1A 1B90A 2XZQH 2R0WL 3ARBA 3VI3E 5IIEB 4X9IA 3WXWL 2F54D 1YPZE 1FSKC 1QP1A 1U8OB 2PO6A 1CGXA 1NL0L 3KPRE 5E5UB 4PJFF 1E28A 1MFBH 6CGTA 2BRRH 2EXWD 5IG7A 4LKXA 4RISL 2WUCH 4Z7VF 1QNZH 1T7ZA 1XIWA 2FX8H 4TN9A 3UJIL 1CGVA 1BQUA 2CGRL 4P99A 5GGUA 2RCSL 4OAWB 4ISVB 1A0QL 3EJZD 1T4KB 4LPUA 1URLA 5DJ6B 3HI5L 4PRIE 5GS1B 5DLML 3L95A 4JFPA 4KKCC 3WFCL 2XRAL 2WANA 5D1XD 1IGJA 5KG9A 4A2MA 5T1LB 1E4JA 5SWZE 1ETZB 3LZFH 3SOBL 5I73B 5EOCJ 3HC0A 3MV7E 2H2SD 4PRPA 3WN5B 4TNVF 1S7WA 4WEBH 3SHSA 2CPCA 4KROB 2D4DA 3QDGE 4CMHC 3F62A 3QJFA 3DUUB 4QXTB 5I9QC 4M7JL 4LLVA 5BQ7A 2QQNL 1EA9C 4PJEF 3FFCE 3U2SB 1ZHNA 4WY7H 1Z9SA 3PWLB 4FQXB 2X89D 3RL2A 2GJ6A 3TBSA 3HZYB 3OF6D 2R2EA 1TTUA 1EX0A 3L3KA 2P1YA 1JVKA 4QTHA 2W0LA 3EHBC 1RZFH 3SBWC 3NFSH 4MJIE 1TPXB 5DO2C 3TGXA 4E9LA 3V6OA 1U93B 3BZFA 1CR9L 2IAMD 4Y16A 3QULB 1WISA 4LP5A 5BRZB 2OSLA 4LSVL 5CBEB 1YZZA 2XA8L 3EDFA 3BAEH 2XTJD 4TYUA 4Q0XL 4H8WH 1HNGA 5JQ6L 3MGAA 1MFAH 4M7KH 1K8IA 4HS8H 4GSDL 4LLUB 3PWPA 1UXSA 3ARDC 2B2XH 3JSSA 4PRAB 3F58H 5IVXF 1CU4L 4DOHB 3QQ9D 1AKJB 1BFSA 4FFVC 3B2VL 5C09B 3RWCB 3WCYA 3KYKH 4U1HB 4BSJA 1JE6A 4ODUB 1JPFB 2APVA 3QDJE 4PD4K 4BZ2H 1SBSL 3ZL4H 5C6WH 3VI4E 2VZUA 3QWQB 1NGPH 2Z93A 4HJGA 4QRRA 4NQSA 5C92A 1OSZA 2FJFA 3FFCA 2BSED 3CSPA 1I3GH 3TCLB 4N0UA 2AGJH 3MNVB 5J57B 3NTCL 4JG0H 5DUPH 5F88B 3V6BR 5F70A 2P7TB 1WZMA 2NY3D 1F11A 4OCXL 5T1DH 43CAB 3KDMB 2OS7A 4M5YL 1JNNL 1FPTH 3QQNA 4ETQB 3UPRA 2CK2A 1SM3H 3BO8A 4JHWH 3WIFA 5CEZD 4XVSH 2Y36H 2QQLL 3K46A 5MEPB 2ITCA 2HLFD 1AHWA 1OSZB 1BAFH 5B4MD 1L6XA 3KPRB 3OSKA 4JFOB 1VA9A 2OJZL 5HYFA 1T83A 1YDPA 2AJ3B 1J1XH 4QCIA 5KS9A 2NR6D 2DQFA 1I7RA 2F19L 4O5LL 1AH1A 5JR1L 1A7BA 2XKNB 3QG7H 4MDJA 4D9LL 1OHQA 4NJ9H 5F7HA 4XAWL 1QLFB 4JR9L 3MACL 4DN3H 3T77B 3SE8L 2HVJA 1FNSH 5IQ7H 1KFAH 3MLVH 3BGAA 5KVFH 5ISZE 1NSNL 3WIIL 2I9LA 5DD3L 4XB7A 1TVBB 1FFNB 4X0KA 5GGQL 4RAUB 3VJ6B 5E9DD 5JUEH 1MRFH 3S88L 2JJTA 2Z8SA 4HZLA 3RTQB 4JRYB 4KROC 3IDJB 4PJ7B 2UZXB 1AJ7H 4ONGL 1KJ2L 4R26H 4GW4B 1Y0LB 1OB1B 5IQ9B 4WGVB 3T4YA 1FO0B 4Q9QL 1OP9A 3GMOA 2COQA 2VUYA 3P77B 2NY4B 5J1SC 5CD3A 3GJFA 2R39A 3VMPA 3MA7B 1MCRA 3I6GA 3TZVA 3ZKXB 3V4PH 5ALBL 3UZVB 4YDKH 2AERT 4IOFD 2V9RA 4OLEA 4PGDA 5C2UB 3MSPA 5ADPH 2N1KA 3N50A 2OXGA 3MMEA 2HG5A 1S9WB 4KQ3H 5EO0A 4H8WC 5DEGA 2H1PL 2X1XR 4JO1L 3VXSA 5K9KB 1TVHA 1MUJB 3KPLB 3ZT5A 1IM3B 5FO8A 4OLUL 4LLDA 4R7NB 3P9MB 5BJTB 3DIFA 1A4KA 3QPXL 1BQHA 1F6FB 5JHDE 3P73A 5CCKL 3JXAA 5DC9B 5C0NC 2QADC 5GJTL 2Q86A 5FYKE 4ZAKD 3P4OB 4BH7B 1J5OL 5IV2B 2QSCL 3X3FL 2OK0H 4DQOL 5CHNA 5T5FH 2NZ9D 4O2FA 1UM6H 4JB9H 1R3IL 4WJ5A 1Q9LA 2R1YA 4NO0D 1RIHL 4PREB 3HG1A 1KBGL 4M61B 4QOKE 4WO4A 1CVSC 4D0DA 1RZKH 3HNTL 3QDAA 4MXWH 3HAEG 1T21A 3VCLB 5I16B 4RBPK 1ADQL 3VFVB 3PV6B 3IDGB 2AQ2A 2AK4B 2CO6B 4F7CB 5JA9A 3MJ7A 3ILQC 4E42B 2V6HA 4O02L 1U36A 3UJTH 3UTPD 4CMMB 1QSFD 3JV4B 3ZKXC 5CWSB 4IJ3B 1X4YA 4D0DB 4D9QE 1DDHA 1ED3B 3L3JB 3DWTA 2O61A 1X5IA 3T1FB 1G9MH 3MYJB 3OKMA 4BFGA 3T0ED 8FABA 2ZOLB 4TUKH 3ILQD 1MJ8H 5FIEA 4L5FH 2FSEA 5EU4B 3MRJA 3GSUA 1WCBB 3I50H 2ICCA 4OLXL 2Y1VA 3PE9A 5EO1B 2DI8A 1J1XL 3IXTA 4U6VL 1F97A 1JZ6A 2WSKA 1AI1H 3WFCH 3IDIB 4G9FA 4MX7B 3AB0C 2VXQL 3QUZD 4G9DB 3UC0L 3HI6H 2FJGB 4PJ5D 4PV9A 3EDKA 4FQHB 5AZEL 5E2UL 3C8DA 2WW8A 1X5KA 5IJVB 3EYOB 2EYRA 3ECBA 3M17A 3ZYOA 2H9GA 2O93L 3S35L 1V3KA 2AP2A 5CEZE 1HN1A 3EZJB 4D9QD 3IJYB 3PHQB 3RL1B 2FX7H 1BD2E 5JO5A 4NZRL 1RJYA 4PJEA 3RWJB 3IDXL 1NAMH 1SBSH 3ZL4L 3SCMB 5IWLC 5H2BB 4EVNA 1I8MA 4O51B 3UTTD 2H41A 4RWYL 3WFZA 4PJ7E 2DBLL 1C08A 2R1XB 1FNFA 1OB1A 1CU4H 2J8UF 1CDGA 4GRMB 1YEGL 2VISA 1JMZA 3MGTA 4JFZL 1ORSB 2NXYD 2AXJA 3SQBA 3LIZH 3LKQA 1INQA 2J8UE 3E6HB 3P40A 4F33B 1ZE3C 2E6PA 1FFNA 1N26A 1E4XL 4X8JB 5HYIA 5B8CB 4KY1H 4ZDHB 1R3HB 2D9CA 4OGZA 1U3HB 3JV5A 3E3QC 4PJAF 5BS0A 1NFDB 2MFNA 5HHOE 4OD1L 5DJ0B 3MRGB 3ZYJA 3AM8A 4GMSH 3VGDA 1IQDB 2MPAL 4HUVA 1PAMA 4JKPL 3F7YB 3VXMB 3TBWA 4N0FB 2Z31C 3U0PB 5KSAA 1RZIB 3FOMB 5F3HB 5C0ND 2DQUL 2NY5C 4F37K 5LGJB 2OL3L 2OM5A 4YHLH 4PJ5B 3DYPA 4QRSB 2D31A 2DKUA 1C5CL 1EGJA 4XHQA 1FSKB 5C6TL 3BGFB 4L1DA 3AS1A 1NUGA 4BA8A 3VI3F 1NCAH 3EYSL 1T20A 1U8KA 3MA9L 5CJ8A 4NUGH 1MCWW 4LAQL 5K9QI 5L2KA 5F7LB 3CD4A 3GZKA 4YBLB 3V6OC 1I3VA 4Q9BA 4LCYB 1FC2D 3RI5K 5BV7C 4C58B 1PG7X 2P7TA 2X40A 3CUPA 1XZ0B 4B41A 2A6DB 4UTAH 3QG6B 4M4PA 4MSWA 1L0YA 4PJFE 1QLRB 2MTPA 1RY7B 1MCOH 3BP4B 4M48L 4UIMA 1ITBB 5I8EA 5EIIB 2FX8L 1PKOA 2AXFB 3UTTB 3MV7B 4RMRA 2OI9C 1ROWA 4XT1C 3IU4H 1WAAF 1CDYA 3D0VA 1FL5A 5HGAB 2E3VA 4H25A 4LEOB 2AQ3A 3RL1A 3UBXA 2OTWA 4UB0L 4PJXF 4X9HA 3MV9E 1Q9OA 4JFZH 1YNKH 3SKMA 3KLHD 2VITA 5EOTA 1A7OL 2RIKA 4GRWF 4RZCB 4Y5VB 4L4TD 1KPUA 3OZ9L 4DWHA 4M43L 4YBQC 1JI1A 3TA3A 1JPTH 1AO7A 1IAOA 2DBLH 1U3HD 3GHBL 4RWYH 2NY7H 3GSNL 3O9WA 4JM2D 5FO9B 1UH2A 2MKWA 2UV3A 3DX8B 4Z5RA 5GSVB 4UOJA 3BW9A 1YUHA 1O7SA 1YEEH 4QHKI 2HT3D 4XP5L 3U46A 4Z18A 2ZKHL 4D3CL 1K85A 1IT9L 4NT6B 4UOW1 1I3RA 1NFDF 2I5YL 3NAAL 5A1AA 2QQKL 3BPLC 3FTGA 4EN3B 5E0QA 3UZQA 3DX6B 3VRLF 1BQLL 1ZAGA 4F9LA 5I71B 3G5VB 3DUUA 4X4ZA 5GHWL 3ULVF 2IH1B 4G43B 1G7HA 3EYFB 1MFDH 2FO4A 2OL3B 3ULUD 3U6RA 5I0DA 1AGCA 4FRWA 5DEFB 2BXZA 1J11A 5D1ZA 5SWZB 5CEZL 5C07E 3KXFE 3TVMA 4QRPB 1G7PA 1IGIL 4JRWA 3LAFA 3RGVD 1AGBB 4EI6A 4PGCB 3DI3B 1I9JL 5D2NA 5EULV 3S7GA 1BLNB 1OTTC 2DTML 3VMNA 1OW0A 4HFWB 1TZGL 1FL6B 4P57B 2H32B 5LAXA 3AXLB 2D4FA 1NFKA 1J8HA 4YFEA 3HRZB 4YHNA 3SDDD 5DTFB 4EUPA 4NZUL 2P47B 5E70A 4X6CE 5HHOA 1H5BC 5K9QG 4HGMA 4Q6IB 4K7PX 3CLEH 4N5EC 2W0KA 1MRCL 3ISWA 4L4TB 5GRXG 2FHBA 4NOFA 3CU7A 3OB0H 1LEKA 3FFDB 3QXDB 5TQ0L 4R2GC 4GKNA 2XZCL 1UYWL 2BERA 3H9YA 1I4FB 3B83A 3PGDB 2X4PB 1EMTH 1UKSA 5I71C 5EU6B 1P2CB 3U7YL 5C8JB 1ZLUH 1G1CA 4G6AD 1JFQH 5DRXA 5HDBF 3S4SA 2A74A 3OKLB 5T5FL 1RZIA 3FOMA 4U6VH 3OR6A 4HBCH 4ZUWA 2HJFB 5FB8B 3IVKB 4UT6H 3ALXA 3TVMC 2GTWA 3QDGB 3PWVB 5IB3A 4CMMA 5B3JE 1ACYL 2A6IB 4FNLL 5DC4B 4FXGA 1BIIA 4APQA 4G8GD 4S1RL 3RDTC 4AK1A 2YSSB 4QRRD 3THMH 3G08B 3HFMH 1DLHA 4WW1B 1WTGT 4OKVB 4ZSOA 4PJBE 5ACZB 1ZS8A 4LIQE 3RGVB 4JY4B 1TJIL 3LV3B 1CBVL 5IVXE 3LS4L 2EH7L 4C57C 1P4LA 5T3ZE 4KUZH 4YHKH 3EYVA 3GM8A 3ZE0E 3VFSB 3CMGA 2H32H 1YYLL 3HZVA 1T2QH 2BVEA 4PJEE 3SCMA 1MLCA 1I8MB 1IFHL 1S7XA 2FLBT 3GMPA 3UJJL 5HYQB 1LO3H 4NC1E 5HXMA 2VDNH 3EOBA 3U9PH 2Q20A 2YK1L 5H35A 4RA0C 5FUCE 2QSCH 4RRPA 3X3FH 1I9JH 3LDBC 3MOQA 3RVVD 3DHMA 3OGCA 4BH8A 3P11L 1OSPH 5E6ID 3RVUD 3KG5A 3I2CL 4Z7NF 4YFDB 5T33H 1JNHB 4TSCL 4HHAA 3IFOA 1VFBB 3O6FB 2QADD 4DFHA 3CJJA 1INEH 5D6DC 2W0FB 2OR9L 1S5IH 3VD9A 4JPIA 2R15A 2FJHB 5IBTL 1U8LA 4LFHG 3T8XA 3HS0B 3ZKSD 4KZDH 5D7JB 4G9DA 1IKNC 1T0NA 3BH8A 4S1QH 1UJTA 3RDTB 5I1JH 1EHXA 1FG2B 4U6YA 5T1KB 3N06B 1G7IB 1YQ2A 4ELME 2QKIA 5F89B 5CJXC 1OT1A 4XPTH 2IH1A 5GS0C 1KXQE 4L3CB 4UINL 2ADFH 1T3FB 4N0CC 3G6JB 3FQTA 1UM4H 1A9EB 5JLZA 3P4LA 4PGZA 5DD6B 4JANB 2NW3A 2Z9TA 3FMGL 1ZVHA 4QRRB 4GRWB 2X9YA 4F7TA 3RX8A 4ELMF 4JEGB 3MXWH 4PRHE 4M43H 4E42A 2BVOA 1AQDA 1WFUA 3WLWC 3T65A 2L7UA 4NQXA 5C0FB 4N5ED 3MJ8A 3RKDD 4LIQL 3X14A 4GH7B 3N85L 4DKFL 5C8JA 5A2JH 4GG6B 2P24A 3SGJC 1MVUA 3RAJH 1JI2A 4I48A 4H88L 4ZMAT 4GLRI 3GSOB 4ZPTB 1WVZA 3B5TA 3DMMD 1JPST 1S9YB 3FQRA 3OG4B 4EIZC 3EYUH 1KG0A 1WFNA 5CD5C 2XG5A 3C87A 4TSCH 1UC6A 3QIBD 4JN2A 4DCQB 5ERWA 5EPMA 1RD6A 1CGSL 1UA6H 2WBKA 4N9GB 2ZCKL 3MQIA 4KDTC 4YEFA 1QYGL 5IW1B 3RP1A 1ZGLA 3AFLA 4GKZB 3LKPA 1QOKA 5BZDA 2LVEA 4OIBA 3QUZA 1OAYH 5JQ6H 3MCKB 2YS4A 2ZOKA 1E6OH 2UWEB 3TCXA 3TCLA 1SJEB 1ZVYA 2IAMB 2OL3H 3WD5L 5BRZD 4BKLB 4YFLI 2YN3A 3O4LA 4XXCA 1J05B 1FAIL 1FN4A 1Q8MA 1S8DB 4PYHA 5AEAA 1A22B 1GRWA 4K3JH 5CP7B 1NAKL 3QNYB 1RJYB 4PJEB 3VFNB 1TTFA 3JZ7A 4RGNE 2IFFH 5IHLB 4QOKD 3G6DH 5DJXA 3EFDL 1AC6A 4HXAL 2EDEA 2BNRD 2EKSA 4U6HA 4X98A 4KZEL 3G5VA 4IDJL 4ORZC 4Z7UA 5C0CA 5DD1L 4PBXA 2N7BA 1CL7H 1G7LA 5GGUB 1E6JH 2QR0A 3GSNA 4RBPH 2ICWB 4KGJA 1XF1A 1HDMA 1UWGH 3FO9A 1K8IB 5FO7B 5GGSA 4NZDA 1GOGA 4NCDA 5HHQB 5IB5A 4ZUSB 3RVWD 1QSFB 4K3EL 5F7WC 2VLRD 5GJSL 1MF2H 3OKOA 4U6XB 3NIFF 3ES6A 5JPNB 1MVFA 1OGAA 3MV8E 5DLMH 5MEQA 3TA3B 4ZSOB 1EFXA 4GAGL 3ULVL 4MNGE 1WF5A 2RCSH 2XZAH 2F5BL 4OF7A 1NKRA 4Z7UB 1HEZB 1BZQK 1KIRA 3O2DL 5D1ZD 1CR9H 4HIHA 4NN7B 3U2SA 3IJHB 5F3HA 1KN2L 3MJ6A 1I9EA 2R69H 3KPPB 1A64A 2XPGB 4GG8B 2EYSA 3VFUB 3QJHA 4XC3H 1PY9A 2DIAA 2DL2A 2EXYC 3Q1SH 4NQEA 1ZEAH 4R96A 1GPOH 4NZUH 2NY3C 5AZ2H 4WY7L 1U3HA 3WFDH 3TP4A 1CD0A 2C7UB 3H9SD 4LSUH 4U1JA 5KW9H 1T3FA 5J11B 2A73B 4WCYH 4A6YA 5I2IA 2WUBH 3HUJE 1LILA 5GIRB 4NOBA 1F11B 1KPRA 5L8KB 2AEPL 2AI0H 1H3XA 2H3NB 4N5UA 3D25A 4FMKA 4ZPVB 2AJSL 4PP2B 2V17H 1KTDA 1NCUA 3PGFH 3MRMA 3CFDB 4X7SL 32C2A 4KK5C 4NHUB 4Z7VB 1AXSA 4MQTB 5IFJA 3HAEH 3PF2A 1DUZB 4R90L 1W2KT 3FRUB 3VU2A 4LPVA 3T2NL 2OR7A 4P2OD 1QNZL 5DZNA 1FL6A 1ONQA 3TBYA 4NN6B 4U1LA 1MVUB 2NXYB 3EHBD 4JVPA 4HUVB 3TO4D 4OJFL 2DYPB 4YGAB 2R0ZH 3WMSA 5J6HB 3HR5A 4GOSA 1X3DA 1T04B 4IMKC 3VXSE 4LCWB 2AK4A 5MERA 5IFAH 4PRPE 1ZA3A 2DQDH 3IGAB 2YD4A 3RA7H 4MCZB 4MA3B 1B6DA 5LJYH 5J13C 1CICA 3VFSA 2W60A 3GHEH 3O4LD 1Q0YH 1V3LA 2UVEA 3HC3L 3V4VL 2B1HL 4U3CA 2MCPH 5GGVL 1KIQB 1A3QA 1EAPB 1MAJA 2EYTA 4M6OH 4TSAL 3SO3B 3E8UH 1HH6A 4N1CA 4X7TA 5K9JH 3ARDD 2CMRL 2GJ6E 4OKVA 3LS5H 3ARPA 1C08B 5KTEH 3D2UD 5TH2B 2JCCA 5GRVL 4IRZH 1VGEH 5TE7L 5I19H 1E4WL 3D3VE 2YD9A 5ICXA 4JO1H 2A6JB 3Q6GL 2F53A 3UO1L 3AS0A 5FECA 4YDVB 4OZGB 3D87B 5ESAB 3DARA 4ZFZB 3W82A 4W4NA 3ULUC 4JHBA 4AT6A 4GKSB 1FRGH 1WBYB 2GSIA 5DMIL 5MHSE 1CCZA 3TJEH 5ANMB 3QIBC 2O5YL 4FQCL 5ISZA 1INDL 3ZE1E 3CLFH 3KLDA 2A6JA 3MRKB 4X4ME 1QHPA 4ZUVA 3VE0B 4LPTA 1EH9A 1RIUH 2VIRA 2EDLA 4MA8H 5ALCH 4H20L 4A6YL 2R1YB 1Q9WA 2YWYA 1GZPB 2O5ZL 3E6FA 3BYTA 3VD3A 4ZFGL 2HT3C 4FXKB 2F53D 3JV6B 1IC4H 1HILA 1ZSDB 4KKNA 1MCOL 3PGCA 2ADFL 4PP2A 4LCWD 4HKXA 1BD2B 3U36B 1BQHB 1Z9OA 4HQQH 1AGEA 1UM5H 4KKCD 1YY8B 3S88H 4YHML 2NR6C 1T1WB 1SY6A 1K4DB 1T5XB 4GBXA 2WIIA 2AJVH 5H94B 1MPAL 2YPLB 5K9JL 1IKFL 3GO1L 4QT5A 4JAMB 3EW3B 1A7RH 4Z77B 2J88L 2VC2L 4MD0A 4RDQG 5F1NA 2MCPL 4N1HB 4FG6C 5J13B 1H8SA 1G7PB 1GOHA 1INEL 1HQRB 3VFVA 4MLIA 2FR4B 4L9LB 3LN9A 3T09A 3LIZL 3MV9B 4G3YL 2DQDL 3NACH 4R96B 4WO4B 4XBEH 4Y8DC 5E5RB 4ZFOB 3MA7A 4LOUD 2GUOB 2FYYA 2YC1B 4ZO8A 1FVDA 3L5WA 3LQZA 4OF3A 4Y19A 3T08A 3T2PA 2ZUTA 5A43C 3BDYH 1NJ9B 1JZ3A 4PJDF 3RUGF 3QH3A 1LE5A 1FNLA 3H9HA 4JFOA 3LB6D 2EYSB 5IV2A 2ITCB 1WCQA 5D72L 2LQRA 2GSGA 1KTDB 2GFBA 2XWTB 3UX9B 3O6MH 4X8XA 4KVCL 2XN9A 4NFBA 5C1MB 1FFPB 4WFED 5I8CA 1SBBA 1Q38A 5L2KD 1BHGA 4NWUH 3AMKA 1CZ8L 4RAUA 2MWCA 3MRFB 4NQCE 4YPGA 2FX9L 2NNAA 4U0RC 5BZWA 4YO0A 2I9LB 3MTRA 5CGYD 3SDCA 3BZEB 2AAVA 2MHAA 4POYA 4KJWD 4CNIA 1I7TB 3CC5A 3B8YA 3VW3L 1RJCA 4G6MH 1B88A 4OKDA 4H25B 4LEOA 3UBXB 5JOPE 3NN8A 1I85C 1BVKB 5SWSB 2A77L 4LLWA 3LKRB 4HGWB 3HB3D 3TVMB 4LSQH 3DMMC 1JTOA 5F7NC 1A7PH 2KUTA 5I8EB 5LVEA 5FHAL 3QNYA 3TNNA 1VHPA 5AZEH 3T2QA 1DANU 2NNAB 2CLVB 1G6RL 1KCVH 5HDOA 3VXRA 1JWMA 3HI6L 3HB3C 3SO5A 5HVHB 3ARRA 4JRXD 4JHAH 4HCRL 4XCCL 1DP0A 1XIWB 4BYHA 1I3RB 2WIIB 2P8PB 2EDDA 3MRQB 1CN4A 2ICEB 1NDMA 5EU6E 3U46B 3V52L 3K4AA 4W6WB 3TEUA 3DYMA 1MLBA 4X98B 4LPXA 4KHXH 1G9ML 2YRLA 3CDFA 3GJFH 3WFHA 5K59E 4TVPL 1TITA 2BY3A 3D1MC 4LLVB 3RPKA 4N0FA 4K94L 4HUWA 1W0WB 3SDAD 5HYJB 4ZFOA 2AJZA 1INDH 3GB7A 3LDBB 4MNHB 1KULA 1MFNA 2EEBA 3U83A 2IJ0C 4OZIB 3VD4A 2CLRA 3GSOA 1YNTB 1CLOH 1N7MH 4CJ0A 2YBRB 1BOGB 1ADQH 3TJHD 4MYWB 3PV6A 2FGWH 4IRJA 1HXMB 1YMME 4F2MA 3U79A 4CAGA 5B22A 1EEZA 5J6GB 4XCYA 1BOYA 2AQ1A 5BRZA 2AK1H 1CD8A 3V6ZB 3MBEA 1YEKH 5D70H 4MNQA 4JJ5B 1QLRA 3V9FA 3FHQA 4OD3L 3WNNA 1ZTXL 4JM2B 3RWGB 2R1XA 1XZ0A 4OQTH 4HMEA 2QADB 5HHOD 2BSSA 3TVMD 5IFHH 4HWBL 1SEQL 4NO3A 4ZUUB 3VFOB 3MUY1 2EIZB 2VE6B 2J7LA 1JHTA 4OFKA 3KPOB 4HS3A 3FQTB 5C0DB 2E9BA 3FQRB 3QIWB 5TFSL 2B4CC 1GC1H 3MFGB 4OLUH 4LNRB 5JW3L 1A1OA 2GY5A 4PUBL 4Q9QH 3GSNH 3KYNA 4PRAA 2FGZA 1RZ8B 3N1FC 4C56A 5I1CH 2EDWA 1B9ZA 4L3ED 1YJDL 3RA7L 3QHFL 3FB8A 3VXOA 4GLRH 2BDNH 4H1LH 5KOVC 1A6VH 4NJAL 4XPHH 3BGMB 2NXZC 4RFOL 1JNLH 2EDNA 2VDRL 3LEXB 5ICXB 2VLJA 3ZO0A 3QT2A 3OPZL 1RZKC 3MXWL 3WXVL 3ORJA 3EO9H 2PXYA 2V2WA 4KKAC 3SJVD 1KFAL 3MLVL 2ZSVB 1KLUB 4R90H 4JPKL 3L3KB 5HYEA 2UWEF 3RL2B 1BJ1H 4GXVH 3PJSA 5KVDH 1HOCA 3BXNA 1M1SA 1X7QA 4XP9H 4ZXBB 1OQXA 1JNJA 1QSED 1NGXB 1RUPH 4WCYL 3U0WH 3B3IB 4KXZI 3SDYL 4XVJH 4QHNB 5DD0H 5E8EB 3KPNB 2K7PA 5DSCA 1XGTB 2R23A 3W0WE 4M1GH 1G6RH 1KCVL 4JFYB 4RX4D 5J11C 3DXAE 3IXAA 3U4BH 5EZOL 1D5IL 2DQUH 1K2DA 4L4VD 4N90D 3GBMH 1A6AB 3FO1A 5DHVA 4DN3L 2HVJB 3HC4H 1KLUA 1ZT4B 1DBML 3DRTB 1T4KA 3MV8B 4W6YB 3RWDB 4OUUB 3CMOL 1XGPB 4P4RA 4WJ5B 1HHJB 5GPRA 1L6ZA 1N64H 4OCYL 1QR1A 3R4DA 3AGVA 2P44B 4P3CL 4XPAL 2EZ0D 1IGYA 5SWQA 4N0YL 2UVFA 4M5ZH 3VXNB 1BVLA 4WW2C 3WIFB 1A6ZB 1NDMB 2X42A 4PJXB 5C0AD 2BMKB 5EOQH 4PJIE 2B20A 5I8KL 5FCUL 1JF5A 3CH1B 3PGDA 5E9DB 3RX7A 1FZMB 2HFFB 3PUCA 1MHHA 4NWUL 3TBVA 4U1SB 4JRYD 1LVEA 1FDLH 1OCWH 1XF3A 1LEIA 5ANME 4Z9KB 3HPJA 3SJVB 3ROLB 4NN6C 1TLKA 4LSVH 4GG6F 5FYKD 5E6ZA 4QXUH 3ARVA 4NN5B 1DVFB 5IHBA 5D7IB 2QV2A 5HVGB 5FB8A 4BZ2L 1IEBB 1FO0L 3GRWL 4GW5B 3MNWA 4LKCB 2K1MA 4ORGB 5E6YA 1HHGB 2MJWA 3UEZA 4QEGA 1CIDA 1RUAL 4X80H 3KXFB 3K0WA 2VR5A 2J6EL 5C2BL 1VKXA 1K4CB 2QQNH 4WNQB 4M7KL 1VACA 2F54A 3TYFB 2B1AH 4XMKL 1Q9LB 3O6FD 5DMGC 1JBJA 4HIXH 1BBDH 1L4IA 3L3HB 2UYLB 5E08L 2K9UA 1BJ8A 4JCMA 2VZOA 1OGAB 4IOIA 4PG9A 4NN7C 4XBPA 3FFCD 1PX3A 2XRAH 3CLEL 1KCRH 4XP1L 2YPKA 3FJTA 1IM9B 1X6LA 4LCUB 4Z95H 1L0XA 3VI4F 5EUOE 3P0VH 3TBSB 1D5IH 3AREA 5EZOH 1RHFA 5E5MA 5A2IH 4YDIH 2ATPA 2EKJA 3IF1A 4RQQB 4YHOH 5A40E 1NMBH 4P5KA 3CPLB 1S9WA 1Z3GL 5E9DE 2IANE 2EDOA 4IS6A 3N85H 1Q0XH 2NXYC 4LDLB 2W59A 4Y5XA 3A67L 4NJAH 4XPHL 5F7DB 5GQBA 1KCKA 4G6KL 4MD4A 4I3SL 3T0BA 2AK4D 2WLYA 4QHUB 1T7VA 3ARGC 3D0VB 1MCBA 5CZXC 3X13B 3ZYZA 4YHYC 4CU7A 3IJSA 3JTSB 1SJEA 2IAMA 1N59A 4JREB 2Y6SD 1XCTA 3HUJB 5A2KH 1ZVSA 1U8HB 1EZVX 3RNQA 3QFJE 2J2ZA 3BD3A 4MAUH 4JM4H 4GBXB 4RISH 4MD5B 3D9AH 1MREL 1Q1JL 4Y4KD 4OQTL 5L7XH 2XWBB 2CLZA 3QIBB 4XPTL 3L9RA 1CFVL 1XGYL 1PX4A 5CP3H 3IDNA 1YY9D 4LQ1A 4HPYL 3EFFB 2Q7YB 3GSXB 4YDLC 5J12C 4U7SA 4OI9A 2FBOJ 4QRSA 1ES0A 4L8CA 3MRPB 4LLUA 5KVEH 5T1KA 3U30C 43C9B 2F8XC 3MO1A 5D6DA 4HW6A 5D7JA 3H9SA 2XTLA 4U3HA 1YMHB 4NPYA 3RWIA 1NUDA 1RQ5A 5DJDB 3T0DA 2WLZA 1YNKL 4Z0XB 1SJHA 3T65B 2EH8L 3CFKB 3R0NA 3O3EB 1ZTXH 2G5BA 1IVLA 3B5HA 4PTUB 3S96A 2Z92A 1LO3L 1A9EA 3QXWA 3VG0H 3V52H 2YPKB 4YE4H 4PJCA 1NFDA 1FLRL 2A9NL 1U9KA 3FRPA 1XGRA 1CDBA 1Y18B 4KTEL 4Z78B 4XP1H 3K8LA 4RMSA 1CQYA 4WU7B 5B8CA 1J1OH 1JN6A 1AIFB 5IF0A 2DL9A 4JZJA 1H3VA 1W72L 4LLMB 1QO3A 1FL3A 4K7FB 3QYCA 3RJQB 1P4IL 3LMJH 3QZWG 1CDUA 1U8JB 2EEDA 1A8JH 5I17B 3IAGC 3MLRL 4DN4H 1A6ZA 1JHLH 3OKKB 1WBXB 4N0RA 2GTZB 1T6VN 4JRXE 2DQEH 2BHYA 2JJUA 4NM8H 3X12B 4DGYL 5C2BH 2JTDA 1WV7T 4PLKD 1KTLA 5AYUL 4WUUA 1HIMH 3MRCB 2VQ1A 5SV3A 1ZLUK 4QTIL 3HG1E 1ZEAL 1NGQL 3HR5B 3GMQB 2ATPB 3BUTA 5I1HH 5ID0A 2IADA 2DLHA 3LN5A 3TO2A 4P2RE 5F8RC 3F6IA 1VENA 4FQHA 3M17B 4ZFOL 2CO7B 2I60H 1NC4A 4PTTA 4U1GB 4Z76A 4OV5A 4TQEH 3M1BB 3NCYS 4M7ZC 5TF0A 2VISB 2GIYA 4YPGB 1H3PL 2DJSA 1N0XH 1F2XK 4WGWB 3HMXL 4IM8A 3DTXB 3ARBB 1A3RH 3UTQB 3MROB 3UTSD 5F97E 4G9FB 3LKSB 2DOCA 3AS3A 5DQ9B 2VXUH 1JZ4A 2YZ1A 2HJKB 3C6LB 1BECA 3BHBB 3KAAA 3VDAA 3L3IB 4MA1B 2YEZB 5GGRA 5ICZA 1P4BL 2IQ9L 2J8UB 2CDFA 3V6FB 2IWGA 2ZJSL 2ZSVA 1BBJA 3EYQC 3AUVA 2IQAB 4JFDE 4QRPE 2LU4A 4P57A 4RMVA 5C7XL 3F5WB 3EYOA 3HAEB 1FZJB 3B8SA 3DRTA 2L0DA 3J7HA 4HPOL 3CMOH 5JW4R 3WV0A 2OP4L 4UT9L 3FQXB 4AG4L 5KG9B 5J6GA 1I8LA 1K2DB 4KKBC 3HCVB 2F74B 4Y4KC 3G5ZA 2EC8A 4NSKA 4HD9A 3WYRA 3WFEH 5E2UH 2BCKA 1XF3B 3MO1B 4JE4B 1YECL 1OP3K 3WN5C 1GJIA 2CSPA 2WBJB 5HY9B 4U1LB 5LG1A 2F9BT 2DAVA 5F96L 1WIOA 3H9ZA 4WTZG 4TSBL 1UH4A 1ORQB 4P0DA 4TRPL 5JOFA 8FABB 1XAUA 3ARDB 12E8H 4J3VA 1A6PA 5FUCC 2ORBL 2E6QA 3AU1B 1HWGB 2PR4L 4NM8L 4FQQB 4W70A 5F7MC 2XFXA 4PJBA 3P9MA 5BJTA 1KXTB 2I24N 4UU9A 1TTGA 1W8OA 1EHLL 1R3JB 2Z4QA 2R56H 5HHVH 1KB5A 2X1PA 3C8KB 4OGXL 3LD8C 4YZFF 1BLNA 1JJUA 3HR6A 2OXHA 4O2CA 5E8PA 3TV3H 1FRGL 4NNYB 3N1PC 4MXVE 4PJXE 5FYJU 4RIRA 4LL9A 3REWB 4YZFE 2ATKB 3ROOB 4CVZB 1RZ7H 1KJ3H 1Q9OB 2BVYA 3UDWA 3QWOA 1QA9B 1LO0H 4OLYH 1BQSA 2NX5A 2ZUVA 1X44A 2UZIL 4BH7A 1YEJL 5DRWB 2CDGA 2JJSC 4A6YH 3B5GA 2HAZA 5TH2A 4PRNA 1RIUL 4FFVD 5FAAA 5DQ9A 2JJVA 4H1LG 2EC9U 4CBPA 2D7TH 2Q8BL 1A7QL 3B6SB 5DFVD 5DK0A 1JYXA 5DJ8A 4ZAKA 3RWEA 4P23D 2BNRE 1VPOL 4POUB 3FOLA 2XZQL 2EE6A 4HJ0D 2V7NB 4OFDA 5EBWA 1NCAL 4OF6A 2HH0H 5JPNA 3CAFA 1NCBH 5D1QB 3ARFA 2B4CL 1OAXL 2DN7A 1OLLA 1U2CA 2YPLD 3OAUL 2DJUA 4F9PC 3ARSA 1IC1A 1W72H 3BPOC 1SVZA 2YKLL 2HLAA 2NYYC 1MCQA 1N7ML 4L8CB 2M8XA 4NO5A 1P53A 4OJFH 5FGBA 2UY6A 1XMWA 4KFZC 5KSAC 1HHIA 5DVLA 3VXSD 4MAUL 1YNLH 3AM8C 1GGIH 1IC7H 2LABA 4FFWD 1JGUH 2XWBA 3KNBA 5EZIH 4LQFH 4CU8A 4OZ4B 1E4XH 5EG6C 4KMLB 2BSSB 4K8RH 4X7SH 4B7LA 3WJLA 1VESA 4LSTL 2EH8H 4TPRL 2HP4A 1LEIB 4PJDA 1U8HA 3QUYB 4WUKL 4D9RD 1MHHB 3TBVB 1KPRB 4QT5B 1KTRL 2AEPH 2AI0L 3QDMA 2L4OA 4K7PL 1B3JA 1T1WA 1NBYA 4I77H 5KSBB 1DBBL 4JFDB 2ZNXA 3O3BA 2HTLC 3VXNA 4YHOL 3VFRA 1NSNH 3EGSB 3HS0A 2RHEA 4KJQC 2WIMA 3B9AA 3AROA 1GZQA 1S7QB 4WWID 4NC2B 1HILB 4D9RE 4ZXBD 2IALB 4NYLB 5C09A 4FXKA 3NIDE 1QSEB 1VEOA 4L4VE 4YWGL 5F21B 2A77H 4MNQD 4PV8A 4HBQA 3DXAD 1UXWA 2HTKC 2FZ3B 5EU5A 4HFUL 2DQJH 5E6IB 3VXME 1QSZA 2GUOA 4YDJA 1S9XB 4LDOB 4G6ML 1MLBB 3I9GH 4O9HH 5F9WC 3L7EA 3WHE0 3S8WA 2AV1B 1MIMH 1T2JA 3L5HA 4NQXB 2MHAB 3VH8G 5C0FA 3SKJL 5KSBA 1D6VH 4KMTH 4WHTA 3WBDA 3SDDC 3UC0H 3BH9B 1A14H 2AEIT 2DWEA 4YO0B 1SM3L 4ALAH 3DV4B 3S36X 2ADJA 3E6HA 5FYKU 1PKQB 5AZ2L 2PTUA 3EOYG 5TQ0H 4TTGA 1CICD 1I8LC 4JVWA 1QFWH 1UWEH 4LRNL 4WV1B 1TQCC 2FLRT 2CQVA 3GMRA 4L29A 5EUOF 2FO1A 1CE1L 4HJGB 4WNQA 2GK0B 3MLYL 1H15B 2BHUA 2JCCB 4IOFC 1T89C 4HG4J 4PP1D 2APXA 4OGAD 1UCTA 1CICC 4Q58C 2P8LB 1RI8A 5D93C 3P0VL 2H9GB 1CLYH 3SPVB 3QA3A 1IQWL 4K3DH 4R0LB 4YBHA 3MJ9A 4RDQF 3QWOB 3BD4A 1P9MC 4XCNA 1U58B 2EDXA 4LSRH 3WFBL 3CFEB 1FLTX 3ECBB 4YX2H 1IC5H 4IRSB 1VFBA 5CP3A 2MQCA 3MOAL 2PYFB 2VMFA 1QBBA 4WFHE 3ZHKA 1MFAL 5IVXB 5F9DC 4ZFZA 3BESR 4NCC1 4ZO6A 3RZCA 2XA8H 2VAJA 3STZB 4XB8A 1IGTA 4MX7A 4OAWA 1GOFA 4JLRB 1RK0A 4XVUC 3HTLX 4DAGL 4YHIB 3OKYA 3NCCB 4G6FB 3MRJB 3INUL 2IPKA 4R4BB 3PWLA 2AXGB 5BS0E 5CCKH 1KGCD 3JWDC 1SYSA 1OQOA 4PR5A 1TZHA 4JY6B 4NCC2 1KT2A 4RAVB 5J0BA 3O9WD 3J8F7 1KLGA 4D0BA 9CGTA 2R0LL 2NLJB 3O8XA 2NZ9C 1MH5B 1WJ3A 5EUKA 4M93C 4HFWA 2DF3A 4KDVA 3STZA 2D9QB 4R7DB 4UDUB 3AB0B 4XCYB 1J12A 1I1CA 1EDQA 3LEYH 4K3GA 1R5IB 5L88H 1VPOH 2FR4A 1QYGH 5CGMA 1B2WH 2DMBA 3OBAA 1HHGA 4U0QB 3T4AB 1WLHA 1DUYB 4BSVB 2ZSWA 3O4OB 1BMGA 3T0WA 1WIUA 4M61A 1P5VA 1DEEA 4P3CH 1N4XH 4XPAH 5CZVH 1HKFA 3DUSA 1MWAB 3WFHB 1LO0L 1NCNA 4OCYH 4UI2A 4HGKC 2CDFB 3OPZH 4J3OC 5I1IL 1S78C 1DUZA 4GRWE 3EO1A 1QBMH 5E95B 4PGEB 5JIKA 4NQCD 4IRSD 4LVHB 2YD1A 1XGUA 5I66A 4Y2OA 4K3HA 3WKML 4OGAC 3D25B 1BM3H 3TH2T 4R2GD 3U4BL 1OGTB 2RQ8A 5E94A 4NKDA 2ADJB 4WHCA 4M03A 3RVXD 3C6SA 4LHQB 1NCDL 2PW1B 4I1NB 1EO7A 1VFOA 1QBAA 3GMQA 4AM0B 2QR0B 1DQML 4XAWH 3ZTJG 4FFYH 4RZCA 4JFQA 3RU8L 2AV1A 3K2UH 5J9PA 4GW1A 5KVDL 3P11H 4O5LH 2F19H 4PY8I 3PP3K 1FYHB 3DURB 3C08L 2XKNA 2E9JA 2BSRA 4YHZH 1EEUA 1AE6H 3BIBX 3OGOE 2QQLH 1G7QB 4HT1L 4M9PA 1A9BB 1QD0A 3VGAC 1I7TA 3CC5B 1MLCB 2AEQH 3HHRB 1FIGH 5I1KL 3C60C 2FD6L 2X05A 2XT1B 3O41A 5ACLA 1G7JB 3P4NA 3OWEA 1CXFA 3G04A 4NRXB 4ODSH 3A6CL 2FNBA 4KDTA 4NNXB 2OI9B 2YD8A 1XF4A 4L29B 4CRPA 1F42A 3NABH 2EYTB 3H42H 3MJGX 2FATH 4KKLC 5ESQA 3H3KA 4Y2DB 4FFZL 4UV7L 3BH9A 5L8JB 3TO4C 1I1AD 2Z91B 4JO2H 3U9UB 2AK4E 3DX6A 4PJDB 2R8SL 3GSRA 1KN4H 3PWNA 3RVTD 4IIQB 5D1XC 3PIQA 1W72B 2EDYA 4PJHB 3IDXH 1RSFA 4R3SA 3DO3A 1JGLL 4HUXA 3SN6N 5IMMA 2HWZL 1MNUH 4NQCB 1SJHB 3HUJF 2FWOB 4H1LA 2XV6B 3TT1L 3RUGA 2WWKO 4HV8A 3TO4B 1M71B 5MENE 3BGMA 1S7QA 1YMHA 4JO4L 3MLTB 3I75A 4HIHB 4XC3L 4TTDD 2VLKE 4UV4L 4HUUB 4HCRH 1KPUB 5DEZA 1AD0B 3HKFA 5DJ0A 3STLA 1QHOA 3CFDA 5LWYL 1EUUA 3MRRB 4OZHB 3SKOA 2GYSA 1NEZG 4LCWE 3OKNA 3NZHH 4JAMA 2XIDA 3IDYC 1T80A 5DRNA 1T7WA 5GJSH 3NFPA 2A2QT 5EN2B 4OTXH 5F1IA 1WFOA 3KLHC 4KJWC 2W92A 1SEBA 2AJYH 4PTUA 5ERWB 4KK5D 1MJ8L 4I5BB 1IKNA 4PGBB 5C0IB 3P9LB 2DQEL 5DD1H 5J8OA 5A2FA 4QXGH 4WI8A 4Z7VE 3BX7C 2OQJA 2R4RL 3QI9B 4M1DH 1R3LB 4GRLA 3SKOB 2GCYA 4JPWH 4EBQH 1PEWA 3K74B 1ZWIA 4Y2DD 1UJ3C 4U7MA 3ROOA 3ZKND 5K93A 3HA0A 1ND0B 4K3JL 4MVBD 4UDTA 1ES0B 5JTWA 3BZEA 3IS1X 1NGWA 4HC1L 2VZ1A 4JKMA 3LB6C 3VFWB 3FT3A 3O6LL 4XMLL 4DVRH 1Z2KA 3VXMA 1FAKT 1MFDL 4PJ9A 3WE6B 3FT2B 3N0PB 2WWMC 4X9GA 1LK3L 3MRGA 4GUPB 5TDPB 1P1ZA 1OWRM 3FOLB 5DHYA 1ZLSH 4JY5L 2ZCKH 2GSGB 4G5ZL 5KSVB 2VH5H 4O58H 1N6QH 5IMOB 3VXUE 5GS0L 3R8BB 5IG7B 4L3EA 4P46B 1BD2D 5E8OA 4FQ2L 5JPMB 5C0BA 3FT2A 1P4LB 2YXFA 4D0CA 1NCDH 3VXRB 1EVUA 5L2JB 5FO9A 2NTFB 3WN5A 4PRPB 2IAMC 4MZ2A 2VC2H 1ETZA 3HNVL 3X14B 2IPTH 5DD5H 4MA3A 1F4WH 3EJYD 3ZTJH 1AGFA 4NSKB 1X6NA 1C16B 3A6CH 3DGGA 3FQXA 5D9SB 1GHFH 35C8H 3RHWK 3OGCB 1M7DB 1YEDB 3ALWA 1FIGL 5I1KH 3RBGA 5CGTA 1K4DA 1T5XA 4AEHL 2V9QA 3LRGA 3QI9D 1IM9A 4JFEE 1CQKA 2IQAA 4QXWA 4HKXB 3QUYC 1E28B 1JZ7A 3UAJC 3ZKMC 5FYLE 2LU3A 1Z5LA 2GEEA 1T1XA 4G42B 3ARDA 2QJDA 4JFHD 1N8ZB 2X4UA 2ERJB 1GSMA 2IPUK 3B2UD 1XT5A 2WBJA 5F89A 3CSGA 5L88L 1PZ5B 1GGYA 3H0TB 5HHXL 5MENA 5FOJA 4C59B 3RIAF 1XH3A 3ARFC 4Z8FH 4U49A 1HINL 1T1XB 5L6YL 5KAQG 2F8VA 5IVOA 5M95B 1AY1H 3EO1B 4RWHA 1BVLB 3K2MC 4YDIL 3RRQA 3D85D 3C2SA 4HWEL 3RVTC 3BP6B 4P23B 2ERJC 3P0YH 3RPIB 2EO9A 1LO4L 5AUMA 1KCRL 2YC1A 4MXQC 3QWRA 3INUH 1S3KL 2J8UA 5SWSD 4HAGA 4FQLH 5CWSA 2HJFA 4PJHA 1Y6KR 3V5HA 2IF7A 2WWMD 1T03H 2MQ0A 3V6FA 3P77A 1F6AA 2O5ZH 5C86A 1KLFA 4OFPA 5C6TH 5CEYB 2NCMA 1DZBA 2YOCA 2YPVL 4AYFA 1HKLH 3X17A 4DZ8A 3RWFA 5D2LF 1FPTL 1JWUA 3FN0H 3CLFL 1WBXA 2Y07H 5E8NB 4M9OA 4G8FA 4IBLT 4WV1A 5DMIH 3CH8A 3VFTB 3QCTL 3IDMB 4DGIH 1HYSC 2FH8A 1UCBL 2CRIA 2ITDA 4X6FB 2E27H 3OJDA 3L6FA 3K8KA 2XZZA 3OKEB 3U4AA 1MAML 2AABH 5FGCB 4FXGB 4DKAA 3V7AE 5CGYC 4TOYH 3A0OA 2CKBL 4P49A 4KK9D 5EC1A 1C1EH 4M6AA 2ZCLL 2GTWB 3BW9B 4JFHE 1EVTC 3LKOB 1QLFA 4EI5C 5L7XL 1VB9A 2FBJH 2IG2H 3SQOL 1OAQL 5DJXB 4JFQB 5KANI 2VDKH 5F7EH 4P23C 2F5AL 1IMHC 3LS5L 2XWJA 4I0PB 5FK9B 3U1SH 5FKAB 3FRPG 3KYOA 4J12A 5AG9A 3Q5TA 1J8KA 3G9AB