1U41A

Crystal structure of ylgv mutant of dimerisation domain of nf-kb p50 transcription factor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
103
Chain Sequence
NLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIIRFYEEEENGGVWEGFGDFSPTDVHRQFGIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Snapshot of Protein Structure Evolution Reveals Conservation of Functional Dimerization through Intertwined Folding
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Nuclear factor NF-kappa-B p105 subunit
total genus 18
structure length 103
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u41A00
4APQA 1G84A 3ULUE 3PWPA 3FHAA 3WFEH 2HLFD 2NXYB 2R9HC 5DJ8B 3HC4H 4MQ7A 1LDPL 4PJEE 4OLZH 5HSFA 3TO4D 2NTFA 3KJ6H 4JFPB 4K3EH 3SE3C 2EE9A 1H5BA 2I5YH 1X5ZA 4ODUA 1PKQE 1IAKB 1YEHH 4JFDD 5FYKE 2J12B 2R39A 1TQBB 2YA2A 2J8UB 1NEUA 1G9NC 4GOSA 2VQ1A 3P4OB 1E4WL 3NABH 2QV2A 3BKYL 4XP5L 3RJQB 1X5GA 1U8KB 1I1CA 3LDBB 3F7YB 4ZQKA 3BDYH 2DLTA 4WI8A 4PTUB 1BFVL 2PW1B 1DZBA 3EOBB 4NUGL 5CIPH 4NPYB 1NAKL 2ZOKB 3D3VA 4J3WA 1AXSA 2YA1A 3W11C 5SWSE 1T5WA 3EUUA 4JM2F 3FQXA 1FCGA 1YYML 1UVQB 3G08A 2EEBA 2XTLA 4YDLC 2PW2A 4OZGB 4DK3A 4DJMA 3D39D 4Q9CA 4KQ3H 3QEQA 4KDWA 1A7QH 5ISZB 5J3HD 3LKRB 3HZYA 1A6UH 5I9QC 3MRGB 1HK6A 3ARDA 4X98A 4W70A 5C6TH 3UJTL 1KIRB 5IB1A 1BQHG 4U1NA 2XN9A 2NX5B 1F4XH 2DJUA 5D1QC 5ECJE 2VR5A 1RUAH 1QBLH 3MREA 5D7SH 2VE6B 2FO4B 4OCSH 4PJ5D 4OGAD 3T0AA 1WF5A 4OF3A 1D6VH 3S36H 4KC3B 3VXSD 4JFFA 2OSLA 1T21B 4X8JA 5I8CB 5E7BA 5FYLE 4NWTL 4WUUD 4YPGA 1A6VH 3TNNA 5JHDE 1UADC 3NN8A 3ZLQC 2YMXH 2XZQH 1ORQA 3INUH 1G6RA 3PWUA 5EU3A 1P84J 3U82B 1MCQA 1TTGA 1X7QB 2F53B 1CK0H 2VZVA 2WWKO 3VFNB 4OZGE 2YUWA 1DVFA 3FFDB 4GW5B 2BOCB 3BOVA 3PGFH 4TUOB 1BJ1J 1INQB 3LV3A 32C2B 4LASH 3DV6B 1INDL 2BVOA 2AK4D 1JPGB 5EORH 4ZAKC 4XBGB 2DQCH 2DKSA 1BGXH 4X5XB 1X4XA 2P5ED 4B41A 3EO9L 4L3EE 4LSSH 3WNKA 3GHBH 2C7UB 4NOFA 1EO7A 3QXVA 2ERJC 4ZUSA 4ZNEE 4HPYL 1FFQA 1G1YA 1EXUA 5F1IB 1WCBB 2J4WH 1NUDA 3MRKB 5F7LB 3ZE2F 1S9XA 3QG7H 3TZVD 3PIQB 1DE4B 3KPRE 2JTDA 2R1XA 4HGKC 4MNHB 4V1DD 1DR9A 5K59F 5LWYL 4NRYA 3WS6A 4GAYB 1H3TA 3IKCB 4KUCF 2RB8A 3UTZA 4R90H 4WUKH 4IHOA 2WINB 4H88H 4HLZG 3N50A 2VXVH 4KI5D 4OUUB 1RUKH 4NNXB 4M03A 3T0EC 2I60H 1EGJA 5DVOA 4FQHB 2AK4B 3QQ3B 3BPCB 3TBTB 2CK0L 4GRLC 1UENA 3RVXC 4LQFL 5AG9A 3S97C 1IEBA 2WQRA 1Z5LB 4NQVB 4PUBL 2DLGA 3O6FD 5DJZA 5T1MA 4O2CB 5C2BH 1Q94A 5C08D 1CGTA 2IAMB 3O6FA 1RQ5A 4IDLA 5AG8A 2E9JA 4H5SB 1MJJB 3QXDA 1CLZL 4ZUVA 1G0XA 3DX9A 3KXFE 2XY2A 3PWPD 4ZPVA 2ICEB 2WANA 2ICWB 3FO9B 4GG8B 3ZE1F 4FTVD 3SE9L 1LO0L 5FYJE 5ADPL 1K5NA 2GSIB 5DO2D 1S7VA 4AQOA 1MRFL 4OLWH 3RIFF 4WUUB 2YZ1A 3TCLB 5KS9B 4HIIB 1CFSA 3S34H 3MGAA 4JO3H 4U1LB 4PJ5E 4X6DB 2IALB 4RFEB 1EH9A 2ARJA 1PZUB 3EW3B 4NJ9L 1CLZH 1GH7A 2ADFL 3LKQA 4M43L 4G80A 2C26A 1RUQH 5DFTA 4DKFH 4J3TA 2NTFB 5BRZE 2F58H 3VXPA 1TZHB 1F90L 4KKLD 4ODUB 2LE9A 2H32H 4DGVH 4NP4H 3MRJB 2VTFA 4BZ2L 1AGDB 1KCUH 4PG2C 5E6ID 5IMMA 3WE6B 2IH1B 4G6FB 4O02L 1Q9WA 3BRGC 1AC0A 3BVNA 3IFPB 4PPTA 1RUQL 3LS5L 4DKFL 3EZ8A 3BZEA 3GSOA 3ARBB 1I8LA 4QYOA 3UZEA 3C6SA 1EHAA 5C0ND 4EI6B 2FEEL 1YPZB 5C9JB 1ZVSB 4MVBC 1HHHA 1QD0A 4QRSB 3OGCB 1YEIH 1T1WB 3ESVF 3ARBC 4YZFF 2BP3A 2LU3A 1N7ML 2IFGA 3O2DL 3RL2B 4MXWH 2C3GA 5EO1B 1CD0A 5DS8A 3A6OA 3LS5H 3O6LH 2YWYA 2AAVA 5HHVL 1ZHKB 3GSQB 3ZKMC 2FHCA 5DVMA 1W0VA 1FZMB 5F9WC 5IFHL 1KB5H 5CLWA 4NQXA 3QNZB 1GZPB 5JW4M 1FN4B 3D85B 3EJYD 2HYMA 4D9QE 5J6GA 1X5AA 4H26B 4K94L 4HZLA 4P2RD 1YEIL 4N0CC 4TVSa 3SDDB 1D5BA 3TA3B 2BNUA 1AI1L 1MCSA 4B53A 3SCMC 1RI8A 4Y16C 5GRYA 4BSJA 2AABL 4KK9C 1ZS8A 5HYSG 5HYIA 4XVJH 4NRXB 4P2CG 4CW1B 1EFXA 2M26A 5DT1H 4PRIB 4PIRF 3O6ML 1QR1B 4PJCB 1D6VL 3PWUB 5FUZL 4FRWA 4JY6A 2I5YL 1N3NA 4PTTA 4HAFA 5GGTL 3ZDZE 4XVTL 5F88A 1UB5B 1D5XB 1X44A 3N1QC 3O8XC 1K8IB 1BOGB 3U4BL 1CGSH 2BY2A 3L5WB 3ZL4L 3P9MB 4M7KH 1BBJB 1NBZB 1T6WA 3QEUB 4PJDB 4XVJL 5D7LB 3VXUB 4Z7WB 2FB4H 4O00A 3RFZC 1Q72L 2I9LA 4Y4KB 4EDWL 5IB5A 1YN6A 3T1FA 3QZWA 2YPKA 2I24N 3L7EA 1FL5A 3IKKA 2X4QA 1KPRA 5IG7A 4PJGB 4PLJC 4MS8D 3IU3A 1E4KA 2DLEA 2FR4A 1MI5B 1HXMB 1AQKL 3S96B 3RJDA 1YY9C 2ED9A 3WN5A 3LRSA 2MWCA 1CXLA 5F7FA 5L9DH 3OWEA 2VERN 4XCNB 1JZ4A 1XF4B 3RKPA 2Y06H 1Q72H 3QDAA 3EO1B 5D2NC 1LEIB 5LBSL 3V5DA 1T7ZA 4XGZA 4JGMA 3TIDA 3LEVL 4QOKE 4RDQG 2E3VA 4OM0H 1MLBA 2Q6WB 2C5DC 1G9MC 5I1DB 5B39G 3TJHD 4N5ED 5L88L 3A6BL 4XNQA 3ULVL 5DFWH 4QTHB 1RUAL 1L0YA 4HS8L 4JFYA 1GIGH 4K7FA 1LWRA 1QKZL 1KJ2L 1YEKH 3RWDA 4W6XB 3WLBB 2QTEA 1L0XA 3ARGA 5IFAL 3QUYA 2D03H 4G8GD 3BUYA 4KJYA 3SBWC 3WIIH 2J8UA 1FCCA 3KR3L 1IC4H 4HKZB 2W07A 2ZKHL 1PKQB 1UM4H 1EHLL 2GSIA 4R4FH 1QFPA 2FZ3B 1GIGL 4JM2A 1TVHB 4FA8A 4HT1L 4LCCB 3O3EB 4OZHE 4A6YA 1FNGA 3TBWB 4LLAA 2NXZD 4MA7L 3RUGF 2VXSL 3Q3GB 3RHWK 1QPPA 4OZGF 5F1IA 3PNWA 1YMHA 4ORGB 5DQ9A 5DVKA 3JSSA 3HZKB 3C6LB 3UBXA 1NANI 2KBGA 4YHZL 1V7NL 4LEXL 5L6YL 4ODSH 2E5EA 5IHZB 1R24B 4U6HA 1JPFB 3RWEB 3HCVB 1I1AD 3MNVA 3F7VB 3PP3H 3H9HA 4LBEB 1NC2A 3RGVA 4M7ZC 2D9CA 3D2UB 3QDHA 4Z7UB 1QP1A 2BHYA 1PX4A 3FT2A 1U8QA 4TUJA 2X4OA 1V7NH 4LEXH 4MJID 5D1XB 1IVLA 2BRRL 2R0WL 2NR6C 5I71B 4PP2B 3W81A 3BZ4B 4NBZB 1VCAA 3NPSB 4XPTH 3HUJA 3FB5B 2EH7H 5JQHC 3KPSD 4X6DF 3WBDA 3O9WA 1R5VB 4WO4B 2CQVA 4M6NH 4N8VA 4I0PC 3SKUD 2EDTA 1G7LA 5FUCC 5DFVD 5FHAL 3WIFB 1QEWB 1GGYA 1FO0A 1N64H 1UC6A 1DLHA 3QA3A 4ESKA 5DS8B 2JCCA 1S9YA 4EXPX 1S9VB 4KK5D 3ULSB 4LRNH 5CAYB 4HCRA 4R3SB 1DVFB 2QJDA 3FFDA 5IP4A 1HYSD 2XWJB 3OKKB 3U9UB 4PR5A 4N0UE 3DV6A 2IANA 4YDJA 4OKVB 3HNVH 2V5TA 2BCKA 3O6KH 1CLOL 2NXZB 4Y5XB 1RULL 4YGVA 3KPQA 5DT1L 3JV6A 4JO2H 3ZDZF 3JWDC 1F90H 1XT5A 1MJ7L 2XQYG 4MXVE 5E95B 5C0JA 1B2WL 3NFSH 2E8YA 1QFHA 1PG7H 4OD3H 2VWEC 4AM0B 3V6ZA 1BLNA 1F3DH 1KCUL 3DV4A 4PJ9C 1CT8A 3QRGH 1QLEH 1KIQB 3T08A 4NFBA 1XF3A 1BAFL 1NLDH 1IBGL 5GRXG 3FT3A 4NKMB 4BZYA 2CD0A 1FLTX 4QHNB 2AXHA 5GS3A 2ORBH 2V2TB 1R5WA 3R0NA 4W68A 1T1YA 4JFED 2OJZL 5D8JL 4PJEA 1SYSA 4AJ0A 1U91B 1DQTA 4KGJA 1T66D 2H2PC 5DJZB 2E6JA 1FG2B 3O8XB 1W0WB 1RZGA 1OY3B 4TULL 4MQ7B 4HG4K 2FJFA 2EO1A 3RUGE 1D9KB 4JZJC 2V2XB 3GUTB 1MWAL 3U0WH 2Q6WA 3SKOA 4ZFOB 1K9TA 2ZZUT 4ZSOA 3AREC 1QG3A 3DVIA 1ONQB 3BKYH 4YIQA 5EU7C 1P1ZB 1FAKT 4UOW1 5SWZE 5T5FH 2Y9RT 5DLMH 1F4AA 4XAWL 4OM0L 4PJ8D 1FJ1B 1AO7A 3TN0C 4RFEA 3V6OE 3HAEB 2RFXA 2GI7A 1GGUA 3E8UL 4R0LC 1J7VR 5KW9L 1LDSA 4OIIH 2X4RB 3UO1H 1J8HE 5EOQL 1NGYB 5JLZA 4NN5C 1TVDA 2RGSA 4Y4KD 1I9RH 2VH5L 1CG9B 5IBTH 3CAFA 3G6DL 4U7SA 4I9WD 1C16A 1A1OA 3U9PH 4UT6H 5KVMC 35C8L 3U46B 3N1PC 2XRAH 3ZDXF 1TZGH 1A7QL 2C7UA 4LIQL 1LQSR 4N1CA 3EFDH 3FQUA 4XMKL 1OP3H 4QRPD 5GS0D 4QGTA 3ZTJG 1J18A 1KPRB 5IG7B 5A2IH 3K2UL 5HY9B 2B1AL 3V95A 4OTXH 3ECBB 3FAWA 4XXDB 3GSNB 1YPZF 3IU3B 2F54E 3UO1L 4DCQB 4RCAA 5CBAA 1N5AB 1J05A 2OZ4H 3T0WA 2F15A 4TTDC 4YLQT 4YE4H 3TP4A 4Z7OE 1OP9A 4OV6F 5C3LD 4NDMA 2G75A 4UT6L 2VLKB 1IT9H 4JKPH 3WS3A 4YHNB 1EEYB 5CBEA 3WO4B 4Z77B 4F57L 4D9LH 2VDPL 3ARFB 4NGHL 2X4UB 3D85D 4LPWA 4JPWH 1JNHB 4F8TA 4LPXA 3BZFA 3VXQB 3LPWA 1OT1A 4P9MH 5FGCB 4CAGA 1I9JH 5DD5H 1G6RH 3BJ91 4YE4L 3EOTL 3HTLX 4WHTB 4KZDL 1EJOH 3MO1B 2UWEA 3VDAA 2DQHH 4GKSB 3WNMA 3H42L 1D5BB 5JIKA 3TA3A 5EORL 5DURD 1BGXL 3DTXA 3IJSB 3UTTB 3MNWB 5B22A 4ETYA 4K3DL 4P2OD 3HI5L 4J23A 5JR1H 2HT2C 3V4VH 4DTGL 3OGOE 3L3GA 1RHFA 3FRUA 4MLIA 4Y1AE 3SJVE 4QCIA 3KYKL 3NCFB 2XI9A 4UT7L 2P43B 4JPKH 4K7PX 4Y5VA 2X4PA 4JY4A 4EVNB 4N9GA 4NQDB 2KKQA 2CDFA 5SWZB 4KTDL 4PR5B 3TH3T 3VWKA 1WAAE 5CJXC 5ACMA 3NCBB 3WXVH 3IETB 2XY1A 3HB3C 3ULVC 1BZ9A 4PLJD 3C8DA 5DR5L 1RJZA 5HD8D 5GGUB 1L7TL 2I25N 3P2TA 3FO2B 1M6OB 3C6LA 3UBXB 2LU7A 4NRYB 1C5DB 3L6FB 1CTOA 2IH1A 5JPMA 4EI5D 4G8GA 3ULVF 5E4IA 3VFOA 1JGUL 1V7ML 5IMKB 3O8XD 1N6QL 4Y5YC 5BV7L 4YHLL 1OGAA 3IDYB 5C0RH 3C6LC 1N4XL 4X7TB 3IRPX 4YUEH 5BQ7B 4CVXB 1HH9B 4WEUD 2R1YB 3OKEB 4U1MA 2APVA 2MOVA 2O5ZL 4PJAF 4LPCA 1MRFH 1W2KT 4ELKA 4WIQA 1BQUA 3NGBB 4L8DA 5DA0B 2EDXA 3B3IB 3BPNB 3VD3A 5B4MC 2B39A 2HMID 4HV8A 2HN7A 3MRMB 4WNQB 1OAKL 4P57A 3SDXF 2Y4SA 5JOPE 4MJ2A 2EIZA 1EFQA 5DJAA 4KKAC 1PG7X 1A9EB 4KVNL 3K4DA 3OHXB 2ZCKL 4Y19D 5IW3A 2J5LC 4RGOH 4XP5H 5E70A 1TQBC 4X0KA 4IOSD 4WV1B 1ZLWH 1A47A 4GMSH 4MA8L 3V79C 3FRPG 3LPFA 3FL7A 1BFVH 3V0VA 5DJ0A 5F7HA 3MLWL 4GSDH 3QIWB 3ZT7A 3LMJH 2FATH 4JFZH 5FFLA 4DGYH 3BIAX 3VFUB 4HF5L 2GSGA 3MV8D 1DUYA 3G04A 3TBYB 4P5TC 1WIUA 4G5ZL 3LB6C 1VFMA 1N0XH 3FN3A 5FXCH 3U30B 4UIKH 1U8PA 3HAEA 4Z7OF 4XAKD 1N5YH 1BBDL 5DUPH 5J6HA 1YN6B 1S7RA 3GZKA 2FATL 5L2KA 2DL9A 2E7MA 2B20A 5E94A 4LEOB 4RNRA 4GMTH 5IBUG 3MGTB 1Z3GH 1N59B 3WFZA 2Q7YA 32C2A 1DBAH 3G5YA 4RAHA 5F93C 2EIDA 2GFBB 5FYKU 1E6OL 4W4OC 4HXAH 1ZA6A 3LKOB 2WWMC 4X5XA 3BDBA 2HT3D 2BY0A 5DUBA 3BE1H 2COQA 3FQRB 3GGWA 3STLA 1WZMA 2HLAA 4WO4C 5JPNA 3VXSB 3C5ZB 2QSCH 3AMKA 1XF5B 3OB0K 4D0DB 3L3JA 1JNNH 4PRAA 4XP4L 3K8KA 3DYOA 3MXVL 3D9AH 3CC5A 1A2YB 1D5ZB 3L5XL 4HC1L 4GAJH 4XVSH 3VXMB 3OR7B 4P4KB 1ORSA 4NO0B 3GKZA 2VXTH 5IT2L 1K2DA 5C0CB 4NYLA 4JPWL 3D39B 2FDBP 4OLUH 4IMKC 5FYKL 2HTLD 2V7HB 4RISL 2FB4L 1HHIA 5BW7C 3CVHH 3HZVA 5F89A 5FOJA 4NZUH 1IAKA 4IOIA 5I17A 4Y5XC 2BY1A 3LSOB 3MOBL 3HR5A 2DQEL 4GRWF 1A02N 1XIWA 3VD4A 2BCKB 3PF2A 3SE3A 1MQKH 1WFOA 2DQIL 2FLBT 4LSQH 5HBBA 4ZOCA 1HKLL 1HQ4A 1FPTH 1QBAA 1GPOH 4JVPA 3CVHA 4KJQC 4OM1H 1UH2A 2X4NA 2Y06L 3F7YA 4NC2B 4WWKD 4ORGA 1RHHA 2GTZB 3RBGA 4OZFA 3RIFK 1RIHH 3RWFB 1HQRA 1TDQA 3MRHA 3PWNA 3I6LD 5AAMA 1FNHA 4Y8DC 5F96H 2XN9D 2JELL 1OD7A 2EDFA 2XWTB 3ALWA 3GMLA 1AKJD 3THML 2GITB 5JA9A 3UX9B 1BOYA 2HMIC 3VXOB 2KUTA 3BO8A 4HUWA 3QCUL 1KCKA 2PF6A 3UJIH 4CMHB 4KZEH 5T33H 4WTXA 3DYPA 1RUMH 3RKDC 5EIIA 5E00A 4NHUA 1ZWIA 1JK8A 4LVNC 5ITFA 1A0QL 2RIKA 5I8OH 4EOWH 1H15B 3K7UA 4LPYA 5E4EB 3PWVB 2BVUA 3U36A 1I8IB 3JWOC 3HE6C 4JQIL 3S35X 1OAYL 4FXGA 3ROLA 3MNZA 4XCEB 3V5KB 3HE7D 1F58L 4EI5C 3OXRB 2P8PB 1NC4A 1VADB 3EDFA 5E5MB 2B2XL 5D1QA 1WAAA 4O9HH 2B0SL 3Q5TA 5JUEL 3LD8B 5HHQB 2NTSP 3HAEH 5DJCB 3H42H 5I8OL 1ORQB 1S9VA 1A7PH 1BD2A 1MUJB 5FDWA 3MUY1 3OV6A 4HQQH 1W8OA 3GBML 2V6HA 3GSRA 2XWJA 1IGIH 2YK1L 5DHXB 2OJEA 1TVHA 4TNWK 3ARTA 5FAAA 2QADB 1W0VB 1F4YL 1F58H 4UU9A 1JYWA 4XX1G 4OCXH 2BMKA 1JF1A 5EZJB 3U46A 2NLJA 1B0GB 3TT1L 4LQFH 2HJKA 4HDIB 1XR9A 4XZUA 3EYUH 4M48H 3MRDB 3BAEL 4CNIB 5DJ0B 5I2IA 1XGTB 1FSKC 4F15B 2ZG1A 1CL7I 1RVFL 4HS3B 2ITDA 4ZUSB 3MLUH 1E27B 5TDNA 2WIMA 3L6FA 1EO8H 4I0KA 3EAKA 5C09B 4OGXH 5L8JB 1F5WA 3SE9H 3FFCD 5D7KD 5E2WH 1JGLH 3TBYA 2CLVB 4JFXA 1F4YH 4N9OB 5EO0A 3MRCA 4J3XA 4QXUL 3GIVB 2FECL 3NA9H 3S35H 4CDGC 1KJMB 2MTPA 3TT1H 4JAMA 4WW1B 1UB5A 4ZXBD 3VXRD 2PYFB 5CJOL 4K3HA 1IZKA 4PJEB 4M43H 2KH2B 4FTVA 4BQ6A 1TZIB 4JANA 4AIOA 4EUPG 3ARBD 3D0LA 3U4AA 1C5CH 4MQXC 5GZOD 3N1MC 3PWLA 4G6FD 1VPOH 3QJHB 3PP4H 3LRSB 3J8F7 4FFVC 5E6YA 1BECA 5IKCB 4U6TA 1NSNL 4QRUB 3L3JB 4QRTB 4P4KA 1S7VB 4YHKL 4NQCE 4YZFE 2K9UA 1G7IA 5C0FA 4MNGB 1KLUB 1RJYB 1A7BA 2GJZA 1I9IH 1L6ZA 1B2WH 3NFSL 1NJ9B 1F8TH 4FQXC 3B2UD 4HK0B 1AR1D 4XVSL 2BNQB 2O26U 3VGFA 1MLCB 1ZANH 2DM7A 1RY7B 3LN5B 4RFNC 1GSMA 3HNSL 5DUML 1AY1H 1MIEL 1CD9B 1ZSDB 5L9DL 4G3YL 1JZ8A 5FM5M 3SPVA 2ZUSA 3EOBA 5ICZA 5CILH 3O4OC 5I1IH 1NCAL 5AYUH 4G43A 4N1EA 3HR5B 4E41E 1XZ0B 4XXDA 2HP4A 4KKCD 1ZHLB 4KUZH 3CSGA 3QISA 2RHEA 3JWOL 4NQTA 3FFCE 5D7KE 1A4KB 3G5YB 4YXHL 3IAQA 4R97B 2FL5A 2NY1B 1PJ9A 2QHRH 5CEZH 4APQC 3AU1B 2BXZA 5DQDL 2DQFB 1BZ7B 1LE9A 2VDNH 4ZODA 4KMLB 5TQ0L 1X3DA 1VGKA 1PZ5B 4F3FA 4O4YH 2NY1D 1Y0LB 5E7FA 2X4UA 1ZLVK 3N1GC 3IDUA 2KQNA 3VXSA 1S9XB 3MV8B 1G7JB 2G5RA 1JHTB 5IB3B 1T1WA 5FKPA 5A16B 5GRVL 1A6UL 1TFHA 5C0AB 2Z8SA 2HT3C 2ZUQB 1BQHA 5HYQB 1LGVA 2H6PA 2F54B 3MRBB 4LLUA 4PJ9D 1ZT7A 2FGWH 4KQ4H 4XP4H 2DQUL 2BVEA 1FHGA 4FTVE 3D2UA 1RUML 1I1AA 1QPXA 4HT1H 2GK2A 1V3LA 3Q5OA 4ZUTA 2HWZL 1Z5LA 1LO4L 4I0PB 4QT5B 4XCFL 2VXSH 3PHQB 2HFEB 1FG9C 4JHWH 4N0UA 4KKBC 1T2QH 4K8RD 4ODTH 5J4MA 4GW4A 3E2HC 4RDQF 5EU4A 4C54A 2NW3B 1CGWA 4TUOA 2VQ1B 3BZ4A 3CVHL 2DOCA 4Z7WE 3VXUE 1AH1A 4JQXA 1MI5E 5IW6B 1QQDA 5K59E 3RWHB 3IAPA 3F12B 1G7LB 2DQEH 4JZOB 5FO7B 3UBXI 5B4MD 5DJYA 2BSTB 3H3BC 5HI5D 4UDTB 4YDLB 2Z9TA 2OP4L 2FWOB 1HKLH 1QLRB 3QSKB 3GSRB 1MY5A 4KUCD 4L8BB 4Z78A 1WJ3A 5DK0A 4HWEH 5C7XH 5C0BE 1FQ9C 2RCSL 4KMTH 3VWKC 3PL6C 4G8GB 4DAGH 4OZIF 1SEBB 5ENWB 4PLNC 1YEKL 4S1RL 5LCVL 4LGRB 4N8PA 5ID0A 3KYAA 1VSCA 4ALAH 1MCIA 1R3IH 1RUPL 1NFDF 4TUKH 4M1DH 4UIMA 1U92A 2YEZB 1MCBA 4K3DH 1CE6B 4R4ND 4PJXB 5K9QG 4OAWB 3MRMA 5ALCL 1HYRC 1ND0B 1T7XA 5FF6B 4XWOC 4YPGB 1HHKB 3MLTB 3B83A 3OJDB 1JN6A 5TDPA 5C0CA 2QLVB 4R4BA 5C2BL 2ICES 2IAMC 1T0NA 2M8XA 3HN3A 3QQ4A 5LQBH 3UYRL 1JZ6A 1RFDL 2P5WE 3A67L 1HHIB 4ONGH 1P4IL 4P2OC 3WL9A 2VITA 5FO9B 3SHSA 1HINH 3CSYA 3ZZ1A 2PXYB 1I3GL 5DTFB 5GS0L 3EYSL 2C1OB 3T65A 1WUNT 4QRTA 3QUYB 1CIDA 3O41B 1HEZB 1TJIH 5MEOA 1B3JA 3DO3A 5BW7A 3MV11 4G6JH 4K55A 5DD6A 4X8XA 2VZ3A 3EOAA 3ZDYE 4HUNB 4PTTB 3V0AC 2IPUK 4YUEL 4MD0A 1GC1H 3I9GL 3QXWA 3TVMA 1RZKC 1NGQL 1M1SA 5IB4B 1A9BB 1EBAA 2AEQL 5CKAA 4NQED 3SJVD 2A83B 4DGVL 1HH6A 2VXUL 3SJVA 3CMOL 1OM3H 4GXUM 1FNSL 5JQ6L 5D2NB 1E28A 4U3HA 4OF0A 1KYOJ 4JVWA 4QRPB 3NFPB 4NKIH 4FZ8L 4GBXC 1HSBB 3BW9A 5TH2B 2Z91B 1VFBA 5B38B 3MLRH 3NA4A 2YPKB 5EA0H 5IHLB 2W60A 2XZCL 2ZCHH 3GSWA 1D5MB 4RGOL 1J86A 5HGBB 1BZ7A 1OCWH 2P1YA 5DLML 2VXUH 3QUZA 1HXMA 1MI5A 1G7MB 2IBZY 3CX2A 5HPMA 5JQ6H 1WSST 4K7PL 4K8RH 1DBBH 5FA4A 5KW9H 2WZPD 4LP5A 1GOHA 5DJ6B 4HF5H 4JO2L 4X7DC 2JK5A 3SKJH 4B7IA 5D7IA 4IRZL 3LKSA 3RWIB 1IQDB 2YA0A 5HHQA 3DMMD 5JA8B 2GCYB 1T3FA 1VKXB 2JCCF 1BBDH 1EBPA 1WBXA 1NGXB 4A6YH 1EPFA 3GSXA 1DQJB 4MNQD 3HZVB 3CVIL 4M7LT 5I30H 3QNYB 3FQNA 4XWOD 2NY5C 5I74C 3SQOH 3VXPB 3LN5A 3BSZH 3WUWB 4U1HB 5HHNB 1YEGL 4JFEB 3ARGD 4BFGA 3STZB 2DQJL 4BYHA 4LAQL 5GGTH 4P3CH 1IT9L 4URTB 4E5XA 4UV7L 4OT1L 4XCYB 1LO4H 1YQVL 1QSED 2VZTA 3RWHA 2HJLB 4JHWL 3NBNA 1X4YA 3HNSH 5DUMH 4JJHA 5SX4I 4PRHB 4N0CD 1RHHB 2GTZA 4XPHL 4Y4HA 1QFWI 4PRPD 3KPLA 1AGCA 3ARFC 4EN3C 3T8XA 4NCDA 1BPVA 3EOTH 2FL5B 4KZDH 3AAZA 3IFOA 4XT1C 2DQHL 3P77A 4RZCA 1FBIH 3V5DB 4LOUD 1YNTB 4U1IB 3I6GA 5FV2A 3QQ3A 5M7QA 2Q87A 4X6EB 1F4WH 4MVBD 4JKWA 1DEEB 1IEBB 3I02A 1IILE 3SCMB 3TPUB 1FC1A 1XGRA 3IDXL 1Q1JL 4WFGE 5CGYC 4IS6A 5DRNB 3RNKA 1D9KA 4JDZB 4JG0L 5DJ2B 2HKFH 4I3SL 4H8WL 2ZUQC 5MP6H 3K4ZA 3ZYIA 2BERA 1NFDB 4YC2C 3T09A 4U7KA 4QRPE 5DD0H 1HZHH 4HMEA 1X5YA 3LSOA 1U3HA 3DVNB 4CJ1A 4ELKB 2EE2A 1DN0A 3HPJB 3R0MA 3OF6A 4J12A 3X11B 3LH2H 3HUJB 2W0LA 1HHKA 1WITA 1KF9B 1A6WL 3PG2A 2A38A 2OLDA 2MJWA 4JKMA 1BVLB 3T04D 3WEXA 4I3SH 4QXGH 4XC3L 2BMKB 43CAA 1NCBH 2BNQE 2X7LA 1EFXD 2DLIA 3BP4B 5FCUL 3CZFA 4PS4L 1DQMH 5D2LB 1DN2A 1O0VA 4QTIH 1SY6L 4P5TB 3L3DA 3JV5A 4UNTA 3U0TB 2EDOA 1B9ZA 4LMQE 5TF1H 1KEMH 2CO7B 5SX4H 5SWSD 5HGAB 3KAAA 3UZVB 1A0QH 4IRJA 3MUJA 4APQD 2VLRB 4NT6B 1JPFA 4PJHE 1OPGL 5DMJB 1AGBA 1FIGH 5JHDD 2B1HH 1F3RB 3HFML 4IOFD 5C7XL 1T0MA 3DXAE 2KL6A 1VGKB 4RMVA 4WY7L 5ILTL 2PCPB 1B4RA 2QSVA 1FZOA 1GC1L 1LEIA 5TFSH 5KSBB 2B2XH 3ARVA 1EHXA 3MUHL 1G7JA 4E42B 5GS1A 3NFNA 5B38A 3CMOH 4KI5C 3BIBX 2NXZC 5HGBA 1FNAA 3BZFB 1I9EA 4HQQL 3W0WD 3Q6GL 2D4DA 5JNYB 2DTMH 1LK2A 1SEQL 5ESVA 3DI2B 5IV2B 2NX5D 4QY8A 2BRRH 2R0WH 4WHTA 3OJDA 4CRPA 5LVEA 4WI5A 3WMSA 2JJSC 4ZUUA 5HYJE 1LE5A 4Y4HC 5ISZD 5D6DA 2DWDB 3WS6C 3MMEA 4TVPL 3O11A 5IQ9B 1FORL 2H32A 3UPAA 5IIEB 4ENEC 2VKWA 5T1LD 1N4XH 3U6RA 3MV9E 4IIQA 1LEGB 5E8NA 2WBWB 1P4IH 1DANU 2A6DA 4GJTB 4HH8A 1JGLL 3AROA 3QUXD 4PRNA 1NGZB 3DGGA 3NA9L 1LP9F 3S35L 5DURB 1GHFH 3FKUS 1ZSDA 4JKKA 5E4EC 2FD6H 1Q9LB 1PDKA 2V17L 4OZIB 1OT2A 2CLZA 2PR4L 4LARL 4Z78B 4GS7C 1DJSA 4M7ZB 4OSUL 4PRDA 3IF1B 2FJHB 2ZCLH 1AGFA 4BFBD 1F2QA 3ZDYF 1DCLA 4NC1E 4JFEA 4YEEA 1V3KA 3C08L 2EE6A 5GJTH 1J1XH 3FN9A 4M02A 1VPOL 4HUXB 3V6OA 4N5EC 2DLFH 1CI5A 5DYOA 5ICYB 2HJLA 1XR8A 5E1AB 1SY6A 4JB9L 3ZHLA 1LO3L 3FMGL 1FZJB 25C8H 2CKNA 4AL8L 4XBEL 4YDIH 5TF0A 1BFTA 2VZUA 4Y19A 1E4WH 1MEXH 1W0WA 4G5ZH 4W6YB 1M7XA 3RDTB 2VL4A 1I7ZA 3B9VA 1P2CB 1JNHA 1T4KA 5DZLA 1FGVH 4FMKA 1P5UA 2H6PB 4ZYKA 1P7QB 4PV9A 1NGWB 4NUGH 2GK0B 3MOAH 1ZANL 3JWDH 1R6VA 4RAUA 2D7PA 3W11D 1PFCA 4J8RA 5C07A 4LFHG 3MR9A 4GKZB 1UKQA 12E8L 4X4MA 5B3JF 3U4EB 3DX6A 4JFHE 2R29H 1KYOK 1DBAL 2DWEB 2Q8AH 1LEKB 1P7KA 3MNWA 5E08L 4S0TD 2HA1A 2ADJB 1RIHL 1BJMA 1S5IL 3WO4C 3I6LE 1DN0B 3HPJA 5EU7E 1IL1A 3OZ9L 1CDYA 4AMKL 3BE1L 4OUOA 3CUPA 1T04B 4WTZA 1NCWL 5I0DA 4QRRA 5EN2A 2K3TA 3ARQA 5HVHB 3RWGA 1G9NL 4NZTL 2DICA 1A7NH 4AEFA 2GKIA 3OAUL 5F9OL 5EOCJ 2G9HB 3VFWA 1DQDH 3CFBB 5T3XE 1CD8A 3ECBA 5EUOB 4EVNA 5BVPL 3PQYA 5LGKA 4FFZH 3D3VB 4QHUA 3V6BR 4Y4FA 1DUZB 2VXTL 4F15C 4KDTA 3SBWA 3SDCB 1A6ZB 2DI8A 4GKNB 3SE4C 3MV9B 1VFAB 3L3KB 3T3MF 3CFKA 5DRZA 4ZDHA 2NX5E 4FQ1L 4JRXA 2DQTH 3ZKMD 5C0GA 2JCCE 1SY6H 3CFCL 4R2GC 1Y6NR 3SOBH 4JREB 2DM3A 1B90A 1TITA 3S5LB 5KVFL 3O8XA 3LAFA 4P59L 4U1NB 5H8DA 4OB5H 2PO6B 1NANH 1P84K 4KKLC 4LCWD 4L3CB 3LD8C 3NFNB 3P4NB 5KSVA 1XGPA 1TJHL 4X98B 1KJ2B 4X6FB 3BN9C 3ULVE 5MHSD 2NX5A 5BJTA 4BFIA 1UGNA 1ZA3A 3QQ4B 1CYGA 5CIPA 3QDMA 2OTPA 3BWAB 5LKNA 2HKFL 2RFXB 2EDQA 4MCYB 5T1KD 4P23C 4YC2B 5DD0L 5IV2A 3OKMB 2Y36H 1I1RA 3RDTD 3VE0B 2DJSA 3DRQB 4X80H 1LE5B 4MXQD 4UB0H 3O9WC 1JVKA 1HQ4B 4EOWL 4PUBH 3VFTB 4WO4D 4I4WB 3BD3A 1R3IL 1FH5L 1RUPH 4PLKD 4PRBA 4OZHA 5C0FB 2VUYA 4B7LA 2GJZB 5C0JB 4P46B 2CKBA 3KPLB 5D1XD 3ARUA 5DI8A 5HI3C 1KGCE 4AM0A 1U8HA 1TQCB 5CZXC 3LQZA 3RRQA 3CFEA 3P11H 2YUZA 1CXIA 5LGJA 1HSBA 3BW9B 3MRFA 4NNYA 4OGYL 5TH2A 3VWJC 3ZKSD 3UEZA 2AXGB 4F33B 1BP3B 1IGIL 5I6XC 1LDPH 1JGDA 4F7MB 3E3QC 4K71B 5I1KH 1NFIA 3LN4A 1IM9B 2A1WH 3GI8H 4XI5D 5IROC 5EUKA 4OFPA 1LK2B 2GFBA 2WV3A 2V9TA 3BEVA 3M1BA 3QUKB 4Y1AA 5IW1A 1NC2D 3RGVD 3P11L 1I8IA 2LU4A 4LLDA 2GJ6E 3IXTB 3MNZB 4Z7QF 4JB9H 4ZOEA 3DTXB 3OBAA 4C56D 3TZVC 3P0VL 1U3HB 4G3YH 5F7KC 1K6QL 5IVXF 4KKBD 1MEXL 3MV8A 3I9GH 2LV4A 4L1HA 2RJMA 5KG9A 3VWJD 5EU6D 3W0WB 4MA8H 5GISL 3PDOB 3G04B 4PJBE 2OJEB 3JWOH 4MD4A 4GSDL 5JZ7C 3HC0B 4UU9B 3C5JB 3CFJB 5CEZL 1JF1B 2CUIA 1F6AB 4MJIE 4X9FA 3DVGB 4RMRA 5GGUA 2NPLX 1VEOA 2D0FA 4ZXBA 5C6TL 3QO1B 3HAEG 4DCQA 5DSCB 3QHTC 1A3RH 2W0PA 1IGCL 3MV7A 1S7XB 2P46B 1OHQA 3BZEB 4X9BA 1YDPA 1CTNA 3SEPA 4HWZB 2IPUG 2YPLA 4KQ4L 4X7SL 4ERSH 3GEWB 4QF1A 5J1AB 1RAMA 1BM3H 3W5NA 2ZUYA 4HKJA 2FWOA 5C0BD 2Z35B 4HUWB 1ACYL 2AVGA 5C0BA 3ULVD 4OZFH 1A6TB 1T6VN 2D2OA 3BP5A 2R69H 3RL2A 1SVCP 3KPSE 1CBVH 1HE7A 3D0LB 4P46D 4XBEH 5IVNA 1IMHC 1ADQL 3VXOA 2UWEB 3MO1A 3BO8B 4M4RA 3VXUD 1AO7E 1GYAA 4JDVA 3QJHA 4WU7A 4XTRD 3C09B 4KWUA 4L5FL 3D39E 4MA1B 2BHZA 3KPMB 3R8BB 1MCRA 4U1KB 3IVKB 3KYOA 3RVTC 4FABL 1U2HA 2JB6A 1NQBA 3O2VH 4ZPTA 1OOAA 3FQWB 3GHBL 4AIZB 4WJ5B 4R2GD 5A2JH 1HIML 4YBHA 3TO4C 1H3PL 3BWAA 3PQYE 4LSDA 2BVQA 4YWGL 2G60H 5T1KB 3W2DH 2VDKL 4N9GB 1T04A 2VISB 4WWKA 3OKMA 2BNQA 3QIBB 5ESQA 1QEWA 3WYRA 5GJSL 5T3XH 5J8OA 3OZ9H 4AMKH 4CGTA 1DQLH 1F6LL 4LIQE 4NPYA 1DLFL 1MFNA 5F9JA 4I9WE 3IB4A 2IMNA 3P0YL 3RTQA 1XGTA 3H8NA 4YO0B 3S3SA 2LFGA 4KHXL 1HI6A 3TIEA 1EV2E 1ZGLP 1Z0NA 5GRUL 2OMBA 1QRKA 5EZIL 1BBJA 3QEUA 4PJDA 5IMKA 1N0LA 5CJBA 1RMFL 1Q8MA 1MCNA 5EC1A 1KB5A 1I7TA 1UB6A 4R7DB 1FZKB 1IC4L 4L3ED 4JM4L 3THMH 2JB5H 1MWAA 4FQ1H 4WFED 3VU2A 4OBSA 2UZIL 1S3KH 2A83A 3NMEA 3BKCH 1NCTA 3CFCH 4MMXC 4E41A 1R3LB 2IANE 3CDGA 3EYQC 1Z0MA 3JVGC 5E6IB 3ISWA 1Z9LA 2AQ2A 1YNKL 4PV9B 4JO4H 15C8H 4Z7WF 3DUSA 3REVA 5GS2H 3KHQA 1S9WA 2A9NH 4CVZA 2RR3A 2A6JB 4RA3A 3V6FA 5KVGH 3VDBA 2BVPA 1WBYA 2P8MB 4JRXD 1JPSL 4LHUB 4C56A 3V0WH 3OR6A 3AXLA 3QXAB 5CUSH 5KTEH 1Q0XL 2UZIH 5DEFA 1P6AB 5F1OB 1LEKA 4KDTC 1KTLB 1UA6H 4NNPL 1YEFL 3T77A 3QZWG 4X5WB 1LMKA 2VZ1A 2ARJQ 4MNGA 1JE6A 4JGJA 3VFUA 4ISVB 5IVXE 1IC7L 2CDEA 1OD9A 2WBJB 3WLBA 3QHFL 4JFDE 1YQ2A 3BRDA 1XR9B 4XZUB 4XVUD 4EEEA 2MQ0A 4OBRA 4PJBB 4X80L 1WCBA 1K8IA 2CKBH 5ICXA 5HHXH 2NY4C 3U1SL 5C08B 4QRQB 2XQBH 5FM8A 5CZVL 1AC6A 5FHAH 1N7MH 3T4AA 4F7EA 4G43B 2EDKA 5I1LA 1F97A 3WUWG 4M8QA 4OF8A 4YDKH 4M9OA 4G6KL 3OKOB 3GI9H 1WAAF 4ENED 4KI5E 3JV0A 4HHAB 2GEEA 2AS5M 1FFPB 3BH8B 1M4KA 4WWKC 2OK0H 1A1MB 1JIBA 1RZJH 2CH8A 5GSRA 4W4NA 4DKAA 3ARPA 3V8OA 3CVIH 2QR0A 1JHTA 5I30L 1QSEE 3VGEA 5C0BB 1EVUA 3VCLA 4L29B 1UT9A 5E56A 4DOHB 4IBLT 4LRIA 1WFNA 4G6KH 3I50L 3BHBB 1IAOA 3QIUB 1GHFL 2FBOJ 2E7BA 1BM3L 1BIIA 3BZDA 2AEPL 2HTKC 4XI5C 3BP5B 2FD6L 4KPHH 2W9EH 3D1MC 2IF7A 3BQUA 2B5IC 5IESL 1UG9A 1N2RB 1IBGH 3DSFL 3LS4L 3FT4B 3QUMB 4LSTL 4GXVH 1YY8B 4JGUA 5HXMA 2IG2L 5EA0L 3UBXG 1UKSA 4ODXB 1R3JA 2JE8A 4F9PA 4U1KA 4R0LA 3WNPA 3DVGA 4QT5A 5BMFH 3P4MA 1QVOA 3ZTJH 4X9GA 4FABH 1I1YB 1NEZA 2GUOB 1AGFB 1KPUB 1LO3H 3RIAK 2FYYA 2NY2B 2BY3A 1SMAA 4NQCD 4PJ5B 4X6DE 4JFXB 3VWJB 2IG2H 4OD1L 4ODHL 4U1GB 4WEMB 5C3TA 1CD1B 2XKNA 1PSKL 1AQDB 4IOFC 4H1LA 5AYUL 5C8JA 5FUOL 2YRZA 4TYUA 4FFWC 3UTTE 2ZSWB 1HHHB 4RRPA 3DNKA 3A6BH 1NCDL 3O3AB 3MCLH 5C0IA 1PYWA 4EZMA 1Y0LA 3IDJB 2Z91A 4OIIL 2W91A 2VDMH 3E3QE 4M5ZH 1HHGA 1RK1A 4P23D 4DVRH 1LO2L 4ERSL 1I9RL 5F6IC 5IBTL 3UYOD 4UV4H 2J8HA 3QDJD 2GK0A 3PWPE 3CH1B 4XNZB 1CCZA 3QDJA 1IKNC 4K7PY 4LIQH 1BWWA 2Q1EA 3QDME 4QNPF 5CGYD 4Z7UA 3RVUD 4P5TD 4AIXA 3L3HA 5ID1A 3VH8B 3K2UH 2HFGL 5BXFA 3AVEA 4F9LC 2D7NA 1XGYL 4RQQB 2Z93B 1HOCB 4UQ3A 3WNOA 4OF6A 5MENA 2J5LB 2XG4A 5TQ2H 3SDDC 5I75C 4O5LH 4IMLA 5IK3B 4MD4B 3W9DB 5IJKC 5DRWA 4ZUWA 2ZSVB 2Q86B 2AKRA 2CR6A 2NY0D 3OPZH 3KLDA 3SDAC 1CXFA 2IC2A 1JPSH 5J56B 3MLXH 4Z7WA 3VXUA 3AREA 4NN7B 4NJAL 4UOJA 1NBYB 1S7SB 2VDKH 4PJAA 5JW4R 4LGSB 2X4RA 3LIZH 3VRIA 3QP3A 5I66A 3T2QA 4KV5F 4NQEE 3TYGH 5IIEA 2HFFB 1YJDC 4P59H 3ZT6A 1TCRA 5MP6L 1IC7H 1S7XA 3GIVA 2UYLA 1B6DA 3SGJA 3VD7A 4HWEL 2FECI 4MHHI 2A73A 4OIAA 3T8XB 1XF4A 2GTWB 2ZNWA 5E8PB 4EBQL 4P4RB 5GRUH 3MRFB 5IGXL 1E6JL 1Z6JT 5JORA 3QUYC 1MAJA 3T0DA 1FFOB 2WUCH 1NDMB 5IB3A 2AJSL 3KDMB 4Y2DC 5KOVC 4O2EB 3QFJB 4TNWF 4ZFGH 2ZOKA 3RHWF 1EO5A 2FX8H 5IQ7H 1IM3A 1C12A 5L2KE 1REIA 3IDIA 4WW2B 2XNAB 5HYQA 2QSQA 4XNMB 3L1OL 4XNUL 2D31A 1TCMA 1S3KL 4X4ME 3CDFA 4MB5A 3L3OB 3Q2CA 4LKCB 3RY6C 1E4XH 3KPPA 1D5MA 1HHJA 4JDZA 3MRNA 3U2SB 2MCPL 4AEIH 5T1DH 4FFYH 3MACH 4N0UB 5K93A 3SDCD 1T03H 4QRRD 1WICA 4NO3A 1QLFB 5FECB 1Y6KR 1YEJH 2WLYA 3DMMC 1YECL 3H9YA 4PJCF 3CXDL 3MOQA 3OKLB 5DD3H 4NQSB 1P2CA 3O2WH 3QG6B 5CUSL 2JK5B 5I73C 4XB7A 2ICEA 5C08E 4YAQB 1U8OA 4LLWA 5DVNA 5FO8B 2YC1B 1IQDA 1MLCA 3AS3A 3WKML 3TVMD 2IPTH 4NQDA 2VC2L 3NIDE 3DMMB 3WEXB 1SJHB 1QRND 1MFBL 4PJDF 3VWKB 2VMFA 3MACL 3PNWB 1F2XK 1KJVB 5DMGC 5F44A 1SEQH 4LCUB 1YECH 3TO4A 3MLZH 3T0BA 4QHLB 2ZOLA 3K74B 1MRDL 3KPOB 3WIHH 5CHNB 1CVSC 4IOIB 2ZCKH 3K80A 2QQLH 4IEFB 1EGJL 1RURH 5I1GL 4PGBB 1A1OB 2GJJA 1BFOB 2QQNH 3QAZB 5IM7A 4OZ4B 3ZKNC 3VG0L 3ZE1E 4I18A 4WGVB 1DL7L 1KN2H 1NAKH 2E27L 3BH9A 5KS9E 1AQDA 4Q0XL 2WP3O 5AZ2L 3U0WL 1NGPH 1T89C 2X42A 3IFLH 3UC0L 5JDSB 5C0CE 3E6FA 4KXZI 4M7LL 3QULA 2DDQL 5FHBL 1G7PA 2MCG1 1ZLSH 4PJXA 2AK4E 2O61B 5EU5B 1HILB 1YNTA 3KXFD 4U1IA 4MJ4A 2CGRH 3FQXB 4KXZH 3S88H 3SO3B 4UIKL 3V4UL 4MJ5A 4OLYL 4GW1A 3E8UH 3I02B 1FRGH 4XPAH 4IM8A 1OAXH 2RAMA 1KEGH 1TNMA 1U3YA 3HZMB 3KWWB 4K3JL 3IVKA 1BQSA 5F6HJ 1TPXC 4M8VA 3S36L 5E2JA 3WDJA 1U36A 2NZ9C 1A7NL 1XCQB 2V7NA 5DMKB 4HJGA 4RAVA 1UCTA 3UTQB 3HC0A 4I77H 4IJ3C 5I0ZA 4U6VH 5AYQA 3U36B 3KPRB 5B3NA 3QNZA 4J2XA 2YKLH 1KJ3H 3MA7A 1T21A 1T20A 4Y2DA 3T2PA 1H5BB 5GGSB 5F3BA 1QSFB 4R8WH 2ZJSL 4RBPH 4GG8A 3ARRA 3VRJA 1C7SA 3OXSB 5T3ZD 1K5NB 1MCHA 4ZUWB 5MENB 1B6UA 2DBJA 5FV1L 2NY0B 4WUUA 1KENH 5I1JL 1WIPA 3FJTA 3DARA 3SDXB 4P3CL 1GOFA 4PJHA 1EAPA 3ZO0A 5CD3B 3MOAL 2F74B 5KZCD 3F62A 2BOCA 3DV4B 3ARSA 3G5XA 5IT2H 1AHWB 5GGTA 3FO2A 4XC1L 3VE0A 3B9AA 4GAGH 3DJ9A 1WWCA 2UVEA 1GOGA 12E8H 3G08B 3L3DB 3FOLB 4Z8FL 2YPVL 4RGMC 1AXSB 1MCWW 2WMPA 4YR6A 3BI9X 3WD5L 4CVUA 1N59A 1NFKA 4XNXH 5ALBH 2R23B 1Q38A 1T5XB 5CJXA 3UTSE 5HPMB 3MRKA 3QIUC 1IFHH 2DKMA 2AV1A 2EYSB 3BPOC 1CIUA 4XH2B 1PD6A 3RGVC 4C55A 4L8DB 4OM1L 2Y36L 3RU8H 4D8PA 3V4VL 3M45A 3IDIB 4WW2A 3PWJB 5K9KA 4XCNA 3WLWD 5IB1B 5F9OH 1AXIB 3C5ZA 1IEAB 3MA9H 2A6JA 4MZ3A 3V6FB 2X4TA 3QCTH 3UPCA 2NY4D 1IQWH 4XNXL 3MJ8B 1U58A 3QH3B 1A1NB 3DX8A 3NCYS 4WW2F 1G6VK 1RZFL 4W4OA 4APQB 2VISA 4AEHH 3MSPA 2D31B 1X7QA 2F53A 2VDOL 4PRIE 4HIEA 3UJIL 4KHXH 3W9EB 1FGNL 1H3GA 1MAML 4K23H 5EU3B 3OKLA 4HFUH 4LLDB 3DETD 3V4PH 5ACZB 2ZUVA 4KKCC 4OKDA 3QI9C 5D2LA 1JPGA 1LK3L 5E99L 2YC1A 2X41A 5A2KH 1GZQB 3CVHB 1I3UA 3QPXL 4OCYL 2EEAA 3RA7L 3LV3B 4OFYA 3VGGA 2YPLD 3K81A 4PRIA 3QI9A 4CUCA 1DUYB 3FQTB 1P53A 4PJ7F 43C9A 1KLFA 3K1KC 4NP4L 1KB5B 2AQ3A 1KEML 3JV4A 3ARGC 5EDXA 1KB9J 2B0SH 2IH3B 5E94B 4KTYA 4JM2B 4K71C 3MZTA 1HXYB 1JMXA 4OD2A 4QWWD 3K4AA 5IOPB 3LEXA 3OTTA 3UAJC 1YJDL 3B9KC 5KVGL 5D1ZB 1HQRB 2XTJB 1FFOA 2EZ0D 1M71A 4HJJL 2YD8A 4NCC1 1KLGA 2Z92A 4ZAKB 3L7EB 2VL5A 3WIHL 1AD0A 5ILTH 2DQDH 5ELIA 1U8JA 3TPUA 1UWEL 1I8KB 2BSRA 3PDGA 1RZ7H 2WUCL 4LSRH 4MA3B 5L8LB 3MBXL 4AK1A 4HMCA 4Y8AA 5L0QC 1S9KC 4GQPH 1I8MB 4HCRL 3HRPA 1OTUC 3MRGA 3L9RB 3ALXA 4FQXD 2Q20A 5BXFB 1RU9H 3KYMB 4HIJB 2O5YL 3NZ8A 4JFQB 1MHCA 5TDOA 1HOCA 4RGND 1DTUA 4Y19B 5E2WL 2YN5A 1ZTXL 1Q94B 4M7LH 5D2NE 2BNQD 5F7DB 4L8CA 1NBVH 1D5IH 1EAJA 5A16A 4XNYH 4DN4H 3H0TA 3KXFB 4UQ2B 4MJ5B 3G6JE 2JJWA 3S88L 2W9DH 4OGYH 3OR7A 2BNRE 4L8SB 4MJ6B 4U3CA 4WO4A 5B21A 5F89B 5HGHB 3WSQH 2IGFL 5C70A 1OGAD 1ULVA 1YNLL 1A6AA 4LDEB 3GBNH 5D5MA 4WFHD 1ZTXH 5CJQL 4HPOL 3GI8L 3DX6B 4F2MB 4OI7A 5D7JB 3LPGA 1JWUB 1Q0YL 4OQTL 5GGSA 5F3BB 4X4ZA 3HE6A 3DECA 2IPTL 1MCKA 1TJGL 1AGEB 5L8KB 3ZMRA 1YMMB 3UDWA 1AD9B 4PB9H 2AI0L 2VLRA 2HKHL 1CGSL 3BGFB 3L5HA 2YKLL 5IMLB 5MERB 4Q9RL 3S36X 3WHXB 3TH4T 2BSED 3FZUC 4F7PA 3VMNA 3PQYB 5HPOA 5ERWB 3X3GH 1CFVH 2LVCA 3GBLA 5EZLB 3QUMH 3DO7B 3LN9A 3WDHA 4JAMB 1ETZA 4XCCH 2XWBB 1TJGH 3BVNB 3PQYD 4XP9H 1UXSB 5EO0B 2APXA 5JW4Q 4KPHL 4TRPH 4EKXA 4LLQB 1JGDB 4F7MA 3QEHA 3FHQA 1NAML 4P57B 5FYKH 3DSFH 3LS4H 4FMFA 4PJHF 3BPLC 2OR8A 4QY8B 2IQAA 3RTQD 3LKNB 5D7JD 4L3EB 4IRSD 4RAUB 4I8DA 4XH2A 2V2TA 4G9DB 3OX8B 1CFBA 4IRSA 5F3HB 4D3CH 4LASL 4H26A 3S3JA 1ZHKA 3ETBF 3KYNB 1E4XI 4G8GE 1CLYL 3M07A 4ZO6A 3WKNA 3GDBA 4NOBA 5FA3B 1QBMH 3RKDD 5LXGL 3W39B 4RMUA 1R3JB 1UCBL 4NN6B 4PP2A 5HHPB 3VRLF 3PWJA 4I18C 3DGGB 4ODHH 1P4BH 3HE7C 1WZLA 4GFTB 3NACL 3EKCA 3QDGD 4MLSA 4MNQE 3WNLA 3MLTA 3NTCH 4KU1A 3QDMB 3UJTH 1BOGA 1YYLL 3OAYH 4HXBL 1Q9KB 2PYEA 1PKOA 4LK4A 2ICCA 2X09A 4P5TA 1PY4A 3WJJA 2VLKD 1A14L 5D7LE 5E2VH 1PAMA 1ZT4B 5T33L 2F74A 2X10A 3QEQD 3CZJA 4UV4L 4M6OL 3U30C 3NAAH 4CN6A 4P2QB 3VDCA 3MYZA 5C0NC 4L4VE 3HPLA 4YFLF 5H35A 4WFFD 5GRZA 3WN5B 1J0JA 5DD6B 3T0EE 1OAUH 4KFZC 3AC0A 4LCCA 4U2YA 5E99H 5F8RC 3D87B 1QZ1A 3FQUB 3H9SE 3MRPB 1J12A 4GAGL 1GGBH 1A14H 5E2VL 4YGVB 4P46A 4P3DB 3S5LA 1FVEB 4Y4HD 3MYJB 4NZJA 4Z8FH 3RY4A 5KTEL 3GK8H 3PGFL 4M6OH 5T1LB 1F4HA 4WFGD 5EOCL 4XNMA 4KHTL 1KCSL 3K0WA 3IRZA 1FDLH 5CZXD 5MEQA 3SQBA 4WI4A 5K33A 5I18L 2X5PA 4PJ8B 1JWMA 3EGSA 2D3VA 1T22B 1GC1C 3LN4B 4N0YH 1JYVA 5C0EB 2AJXH 3GK8L 3KYMA 1I8KA 2BSRB 4HIJA 4KTEL 3QG7L 4MCYA 4MAYC 5E9DE 5I17B 3TNMB 3EDJA 5KN5A 4G6AD 2GW5A 3FQWA 4M1GH 3ULUL 3K46A 2BRQA 3ZYJA 2VQTA 8CGTA 4QHMA 1CN4A 3CNKA 4HCRH 4U1SA 4P2RE 5DXWA 2JB5L 1RUKL 1FNLA 2Y07H 4HKBB 5EO9A 1CGUA 5HGHA 4G6AC 2FZ3A 2XT1B 4U6YB 5I8EB 1MAMH 2M1KA 3VA6A 3KLAB 3TH2T 1OQXA 3Q5YA 4KROB 4WGWB 3O81A 5D6DC 5JW4N 2P48B 3QPQC 4WHYH 3TWCH 5I1EH 4L4VA 4WDIB 4QHUB 4WFFE 2AXFB 5I1AA 2WWMD 4NQCB 4K94C 5F88B 3C2AL 1U3HC 3L1OH 3VI3E 1L4IA 5C9KA 4ONGL 1CU4H 5HHVH 5D7LA 5CJQH 4G8IA 5DQJB 3VD5A 1A4KA 2YRLA 3P4MB 3MLYL 2FX9H 4JO3L 5HYJB 1UB6B 4R7DA 2OMNA 4NN5B 4PY8J 5HYEA 2GAZA 4MNQA 5FB8A 3QDJE 5DSCA 2HKHH 2V9QA 3EYVB 4JG1H 1H15A 4QOKD 3V52L 4O2CA 4DQOH 3QHFH 1BD2D 5EUKB 4UTBH 3C09C 1CDIA 1NLBH 2VYRE 4JLRB 4X4XA 5AWNL 4PRPE 3CDGB 1DBKH 4ZS7H 3DO7A 5MEND 2LQRA 4X7FC 4O2FB 1IEAA 1E0OB 4YHMH 1KC5L 1LD9B 2R1YA 3HMXH 1CDGA 3MRBA 5FECA 4R4BB 4TULH 1QFUL 5FKPB 1INEH 2D7OA 1JGEA 3F5WB 4TRPL 1CDCA 4TPRH 2R2BB 3KPRD 5ETUB 3ZL4H 4NKDB 4M6AA 2V7NB 3O9WB 3GSNH 4HJGB 4RAVB 5I1HH 3H6JA 4MX7A 4PG2A 1UWXK 5DJDB 1NDGA 3GI9L 1EEUA 4EN3D 2C1PB 2V5YA 2BDNH 1KC5H 4F8QA 3QDMD 1CFQA 3HS0A 1JF5A 3VGAB 2DRUA 4PY7A 5FM4A 5I75B 5EUOE 3CPLB 3MRQA 1NBQA 1IAIH 3KGRA 2CRIA 3BP7A 5IEKA 4Y5XA 3GMRA 4U31A 4MWFB 3QIBA 3IFLL 3UC0H 2G9HA 4ZFOL 5HI4D 1NMBH 2DDQH 5FHBH 3U9PL 1PEWA 3EOAB 3IU4L 4D0CB 1R5IB 4KDVA 1P4BL 4QCIB 1A22B 4PGZA 5C86A 4GG6F 3NACH 3C6LD 4LP4A 2FGZA 1CT8B 4Z95H 1XF3B 1GXEA 5GGRY 4OLXL 3INUL 4A6YL 4EXKA 4XNZC 3V5HA 1KEGL 1H9VA 1FC2D 2EDWA 2R15A 5GQBA 2W60B 2QKIA 4N0FB 4LSPH 5IF0A 3MRPA 3QQ9D 4P3WA 2W0FA 2CXGA 1DDHA 1C5DA 3NAAL 4GUPB 3HB3D 3HPLB 2EYSA 3BEVB 4Y1AB 1UZ8A 5IW1B 1BD2E 2X6MA 4HIXH 4O58H 5DK2A 4H0HB 1ZA6B 3O45B 3LY6A 3MRLA 4R6UA 2H8PB 4LLYA 5E8PA 2GT9A 3OPZL 4HPYH 3DGCR 4PGCA 3MROB 2DAVA 1CQYA 1U92B 2YEZA 4UDUA 4XMLH 2NZIA 3T0VA 1C1EL 1S9WB 4CVZB 1YPZE 2ILLA 2P44B 3GRWH 1FYTA 4PJCA 3EGSB 3I2CH 1A64A 3FFCB 4GBXD 3QCVL 1NAMB 5L2JA 5HHPA 3UJJL 2IJ0C 1YEDA 3PDOA 5EH1A 3ARDC 4Z6AT 3OAZK 1KN4H 1FVDB 2B4CC 3AB0C 4PJFB 4Y2OA 5LXGH 2PTUA 3H7BA 2I9TB 3JUYA 3UTTD 1NUNB 3C9NB 3IDNB 3NN8B 5E03A 1WFUA 3KPPB 1U8NA 3HI5H 4ZTOH 5D7JA 1BVKB 1MOEA 4U1SB 2I9LB 4Y4KA 5FK9A 4W81A 5LCVH 3DBXB 5IGXH 1OLZA 5KJRL 3SO3C 5CS7A 1I1YA 4ALAL 4M62L 2JIXB 5T3XL 1FV1B 2X4SA 4CL7A 1CVRA 1HI6B 1KN4L 2HFGH 2XYCA 1YA5A 1VA9A 4E5XB 4P2OA 4OCWH 2DLHA 1FNEB 1OTUD 2R2EA 4HUKB 2HAZA 4HBCH 1KJ2H 1OL0A 2X4NB 3L95A 1S7UB 2C4FT 2OS7A 5C08A 3TN0D 1ZGLM 4ZSOE 5T1DL 1C08B 5GS0C 3SY0A 4NKQB 4RFOL 1NFIB 4QOKA 1YEJL 2FJHA 1U6AL 5HHMD 1A7OH 2MPAL 4OFYD 1CXEA 2XIDA 3UXFA 2AP2A 5EOTA 1KIPA 4PRID 4JE4B 2ITCA 2D7TH 5MHSE 3B2VL 2E8ZA 3S7GA 3G6JB 4MZ2A 1JTPA 1XCTA 3HG1D 4BK5A 2CLRB 5K9OB 3CIQA 3KPMA 5EIIB 3B5HA 2OM5A 2H2PD 4CU7A 5HHOD 3V52H 5JIIA 2BOBA 2B1HL 3I6KA 2DBLH 2F5BL 1EZVY 1TNNA 5F7EH 2XXCB 2FO4A 4UQ2A 5DEGB 2AJXL 4KY1L 3ARED 3NCJL 4LCIL 1TVBA 1NGXA 1P1ZA 4KK8D 1YEFH 3FN0H 1M7IA 4B50A 2FIKB 3VG0H 3TLRA 2NYYC 1JHKH 3TYFA 4GAFB 1T66C 1VENA 5EPMA 4AG4H 1CFQB 3HS0B 3M8OH 5CSZA 5I1HL 3ELAT 1ZLSL 3VFNA 5J9PA 2EH7L 3K8MA 3MLSL 1UEYA 3QO1A 1HNGA 5CEXB 1SEBA 5ENWA 4HUVB 1UWEH 5GRVK 4CJ0A 3D0VB 3AMLA 2HFTA 3LB6D 4JPIA 3C5SB 3WFDH 3GO1L 2DYPA 3OKNB 5FYLD 2VABB 3ARDD 2R4SH 1GGCL 1U8KA 3UP1A 4AG4L 4HK3N 4MAYA 2O5XL 1HH9A 5CGMA 5K9JH 3OAYK 3F7QA 3LQAH 2AJ3A 1MJUL 3CSBA 4LOUC 4TTGA 4J6RH 5L2KB 2FIRT 2VDQH 1S7TB 4U1JB 4X4XB 1D5IL 1IM3B 1C12B 2VRAA 4I0PD 2A6IB 1R5VA 2W9DL 5KSBA 3W5MA 4Z95L 3PGDA 1JN6B 5TDPB 1JYXA 1TIUA 4DKEH 2A9ML 1XGRB 2AJUH 4HWUA 5ACLA 2OTUA 4Z9KB 5DEFB 3MRLB 4FTVB 4R97C 2WBJC 3MV7E 3P9WB 2DMCA 3PWPB 2D0GA 4HIHA 5I1JH 5KVDH 1YQVH 3O41A 4CMHC 4JR9H 5IR1A 3O6FB 3TBSB 4OKVA 4X0KB 1FN4A 3D85A 4Q58C 5SWSB 4OI8A 3MRRB 4ACPA 1I1AC 1KOAA 4YEFA 4XHQA 3QXTA 5FO8A 5DF0A 5FOBB 3UTTA 1QSFD 4PRHE 1AD9A 2HVKA 3HG1A 1GJIA 2HRPH 4XCCL 1OGAE 4HIIA 2UVFA 3B5GA 5KVDL 2X89A 1MCOL 1KCVH 3EHBC 5J6HB 5IK3A 3W9DA 2VDPH 1FRGL 4XPAL 1FPTL 1N6VA 1HKFA 1NEZG 2F9BT 2YD7A 5CHNA 3MV8E 1AR1C 3QYCA 3X12B 1P4LB 4IIQC 2J7LA 4HWNA 1UXWB 3S37L 3NFPA 3DHMA 4XP1L 4Z7NF 5D7IF 4ELMA 2UYLB 3DUUA 2GJ6A 3CK0L 4U0QB 1UJ3A 5ICZB 5HHME 2HT2D 2E7LC 1LILA 7CGTA 2ZG3A 4RWYL 4KJPC 4R26H 1FG2A 4NT6A 3LQAC 1EJ6A 1C5BH 2VDRH 3CLEL 2AJZA 4PJXF 4OFDA 5CWSA 5GGQL 5GHWH 5SX5H 4BKLB 3ESUF 2QQKL 5DQ9B 1OB1B 4R4FL 5E1AA 3BN3B 3RPKA 2BZDA 3IKCA 3P30H 5MEQB 3T4YB 4OGZA 5IHZA 1TZGL 2GY5A 2NQCA 4PJ8A 2GT9B 2BXYA 3X14A 1NL0H 1A3LH 5LGJB 2V2WA 4E42A 1A21A 5BOPA 5C6WH 1PVHA 3B3IA 1AJ7H 3D69A 2XZQL 4NHUB 3BXNA 2R2BA 5ETUA 4DVBB 1C5BL 3CLEH 3CC5B 4PS4H 4ZAKA 1EA9C 4X8JB 5DJDA 3VFGL 1U6AH 5DC4B 3QNYA 1CE1H 2MPAH 5EOTB 1XCQA 4OCMC 4EQ2A 2PO6D 3TFKC 5TE6L 1JPTL 4ZNEA 3PV6A 3B2VH 4S0SD 4G6ML 2G2RA 3HG1E 3WUWA 4BH7A 4HUUA 4R96A 3FO9A 3QCVH 3HHRB 4JFYB 5IVZB 3CPLA 5E5UB 4PRNB 3REWB 3WFHB 3O11B 5IQ9A 5DMIH 3H3KA 3ARGB 4KRNA 4U4BA 3DX7A 5MEPA 1LEGA 5E8NB 4NZDA 5FGBA 3QG6A 4D0CA 4PREB 1UM6L 1J05B 1N5AA 4LCIH 3JTTB 5HJ3A 5D71L 1MHHB 1L9NA 4KRPB 4M62H 3LQMA 1AHWA 3OMZA 3VFWB 4XAKE 5FO7A 2NY5H 5C0IB 2XPGB 3C60A 4L3AA 3KJ4C 1JBJA 4D94A 3PIQA 4CVWA 5IVXA 4I18B 3OQ3B 4QXUH 3T1FB 4PJ8C 4EBQH 1J8HA 4GAYA 1CFTA 2XV6B 4KTEH 2F8XC 3MLSH 4BA8A 1MI5D 5E24E 3G5ZA 2XKUA 4WI9A 1BZQK 4IS6B 4TVPH 5T5NF 2FX7L 1WEJH 3CU7A 4M9PA 3ZE2E 4G9FA 5K9QI 3FCTA 3VMOA 2QBWA 5D70H 3V5KA 1ZVSA 3FT2B 1ETZB 4WTZG 4KVCH 1XF5A 4D0DA 3BIKB 1U95A 2V9RA 1P7QD 1QOKA 3P73B 4FQCL 3BYTA 1N0XL 2VDQL 3IDMA 5H37H 1AFVL 5I1EL 1N6QH 1BAFH 5BJTB 4PJIF 1YY8A 5C0RL 1BVLA 3IT8D 4H1LG 5IB2A 1NSNH 2DIJA 2CDFB 3VGDA 3B4NA 4HIHB 2NY0C 1GZPA 4PD4J 4Q9RH 4RWHA 4DKEL 5D70L 3CZFB 4RRPG 3X3GL 4KY1H 5BZWB 5B39A 4PJAB 1TZHA 4K8RC 5T3ZE 5FUZH 3VFPB 5LGHL 3GMQB 1NFDE 4FQCH 4F37F 3I85A 3CLFL 5JXAH 3CSYB 2NXYC 1A5FH 2C1OA 3T65B 1QA9A 1CICD 3QB7C 5EIQA 4AH2B 2QSCL 1IAII 4MMZC 2JJTA 4JPIB 2P5EE 3OKNA 4PG9A 1PLGH 4UTAH 1UH4A 5T5FL 5DWUL 5I1GH 3WE6A 5JXAL 5LAXB 2PYFA 1NDMA 1DSFL 1FLRH 5GISH 3RWFA 3EO0A 3QUXB 3KHOA 2O61A 4FXLA 5HDBE 2ATKA 4X6BA 2YBRA 2XICA 5DD1H 4Q9BA 4EI6A 3GSNL 4RISH 4JZNA 1MJUH 4UMGA 4FP8L 4ZS6C 4XP1H 1Z2KA 3D25A 5CBAB 1QNZL 4WUUE 3CCHA 3UYPA 2F5AH 1MF2H 1T1YB 1F42A 4NO0D 3SGJC 2NY7L 3D48R 1KJ2A 4HD9A 5ESAB 5F70A 2B1AH 3V9FA 4JFEE 4EIGB 4CMMB 4N90E 1GPOL 1GGIL 1ZA3B 3T0ED 1U0QA 1VB9A 2EKSA 2OZ4L 2Q76B 4I1NB 3C5ZD 1V8HA 2CIIA 4JJ5A 5BZDB 1ND0A 5F9AC 4IMLB 3MRRA 5DRWB 2V2WB 4XCFH 3B2UC 3BMWA 3BX7C 4R7NA 2Z0BA 1J1OL 2YPLE 4BUHA 1T2QL 3O6FC 1AJ7L 2P8MA 5FYJL 2MNUA 1L0QA 2CJUL 2JJTC 3OG6B 5J11C 5CINL 3DROA 4HKXA 2HFEA 4L9DA 3GSXB 4QHLA 2ZUXA 4LEOA 1KELH 3IYLW 3QZWB 5F97E 2HTKD 4M00A 5GRWA 4TN9A 1DVFD 3OKKA 3U9UA 4NKOA 5KVFH 3O3BA 4FFVD 5EOCH 4J4PA 4OB5L 3BH9B 2AJYL 3TV3H 4Y5VB 4MDJB 3V7AG 2Y5TA 4YHZH 2DM2A 3CX5J 4P9HL 3L95B 3S37H 2W0FB 2R0ZH 2X40A 3H7LA 1OVZA 2I60L 4DAGL 4F3FB 4YWGH 4I2XE 5DI8B 1UM6H 4S1RH 4TNVK 4S2SB 3GRWL 4PJEF 4RGMB 3HNTL 3NOIA 7FABH 5AAWA 2Z35A 2XXMB 1LNUA 3TZVB 1M05B 4ZXBC 2VSDA 1MQKL 4LSQL 2N56A 2H2SC 5J1AA 1E28B 1DQLL 1KIQA 4JCMA 4OLVL 3FO1B 5JTWA 3ULUC 1EEQA 1OAQL 1KG0B 4IJ3B 3TJHC 2R0ZL 5I71C 5JIPA 1IAIM 1DEDA 3MLVL 4EN3A 2MQ3A 2X9WA 1NAMA 5L2JB 3RUGB 3IDYC 4HHAA 1I1AB 2P4AB 3MRIB 5LG1A 5TPWL 3QQNA 4JM2C 4MA3A 1JNLL 1JGUH 1V7MH 2JELH 1XIWB 4MHHG 4ORZC 5ISZE 5CJ5A 3KLHC 3L9RA 3MCKB 5BS0E 2BFVL 2EYRB 1UYWL 2OX5A 3KYOB 4KZEL 1XF2A 1B4JL 4A2MA 1YY9D 4N8CH 2FIKA 3OAZH 3BWUC 3EIFA 5AZEL 1CF8H 1G7IB 2WBJD 4TSBH 1BWMA 1FNGB 4J4PC 1JTTA 5KSAC 2FX9L 4HFWB 4WU5A 4BZ2H 2ESVD 4AQ1B 3DI3B 5L0QB 1JTOA 1FDLL 4MQTB 4G6JL 1MREH 4LCWB 1VERA 4OZIE 1QBBA 3PWNB 3BP6A 5IW6A 1HCFX 2OI9B 4DQOL 1HEZA 4POYA 1H3WM 4KV5E 4N0RA 4NWUL 5DA4A 4UDTA 4JRXB 4QHKJ 3HE6D 4OZ4A 5C0GB 2D7TL 1JI2A 4OLWL 3LEXB 3CFDA 1YC8A 1VEPA 3VFRA 1Q9OB 5D72L 3RAJH 3U7WH 3HMXL 3PP4L 5SWZD 4XCYA 3SKNB 4JDTL 1FL6A 1W0YT 3EDDA 1INEL 1G7HB 2AJZB 4BKLA 1JNJA 3R1GH 2ADFH 3D3VD 4TPRL 5C0DA 3K8LA 1RJLA 2V5SA 5GPRA 2Y6SD 2V5RA 4LBEA 2R2CA 3PGCA 5IFHH 4NQEA 4XPTL 2ATKB 4X6BB 4YK4C 1ZHNB 4GW1B 1O7VA 3U48A 3MUZ1 4WHDA 5D2LF 4X6CA 1AI1H 1JHKL 3MLUL 3IDJA 2VJXA 2NY3B 3OX8A 1FO0B 4GMTL 1EERB 3M8OL 3RVWD 5DD1L 3B6SB 4K3GA 2IQAB 3RWJA 4TTDD 2NY3C 4JFHD 2BK8A 3HNVL 4Y2DB 1SHMA 2HJKB 1C5CL 2VN4A 3MRDA 5GS2D 4CNIA 5I2IB 2H3NB 4I0PA 3ZTNL 4P2RA 4WW2C 5D93C 4UTBL 2HVKB 3HG1B 4PJ9A 4ONFH 2QHRL 2Z93A 5DQDH 1GGIH 2QEJA 4MCZB 2HTLC 5HGDB 4L4TE 5D7SL 4PREA 1VKXA 3FTGB 4Z76A 4Y88A 5LGHH 1CXKA 1Q0YH 4G42B 4YJZL 4J3SA 3NCMA 4ZTPH 4LDLB 3SJVB 2W9LA 1NMCB 3GKWL 4UV7H 2AXFA 1FSKB 5I1AB 5IHBA 1QFUH 4MDIA 3N06B 5I1CL 4DW2H 1MPAH 2R69L 1NH6A 4LVEA 4OV5B 5IB4A 4JHAL 4QRRE 5D7IE 3FOLA 1JL8A 4JN1L 5H94B 1ADQH 4HEPG 1NCUA 1UEMA 3VJ6B 3RX5A 5DQJA 1SJXA 4FNLH 4NZUL 3MGOB 2AGJL 1J87A 5DWUH 4PRDB 3LEVH 3SE4A 4KKNA 2JIXA 3PGDB 1FFPA 1LO5B 3L5IA 5DO2C 5KOMC 3VXME 2EDJA 2F8OA 1BX2B 3KLSA 1F6FB 2W1NA 3D6GA 2QR0B 3TT3H 2L7UA 1BMGA 3T4YA 4JN1H 1PW3A 4L29A 2YHGA 5I19L 4BQCA 3W2DL 1TTFA 3RIAF 4QRUA 1ZLVH 2WLZA 1G6RL 2ZNXA 5INDA 1VFOA 4NRZA 3Q6FB 1CE6A 5EZOL 1JWMB 4JQVC 5BS0A 1U3ZA 3F6LA 3KDMA 3KXFA 1WBYB 3QFJA 3RQ3A 1AQKH 1FJ1A 5DVLA 1MCOH 4PJ7E 4RIRA 3REVB 4LNRA 1A7RH 1QBML 4Z0XA 1UM4L 1ED3A 4NC1C 4PBXA 4M5ZL 2DD8L 5DJAB 4DVRL 3BPNC 5TQ0H 2YR3A 2C1PA 3K2MC 4ODXA 4HGMA 1T22A 3L3IA 3MLVH 4DUWA 5F72S 1ACZA 1JZ5A 5E2UH 4PP1D 3MRIA 3HE6B 3BESR 5EZOH 3IJSA 3OB0H 2AV7A 1OLLA 3C87A 3LDBC 1UXWA 3ILPA 2CDEB 1MNUH 43C9B 2ESVB 1TVBB 4QTIL 1B4JH 2WAHA 4G80B 3TCLA 2DQGL 4PRHA 4TSBL 4PB0H 4XPBH 2IEPA 2ARJB 4Z77A 3CFBA 4HDIA 4QRQA 3BGMB 3FOMA 1WT5A 3KR3H 2CRMA 5DZOA 1U9KA 1CS6A 4Y4FB 3UYRH 1WZ1L 5IMOB 3KPOA 4X6EA 5D6CA 4OCRH 2VLLA 4BQBA 1N6UA 2X1WL 3EYVA 3CFKB 5DRZB 4ZDHB 1V5JA 2CLVA 2ATPB 3NGBC 4OIBA 2NR6D 4M6NL 1RJCA 4HUXA 4MA7H 4P49A 5HYJA 3BISA 2FJGA 1KJMA 1UM5H 4NNXA 2OYPA 5JOPD 5JHDA 5DHYB 4YX2H 5IMMB 4OGAC 1ZWIB 3MLPA 2J1KA 2EYTA 3FO0H 5I18H 4P48A 5HVGB 4ZFZA 5JDSA 4H88L 3R1GL 2I27N 3OSKA 2VAAA 4HJ0C 4HUMB 1F13A 1FAIH 1MELA 2GYSA 3U83A 3OL2A 4MNGE 2N7BA 3F5WA 2CK0H 2R0KL 3O9WD 1U8MB 2WUBH 1JV5B 1YEDB 4LCWE 5HVWA 1U93B 2GHWB 2VZOA 3BT2H 3P40A 5BRZB 1G0DA 2G5BA 1E4JA 1WC7A 2B8OT 3O3UN 2J6EH 5EO9B 3GO1H 1K4DB 3WO3B 3ZKXC 4U6YA 3MJ6A 3WXVL 4J8RB 4F2MA 5F9JB 3KWWA 1SVZA 1CFSB 1W72H 1BVKA 1IGML 4OF7A 5DR5H 4NQUA 3V0VB 3O6LL 1URLA 5K9JL 2AXJA 4M1CD 3IDGA 4J6RL 3FB8A 3ABZA 4L4JA 3E6HA 2HFFA 1RZIA 2CUMA 5IMLA 5JO5B 4PD4K 1LHZA 3RI5K 3RVVC 2XG5A 1QO3B 1QSZA 3TO2B 1WEJL 3CDYA 4P5KB 4LVHC 3O4LB 5F1NA 3ZTNH 5DMYA 1JF6A 4DUXA 4ZD3L 4DZBB 2YD2A 2Q8BL 2YSSA 2O5ZH 3MYJA 4Z0BH 1J0HA 3SDXA 2XACC 1CXHA 5CSGA 2VC2H 3DIFB 5GZNC 1MFBH 2P5WD 3LKNA 5FM5O 5F7MC 4V2BA 1G7QB 2IPKB 4OLZL 4LKCA 1CDHA 3ARDB 4PRPA 1KXTB 5K9OA 2VITB 4YHML 3QEGL 2R56H 1KTLA 4XPFL 3U0PA 4OD3L 4WI6A 4ONOA 1YEHL 2EDDA 1FFNA 2A77L 1CZ8H 5JXEA 3PWLB 4ZUUB 1OTTC 5DHVH 4WI7A 4MAUH 1Z9SA 5D2LE 3MROA 1YN7B 3QBTB 3HKFA 4NRZB 3ZE0E 1E4KC 3EDEA 1KB5L 2OI9C 1KIUA 35C8H 2QSTA 3GMMA 1MCPH 5BS0B 1FVCA 4GBXA 3D39A 3S8WA 2BDNL 3QO0B 4IIQB 2F8VA 4NRXA 1D3CA 3GMRB 3K3QA 4XMKH 1KLUA 1RJYA 2BC4B 3H3PH 3AREB 8FABB 1FL3A 2MKLC 3DBXA 4PG9B 4XRCB 5IHUL 3ULVH 2AKRB 5FKAB 4F80A 5JOFB 5J0BA 4HBQA 3MGTA 4L9LA 4PJGE 1U8NB 4AYFA 4LHUG 2X1XR 4P2QA 3MJ9A 3VXNA 3GMOA 4J7RA 1OAZL 1X9QA 3CDCA 3TO4B 1AR2A 4FQQB 1JJUA 4ODBD 1FYHB 4XVTH 3GFUA 1SJVA 4BH8B 3Q48A 5HGAA 4HX1B 1MPAL 4JO1L 3MGOA 5DUBB 5DJYB 6CGTA 2CPCA 5BOZG 3PABB 4Q2ZB 1MNUL 3QEQB 4M7JL 4FNLL 1J10A 4X9IA 3G5VB 3FQTA 3VD9A 5JW3L 4PJCE 3MV9A 1F3JA 4GRWB 1OGTB 2OXGA 3UDWC 4G6MH 2A6IA 3GMPA 4MD5B 3SDDD 3RWEA 5C6PB 2UUDK 1T83A 4O5LL 3HCVA 1P7HL 1PEZA 1RV6X 1FE8H 3VFSB 3FOMB 3Q6FA 1KSRA 4QXTB 3BQUB 4NSKA 5DEZA 3MLXL 1IJ9A 4OCRL 2NNAB 3QWRD 4TOYH 2PN5A 3F65A 4MSWA 2JIXD 3FONA 2DWEA 1H0DB 1I4FB 4YBLB 4JPKL 5CEZD 3I6KB 3PV7A 3BQUC 4M4PA 3MRNB 3JUZA 2H3NA 1YUHA 3ROOA 5A3ID 1OPGH 4X99A 2AJYH 3TV3L 1ITBB 4LDOB 3LKPA 5GHWL 5IJVA 5I8EA 1KPUA 3OXSA 3ARWA 3O3BB 4YHYB 1E6JH 3GM8A 4FHBD 2HG5B 2WUBL 4FFWD 4LCYA 4BJLA 4Z18A 4ETQB 1M7IB 4DZ8A 3MRHB 3GHEL 2Z31B 4WWKB 4HK0A 3QDGE 2BSSB 3AFLA 4WI3A 5CEXA 3A6CL 1S7UA 5EUOA 3VFRB 1EAPB 1ZMYA 5CSZB 1HINL 4HK3J 4U6XA 5TE6H 2HJFB 1TQCC 3DVFA 5DK0B 5EWIH 1EDQA 4LPVA 2BNRB 1D9KD 3MFGB 4MB3A 3W82A 1KFAH 4S1QL 1T1XA 4HWBH 4AH2A 3GHEH 5CJOH 2P5WA 4OFKA 2B7DT 3VFMA 1K3IA 4NBXB 5EU5A 5E00B 2E9BA 4F58H 3A6CH 3KPNB 2PNDA 1XMWA 3E6FB 2YN3A 1JHLH 4JFFD 1PG7W 4N8CL 3EFFB 4UQ3B 1CF8L 1MJ7H 1G7QA 5E5RB 5E8OB 4ZOAA 2VLRD 1WGOA 1UM5L 3MODL 4TSCH 3EO0B 3S3PA 4JZJA 1FIGL 4LHQB 4EDXA 2V17H 1MREL 1NPUA 1OWRM 1J0YA 3HFMH 1ZT1A 3EDKA 5GGRA 2ARWA 2DBLL 2F5BH 4KROC 4HIEB 5A40E 2OXHA 4EUPA 2QQLL 5KSBF 4J3VA 1PLGL 2R0KH 5DJ6A 4PYGA 2QQNL 3SDDA 4UTAL 4ZOBA 2DQDL 4ZSOB 4DN3H 3BAEH 2JCCB 1J1XL 4PJ9B 3ULSA 5KSBE 2DLFL 2VLRE 1EZVX 2FJFB 3KNBA 1AO7D 2A77H 3HI1A 2YD5A 4X5WA 3QHZL 2A6KA 4O02H 1B0GA 5TDNB 4Q74A 4F9PC 1QSFA 2HVJB 2KDGA 5EN2B 4Z7VB 5EULV 5I1IL 4GRLB 1MIMH 3N85H 2EH8H 5D1ZD 3QUZD 4V1DA 5I74B 3BPOB 3GMNA 1A4JB 4Y0GA 4JRXE 1A9BA 3RZWA 3JWDL 1R3HB 1FL5B 1UFUA 3KPSB 3C6SB 1I3VA 1R24A 4U6HB 4H1LH 5F9DC 5A2LH 5D2NA 1Y6MR 2F53D 1T0PB 4LLMB 3F7VA 4Z0BL 5C9JA 5H37G 5AEAA 1CFNB 5J89A 3VXRE 5I8KH 1KTKE 3L5XH 4HC1H 3QUKA 3M1BB 2KPNA 4P5MA 3G5VA 1UKTA 4YR6B 1MVUA 4TQEL 3BGAA 3EFDL 1KULA 3VXTB 1F11B 4BSWA 4M3KB 3HI6H 3MMEB 3J7HA 4PBVC 3WS3B 3U0PB 4PJ7B 3RNQA 2OTWA 1G9EA 4D9RE 3QI9D 4KAQH 1Z3GL 2P24A 2FGWL 1CK0L 5GIRA 3SGKC 4QNPE 2VDLL 1U58B 3QH3A 5D93B 1BQHB 4NZRL 3DUHA 1E6OH 5CSBA 4ZO8A 1ES0B 3BHBA 3QIUA 5FCSH 1I1FA 4KK6C 4MSWB 2A0LC 2DQIH 2ICWJ 1K85A 2X70B 1X5XA 25C8L 4K7FB 4MQSB 3W0WA 4P9HH 5D5MB 3IXAB 3S37X 5DD5L 3HUJF 2N1KA 4WEBH 5AD0B 5MENE 1Q1JH 3U79A 2HRPL 3ULUD 1MF2L 2ED7A 3B9KB 1ZXQA 3D0VA 4GAJL 5T1KA 3SPVB 4NUJB 4P5KA 3NIFF 1IFHL 4FQXA 1OF2A 3MV7B 2YD6A 5CFHA 3TT3L 4ODVH 5ESQB 4OLUL 2J8OA 2VO5A 2GJ6B 5ERWA 1TJHH 4ZXBB 3CH8A 4OQTA 5I19H 1MFAL 2QQQA 4XPGL 2FCBA 1G7PB 2UY7A 2Y25A 4DTGH 1OAZH 1H3XA 3BGMA 1HILA 3K1DA 4NIKB 4PJGF 1J1OH 2IH3A 3KG5A 3QR2A 2R9HD 2HLFC 3GSVA 1NCBL 4Y16B 1PZ5A 5FYJH 1XGUB 4QHNA 2CJUH 1T1ZA 2BFVH 2UY6A 1W8NA 3VG9B 5ANMA 2DD8H 1G9NH 1M71B 4DGIL 4UNUA 3OAUH 5E6IC 1U8QB 3P30L 4TUJB 4O9HL 1RZ8A 5EUOF 4CVXA 1VGEH 1MFDL 4FG6D 2PCPA 1CDUA 3VXQA 4JO4L 1CGYA 1INDH 1A3LL 3LCYA 2NY6B 4ZUTB 4HG4J 1ZV5A 1A6PA 4D9LL 4S1QH 2D03L 1YMME 1YZZA 3L7FB 4C59B 1JYNA 1OARH 2ZKHH 4WI2A 3QJFB 4LLVB 4P9ML 4RMWA 3TN0B 3RWDB 1MHCB 5I76A 3QCUH 2J4WL 1QFWH 4N68A 1L7IL 5ESVB 2NZ9D 5AUMA 4RQQA 3HNTH 7FABL 3RX7A <