1U41A

Crystal structure of ylgv mutant of dimerisation domain of nf-kb p50 transcription factor
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
103
Chain Sequence
b'NLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIIRFYEEEENGGVWEGFGDFSPTDVHRQFGIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear factor NF-kappa-B p105 subunit
molecule tags Transcription
source organism Mus musculus
publication title Snapshot of Protein Structure Evolution Reveals Conservation of Functional Dimerization through Intertwined Folding
pubmed doi rcsb
total genus 18
structure length 103
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u41A00
4TNWK 5JXEA 1F4WL 1J86A 4HLZH 3CGTA 1U8QB 4J4PD 2W59A 1UH2A 3WL9B 4HGMA 4IHOA 1F6AB 3GSNL 4HPOH 4N0CC 3BP5B 3C9NA 3DGCR 1KB9J 1WBYA 4X99B 4X7SH 4Z7QE 2BC4A 4PJBE 1RURL 2EXYC 1AGDA 4ZFOB 3UBXG 3D39B 3BGMA 2D7TH 4Y1AE 3HFMH 1YC8A 4JRYB 5D71H 3LZFH 4U0QB 1N59B 1OAZH 3C8KA 1OTTC 4AL8L 3BXNA 3DO7B 4HWBA 3AU1B 2ZCHL 4LLAA 5A40E 1HYSC 1MEXL 4L4TD 4GAGL 4HULB 1YMHA 3AB0C 2APFA 3RWIB 1S7UA 4YDLB 3NPSC 1U58B 3ULVE 4NQUA 3UTZB 4ZXBB 1AR2A 5GZNC 2NY7H 4FZEL 1KUMA 2JB6B 2WM0A 1S7WB 1T1ZB 3DETC 4Q6IC 3P0VH 1JHLH 1H5BB 3H9YA 1BFOB 1I1AA 1IQWL 3DX9A 3TBTA 4H0GA 1KC5H 1DEEA 4R2GB 2DWEB 1Q0YH 4KKAD 3BPOC 1L7TH 3SKNB 4R96A 1LEGA 3L95A 3VXSD 1A14H 2Z93A 5TFSL 3QDJA 1RJLA 2IBGA 4BFIA 1LMKA 2GTWB 1CGXA 4NZUH 3O8XB 1T2XA 3VXPB 1I1AB 3HPLA 1IGTA 5D7IE 4DGIL 5INCA 3KLAB 4PRBB 3Q1SL 1UWGH 5KVDH 1PKQA 3QQ9D 1NFIB 1VGKA 2A38A 4CU7A 4OCRL 3VWJD 2IADB 3KPQA 2LAGB 4PRDB 5F1SA 1UXSA 2D7MA 3P4OB 5HHXH 5EWIH 3PWVB 2K1MA 5HDQH 4ODUB 4PRDA 1XF4A 2IMNA 5TE4L 4FXLA 1I9JH 1OSZA 4MNHA 1LNUA 3KWWA 4Z0XA 4YHNB 5E00A 1CE1H 5E08L 5IM7A 3PGDB 4NWTL 3RUGB 1AXTL 5INCB 1BX2B 3BQUC 4RAUB 4DKDC 1HHJB 3ZMRA 5C2UB 1IC4H 4S1SL 4FQQA 4QEGA 1UQSA 3EYVA 4LASH 3HC3L 4MXWL 5F9JA 5ICYA 1I75A 5JHDE 1CI5A 2WUBL 5JHLL 5HGBA 4KHTL 1JN6B 5ILTL 3B3IA 3CDFA 3BPLC 3P0YH 3QFDB 4FFWC 4PJ7B 4UOW0 4OZFH 1RHFA 5TPWL 5DVNA 3CFCL 4LLMB 3T2OA 4JKLA 1NMBH 3TBSA 2B4CL 5I74C 2V7NB 2X89A 3TCLA 32C2A 1B6DA 3CMGA 3LQZA 4MMZC 4FQQB 4J6RH 5BRZB 1SBBA 5E2WH 1S7WA 1OQOA 4C83A 4PRHD 2YWZA 1C5DB 4IIQB 2I5YL 4NKIL 1QRND 5HD8D 4KGLA 4UTBH 5DLML 3RGHA 3SDAC 3IGAB 1NEZG 4HWUA 3QH3A 4G7YH 5GGVL 1JNLL 4HDIA 2NW3B 3RX5A 4W68A 4F15C 4IRSD 1J8HE 2E27L 4NHCL 5AWNL 2IALB 2DS4A 4U4BA 3F6LA 2CMRL 2XKNA 4YGAB 2AXHA 1A8JH 1B0GA 4L29A 1WIOA 4Y4KB 5M95B 1OOAA 32C2B 5JHLH 4Z7NF 4X6BB 4UT6L 4PBWD 5KVGH 3V5HB 1A6AB 1T5WA 4PRBA 3UJTH 5D93B 1P69B 2YRLA 4RFNB 4EN3A 1ORQA 5GRJH 5CLTA 2DJSA 4D9LL 5ICZB 5D1ZA 4XMKH 3QRGH 2PW2B 2F19H 3ARRA 1DFBL 3QI9C 3O11B 1RJLB 5CJQL 5KVGL 1A1MB 3ILPB 1EFXD 3B2VH 3MXWH 3DURB 3LV3B 3MRPB 2EEBA 1TJHL 1G6VK 2FR4B 4N8PA 5C0EA 2P43B 3ARTA 4NO3B 4JPVH 1E27B 3PDDA 1KT2B 3X3FL 4WWID 2X4QA 1SJEA 5EBGA 3QDMA 1J05B 4QHMA 5I1DA 3LV3A 3TO2A 3BWAB 1GYAA 4HMCA 4ZUUA 3SDCC 2EICA 2CUIA 5E8PB 3VXOB 4TUJA 2YD1A 1P84J 1S3KL 1H8OA 1FCGA 4KROD 4PGCA 1IM9A 1WWAX 5HHNB 4ZUTB 1NCAL 5E6IA 2DKSA 3WIHH 5I15H 1ITBB 3DRQB 4K3GA 4Z7UE 2H2PD 2HFGH 1T22B 3S7GA 3V0VB 1T66D 4KROB 3WEXB 2VTFA 3GO1L 3B9KC 1HK6A 1HHGA 1JPGB 3BEVA 3SO3C 3OMZA 3HZYA 1RHHA 4ORZC 3CC5B 4U3HA 2Q8BH 3MV7D 1MHEB 4F57H 3IVKB 3IB4A 5EBMB 4R3SB 4Q0XH 3VFVA 3KPRA 1EMTL 4OD3H 5F6IC 1YDPB 4D9LH 1AHWB 2QL1A 1GGIH 2C4XA 1R5IA 4KRNA 4GMSL 4HFUL 4TSBH 1UT9A 5IKCB 3CUPA 3NCEB 4WU7B 1KCVH 4RQQA 4F9LA 3WFDL 3WO4B 4JZNB 2DTMH 1S7VA 4D9QD 2FO1A 4G8EA 1EBAA 4WFGE 2E9IA 4B7IA 1BJ8A 1EFQA 3J7HA 5C0CD 2BVYA 1I1YB 3QIBC 4PJIF 3Q6GH 5E94B 4XMLL 1P53A 1OARH 1UJ3B 1WBXB 2OMBA 2VXUH 3B6SA 4G9DA 2CRMA 2UY6A 1WBYB 3OR6B 1AIFB 2XWJB 5TE6H 1F8TL 5B22A 2QHRH 4GXVH 5DJCB 4KQ4L 5DVOA 2BVQA 5EU4A 4ZO6A 4Y5VB 3U46A 3IAPA 3MLZH 3I84A 5TF1L 2ZUQC 3U7WH 5C0GA 4LCUB 3MLYL 5FCUL 4EDXA 5KVFH 5DQ9B 4EI6B 2IBBA 5DJ2A 5F9WB 2COQA 2NY1D 2V9QA 4KY1H 4RGNE 3GSOB 2K7QA 3WHE0 1AE6H 1S7UB 3IXTB 3PQYA 2R0KL 2Y07L 1NFDB 4GW5A 3OKLA 2VQ1A 5LGHH 3D3VB 2GK0B 5DK2B 3BXNB 4LCUA 3P9WB 3SE4C 5M94B 1E4WL 3AS1A 1KGCD 2V2WB 3QNYB 5L7XH 1E6JH 3RL1A 5E6IC 1CK0L 1AI1L 1PGRB 1U8KA 4HG4J 3GBNH 4MXVE 4WHYH 1HHHA 4PJCE 2VISA 5ALBL 1U8KB 1Z2KA 3C5SB 5JHDD 3BKCL 4HH8A 3PWNA 1KB5B 3ARSA 5MENB 4TUOA 3RY6C 5TGBA 1AD0A 2OLDA 3WS6A 1S7VB 5H94A 1D5XA 3JVGA 4JDZB 4KH2A 3WIHA 1IGIH 3V9FA 5EWIL 1S7RA 1I9IL 1WIPA 1HKLH 3HUJE 1IBGH 2YEZB 2HFFB 3SCMC 2P5ED 1I85C 1OSPH 1JGDA 4R26L 4RSVA 5HPOA 4IS6B 4NP4H 1D9KD 1V8HA 2WWMD 1LHZA 2DQJH 4L1HA 5E2UL 4YX2L 2EZ0D 1A2YB 1NAMA 1ZGLM 1I9RL 1I9EA 4EN3C 5HY9B 1SJVA 3OJ2C 5JQ6L 1OAQH 5ANME 4CGTA 3U7AA 3TM6A 1DSFL 1RD6A 4RMSA 4RRPA 3NTCL 3TIEB 2RFXA 3T65A 1PLGL 1EEZA 1FNSL 5GS0D 3GSVB 4QXWA 5D71L 2UZXB 4M7KH 1MVUA 5T1DH 1EGJH 3NABH 2EDKA 3F12B 2PYEB 4FNLH 4X8JA 1UA6H 3O9WD 3VXQA 2BXYA 3CXHJ 1YECH 3PE9A 2JKXA 5C70A 4DEPB 5E2JA 1RUKL 3CSPA 2DQJL 3FN0L 1U8MA 1FYTA 5AD0B 1XF2B 4F8QA 2DLEA 4ODSH 2ZCHH 3W5NA 4JFFD 5ERWB 4JN1H 2EXWD 1IGMH 1JNJA 2J5LB 4MCYB 3O0RH 1ORSB 2NY0C 1R5VB 3PNWA 3MRLA 1RZIA 4H88L 3ULUC 3AMLA 4I2XA 1HSBA 5GJTH 5IGXH 3QXAB 2DM4A 1RHHB 4P3DA 1U3HD 3Q5OA 1GIGL 4DZBB 5GGRY 4KROC 1UKTA 3KPSA 3P0GB 1W0YT 3ULUF 4F2MB 3CSYA 3S4SG 2ZPKL 3BJLA 5IFJB 4XVJH 4F7EA 2X7LB 4LVOC 1U3HB 3FHAA 4XVUD 3K4DA 1HDMB 3MSPA 1UZ6F 4DFHA 3EJZD 5BQ7B 4PJ8D 4C4KT 1JRHH 1ZT7B 2AJUL 1CT8B 3F58H 2G2RB 2HLFC 4KMLB 4ZNCD 5A2JH 3MV7E 4UINL 5JQHC 1CXIA 4LVHC 3QISA 4CVXB 3OR7B 2PNDA 3NFNB 5D5ME 2CIKA 4P23A 5IFJA 1N3NB 1ADQH 5SWQA 3TPUB 3MJ7B 5J89A 4F7TB 3WNLA 4PG2C 2AJYL 3EJYC 2FGWH 2NYYC 2W65B 4JJ5B 1IM3A 5HYJD 1F6FB 3ARDC 5T1DL 4ZOBA 1KCKA 4DKFH 4GRLA 3ARGB 5H2BA 3ECBA 3U0TA 4IIQA 3BDBA 4P5KA 2BMKA 4K3DL 4KI5E 4QNPF 4OGXH 1BZQK 2CLRB 3NA4A 4ENED 3CLFL 3MLXH 5I15L 2LU4A 4X7SL 1W0VB 5B4MC 3TGXA 2HAZA 1F11B 2ZOLA 2NYYD 3ARYA 3M17B 1HKFA 3FO9B 4MWFA 3IDGA 3BQUD 2QJDA 3SHSA 3ZKSD 5MEOA 3V8OA 4WWKC 4WFEE 5CCKL 3HB3D 3MROA 5C7XL 4RMUA 3O6FA 5DMIL 2D9CA 5IHLB 4EI5C 4XCYB 4RAUA 1U8OA 2RHEA 1P9MA 1UH3A 1NLBL 2OP4L 4LLWB 4EQ2A 1W8NA 1UZ8A 2E6JA 1L9NA 1ZEAH 3NOIA 1LK2B 3W9EB 3GM8A 3LSOB 3PV6B 4XXCC 3ZDYF 4J2XA 3V5KA 5IIEB 5FUCE 5LGKA 1J1PH 1ZA6B 4J3XA 3O2VH 1T0NB 3LQZB 4OJFL 1UKSA 3KXFA 3NCYP 2X41A 5J1AA 1MCFA 2H26B 4U1MA 1HZHH 5D7LA 5DHYB 3JVGC 3MV8B 3U6RB 5EC1A 3IFPA 4PJHE 3QUMH 1N7ML 1FQ9C 5AG8A 3GMPA 1YA5A 3FOLA 3K3QA 1GJIA 3GB7A 4MS8D 3MV8A 2Q87A 1OWRM 3GIZL 3FT2A 3IDYB 4AL8H 3KR3L 5J1AB 2AJVH 3VXSB 1A9BA 1OTUC 3ULSB 4XP9L 4LQFL 2BXZA 5DD0H 3ALPA 5T33L 4HFWB 4OV6F 4KDVA 3C5ZB 3BN9D 3HZVB 3CFEB 5FFLA 3AM8A 1NC4A 4Q58C 3OR7A 2C3VB 2D7QA 2HFEA 2YPVL 4GW5B 1RY7B 2ED9A 4N5UA 1CE6B 4ZPTB 3IJYA 4MA8H 3TFKC 1DVFA 3K4AA 3HE6A 3LQAL 4I0CC 4XCYA 2Y9RT 1C08A 2PTTB 5FM5O 1HE7A 4CDHA 1FZJB 1IMHC 4EDXB 5FUOL 2Q20A 2WBJB 3QZWA 3WYRA 1Z0MA 4OIIL 4PGEB 5DURD 3FKUS 3NIDE 4QRUA 4X6CF 4OQTL 3ZKNC 1VFMA 1IAOA 4NN5C 3O81A 4ZPTA 5DWUH 4G8GE 1TJGH 1ZTXL 4PJ5E 2XXMB 4HV8B 4POZD 4QTIH 3KDMA 1WIUA 4JFYB 1QA9B 3B5TA 2VB5A 1MCNA 5EORH 4OT1L 4LGPB 4QRPA 4LPCA 2JB6A 3HI1B 4JFYA 5D2LF 4JO4H 3X17A 1LD9A 4M1CC 2V2TA 2V17H 1Q72H 3PGFH 1HZHL 1CS6A 4GS7B 2GJ6A 5JIPA 3GMQA 3RNQA 5DUBA 1CICC 1MPAH 1GHFH 4ZO7A 2X09A 1QRNB 2VXVH 3DX8A 1ZHBB 1YPZF 5CZVH 4IRJD 2P1YA 2YMXH 5TH2B 3STLA 4HIEB 2VLME 3WUWA 5IHZA 1K5NB 3QRFM 1N64L 3ULUD 1U3HC 5ID0B 1G0XA 4S11A 5TH2A 3STLB 3KXFE 1ED3B 3FOMA 4JCLA 4UV7L 3E6HA 1IFHL 3VXRB 2QHRL 1GH7A 4GXVL 4KXZI 4ZFGH 5DUBB 8FABA 4GT7A 4MWFB 2V2XB 5FA4B 3WSQL 1KNOA 3LKPB 3BDXA 4I18B 3C5ZA 2MTPA 4BFBD 4KKCD 5IB1A 3MR9B 4IS6A 5LQBH 1QFWI 2GEEA 1A4KB 1J9CT 5CD5C 5KS9E 4L3EB 4TSCH 4I9WD 5DS8B 1I4FA 3CFIC 1YNKL 5FK9B 5E4EB 2DJ4A 4L8SC 2C3WA 4PRAA 2ZOKB 2VLRA 4ZS7H 2ICWA 4FA8A 2E7LA 4KMTH 3WBDA 3P4NA 3UYOD 1CLCA 5FHAH 3BD4A 1M6OA 4FMKA 4OV5B 3RVVD 5C9JB 4ODVL 5FGSA 1AO7D 2FH8A 4MMXC 3LN4B 3GK8H 1DCLA 3MLVH 4CMMB 5GS1A 4I3GA 1HIMH 4PJXF 4OBRA 1NGZB 4P57B 1LO2L 1WK0A 2OXGA 2F54D 3T4YB 2BNRB 5CEZE 1HWHB 3O9WB 4CBPA 5E8DH 4FHBD 2ADFH 4PJEE 2B8OT 1C5CL 1DBMH 4KTYA 3RAJL 4P3CH 4PR5B 5KAQF 2BVOB 2X4SA 4M7ZB 4NO5A 5HYQA 4ERSL 4XVUC 3DSFH 5FHBH 3TJHD 4M8QA 2X7LA 2CDEB 4UILL 1MHPH 3ZKMD 4YDVB 3IYLW 1P7KA 1TQBB 5HVWA 1N64H 2IJ0C 4PR5A 2Z8SA 2A1WL 1G7LB 2F5AL 1BHGA 2PW2A 1IJ9A 3VXUE 2MQ3A 4X9IA 3PWPE 4U3XA 3OXRA 1G9NL 1FLRH 2VL5B 1KF9B 3VFNA 1F3DH 1KLFA 3GNMH 2P5WB 3TPUA 3P73A 4A6YA 4XXCA 3GMOB 4NDMA 4XBEL 1MCEA 3WXWL 1KCVL 5JW5B 2LTQC 4F37F 2W07A 3M07A 2YC1A 5D5MB 3D0VB 3RDTB 1GRWA 4G6JL 4YC2B 1D6EB 5L9DL 2G2RA 5E6ID 4Z0BH 1DR9A 1TZIA 3RQ3A 4M93C 4EUPG 2X4UB 2Z8RA 4LCWD 4JB9L 1MY5A 4NNXA 4EI5A 4G7VH 3VGBA 5TDPA 4GFTB 3MODH 5DJXA 3HTLX 2ENSA 4M43L 2J1KA 3CXHK 3C5SA 4Y4KD 3PQYD 4GG8A 1FPTL 4UT9H 4NQXB 5HDOA 2B39A 4MA7L 3V95A 1OP5H 2ZJSL 4FNLL 4XPTH 3L7EA 3O2DH 1ED3A 4G43B 3ARGD 1CFBA 1D6EA 1MCWM 1XF5B 4O9HH 1A21A 3QI9B 4LBEA 5L0QC 4X0KA 5DUPH 1OT2A 2FJFB 3VJ6A 5EG6C 3VFMB 3JV6A 3LEVL 2BFVL 5C6TL 4UTBL 4K94C 1EFXA 4APQA 1QFWM 3U4AA 3D69B 5IESL 1AHWA 5LXGL 3U4EA 1KEMH 3RNQB 1E0OB 2W9EH 5I0ZA 1F45A 4FZ8L 3DX7A 2GJ6B 4PJAA 2X4TA 1MCHA 3KPOA 2EH7H 4ORGA 5IFAH 4CDGC 1MAKA 4M6ML 1ND0A 3PWVA 3SDXF 3WEXA 2GJ6D 2WBJC 1H0DB 2R39A 4O2FB 1UXSB 1B0RA 5FF6B 4JKWA 3NIGE 3HE6C 1LDSA 2A1WH 3HNVL 5ANMA 3RUGE 2XWJA 3L5XL 3IJSB 2DN7A 4AMKH 3EYSH 1AR1C 3FQRA 3L5HA 3EHBD 4IJ3C 1EDQA 3JXAA 4JO1H 3ZKND 1QRNA 4YHPB 2IANB 4WJ5A 1G9EA 5JMRA 1J0HA 4HG4K 3QNZA 1EMTH 4HEME 2W60B 5BOZG 2R69H 5C9JA 3OTTA 1E4XL 3OKLB 5D7SH 4TOYH 4GKNA 1KG0B 1S7TB 1KPVB 3RZCC 4JB9H 3MTRA 1NANH 25C8L 1NCBL 4PTTB 1IGJB 3QG6B 4WIQA 4Y19B 1BLNA 1ZLUK 1SBSH 3PXHA 4OLVH 3QNXB 4JAMA 4MAUH 1JPFB 2FJGA 4XRCA 5F6IB 5DQ9A 4JM4H 5KTEH 4MA7H 3ULSA 5IEKA 4KAQH 3MYZA 1YMHB 1C1EL 5D7KD 3RWIA 3PF2A 1AO7A 5IEKB 1TTUA 4K2UH 3AB0B 2MPAH 2XZQH 4HBCH 3FO1B 1QFUH 1JWUA 3RL1B 3FB8B 4Z5RA 3SJVA 3I3EA 1JUFA 3RI5F 4HX1B 2EEDA 5DMIH 1ES0B 4NYLB 1VEOA 3VWJC 4YFEA 1JPFA 5CBAB 2FIRT 1Q0YL 4RAVB 1NC2A 5FYJU 1LO3L 1FSKC 3F7VA 1BF2A 1II4E 3A6BH 2R1XA 1MCPL 3D3VE 4MJ5B 3ZKQD 5MENE 2AERT 2H45A 2YUWA 1D5XB 1JHLL 3IDUA 5DHVA 2ADIA 3VI3E 1Q38A 4GLRH 3JWDC 3WL9A 2C3HA 4XP6H 3QUYD 5B21A 1FZMA 3MCKA 4PJ5B 5EOCJ 4HD9A 2F74B 4KKBD 5D1ZD 1XGPA 2HP4A 3RVWC 2MQCA 3L3OA 3VXSA 3AGVA 1KT2A 1V3MA 2ZP0T 2DQIH 3KDMB 4XBGB 1S5IL 1JZ6A 3JV4A 3OKNB 3PGCB 4NM8H 4WFFE 1BQHA 2KQMA 3QEUA 2UYLB 4HEPG 4U1JA 4PJ9A 4U1LA 3BH8B 4JRYD 1AXTH 1M05B 3O11A 5A43C 1MWAL 4BH8A 3CZFA 1K2DB 1NJ9A 5ESQA 4LKCB 4U2YA 2YD8A 4NUJA 3L9RB 1JV5B 5CMAB 3KXFB 4ZXBD 2YR3A 5SWSB 3VXUD 1R3LB 2BOCA 1U8NB 4PJXE 4D0BB 5GGVY 1MCRA 1IILE 1S7XA 4LSUL 2XWBA 5D2NA 3BJ91 4PJ8B 1SM3H 5I19L 1EJ6A 3DUHA 3IETA 2WW8A 4PLKC 1UZ8B 3QAZC 2BSTB 2H6PA 3W11C 4JRXE 4CVZA 1YY8B 4M93B 5E8NA 2OR7A 5IF0B 4KHTH 4XAKE 1UCBH 5ACZA 1BECA 1JZ4A 4Q74A 4NT6B 3U9UA 5I18L 5I1CL 4X8XA 1TITA 5C1MB 4OLZL 4MNQD 4LF3A 3D2UB 5EO1A 1KIQA 1WICA 4FZEH 2NTFB 3MV7A 4N9OB 4U6VH 2FEEI 1MRDH 1N4XH 3UBXA 1GPOL 1ZXQA 5E1AB 3SDXA 3WIFA 5BVJA 1D5BA 1T21A 5GGQL 3GHEL 1CBVL 2CLZB 1NGPH 4G42B 1CT8A 2Q86B 3V4UL 3P9MA 4F15B 3TBYA 3LKRB 3IXTA 5TE4H 4F33B 2H26A 2JJTC 4XNUL 1KN4L 2ED8A 3NCCB 1UA6L 1YDPA 3EO1B 2HT3C 2AK1L 3CX2A 4LCWE 5DFWH 4M5ZL 4LFHD 5CGYD 1YEHH 2P8LA 5BOPA 4XCEB 1S9XA 2C1OA 1LDPL 3C6LA 3BPLB 4PUBL 3OKKB 3QUXB 4GRLD 1LE5B 2XA3A 2ERJB 4YQXH 5B4MD 3VXMB 4PRID 5DJCA 2Q6WB 5SWQB 3EAKA 5CEYA 3NGBC 4YJZL 2W0FA 3DMMB 2E3VA 1QACA 3T0BA 1N59A 3ZL4L 4IIQC 1NAML 3N9GL 4L8DB 1FYTE 4IMLB 4W6WB 3MOAL 4RGNB 5DJDB 3VXMD 1GZQB 3GZKA 5BQ7A 1KGCE 1B4JL 5LWYL 4L8CB 4ZMAT 1QSZA 2ITCA 4X6CE 3RIFK 2AK4B 1CD8A 1YJDH 3FJTA 3FCTA 2WV3A 4OZHB 4PJFA 3QULA 3LKQA 1QR4A 2EDDA 3S5LA 4JM2C 1CF8H 4QY8A 3FN9A 5IHBA 2PXYD 3IKCB 2DIAA 2R4SH 3GSQA 2PTUA 5FO7A 3RDTD 4U7MA 1OHQA 3P30L 1XGQA 3MA9H 4YDIL 4HIXH 1GGBL 3PWLA 4KDTA 3AAZA 1R24A 5LBSL 2P24B 3BD5A 3SDCA 1Y0LA 1XF4B 4PG9A 2N56A 3X11A 1NMAL 5D2NB 3MRKB 3MV9A 5IMOA 3KYMB 4GUPB 3ZE1F 2V7HA 5HVGB 5A2IH 2DQTH 3WIIL 1CDIA 5KSBF 5L8JB 1EERB 2BHUA 5D1QD 9CGTA 5GRUL 4DUVA 4J4PC 4S1QH 4WUUA 5BS0B 3HPLB 3KPTA 3VFRA 4NRZA 1SYVA 2CJUH 1G9MH 2FB4L 1RU9L 3RTQC 3ZTNH 1YZZA 1AE6L 2NY2C 1KEGL 5EUOB 4YEFA 5IB5B 3BRDA 3ULVL 1JHTA 3GMNB 4AG4H 1LVEA 1U0QA 2J4WL 4Z8FL 4PJ7E 3FQXB 5B8CB 5I1DB 2IMMA 3TESA 1MRCH 3OKEB 3LIZL 3SY0A 1U6AL 4WU5B 3PNWB 4MNHB 5BW7A 2R8SH 2J2ZA 1DLHA 4AT6A 1K8DA 4TVSa 4DAGH 5ABDE 3RVXD 4C59B 2EDOA 2DI9A 3I75B 1P4BL 4AQ1B 1X6LA 1MSPA 1JN6A 5LGJA 2JCCB 5TQ0L 1KIPA 2IANE 1FO0L 2XXCB 1YYMH 1DVFD 1JPSL 3KYKL 5C0RH 5LCVH 1MI5E 3SE9L 5DO2D 4Y88A 5HHOA 4Y0GA 1J18A 2E7LC 1XGUB 1ORQB 3F12A 1KELL 2B20A 3CPLA 3WXVL 3LS4L 2EIZA 2DKUA 3OV6A 4YXLL 5IR1A 5GPRA 2OTUA 5DJAA 4OGAC 1NGYB 3SCMD 3VE0B 4E41D 4OCLC 3STZB 3FO1A 5AZEH 1SHMA 2XKNB 1CD9B 1OAYL 4HIXL 3IKKA 2GT9A 1H8NA 3PXJA 4UMGA 1QSFB 2APWA 4UV4H 3RZCD 2EE2A 3PABB 3EGSB 2ESVA 4L9LA 4QT5B 5C08E 2A6KA 3FB7B 3GO1H 5I2IA 1NCAH 1J0ZA 3NN8B 4GG6F 5IT2H 3X12A 3ZDZE 5IB4B 3SGEI 3P9MB 3LH2L 1EHLL 3C2AL 4Z77A 5EC2A 4DVBA 5I1JL 2F8VA 5B3JE 5SV3A 1RQ5A 1X5JA 1BD2E 5I9QC 4EBQL 1SQ2N 2A6KB 2IQ9H 4ZNEA 2R8SL 2XZAL 4BZ1L 3VXNB 1GGCL 3HI5L 3O41A 4N1HB 3G5XB 3VH8A 5CJXC 2Z9TA 3CFJA 3H42L 2VDNH 4CMHC 2O5ZH 3DPBA 2PR4L 4DK3A 4XNMB 2R2BB 3VXRE 3ZE1E 4E5XB 1X4YA 3DYPA 2Y36L 1L0XA 1OGAB 4LHQB 4X98B 2NY1B 4JFXA 3V5KB 2FL5B 5IIEA 5IMKB 4PJFF 3QPQD 3WFBH 1ZTXH 4GG6B 4XVTL 3HMXH 1P4IH 3MRBB 5H8DA 5HTSA 5EZLA 1XGUA 4UDUB 1OGAD 4HS8L 1E4WH 3MLRH 2YPLD 3WFHB 5J13C 4KU1A 1XZ0B 5IMOB 4ONFL 5FOBB 3UZQA 1UCBL 3QB7C 1U3ZA 4PG9B 4PY8I 1LEKB 2YA2A 2FJFA 1BBDH 3N85L 3WUZA 4QF1B 1QPXA 3UAJC 1QBMH 3PDGA 1F4HA 2NR6D 1YQVH 3KPMA 3ARDD 1BZ7A 1MRDL 2UWEB 4OM1L 1JZ5A 4IHOB 3NFPB 3MLWL 2YD2A 1URLA 1DZBA 3D85A 5TF1H 5ACLA 4G6KH 5KSBB 5IGXL 2AEQL 3O6KH 4A2MA 3F7YA 4PJGF 3THMH 2EZ0C 2Z4QB 2XQBH 2Y5TB 4JY4B 4EUPB 2D0HA 3QCVL 4P2RA 3HI6L 2J8HA 2NY3C 2VDLH 4G8EB 2VKWA 4JRWA 4OLEA 3QJHB 2H2SC 3P4LA 2VIRA 1YEKH 2IAMA 2BDNH 2OJEA 5KN5B 2HRPL 4NPYA 1W2KT 2NPLX 1ZLSH 4CADB 2ICCA 1ADQA 5BJTB 2VDRH 2EYRA 1DUYA 3WNOA 1MWAB 2A6IA 4JREC 1T1YB 2W91A 4FZ8H 4UNVA 3VXMA 5FUCC 1NBZA 4XPGH 2R1YA 1BFVL 5GGSA 4P2OA 5I1LA 1OM3H 4LHUD 1N5YL 3NTCH 5C0EB 5E4EC 2I27N 4DEPC 3FQXA 1LP9E 5B8CA 2VH5H 2AJYH 4ZUVA 4PJDB 5D8JL 1N6VA 4XC3H 2VN7A 2X4PA 5D7JD 1DQDH 4F2MA 5T3XE 4DGYH 5CILH 3GSQB 2QV2A 1AC0A 3L3KB 5KSVA 1QBBA 2IEPA 4NM8L 3SN6N 1C5BH 4DVRL 1JTOA 1ZEAL 2JJSC 5DRNA 3VG0H 4HJJL 3EYSL 3QWRA 4W70A 4N0FB 1A6AA 4NSKA 2X70B 2EEAA 3VI4E 4PRIB 4JHAL 4I4WA 2X9XA 2BSED 1PJ9A 4GXUN 5FB8A 4K3EL 1MOEA 1YEGH 1CGYA 4X6EB 1MUJB 3TPKA 4FQXA 1A1OA 1QHOA 3ZHKA 3GSXA 4XCFL 1P6FA 5AZ2L 5ITFA 3VRJB 3I85A 3BW9A 5ADPH 4LEOB 1OSZB 2OP4H 4UZGA 4GG6A 2EDTA 1J87A 4HMEA 4WTXA 4ODUA 3G5VB 4RAHA 4K9EC 5FV1L 5JNYB 2P45B 1CXEA 2CH8A 1UB5A 3OL2A 1PEWA 3TH2T 5CP7A 1RFDL 1C1EH 4PLJD 5F9AC 3PDOA 1X5KA 3QFJD 4EQ3A 3E3QE 3OGOE 5E9DD 4XI5C 2CLVA 4C56E 2EYTA 1BQUA 5C3TA 2HLAA 3QEQD 4TSAL 3KLHC 3RWDB 2EDYA 3CZFB 4NZDA 3EYVB 2V5YA 3BUTA 1OAZL 1F3JA 3SDAD 5DD1H 4M3JA 4L9LC 4OCXH 3O4LA 1PX3A 4R4ND 2IAMD 3QEQB 1RFDH 4U1JB 1JGUL 2CK0H 3DSNA 1ZHNA 5EO1B 1AKJA 5F9DC 5FGCB 2RBLA 5C0CE 4ONGH 1S8DB 3GKWH 4GKSA 5KJRL 5DRZA 1HWGB 1PZ5A 3DUUB 2IAMB 5KN5A 2GY7B 4DKEH 2DMBA 1VFOA 1MJJB 1PY9A 1T2QH 3WNNA 3VFWA 1T2JA 2NW3A 1T04A 2KQNA 3MJ8B 3EDEA 3OKMA 3DVIA 3IGAA 3QH3B 4JRXA 3LN5A 4J3UA 1R3JB 3WXWH 3I6GA 3R1GH 1S5IH 4L5FH 4QHUA 2E27H 4NHCH 2HRLA 4LLVA 1MJJA 5GZOD 2Z35B 4FQJH 2DLHA 5MP6H 2DBLH 2NLJB 4FQLL 1U8PB 4P2QB 5B38G 2UZIL 2IF7A 1NGYA 3VE0A 3L9RA 2YSSA 5JDJA 3MO1A 4IDLA 3UBXB 3QO1A 3DIFB 3VFOA 1YEGL 4HKZB 4E0RB 5TF0A 3CFCH 3BP4A 3WJJA 1QLEH 2JF1A 5FYKU 3U0WL 4FS0A 1MFAH 1HINH 1S9VB 1LEKA 2ICEA 2FYYA 3D3VD 5HHOE 5FO9B 4AEHL 1LO3H 1JF1B 1I1CA 1JWMA 4MJIA 2N1KA 1DVFB 4YXKH 1KJ2A 2FATL 3RL2A 1JF5A 3NIFE 3O0RL 2WMPA 1WEJH 3KLDA 1GSMA 3OPZL 3VWKD 4RMQA 3SDDA 1KPUA 1U92A 4HF5H 2ATKA 2PO6D 4PBVC 3R4DA 4MJ6A 5E08H 25C8H 4P0DA 4PB9H 5D4QA 3F62A 5SWSD 1FGNH 4NKOB 3TO4A 3MV8D 3VXUB 4ZAKD 4EIZC 1UJTA 4LSSL 1WEJL 1MELA 2PO6B 3DO7A 4KHXL 3PP4H 1H9VA 3QDGE 3E6FA 1TZHB 3RZCB 2VLKA 5CINH 1N4XL 5GXBB 4M4RA 2BHYA 2Y25A 1WVZA 1IEBA 5LG1A 5J06A 3EYFA 3L5WA 5EUOF 3RWCA 4QNPE 1CXHA 1YUHB 3L5XH 1RZ7H 1I7TA 3QEUB 4KDTC 5GRXG 4Z77B 4RDQF 4NQSB 3JWNC 2KUTA 2ADGA 2F58L 4ISVA 5IG7B 3VG9B 3R1GL 5DMKA 5DMJB 3TVMC 1QR1A 3TYFB 4R3SA 3TYGH 3LSOA 3PV6A 1CN4A 3NA9L 4HKBA 2Y72A 4EXPX 4LU5H 5F7MC 3ARFB 1DANT 2DQDH 3QXVA 3D69A 1YQVL 1HHGB 1XF1A 4MXVF 2HLFD 1G84A 3GM0A 3F7VB 4S1SH 3MBXH 3T2QA 5GRJL 3HNSH 3FCTB 2G75B 5IOPA 1WQVT 3VMOA 3GMMB 4F7MA 4D9RD 4Q6IB 4JFZL 5CWSB 4V2BA 4KJQC 2NLJA 5M7QA 2I60L 1HIML 1SYSA 1X5GA 4XHJD 3L3GA 4D0DB 3GRWA 2NX5A 2WNGA 3ARWA 5FGRA 4U05A 5FYJE 4JE4B 1F90L 1B90A 2IPKA 2HT4C 2VKXA 2ZUVA 4FFYL 4R7NA 2JLLA 5BRZE 5DVLA 3NFPA 2K7PA 1X5LA 4J3OC 3SKOA 1U95B 1DP0A 4G8FB 3QEGH 1UADC 3OKEA 3UROR 4IRJB 3BVNA 3VGGA 3EO1A 2YXFA 4PLKD 1H3PL 5CJBA 5AYUL 1G7PB 4Y16A 5HPMB 3GGWA 2NNAA 1IVLA 3V4VH 4ETQB 5HI4C 1F2QA 1DQML 2P49B 1HCFX 4JO3L 1WITA 4IRSB 4P4KA 3WFDH 4CVWA 1MIEL 3ETBF 5CJ8A 3C8HA 5DJDA 1AC6A 3QXDA 4RA3A 1NGQL 3U0PA 3DECA 4ODTH 1RU9H 4LCWB 5SWZB 5TQ2L 2YBRA 2Z31A 4P5TB 2CDEA 5AZEL 3SBWA 4OLYL 4QRRE 3GSRB 3NZHL 4JHAH 3VA6A 3TN0A 4F58H 1XIWD 3KPLA 4RA0C 4Y16D 2F15A 5CSZB 1R3IH 1V7MH 2XN9A 3INUH 1PZUB 4QXGH 3BW9B 4Y5YB 1FFRA 2NZ9D 4ZODA 1PX4A 2DMCA 3Q0HA 2BCKA 2XZCH 4NJ9L 4TSBL 3HMXA 4OIIH 4MCYA 4WHDA 1CFVH 1K3IA 4S2SB 4JRYE 4UBDD 5GRWA 1A64A 1UVQA 3QDJD 2BZDA 1EFXB 2VNCA 1RVFL 3PL6C 5FO7B 3HNSL 2VZSA 2F53A 1MREL 5I66A 1UKQA 3JWDL 4GRWB 5EBWA 3FB6B 4LSDA 5IB4A 3ULUL 5ETUB 4RX4A 5I73B 1HHKB 5JDSA 1J7VR 3ZL4H 1IAKA 4LKCA 4JQXA 4YLQT 4U2ZA 1KELH 3FB5B 3L5IA 2VDQL 5MHSD 1WBZB 4LDOB 5LQBL 2B1HL 3L7FB 2VLRD 1JL8A 4DTGH 2CRIA 2D7OA 5I1GL 2MKLC 4P9HH 2GAZA 2P8MA 4YHZL 2AJ3B 4WDIB 4PY8J 2VXTH 4KJWC 1A1NB 2MHAB 3FZUD 3O2WL 3MLWH 2YMXL 1EA9C 4U6YA 1VKXA 1RUAL 4Z8FH 4OZIA 2P5WD 4HAFA 2HJKB 4NO0B 1CXFA 1V5JA 4Y2DD 3MNZA 4WTWA 4JKPL 1NGWB 4ODWA 1A7NL 2DWDB 3GKZA 2IADA 3KJ6L 5T1KA 4ZUWB 2G60H 4XPBL 1A47A 5D1XC 2H1PL 4F58L 4Y2DB 4W6XB 1JV5A 4D94A 1Y6KR 3I02B 4PGBB 5I8CB 5HHQB 4Z76B 4PLNC 4DK6A 4ZFFA 1K2DA 3T04D 4Y4KC 5H37G 5FK9A 4P4KD 3QQ3B 3MBEC 1A7RL 5F6HJ 1CLOH 3T08A 4UIMB 4IM8A 4HH9A 4PPTA 3X3GL 1KXTB 4BUGA 1CL7H 3MRNA 4HIJA 3EO9H 3KGRA 3NAAL 2Y6SD 4OUOA 4GW1A 4ODXA 1J0YA 4GRWF 2DBJA 1HXYB 3KPRD 1EHXA 1AH1A 4YO0A 2JIXA 5EIIB 1OCWH 4XPHL 3CFDA 5DD5L 4OF8A 3G6JB 1S7XB 5KZCD 4OKVA 4M62H 2ZWLT 3VU2A 2P4AB 4P2QD 1QEWB 1U36A 4PY7B 5MI0C 1ZWIB 2J8OA 2H41A 4M61B 4V1DB 1J1OH 4I3RL 3U79A 3OAUH 1IT9L 3OZ9L 4JKKA 3CFDB 5L6YL 1UWEL 1BD2D 2JIXB 4HCRA 1RV6X 1NFDE 3FMGL 3NCBB 1U93A 2EKJA 5GJSL 1CQYA 3HI1A 4LSQL 2R2CA 3SPVA 2B2XH 3KPSE 3WE6B 4MJID 1P84K 4TSAH 2OCFD 4HW6A 1AIFA 4MVBC 1IC1A 4DFIA 3G5YA 2ZUWA 4ONHA 1VACA 2AV7A 2XTLA 3QUMA 4HIEA 1QFWL 5HHMB 2WUCH 3MLUH 4MX7B 2VAAB 4FFWD 2OTWA 5EA0H 5DD3H 2UVEA 3GHBL 1S78C 5BRZD 5C0BA 3C6LC 2XRAL 3QG7H 1NEZA 1X4ZA 4MVBD 3BFOA 4HWBH 3NCYS 4X4XA 5JW3L 3H3PH 5J56B 4I48A 3EOTL 1NAKL 3QUMB 4OCMC 2ADJA 3MNZB 2W0FB 4ONHB 4YE4H 3QEHB 4AIOA 5L88H 1OGTA 1QFHA 5LKNA 4LSUH 1OLLA 2ITDB 2FWOB 1Z0NA 1P6AB 3V5DB 1T7WA 2AI0L 4P59L 3X13B 2ZPKH 2I07A 1MCQA 5KSAC 4YHIB 4L3ED 3S9DB 3W0WE 2E9JA 3QZWB 4XMLH 5JW4Q 4Y8DC 1BEYH 3OKDA 4WRLA 2VABA 5DVKA 4M7KL 3EO0B 1JWSB 5DD6B 1EK3A 1XCTB 4PJAB 2VDPL 3TBYB 4LCYB 4R8WL 2AXGA 3C60D 3S5LG 3K2UL 3UYRH 4QHKJ 3BZEA 1A6VH 5BS0E 5CBEB 1I8MB 2HVJA 4OZFB 3OPZH 1GGTA 4RBPK 4ZDHB 4BH7B 5KG9A 4OZIF 2E6QA 4Z95L 4OD1L 1IC7H 1MLCA 4AEHH 3TWCL 1GGIL 4M7LH 4P3WA 3DRTA 1QLRA 3MJ6A 3P77B 4KPHL 3GSNA 3VFWB 1WAAF 5IF0A 5E8NB 3WCYA 3WLBA 1HSAA 4P9MH 4JZJB 2DQCL 3EYQD 4MYWB 4BM7A 4D9QE 1MI5D 3FT2B 4RDQG 4QRSA 3DVGA 1MCSA 1F4XL 4XNQA 2J8UA 2APBA 5E5UB 1MCOH 4XP6L 1ZGLP 5C08D 1SYVB 1WCQA 3GMPB 4ZTPH 3U0PB 4JFFE 3D18B 4K94H 4N0YL 4RGND 1IL1B 3QWRD 1AGBA 4U6XA 2XTJD 1DQJB 4CW1B 5I1AB 4YFLI 3MOQA 3I9GH 3VWKA 3QBTB 2ZUTA 1Q94B 1MCLA 6FABL 1KYOJ 2OYPA 3GGWB 2RGSA 4XVJL 4MZ2A 4YQXL 3QA3A 1OVZA 3V5HA 2EIDA 4DZBA 4CKVX 2N4IA 1OAXL 2I9LA 5C0GB 4JZOB 1YMME 3C5ZC 3AREA 5F7FA 3EYUL 1ACYH 5EOCH 1E28A 5L2KB 4OUUA 5EO9A 4P2CG 4RGOH 4MA3B 2IFFL 3UCRA 3WS3A 1QSEA 3B2VL 3BSZH 2F8XC 1H3WM 4X4XB 2CRZA 1DUZA 5HGHA 2QHLA 2VH5L 1H3UA 4AK1A 5GGSY 3WKMH 3K2UH 3UYRL 3QJFB 4N5ED 4GLRI 2X70A 3RGVC 3V6OA 3FOMB 2DQTL 2R29H 2RQ8A 1XF3A 2BNUB 3EDDA 3LHPL 5TDOA 2C7UA 4OF5A 5EBWB 3F5WA 5ID1A 3LQMA 3UTSB 2VABB 4S0TD 2OR9H 2AJZB 3UDWC 1U8LB 4YXKL 5MI0B 3GMQB 3T2NL 1A7PH 1KC5L 1UM6H 1K4DA 1IQWH 3IDXH 1OTSD 2DTSA 3JTTB 1YN7B 1T2QL 4MDIA 2IWGA 5D1QA 1OGTB 1J1XH 4ZTPL 3HB3C 1IKFL 5IHUH 2VZUA 2APTA 4MXQD 3ILQD 2QBWA 4PJIA 3VWKB 4L8BB 5FGBC 2J88H 3IFLH 3FFCA 5E2WL 5C0NC 1SM3L 2EE3A 4R6UA 4LGRB 4KKAC 1D6VH 2OR9L 2R2EB 3VRIA 1LO2H 4HC1H 2AGJH 5BV7C 2Y4SA 3BKJH 5SX5H 5K9KA 1V7ML 2UWEE 4HZAA 5ACZB 4I3SL 1C16A 3SE9H 4JFEB 1BZ7B 3HE7A 3KYKH 1AR1D 2A9ML 1BVKB 5IQ9A 2V9RA 3PP3K 5GGTH 2FO4B 1GVIA 4KQ3L 3RTQB 3QHZH 2W0KA 3TZVA 4AIZB 4RZCA 1KPUB 2HFGL 1YMMA 4ZAKA 2QSTA 4BA8A 5IMMA 1YEIH 1NGPL 3BKML 2CRYA 4J7RA 4IOIA 1F00I 4QGYA 2P42B 1WWCA 4D0CB 1MLBB 4ZUSB 4ZUWA 4AG4L 4QTHB 3JV5A 3C8KB 3MLYH 5FCUH 3EYOB 3HC4L 3C5ZD 3RKDD 2HT2D 4MA1C 2RFXB 4W4NA 3UTQA 4JPVL 4PJ7F 5D7IF 1C7TA 3BGMB 2J8UF 1RIVH 3D39A 4EOWL 2DYPA 4DZ8B 3MBEA 1NMBL 4I77L 3E6FB 4PJ5D 4XBGA 3BEWB 3VH8B 3WDJA 1AGFA 3WLBB 4X4YB 3DNKA 2DM2A 1U8QA 4XMKL 4UILH 5F1IB 2A0LC 1C5DA 4B7LA 3ZTNL 2L0DA 1XR9B 4NC1C 4NNXB 3WJJC 2FSEB 4FRWA 3IFNH 1Q72L 5DDHA 5A16A 1MJ7H 1TZIB 3D3VA 1U3YA 1ZANH 3KS0H 2BP3A 1YY9D 5C2BL 1GCFA 5IBUG 4YHYC 2A83B 2O5ZL 2NCMA 3BIKA 3MRIB 1QZ1A 2Z8VC 4PRHE 1AD0B 5EO0B 2FYYB 4KC3B 3SJVE 4OM0L 2ORBL 4IOSD 3I3DA 3PP3H 4WW1A 3UTSE 1BQLL 4MLIA 5DJ6B 4I3SH 3HZKA 5FYJH 1T03L 3M17A 2DKMA 1EXUB 2P48B 1KCRL 2VXTL 1TPXB 4NWUH 2VZ3A 2XACC 3MX0A 4XNZB 5EUOE 3MJ9A 1CFNB 4L4VE 3AS0A 1SY6A 1CD1A 1OCWL 2GAZB 2L4OA 4AMKL 3KPQB 4TSCL 4X4ME 3MNWB 2ZSVB 5F6HI 1PKQB 5K59E 2BFVH 1U41A 4EBQH 3BKMH 1TETH 1VEMA 4BFGA 3GJEB 5E24E 2JCCA 1NL0H 1HOCB 3CSGA 5DR5H 4FXKA 4MAYA 1G7PA 3I50H 4Y16B 2ICWI 3LEVH 4KGJA 5JLZA 1G9ML 3DGGA 3QEQA 3NFSH 3QO1B 3VFOB 4NCC1 4CU8A 5F1NA 2B0SL 1DLHB 4LHUA 1WTLA 2HVJB 4OZFA 2K9UA 3SY0B 3QDGD 3TA3D 3VDAA 4JFFA 4G80A 1I4FB 2BNQA 2O26U 5K9JL 5DHYA 1P1ZB 4PJIE 4MD0B 2EYTB 4K7PY 1JHTB 3EFFB 4TULL 3LEYH 3NBNA 3HMXL 3MQIA 1U8HA 4WI7A 1V7NH 2X4PB 5CSZA 4G6MH 4HIIB 5E6YA 2VQUA 1B4RA 1ACZA 2VLJB 3O2DL 4HK3J 3R06A 4I18A 3OKMB 2YA1A 3X13A 1CICA 2D7NA 2YPLB 5D9SA 2X4OB 4C54A 4EVNB 1DBJL 4WI5A 3ARBD 4HJGB 2R56H 3EUUA 3SOBL 5HHPB 1XR8A 1TZGH 2OL3B 3I6LD 3P2TA 5D1XD 5I1JH 3CH8A 1ACYL 2DQFB 5EOCL 1LO5B 1P7QA 3DV4B 1AQKH 5FYLL 4I0PA 3VG9C 4OKVB 4FFVC 5C08B 4BZ1H 4XBEH 4RGOL 1A7QH 1KBGL 2LVCA 1FCCA 4CAGA 4JANA 5H35B 4Z7VB 5T5NG 5KANI 4HK3N 4YO0B 5EU5B 5FO8B 4LLDB 3UPCA 5KVEH 1U8JA 4MSWB 3HC0A 3LKOB 1NCDL 1AXIB 4GW4B 3LEXB 1FFQA 4PG2A 5IBTH 4HIJB 3L3HB 3CXDL 2X4NA 4P23C 4YEEA 5JA9A 5DJ0A 1CLYL 3BUYA 4K3EH 1W0WB 2BJML 5F9OH 3ZKMC 3L7FA 4EUPH 1L0YA 2AXFB 2H9GB 4U1NB 4G9FB 1A1MA 3N85H 2NY6B 4RNRB 1QKZL 2Q76A 4FP8L 3SGEH 5D7IA 4NQEE 1UACL 3GIVA 1KJ2L 1OAUL 5H2BB 3ROOB 2R9HC 4KJYB 4BZ2H 4U1SB 3RDTA 3TEUA 1DBBL 1MCIA 3HLAB 3L5WB 3LKOA 1HN1A 3RPIA 3H9SA 3FT3B 4BYHA 4RRPG 3MCLL 5C0JB 3P4MA 5EORL 2FJHB 5F21B 1TZHA 3TWCH 1ONQB 3V6OE 1GAFL 4KK8D 2CDGA 4CVXA 4BUHA 5DK0B 4IBLT 2Y36H 1CLYH 1RZFH 5HGDA 3TO4B 1MIMH 3VXUA 1S9WA 2G5RA 1DL7H 1OW0A 2GFBB 2ZSVA 2XV6B 3KYOB 4R2GC 2GITA 1EEZB 2ZCLL 2AV1B 1U9KA 3TN0B 5IEHB 4QHKI 1Q9OB 4NN7B 1IAMA 5DD1L 3BQUB 4K3JL 3VD9A 5F88A 2X6MA 2VDRL 1YNLH 1P4LA 4ZTOH 4IDJH 4NKMB 5BRZA 4U1GC 4YPGA 4BKLA 4X7TA 5JORB 4PYGA 4G80B 3W81A 3WNPA 1IFHH 4HH9B 5DZLA 2O93L 3ES6A 3QPQC 1ORSA 4QRRD 4XCFH 1RJZB 4GJTB 4OF0A 4TUKL 5DO2C 3BP4B 2E7MA 5BVJB 5JHDA 1T1WB 5BZDA 1A7QL 1KBGH 3G6DL 1MFEH 3QWOB 3BO8A 1UQSB 2KZWA 2Y5EA 4P2QA 4JY6A 4ZOCA 5DZNA 1KCSL 3IU4H 3TC9A 4L3AA 4YHYB 4JFOA 1DQDL 4KKNA 3W2DH 5HDBE 4MQXD 5CJXA 4KPHH 1KTKE 4S0SD 5I76A 3HZMB 3GFUA 3H9HA 3FONA 1P5VA 3LMJH 5T1LA 1R3HA 3OHXB 1RK0A 1UCTA 4KRPD 4PGDA 4KTDL 1QSFD 1L6ZA 2OXHA 4AH2B 5KSAA 1TCMA 4M7JL 5I8EB 3RIAF 2FD6H 5CEZD 3SDDB 2FATH 2NW2B 1DBBH 2I24N 1ZOXA 4JJHA 2VLKD 3LVEA 5IMLA 4X6CA 4XGZA 1HQ4A 4H20L 1M7DA 1VFAB 1UJ3A 1WBXA 3BD3A 1FL6A 2F5BH 3L3DB 4HPOL 4PJBB 4N1EA 4H26B 3QDGA 3TA3A 3QP3A 4L4VD 3L3DA 4XNXL 4LIQE 4K71B 4MNGA 3PHOA 1M7DB 3H3KA 3OGCB 5IV2B 5T3XD 4NNPH 5DJ2B 2A6JB 1XCQB 5HHME 5D5MF 1JYXA 5ETUA 3PGCA 1DANU 1T7VA 2DQUL 1RZ7L 5T3ZL 1FL3B 3FRUA 2WBKA 4JR9H 4NKIH 1WFOA 1H8SA 3FB7A 3FRUB 1NAKH 1UYWH 1TXKA 3PABA 3BHBA 4NQSA 2JJWA 4NNPL 3H2WA 4OGZA 1DJSA 3FAWA 3GKWL 1QVOA 2FBJL 2P5WE 3P11H 1RZGB 4HGWA 4K7FA 4A2LA 3KR3H 4PGEA 3BT2L 2HMIC 1ITCA 2WBJA 3TT3H 1AGEB 3FQTB 1NGXA 2BOBA 4HK0B 5SV4A 4JDTL 1G7HB 3JWOH 1BD2A 2AEPL 1WWBX 4Q9QH 4P5TA 4LMQE 1IC4L 1JMXA 1KYOK 1CFSA 4NGHL 1BD2B 3S36X 3VFPB 3SJVB 1M7IB 3BZ4A 1BOYA 3LMJL 3IJYB 4KI5D 3ARFC 2VERN 4WY7H 4M7JH 2OZ4H 5IKCA 4NIKB 4MB3A 4LKXA 2MCPH 3V52H 2FX9H 1F58H 5MEPA 1SJHA 1DQLL 4WEBL 1HQRA 4PREB 1QR1B 3BWAA 3U1SL 3SDCB 5HI3C 3BRGC 4J3VA 1FSKB 4CN4A 4ZG1A 3I6KA 3C5JA 2W0LA 4HS6B 4CU6A 2HT3D 3ILQC 1I8KA 4YHML 4PJXA 4UTAL 1J1OL 3O6FD 5T5NF 2EDHA 1PY4A 1LEIB 1FIGL 1GC1H 5C0CA 3RHWK 4ZXBC 1X6NA 3OQ3B 4BSWA 3VD4A 3HRZA 4ZO8A 4F37K 3V7AG 2QKIA 3D0LA 3QIUB 1F3JB 1KCUH 3CPLB 4LMQI 4H8WC 1ZK9A 2F58H 4FFYH 3UZVB 3SO5A 1D5IL 1G6RL 1VFBB 3SE8H 3ELAT 4P2QE 4X7TB 4PGBA 5E8OB 5I8CA 4U1MB 1KPRB 3RRQA 1RVFH 5IMLB 1QRKA 5HYIA 4LLVB 1JHKL 1WFTA 3MRFA 5KW9L 4U33A 1IZKA 2QKIB 1TQCC 3GSVA 1BBJA 3MRMA 3REVA 3HRZB 4GAJH 5A2KH 4I5BA 4YAQA 1VENA 4P46D 3ARQA 1T04B 2WZPD 3Q6FA 4JM2A 1VB9A 3TLRA 1XH3A 3SQOH 5KS9A 1C12B 3MGAA 3OKOA 4OCWH 4UQ3B 2OBGA 2VLJE 2GTZA 1TVDA 5EBMA 5I17A 1FZOB 1OTTD 3ZE2E 4LAJH 1BIIA 5TQ2H 2IQAA 3M1BB 3PJSB 1NGQH 1SMOA 5F44A 5C09D 4UAOC 3RA7L 1XH3B 3C6SB 2ICEB 1S9VA 4Q9QL 4N0UE 2YA0A 3K74B 3T09A 3VFUA 2PYED 1A7OL 1E4KA 2NY4D 4YAQB 4PJGB 5KW9H 3QAZB 2DQFA 1HQ4B 5IW1B 3WV0A 1PDKA 5LCVL 5HHPA 1T5WB 3VGDA 2BVUA 4ZPVB 1AQDB 1YUHA 4JDVB 1YNKH 4NWUL 1FNEA 2PETA 2Q3ZA 1UENA 4JFDA 1LP9B 3MFGB 2OS7A 3WIHL 3CU7A 2VDMH 2Z92B 5E5MA 5ALCL 4KVNH 1U2CA 5FDWB 5BZWA 4G8GB 3TO2B 5F7WC 3A6BL 2ESVE 2PXYA 4YNYB 3NCFB 4WI4A 5BZWB 1BOGA 1RUQL 5I8KL 3BDYL 2IGFH 3BKYL 5D5MA 4DN4H 1A3RH 1TVHA 4PRIE 4DWHA 4TVPE 3IKCA 1FNEB 4JFDB 3DSFL 5D1QC 4Z7WB 5GGTA 4ERSH 1MQKL 3NMEA 1HQRB 3SDAB 3ORJA 1F4AA 1ZLWK 4FFZL 5EZOH 4WEUD 3HLAA 5F9JB 1WZ1H 4JQVC 5D96C 5DJZA 2RB8A 5K9JH 1GZQA 3T0EA 1NUDA 1ZE3C 5GS0H 2DL9A 4HKJA 3RWEA 4S1RH 2VLLB 3VFPA 4YPJA 3P9LB 4JO4L 1IAII 1EUUA 5CP7B 3SKNA 2XYCA 2J7LA 3V0AC 5INDB 4J3TA 1RURH 1CYGA 2ICWJ 4OFDA 4W81A 3UZEA 5T3ZE 1FIEA 3CNKA 3MJ9L 2OMNA 3DTXB 2LAAA 4JM2D 2CPCA 1IEAA 1JGVL 5K59F 1FC2D 4LU5L 1J0KA 2CR6A 2VITA 4O58L 1RJYB 4P57A 1MCJA 5BV7H 4ZYKB 4GRWH 2NZIA 3MRQB 2A73B 1XZ0A 2OJEB 3C2AH 1YN6A 1XGYH 3DUUA 4F8TA 1HKLL 5CGMA 5I1IH 3SDYH 5FOJA 2PYEA 4W4OA 1Z9SA 4O58H 2VLRB 4JHBA 2Z4QA 4OBSA 3GMMA 1O7SA 2WINB 4EVNA 4HUWB 5C0AE 4O51B 3MOAH 1MFDH 4I1NB 4XPHH 1S5HA 1ODAA 3TNMA 3VFSA 3C6SA 1W72A 3UPRA 1U8HB 3IVKA 4HHAA 2B5IB 4MAYD 2IAND 1A0QH 3L5JA 4QXTB 2R29L 3RUGA 1D5MB 5ENWA 1UZ6E 4MSWA 2V17L 4HUVA 1G7JA 1OPGL 5FM5M 1AP2B 5DXWA 2AABL 1FVEB 2N7BA 3TVMA 4AH2A 1DBML 1YYLL 2R1YB 1NBZB 3MCLH 1MHHA 1XGTB 5BVPH 4OIBA 4FXGA 4ZQKB 1PEZA 3VDCA 2B1AH 4NC0B 2C1PA 3H0TB 3KYNA 4G7VL 4OSUL 4M61A 3L3JA 2NY0B 4M1GL 1NC2D 5IWLA 1MJ7L 2F8OA 3U7WL 3QQNA 4K8RC 1CCZA 5GHWH 3INUL 2EKSB 4JRYA 5D9SB 4FQXB 1TENA 1AFVL 4NQCE 4JFED 2D2OA 2R2BA 1CD0A 1NC2B 3HPJA 4KUCD 1KJMB 3RVTD 1GGYA 4I4WB 5MERB 1BREA 2DLFL 1QVOB 3ZKXC 1OARL 4ZSOA 1P7QD 2GIYA 2XY2A 4XVSL 4AEIL 1DEEB 2R9HD 2DI8A 4RNRA 5TE6L 4KK8C 3Q2CA 2DM7A 3THML 3GNML 5GQBA 1GOGA 3LD8C 5DYOA 5AUMA 1NDMA 3D87B 3L3HA 4TQEL 3RI5K 4DVRH 1EVTC 1CXKA 1U92B 2VXQL 1B2WL 4WEBH 5F88B 1A22B 3CLEH 1OF2A 1IAIH 1OGAE 5F7EL 2EC8A 3H9SE 5D1ZB 1FFNA 1TZGL 3GJEA 4KAQL 5EU5A 3BIKB 1GZPA 3D85D 3R0MA 2A9MH 3EJZC 4U0RC 3CFKB 2M26A 5GRVK 4HQQH 2WBJD 5DYOB 2CDGB 1VPOL 2V7HB 4BELD 3FFCE 3HAEH 1TFHA 1IGYA 1WAAE 3BPNB 4HUNB 1YYLH 3K8LA 3MV01 3C09C 4PJEF 4XT1C 3ARPA 1RIUH 4M48L 2XPGA 4OIAA 5E5RB 1G7JB 4LAQH 1EH9A 4P2RB 1S9YB 2CGRL 3U83A 2EYSA 3OAUL 3BP5A 3PUCA 1K4CB 2XY1A 1RK1A 3FMGH 3DYMA 1OB1A 4M62L 1ZS8B 5IEHA 1RIUL 3F5WB 2PR4H 4XRCB 2VDOH 1EX0A 2EDBA 2YKLH 4Z7QF 2UWEA 2Q1EA 4L8BA 5FEBA 4WO4B 1JE6A 3IDYC 2QTEA 3IJHB 3ZDXF 3KPMB 5D7LB 1UGNA 4NN6B 4UUJB 3HN3A 1ZLSL 4I0PD 2CDFA 2O61B 3NCMA 3HAEB 1KIQB 2NY6D 3KXFD 4Y1AA 2Z31C 1YY9C 4YH6A 1U2HA 4LDEB 5FYLH 3ES6B 4NOBA 3MUZ1 3M1BA 2DDQH 4PJBA 5SWZD 5DEFA 4I0PB 3KPRE 1FZOA 5CUSH 1TTGA 4WV1C 3ZHLA 1NDGB 4DKEL 1X5AA 3IETB 4K9EH 4OQ1A 5D8JH 4F7PB 1EAJA 3Q6FB 1I1FA 2Z92A 2AXFA 3U4BH 4XCEA 1A6VL 1W0WA 1A7PL 2VLJA 5DMYA 1I3GL 4MNGE 2YUXA 5C0AA 3LKNA 4NM4H 2HT2C 3B5GA 1T80A 4EXKA 4WV1A 3QUML 4PJEB 1JK8A 4JFOB 4LIQL 5C09B 3VFUB 4KZDH 3RUGF 2FX9L 4BZYA 3ROLB 1G0YR 4CRPA 3I75A 3IFLL 3DMMA 2F54B 1T4KA 4OLZH 1Z5LA 4XVTH 4TOYL 3P73B 4A6YB 4X83A 4UINH 3TJEL 1RI8A 3HKFA 1IARB 5C07E 4Y5XB 3BIBX 1E27A 4R4FH 5ADPL 4JJ5A 4JCMA 4PJ9D 1KLUB 2P8LB 3HNVH 4LP5A 4AJ0A 4YBQD 1F4YH 2FBJH 2AJZA 5J57B 2A0LD 2XG5A 5DJXB 3T0EB 3DMMD 4DN3L 1KB5L 3MLUL 4L4JA 4Z7WE 3QXDB 3RVXC 4K23H 5GZND 4UB0L 5EPMA 3VH8G 3AU1A 5CIPA 4PV9A 5C0FA 2E9WA 4RBPH 5C7XH 4LCYA 3VG0L 5IOPB 1L4IA 3TFKD 5JW4M 1C7SA 2VR5A 4HWBL 1G7HA 4YUEH 1ONQA 5IB2A 2Y06L 1M05A 2GSIB 4LVNB 5IB3B 3T77B 3X11B 4JHZA 4OZFG 2HJLB 4F3FB 2OSLB 3BGFB 2I07B 4P46A 3MUJA 1K4DB 3OAYH 4HKBB 3MA7A 3BZFA 1T3FA 1LE9B 4H1LH 1OTUD 1CD1B 4PD4K 3DX6A 3OX8B 3D25A 3MMEA 4D0BA 2AGJL 3T3PF 5MEPB 3HNTL 4PS4H 1IGCL 4YR6A 5CBEA 3BZEB 1DN0A 2BNUA 2FIKA 4LPVA 4PJEA 1A6ZA 4HIHB 1I8LC 2X89D 4N8CH 2CO6B 1ZVSA 3TN0C 4OTXH 5I1KH 3ZT6A 5ID0A 4J8RA 1NCCH 2QQQA 1HOCA 1Q9WB 3UTQB 5EU7C 1KLGA 4QHNB 2YWYA 1FO0B 4HZLB 4NCDA 3ABZA 4L8SB 2M8XA 1YMMD 2VZ1A 4MNQA 1ZHLA 3G6DH 1TJIH 1A2YA 3V6ZB 5L2KA 3P0VL 1YECL 3HR6A 1H0DA 3JWOC 5D6DA 1XGTA 5GRVL 4BFEA 3MFFB 3QEGL 3PIQB 1BJ1H 3R06B 2CJUL 1YMMB 2FECL 1Y18A 3MR9A 1BBJB 1AFVH 1A9BB 3O6LH 4Y4HB 5ILTH 3OBAA 1KEGH 2GCYB 4K94L 4PJBF 2PW1B 4QGTA 4YC2C 3FN0H 1JWMB 4L8SA 3ZLQC 4LASL 3D39E 4OGYH 2GTWA 4L4TB 1BVLB 2LQRA 2X1XR 4Z7VE 4WI6A 3VDBA 1VCAA 5TDOB 1TIUA 3O6LL 1PYWA 3JWOL 4OJFH 2FEDC 4FMFA 4JG1H 5F7DB 4OLYH 3Q5TA 2BOBB 4U1GB 3LCYA 1CG9B 4Q0XL 2ZG1A 3AMKA 1J10A 4PP2A 3X12B 2YOCA 4C58B 3KLHD 1X9QA 3IDJA 4YZFF 3NN8A 4WWKB 1DUZB 5F8RC 4WTZG 3QIUD 3V0WL 4MA1B 4AIXA 2ZCKL 3IDIA 5MEND 2XZAH 3LDBB 3H8NA 3B8SA 3HG1E 4QYOA 4MA3A 1RUAH 3D9AL 2HG5A 3TYGL 1NCCL 3LKSA 4YWGL 5JUEH 2P8PB 2V5RA 3MGTA 3OKKA 3QUXA 1FH5L 4KQ4H 3I2CH 3SDYL 4O02L 3AROA 4AM0B 2VYRE 2HWZL 3EOBA 1PAMA 2E5EA 3FT3A 1NDMB 2EDFA 4WW1B 3FO2A 3FQRB 3VFMA 3CLFH 3MLXL 5JTWA 3EKCA 3RU8H 3CK0H 1KCUL 3RWDA 4PB0L 5C0DA 5FYKL 1CDJA 1FL5A 3DO3A 3BN9C 3RBSA 3MRJA 4U6YB 1VKXB 1CXLA 5C8JB 3FAXA 2HVKA 4MCZA 4XNQB 4GG8B 2FO4A 5E9DA 4HUUA 3ARUA 2DLGA 3FONB 2W92A 4O2CA 4XCNA 3MGOB 4NN5B 3V6FA 4PTUB 3QHTC 2JK5B 2JJSA 4FQHB 2XTJC 2AKRB 3HUJA 3LS5L 4QOKE 1MQKH 3D1MC 5D70L 4QKXB 4QHLA 1J1PL 1RIVL 1WCBB 4UT6H 2AQ3A 4ZDHA 3V4UH 3QO0A 4KK9D 2BOCB 3OAZH 3TVMB 4HX1A 5JIIA 5JHDB 4APQD 1XR8B 4ZPVA 2SEBA 1OW0C 1YEKL 2V5SA 4R97B 2NTSP 4F80A 2E8YA 3NH7L 3C87A 1WF5A 4D9RE 2JB5L 2AS5M 7FABL 2BVTA 3E2HC 5ITBH 4JHWH 5AYUH 1HXMB 1WT5C 3V0WH 4OB5L 4EN3D 1E4JA 1E4KC 2X1OA 4O02H 4JEGB 1ND0B 3KG5A 2NXYC 2OJZH 3EDKA 5DRWA 4WI9A 2LFGA 1XEDA 3OJMB 4Y4FD 1UWXK 1CGSL 5T1MA 3UBXI 1CTOA 2VE6B 4I9WE 4F7PA 5HYQB 1U42A 2X44D 4G8IB 4WI3A 4MNQB 2XZCL 4NJ9H 1IC5H 4XPTL 2OQJA 1BMGA 1O5DT 2ZZUT 3T8XA 4U1KB 4X5XA 4QRTB 5AEAA 4OAWB 4LQFH 3P77A 5D6CB 1NCNA 4BSVB 3SKMB 4YHOL 2J6EA 5DK3A 2PN5A 1PLGH 3T1FA 2WBWB 3NFNA 2F19L 3BP7B 4QRTA 1UG9A 3ZDYE 5MEOB 1CFQA 4JLRA 4MJ5A 5CGTA 5I71B 3B8YA 3O6MH 1FYTD 2FZ3A 3D18A 4YXLH 1WFUA 4YDVA 3DBXB 2Y6SC 4F57L 2ATPB 4UAOB 4NHUA 4WNQB 3BQUA 1QNZL 3RWFA 1JUFB 3GJFH 3P9LA 3GSUA 3O8XC 4JO2L 3W2DL 2CXKA 4OI8A 3VW3L 4GRLB 1S9WB 4KWUA 3O9WC 4WUKH 3ARED 2XNAB 5ICZA 4Z76A 1CFQB 2XPGB 5JDSB 3SGKC 1CZ8H 4PJFE 1E6OH 1FZJA 4JKPH 3MJ7A 3P4MB 2GSIA 5C0JA 3RVUC 3JTSB 1F3DJ 3PQYE 4OZHE 3OG4B 4IMKC 1S7QB 4MAYB 5B39G 2E7CA 4R0LA 4M8VA 1K5NA 2ADJB 2DQHH 1ZSDA 3RX8A 5ID1B 3NCJL 4KI5F 4NQVA 1REIA 5DD3L 3MGTB 4HWZB 3Q5YA 5CIPB 5C0FB 1INEL 1XFPA 1M7IA 3BZ4B 1JWSA 2WK2A 4TUKH 1O7VA 2MSPA 4UIKL 3OKDB 1QD0A 1WTGT 4N8CL 4MAUL 1LD9B 4FQ2H 43C9A 1AGEA 3VCLA 4GBXD 1K8IB 3UEZA 1NANI 1FYHB 1SYSB 4CJ1A 1I1AC 4OD3L 4IRSC 4J3SA 4CVZB 3P3YA 5ANMB 3SDDD 1QLRB 4HWZA 3EOAB 1NAMB 1AJ7H 4LCCB 4XPGL 1JPTH 3BGAA 2RR3A 4M43H 5JO5A 4TVPL 3BZDA 2ZG3A 1IAIL 5EU6B 2D7TL 5AD0A 1U8NA 4XP1H 4NO2B 4P99A 3MBED 5CD3A 2DICA 3ULUE 4QXUH 4XC1H 3T0VA 3O6KL 1XCQA 2NX5D 3DXAD 3MRDA 1KJ2H 1OAUH 3G5ZA 4U7SA 5JA8B 4G8FA 5LGHL 1JFQL 3RVTC 1C12A 1ZVHA 2KH2B 1QQDB 1K6QH 3NPZB 4HIIA 4NQDD 3HUJF 4ZQKA 5EU6A 4MZ3A 1F8TH 3FN3A 3MLTB 2AEQH 4KMQA 4R4FL 2HVKB 4MCZB 4JR9L 2J8UB 1XIWC 2XQBL 3IXAA 5MEQB 4M6AA 3ZYZA 2GI7A 2ESVD 4V1DD 5D93C 4HPYH 2DQCH 3ESUF 5MERA 3RWJB 5DJYB 1K6QL 5K9KB 5GS0L 1EHNA 1HI6B 3HPJB 2EO1A 4QCIB 3K46A 4TVPD 3MPCA 2L7UA 4F9PA 1QQDA 1HYRC 3S36H 3TV3H 4Y1AB 1NC4D 3WJLA 3HE6B 4HIHA 2VL4A 1A5FL 4QRPD 4KRLB 3RAJH 4KHXH 4GRMA 2XA8H 2XOTA 4X5XB 2B5IC 2DLTA 3DI3B 1SMAA 2FX7L 3FQNA 5EFIB 2I26N 4ZAKB 5SX4I 5ADOH 4RZCB 3HE6D 3H7BB 4X4ZA 2G5BB 1QG3A 1Q1JH 4HS3B 4Q97A 1I9RH 5L2JB 3HI5H 5TGBB 3V7AE 4HQQL 1XR9A 4HPYL 5DC9B 1YN7A 2XKSA 2BVPB 4XPFH 2FEEL 3KHQA 5CUSL 3PWNB 3JSSA 4JN2A 2HWZH 5F1IA 5HD8C 3I3BA 1KNOB 4WWKA 2HJLA 1KIRA 3SPVB 3DETD 1NLBH 2IFFH 5CZKA 3TNNA 4KK9C 1OAQL 2ATPA 2VRAA 4HS3A 4G6JH 4NJAH 2C4FT 5C0IA 5T3ZH 4PGJA 4XC1L 6FABH 3O3AA 5I30H 1IM9B 1FDLL 1Y6MR 2J5LC 1D7FA 3GI9H 1BFTA 1K85A 4NZRH 2GQHA 3GSOA 4TRPH 4DW2L 3RY5A 3T2NH 3DUSB 1NPUA 3MGOA 4IJ3B 2X05A 5T1KB 1MCKA 1W0VA 4H1LB 5D7LE 1ZA6A 5MP6L 4G3YH 4OZGE 1FDLH 3LRSA 4YZFE 4GW1B 5JO5B 1N7MH 4OLUH 4Z6AT 1NSNH 4CN1A 3RKDC 4R90L 3QIBD 1MJUL 3FQUB 3KS0J 1TQCB 1KJ2B 2P7TA 2OSLA 5IJKC 5JXED 2IPKB 3MLTA 4LRIA 1PQZB 1FZKB 4LSQH 5BMFL 4WI8A 4OT1H 3IT8D 3HI6H 3V0VA 4O51A 4OCWL 4XPFL 8FABB 3SQOL 3B9AA 2YSSB 3HFML 1EEQA 4OCXL 1A14L 5TFSH 5C0AB 4POZC 4EDWH 4KJQD 5K93A 1L7TL 2YD3A 3FQWA 4BJLA 2IFGA 5KSAB 1QOKA 4IMLA 2IBZX 4IOFD 5CSBA 3OHXA 2ZUQB 4RMTA 5IQ7L 1IKNA 3S88H 5D72L 3HZVA 3D25B 3NIFF 2YD6A 2AK4D 4C56D 3VXSE 1LE5A 4HFWA 3SKJH 1Y6NR 4OZ4B 1LK3H 2HKFL 5E6ZA 4HJGA 3K1KC 5J12C 4G8GA 3UJJL 1MFAL 1FH5H 5I17B 5ACMA 4OCNC 3C6LB 4JPIB 4QXTA 5B3JF 1KLGB 3L6FB 2H2PC 3B9DA 1KENH 2CUHA 4P5TC 5IVOA 3KPLB 3BH9B 1F58L 5J0BA 1KCLA 1IGCH 5D72H 4HXBH 3GSUB 4KDWA 3B4NA 2Z31B 3UTSA 2NY7L 3EFFA 1S7SB 5CEXA 4G6AC 3O4OC 4KVNL 5GRYA 1EUTA 3LKRA 2AK4A 3NACL 1OY3B 5E6IB 1CFTB 5ICYB 4WV1B 1AXSB 5J6HA 5EPMB 1JYWA 3DV6B 1P2CB 3ET9F 5MENA 1MHCB 4WENB 1S7QA 4H8WL 5HYJB 1MJUH 3KPSB 4IRZL 4MDIB 2NXZB 5D1QB 3ARGA 4JFHD 4PV8A 1BP3B 4DKAA 35C8H 1MRFH 5F9WC 3IDNA 4Q9RH 3WHXA 2WUCL 4G9FE 3GMLA 2VDKH 3KPSD 3UPAA 2DQGL 4XBPB 3GK8L 3LKSB 4M6NH 3VRJA 1I8IB 2NX5E 3ZE0F 3V2AR 4DQOL 4WNQA 2VSDA 5T1MB 1CE1L 3WD5L 4XP5H 1U8OB 2D9QB 5C8JA 3H9SB 3EIFA 1FFOA 5HDQL 2QEJA 3HHRB 4X9HA 4Y5XC 4JY4A 4UDUA 2JB5H 1H3XA 2CLVB 1F4XH 2Q86A 4WUUE 3VD7A 5D7IB 1BPVA 3FHQA 1KB5H 2D7PA 1TPXC 3DXAE 1CDYA 2HA1A 5SWSE 4KTEL 3MRRA 1Z9OA 5CSGA 4QHLB 3M8OL 4P2RE 1A6PA 1D3CA 1XGYL 3DVGB 1JGEB 4RFEB 3EZ8A 1MPAL 1T3FB 1LE9A 2VZTA 1S9YA 5E56A 4ZOEA 3CX5K 1LO0L 4PLOB 3S4SB 1CLZL 2GTZB 4QHUB 3SCMB 4E41B 5HHMD 4XMPH 2YK1L 3QZWG 3UTTA 5KS9B 4Z7UA 4ZFZB 4L3EE 1UM6L 4PJAE 1L7IL 3S35H 3MFFA 2ILLA 1SJXA 3ZE0E 4H8WH 1HEZB 5E9DB 2LE9A 5E2VH 4YHOH 1FN4A 5DGQA 5HYFA 4OF7A 4LVNC 5EU6E 2MCG1 2VO5A 4DOHB 3U9PL 2ERJC 4XNYH 1ZHNB 3U30B 4ONFH 2O5YH 5IBLC 3DMMC 4OQTH 2YPLA 3BDYH 3ZSSA 2MMXA 2D4DA 4MJ4A 3M8OH 5CEZL 3NIGF 2NY3D 4L4TA 4D3CL 2F53E 2EDXA 5CLWA 1GPOH 3A0OA 4S1DC 3MRCA 5I18H 3CU1A 1RPQA 2J3SA 4J12A 2NY3B 1WZKA 4UQ2B 4PIRF 4O2CB 4XCNB 4NFCA 1SY6L 5FYLD 3MRLB 1Q0XL 2FRGP 2E9BA 3QUZC 2PYFA 2MNUA 3PG2A 4RMRA 4EJ1C 5C07A 2H32H 1F13A 4ACPA 4OI7A 4R7NB 3G5VA 1I7UA 1ETZA 1HH6A 2GK0A 5E94A 1DUYB 5IQ9B 2P44B 1OAKH 1N6QL 1I3VA 3HZMA 2X40A 1YEJH 1G7QB 3FQNB 5HHOB 1AY1H 4LK4A 2FLRT 3BGFC 4LSVL 5E7BA 2ADIB 4DTGL 15C8L 4OCSL 1T83A 3G6JA 5EULV 4NBXB 1LWRA 1PG7L 3QCTL 3EYFB 2NY5L 5KOVC 4HFUH 1MHPL 4YBHA 1QFWH 3OF6D 4OLXL 4OFPA 3EOBB 2FECI 3N1FC 1KXVC 1VACB 1LEGB 3L95B 3MUY1 4JPKH 4P3CL 5JXEC 3LS4H 4OGYL 2DD8H 2CKNA 1JWUB 4O5LL 1NBYA 1TDQA 2NY5H 3RIAK 3ARBA 4X4MA 5B39B 5INDA 1CFVL 3ARXA 3C9NB 4Z7VF 1JPTL 4MB4A 4QF1A 4R0LC 5BV7B 4LARH 4I48B 1B4JH 5DMKB 3UTZA 1Q9OA 1UACH 5J1SC 4H25A 1MCWW 4HAGA 5EIVA 3KYOA 3DX7B 2UVFA 4WO4D 3QR2A 1JNNH 3IS0X 5FKAB 3IJHA 1WAAA 3ZT5A 2XQYG 4H0IA 4Y4FB 2LVEA 3LH2H 1FNGB 4KK5C 1OLZA 3IRPX 2WWMC 1CVSC 3ZYJA 3VXOA 5L2KD 4TNWF 1J1XL 5BO1L 4Z7UB 4ZFZA 1MFCH 3GSWB 3WSQH 2M1KA 3PWPD 4BK5A 2MPAL 2XZQL 4HBCL 1UXWB 4OZGB 4LCIH 2VLRE 4BKLB 3AAZB 2VITB 2EYSB 3IJSA 1NCWL 2PKDA 1MVUB 4YGVB 3EW3B 3EHBC 2W1NA 4Y4FC 1W72B 1T0NA 5IVNA 4JO2H 5F70A 2NXZC 3WFZA 3C09B 3VFRB 3LY6A 4E9LA 2KZ1B 1SBSL 5BXFB 4AY0A 2ED7A 1X44A 1MLBA 4ZUSA 3CFKA 2B4CC 3QUYB 3WLWD 2PYEE 2C1PB 4LLWA 4GW4A 5IV2A 4K7PX 3RZWA 3TT1L 1GAFH 5E8PA 3MXVL 4J8RB 3ROLA 3H6JA 4UB0H 4HUVB 5HJ3B 1JJUA 4JFEE 3CVIL 4O2EB 3HE7C 3ARBB 5B39A 5E2TL 4P9HL 4YHZH 1AGBB 1TLKA 2XTJB 3K8MA 1NMCB 4UNUA 5D7JC 2MJWA 3OWEA 5I8EA 4NP4L 3S5LB 3OAZK 3C08H 3RWFB 3OR6A 2Y5TA 4S10A 1UWEH 1R3JA 4LPWA 3W5MA 3MYJA 4KZEH 1Q8MA 4N0UB 1BWWA 1EO8H 2NY2D 5I75C 3UTPE 3ARBC 5DHVH 3DV6A 4M00A 3JUZA 4OM1H 3L1OH 4XHQA 3C6LD 2QR0B 3ARVA 5DTFA 3VD3A 5FO8A 1F97A 2BJMH 2EC9T 2DMKA 2NNAB 1KEML 1KIPB 3QNYA 2OJZL 2V2WA 4BFIB 3GJFA 5IFAL 4XNZC 2EH7L 4BSVA 2MQ0A 3JTSA 2DWEA 4J3WA 1RZJL 1EGJL 2Q8AH 1QO3A 2VDOL 2APVA 3FFCD 4PV9B 3HR5B 4S2SA 1IGML 2HFTA 4HLJA 3PQYB 4OTXL 5I1KL 2CIIA 4P4KC 1XCTA 2R0ZH 5C2BH 4KJYA 1XGQB 1FPTH 5DRWB 1U8LA 3G6JF 4KY1L 5BXFA 1CBVH 2NX5B 2B0SH 2R1WA 4ODHH 2F53D 4NUGH 4GRWE 2OZ4A 4ZD3L 4F7CA 1A9EB 3LOWA 2GFBA 1X7QB 3E6HB 4R97C 5DEGB 2FWOA 1FNSH 1D5ZA 1FLRL 1ZMYA 2IH3A 3FB6A 4URTB 3IDMA 1IGYB 4I18C 3TZVC 1T4KB 4HJ0D 4X6DB 3VXNA 1X5IA 1LO0H 3T0EC 1HHJA 3QUXD 2P46B 2XZZA 5TJWK 2VUOA 1KCSH 3IU4L 3WKNA 5HVHB 4PJ9B 3VXQB 2P24A 1R24B 5KTEL 3P4NB 4BQCA 2AI0H 3WN5C 2ICWB 3AREC 1X7QA 5DEGA 4XCCH 3DOSA 4OZHF 1I8KB 1KENL 3S88L 4GSDL 3K4ZA 4Y1AD 1EEUA 4HUUB 4JVWA 1GC1C 4B5EA 1DBAL 3A6CL 1T1ZA 1MIML 3G08A 1QFUL 5IG7A 4E5XA 4RIRB 3TBSB 2YBRB 5IB1B 5IBLD 3ME0A 3MRMB 4ZOAA 5EH1A 1ERNA 3B3IB 4HKJB 4PJ7A 5FM4A 3REVB 5DT1L 3MRFB 5E9DE 4LL9A 4N9GB 1FNLA 5ESQB 4ZTOL 3CVHA 4O2EA 1JPGA 3BEVB 2H3NB 5F97E 1AI1H 2HTKD 1EV2E 4KKLC 1IC7L 2G75A 3RTQD 1BIIB 1T89A 3DYOA 2O61A 1KJVB 2W9LA 4GAJL 3O3DB 4NQCD 1H5BC 1V3LA 5BW7C 2IPUK 4IRJC 4M6MH 4YNYA 2J88L 1G9MC 2OI9C 1EAPA 2YRZA 3RBGA 4EUPA 1FGVL 3EGSA 2BVPA 3LPWA 4ZO9A 1Y0LB 3O2VL 1EAPB 5L2JA 3A67H 1PSKH 1NSNL 3KJ4C 4OF3A 2G5BA 1YJDL 3RTQA 1T20B 3CFJB 3RGVA 4B41A 1I3GH 2HH0H 4BK4A 2BNQB 2DBLL 1XGRA 5CINL 4QRUB 1S5HB 4PGZA 1S7SA 3K7UA 3CXDH 5F93C 3ARFD 3BESR 4L5FL 1TJIL 1OP3H 2WQRA 3W39A 4MB5A 1MAML 4Y7MA 5JOPE 4K7FB 5I19H 4HJJH 3RP1A 1HILB 1F2XK 3SDAA 3WKML 4Q9RL 4UDTA 4NZJA 4L9LB 1V3KA 1Y18B 4Z7WA 4RMVA 4JM4L 1BF8A 1QP1A 2JCCF 2H32A 4QYOB 2EDLA 4FG6D 4GKZB 3QNXA 5IMKA 2ZUXA 3MV9B 2DTML 4L9DA 4S1QL 5DQJB 4QTIL 2EDJA 3U7YL 4NWTH 5D1XB 5J4MA 1DBKH 2MCPL 3V52L 4LQ1A 2QADC 4PB9L 4YUEL 5DK0A 5FYKH 5AAWA 4X9FA 5I8KH 3RJDA 1HCVA 1KPRA 1FORH 3UYPA 1N6UA 5CKGA 2VAAA 1MUJA 4HF5L 5CGYC 1EEYA 4C56B 5F7NC 1CF8L 1WZ1L 5HYEA 5CZXC 3GSWA 4LRNH 5I1IL 3OXSA 1FZKA 4KVCH 5IVXB 5BS0A 4LBEB 2I5YH 4HKZA 4E0RA 3TVMD 1XF5A 3MA9L 4YDIH 3T0DA 1M7XA 2PO6C 3FO9A 3CDGB 1A9EA 3MBXL 3PDOB 5FKAA 2B4CH 1VGEH 3UXFA 5J7CC 3CUPB 4WU7A 4YR6B 4YWGH 5JUEL 4PJXB 2R4SL 1A6UH 2WWKO 4UV7H 1YN6B 3T1WA 5I30L 2D03L 3D2UA 4H5SA 5EOTA 4MJ2A 5J6GB 1K8IA 1UFUA 1T1XB 1OP5K 4BQBA 5JNYA 3BI9X 3QHFH 5FXCH 1FVEA 4P2YA 3I6GB 1KFAL 1BX2A 1NBVL 5H37H 4LHUG 1MF2L 2HH0L 1YPZB 1LK2A 3GEWB 3W9EA 5BCAA 1FNFA 1JCKA 4PTTA 3KWWB 4YHNA 5F3BB 2XWTB 1IM9D 1C16B 3QEQE 1MCOL 4GBXA 5FAAA 5BV7L 3AM8C 1RZ8B 1Q9WA 4OSUH 3TF7C 1KCRH 2CKBL 5GGTL 5EIIA 2EIZB 2IG2L 4HUWA 3O4LB 5T1KD 5ALBH 4NFDA 4XAWL 4N0FA 4ZUTA 1TNNA 2NW2A 5KBNC 2VLJD 5HI5C 3G04B 1P2CA 2R2HB 1CICB 1FG2B 3CIQA 5KVDL 3AC0A 2FD6L 5I1AA 3MLSH 4N0UA 2WQ8A 1G7LA 5CZXD 1N8ZB 2E7HA 2JJUA 1FORL 2QQKH 4GO6B 3SDXB 3WIFB 1JI2A 5CEXB 1P4BH 3PJSA 5CEYB 4MD0A 4X5WA 1I9JL 2FHFA 4NKDA 3T4AB 4X5LA 5IFHH 3QXWA 4JFFB 2X4NB 4YHKH 1QSFE 1OTSC 2NY5C 4XBPA 5I71C 3AREB 1RUQH 3L6FA 1ZAGA 1QO3B 4GAFB 1W72L 3WO4C 1YY8A 3VXTA 4X5WB 1LO4H 1DQQA 3MRGB 2FHCA 4PV8B 1Z9MA 4PJHA 4XI5D 3D5OF 3H42H 3QCUH 3SKMA 4XB7A 2VLLA 4HJ0C 3CFBA 3JV0A 4MDJA 2NY2B 2FB4H 1CR9H 1MFCL 5DHVB 4XP9H 5DTFB 2DIJA 4LPXA 3VRLF 1FG9C 1AXSA 1NBVH 4X6CB 1MFDL 2R1XB 4TVPH 4DCQB 2CLZA 3HG1D 3DI2B 4OLWL 5GISL 1WWWX 3LAFA 1NCUA 4P2OC 1WISA 3QJFA 2XT1B 3CDYA 3JWDH 4J6RL 4M9PA 1P9MC 4JY5H 3QIWD 4QXUL 1X3DA 1HHIB 4JFDD 4LEXH 5FF6A 5FHBL 1JI1A 4LAQL 3CH1B 3G9VA 2A9NH 3QDME 4RCAA 3V79C 3W11D 5FUZH 5F7LB 3JTTA 2X4RB 3GMLB 2Z31D 2V2XA 3S4SA 2ZNXA 2C1OB 4YDLC 2Y23A 4JN2B 5MHSE 1CGTA 4NN7C 5B3NA 4L4VB 4X6EA 1YYML 3S3JA 2XWBB 2ORBH 3NZHH 4NO2A 5CD3B 4WEMB 3N0PB 4WCYH 2DRUA 3HAEA 4FQ2L 1Q9LB 5I6XC 4WGWB 1EVUA 5C3LD 3CLEL 4B50A 2C7UB 4U1SA