1U41A

Crystal structure of ylgv mutant of dimerisation domain of nf-kb p50 transcription factor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
103
Chain Sequence
NLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIIRFYEEEENGGVWEGFGDFSPTDVHRQFGIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Snapshot of Protein Structure Evolution Reveals Conservation of Functional Dimerization through Intertwined Folding
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Nuclear factor NF-kappa-B p105 subunit
total genus 18
structure length 103
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u41A00
3GDBA 4MXWH 1WTGT 5E2VL 5BMFL 4MJ5B 4Z6AT 3GBML 1LQSR 1NFKA 3WFZA 2R0ZL 1F90L 1YMMB 4KRNA 2QKIA 5F7YC 5JOFA 5DQDH 5JHDE 2EDHA 1YYLL 3D39A 1ONQB 4H20L 2YD6A 3TJHC 1AGBB 2EEBA 2FATH 2HFFA 1R0AL 2UVEA 1AC0A 4MX7A 2W9DH 5EU6E 5I1KL 4LHQB 1XGRA 4HKBB 1CFNB 2HLAA 1IAIH 2F19L 1A9BA 4JRYA 3AAZA 3QRGL 4JFEE 5TDNA 1H5BB 5BS0E 4N5UA 4YPJA 3TVMD 4LRNH 1Z0NA 2K7PA 3WJJC 2DB8A 3HG1D 1EIBA 1FRGH 1JN6A 5GS1A 5F9OL 3T04D 5BJTA 3Q5TA 1MRDH 2GK0B 1I9RL 2PW1A 4WI2A 4HF5H 4HK3N 4YHPA 1NLDH 3HUJE 1NPUA 5HY9A 2CUMA 2NW2A 1FYTB 3ZLQC 4LLUA 2CPCA 3CXDL 4NP4L 5F71A 4OZHF 5IWLC 2IG2H 1HILB 4L4TA 2C26A 3IS0X 4OCLC 2A83A 2VKXA 3FB7B 3P3YA 3O8XD 3CPLB 4KY1H 3G6AB 1FPTH 4ENED 2OL3A 3IDMA 1VEPA 4HX1B 1U8LB 2J5LB 4Y4HC 1A64A 3B2UD 4X6BA 3GMNA 4I9WE 2FX7L 3ALWA 3MV01 5IBTH 2YUWA 1I9IH 1GCFA 1F11B 4XP5H 1YUHA 1EJ6A 1FE8L 3LPWA 3U9UA 2ZG1A 3B2VH 1WZMA 4GBXC 4ZQKB 5F7DA 3SOBL 5BRZB 3O4OC 4Y5XB 2WLYA 4RNRA 3VFOA 4NO2A 3CDFA 2UVFA 2UWEA 4C83B 5HGAA 1UXWA 4OSUH 4RIRA 3S8WA 1T5XA 4JZJC 2R4RL 1CYGA 4FQXC 5LGKA 1NGZA 4X7FC 2VXQH 4QWWC 2X2YA 1QRNA 3EFFA 1J11A 5IT2H 1T0MB 1A3QA 3P9MA 2VIRB 3TZVA 4BFBD 5JW3L 1FORH 3N1MC 4B7IA 5KSUB 1K4DA 3HE7A 4H25B 5T5NF 3WEXB 5B39A 4OI8A 3SE9H 2BNRB 5HVHC 1M6OB 4MGXA 2P1YA 4OF8A 2DS4A 2X4NB 4WTWA 1RUQH 1PEWA 3HCVA 5L88H 4NQXB 3PDOA 4HBCL 1K8DB 3QEUB 3DSNA 2FJGB 3THML 1VGKA 4OCSH 1HDMB 3C5SA 3D9AL 3TBSB 1HHGA 3OR6A 1XIWB 3SHSA 5CS7A 5C07D 5I66A 3MXWH 2XWBA 4U6VL 1HDMA 5F9JB 3P9WB 4Q0XL 5A16A 2NLJA 4Y19B 1PY4A 1VSCA 3MV8E 3HG1E 4FQCL 3VFWA 2XZCL 2J8HA 3U7AA 1MJ7H 3OAZH 2X70A 2VLJD 5FA4A 3TYGH 2B8OT 1GC1H 5HJ3A 5KVGL 3GMPA 2Z92A 3NAAH 5E2JA 4PJEB 5C0DB 2Q8BL 4KQ4L 1N26A 5DUPH 1Q94A 3CSGA 5E2VH 3NGBC 3TCLB 4M6NL 2QSCH 2X4PA 5T1DH 2WANA 3SJVA 2P5WA 3BRFA 5IB4A 3H8NA 4PJDE 1IM3B 2AJXL 1OM3L 3HS0A 1Q72L 1INEH 2H3NA 2GEEA 2XYCA 5BZWA 3QCTH 4M02A 2BVEA 5FFLA 4HG4K 1EHLH 3VI3E 1F90H 3LS5L 4PJ9A 3MQIA 3BKYL 3VXRD 1YECH 2VDLL 1FYTE 3AFLA 3FOMB 4Z18A 3W82A 3CH1A 5E00B 4LCUB 4APQD 3PQYD 3JV4A 1AQDA 4JO4H 3QHFH 2VQTA 2L7JA 3NFSH 3QDJE 2W38A 1EEYB 1QBAA 1R3HA 5EO9A 1MFCH 4H8WC 1PY9A 1IGTA 5KS9E 3OMZA 1S7WB 2D7NA 4RRPG 3ARTA 2D03H 5C0FA 4X4ZA 5BRZD 3T0VA 2RIKA 4M03A 5FV2A 3SO3B 5L2KB 2GFBA 5JLZA 4PRNB 1QSFE 4HXBL 2E8ZA 4O4YH 3PL6C 2CDGB 3SCMB 3HMXA 5IUSA 2PO6C 2NXZD 2FO4A 1GXEA 2CDFA 3RDTB 4RGOL 3Q48A 4W68A 2I60L 4WHTB 1D9KA 4QKXB 3TC9A 4KI5C 3W0WE 1UKQA 4TSBL 3FRPG 5FIEA 3K2UH 5L9DL 1LO2H 1RJLB 4G9FB 4GUPB 1WBYA 4G6ML 1PG7H 2HFEA 5D1QB 2GSIB 5IB2A 4ZOCA 1UM6L 2EEDA 4KUZL 5ID0B 2A2QT 4A6YB 4HJ0C 1CDUA 3NA9L 1K8IB 5HXMA 4M7LT 4YGAB 2Z4QA 3W0WB 1W0VB 1AGBA 4HFUH 4NKIH 4I3GA 3R06A 2XOTA 5JOPD 2HJFB 4QRPD 4PYGA 4U1GC 1WBYB 2QLVB 3QQNA 4ZUTA 4N8PA 5IR1B 3K1DA 3JBG7 5JOFB 2QSQA 4AEHH 1HHHB 4W70A 5FDWB 1TVBB 2R1WA 4LEOA 3WIIL 3LRHA 1OAUL 3C09B 3SGDI 2HKFH 1HCFX 5DT1L 5IQ9A 3QIUD 3VXTB 1AP2A 4MA1B 2V7NA 4RFNC 4KJWC 2NY5C 2IPTL 3F58H 4XPTL 5D1ZD 1DZBA 2CR6A 3MFGB 3GKZA 4XNUL 4X9BA 3PWJA 4LLMA 1BIIA 1C16A 1BFVL 1T5WB 5MENA 3QUYC 4M48H 4TUJA 2HP4A 1LHZA 2DLGA 3SDDA 5J11C 2BOBB 1R0AH 5EDXA 3S5LB 4HZLA 5DK0B 3T0ED 4NPYA 3KLAA 4U1LB 4LHUB 1OTSC 2HYMA 3DX7B 5I75C 4XBGB 4JFHD 5IESL 3HE6D 1JYXA 3ZKQD 43C9A 4FG6C 1Q94B 3RUGA 2HT3D 2YA2A 1H3VA 2BSRA 3P4MA 4NQVA 5C6WH 4M61A 3DVNA 2VAJA 4G3YH 4HIXH 1TJGL 1YEKH 3AC0A 1I3GL 1UYWL 2J5LC 3WLWC 3HPJB 3BVNB 3HI5H 1LE9A 1I7UB 2H3NB 4JQIL 4NCDA 3JZ7A 4NFBA 3MCLL 5EZLB 3EZ8A 3B8SA 5T3ZD 3R0MA 5LXGH 4XP9H 4YHIB 2BCKA 3U2SA 3NFNA 2XZCH 3T0XA 4BQCA 1S78C 4G7YL 5D71L 3RX8A 5DD3H 1IFHH 4RDQG 5GISL 5D7LD 3RWIA 3K8LA 1AO7E 2CUHA 3GO1H 2F74B 4YDVA 1P6FA 3KS0J 2C5DC 2AK4E 5FGCB 4Z0BH 2A6JB 4ODSH 5IW1B 3GSNA 5IB4B 4OZIE 4LVEA 3TO4B 1NUDA 1LDPL 4OCNC 1HSAA 4PS4L 3ULUL 3OPZH 2VZOA 3DUUB 1U95A 5IHZA 4TOYL 1U3HB 5HDLA 3HI6H 4KGLA 5D1QD 5DA4A 5CD5D 3PXHA 3QH3A 4ISVB 1PKQE 2OJEB 2DMKA 1FP5A 3ARDD 4EI5A 3BKYH 3GIVA 5D7JB 4UV7H 5C0JA 1YYML 4CRPA 2DQJH 2XT1B 4E0RB 2X7LB 4ISVA 4TSCL 2I60H 1IARB 4G42B 4JFHE 5DYOB 2DLTA 4R9HA 2NW3A 2DLHA 3GB7B 4FFVD 3B4NA 1WTLA 4X83A 5J4MA 1DUYB 1JWMB 1R5IA 1BEYH 1IBGH 1LO3L 3TO4A 3IDXH 3EJYC 3VXQA 1NGZB 4LHUG 1CBVH 4PGDB 1BF8A 4ZNCD 4NUGH 1QO3B 3P0VH 2BSED 3D85B 5IJVB 4XVUC 3K2UL 2R1YB 5J7CC 1H3XA 4Z7UA 1CLOL 1DANT 1H9VA 2EDYA 3QQ3B 3MRNA 2I9LA 4MLSA 4NGHH 3TT1H 5E70A 2W1NA 2GI7A 3OX8B 1WBXA 2PTTB 3D39D 4TTDC 3D6GA 2DJ4A 1AY1L 3F7RA 3OF6A 4PJ8D 3UTTB 2F53D 3VA6A 1BBDH 1GPOH 2E7MA 3TN0D 5HI3D 3DRQA 1TZIA 4MNGE 3LKPA 2FECL 3BGMA 3MLXL 2G75A 4JGUA 4KQ4H 3DGCR 5DK2B 4Z9KB 3SDYL 4W6XB 2NY1C 4C54A 2MSPA 5I18H 3ZKMD 2VDPL 5BQ7A 3P73A 2LU7A 1AGEB 5CMAA 4OCXH 3BH9B 1NCNA 5I1IL 4FQIL 1BFVH 3MNVB 4CVXB 1FFQA 1FVCA 3VFTB 3ZSSA 1GIGL 1IGMH 4LSQH 3AMKA 2WIMA 3P9LB 4FRWA 4YPGA 3C08L 5DD5L 1XGYL 2GJ6D 1IL1A 4MJIA 5LGJB 5FGCE 5SWZA 3ES6B 1JNJA 5D8JH 2I9TB 1L0YA 3L3JB 1T1WA 3SGKA 3BP4B 3JWDH 3QDJA 3EDDA 2Q8AL 1JPTH 3OKLB 5JMOC 4G9DB 2AJVL 2DLIA 3CFJB 4XCFH 5FF6B 5EULV 3WL9B 2VB5A 1A7QH 5I1JL 1N59B 5IEHB 5HY9B 1HSAB 1PFCA 4EDXB 5BVJB 5JXEA 4F57L 2CKNA 5SV3A 3GM8A 3O4LB 4LPCA 2EDXA 2X1WL 3EOYG 5E99L 1D5ZA 1C08A 1V3LA 3ULVD 4YC2C 1CVSC 5KSAA 1K9TA 3T3ME 5CEZD 1MH5A 4RAUB 1XF1A 1K4CB 4XNMB 1AD9B 4AENB 2KZ1B 3VCLB 4JVWA 2WBJD 3VGFA 4JN1L 5CHNA 2PTVA 4F58L 2HTKD 5EUOE 3P4NA 4O2CB 3LH2H 4OCYL 4JFFA 3B9KB 1GGUA 2DL9A 1OSZB 4YHOH 5CINL 5ID0A 3OKOA 5ANMA 5DLML 3OKNB 3SEPA 4Z7OE 5BXFB 1K85A 5JR1H 1TCMA 1WBZA 2E9WA 2J4WL 3ULSA 1A7PH 4ZSOA 2IPKB 5JHDD 3IRZA 3NOIA 3RX7A 3L95B 1ZOXA 2EXYD 3SKOB 1J5OH 4GOSA 3D0LA 4OCMC 1JV5A 5GSVB 1I9JH 1OP3K 3RP1A 1NUNB 3QZWB 2AS5M 1IM3A 5FXCH 1J7VR 5H94A 1H3PL 3VMPA 4J3UA 3S4SG 5EUKB 4OD3L 1JWUB 1F13A 5C09E 4S1RH 2BVUA 3AB0B 3C6LA 4P2CG 2DQGH 5GZOD 4NQEA 4H20H 3QXAA 1XGUB 1AH1A 1XF4A 4FQJL 3AVEA 4PREB 1C16B 4FTVA 4R90H 1BD2E 4PR5B 3WBDA 4R4BA 1G6RB 4PJFF 2XWTB 4U1GB 2IF7A 3GMLA 3QUKB 1N6QH 3QHZH 4LRNL 4P5TD 3M8OH 4KTDL 4LCWE 3T2QA 2D4FA 1TETH 2ERJB 3AY4A 4XC1L 1A0QH 1LE5B 3GMQB 3DO7B 3BO8A 3VFUB 1WWCA 3IETB 2BVTA 5AAWA 1GSMA 3HRZA 4X7DC 1I1RA 4LVOC 1N3NB 3KDMB 4F8TA 4ODUB 4OSUL 4QTHA 3MJ7B 3ZDXE 1DN0A 1AE6H 3VXRA 5IW3A 5F1NB 1DFBL 4D9QE 3MA9H 2P5EB 1AR1C 1KTRL 2VLLA 3IT8D 4G43B 2BX5A 4YHML 1GGBL 3SDYH 4HIJA 1G1CA 5IT2L 4PRBA 2CXGA 5AZ2H 2BP3A 1RJLA 3P0VL 1A6AB 2OTPA 3VD3A 1NL0H 1MAMH 3BUTA 3VFRB 1G9ML 3VXSB 5LGHL 3VA2C 5EORL 1KF9B 3H9SE 5AG9A 2UYLA 1QA9A 4G8FB 1X9QA 1PX4A 3ZYJA 1OP9A 4X5WB 3P11L 3HNTL 5JDSA 1T0MA 2BCKB 5KTEH 1AKJB 2WUBH 3HC4L 3RI5K 4IRJA 4OLXH 2V2TA 3DV6B 1MLCB 4HUWA 1P7KB 5BZDB 1LE9B 4J3SA 4XCFL 4HIEA 4N0CC 3S4SB 5JUEL 1JK8B 4L4TD 1SJEA 4ZFOB 4MQSB 1KJMB 5DVOA 3AREB 1KB5B 2UUDH 5CZXC 5E8PB 3EYOA 3U0TA 5KVEL 3HI6L 5E99H 2BNQD 3HZMA 4Y4FA 4CW1A 3WUWA 4YDIH 3IFLH 2XY1A 5DRWB 2B5IB 1UJTA 2F58L 3QNYA 5MEPA 3GUTB 3SCMC 3MV7D 1CGVA 5C0CE 4OGAC 3LB6C 2EYRA 4J3XA 3BKMH 3KHQA 3ULUE 3MXWL 4JLRB 3V7AG 1CLYL 1FDLH 4PJ7A 3DRQB 4Z7QF 1EMTH 3HG1B 1A7QL 1UFUA 2DI9A 2R9HD 4Z77A 2VXVH 3QNYB 1I8LC 4ZDHA 4UB0H 5F7MC 3LSOA 4PG9B 4HJJL 4XTRD 5EOTA 4OFYA 5FCUL 4OZIB 5D1XB 4JFQA 3FQXB 3C9NA 1AGFB 2F8VA 3U0TB 4Y1AD 3WIFA 1BM3L 2PXYC 1NCAH 4HWZA 4QY8B 2R1XA 3QA3A 2Y36L 1ONQA 1UQSB 3H3PH 4U1IA 2EIZA 3FB8B 4BH8A 4W6YB 3QUML 5KBNC 2NY6D 2YEZA 4JHBA 2YUXA 1DBKL 5EOTB 3RHWK 1KJ3L 2Z91A 3CXHK 4G6FD 4Y19A 4YXLL 3LZFL 4DKDC 3QQ9D 2VLRD 2W9EH 1O5DT 1R6VA 1E4XH 3QIBB 3CFCH 4P2QA 1XIWA 2APBA 5JDSB 1U91A 3BEVA 3O8XC 1ZT1B 3ZHKA 4HS8L 1JMZA 1R3LA 3QIUB 2YBRB 3I6LD 4RGMC 1S9VA 5C0BB 4AM0B 4NDMA 2A73B 2XFXA 5SV4A 5D1ZB 2IALA 4HAFA 1NMBL 5IHUL 4M1GH 4L3AA 2OI9B 3LHPH 4YBQC 2X4SB 4G5ZH 1G0XA 4J8RB 4AMKL 5BW7A 1SYVB 2VLRE 5TPWL 1TQCB 1YPZB 3B9KC 4S0SD 3V6OC 1WC7B 4UT6L 5HGGS 1H15B 3GK8L 1FBIL 5E9DA 5CP7A 1IQDB 2FH6A 1S7XB 2OR9L 4U49A 4WU5B 4M7ZC 4Q9CA 4LF3B 2CDEA 3TLRA 1U92B 2Q6WA 1HI6A 3STBA 3QEHB 4YH6A 2A77L 5I74C 4CVUA 1I1CA 5GGVL 4P2RE 4NQDA 3VD7A 5CSZB 3SBWA 4DZ8B 1FO0B 3DO7A 2IJ0C 3MA7B 2GJ6B 5E94B 4NQEE 1S7TA 3DI2B 3EGSA 1KXQE 1RJZA 4PB0H 5C08D 4XVJH 3CZFB 4QRSA 3S37H 3BXNB 1RI8A 4ZXBA 2NY5H 4YGVA 3MLYH 3TN0A 4QRTB 4G8EB 1BX2B 4S0TD 2EIBA 3BKJH 3WN5C 2G5BB 2OBGA 2VNCA 4U1JA 4CVWA 5HYQA 1PGRB 5E0QA 4IOIA 3TH3T 2N4IA 2P5WE 3RGVA 5EC2A 1XH3A 4GW5A 2ZSWA 3WHXA 5GRZA 4OFDA 2ED7A 3VG9C 1ITCA 4O5LL 5D6CA 2VLLB 2F5AH 2ZSVB 4OZ4A 5FCSH 1GC1C 2DL2A 4PJ9D 3MBEA 4X6DB 1C1EH 4XNYL 2G9HA 3I3DA 5DJCA 4DWHA 2CKBH 3FFDA 2JELH 1GOGA 5GZND 4WI6A 5EWIL 2R2HA 2DQDL 1JGVH 1A9EA 1T5XB 4WO4B 4HFWB 2C4XA 3GJFH 2YXFA 2J1KA 1SEQL 4EBQL 3B6SB 4NN5B 1DBBL 4GT7A 1UWEL 2DMBA 5JUEH 2HFGL 4MJ2A 4WJ5A 4D8PB 1MIML 3QUXD 4YDIL 3IU4L 1MJ8H 1QLFB 2VDRL 5E4EB 3M07A 1UYWH 3WUZA 3QI9D 4JRXD 5IKCB 4HS3A 3QWRA 5ERWA 3S36X 1C5DA 5I66B 2VLJA 3TFKD 4NO0A 5A43C 2YPLE 2P42B 2V5TA 1S5IL 1CFVH 4WUUB 3C60C 4NUJA 5DC0A 4N0UA 3WUWG 5B3JF 1IEAB 3HE6B 3EJZC 3QG6A 1Z5LB 2E7LC 3TH2T 2PO6B 3QHFL 1AR2A 3NIGE 2DQCH 5T3XH 4NNYA 1FGVH 5TDPA 4EDXA 3IFLL 1TTUA 4JFDB 5F89A 5GIRA 4U1SB 3LN9A 3VGAB 3PWUA 5JXAL 3RY5A 3ARGB 3W5MA 3TT3L 4Z7VF 4JJHA 4P4RB 1CGXA 3ZZ1A 2IQAA 4PPTA 4I0PB 3LIZH 2CJUH 4U1JB 1HSBB 2WWMD 3BHBB 4NDMB 1T1XB 4JRYB 5TDNB 1TCRB 3L3HA 4WU5A 3VFSA 4K7FA 4PJDB 4HZAA 3B9KA 3V6OA 1I3RA 2P24A 4PJGB 2DTML 4KKCD 5DDHA 1MCCA 4L4VD 5HHOE 5HVFB 4KKAC 1AD0A 3H9HB 3VE0B 3ZDZF 4GRWB 4KV5E 1J8HB 1ORQB 2XA8H 4IOFC 1BZ9A 1MAKA 2JB5H 5CGYD 1N7ML 3OGOE 1AI1H 3QUMH 5FDYA 4M5YL 2Q6WB 3O4LA 5EORH 4P9HC 4XWOD 1BFTA 2Z35B 5C3TA 5BVJA 3EO0A 4YXLH 3EOAA 5GXBB 5CJOH 4U2YA 2D0HA 4FQ2H 4RRPA 1K2DA 4JFOB 2EE9A 3CVHB 1PYWA 1J88A 1NMAH 4LMQI 2DIAA 3MV9D 3RPKA 5FF6A 2Y25A 2NMSA 4MXVE 1TTGA 5DJ8B 3BN9C 4PY8J 3HAEB 3GJFA 4HWEL 1PYWB 3BSZH 4F80A 1X5KA 4NRXA 4XCYA 4NT6B 5F6HI 4M1DH 1D3CA 2CK0L 3R1GH 2JJWA 3TBYB 5EU6A 1MCDA 3JVGC 2ITCA 3GJEB 2EYRB 4MJ6B 4E9LA 2BNRE 3P9LA 4LFHD 4N9OB 4XVJL 3OAYK 3VRJB 5TPWH 3VXOB 3MLYL 1ZLSL 4XNZB 2MTPA 3VXME 1AO7A 3CLEH 5CBEB 5E6YA 3FO9A 1FNGA 4NO5B 4O51A 3W9DA 3MV9E 1JMXA 4ODXA 2DKMA 3RZCB 3MXVH 3OL2A 5E8OB 1T6WA 4WUUD 5IBTL 3MRMA 2YA1A 2AEPL 5AD0A 2VZTA 3MFFB 1I9IL 2ZUTA 2PUQT 3QPQC 2VTFA 3MOQA 1NCBL 3QA3B 3V9FA 3EO9L 4JB9H 1G6VK 5CGMA 4D0CB 1A6PA 4R4NC 1Q9LB 4OLVL 3EYUL 3D3VD 5M95B 3D18B 2RBLA 3QB7C 1WZ1L 2XQYK 5EZJB 3BWUC 3LD8C 1VCAA 5AUMA 2OXHA 5DJ2A 2EDOA 3MRHA 1VFBA 4OGYL 3ZTJG 3EFDH 4PJFA 4OF5A 1DVFA 1BBJA 3DUSA 35C8L 1J87A 2GYSA 2H6PB 5FO9A 4I3RH 3TP4A 3D2UB 4JG1H 4NNXA 4X7TA 1UM4L 5D4QA 5F9DC 3ZE2F 4Y5VA 2WP3T 2FLBT 4Y16C 5E9DE 2NY2C 1HH9A 2DBJA 4PGCA 4UUJB 1MCHA 4Z7VE 4L4VE 4PJIA 3I6KB 3P77B 3ARDB 5FYJD 4UT7L 1ZHBA 1T2JA 4GXUM 4RMTA 4U1MA 3LEXB 4KC3B 4E42A 4Z7WE 4PJXB 1EEUA 5EUOF 1JTOA 4CDHA 1QVOB 5DHYB 3T65A 5I73B 2MCPL 3L9RB 2V2XB 3C5ZC 2EO1A 3BVNA 4U6VH 3H6JA 4KQ3L 1ACZA 5BS0B 3ARVA 4JFEB 4LSRL 2PW2A 4JO3L 2ZUYA 2XPGB 3O4LD 1NANI 2OJZL 1EEZB 3MRKB 3OKMA 5GGUA 1SJVA 3VD4A 2LTQB 1JPSL 4GXVL 2VH5L 3BAEL 4Z76B 2F5BH 1SQ2N 2EDFA 2UWEE 2WM0A 4JO1H 3T0WA 2EH8H 2XNAB 4X6CF 4MJ4A 4LLQB 4OI9A 4PGEA 3MV9B 2HMID 4YDVB 4AT6A 5I73C 4OZHE 4BH7B 2JJTA 1CGYA 3IFNH 5HDQL 3MUGA 4U6HA 2KH2B 4PV8B 5C0AE 3DX9B 12E8H 4K3HA 5IVOA 5EU3A 1ZHKA 5TE7H 4F9PA 3MOAH 1INQA 3JTSA 1CN4A 1K2DB 3DROB 1KPRB 4PJAE 1RZJC 3I50H 2OLDA 4NSKB 4DVRL 4M8VA 1PSKL 4JPKH 2WQ8A 5DUBB 1J5OL 1QSFA 5FECB 1HKFA 1FORL 1WBZB 1U58A 3ARBC 3W39A 4XP5L 5FM5M 4HDIB 4NYLA 3SN6N 4OT1H 3PP3H 2AJYL 1MREH 3U46B 2GUOB 3BXNA 3VD5A 1NGQL 4N8VA 4ZOAA 5K93A 5IQ7L 3IJSB 3QUKA 4HBCH 5JIKA 4O9HL 3F7YA 5EN2B 4JEGB 5L2JA 1XF2B 4I2XA 4NIKB 5CWSA 5JW4N 5ESVA 5GJTL 3ME0A 1XCQA 3RVXD 4OD1L 3GNML 4GW4A 2NY4D 3TN0C 3VCLA 5HI3C 3VW3H 3WJLA 5C07B 4HW6A 2BNQB 2UY7A 4Y2DD 4Q0XH 4P2RD 4J4PA 3CH8A 4P99A 1FZKA 4DVBB 2IEPA 2Z8VC 5MEOA 4LAJH 1LO5B 3HAEA 5C07A 3DUSB 3G04A 3O3UN 3DGGA 3O9WC 3UJTL 2BDNH 4ELME 1H15A 3TA3A 4G9FD 1CR9L 5IMKA 2X41A 5DS8A 5TDPB 4BK5A 5FOBA 3DX8B 1EGJL 4OLYH 3ZE2E 3EO9H 1BQHB 3L95A 2CK0H 4H26B 1K5NA 5D8JL 2HT4D 1MSPA 1RUML 2DD8L 3B5HA 4QNPF 5I15H 2BFVL 6FABH 1D9KC 3FOLB 2VDOL 2R39A 4G80A 1X5FA 4YHYB 1HQRA 4NM8H 2H41A 4IMKC 4MCZB 1KNOB 1SJHB 3RA7H 4X4XA 4LP5A 3AS3A 1BQHA 4KVCL 1KEGL 4WNQB 3KAAA 1W72B 2P24B 4PJGA 4LK4A 3CFEB 4LVNC 4TSAH 2J4WH 1A3LH 4OLUH 2WWKO 1SYVA 4ZDHB 3QIWC 1XGTA 4GKOA 3RUGE 3IKCB 4Z77B 5FEBA 2DQHL 5IMLB 2ZKHH 1JF1A 1A47A 2J2ZA 1U8JB 1I1AC 3STZA 2G75B 2AXHA 3MGTB 2VN7A 4QYOB 3WNNA 1TENA 4LSSH 1UCTA 4PJDF 5KVMC 5JW4Q 2P5EA 2EC9T 4L8DB 4N8CL 5IEHA 1NC4B 3S3JA 1MIEL 1TIUA 3IDYB 3GSVB 2YD2A 4GBXD 1F6AA 2Y5TA 3J7HA 5GJSH 3CVHA 2JTDA 2O5XL 3HPLA 1KTDB 1XIWC 3F7QA 4MQXC 4X6CA 1YJDL 4XAWH 4XPHL 1U8HA 3HB3C 2J88L 4ZO7A 2R56L 4DN3H 5T1LB 1YMHA 3KYMA 1AJ7L 4PGEB 2C1PB 2UZIH 1YEEH 2EXYC 4U3XA 4UOW0 1CICC 1NMAL 4XPGH 4LARH 2WWKT 3U0WH 4E42B 1YEKL 3RWEB 3VXUE 3JV4B 4JCMA 3NTCH 1RY7B 3ULUC 4WWKD 4XPAH 4JKKA 3QFDA 2B2XH 2VXSH 3DO3A 5D72L 1AQKL 4ZAKC 2VXTH 4RWHA 2UY6A 4WUKH 4ZTPL 2YC1A 3QCUL 1I7RB 2J8UA 3BDYH 2CDEB 5D7LB 5I9QC 3M17A 4NKDB 1H5BC 3IXTA 4Z76A 1KT2A 3H7LA 4WGVB 2EDTA 3N9GH 4LSVH 3U30B 3PP4H 2WZPD 4MNQD 5DRNA 1LP9F 1NCWH 4QRPA 4HCRA 4BUHA 1SBBA 5E8PA 4PS4H 4WI9A 3ULUH 3RTQA 5HPMB 2CIIB 2FJFB 1IBGL 4WCYL 1DQQA 1CLZL 5EZIH 2VLRB 4NNXB 2V5MA 5I30L 4WFFE 3I3BA 3MREB 4WWID 1T2QL 1QBML 4Y5YA 2VABA 2Z93A 3GNMH 4L4JA 1RK1A 4QHKJ 2EXWD 2VABB 3KPRE 1OW0A 4ODHH 2QADC 2ZCKL 3QO1B 5K9QI 4OZFH 3FB8A 4BH8B 5HBBA 2O61B 4Y4FD 1FLRH 4IMKA 5IESH 3ROOB 1UQSA 1CF8L 3KJ6L 3P4OB 3QAZC 2HLFD 5T1LA 25C8L 4MXVF 2NX5D 1A9EB 1WT5C 3UTPD 5E8EA 1ZGLP 4RMQA 1CFBA 3U48A 3WV0A 4Z7NF 1T22B 2D7TH 2FEEL 2YUVA 4UDUA 1KIQB 3VWJD 5C8JA 2M2DA 1ZHNB 43CAB 4NGHL 1ZE3C 3GKWH 3IU3B 2YN3A 3C6LC 4M6AA 1YEJH 4JG0H 3G6JB 3LPGA 3UJJH 4JZJA 5L8LB 2ICWJ 2KQNA 4FTVB 1T5WA 2NY1B 3HRZB 4GXUN 1EHNA 2LVCA 3UTTD 4YR6A 4YEEA 1I8KA 3KPMB 3O3EA 3RIFF 1NCAL 1A9BB 2CLZA 3CAFA 4D9RE 5J6HB 4ODSL 2Q7YB 2C3VB 3VG9B 1DEEB 4R0LA 1RUMH 2DD8H 2XZAH 5EA0L 1MJ8L 3PWVA 1ZVSB 3EDFA 5F6IC 3KYKL 2NTSP 1T66D 3HPJA 4MNQE 4QHNB 1JPGB 4XAKD 4KJQD 3GFUA 1K4CA 2AQ2A 5MENB 1BECA 3E8UH 4WW2B 1F3JA 2BVOB 4Q74A 1IM9D 4HUWB 1XGQB 4KVCH 4NRXB 1JYWA 3GSNL 3QJFB 3QIBC 4HJ0D 4P48A 5FKPB 4IDJL 4TULH 4X5WA 3D9AH 4G8GE 1T0NA 4OJFL 2YD1A 2DQHH 5FO8B 3PJSB 3SDCC 1HWGB 1WAAA 2FZ3A 4MA7H 2YOCA 3E2HB 5F7EH 2D4DA 4D2NA 4R26L 2I26N 1MCJA 4N8CH 2KL6A 1JPST 1RZIA 3NAAL 2BRRL 1B4JL 5DQJA 3L3GA 1E4XL 3LVEA 1J0HA 3QEQB 5IV2A 3KYOA 1W0VA 4NRZB 5ACZA 2FX8L 4ERSH 3QQ4A 5I8EB 1GOHA 2BZDA 4H1LG 1Z3GH 1HHIB 3KLHC 3WL9A 3P4NB 2C3GA 5I1LA 3RJDA 4CGTA 5E1AA 2BVYA 5IB2B 2IGFL 3U46A 1AXTH 4BFEA 1HYSD 5DMJB 2B2XL 2VXSL 5C0JB 1F8TH 5E5MB 3QPXL 1MEXH 1JHLL 5DMKB 1W0WB 1C08B 3SDCB 1IC4L 1G9EA 2AQ1A 3HR5A 3EW3B 3SGEH 1ZV5A 3OJVC 3GK8H 3EDEA 4YX2H 2H9GA 4UINL 3QJHB 5HHME 1NKOA 4P46D 2LU4A 4NKMA 4NQDE 5ESQA 1A1OB 3TJEH 5MEOB 1YN7B 4XCEB 3FTGB 5JPMB 4NCC2 5D6DA 1FJ1A 1I9JL 5KSVB 1BQUA 1FZKB 3NIDF 4UMGA 2YD5A 1JNHA 3ARWA 3BGMB 4JQVA 2XXCB 1NAMB 1WIUA 1T7XA 3VU2A 1A14L 3LEYH 1RZ7L 5C0IA 5DQ9B 5D7SH 2EIDA 4JFXB 3VD9A 1VGEH 3EBAA 1J18A 2PF6A 4FQJH 3KPRD 4LFHG 5INCB 1MCPL 4M62L 1P1ZB 2PTTA 2ZUQC 3WKML 4PP2B 4KWUA 1EO8H 3ZKXC 4P2OC 1MPAL 4ZFGH 4J2XA 1TLKA 3TO4C 1F3DH 3QHZL 1U58B 3W39B 4DUXA 4KK5D 3QDGE 1U3ZA 4NWTL 1QO3A 4OIIL 1DL7H 5CZVL 3MLWH 4Y16B 1E6JH 1JCKA 4LSDA 1GC1L 4GLRH 2V2XA 2E7HA 43C9B 2VISA 3W2DL 1FYHB 1TXKA 3I85A 3WNOA 4PLNC 2DM2A 4EN3A 1G9MC 2YRZA 3N06B 3TEUA 3ULVL 1CD8A 2BHUA 1F02I 4LVHC 5IB3A 1YEGL 3RWCA 4FFZH 4MVBC 3D5OF 1I8KB 3KPMA 1ZLWK 4PV8A 4NQCB 2ZOKA 2NTFA 1ZT7B 1M7DB 1VADA 2PNDA 5D7KD 1BIIB 3C5ZB 4ETQA 3CD4A 1I1AA 3OJDA 4ELKB 4M8QB 1LD9B 4PJIE 4EXPX 4PJHA 5HPMA 3C5ZA 4ETQB 1DQLH 5IVXF 1VADB 3F7VA 5EFIB 4DAGL 3CZJA 4LKXA 4JG1L 4HUXA 1A7PL 3KPSB 4V1DB 3EGSB 4JDTL 3U2SB 2J8OA 4P5KA 3T3MF 1RIVH 2Z93B 3UROR 2PCPB 2Z31D 3TFKC 5IW1A 5D7KE 3EJYD 3P4LA 1H3PH 1T1WB 3QEHA 2FBJL 2IH3A 3QUYB 3FFCE 3F12A 1L7IH 5D1ZC 3QBTB 1RMFH 2ADGA 4H88H 5ALBL 4IRSA 3R06B 3UC0L 5E08H 3WEXA 2VWEE 2Z4QB 3QH3B 2IAMD 1V5JA 1OAXH 4XBEL 4P2QB 1JZ5A 3JV6A 4PJIB 3EKCA 3P40A 3A6BL 1CD1B 2XZAL 3EYVB 3L3GB 5EA0H 4M93C 4DGVL 3KXFD 5CBEA 1KEML 3PGCA 3H3BC 4WI8A 5GQBA 3LDBB 4G9FA 4GUPA 4JFYB 4XCNA 1CGWA 4U2ZA 4FQ2L 2YMXH 3PE9A 1IVLA 1G7PB 4MAYC 1NFDA 4XC1H 3NCCB 3H9ZA 3HMWL 4PRHB 1GZPB 2Q76A 5J3HC 4TVPH 3GZKA 4JO1L 4S1RL 1AGFA 1KXTB 2EC8A 2ZUQB 4GAYB 4CMMB 1VKXA 1BOYA 2CLVB 1J8KA 2VDNL 5ADOL 1NC2A 5EZJA 1FFPB 1DANU 3ETBF 5EUKA 5SWZE 5J12B 3KLAB 4U1LA 5HVGB 1OLZA 4NQSB 3JTTB 4PJFE 1G7MA 3DARA 1BGXH 5IJVA 3RVWD 1IGYA 3MRJA 4F7PA 1ZHLA 3CLEL 5C7XL 5EH1A 1FNLA 3VG0L 1F4AA 3S3SA 1FLTX 3L3DB 1YEHH 1MOEA 2CRZA 2VE6A 1Z3GL 4ZTOH 3WFCL 1B88A 1G0DA 4LU5H 3BJ91 1MCOL 2X5PA 1OWWA 3HZVB 3HR6A 3V5DB 2Y07L 2F53E 1NC4A 3MODL 1IMHC 1A7OH 5DMGD 4GAYA 2X89D 5D7SL 1CL7I 3P0GB 4GRLA 4QRRA 4TUJB 1EFXB 5ID1B 3A6OA 3S9DB 4K94H 4LLYB 4OFYD 2X4TB 4K8RD 1H8OA 1MF2L 2J6EH 1F6AB 3QIWB 3MRFB 2CRIA 1A21A 4K23H 4KZEL 2VQ1A 5H2BA 4NZDA 3DSFH 3PWUB 2YPLD 4L8DA 1JYNA 1DR9A 4JVUA 3TIEB 1F6FB 4J3TA 3QULA 2P4AB 3AREA 2FHBA 3CFJA 4R4FL 1BAFH 1T7YA 4GAJH 1JZ8A 2YPKB 4U6XA 1BJ1H 4M48L 3U4BH 1CXIA 3F8UB 1F3JB 1FAKT 3MRRB 4KTEH 3RFZC 1DL7L 5DURB 4BK4A 4IDJH 2RFXB 4G6JL 4S1SH 4AG4H 2GJJA 4JREC 2NY0D 2CO7B 4WU7A 4F9LC 2E9IA 1X7QA 3IJSA 5C2BH 4XVUD 4KDTA 4PRNA 3QEQA 5IV2B 4QTIL 3BPLB 1JVKA 5F7EL 2GSIA 2VN4A 4HEPG 4ALAL 1KULA 1KLFA 1K3IA 4NZTH 3RPIA 4P4KA 4M4RA 5FYKL 3T77A 2R2CA 4G6AD 4NZUH 4AL8H 3DPBA 3CK0H 4K7PY 5D7IA 5DUBA 3RUGF 1EDQA 4QRPB 2KQMA 3LKSA 1WCQA 4MWFB 4QEGA 5ESVB 2IBBA 3NCYP 5HHXH 3TA3B 4JPVL 5EIQA 5D71H 1E4XI 2GJ6E 1Q9WA 1NC2B 4WEUD 4K9EL 1CIUA 3U1SL 4Z7QE 1MRCL 1MIEH 1QTYT 4CMMA 5BMFH 2P8MA 3BP5B 2VR4A 3CFKB 4XNYH 3RGVC 4HK3J 1XGYH 4F7CB 4WO4C 4ZQKA 3F62A 5F7DB 1XCQB 3QUMA 4GG6E 4LLDB 3WKNA 3T8XA 5HVWA 1V3JA 1JPTL 1R5IB 2Q7YA 2VZ1A 3EIFA 3HUJA 5FK9B 4Z0BL 3DVIA 1G7IB 1WF5A 1G84A 2G60L 3TCLA 1RK1B 4RX4D 4C57C 4QXGH 5FYLL 1NH6A 4IJ3B 5DYOA 2E6QA 1ZT4B 4FFWD 5CUSH 4LPXA 4JR9L 5KSAC 2FHFA 3QEUA 1NC4D 5IEKA 3UPCA 1RU9L 3AGVA 4NC0B 3T09A 1HINH 1WVZA 3QHTC 1XF5A 4JZJB 5BZWB 5IOPB 3V0AC 1ZAGA 3SE4C 1JGEA 4UAOC 5I17A 1WEJH 4PRAA 4OM1H 3BPLC 1BOGB 2X6MA 4ZTPH 1ES0A 2X4UA 1WC7A 4YHPB 2C1OB 4HKJB 2R56H 5KVFH 3PNWA 2XPGA 5C0EA 1WSST 2G2RA 2GY5A 1IKFH 1OAKL 3MRCA 1U8KA 2IAMB 5JW5A 4BH7A 1X5XA 2MMXA 1ZLUK 4QRUB 3S37L 5KSBA 4AEEA 4LU5L 1BEYL 4MB3A 3UPAA 4LSPL 1E27B 1XGTB 4DKAA 3TT1L 1GH7A 3AMLA 1CIDA 2A74A 5GRUL 1LO0H 1FVCB 3K74B 5BV7H 2ADJA 2P45B 3QWOB 2XIDA 2VDOH 4WFHD 4JRYD 4QHUB 5ACMA 4EJ1C 4JAMA 5ADPL 3ROLA 1QBMH 2NY4C 5DEFB 4UIKL 2WIIA 4XB7A 3ILPA 3VXRE 4JHWL 2VISB 2R2BB 1RZKL 4F8QA 4XXCA 3WO4C 1DQQB 3KYMB 2EKSB 5EU7E 3JWOC 1X5HA 5BRZA 5CAYB 1KTDA 4L3EE 4MAUL 4CVXA 4HG4J 2OXGA 5I0DA 1E0OB 1DBML 3CLFH 3PXJA 4GAJL 5DQJB 4NO3B 3IU4H 2QL1A 5EZIL 4MB5A 3SGJC 3QDAA 1JNNL 2B20A 2BFVH 6FABL 2L0DA 3VRJA 4WVRA 1MJUH 2NW2B 4O5LH 2PXYD 1BZ7A 4FFYL 3QDJB 3O6LL 1CGUA 2YC1B 4LOUC 1A7NL 1SBSL 5HGDA 4QRQA 1ZTXL 3LN4A 4Z7NE 5C0IB 1Z0MA 3V5HB 4XAKE 1NFDB 3BP6A 1IEHA 3G5VB 3IFPA 5LAXA 4HEME 1D9KB 3K4ZA 1KCRH 3G6AA 3MRMB 2CDFB 1IGFH 2AKRA 5F8RC 1NDMB 5DO2D 5GGRB 2RCSH 4TPRH 1AHWC 1RVFH 3QIWD 2ZKHL 3WNKA 4TNVK 4G6KL 3OJ2C 4G8IA 1UKSA 4MAYA 4HKZB 3GHEH 4KTEL 1L9MA 3BISA 3E2HC 4F33B 3NZ8B 5T1KA 3MJ9L 1AKJD 4MAYB 3L5IA 5C0BE 3VFGL 3OG4B 3RDTD 1KIRB 4WV1C 4AY0A 3L6FB 4FQHB 1LGVA 4DEPB 1BVLB 4JDVA 3BYYA 3ZSTA 1KPVA 5L0QC 1NMCC 3WFHA 4J12A 4X9FA 4RQQB 4RWYH 5GRJL 1GGTA 4MX7B 4UOJA 4PRPD 3QWOA 4JPVH 3GSUA 1SHMA 1RURH 3QQ4B 5I8EA 4BSVB 1VGKB 1TCRA 3JXAA 4H1LB 4X6FA 2VXUL 3DXAB 1HZHL 2B0SH 1OD9A 4N9GB 3NIGF 5J1AA 3CJJA 4W81A 2XG5A 4LVOB 5AWNL 2O61A 1NEZB 4R90L 1MCOH 3KLDA 1U8KB 2IAMA 3ARGA 5ETUB 2ZZUT 4G43A 2ZUSA 5T3XD 3LKOA 1U2HA 5EZLA 3QCTL 1PQZB 1TETL 1B4RA 3SDXA 1CGSH 1U8MA 2PYEA 1KFAL 3QUZD 4UT7H 3ULVE 5E5RB 2E9JA 2QKIB 3OQ3B 2ZCLL 5DMIL 3EYQD 4PGZA 1E28A 3IETA 2NLJB 3V5KB 5KW9H 1AD0B 2ITDB 3GMQA 1P69B 3OGCB 2AXJA 3UAJD 2DQIL 5F44A 1P1ZA 4HK0A 2XN9E 1LO2L 3FQRB 3T08A 5DWUL 2DLFL 1JGUL 3O3EB 5FOJA 3HUJF 3O6KL 3VFMB 3V6FA 3F5WB 2F5BL 1D6VH 2VLKB 4K55A 2AJUH 3BSZL 3ARPA 1NCBH 1QUNA 2JB6B 3RL1A 1A2YB 5CWSB 1AXTL 1MREL 4NQED 1G6RH 1P4BH 5CJQL 3V4PH 3REVA 4UTAH 3IXTB 4OKVB 5E8NA 1NGXA 3VXSE 3RKPA 5D6CB 2VSCA 4QHKI 3QUZA 1ERNA 4NRYB 6CGTA 3M45A 4OLWH 1ZLSH 4OD1H 1AGCA 5MHSE 1PLGL 4RIRB 1YMHB 3RGVB 3S96B 3IJYB 1H0DB 4YHMH 5F1SA 1F4WL 2Z31B 3N85H 2ZUVA 4Y4HB 1OCWL 4UV4L 5CLWA 2WBKA 3S3PA 5IR1A 2Y06H 1NAMH 2XWJB 3V52L 1O7VA 4ODXB 3RZWA 5IKCA 2AEPH 5C0AB 3U30C 5KTEL 1VEMA 5DD0L 3MLWL 1CDBA 1T80A 3VFNB 3QJHA 4ZPVA 4U7SA 1ZLWH 1SBSH 3JV5A 3VWJC 4JB9L 5EC1A 4ONOA 5ANME 1G6RA 1EHLL 4CU6A 4UNVA 3B6SA 1ZKAA 4UUJA 3I75B 2HAZA 3SDCA 4PRPA 1AD9A 3GSNH 5EU6B 3RQ3A 4WO4A 4AENA 4ZO6A 3HZKB 3K3QA 1J0KA 4HWUA 1C7TA 4FOMA 3PDOB 2BHZA 3L3OA 2JJVA 3CFDA 4OGYH 1OHQA 4H26A 2BNRA 3SDDC 1NBQA 5FKAB 1A1OA 2DM3A 1CK0L 3U36B 1V7NL 1QBLH 2M8XA 3N1FC 5DRNB 5DJ2B 1FGNL 1MRFH 1KIPA 4A6YA 1CICB 2OTUA 3VXTA 3VWKC 3JUYA 4P59H 1B2WH 4IOFD 1T66C 4ZSOB 4FQQB 4HT1H 4HH9B 4P3WA 2ED9A 3L7EB 4JRXA 5BO1H 1OARL 4J3VA 3TWCL 4Q6IA 3DETD 4HWBL 4D0CA 2XRAL 2EZ0D 4M6OH 5DHVA 1IAMA 2OMNA 2YN5A 4UDTA 1MNUL 1R3LB 3QIUA 4U0RC 1IILE 4FFZL 4DGYL 3IAQA 3C6SB 4ZYKB 1M71A 3H9SA 3R8BB 2IH1A 4IS6A 4X7SL 5FYKE 2N56A 5J6HA 5ALBH 3C2SA 3QUXB 1L6XA 3MGOB 4MD0A 4UDTB 1CDIA 1EJOL 5DEZA 1MFBH 3SDCD 3L5WB 1S5HB 3WFBH 3I6GA 2AV1B 4AIOA 5D2LB 4G7VH 4Y5VB 4RA0C 3BGFB 2NYYD 1TZHA 2ATPA 5FYJL 3WO4B 3FFCD 5CD5C 5FUOH 4LSUH 3T1FB 1JPGA 3ISWA 4P2YA 5MERA 4Q97A 3I3EA 1TZIB 4PUBH 1WT5A 3IDNB 1KBGH 1T21A 2X4RB 3KGRA 3GBMH 4BZ1H 2Y5TB 1NSNL 2CLZB 2EDKA 4KROD 1OPGL 2E7CA 3OPZL 4UQ2A 4JM2D 4WI5A 4GRWF 3BP4A 1HXMA 4GG6F 4EI6A 5EU4A 1LEKA 5I1HH 5MERB 1R3IH 2BVPB 4K71C 4PRPB 4ODVH 5J06A 4WW2A 4GRLB 4QRRB 4X4ME 2VL5B 4R4ND 4MAUH 5HYFA 1QSEB 4ZUUA 1IAKB 2DQIH 2VYRE 1J9CT 1N5AB 1D5BB 4FQXA 1VFAB 4NBZB 2UZXB 1MJJA 5GGUB 3H9HA 3DHMA 1CD1A 3EYVA 1X5ZA 2VZUA 3NH7L 1FRGL 2NW3B 3PP4L 1P4LA 3WXVH 1N5AA 3IAPA 3CMOH 3CXHJ 3MO1B 3O81A 4WFGE 4DK6A 4PGBA 4U6YA 3HE7C 3FZUD 1KC5L 4TTDD 3V5HA 3C60B 2DDQL 2XZQH 2VDKL 1U8QB 4BA8A 4KZDH 1CL7L 3LQAL 4OZIA 5A1AA 4ZS6D 3GUTA 4NM4H 3DROA 3SDXF 3RTQB 2OJEA 2ADIA 3UBXB 3G9AB 5ISZB 4MSWB 5EU3B 3QNZB 3BEWB 4KVNH 4K3EH 3UDWC 4MJID 1MLBB 1WISA 1HXYA 5EIIA 3MRNB 3WXWL 4P2OD 4DUVA 1U95B 4N1EA 2R1YA 4NN7C 2ILLA 2AEWA 3VWJA 3P0YL 4I48A 1Z5LA 4U1KB 5GS1C 3S4SA 1KB9J 4HUNB 2V9QA 2X4NA 5DJXB 2A6IA 5EB9A 3ZKNC 4FQXD 2VDQH 1DVFB 3F6IA 5GS3A 2Y06L 1CLZH 4M7JH 4QHUA 3O9WB 3LQAC 2VDPH 1EFXD 2ZWLT 4G42A 5I8KL 1ETZB 2MWCA 1KT2B 3OR6B 4ODUA 4BYHA 3VXNA 3GO1L 1TQCC 2QQQA 3DOSA 1WWBX 1XCTB 5DJXA 1BD2D 5HI4D 1EXUA 5ICYB 4Z95L 4NQXA 4B41A 1TNNA 2DKUA 2CRYA 4OM0L 5JIHA 4NHUB 1ZGLM 5C08B 3VWJB 1P7QA 3VFUA 3KXFB 3N50A 4YQXL 4YZFE 2W0FB 2ORBL 5ACLA 5ENWB 2DM4A 2EIEA 1NGPH 4WUUE 3MJ6A 1MJJB 3GSVA 1NEUA 3S36H 1RSFA 5CCKH 2Z31C 4GRMB 1A2YA 1N3NA 2FJHB 3I9GH 4Y1AE 2F8OA 5DK0A 1RIHL 4PJBF 2R23A 3CFDB 4M8QA 1N64L 3OJMB 1T6VN 3V6FB 5I2IB 1NCCH 1Y18A 3GKWL 1PKQB 4O02H 3BUYA 4NWUH 4TRPL 2VAAB 5F72S 3HAEG 5EOCH 3QFDB 1SVZA 5GS0H 4M6OL 2IAMC 2OTWB 5J12C 4GRLD 4QRRD 2CXKA 4WUKL 2FD6H 5T33L 4Q7DA 4ZMAT 4L8BA 4GS7B 4UBDD 5I75B 5SX4H 2VC2L 5AG8A 2GJ6A 2N7BA 1S9YA 1MHEA 2H8PA 3MV7E 3D0VB 2Q20A 1EBAA 4OQTH 5E6ID 4PD4J 4ZO9A 1OGAA 4K3JL 5K9KA 4JO4L 3GMNB 5MHSD 5DI8B 1UA6L 3MGTA 1BHGA 2XRAH 1KBGL 2OI9C 3S96A 4NQVB 4EUPB 5AD0B 2ZG3A 3IDMB 2DJSA 2V5SA 2NR6D 4J7RA 3MR9A 2OL3H 2XICA 1MFCL 1RFDL 1UWXK 1BJ1J 3MRQA 4MD0B 5IB5B 2VLME 1T3FA 4N0FA 1UVQB 1J0IA 4ZS7H 1Q8MA 5HHOD 3S37X 4MA1C 3MV7A 3MLRL 3S5LG 3O2DA 2JJSC 4I1NB 1RZFH 4KZEH 1YY8A 1JTPA 3ZE1E 3MC0A 4NQEB 1EO7A 4PUBL 1GAFL 4XXCC 4RCAA 3WFDH 4BZ1L 3NH7H 2ZP0T 5T5NG 2LFGA 1EZVY 1DEDA 4XP1L 3MBXH 5HHNB 4ZODA 3RDTA 3D0LB 4YFLI 4O2FB 3C6SA 4Y1AA 4XP4H 3QFJB 4R7NA 2MQ3A 1T3FB 4BM7A 4GG6B 1DLHA 1JF6A 1U8PA 4HLJA 2AEQL 1YEFH 2JK5A 3TV3H 3Q6GH 2AXGB 1AR1D 3AROA 3WNLA 3L5WA 3L7EA 5E2TH 4KJPC 4ODHL 2R2EA 4GG6A 1U36A 1K5NB 3ARFC 4FQCH 3WIFB 2APTA 3BFOA 3MLUH 4QLRA 5D1XA 1CDHA 1DP0A 4QXUL 1FZMA 4LBEB 5CMAB 5EU6D 3O41A 4XI5D 5ETUA 5GGRA 5D1QA 4J8RA 1NCTA 1EPFA 1XIWD 3QRFM 2ZJSH 4JREB 4QRPE 4JKMA 2ADFH 4X8XA 3P0YH 5FV1L 3QG7H 1OLLA 3DVFA 5DUML 2QJDA 3MV9A 1CICD 2YBRA 1MAML 2EE3A 5DJAB 4KVNL 3ZKXB 43CAA 5KANG 1CD0A 4QTIH 3O3BB 5IBLC 3BH9A 5C6PB 5DLMH 3WFHB 4P23D 4F2MA 1F00I 5BQ7B 3ULVH 1EH9A 5I8KH 4NBXB 5AZ2L 2H1PL 3U0PB 4N0UB 4AL8L 3WIIH 5C0FB 4HHAB 1KLUA 4D0BA 4APQA 3BZFB 2HG5A 3VFTA 2QSCL 5IF0B 2FJHA 4P5MB 3D0VA 3ARGC 3S7GA 3I2CL 2JIXD 5DD6A 3DV6A 1HE7A 4Y2DC 4YHKH 3OXSA 3ROLB 4Y8DC 1EA9C 3MTRA 3B8YA 3CH1B 1M1SA 4BZ2H 3UJTH 5B3NA 2ITDA 3FOMA 4P4KD 1JPSH 4GXVH 2FX8H 2IFFH 1RIVL 3MUGB 4U6HB 4PRHA 4R3SA 3VFPA 4BQBA 2IANE 2EH8L 1YDPB 4HUVA 5F7NC 4JO3H 2XACC 1INDL 4U1KA 3TCXA 5J9PA 5MEPB 2EDDA 5C08E 4M5ZH 5A40E 4QNPE 3EOTH 4B7LA 1FIEA 5E08L 1TZGL 5E4EC 5IHZB 3VWKB 3WXVL 2JB6A 1UA6H 5B38G 4W4OA 4R96B 2X10A 4XMKH 3QDHA 3V5KA 5CSZA 4OF6A 3IB4A 1KB5A 1A6ZB 1S78D 4K2UH 3U7YH 2ZSWB 3BZ4A 3QQ9C 3U6RB 1JZ2A 3T77B 3ARRA 2O5ZL 3G9VA 1QHPA 4NJ9L 3GSRA 4PJFB 2AABH 1KFAH 4J3WA 2IGFH 1S8DA 3ULVF 4Z8FL 2GSGA 4N90E 2VXUH 2XQYG 1IRAY 1ZLVK 2FECI 1YUHB 2YZ1A 5GPRA 3BH8B 3D18A 2BMKA 4KHTH 1HIML 1VENA 2AW2A 5F7UA 2WK2A 4L4TE 4MXQD 4JGMA 2A0LD 1QFPA 1ZK9A 5J1AB 4ZFGL 2R0WL 4F7CA 3ARFA 1KLUB 4HHAA 1UWGL 2KPNA 3W9EB 2DLFH 3FQXA 1QRNE 1DBAH 2VIRA 3TZVB 4YHLH 4YDJA 3NIDE 4O9HH 4HKJA 2C1OA 2X40A 4IRSC 1FC1A 4NO5A 4O51B 5GJTH 4RQQA 5F1NA 4M3JA 4WW1B 2X4OA 3I84A 5BS0D 2AJYH 3QZWA 5BVPH 2W59A 4OCRH 1IC5H 5D2NE 5DTFB 4PJ7B 3B2VL 1GOFA 3MLUL 4P23B 3UO1H 2EC9U 3ULUD 2R1XB 3NABL 2AV1A 3FONA 5EOQL 3MCKB 4OLWL 4XNQA 5E2TL 5E2UH 1IT9H 1KJ2L 4PRPE 1OCWH 4RGNE 4UV4H 1IGIL 4HGKC 2YEZB 2I27N 5J11B 2EDRA 2C1PA 3MA7A 3T0EB 3UJIL 3LKQB 2J6EA 1HQ4B 5DUMH 4EIZC 2NY7H 2EKSA 4OCXL 1T1XA 1FCCA 1MH5B 3I6GB 2P46B 3ILPB 1E4WH 3UTTA 3FN3A 2Y7QA 3WLBA 1V7MH 3CDCA 4WDIB 5EO0B 1B6UA 2OCFD 3IJHB 4YIQA 3VE0A 1GPOL 3TH4T 4NO3A 1YYLH 1HZHH 2YWZA 4NPYB 2KZWA 2V7NB 1M71B 4P2RA 5F7WC 5H2BB 1QBBA 3VFSB 3QCVH 2ADFL 3MJ9H 4QYOA 3MRLA 1DQLL 2R69L 3VRLE 1I8MB 3QG7L 4X9HA 3QI9C 5HGDB 3MRIA 4E41B 2CR3A 1QOKA 4K07A 2XKUA 5EUOB 1L0QA 1G7LB 1S5HA 1BZ9B 1YZZA 4XX1E 2CO6B 5F7HA 5GRVK 1JGLH 3DRTB 3RVUD 1P2CB 1I9RH 4ZPVB 3AY4C 3G6JF 3NTCL 5C0CD 2HT2C 1WV7T 5IB5A 3F12B 3TGXA 3TNMB 5KVDL 1UWEH 3TM6A 5CINH 1MLCA 4LAQL 3D3VA 1IGTB 2ENSA 3O8XB 1QBLL 4S1DD 5EBMA 4OIBA 3MRLB 5JXAH 2APFA 3BP7A 2VLJB 2J88H 1NC2D 4NRYA 3MBXL 4K7PL 2AJ3B 4JHZA 4PJBE 5EC1B 4V1DA 1CDYA 3KG5A 5I19H 3ESUF 4KGJA 1CBVL 5C2UB 4GRWH 2WWMC 4FQLL 3JTSB 1FH5H 2MQ0A 3LQZB 4XPAL 3N9GL 4LSVL 1WK0A 5D72H 1CFSB 1YEDB 4OZGF 1JJUA 1OGAD 2ZSVA 4OZ4B 3SKNB 4XMPH 1YY9C 1NDGB 2VLKD 1NUGA 2EDNA 2P8LB 4BQ9A 4KK5C 1DE4A 1FCGA 3D1MC 1Y18B 3QCUH 1DSFL 3HZKA 2AXFB 4LCCB 2FCBA 3MJGX 1VERA 4PGDA 3ZO0A 3VGAC 4KHXH 2HTLC 1TJIH 2WV3A 1I9EA 4JJ5A 1JHKH 3TYFA 3ZTNL 5IM7A 5H94B 2X42A 5C09D 4LKCB 4GJTB 5JORB 1N6VA 4HC1L 4DN4L 5FHAH 3FONB 4NUGL 5DJYB 3LIZL 5GZOC 2XA8L 3MMEA 1BVKA 3V0WH 4LASL 4JRWA 1WGOA 2IADA 2MPAH 5ILTL 3GSWA 2BC4B 1VDGA 5C92A 2R0KL 4JN2B 1S9XA 4U33A 4KMQA 2AJZA 4PLKD 3BX7C 15C8L 2APWA 4X9GA 5EWIH 3EYFA 3ZE1F 5L2KD 1WAAE 1MI5D 3MLZL 2L4OA 2ICEB 4JFPB 3UTSA 3KJ6H 1JUFB 2FR4A 3C09C 3OAUL 2ZUUA 1OTTD 4LLMB 4IOIB 4WWKB 1DQJA 1RZKH 4X0KB 4AEHL 1M7XA 4S1QH 5KS9A 1M7DA 1KGCD 2EYSB 1Q0YH 1HK6A 5I1IH 5DJ0B 3VRLF 3MLVH 1AFVL 2XWBB 5JHLL 4YHIA 3D39E 1MLBA 5EIIB 3FFCA 5D9SB 1KJ2B 4EDWH 3REWB 2ESVB 4QTHB 4OZGB 3T0AA 3K4DA 5HHOA 3X13B 4Y16A 4MJIB 5EOQH 5LGJA 2Z8RA 1BQSA 4RBPK 5I1LB 3G6JE 1UXSA 4FXGA 4DW2L 1TZGH 3EJJX 3BESR 3N1PC 1X5YA 1C8PA 2CRMA 4PBWD 2R69H 4PRIB 3VGGA 2OQJB 5JO5A 2QADB 5K9QG 4YHZH 4PG9A 1J86A 1UM4H 4RFNB 1G7LA 1M4KA 5D7LA 5B38A 2ORBH 4FQXB 1LK3H 3VJ6A 2EECA 2HH0H 1LD9A 1T83A 1MVUA 5DD1L 3QXWA 1BBJB 5CCKL 2F74A 5ISZE 4QRQB 5ICZB 4OUUB 5EBWA 2CLRA 3RWGA 1Q72H 1NAKL 1BFOB 2AERT 4EUPG 2WP3O 2F54D 3G6DH 3LS4L 4DCQA 2BOCA 1N6UA 5KVDH 3WUWB 5IK3B 4YAQA 5TJWK 3AXLA 1RUAL 4WI3A 1Q9LA 4K3DL 4HXBH 4U7KA 2JJSA 1QLRB 3SCMD 4QXTA 4UB0L 5I9QB 2BXZA 1FFNA 3CC5B 1VPOL 1G7PA 2B1AL 1XR9B 1SMAA 5CEXA 2E3VA 1CXHA 3WIHH 2QV2A 1D5IH 1DQML 3NCFB 4IM8A 5DZLA 4QXTB 1T1ZB 4HWZB 4QY8A 4L8SC 4JM2F 4NQSA 4PJ5D 2V5RA 3X12A 1A0QL 4NQCE 5C0RL 5F9WC 2Q3ZA 4QRRE 2F54E 5GS2H 1WBXB 1R3KB 1QFWH 4XNQB 3O2WH 2F15A 1SVCP 5F9AC 1K3ZA 5FYLE 5I1HL 1RHFA 1SY6L 1NCCL 1Y0LA 4ZAKA 1FZOB 2KDGA 5HHPA 3OAZK 3MRJB 4F7PB 4PIRF 4V2BA 2IFGA 2DQFB 4JVPA 3G6JA 2DWDB 2ATKA 4OTXH 2X09A 3T2NH 5DD3L 4I0PA 1ZHNA 4ONFL 1H5BA 4M00A 5GISH 5I19L 4P4RA 5C9JA 2LABA 2NY0C 1AKJA 1FFPA 5CEZL 2G2RB 3OX8A 2D31A 2VDML 4JFOA 4LDLB 3Q3GB 2ADJB 5D7JD 3LHPL 4PRIA 5JO5B 5DEGA 1J1OL 5F88B 3ZTNH 1R24A 4G5ZL 4YEFA 4NNYB 1FNFA 3KR3L 3VXRB 2GK0A 1SJHA 4X98B 2VDQL 1MPAH 3KDMA 4XZUB 3RGHA 4N0YH 4QOKD 2ID5A 5IQ7H 1MAJA 4R2GB 4YHNB 4LIQE 4OIIH 3LKNA 3PIQA 4OZGA 1VGEL 1BWMA 4M6ML 4NN7B 2NTFB 3RZCD 3PWLB 2PCPA 2X1XR 4X8JB 2FWOA 4JAMB 1CFTA 3T0EC 1ES0B 2X4UB 3LD8B 1HHGB 3EFDL 1XT5A 3MNZA 4DFIA 5CKGA 3UYRL 1MCKA 15C8H 3WNMA 3HE6C 2J8UF 3RWFB 2ADGB 2M1KA 5E00A 3GSWB 1W8NA 1WFOA 3O9WD 1E27A 3WKMH 4WENB 4L8SB 1FSKB 4Y4HA 4FQ1L 1G0YR 5LGHH 1BLNB 3DLQR 4L9DA 1QEWB 3RWIB 3TESA 3U83A 2BNQA 4FP8H 4E5XA 4NZJA 1MHPL 3FT2B 5IMOB 1I7TA 5IJKC 2C4FU 4LIQL 4N1CA 3QFJD 3O6KH 1NLBH 4K8RH 4XNUH 5CZVH 3IDGB 3AS0A 1ZS8A 1NGXB 3RBSA 5M7QA 3A6CL 3S34H 3NZHH 1IGJB 4L9LC 4PJAA 2XN9D 1EERB 2YD4A 2XV6B 1CLYH 4MWFA 1UT9A 2WUCL 1XGQA 3IFOB 5DVMA 4P46B 4RISL 2LAGB 3LKRB 4JCLA 4LSRH 3WHXB 5T33H 4Y5VC 5GS0D 2D9QB 2MQCA 4HLZH 5B4MC 1Q0YL 1T83C 1A3LL 4PBXA 3FTGA 1RMFL 4HJGB 3MLVL 5MI0B 2SEBA 3GHEL 1X5JA 5L8KB 1F4WH 3N85L 4K8RC 1UH3A 3FMGH 3PWPE 5LG1A 1RIUL 2APXA 4OV6F 2VUOA 3WO3B 3GB7A 4AJ0A 4RZCB 4JFXA 5JW3H 3BW9A 4OD2B 3MZGB 2VERN 5LBSL 4JDTH 3MREA 3MV8D 4R97C 3ULSB 4CKVX 5C1MB 4PREA 1Z9OA 2YUZA 3SQOL 5BO1L 3NACH 4JDZB 2DQTH 2ZOLB 4MNQB 2XI9A 5C07E 1FO0H 5L6YH 3QUXC 4LCIH 5KSUA 3QO0A 1S7XA 1B90A 4PJIF 4RGND 4TUOB 3U4EA 4KDTC 4YFEA 1EEZA 3MRKA 2LVEA 3P9MB 3UTPE 2XN9A 1CVRA 5DJZB 3CDGA 2B4CL 4NKQB 4YHOL 2E8YA 5DHVH 4LLAA 2R1WB 4KY1L 4LEOB 1CQYA 4CBPA 5I16A 3EO1B 4KRPC 5DMKA 2MFNA 1P5UA 4R97B 5IMLA 4KJWD 1UM5H 5I1DB 4WWKC 3DWTA 5DWUH 2NR6C 1HH6A 1UCBL 3NPSB 4YC2B 5H35B 3IAGC 1OP3H 2A9ML 4HIHB 4UOW1 3T0EE 1D5XA 1RJZB 1U6AH 1HOCB 1CFQA 1CE6A 1QLEH 1YEFL 3FO1B 4NQDD 3I6KA 3DXAE 4EEEA 1F58L 3QJFA 1KNOA 3QUYD 4DGYH 4M3KB 4QHLB 2ZCLH 2AK1H 4PJ8C 1ADQH 2IG2L 1AY1H 1VESA 4RSVA 1OTSD 3QISA 1NFIB 4OLZH 2DQCL 5T3XL 4GBXB 4MZ3A 1X6NA 2FZ3B 3MYZA 5JOEA 4Y5YC 5LWYH 4OKDA 3BT2H 4ZFZA 2BSRB 3T0DA 3RGVD 3V6BR 3KHOA 5ACZB 5JHDA 3QXVA 2GIYA 5FUOL 4I5BB 3MBEC 2R4SL 2OR7A 3NCJH 1PG7W 1LK2B 2AI0H 4QXWA 3MRFA 4LPTA 4PFEA 3FT4A 2RHEA 1RHHB 3TF7C 5IMMB 3NA4A 3VXMA 2PW1B 3IF1B 3MODH 1S7WA 1CTNA 4OD3H 4M7ZB 1N0XL 1FSKC 4HULB 1O7SA 3IF1A 5JQHC 1HQ4A 1QPXA 2BERA 3LY6A 1Q9KB 1BZ7B 1F6LL 3HS0B 1PDKA 3BQUA 1EEYA 1IAOB 2ESVD 5DMYA 5JW4R 4DQOH 2CDGA 1DUYA 1JWMA 3LCYA 4PRHD 3FO9B 1XGRB 4DCQB 3LQMA 4CW1B 1JFQH 3RWEA 1U8NB 2FEDC 3UTSE 1BAFL 2X05A 4Z7VB 1G9NC 1IM9B 2MKLC 3DMMC 4N0YL 1IZKA 4KI1A 2CMRH 3RU8L 1KJMA 4E0RA 1NCDL 3CU1A 4KPHH 1JE6A 4JFYA 1ZEAH 25C8H 2WMPA 4EQ3A 2YRLA 2HJFA 4LSPH 3RHWF 3T0BA 2IFFL 2NQCA 1ACYL 5FOBB 5KAQF 2DQDH 1U3YA 5C0ND 3RTQD 3GHBH 1GYAA 2D7TL 4XH2A 3RVTC 3FB6A 1ZA3B 3QR2A 3QUZC 4K3EL 2Y9RT 2HFEB 4XBPB 2IH3B 4PRDA 3AS2A 4FFVC 1EJOH 1A4KB 3FRUB 4JFDD 4P2QE 3EYQC 4NZTL 3MXVL 2X4OB 2JJUA 4KJQC 4WEBL 4D0DB 4XVSH 4EOWL 2Z0BA 4IS6B 3CFEA 5K9OA 3S35L 1DUZA 2H26A 1W2KT 3EYSL 3TJHD 4WNQA 2NX5B 5EIVA 1S5IH 3BKCL 4OLVH 4M7JL 1OGAE 1EVTC 5IOPA 1RK0B 1B0WA 3DI3B 3HLAB 2WUBL 4IRJD 4NZRL 4M43L 4NHCH 3SO5A 4PJXA 5CFHA 4V1DE 5L8JB 4XPFH 1YMMA 4ZUVA 1BVKB 1ZXQA 4M5ZL 1R5WA 3QWQB 4Y19D 5GGTH 3WD5H 4JHAL 1FGVL 5CJXA 5A16B 2BHYA 2V2WB 4ODVL 4RZCA 4NWUL 1J10A 4JY4B 3KR3H 3WE6B 4EZMA 3BIKB 1INQB 1A1MA 1S9XB 5DJ0A 1PD6A 4PGCB 2AV7B 1BP3B 1T04B 4WCYH 1I7UA 5KVFL 1RJCA 3HC0A 2P44B 3VI4F 5I0ZA 1IKFL 1OAKH 5DO2C 4M6MH 3UBXI 4I4WB 4K3JH 4HIJB 3BDXA 3TIDB 1MCFA 4GKZA 1QRND 2QHLA 3RVVC 2OL3B 4OZGE 4Y4KA 1MUJA 5L9DH 3MLTB 4I0PC 4UQ3B 4KK8D 1ZT7A 1EV2E 3FB7A 3BE1H 4F7TB 1AHWB 1A1NA 4F7EA 4EIGB 1FYTA 1JZ6A 1RPQA 2OMBA 4XP9L 3KPOB 1AI1L 1F45A 4YNYA 1CF8H 3SDDB 1TQBB 2LAAA 3SKOA 4W6WB 3E6HA 4L5FL 2Z31A 3ZE0F 3VFPB 4PGBB 3BPNC 1IFHL 4U6YB 1P84J 4UIKH 4AEFA 1C12B 4G6MH 3GGWA 4LHJB 4MA8L 4OQTL 4ZUTB 3QFJE 4NFCA 1KTLA 4RFOL 4EQ2A 1CZ8H 4IRSD 1WQVT 3PGDA 2G9HB 3VXOA 1F2XK 1DBMH 1S7SB 1QFOA 3E6FA 5BOZG 3DMMA 1KG0A 2XQBH 4XPTH 2BK8A 4KKLD 5SWSE 4KTYA 4KRPB 1A8JH 4XNMA 4G80B 4OCWL 5K9JL 2RQ8A 4KK9D 1LP9E 3U4AA 4R7NB 1YEIL 1RJYB 1A3RL 3CVIL 4XVTH 4O2FA 3CLFL 5FO8A 3BI9X 5D5MF 1NMBH 5IHUH 3H7BB 1R24B 2CMRL 3RU8H 1RV6X 1OTUC 4PTUB 4S1QL 4UAOB 2MNUA 1TITA 4MDIA 3QNXA 3CGTA 3RWHB 2QSTA 4G8GA 5E5UB 1U8JA 1IGCL 1YA5A 3STZB 2VRAA 1MFAL 3QXTA 2X4TA 1URLA 1EZVX 5ID1A 1L7TL 4NO2B 1U9KA 1N64H 1OY3B 3O41B 1Y0LB 4ZAKB 3WS3A 2FO4B 4NM8L 3RIAK 5DS8B 3S97C 5EBLB 5F1KC 5MEND 2X89A 4JM2C 5EOCL 4JPIB 1PW3A 4MA7L 2VLJE 4UTAL 2VE6B 3MX0A 3IDJB 1LNUA 3ARZA 5D1ZA 2C3WA 5JXED 5C09A 4DJMA 2H6PA 3LV3A 3N1QC 4AM0A 1ROWA 2CGRL 3CC5A 4N90D 1J05A 5E6IB 5IVZA 5IGXH 2CKBA 5TFSH 5CBAA 5I1GH 1MHEB 2NY6C 1Q9OA 3GSUB 2GQHA 3JUZA 3BIAX 5LXGL 3GI9H 3GBNH 2GAZA 2OZ4H 4DKEL 4XVSL 2VLMD 1ADQL 4YIQB 4WHCA 2X4PB 3KXFE 2F5AL 1P9MA 2YPLA 3NPZB 2GJZB 4XPFL 5GGSA 2M26A 4GMSL 1DVFD 1S7VA 4Z7UB 3HE7D 2JF1A 2ZNXA 1U8OA 4QF1B 5SWZB 1GZQB 3T4AB 3WNPA 3GMRA 4DOHB 3CX5J 1U2CA 5F7LB 3FQNB 1PG7X 2B39A 1RUAH 2X1QA 4S1DC 3SY0B 2GTWB 1U3JA 4IHOB 2ZPKH 3UYPA 3HMXH 1PX3A 4H88L 4OQ1A 3F7YB 5EN2A 1KN2L 1XF2A 3WSQH 4YXHL 1AGEA 1M05B 3MLSH 1Z9MA 2UZIL 5T1KD 4N1HB 1S7QB 2PYFA 2OP4L 4XPGL 3OXRB 5DR5H 4PJ8A 1H0DA 2R0KH 4P59L 2PO6D 3D25A 3RY6A 3RNQB 4QHMB 4APQC 2ITCB 2VDNH 3GJEA 1RZ8A 3O2WL 4PYHA 1Y6KR 4XXDA 2YD3A 3VWKD 4JHAH 4PP1C 5FGSA 5J1TC 5DJCB 1CLOH 3D69B 2RGSA 4HC1H 3X3GH 2AK4A 3JWDC 3CXDH 2A1WH 2VLKA 3U79A 4P57B 3GSRB 32C2B 5GHWH 5ELIA 3EFFB 1NCDH 5ECJE 4ZAKD 4IIQB 1FG2B 3PL6D 1HIMH 3ROOA 4JY6A 2FJFA 5C7XH 5JR1L 4DKFH 1OB1A 1MY7A 32C2A 3GSXB 5B39B 5D1XD 1A7OL 4NO0B 2IPUG 1S7TB 1XGPA 4Z7OF 2KUTA 5AUMB 5I30H 4RMRA 2D31B 4HS3B 3K80A 1S8DB 5B21A 3RI5F 1FPTL 2X7LA 4HC1A 4I18C 1KELH 4L5FH 3K81A 1QSEE 3NCYS 4WGWB 2XTJB 4OGXH 3VXPB 3L1OH 2XQBL 5AZEH 3JSSA 1U3HD 3BGFC 4K23L 2JELL 4X7TB 3MJ8B 4PG2C 1B3JA 1ZLVH 1IQDA 1Z2KA 5K59E 1KUMA 3MRBB 4GRWE 2V7HA 3TBVA 4Q9RL 5JIPA 5DRZA 1NBZA 1HXYB 1EFQA 2HJKA 1M05A 1IT9L 3MJ7A 3GSXA 1NEZA 4Y0GA 1DLFH 3CVHL 3TO2B 5IF0A 3S5LA 4PBVC 3HHRB 3MOBH 3SE9L 4FABL 1HHJA 3ZHLA 4M9OA 2FIRT 4HUMB 3QXDB 3KPSD 1OF2A 4FZ8L 4JZOB 1FVDB 4EI6B 4POUB 3D3VE 1ZT1A 4ZOBA 2HLFC 4Q2ZB 1PVHA 1TVDA 4MZ2A 4YUEL 4POZD 4DUWA 4RBPH 4OCSL 4DOHE 2RR3A 3BDBA 3O3BA 2A38A 3DHJA 4PJHF 4JKPH 5KVGH 4X7SH 1VFAA 1W72A 2BJML 4EI5D 5CBAB 3EO0B 1RULH 2PETA 1RUQL 1FZJA 3JVGA 3SDXE 4F3FB 3C6LD 4RMSA 4NQDB 4QCIB 1HN1A 1U8LA 4PJ8B 1NLDL 2EEAA 3OHXB 5D93B 4ZSOE 2J3SA 3GRWL 2GJZA 3MROB 1OM3H 1U92A 3LN5A 2HLAB 3UPRB 1INEL 3FFDB 4YBLC 4X7EC 3V0VA 3MRDB 4M6NH 4QOKA 5TDOA 3SDAB 2CUIA 5ALCH 1NCUA 3WLWD 5CIPB 1JV5B 1Z6JT 1YECL 4I3SH 4MMZC 1KLGB 3X3FH 3FAWA 1ZA6B 2BY0A 5HI5D 2X9XA 1I1FA 5F8QC 1JPFA 4PGJA 3X13A 5IMMA 3SE4A 5HSFA 3RPIB 4GSDH 4XNXL 2FL5B 1M7IB 4P9ML 3GMOA 5HI4C 4UIMA 2DYPA 4ZXBB 5KSAD 3FO2B 1AP2B 1UM5L 3C5JB 3H7BA 5L2JB 2P48B 3UTZA 1UH4A 3SCMA 4RMWA 5INDB 5DJDB 2RFXA 3GMOB 5L0QB 3HE6A 5JLZB 1R3IL 2BVQB 1ZANL 5CGTA 4YZFF 3OB0K 4NUJB 4NN6C 4HIEB 4EVNB 5ISZD 1ZWIA 4OM1L 1P4IL 4N5ED 3ZYOA 1TPXB 2DQGL 4MDIB 4M1DL 3K1KC 3BJLA 5KN5B 4JQVC 1T7WA 4LCYA 4RDQF 3DMMB 3UTZB 2Q1EA 1EMTL 4OLZL 1CFQB 5IMKB 3LEVL 3PWNA 4YJZL 3SGEI 3BQUC 5FKAA 4A2LA 5CILH 3VFVA 4FP8L 3CSBA 4R26H 2H2PD 4K7PX 2OJZH 3DECA 2PKDA 4FZEH 5IIEB 4G8GB 1G9NL 3IJYA 5HHQA 1LO4L 2ICWB 5IG7A 1KV3A 3FHAA 1T2QH 3TJEL 5MEQB 1KCVL 3G5YB 3IDIA 2E9BA 4PTUA 4PY7A 5HPOA 3ARGD 3SE8H 5ESAA 2YZ8A 1UB5A 2XN9B 2MPAL 5ILTH 2AJSL 3QO0B 4GMTL 4OFIA 4R8WH 4CNIB 2D7QA 4JHWH 4WW1A 2GHWB 3MBEB 1FL5B 2NY1D 1DCLA 1WZ1H 4LNRA 5KZCB 3FQTB 2VAAA 4OZFG 5I2IA 2HKFL 5C08A 3PWPB 1YQVH 1UC6A 2G5RA 3KPPB 3VFMA 1S3KL 2W60B 4TUKH 3MNWB 1DE4B 2QQKH 2WW8A 3LKPB 1LE5A 4WFFD 2NY2D 1XCTA 3CU7A 5BW7C 5DZNA 1MFNA 4GQ9L 4H8WH 2NY3D 3FO0H 3KPLB 4Y2DB 3SE3A 1GL4B 4FTVE 4OZHB 2KBGA 2DKSA 1MHHB 1YEJL 4M9PA 4PLJD 4U1HA 4CADB 2I9LB 2A6DA 4R2GC 4UQ3A 1RZ7H 2OM5A 5AYUL 4TTGA 1LEIA 4WFGD 4P5TB 2HVKB 4CDGC 1CXFA 3TO4D 3KPRB 4LCWA 3NPSC 1YEGH 4Y88A 2FB4H 4KKCC 3RWJA 3PHOA 3BRGC 3WS6C 4LLQA 4D3CH 2P5ED 1EK3A 4JKPL 5I76B 1A6WL 4PTTB 5CP7B 1QKZL 5EPMB 2Q87A 3Q6FB 1BD2A 1B0GB 1G7HB 1ZS8B 3HNVH 3DUHA 4R96A 5FM4A 4OV5A 3DRTA 4FXKA 3JV6B 3NFPB 5IBUG 1SEBA 4ZUSB 4UIMB 5F3BA 2B7DT 1F4YL 1KJVA 1B0GA 1G7HA 3D69A 3DJ9A 4JR9H 3OKEA 2LE9A 3U7WH 4OV5B 1C7SA 1F4XL 5ITFB 1HNFA 4O2EA 3VFGH 1WWAX 2X4SA 1PZ5A 3WFEL 1SJEB 4ZFOA 5ICXA 2RAMA 4WTXA 2BXYA 1FG2A 5A2KH 2JCCE 4YUEH 1UXWB 3O6FC 4P5TA 2H2SC 2FD6L 1OSZA 4X6EB 4Y5XA 3UTTE 1RVFL 3BKML 4JQIH 3VXMD 3MGAA 1LEGB 1MQKL 1HNGA 1JZ7A 1TJGH 1MHCA 3GSQB 3ARED 5CLTA 4HCRH 4XWGL 4WFEE 5B39G 5C0GB 3ABZA 2D7PA 3CX2A 2F54B 2OL3L 4JKWA 1S7RA 4P9HL 4WW2F 4HSQA 1VPOH 5C0BA 4M1GL 3MCG1 3RIAF 1EHAA 1IEBB 1G7QA 1I3VA 5DRXA 5DK3A 1VFBB 5E6ZA 5FHBH 3ESVF 1EVUA 3BPCA 3FT3B 4GKSA 5TH2A 1E4JA 4NKOB 1AIFA 4I8DA 4NQTA 4M43H 4NHCL 5MP6L 5GSVA 2W9EL 1UB5B 1WFUA 3IFPB 5LAXB 4XP4L 3LS4H 1UWXH 2ARJA 1FNSL 3Q1SL 4IBLT 4RNRB 3VFOB 3VXUB 4H1LA 5TGBA 4P9MH 1T89A 5DT1H 3P4MB 4XH2B 5A3IC 4G8IB 3ZL4L 3BO8B 5FHAL 3WN5B 3T2NL 4NKOA 3CSYB 4UT6H 4BFIA 4IDLA 3SGJA 3DX7A 1HKLH 1BVLA 3VMOA 1YEEL 4U7MA 2CKBB 4R4BB 2DJUA 1FL6B 2FHCA 1KCUL 3OV6A 4AEIH 3BHBA 4FZEL 4M1CD 1W8OA 1BVZA 2C4FT 4UZGA 1CI5A 1S7VB 1Z9LA 5HYSA 2VXTL 4HH9A 1QFWI 5I8CB 3O11B 3VH8B 3C8KB 3QUXA 1AGDB 1R3JA 4WI4A 1OVZA 2NCMA 3PABA 4M7LL 3HRPA 4HUUA 3C5ZD 4L3ED 2FEDD 3RJQB 1QA9B 4G8FA 5DHXB 4Q2ZA 2HT2D 3FO2A 3DMMD 3EOAB 5A2LH 4G9DA 1Y6MR 2LQRA 3H9YA 3QDMA 4JM2A 4MA8H 4CUCA 5D5ME 3QG6B 4JO2L 4RFOH 5H37H 2GY7B 1BPVA 5SWQB 5JHLH 4MA3B 5CKAA 1PZ5B 1P7KA 1I85A 2YRPA 3ES6A 3AAZB 2X4QB 3G5XB 3IKKA 5I1AA 4EBQH 4JY5H 2Y07H 5DC9B 1QFHA 3W0WA 5DD1H 3PDDA 5IHBA 4JFZH 4BJLA 2VZVA 2A74B 1P9MC 3RTQC 1HEZB 3O2DL 4LLVA 3OTTA 5J9PB 1MF2H 5TF0A 1YC8A 3MJ8A 4HWEH 4NYLB 3GIVB 5D7JA 4GQPH 3GGWB 1I1YB 4DAGH 3O4OB 4Y5XC 1AGCB 2FLRT 3CMGA 4O00A 2ZUXA 1C5BL 1NJ9A 3ALPA 3E0GA 5FYKH 4KKNA 3TYGL 2H8PB 1B6DA 3DETC 3WCYA 5EFIA 3DV4B 3CFBA 3KJ4C 3BKCH 3ARBD 3VXUD 2NY2B 5H8DA 1KTLB 4LQFH 4NJAL 4D8PA 3SKMA 1F4YH 1FFOB 1P4IH 4JDZA 4H0IA 1FL3A 1FVDA 3L3IA 1FYTD 4XHJC 3GIZL 3ZT7A 2NY7L 3PHQB 4AIZA 3QWRD 4U3HA 3CIQA 2P8PB 1A6WH 2EDWA 3OR7A 1L0XA 1OAXL 4JZNB 4DFHA 1H3GA 1FFOA 3A6BH 5IVXB 1I8LA 2HJLA 1JTTA 2ENYA 3QRGH 4QRSB 2GAZB 4LVNB 3FN0H 3VDCA 1NBZB 3LKSB 1FIGL 5F1IA 3WFEH 1TPXC 1JF5A 3KYNA 4TNVF 2YHGA 3BYTA 3VG0H 3MRBA 4PV9A 5CEYA 3BZEA 4TVPL 4ZUVB 4NCC1 5HDOA 4PJ7F 3DX6B 1XGUA 1J1XL 3KNBA 3ILQD 3L9RA 3RIFK 5IP4A 4RMUA 4MDJB 2W92A 3Q0HA 5JORA 4ESKA 5HGHA 5C8JB 3L7FB 1A1MB 1P7QD 3P2TA 3VXNB 1DBAL 1MCIA 5DFVD 3OKDB 4JPWH 1DUZB 2H26B 3GMLB 3LKOB 4HZLB 1TDQA 4KU1A 4R6UA 3QUMB 3O45B 2XWTA 1H8SA 4MQTB 3Q5YA 1UJ3C 3QQ3A 5HHVL 2AVGA 3MRPA 4PJEA 5C0DA 9CGTA 3QI9B 4Y2OA 3B9KD 1U8OB 4QF1A 2A6JA 1KN2H 5HJ3B 3PWJB 1IE5A 4WTZG 3IDUA 1A6TA 2X70B 3SDXB 1TJHH 4N9GA 1CZ8L 2XFXB 1XF3A 1JHLH 3ARSA 1JWUA 1S9VB 4QRTA 4Z7WF 4ODWB 2A6KA 4O58H 2F53B 2JE8A 5E9DB 1T20B 3HC3H 5K9OB 4GAGH 3OGCA 5BVPL 2LTQC 5DD5H 1KJ2H 5E6IA 3B9EA 5EU5A 2IBZY 2Z91B 1MI5A 3PV6B 2VLKE 5I8CA 4OAWA 2AI0L 1EBPA 4X99B 2I9TA 2EH7H 3O2VL 3QAZB 2Y6SD 4JM4H 1EFXA 1U8MB 2PYEB 1I1FB 3EHBD 4LLVB 4KMTL 1Q38A 4YPGB 4LF3A 1KLGA 5J8OA 3UYOD 1P2CA 2FX9H 1KCKA 4KHXL 2W65B 5SX5K 2PYFB 3UTQB 4O2CA 4NZUL 3UPRA 1DFBH 1OTUD 2K9UA 4ZFOL 1NL0L 4YDLC 4Q9RH 4Z5RA 4YHNA 1KC5H 4DKFL 3KWWB 1A4KA 3FRUA 1AO7D 1G7JB 4HMDA 3F58L 4U1NB 5GZNC 3DVGB 4XRCA 2JCCA 1OT1A 4HKZA 4NWTH 1ORSB 4LQ1A 4OCYH 3T2OA 3E3QE 2FYYA 1U8NA 3GJFK 1NQBA 5FKPA 4I0CC 3ALXA 2FYYB 2AKRB 3TZVD 4S11A 3EYOB 3MV8A 4Y89A 1FVEB 1ZSDB 3O6FB 1CD9B 5I8OH 1JWSB 2WINB 1HHJB 2HN7A 4C56E 1G9MH 1T03H 3VXMB 3OKKA 5IW6B 4UTBH 1WAAF 3C9NB 2OP4H 2NXYD 3FB5A 4LQFL 4LL9A 2BSSB 3PGDB 4JPIA 3O6LH 4PLOB 1KN4L 2Y1VA 5TQ0H 4EXKA 1ZEAL 4YR6B 3HG1A 2GITA 1P7QB 4N0RA 4XNZC 2DI8A 1WEJL 1JN6B 4KAQL 4MCYB 5GS1B 1IGYB 1RURL 1QR1A 3EAKA 2CD0A 1G1YA 5KVEH 2Q7NA 4FQQA 1T22A 1FN4A 5GHWL 2Y23A 4HKBA 3L5HA 3LMJL 4CMHC 3RA7L 2CLVA 4NJAH 2UYLB 4E41D 3FN0L 3ARFB 2ZCHL 1NGWA 2A6IB 4MCZA 1PAMA 3D39B 3I50L 5EZOL 1NGYB 4KKAD 5GRUH 3NCJL 4IOSD 4JFDE 4P2QD 3VXQB 5CD3A 4MXWL 3MJ9A 4PRBB 1TJIL 3SDAD 3PF2A 3BMWA 3K7UA <