1U46A

Crystal structure of the unphosphorylated kinase domain of the tyrosine kinase ack1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
255
Chain Sequence
LTCLIGEKDLRLLEKLGGVVRRGEWDAPSGKTVSVAVKCPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQDDHYVMVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activated CDC42 kinase 1
publication title Crystal Structures of the Phosphorylated and Unphosphorylated Kinase Domains of the Cdc42-associated Tyrosine Kinase ACK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 255
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u46A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u46A01
2J0LA 2WQEA 2B52A 4BGGA 5A14A 5AFVA 3ROCA 3PA4A 1XH4A 3QU0A 4GH2A 4CTBA 3P0MA 1SZMA 4F9CA 1YOLA 4YBKA 4ANLA 2X6DA 4YMJA 4RJ8A 4GK3A 2OW3A 4MNEB 4S31A 2GNIA 2W4JA 3FI3A 4YC6A 4M8TA 1XR1A 5CENA 2XIXA 4KUJA 3R2BA 4BYJA 3LM5A 5ANGA 4ZTNA 4DEDA 3MIAA 3SA0A 4LRKA 4DTAA 5FBNC 3LXPA 5DRBA 2WQNA 4X2FA 2HW6A 1UU3A 4C38A 4QQ5A 2JFMA 4M14A 2XK7A 1JWHA 2XRWA 4U3YA 4KSQA 2KULA 4EH9A 4AS0A 3MH2A 2WNTA 3I6WA 4AA5A 5M06A 1P5EA 4ZSAA 4GL9A 4OBOA 5DLSA 4FOCA 5AIKA 5BMMA 3TUDA 2BFXA 4L7FA 2BZKB 4C0TA 3RMFA 4U7ZA 2QHNA 3Q60A 3NCZA 4TRLA 4CKIA 3L8XA 2Z2WA 3FZOA 5DBXA 4KKGA 3FMJA 3PZHA 1M2PA 4DHFA 4K0YA 2W96B 1KE7A 3EQGA 3FDNA 4TYEA 5I3OA 3FYJX 5BVNA 4R7HA 4UZDA 5IQEA 4R1YA 1URWA 1FVVA 4QT1A 4LQMA 4G16A 3WF7A 5HVKA 3CIKA 2VX0A 3E3PA 1TQIA 1WBVA 3OTVA 4H36A 3C4CA 3PRIA 2R3MA 4JL9A 1OPJA 3ZC6A 5HIEA 2PVJA 1H1SA 5JK3A 5LJJA 3KMUA 2RGPA 3VS1A 3QA8A 4NKSA 3PA5A 2ZYBA 4FSZA 4GIIA 4XP0A 4OTPA 4MXXA 2BRMA 2XK8A 1WCCA 4YJRA 3MIYA 3UOLA 4NWMA 3NZ0A 4QMLA 2XRUA 2PUIA 3KXXA 4L67A 4K33A 3ZSGA 3P79A 1R1WA 2YABA 5HIDA 4UMQA 4IC7A 4AOJA 1OB3A 1H25A 2R7IA 4MD7E 3BE9A 4CD0A 5BUIA 3W32A 2VTJA 3OT8A 2VTQA 4ANNA 4XG9A 4F9YA 2W06A 2FVDA 3FEGA 3F5XA 1BLXA 4AGCA 2IG7A 2Z02A 1W0XC 4J98A 3GQIA 4FV2A 3FMMA 4C3FA 4FZ6A 4TWNA 5JN2A 5L6OA 4HCVA 5AAGA 4ACHA 3NNVA 3UMXA 2ZMCA 5L2TA 3MVMA 2XEZA 3TKIA 3O0GA 2W99B 4ASEA 4AZWA 4U0IA 3GUBA 5AP3A 3ZLWA 4BDGA 4FT7A 4BDHA 4JDHA 3AMAA 4AP7A 3A8XA 4I6FA 4NEUA 4S2ZA 2YFXA 4XLVA 5AP0A 1H24A 3D94A 3HV4A 5BYLA 3KMMA 3UTOA 5AV3A 2HY0A 4EOSA 4E6DA 2HY81 1BL7A 1FBNA 2QR7A 3TNPC 5B7VA 5IMEA 3Q96A 3IECA 4NSTA 2YERA 3N4TA 5CEOA 2OIQA 2PYWA 1M2QA 1U54A 3AD4A 3R7UA 3ALNA 5I9XA 3PDTA 4FV6A 3B2TA 4RWJA 3VRYA 3KRWA 3R7OA 3FI2A 4PMMA 4W4XA 1OUYA 1PY5A 2F2UA 3EFLA 3W2OA 4E5AX 4XH6A 4F63A 3E8DA 4AE6A 1Q8WA 4UWBA 2EB2A 2UW6A 5M4UA 3F66A 5IEXA 2P4IA 2BAKA 3DFCB 5J9YA 3UQCA 3IDCA 5D9HA 4WOVA 1P4OA 3A99A 3W1FA 2F57A 2VO3A 1V0PA 2UVZA 4JNWA 4AA4A 5M57A 5DN3A 2X7FA 4AN9A 4CYJA 4UXLA 5HU3A 2JKQA 5BVKA 5IQDA 4ZY5A 4RWLA 4DF3A 3FSKA 2ETRA 4EBVA 5HICA 4GVAA 4GYIA 4A9SA 2Y4IB 4EYMA 3TIYA 3UE4A 1OL1A 3QALE 4NCTA 2VZ6A 4GRBA 5D1JA 4D5KA 3DBFA 3FQHA 4EBWA 4PMSA 1H0WA 3POOA 4JG6A 4UYNA 3DNEA 2GFSA 3GC0A 4QO9A 4BN1A 3MGYA 2UZDA 2Y4IC 2V55A 5E91A 3RVGA 2Z7RA 4EWQA 4BBMA 2ITQA 3CGFA 5CT0A 5KKRB 4N0SA 5C27A 3R9NA 3V6RA 3C0GA 3U4WA 5CSPA 2GHLA 5EHYA 2NP8A 1LEZA 4P5ZA 4W8DA 1PW2A 1U54B 5F20A 4BL1A 4OTIA 4MF1A 2I0EA 4FTTA 1Q3WA 3R7IA 5KKRC 3LMGA 4JQ7A 3R7GA 1ZYJA 4E4LA 2P2HA 3BBWA 3VJOA 1AQ1A 3QKMA 4OUCA 5IH6A 3KCKA 2OXXA 3RZFA 2QOIA 2ITXA 5GNKA 4YURA 3NYXA 2ITUA 4FTRA 5CI7A 3SV0A 4IDTA 5IDPA 3CP9A 4R3CA 4AN3A 4NH1A 3ZZEA 2VTPA 2VTHA 4WRGA 1TQPA 1JSUA 2JEDA 2X2LA 5FP6A 1OUKA 4LV8A 5HD4A 2BHEA 4GSBA 4M12A 4BWXA 2HZ0A 1MRYA 2WGJA 5EI8A 5H9BA 3MH3A 1XH8A 5KE0A 3I79A 3QFVA 2VU3A 2C0OA 4P90A 5C8KA 4FC0A 3FXZA 4QMNA 4MWIA 5TR6A 4IXPA 4L9IA 4L00A 1ERKA 1CKJA 2WMVA 2B55A 5E1EA 2J90A 3QUPA 3QQKA 3W2CA 3F3WA 2YIXA 2QKRA 2YCSA 3D7TB 4YPDA 4EHVA 2WTKB 3OCTA 4FX3A 3LXLA 4DE4A 3QRKA 2RF9A 4NCTC 4TZRA 5JRQA 3MTFA 3CEKA 4CZYB 3ID6C 2JAMA 2NRYA 2RFNA 3QYWA 1J91A 2PL0A 2PZ5A 5A6NA 1PF8A 4DFNA 3P5KA 4G9CA 1IRKA 4F9AA 4E4XA 5CYIA 4I5MA 4JR7A 1Z5MA 2WTKC 4BKZA 5HZNA 4AWIA 4F65A 4TXCA 5EFQA 3NNWA 1WBOA 1B6CB 4Y73A 3AD6A 3R8MA 2BALA 5FLFA 4EUUA 3P1AA 3LJ0A 4KIPA 4ZLZA 4QP7A 3C13A 3C50A 2PWLA 5H8EA 3SHEA 3DFAA 3IDPA 2ZDUA 3OFMA 4BCFA 2CKPA 3QTZA 2YIRA 5T3QA 1DM2A 1K9AA 4UYAA 3V8TA 3WZEA 5GJGA 2W5HA 3O50A 4RX8A 4L68A 1ZYLA 2G9XA 2J0IA 3QCXA 4A4XA 4ZTQA 4H05A 5M55A 5CAUA 5AP7A 3WE8A 3PJCA 2P3GX 4X6QC 5AIRA 5AR7A 4FGBA 3G6HA 1CDKA 2VUWA 5FM2A 2BDJA 4ZJIA 3LCOA 5IMXA 4RZWA 4GW8A 3U55A 4DCAA 4GJ2A 4QTDA 5HE3A 2VTMA 2Q0NA 3E64A 3UYTA 2O64A 5F94A 4FIJA 2VN9A 3LQ8A 3W55A 3ZEWA 5EOLA 3LFDA 3BHYA 5KNJA 3V5QA 4CCUA 4J97A 5JZNA 5TT7A 3RNIA 5L4QA 1ZOGA 4II5A 4YZMA 3UC4A 1J1BA 4QPSA 3OCGA 4AGUA 3K3JA 3EJ1A 3Q4ZA 4YHFA 3KXGA 3C4XA 1IR3A 3RWPA 3FL4A 3M2WA 4E5WA 5BUJA 3HVCA 2W05A 3LVPA 3I6UA 4KWPA 4OTDA 5AADA 3TUBA 1UKHA 1XJDA 2B54A 2E2BA 2GNJA 2J4ZA 3NGAA 2HELA 3N4VA 2WTVA 1IA9A 2IJMA 4KINA 4X2JA 5GJFA 3Q9WA 4FYNA 3TJCA 2O3PA 3FLZA 5KMOA 2BAQA 3OVVA 2FB8A 4OTFA 1FOTA 2W9ZB 4Z7GA 2Y4PA 3LIJA 3LKMA 2X81A 2C3KA 4AT4A 5HU9A 5KMKA 3MVJA 1KE9A 4YUQA 4QTBA 5J7HA 2WXVA 4RWIA 4RA5A 1Q3DA 3ORZA 3L9MA 3AOXA 4B0GA 1KV2A 4RIWA 5I0BA 2E9PA 3BLHA 5L2WA 2R7BA 1VZOA 5E8SA 3W2SA 2V5QA 4UZHA 4U41A 3QRIA 4EUTA 4YZ9A 3OY3A 5BNJA 1R3CA 3SLSA 2R3KA 4FSTA 3RI1A 5CEPA 2VTLA 2OK1A 4TKSA 3ELJA 2G15A 2XIZA 5E8ZA 4OGRA 2R4BA 3S0OA 4YJQA 4ZLYA 2UZUE 4J99A 5CAOA 2ITVA 5GINE 5HGIA 4FKVA 2ONLC 4MCVA 3ZONA 2R3LA 1OL7A 1SNXA 3DOGA 3ETAA 3HMPA 2PU8A 4QQJA 4PY1A 1RW8A 4BHNA 4GK4A 3NX8A 3QF9A 4EC9A 1H01A 3OG7A 4JAIA 4KB8A 1H27A 3U87A 4TNDA 1ZYDA 5I9WA 2QOKA 3NUNA 4RIOA 3NMUF 4IWOA 4FZDB 5DGZA 3E7OA 1NVRA 1XHAA 3R22A 4JBPA 4MAOA 4XMOA 5HTCA 3RM6A 2XJ2A 5CASA 5AUZA 3D83A 5HVJA 4BGQA 2J6MA 4UALA 3FSFA 2G2IA 1WVWA 3RJCA 4F1OA 3IOPA 4A9RA 4JDKA 3B8RA 4H3QA 3ZLYA 4UMPA 2XNMA 2KTYA 2J50A 2WMUA 3DNDA 4BDDA 4D2SA 3M1SA 3U4UA 4RIWB 4JVGA 4ZP5A 3JR1A 3BYUA 3F3VA 4BI0A 2F2CB 4IDVA 5IA5A 4U80A 4IANA 3ZUTA 1PXOA 3AD5A 3NCGA 3D5WA 4ACGA 5IA0A 3R9RA 5M09A 3VUDA 4FV5A 5E1SA 4TPTA 3FY0A 3QD0A 2HENA 3OW3A 3KRJA 4CGAA 3L8VA 4J52A 4BI2A 2CCHA 3RHXA 4A9YA 5HLWA 3C51A 3N4UA 2VTRA 4JI9A 4YC8A 5DPVA 4UN0C 3ANQA 4ALUA 1YXXA 2LGCA 3IKAA 3NUXA 4EOKA 1MP8A 4R5YA 2JDRA 4G3DA 4NW5A 4QRCA 1Q8UA 4W8EA 4P4CA 3WZUA 2YM8A 1Q41A 3HP2A 2R3HA 5E8WA 3EQRA 3ZH8A 5KHXA 4ZY4A 4QMZA 2VWBA 2IW9A 3R7VA 4YSJA 5HX8A 2WTIA 3IOKA 4LUDA 2SRCA 2XK4A 3BGZA 3CQWA 5M4FA 1V1KA 4USEA 4A4LA 3TIZA 3UPZA 2JITA 1SYKA 3KKVA 3WF6A 3D15A 3ZSHA 2OF2A 5K0KA 5I3RA 4FODA 4L7SA 2QONA 2OO8X 2QOFA 3QC9A 3W33A 1OGUA 4BYIA 4YNEA 4RSSA 3MTLA 2H6DA 4FV0A 2QOHA 4F1MA 5LWMA 4I22A 3UC3A 1CSNA 3GCSA 5M4IA 4O6EA 2WO6A 1AD5A 4I94A 2UZNA 4YTHA 2F9GA 3I81A 4YHJA 5F95A 2QOQA 4BKYA 4AW1A 4HGEA 3DY7A 5CU4A 1O9UA 3VBYA 2X6EA 2C47A 4BIEA 4JOAA 1K2PA 1M2RA 2C5OA 3EOCA 3VBTA 4D2WA 5EYCA 5LCKA 3UOKA 2DYLA 4AT5A 5JZJA 3DKOA 3GFEA 1CKIA 2PE1A 3DJ5A 4IAYA 3TI1A 3A8WA 3BHUA 3ENMA 3SRVA 3IS5A 5E8YA 4IX6A 4MVFA 4JX7A 4OBPA 4NM5A 4EQCA 4GKIA 2E9OA 4S30A 4BDKA 5JFWA 3HRBA 4YZNA 2BILB 5M4CA 5IH4A 1Q8TA 2I0HA 2UVYA 4IZ5A 4LI5A 4ANQA 3MN3A 5C1QB 2BVAA 3CY3A 5FTGA 1PXMA 3KRXA 3KN6A 4IW0A 3VVHA 3HMOA 3LJ1A 2C6TA 4D28A 4F99A 4RIXB 4BTMA 5C4KA 5DR2A 5J95A 4FTKA 4PX6A 5FEDA 4FT0A 4IVDA 4MBIA 1FVRA 1OIYA 1R0PA 3LFCA 2ITZA 4K11A 5T68A 3UGCA 4BCHA 4FSRA 1J7IA 2O5KA 4IVCA 4JJRA 5FTQA 3G51A 2R3OA 2QHMA 4XP3A 5HE2A 4WHZA 1GIIA 1NT2A 3Q6UA 4NKAA 5ANEA 3DS6A 3LXKA 3THBA 3DXQA 1WBWA 2PVLA 5AUUA 2WEIA 3R1QA 4FZFB 4HNIA 3UDBA 5CQUA 3G5DA 1Y57A 4P7EA 4LOOA 3A2CA 4FL2A 1SM2A 3O71A 3GC7A 1PKDA 2PVRA 4LG4A 3MDYA 2BIKB 4EOLA 3WZJA 4EEVA 4EH2A 5CF4A 3DKFA 2UW9A 3EHAA 4WUNA 4C34A 2HOGA 4FKIA 4IJ9A 3TM0A 4AFEA 1PKGA 2CGWA 1UV5A 4LRMA 4M69A 4WNMA 5HIBA 5AV0A 4WG3A 3NYVA 3WBLA 3I60A 5HD7A 3C0IA 5KZIA 3QTIA 4C36A 1JQHA 4DA5A 2YJRA 1UU7A 4IADA 3EQIA 4K9YA 4OW8A 3I4BA 3VS3A 4B7TA 4BIDA 5AUTA 4FL1A 3T3VA 4E20A 3OBGA 5LMAA 3UNJA 3TT0A 5IPJA 5HG8A 3UYSA 2JDTA 5HX6A 4AXAA 2J51A 3HDMA 3ULIA 4GFOA 4QTEA 3NUUA 4XRJA 1F3MC 2WAJA 4EH6A 4X2NA 3Q2MA 4WKQA 3QZIA 4GS6A 2FO0A 4PDSA 5IZFA 2YACA 2C5NA 3P4KA 1Q97A 2XNOA 3E7VA 5BMSA 5IUGA 2EUFB 4XUFA 4FKLA 1XH6A 2I40A 2RFSA 4FTNA 2PMIA 4I23A 1Y6BA 4IFCA 3VUTA 4GKHA 3GU8A 2VTAA 3NVKI 4YLKA 1HCKA 3KN5A 2DUVA 3ITZA 3R8ZA 3CLYA 4QMSA 4H58A 3KCFA 3ALOA 4MQ1A 2B9JA 4QP2A 3O8TA 5CF5A 3RGFA 4O81A 3VUIA 1VYZA 4KBCA 1STCE 2ITWA 2QU6A 4TYJA 5L2SA 1MRVA 2XA4A 4OTRA 4ZOGA 3OEZA 1R78A 3BU6A 3F2NA 3I7CA 4BTKA 2C30A 4FKJA 3NUSA 3TDWA 4M69B 4RRVA 1H4LA 2VWVA 3QQFA 3BYVA 2WOTA 3KK8A 3ZO4A 2CKQA 1OPKA 3L1SA 4F6WA 4CFMA 1WBNA 4G6NA 3OD6X 4CMOA 1L3RE 1ZYCA 3OXZA 2BUJA 4O38A 2W4OA 4IWPA 4E7WA 2X4FA 3RINA 5CSWA 4EZ5A 4R77A 4BBEA 1XH7A 3FZRA 4ANBA 2R5TA 4X0MA 2R3GA 3SGCA 1PMEA 1I09A 5BVWA 5JGDA 2C3JA 4O0XA 3AG9A 3QGYA 2R9SA 3FJQE 2IZTA 4DAWA 4PUZA 5E8VA 2JDSA 3C1XA 3SXRA 2I6LA 4PMPA 3VS4A 4IH8A 5CU2A 3TNQB 4LGDA 4M68A 4MD8E 3TKHA 5JGBA 4CG8A 2GDOA 2Z60A 3GC9A 3GU7A 4MQ2A 5DT3A 4HVGA 3KXNA 4Y95A 2OLCA 3FZPA 2WD1A 1WAKA 2C6KA 2QQ7A 3C4ZA 5HO7A 5A9UA 5M51A 2QR8A 4C4FA 3ZM9A 1YWNA 4IACA 3JY0A 4RVMA 2BPMA 4XEYA 2C6MA 2YWVA 4BDAA 5DEYA 3COKA 4HYUA 1WZYA 4ZS4A 5AUVA 4L3LA 3K54A 4DEBA 1M7NA 1JSVA 5IU2A 1OKYA 3PJ2A 5FTOA 4U40A 2JKKA 4WNPA 3OMVA 3RWQA 2WZJA 5K4JA 1PXIA 1H0VA 2X9FA 3QQLA 4Q2AA 5HKMA 3UMWA 5L3AA 5FUTA 3CJGA 4DTBA 4OLIA 3BHTA 3VS2A 2CJMA 2G2HA 2UW4A 4EH3A 3H4JA 2XEYA 3P08A 2QOOA 3O8UA 4UV0A 4XYFA 4D4VA 3HKOA 4APPA 4AZTA 4U44A 3DKGA 3RPOA 3BEAA 3PY3A 4HVHA 4KA3A 3KEXA 3LCDA 5J79A 3G15A 4A9UA 4FTAA 2B9FA 5EM5A 3ATSA 1UU8A 5L6WL 5TF9A 4BY9E 1GAGA 3NNXA 4H39A 4FTLA 2FUMA 2OXYA 3P78A 3OW4A 3DAEA 5CSHA 4CLIA 1KOBA 1JOWB 3PXQA 3QQGA 3R63A 3JXWA 3RHKA 3QTSA 3C4WA 4J71A 3LE6A 4CFVA 2WOUA 4IB3A 1Q8ZA 3NVMB 4I5PA 4FNWA 3DU8A 3BGPA 3OCBA 3D7ZA 4BKJA 4DBXA 2P55A 4MHAA 3WIKA 3HV3A 3EYHA 5HTIA 4O7TA 3Q32A 4FV8A 4EZ3A 4IZYA 4AT3A 1TQMA 2WTWA 5CEIA 4EHZA 1ZY5A 3HA6A 4M67A 2W1IA 4XG3A 3PIYA 4V01A 4NTSA 3FMNA 2PVNA 2CN5A 3V51A 4UX9A 5A54A 3CTJA 4I21A 4PL3A 5A4CA 1O6YA 1LR4A 4IZAA 3EZVA 5E9EA 3FLYA 5CU6A 3TJDA 4D2RA 3ZO1A 5EDRA 5ACBC 5CS6A 1IAHA 3LLAA 4JG7A 4FKSA 4IAAA 5HBJA 1YXVA 1OIUA 2E9VA 2YEXA 4EYJA 4L01A 4NU1A 4JBQA 4TYIA 2V22A 3HA8A 2GSFA 3SDJA 4DH1A 3BZ3A 4DG3E 4M0YA 4QMXA 1XH9A 3NDMA 1G8SA 1U5QA 3DBEA 2VTTA 3G0EA 1NVSA 2HXQA 3DK6A 3ORMA 4ANSA 4F0GA 3ACJA 1H8FA 3MB7A 3AGMA 3G9LX 3L9PA 1VEBA 2JD5A 4ZTRA 4EK8A 3LMIA 4EOMA 3RK5A 4FNYA 4F7NA 4DEEA 5ETCA 4FKUA 4ALWA 3BV3A 1UA2A 4V0GA 3RK9A 3VQHA 1O6LA 1O6KA 5HNIX 1YWVA 2HWPA 1WBSA 2HZIA 4G2FA 3ANRA 2BMCA 3PPJA 4IMYA 4LGGA 4O2PA 3O2MA 1XBCA 3RAWA 3ZSIA 2YN8A 4EOPA 2VTSA 3V5TA 3ZLXA 2Z7SA 3KK9A 4G3CA 4HCUA 4DINA 4BR3A 5C03A 3DZQA 2P33A 3S00A 3V8WA 4O7VA 2XZSA 3IK3A 4FKGA 1UKIA 4LUEA 1ZWSA 1QPCA 2AC5A 3LCKA 4G31A 1Q62A 5D10A 3D5UA 4YGAA 4O0UA 3IW4A 1TVOA 5BQ0A 2B1PA 3FMEA 3SOCA 2A1AB 4S34A 2IZRA 4FNXA 4GT5A 2EXEA 3FMHA 3MV5A 4JR3A 1IA8A 3RPVA 3ZLSA 4DH7A 3DQWA 4D2PA 3Q4TA 4RBLA 5ANJA 4D55A 3AT3A 4PWNA 5IEYA 5D12A 4DC2A 4I93A 4G17A 2GQSA 3PXFA 5IA4A 4TL0A 4G3GA 2CMWA 2WHBA 3SG9A 3RNYA 3O96A 3PY1A 4F7SA 5E8XA 2GNHA 1XKKA 3EWHA 3QA0A 4FKOA 5AP6A 3N51A 1NY3A 3MFRA 2W1FA 5DT4A 2A0CX 3EYGA 3IW5A 3IW8A 4RMZA 4HGSA 3DCVA 3Q2JA 3KC3A 3VS6A 2FYSA 3KXMA 4AN2A 3BWJA 4K1BA 4ACDA 4FKWA 4CV9A 4BCMA 4BCGA 3QYZA 4I5HA 4V0GB 2P0CA 4BFMA 3NW7A 2BRGA 3KRLA 2GQRA 2W5BA 2JGZA 4W9XA 3E62A 3LFEA 4Y83A 3UG1A 4AZVA 4EI4A 4HVDA 4NYEA 2XNPA 2GNFA 3GVUA 3G6GA 4TTHB 3LCTA 3RKBA 1ZRZA 4IX5A 5DRDA 5AR8A 2H96A 4D58A 4E26A 4EK3A 2BAJA 3ACKA 3QTXA 5B2LA 5FXRA 5KUPA 2CNUA 4L6QA 3GCUA 1Q8YA 3MVHA 2GPHA 3COHA 3NYOA 4FKPA 2PVMA 3A7HA 3QWKA 1OBDA 2HYYA 3F5GA 4DTKA 2RIOA 2XKEA 1ATPE 4NM7A 2W1DA 1A9UA 4RIYA 4J96A 3VAPA 5DVRA 1U4DA 4DEHA 3QCSA 3F7ZA 5H3QA 3HAVA 2ZV2A 3LPBA 1YRPA 2ZDTA 4CZUA 4HZSA 2OBJA 1GZNA 3ZRLA 1MRUA 2CNVA 4QYGA 2Q0BA 4A9TA 3ULZA 5C26A 4GT3A 2QG5A 2HW7A 2OIBA 1EH4A 3JPVA 4F09A 2QODA 3Q52A 4U43A 4X2KA 5HG7A 4AQCA 3C7QA 5DG5A 4XV9A 5BPYA 3CTHA 4O0SA 5GZ8A 2YIQA 2CLQA 2C68A 3NW6A 1YXSA 3CC6A 4F9BA 4YC3A 4FEXA 4I3ZA 4QD6A 1P2AA 2OZOA 1UU9A 3ERKA 5GJDA 3W18A 1K3AA 4QMOA 4XOYA 5FDXA 3WYXA 3C5UA 4DITA 1BL6A 2PMNX 1GZKA 4QPAA 5CWZA 2UUEA 3VBQA 5CT7A 1IASA 5IQAA 3BBTB 2VWZA 3NAXA 4JS8A 4YJOA 2QO2A 2WMXA 3FUPA 5HE1A 4PDYA 4D4YA 4ITJA 3HMIA 3JY9A 4ZZOA 3LXNA 1RQQA 3TNIA 4D4SA 3W10A 3ZUVA 5CAPA 4FGRA 4IB5A 4KBKA 4N70A 1KOAA 4JBOA 3GNIB 3AMYA 2OIDA 2GS7A 2PMLX 3UBDA 5FD2A 4N4SA 1G5SA 3W2QA 4F6UA 2HXLA 1MUOA 2PTKA 1JVPP 3EH9A 4TYGA 3P7AA 3F3TA 5CANA 3QLGA 1UNHA 1OKVA 4I5CA 2RFDA 3I1AA 4OBQA 5AEPA 4CYIA 4ZJVA 4ZTMA 3OF0A 2WMWA 3UVRA 2UZEA 4AGWA 4EKKA 5KBRA 4IM2A 2Y6OA 4C33A 5EYMA 5J1WA 1OBGA 4NIFA 4O7SA 3FXXA 4USFA 3DAKA 4ZSGA 4J8NA 4JAJA 3UP2A 2RL5A 3ZRMA 3SAYA 3F69A 4ZSEA 1FPUA 3BIZA 3PLAE 3B8QA 1E1VA 2V7OA 4EH7A 2BCJA 3PG3A 4FTQA 5EQPA 4HPUE 3VO3A 4ERKA 3E8NA 4BDJA 4FEWA 1Q24A 4QPMA 5ANDA 2QCSA 3PYYA 2WIPA 3QHWA 3H0ZA 1GNGA 4O0WA 4PPBA 4HW7A 3V8SA 4GIHA 3T8OA 4NTTA 3KFAA 2BZIB 2CKEA 2J5EA 4KIQA 2OGVA 3GENA 3NS9A 3FI4A 2VWXA 4UMUA 3PJ1A 4FTUA 2JBOA 3OBJA 2WQOA 3HNGA 3QKLA 4CQGA 3S2PA 5AP5A 1T45A 3A62A 4M15A 5EW8A 2DQ7X 3RM7A 3KXHA 4O91A 4ASXA 3BE2A 1Y6AA 3EFWA 5A4TA 1RE8A 1YI6A 4TN6A 4C58A 1FMOE 4GG5A 5IISA 2YCQA 5J7BA 3HL7A 2A4LA 1OL2A 2X2KA 1OECA 4BTFA 2XYNA 2R2PA 3QQUA 4BWKA 2H8HA 5HE0A 3VS0A 2WELA 5AV2A 4BIBA 4JDIA 5CZHA 4C61A 3EL7A 3NW5A 1ZMUA 3F61A 1TKIA 3EN9A 4FR4A 5H2UA 2JDOA 3MFUA 1DI9A 2PZRA 3V5JA 2XK3A 5DH3A 2OH0E 3MA3A 3GCQA 3QTRA 4MTAA 5DNRA 3QZFA 2UZTA 4GCJA 5HO8A 5K3YA 3SXSA 5DMZA 1UNGA 2GNLA 4MX9A 2OWBA 3AC5A 3MYGA 5JKGA 3ATTA 2YIWA 3LQ5A 4L52A 4MBJA 5JEBA 4ZIMA 4GU9A 1PXKA 4IAZA 4AZSA 3QD3A 5KCVA 1PMUA 4RVTA 3DXPA 5J5TA 2ZOQA 5HNGA 4G6LA 4ACCA 2UW7A 3UPXA 3G33A 5KX8A 4K8AA 3R02A 4KSPA 3SXFA 1UWHA 3TZ7A 3GC8A 3BCEA 2O63A 2QC6A 3E88A 5HBEA 2IPXA 2GMXA 4PF4A 1KV1A 3PFQA 5E90A 4FVQA 4QMYA 4HGTA 1PXLA 4C4GA 1H28A 3KU2A 3UJGA 2XUUA 4CFWA 1YI3A 5ANIA 2JKMA 3ZMMA 4FEQA 2WB8A 2BRNA 3CSVA 4CV8A 5F4NA 3FAAA 3MFSA 3VUHA 1P4FA 4XOZA 4BZOA 3DT1A 4ZK5A 4FV9A 4YO4A 3V5LA 3VUGA 4AGDA 3TDVA 3QRJA 3VHEA 5JFVA 1CMKE 4U9AA 4ENYA 4R1VA 3R0TA 5CEQA 2W1HA 3WOWA 4ZTSA 5IA3A 3KRRA 5AP2A 4GG7A 5CAVA 5CEMA 5EKNA 4WD5A 1ZARA 2PE2A 4E73A 3UQFA 5AA8A 3COMA 2F49A 2VX3A 3A7GA 2F7ZE 1PXNA 4I92A 2YDIA 2VNYA 2XVDA 3FLNC 3OC1A 1PMNA 3ORLA 3PXZA 4FSYA 4EH8A 3G2FA 5AP1A 5FEQA 3IW6A 4ERWA 4UXQA 2R3JA 5IQHA 2IVTA 3FZSA 3G0FA 3VUKA 3QBNA 2R3QA 4ITIA 4HYIA 1R0EA 3OHTA 3R1NA 3OEFX 2Y7JA 3PVGA 4EOIA 3R28A 4IX3A 3Q5IA 3VF9A 4CVAA 3F3UA 3L8SA 2VX1A 3Q9ZA 3QXPA 3VBVA 2XMYA 2YDJA 4D4RA 1LUFA 4AF3A 4QMMA 4QMPA 4V04A 3WIGA 2J0MB 3OT3A 3ZBXA 4ALVA 2UZWE 5E4HA 4FSQA 3AC3A 4ZSJA 4ARKA 3P7CA 3DV3A 3EZRA 3M42A 4PDOA 5BVFA 2VWIA 3KQ7A 4OTHA 4JBVA 4ORKA 4BI1A 4LMUA 1H1RA 3ET7A 2B9HA 2Z7LA 3F2AA 3G90X 5EI2A 4DFXE 5I9YA 4ZZNA 1ZMVA 3HMNA 1OPLA 1JAMA 2O0UA 5A4EA 3UVPA 2W9FB 3LFQA 3Q5ZA 2QOCA 4XRLA 3SD0A 3R8LA 4BZNA 4CLJA 3NRMA 2PVFA 4HNFA 1IEPA 3PWYA 3I0OA 3MSSA 4QYEA 4RPVA 3KULA 4MYGA 4FVPA 4RJ7A 2IO6A 1OVEA 2OJIA 5B0XA 4OAVB 3EN5A 2ZVAA 3BU3A 4Z9LA 1BX6A 4FVRA 3ZDIA 4CT2A 1WVYA 4MH7A 4QMWA 5LMKA 2ESMA 3NUYA 1KE5A 5EQEA 2XCKA 3GU5A 3NEWA 4XCUA 2W17A 3MH1A 4GT4A 4RFZA 2UVXA 3QCQA 4EORA 3MPTA 1FVTA 4FTCA 3QD4A 4RVLA 3C5IA 3ZTXA 2R3NA 2PZPA 5FRIA 2QOLA 4U45A 3DJ6A 1BMKA 4B9DA 3U6HA 4O96A 2YM3A 1M52A 4DLIA 4MXYA 3CKXA 2XH5A 4UB7A 3OXTA 4FV1A 5ACKA 2REIA 3U54A 4E6QA 3H30A 4RFMA 3TN8A 3A7FA 2GS6A 1YDRE 3O7LB 5AV4A 1AGWA 4NUSA 5ICPA 4ITHA 4C59A 5EM6A 2NNWB 4RX9A 2XNBA 2A19B 4KS7A 2CKOA 5HHWA 4PTCA 3KY2A 2PZYA 3R73A 3TTIA 2FA2A 2G2FA 4AUAA 1F0QA 2X8EA 4E3CA 1SVEA 2ITNA 4WIHA 3VJNA 4PP7A 2XKCA 3H0YA 4D0WA 5BUEA 1Q99A 3FZ1A 1PXJA 1XO2B 5EHOA 1ZLTA 5HI2A 3EKNA 3FLWA 1F5QA 3QWJA 5HNBA 3V3VA 4X3FA 5EW9A 3AC1A 2IVVA 4FE2A 3HEGA 3UOJA 2YDKA 3A4OX 4OT6A 5FG8A 4ZXTA 3TCPA 4C7TA 4E4NA 4FEVA 3TUCA 4ZSLA 4WO5A 5LMBA 1S9IA 1W8CA 3DA6A 4CKRA 1A48A 2R3RA 3AC4A 3NSZA 4O0YA 3CR0A 5IKWA 4J8MA 4XG8A 5JT2A 5A4QA 4DEIA 4RLLA 2QURA 3RK7A 2ETMA 2W1EA 5L8LA 3DJ7A 1JKLA 3GOKA 4USDA 3QD2B 3MB6A 3CTQA 4S33A 1YHVA 2X0GA 2IWIA 4KNBA 4L46A 2XYUA 4AACA 2YHVA 3IONA 5CU0A 3T9IA 4ASZA 3WF9A 4Z3VA 4FICA 5LVLA 4PV0A 2WKMA 3R8PA 2XB7A 3ZHPC 2IW8A 5IF1A 4K2RA 1DS5A 3FMLA 4ZMFA 2A2AA 1Q61A 2VTIA 4C3PA 2BDWA 3GXLA 3VW8A 3JUHA 3ENHA 3SRVB 3R1YA 5CF8A 4YJUA 4B6LA 3ZEPA 4JXFA 5CNNA 4EC8A 3SG8A 4BICA 5GZAA 3BELA 2XNNA 4GV1A 2BTRA 4X7QA 3VULA 1ND4A 3QKKA 2PMOX 4JDJA 3OUNB 4WBOA 3E8CA 2GNGA 3VQUA 5L8KA 3ZFMA 2UZBA 3PWDA 5H8GA 3VBXA 2XM9A 4WBBB 4KD1A 4X3FB 4IAKA 4D1SA 2XBAA 3HAMA 3MPMA 3R2YA 2W1ZA 4G1WA 2C6DA 5C9CA 1HOWA 4FF8A 3K5UA 3IQ7A 4GFMA 5EI6A 4AW5A 3P23A 3O51A 4F4PA 2H9VA 5CSVA 4FZAB 4O6LA 5HQ0A 3KF4A 4TW9A 5TKDA 3NLBA 4D2VA 3DK3A 4G3EA 4CFXA 4R7BA 4ZMEA 4U42A 3HYHA 4E6CA 3BPRA 5E7RA 3ZBFA 4EH4A 4IB1A 2NPQA 3BYOA 2YA9A 3QAME 4U3ZA 2RFEA 1OZ1A 4XS2A 4XV1A 2PUPA 2PULA 5GIOE 4XV2A 4Y46A 1YDSE 2EXMA 4BF2A 3VRZA 1VYWA 2JDVA 4TNBA 4D0XA 2J2IB 3PSDA 3UO5A 3LZBA 2QOBA 4FYOA 3PA3A 3UIXA 4BCPA 4CZTA 5IQFA 4D1ZA 4QYYA 3QL8A 3G9NA 2PZIA 4RQKA 4Y5HA 3PLSA 3REPA 3VS7A 4AZEA 3HLLA 5AAEA 1OI9A 3HP5A 3EQDA 5IDNA 5DR6A 5FWKK 4FIFA 4CSVA 2BFYA 3SW7A 3FQEA 2QO7A 5EK7A 2CGVA 2CGUA 2DWBA 4FOBA 4XG6A 3ZC5A 4NL0A 4FG8A 4OR5A 2JLDA 2WQBA 5AM7A 4ZAUA 4EK6A 2CCIA 2V62A 5EG3A 3GQLA 2XIKA 2WMRA 3GU6A 5DEWA 3AXWA 2HZNA 2XJ0A 2VV9A 3BQCA 4HOKA 3QTQA 3VF8A 2CGXA 4DGNA 2UZLA 4JT3A 5AR3A 2IN6A 3LFAA 3PUPA 4I6BA 4PP9A 4XBRA 4YU2A 4FK3A 4FSNA 4GMYA 1Y8YA 2PVYA 4C4IA 4MXCA 2UW8A 1NA7A 4X3JA 5A46A 5C8NA 4V05A 3NNUA 4LOPA 2Z8CA 4RGJA 2C1AA 3R9DA 2FSMX 2WTDA 3PJ8A 2GHMA 4R7IA 2FGIA 4FZ7A 4C2VA 2UV2A 5K5XA 4BCOA 3FWQA 4AA0A 3OROA 1XWSA 4I20A 3TZ9A 4EQUA 4FK6A 3ORIA 5FM3A 1PMVA 2XJ1A 5IUIA 2XKFA 4EOQA 1U5RA 3F82A 4W4WA 1RJBA 3BYMA 4AZFA 4I4FA 4E4MA 4QMQA 3II5A 5JMSA 4M97A 2VO0A 2Y0AA 4RVKA 1OITA 3DXNA 5A4LA 2QO9A 2EU9A 2IVUA 2H34A 4WUAA 2GU8A 5IQBA 3AGLA 3PE2A 1YOJA 5FBOA 4YTFA 5CXZA 3HUBA 4ID7A 4Q9ZA 2OI4X 1FINA 2VTOA 3HGKA 4H1MA 3DAJA 3LCSA 5HLNA 5EHLA 3OOGA 2YZAA 4L45A 3ZDUA 4N57A 3CQUA 4O27B 4P2KA 3VC4A 4P5QA 4DGLC 2BTSA 2YLFA 2OFUA 3JS2A 4PL5A 1CM8A 1YKRA 3QQJA 2F7EE 1VJYA 4M7IA 4JX3A 3LQ3A 5I9UA 4UWCA 3CD8A 4R3PA 4UWYA 1XBBA 1YHWA 4F70A 4R5SA 3COIA 3R83A 1G3NA 1BYGA 3Q4UA 5I9VA 3TV6A 3QRTA 3DB8A 5AP4A 4EOOA 2CN8A 3AT4A 4L43A 4G34A 4IEBA 4UMRA 4DFZE 4WSQA 2VRXA 4EONA 2X1NA 2YIYA 3NUAA 4C35A 2HCKA 4U97A 3KVWA 5GZ9A 3Q04A 2YCRA 3MI9A 4DT9A 4BTJA 4PTGA 5GHVA 1ZAOA 3QTWA 3FL5A 3NUPA 4Q9SA 3UIMA 3MESA 3BHVA 3U6IA 2OJJA 1RDQE 2B9IA 2VD5A 4FKQA 4OTGA 3OTUA 3NR9A 2Y8OA 2B7AA 4KS8A 5JQ5A 4EK4A 3CE3A 1W82A 5HCZA 5JSMA 2X7GA 4D1XA 1GJOA 4EL9A 4DEGA 4YTCA 2G01A 4DFBA 3MPAA 3FC2A 2J0JA 3R9HA 3FC1X 4RC3A 2IVSA 3FYKX 3E92A 1YHSA 5AMNA 2BZJA 2P2IA 3MY0A 3Q9XA 4L53A 4CNHA 4QYHA 3TV7A 4XG4A 1SMHA 3WILA 1LPUA 1QMZA 3DBDA 3LOKA 3GB2A 4F64A 2OSCA 3LMHA 3BQRA 4WA9A 2WTJA 1P14A 1YOMA 5AM6A 3HV7A 2GCDA 5DI1A 1VR2A 1BI7A 3OWLA 3KB7A 2GQGA 4KKEA 2GHGA 5EH0A 4YSMA 1PYXA 3WI6A 4JRVA 5AWMA 2C6LA 4FV4A 2JIUA 3EFKA 4NM3A 2RG6A 1WBTA 1OIRA 3R8UA 5BYYA 5IQGA 1L8TA 4JIAA 3DDPA 3LHJA 5E8UA 3ZXTA 5J1VA 1SVHA 2OXDA 2Q83A 3HRFA 3ORXA 4TT7A 4DG0E 1HCLA 2YITA 5HCXA 3KGAA 3PXKA 2XF0A 5LOHA 3SX9A 4H3BA 4RJ4A 3UG2A 4R8QA 4YLJA 3WE4A 3I7BA 1KUTA 4C2WA 4FIIA 4ASDA 4I4EA 5IA1A 5M53A 2GS2A 2IZUA 3BX5A 3TKUA 4HYHA 4AOIA 5JH6A 2V7AA 4ANMA 2E9NA 4ZY6A 3BRBA 4H1JA 3K2LA 5J5SA 3E8EA 4EJNA 4MXAA 4F7JA 1FGKA 3BU5A 5DWRA 3TACA 1H1WA 5AUYA 5L2IA 3FZTA 1V0BA 3OOMA 4Q5EA 3E3BX 2C5YA 4BBFA 4IVBA 5DE2A 5D41A 2Z7QA 1XBAA 5M07A 4C8BA 2C6OA 5D7VA 1LP4A 4RLKA 1H1QA 5CVGA 5CALA 3P7BA 4F7LA 4LV5A 3JVSA 4GEOA 5ANOA 5AX9A 4I0RA 3TZ8A 3EQBA 4FKTA 2C3IB 5KMNA 4UY9A 3I5ZA 3F6XA 4CXAA 4D5HA 3VWAA 3ZFYA 4XG2A 4KIKA 4F0IA 3UP7A 3D5XA 4I1ZA 4A06A 1QPJA 2ZM4A 1GY3A 3EQFA 5FQDC 3BI6A 3CPCA 4WT6A 4RJ3A 3TV4A 4TWPA 3WF5A 4HVSA 2CHLA 3W8QA 4EK5A 5CEKA 2WFYA 5I4NA 3Q4CA 4RA4A 3BEGA 2WMTA 5CTPA 4N6ZA 4MKCA 3U6JA 3M11A 1H08A 2F4JA 3RZBA 2ERZE 2GTNA 5AX3A 4ZZMA 4MBLA 3C9WA 4RQVA 4WRSA 4C62A 4FSUA 2GFCA 4R3RA 1NXKA 4QP4A 3DK7A 3I5NA 4GVJA 4IFGA 4YNOA 5ETAA 4O7WA 2O65A 2JC6A 3R8VA 2FSLX 5D7AA 4BGHA 4CT1A 2PPQA 4FT3A 3PZEA 4RJ5A 4OT5A 2EXCX 1KSWA 5BYZA 2VGOA 4WNKA 5C01A 4PNIA 3OXIA 3PE1A 3ORKA 4QYFA 1I44A 3GGFA 1R39A 2V0DA 4AAAA 5IQCA 4CCBA 2VWUA 3HX4A 3HZTA 3IG7A 4BB4A 2BZHB 3AC8A 2WMQA 4AX8A 5ETFA 4QTCA 2UZOA 2ZAZA 3HMMA 4ANOA 4G3FA 3CCNA 4E8AA 2I0YA 4DG2E 2O8YA 3VUMA 2XP2A 3OP5A 3FY2A 4F9WA 3LFBA 4XP2A 5F1ZA 4OTQA 2EVAA 2B0QA 3VHKA 3IDBA 3LFNA 3H9OA 3ROYA 3FLQA 3LJ2A 4KIKB 4QP3A 1PJKA 4OTWA 2QD9A 3C4EA 5C8MA 4D9TA 5HBHA 5J9ZA 1B38A 4DH5A 2CNQA 3AC2A 4NJ3A 3V01A 2C4GA 2J9MA 4MWHA 4B4LA 3UNZA 5CSXA 2YAAA 5FP5A 3EQHA 4ONAA 3A61A 4G9RA 5HEZA 4UBAA 5HESA 3UZRA 4FTOA 3KXZA 4FMQA 3AT2A 4DLJA 2WPAA 3D7TA 4YZDA 4BCJA 3ORNA 3HV6A 4O83A 3GBZA 3CXWA 1JKKA 4M13A 4JRNA 2HK5A 3Q9YA 3C0HA 4DGOA 2B53A 3ZO3A 2FH9A 2RG5A 5BX0A 2AYPA 2C0TA 3SOAA 3QHRA 2EWAA 3LLTA 3N9XA 4L42A 4BDCA 5CQWA 3PRFA 5EQYA 3NIEA 5BVOA 3PXYA 3ZS5A 1ZOEA 2QNJA 2W1GA 4KRDA 4CMUA 1NW1A 5CXHA 1GIHA 3QTUA 1JPAA 4RIYB 3EKKA 4YZCA 5AV1A 3FPQA 4WNOA 5AJQA 4DH3A 4Y85A 5L2QA 5BVEA 3DTCA 3LM0A 4YJTA 2ETKA 4I0TA 3ZXZA 4F08A 1W98A 2C0IA 2WMSA 2YISA 3H9FA 4IB0A 3OZ6A 3TNWA 2CSNA 4LRJA 2ZB0A 3ZYAA 2PVHA 3F9NA 3BYSA 4FT5A 4NK9A 4Z55A 5AA9A 3W8LA 4QP9A 3T9TA 3VIDA 2CDZA 3D4QA 4G6OA 5DOSA 4J95A 3I0QA 1JNKA 4PMTA 1H26A 3NYNA 4X21A 1BI8A 1Z9XA 2OJGA 3H10A 2C6EA 4YP8A 4E1ZA 3TZMA 5IQIA 2C69A 4NFNA 2R0IA 3SC1A 4BC6A 3TG1A 3FHRA 3TNHA 1NVQA 2YJSA 2I7QA 2QI8A 4YBJA 4CFNA 3F3ZA 5J8IA 3QUDA 2NO3A 3W2PA 1APME 4NJDA 3QQHA 3UO6A 2C3LA 3FHIA 1J1CA 3O7LD 2ZB1A 4PPAA 2J0KA 5IEVA 2XKDA 4I41A 2YZLA 1JLUE 3RTPA 4K6ZA 5CLPA 5AAFA 3IPHA 4BDIA 2F7XE 1W84A 3HV5A 5IUHA 2J7TA 3FXWA 4PTEA 4J1RA 1OMWA 4FIEA 3RPSA 5AR2A 1UNLA 4LM5A 5LWNA 3O17A 3UIUA 5IH5A 4HPTE 2OFVA 4EH5A 4YO6A 1ZXEA 1LEWA 3R21A 4XBUA 3L9NA 4DN5A 4JLCA 3GCPA 3U8WA 4O86A 4IZ7A 5ANKA 3RCDA 1M7QA 3UODA 4A07A 1REKA 4Y5QA 5TOZA 1ZY4A 4A4OA 5EDPA 4IQ6A 5HOAA 5TE0A 3R04A 3VBWA 3KL8A 3L9LA 2JIVA 4DFLA 4LMNA 4NIFB 4L3PA 3WARA 3C4FA 4E6AA 3WYYA 4C4JA 4CKJA 4CQEA 3PJ3A 3BWFA 4KRCA 1E1XA 3DPKA 4FBXA 2ONLA 3MBLA 1FQ1B 3CQEA 5CX9A 3OWKA 4M3QA 4BCKA 5BVDA 2FSTX 2R3PA 4QNAA 2X4ZA 4B99A 4MNFA 4RFYA 4FTJA 3PPKA 5IA2A 1U59A 3EN7A 2XNGA 3V5PA 4K18A 2VTNA 4FIHA 5HO6A 4FG9A 3KVXA 1UWJA 3GFWA 4QMTA 2X8IA 1J3HA 2WQMA 4UMTA 2ACXA 4O1OA 4FI1A 3FBVA 3AMBA 4CRSA 3RCJA 4AW2A 4QQCA 3LFFA 3SQQA 3BKBA 2PSQA 4TY1A 1Q4LA 3ORPA 4O21A 3PY0A 5EM8A 4C4HA 4PNKA 4DFUA 5L6PA 2ITPA 2HIWA 5EDQA 4AG8A 1KE8A 2PUUA 3RAIA 4APCA 4CFUA 4Y8DA 1YWRA 3MJ1A 4DT8A 4XG7A 3V04A 4QMVA 3QC4A 4RG0A 3GEQA 4XHKB 3T3UA 4W4VA 1W7HA 5M44A 3LFSA 4UEUA 3BHHA 2HAKA 4DYMA 3BGQA 3DLZA 5E8TA 2VO6A 1IAJA 4ZTLA 4BWPA 4Z16A 2CLXA 1YW2A 4ACMA 3PPZA 3WZKA 2JAVA 3ZM4A 3O23A 4C37A 3BLQA 5DT0A 4C4EA 3QRUA 1DI8A 4NM0A 4I24A 1ZYSA 4FSWA 3QX2A 4J7BA 4AOTA 4IAFA 5KO1A 3DTWA 4FV3A 3V6SA 3L8PA 4BDEA 5EW3A 4BRXA 2BKKA 3MY5A 4X2GA 2W5AA 2ZMDA 3QGWA 4HGLA 3MJ2A 4W4YA 4D2TA 4DGGA 2YCFA 3MFTA 2X2MA 4ZJJA 3W16A 3IW7A 3KREA 2DS1A 5DFPA 2OKRA 4TWCA 3WZDA 4O82A 2YAKA 2XK6A 4FNZA 1M14A 3BLRA 3NPCA 1YQJA 5B2MA 5LVNA 4U81A 3FI8A 1CTPE 3PVBA 1MQBA 2Y6MA 2W0JA 2W7XA 3EN6A 5G6VA 3UQGA 2XCHA 4PRJA 2PHKA 3KMWA 3R71A 2PE0A 3RAHA 3FMDA 5J87A 3QLFA 4NFMA 2ZV9A 3R9OA 2VAGA 1J7UA 4YJNA 2VWWA 3R00A 3FLSA 3IGOA 3PTGA 5KBQA 1WFCA 1XQZA 2ZM3A 4JQEA 4YLLA 2OU7A 3U9NA 4O22A 5LARA 4O7NA 1WMKA 3CY2A 5FDPA 3ZRKA 3S3IA 3D2IA 1URCA 3ZFXA 1IG1A 4XLIA 2O2UA 5I5ZA 3ZO2A 2UW5A 3FKLA 5AR5A 4OAUC 1PXPA 4CTCA 5JRSA 4FEUA 4QP1A 1Y8GA 4FUXA 3QXOA 5FXSA 4BVUA 4HVIA 3R6XA 3RAKA 1YXTA 4C57A 2GTMA 3MY1A 5DYJA 3CD3A 4ZLOA 3UNKA 3PIXA 1H1PA 3A4PA 2BKZA 1OM1A 4IX4A 4KBAA 4MD9E 4DEAA 3OUKA 4EWHA 5KHWA 5LXMA 2YM4A 3U9CA 4TYHA 3GCVA 4HZRA 5JFSA 2BRHA 3FMKA 1QCFA 2R0UA 3MVLA 4M66A 5HORA 5GIPE 2XS0A 4CEGA 4EHGA 2C5VA 2QVSE 3HECA 4GU6A 5ETIA 4BCIA 2UZVA 3GOPA 3QZGA 5CU3A 4QQTA 1QL6A 4YHTA 3HRCA 4L8MA 3DGKA 4FT9A 4DGMA 4RC4A 3VNTA 3E93A 4AW0A 3A7IA 1JBPE 5KMLA 3VW6A 2PK9A 4IJPA 3EN4A 4O0RA 3CPBA 4RIXA 2J5FA 3H3CA 3UOHA 4FL3A 1QPDA 1KE6A 3Q3BA 2ZJWA 3JVRA 4E93A 5M56A 2OG8A 3DZOA 4NT4A 3DDQA 3OWPA 4AU8A 2WEVA 5JQ8A 4XNEA 3HDNA 1ZOHA 3LAUA 5D11A 5CI6A 5I9ZA 3NWWA 4JQ8A 4C02A 1CKPA 1SNUA 2AC3A 3RP9A 1B39A 3AQVA 2I0VA 2I1MA 3FV8A 1KWPA 4EHEA 4I6HA 3CKWA 5H8BA 3E63A 4HCTA 2ZV7A 4F1TA 3UVQA 2QU5A 3CGOA 2YLEA 3LW0A 3QUEA 4Z7HA 3OY1A 4X6RA 4BZDA 5K5NA 1X8BA 5LQFA 3DBQA 2R64A 2BIYA 2VO7A 4MXOA 3UO4A 5EYKA 1H07A 3R01A 4LYNA 4CG9A 3D2KA 1JKTA 4EZ7A 4TYHB 4QP6A 3SKCA 4WSYA 5K9IA 4TWOA 2RSVA 4IHPA 5B2KA 4CRLA 1XH5A 2R3FA 5EM7A 1PYEA 3ODZX 3KULB 3O8PA 3K3IA 4IWQA 4PL4A 2ZM1A 4YZBA 5CF6A 3FKOA 4H3PA 3GI3A 5A3XA 1PRYA 5CY3A 2VNWA 4F6SA 2JKOA 2XK9A 5JGAA 2EB3A 1YDTE 3PVUA 4L3JA 4EKLA 2C1BA 3S4QA 5EYDA 1M17A 3EQPA 4LGHA 3IGGA 3D5VA 4FIGA 4S32A 1Q5KA 2JFLA 5LMKC 4LL0A 4U8ZA 5KMMA 1ZZ2A 2IW6A 2ITOA 2FSOX 3VS5A 2ITYA 1PHKA 2PVKA 5T6KA 4B8MA 2UW0A 4GYGA 5HLPA 4RX5A 3S95A 1Y91A 1BUHA 3R30A 3MWUA 4PPCA 4W9WA 4QOXA 3R7EA 3UZPA 4DBNA 3R7YA 5AUWA 3GP0A 2AUHA 1YVJA 3NIZA 3MW1A 5DA3A 4I6QA 4K77A 1U46A 2WIHA 3R1SA 3EQCA 4O0TA 3ZCLA 5KMJA 3PG1A 4IIRA 4HJOA 2XIYA 3TWJA 2OF4A 3FKNA 3PP1A 2QLQA 2YM6A 4U5JA 4O2ZA 3ZUUA 5L8JA 4NW6A 1GZ8A 3ZOSA 3HUCA 5F9EA 5FEEA 4O1PA 4EOJA 4HYSA 4GJ3A 4L44A 5KMIA 4Y72A 4KIOA 5C4LA 3F5UA 2X7OA 3U51A 4ZS0A 1ZZLA 4FUYA 4O7YA 5M08A 2LAVA 5TO8A 3TEIA 3B2WA 4MEDA 4R6VA 5HVYA 4CFFA 4EJ7A 4LOQA 3QCYA 2QLUA 4YJSA 1H00A 1REJA 5CZIA 2BROA 2VWYA 2HWOA 3D9VA 4X3FC 3RPYA 4GUEA 4QMUA 3CJFA 4O84A 1E9HA 3KA0A 1QPEA 2PY3A 5LVOA 3E87A 3MS9A 4WG4A 3ZU7A 2XIRA 3F2RA 4AFJA 4FSMA 3PIZA 4GFGA 2ERKA 4KABA 3RBWA 2PUNA 1GZOA 4JG8A 5G1XA 1GOLA 3P9JA 5FXQA 1DAYA 4O7RA 1OL5A 4YJVA 3DLSA 4XJ0A 4CMTA 2NRUA 3JYAA 3K5VA 5CVFA 1FGIA 2BR1A 1G8AA 4O7ZA 2XM8A 4RJ6A 1T46A 3EFJA 4IBMA 2BHHA 4PDPA 1W83A 4MXZA 4RT7A 1OL6A 3D14A 3EL8A 4XX9A 3SW4A 3V5WA 4BHZA 4DCEA 4J53A 4M0ZA 1GIJA 5LCJA 5J9LA 2QKWB 4B8LA 4C3RA 4O7LA 3OCSA 1Z57A 3RPRA 2YM7A 2B4SB 3F7WA 5CAQA 2JBPA 3POZA 3E5AA 4ZEGA 2A27A 3TTJA 2OZAA 5KZ0A 2WU6A 1JKSA 3S1HA 5HG9A 4YJPA 2HZ4A 3QX4A 4N6YA 3PSCA 4EQMA 3WF8A 1J7LA 5DHJA 2CPKE 4DH8A 1JSTA 2WMBA 5ITAA 4IM3A 3Q53A 2WTCA 1BKXA 4KKHA 4D9UA 3OWJA 5LVMA 4M84A 5EKOA 5HG5A 1WBPA 3DB6A 4BDFA 2W1CA 4BDBA 1OKZA 3EMGA 1WVXA 3FPMA 4F0FA 3GU4A 4AE9A 3P86A 4WG5A 3RALA 4U6RA 3GT8A 4FV7A 1V0OA 2RKUA 4RZVA 4YTIA 4IAIA 4U79A 4FA2A 5K4IA 4GK2A 3EIDA 5EOBA 3QZHA 2IZSA 2OJ9A 2UW3A 2XBJA 2OH4A 1DAWA 1SVGA 4O0VA 3H9RA 3ODYX 3CBLA 3Q6WA 4RWKA 5DR9A 5CVHA 2ITTA 2R3IA 2QG7A 4ENXA 2VGPA 4Q5HA 4IM0A 3MA6A 2JIIA 4MF0A 5HTBA 3DQXA 5AUXA 2X9EA 1S9JA 3BV2A 3D0EA 2X39A 3NAYA 2Y9QA 3OS3A 2ZV8A 4FG7A 5DIAA 2BRBA 4MNEA 4G5JA 5E92A 5IG1A 5LVPA 3FQSA 1FMKA 2WU7A 4LFIA 1UVRA 4FTIA 1YXUA 4FTMA 1A06A 3W2RA 4DFYA 1OIQA 3TXOA 4IE9A 4LL5A 2G1TA 2C5XA 4G5PA 5FGKA 2E9UA 3SVVA 3DKCA 2WMAA 5HCYA 3ORTA 5A6OA 3PSBA 2OICA 5JFXA 2OJFE 3TL8A 4YPSA 2OZAB 3F5PA 1OKWA 3FE3A 3UIBA 2XNEA 2X8DA 4E5BA 3A60A 4BCNA 2YM5A 3PVWA 3VN9A 2YWPA 3EB0A 4A7CA 4PQNA 4QTAA 4FKRA 4IVAA 4ZTHA 4XV3A 2W4KA 3KF7A 3MH0A 5K0XA 1YI4A 2C6IA 4BCQA 4YR8A 4QP8A 1MQ4A 4IWDA 3DBCA 4JIKA 4RX7A 3ZZWA 4IC8A 3A7JA 4I0SA 3F88A 4NZWB 4GUBA 5CNOA 3CS9A 3PXRA 5AR4A 4R78A 2BDFA 3PP0A 4KAOA 1ZMWA 4MK0A 4RC2A 3UZTA 3IO7A 4QNYA
chains in the Genus database with same CATH superfamily
2J0LA 2WQEA 2B52A 4BGGA 5A14A 5AFVA 3ROCA 3PA4A 1XH4A 3QU0A 4GH2A 4CTBA 3P0MA 1SZMA 4F9CA 1YOLA 4YBKA 4ANLA 2X6DA 4YMJA 4RJ8A 4GK3A 2OW3A 4MNEB 4S31A 2GNIA 2W4JA 3FI3A 4YC6A 4M8TA 1XR1A 5CENA 2XIXA 4KUJA 3R2BA 4BYJA 3LM5A 5ANGA 4ZTNA 4DEDA 3MIAA 3SA0A 4LRKA 4DTAA 5FBNC 3LXPA 5DRBA 2WQNA 3PUFC 4X2FA 2HW6A 1UU3A 4C38A 4QQ5A 2JFMA 4M14A 2XK7A 1JWHA 2XRWA 4U3YA 4KSQA 2KULA 4EH9A 4AS0A 3MH2A 2WNTA 3I6WA 4AA5A 5M06A 1P5EA 4ZSAA 4GL9A 4OBOA 5DLSA 4FOCA 5AIKA 5BMMA 3TUDA 2BFXA 4L7FA 2BZKB 4C0TA 3RMFA 4U7ZA 2QHNA 3Q60A 3NCZA 4TRLA 4CKIA 3L8XA 2Z2WA 3FZOA 5DBXA 4KKGA 3FMJA 3PZHA 1M2PA 4DHFA 4K0YA 2W96B 1KE7A 3EQGA 3FDNA 4TYEA 5I3OA 3FYJX 5BVNA 4R7HA 4UZDA 5IQEA 4R1YA 1URWA 1FVVA 4QT1A 4LQMA 4G16A 3WF7A 5HVKA 3CIKA 2VX0A 3E3PA 1TQIA 1WBVA 3OTVA 4H36A 3C4CA 3PRIA 2R3MA 4JL9A 1OPJA 3ZC6A 5HIEA 2PVJA 1H1SA 5JK3A 5LJJA 4BJJA 3KMUA 2RGPA 3VS1A 3QA8A 4NKSA 3PA5A 2ZYBA 4FSZA 4GIIA 4XP0A 4OTPA 4MXXA 2BRMA 2XK8A 1WCCA 4YJRA 3MIYA 3UOLA 4NWMA 3NZ0A 4QMLA 2XRUA 2PUIA 3KXXA 4L67A 4QEBA 4K33A 3ZSGA 3P79A 1R1WA 2YABA 5HIDA 4UMQA 4IC7A 4AOJA 1OB3A 1H25A 2R7IA 4MD7E 3BE9A 4CD0A 5BUIA 3W32A 2VTJA 3OT8A 2VTQA 4ANNA 4XG9A 4F9YA 2W06A 2FVDA 3FEGA 3F5XA 1BLXA 4AGCA 2IG7A 2Z02A 1W0XC 4J98A 3GQIA 4FV2A 3FMMA 4C3FA 1TFFA 4FZ6A 4TWNA 5JN2A 4LV7A 5L6OA 4HCVA 5AAGA 4ACHA 3NNVA 3UMXA 2ZMCA 5L2TA 3MVMA 2XEZA 3TKIA 3O0GA 2W99B 4ASEA 4AZWA 4U0IA 3GUBA 5AP3A 3ZLWA 4BDGA 4FT7A 4BDHA 4JDHA 3AMAA 4AP7A 3A8XA 4I6FA 1W2DA 4NEUA 4S2ZA 2YFXA 4XLVA 5AP0A 1H24A 3D94A 3HV4A 5BYLA 3KMMA 3UTOA 5AV3A 2HY0A 4EOSA 3O5AA 4BJJB 4E6DA 2HY81 1BL7A 1FBNA 2QR7A 3TNPC 5B7VA 5IMEA 3Q96A 3IECA 4NSTA 2YERA 3N4TA 5CEOA 2OIQA 2PYWA 1M2QA 1U54A 3AD4A 3R7UA 3ALNA 5I9XA 3PDTA 4FV6A 3B2TA 4RWJA 3VRYA 3KRWA 3R7OA 3FI2A 4PMMA 4W4XA 4DHJA 1OUYA 1PY5A 2F2UA 3EFLA 3W2OA 4E5AX 4XH6A 4F63A 3E8DA 4AE6A 1Q8WA 4UWBA 2EB2A 2UW6A 5M4UA 3F66A 5IEXA 2P4IA 2BAKA 3DFCB 5J9YA 3UQCA 3IDCA 5D9HA 4WOVA 1P4OA 3A99A 3W1FA 2F57A 2VO3A 1V0PA 2UVZA 4JNWA 4AA4A 5M57A 5DN3A 2X7FA 4AN9A 4CYJA 4UXLA 5HU3A 2JKQA 5BVKA 5IQDA 4ZY5A 4RWLA 4DF3A 1XMLA 3FSKA 2ETRA 4EBVA 5HICA 4GVAA 4GYIA 4A9SA 2Y4IB 4EYMA 3TIYA 3UE4A 1OL1A 3QALE 4NCTA 2VZ6A 4GRBA 5D1JA 4D5KA 3DBFA 3FQHA 4EBWA 4PMSA 1H0WA 3POOA 4JG6A 4UYNA 3DNEA 2GFSA 3GC0A 4QO9A 4BN1A 3MGYA 2UZDA 2Y4IC 2V55A 5E91A 3RVGA 2Z7RA 4EWQA 4BBMA 2ITQA 3CGFA 5CT0A 5KKRB 4N0SA 5C27A 3R9NA 3V6RA 3C0GA 3U4WA 5CSPA 3W0RA 2GHLA 5EHYA 2NP8A 1LEZA 4P5ZA 4W8DA 1PW2A 1U54B 5F20A 4BL1A 4OTIA 4MF1A 2I0EA 4FTTA 1Q3WA 3R7IA 5KKRC 3LMGA 4JQ7A 3R7GA 1ZYJA 4E4LA 2P2HA 3BBWA 3VJOA 1AQ1A 3QKMA 4OUCA 5IH6A 3KCKA 2OXXA 3RZFA 2QOIA 2ITXA 5GNKA 4YURA 3NYXA 2ITUA 4FTRA 5CI7A 3SV0A 4IDTA 5IDPA 3CP9A 4R3CA 4AN3A 4NH1A 3ZZEA 2VTPA 2VTHA 4WRGA 1TQPA 1JSUA 2JEDA 2X2LA 5FP6A 1OUKA 4LV8A 5HD4A 2BHEA 4GSBA 4M12A 4BWXA 2HZ0A 1MRYA 2WGJA 5EI8A 5H9BA 3MH3A 1XH8A 5KE0A 3I79A 3QFVA 2VU3A 2C0OA 4P90A 5C8KA 4FC0A 3FXZA 4QMNA 4MWIA 5TR6A 4IXPA 4L9IA 4L00A 1ERKA 1CKJA 2WMVA 2B55A 5E1EA 2J90A 3QUPA 3QQKA 3W2CA 3F3WA 2YIXA 2QKRA 2YCSA 3D7TB 4YPDA 4EHVA 2WTKB 3OCTA 4FX3A 3LXLA 4DE4A 3QRKA 2RF9A 4NCTC 4TZRA 5JRQA 3MTFA 3CEKA 4CZYB 3ID6C 2JAMA 2NRYA 2RFNA 3QYWA 1J91A 2PL0A 2PZ5A 5A6NA 1PF8A 4DFNA 3P5KA 4G9CA 1IRKA 4F9AA 4E4XA 5CYIA 4I5MA 4JR7A 1Z5MA 2WTKC 4BKZA 5HZNA 4AWIA 4F65A 4TXCA 5EFQA 3NNWA 1WBOA 1B6CB 4Y73A 3AD6A 3R8MA 2BALA 5FLFA 4EUUA 3P1AA 3LJ0A 4KIPA 4ZLZA 4QP7A 3C13A 3C50A 2PWLA 5H8EA 3SHEA 3DFAA 3IDPA 2ZDUA 3OFMA 4BCFA 2CKPA 3QTZA 2YIRA 5T3QA 1DM2A 1K9AA 4UYAA 3V8TA 3WZEA 5GJGA 2W5HA 3O50A 4RX8A 4L68A 1ZYLA 2G9XA 2J0IA 3QCXA 4A4XA 4ZTQA 4H05A 5M55A 5CAUA 5AP7A 3WE8A 3PJCA 2P3GX 4X6QC 5AIRA 5AR7A 4FGBA 1G8JA 3G6HA 1CDKA 2VUWA 5FM2A 2BDJA 4ZJIA 3LCOA 5IMXA 4RZWA 4GW8A 3U55A 4DCAA 4GJ2A 4QTDA 5HE3A 2VTMA 2Q0NA 3E64A 3UYTA 2O64A 5F94A 4FIJA 2VN9A 3LQ8A 3W55A 3ZEWA 5EOLA 3LFDA 3BHYA 5KNJA 3V5QA 4CCUA 4J97A 5JZNA 5TT7A 3RNIA 5L4QA 1ZOGA 4II5A 4YZMA 3UC4A 1J1BA 4QPSA 3OCGA 4AGUA 3K3JA 3EJ1A 3Q4ZA 4YHFA 4JMQA 3KXGA 3C4XA 1IR3A 3RWPA 3FL4A 3M2WA 4E5WA 5BUJA 3HVCA 2W05A 3LVPA 3I6UA 4KWPA 4OTDA 5AADA 3TUBA 1UKHA 1XJDA 2B54A 2E2BA 2GNJA 2J4ZA 3NGAA 2HELA 3N4VA 2WTVA 1IA9A 2IJMA 4KINA 4X2JA 5GJFA 3Q9WA 4FYNA 3TJCA 2O3PA 3FLZA 5KMOA 2BAQA 3OVVA 2FB8A 4OTFA 1FOTA 2W9ZB 4Z7GA 2Y4PA 3LIJA 3LKMA 2X81A 2C3KA 4AT4A 5HU9A 5KMKA 3MVJA 1KE9A 4YUQA 4QTBA 5J7HA 2WXVA 4RWIA 4RA5A 1Q3DA 3ORZA 3L9MA 3AOXA 4B0GA 1KV2A 4RIWA 4DHZA 5I0BA 2E9PA 3BLHA 5L2WA 2R7BA 1VZOA 5E8SA 3W2SA 2V5QA 4UZHA 4U41A 3QRIA 4EUTA 4YZ9A 3OY3A 5BNJA 1R3CA 3SLSA 2R3KA 4FSTA 3RI1A 5CEPA 2VTLA 2OK1A 4TKSA 3ELJA 2G15A 2XIZA 5E8ZA 4OGRA 2R4BA 3S0OA 4YJQA 4ZLYA 2UZUE 4J99A 5CAOA 2ITVA 3UDZA 5GINE 5HGIA 4FKVA 2ONLC 4MCVA 3ZONA 2R3LA 1OL7A 1SNXA 3DOGA 3ETAA 3HMPA 2PU8A 4QQJA 4PY1A 1RW8A 4BHNA 4GK4A 3NX8A 3QF9A 4EC9A 1H01A 3OG7A 4JAIA 4KB8A 1H27A 3U87A 4TNDA 1ZYDA 5I9WA 2QOKA 3NUNA 4RIOA 3NMUF 4IWOA 4FZDB 5DGZA 3E7OA 1NVRA 1XHAA 3R22A 4JBPA 4MAOA 4XMOA 5HTCA 3RM6A 2XJ2A 5CASA 5AUZA 3D83A 5HVJA 4BGQA 2J6MA 4UALA 3FSFA 2G2IA 1WVWA 3RJCA 4F1OA 3IOPA 4A9RA 4JDKA 3B8RA 4H3QA 3ZLYA 4UMPA 2XNMA 2KTYA 2J50A 2WMUA 3DNDA 4BDDA 4D2SA 3M1SA 3U4UA 4RIWB 4JVGA 4ZP5A 3JR1A 3BYUA 3F3VA 4BI0A 2F2CB 4IDVA 5IA5A 4U80A 4IANA 3ZUTA 1PXOA 3AD5A 3NCGA 3D5WA 4ACGA 5IA0A 3R9RA 5M09A 3VUDA 4FV5A 5E1SA 4TPTA 3FY0A 3QD0A 2HENA 3OW3A 3KRJA 4CGAA 3L8VA 4J52A 4BI2A 2CCHA 3RHXA 4A9YA 5HLWA 3C51A 3N4UA 2VTRA 4JI9A 4YC8A 5DPVA 4UN0C 3ANQA 4ALUA 1YXXA 2LGCA 3IKAA 3NUXA 4EOKA 1MP8A 4R5YA 2JDRA 4G3DA 4NW5A 4QRCA 1Q8UA 4W8EA 4P4CA 3WZUA 2YM8A 1Q41A 3HP2A 2R3HA 5E8WA 3EQRA 3ZH8A 5KHXA 4ZY4A 4QMZA 2VWBA 2IW9A 3R7VA 4YSJA 5HX8A 2WTIA 3IOKA 4LUDA 2SRCA 2XK4A 3BGZA 3CQWA 5M4FA 1V1KA 4USEA 4A4LA 3TIZA 3UPZA 2JITA 3W0QA 1SYKA 3KKVA 3WF6A 3D15A 3ZSHA 2OF2A 5K0KA 5I3RA 4FODA 4L7SA 2QONA 2OO8X 2QOFA 3QC9A 3W33A 1OGUA 4BYIA 4YNEA 4RSSA 3MTLA 2H6DA 4FV0A 2QOHA 4F1MA 5LWMA 4I22A 3UC3A 1CSNA 3GCSA 5M4IA 4O6EA 2WO6A 1AD5A 4I94A 2UZNA 4YTHA 2F9GA 3I81A 4YHJA 5F95A 2QOQA 4BKYA 4AW1A 4HGEA 3DY7A 5CU4A 1O9UA 3VBYA 2AEGA 2X6EA 2C47A 4BIEA 4JOAA 1K2PA 1M2RA 2C5OA 3EOCA 3VBTA 4D2WA 5EYCA 5LCKA 3UOKA 2DYLA 4AT5A 5JZJA 3DKOA 3GFEA 1CKIA 2PE1A 3DJ5A 4IAYA 3TI1A 3A8WA 3BHUA 3ENMA 3SRVA 3IS5A 5E8YA 4IX6A 4MVFA 4JX7A 4OBPA 4NM5A 4EQCA 4GKIA 2E9OA 4S30A 4BDKA 5JFWA 3HRBA 4YZNA 2BILB 5M4CA 5IH4A 1Q8TA 2I0HA 2UVYA 4IZ5A 4LI5A 4ANQA 3MN3A 5C1QB 2BVAA 3CY3A 5FTGA 1PXMA 3KRXA 3KN6A 4IW0A 3VVHA 3HMOA 3LJ1A 2C6TA 4D28A 4F99A 4RIXB 4BTMA 5C4KA 5DR2A 5J95A 4FTKA 4PX6A 5FEDA 4FT0A 4IVDA 2A98A 1FVRA 1OIYA 1R0PA 3LFCA 2ITZA 4K11A 4MBIA 5T68A 3UGCA 4BCHA 4FSRA 1J7IA 2O5KA 4IVCA 4JJRA 5FTQA 3G51A 2R3OA 2QHMA 4XP3A 3BL7A 5HE2A 4WHZA 1GIIA 1NT2A 3Q6UA 4NKAA 5ANEA 3DS6A 3LXKA 3THBA 3DXQA 1WBWA 2PVLA 5AUUA 2WEIA 3R1QA 4AQKA 4FZFB 4HNIA 3UDBA 5CQUA 3G5DA 1Y57A 4P7EA 4LOOA 3A2CA 4FL2A 1SM2A 3O71A 3GC7A 1PKDA 2PVRA 4LG4A 3MDYA 2BIKB 4EOLA 3WZJA 4EEVA 4EH2A 5CF4A 3DKFA 2UW9A 3EHAA 4WUNA 4C34A 2HOGA 4FKIA 4IJ9A 3TM0A 4AFEA 1PKGA 2CGWA 1UV5A 4LRMA 4M69A 4WNMA 5HIBA 5AV0A 4WG3A 3NYVA 3WBLA 3I60A 5HD7A 3C0IA 5KZIA 3QTIA 4C36A 1JQHA 3TMOA 2YJRA 4DA5A 1UU7A 4IADA 3EQIA 4K9YA 4OW8A 3I4BA 3VS3A 4B7TA 4BIDA 5AUTA 4FL1A 3T3VA 4E20A 3OBGA 5LMAA 3UNJA 3TT0A 5IPJA 5HG8A 3UYSA 2JDTA 5HX6A 4AXAA 2J51A 3HDMA 3ULIA 4GFOA 4QTEA 3NUUA 4XRJA 1F3MC 2WAJA 4EH6A 4X2NA 3Q2MA 4WKQA 3QZIA 4GS6A 2FO0A 4PDSA 5IZFA 2YACA 2C5NA 3P4KA 1Q97A 2XNOA 3E7VA 5BMSA 5IUGA 2EUFB 4XUFA 4FKLA 1XH6A 2I40A 2RFSA 4FTNA 2PMIA 4I23A 1Y6BA 4IFCA 3VUTA 4GKHA 3GU8A 2VTAA 3NVKI 4YLKA 1HCKA 3KN5A 2DUVA 3ITZA 3R8ZA 3CLYA 4QMSA 4H58A 3KCFA 3ALOA 4MQ1A 2B9JA 4QP2A 3O8TA 5CF5A 3RGFA 4O81A 3VUIA 1VYZA 4KBCA 1STCE 2ITWA 2QU6A 4TYJA 5L2SA 1MRVA 2X0PA 2XA4A 4OTRA 4ZOGA 3OEZA 1R78A 3BU6A 3F2NA 3I7CA 4BTKA 2C30A 4FKJA 3NUSA 3TDWA 4M69B 4RRVA 1H4LA 2VWVA 3QQFA 3BYVA 2WOTA 3KK8A 3ZO4A 2CKQA 1OPKA 3L1SA 4F6WA 4CFMA 3TYKA 1WBNA 4G6NA 3OD6X 4CMOA 1L3RE 1ZYCA 3OXZA 2BUJA 4O38A 2W4OA 4IWPA 4E7WA 2X4FA 3RINA 5CSWA 4EZ5A 4R77A 4BBEA 1XH7A 3FZRA 4ANBA 2R5TA 4X0MA 2R3GA 3SGCA 1PMEA 1I09A 5BVWA 5JGDA 2C3JA 4O0XA 3AG9A 3QGYA 2R9SA 3FJQE 2IZTA 4DAWA 4PUZA 5E8VA 2JDSA 3C1XA 3SXRA 2I6LA 4PMPA 3VS4A 4IH8A 5CU2A 3TNQB 4LGDA 4M68A 4MD8E 3TKHA 5JGBA 4CG8A 2GDOA 2Z60A 3GC9A 3GU7A 4MQ2A 5DT3A 4HVGA 3KXNA 4Y95A 2OLCA 3FZPA 2WD1A 1WAKA 2C6KA 2QQ7A 3C4ZA 5HO7A 5A9UA 5M51A 2QR8A 4C4FA 3ZM9A 1YWNA 4IACA 3W0PA 3JY0A 4RVMA 2BPMA 4XEYA 2C6MA 2YWVA 4BDAA 5DEYA 3COKA 4HYUA 1WZYA 4ZS4A 5AUVA 4L3LA 3K54A 4DEBA 1M7NA 1JSVA 5IU2A 1OKYA 3PJ2A 5FTOA 4U40A 2JKKA 4WNPA 3OMVA 3RWQA 2WZJA 5K4JA 1PXIA 1H0VA 2X9FA 3QQLA 4O4EA 4Q2AA 5HKMA 3UMWA 5L3AA 5FUTA 3CJGA 4DTBA 4OLIA 3BHTA 3VS2A 2CJMA 2G2HA 2UW4A 4EH3A 3H4JA 2XEYA 3P08A 2QOOA 3O8UA 4UV0A 4XYFA 4D4VA 3HKOA 4APPA 4AZTA 4U44A 3DKGA 3RPOA 3BEAA 3PY3A 4HVHA 4KA3A 3KEXA 3LCDA 5J79A 3G15A 4A9UA 4FTAA 2B9FA 5EM5A 3ATSA 1UU8A 5L6WL 5TF9A 4BY9E 1GAGA 3NNXA 4H39A 4FTLA 2FUMA 2OXYA 3P78A 3OW4A 3DAEA 5CSHA 4CLIA 1KOBA 1JOWB 3PXQA 3QQGA 3R63A 3JXWA 3RHKA 3QTSA 3C4WA 4J71A 3LE6A 4CFVA 2WOUA 4IB3A 1Q8ZA 3NVMB 4I5PA 4FNWA 3DU8A 3BGPA 3OCBA 3D7ZA 4BKJA 4AXEA 4DBXA 4DHIB 2P55A 4MHAA 3WIKA 3HV3A 3EYHA 5HTIA 4O7TA 3Q32A 4FV8A 4EZ3A 4IZYA 4AT3A 1TQMA 2WTWA 5CEIA 4EHZA 1ZY5A 3HA6A 4M67A 2W1IA 4XG3A 3PIYA 4V01A 4NTSA 3FMNA 2PVNA 2CN5A 3V51A 4UX9A 5A54A 3CTJA 4I21A 4PL3A 5A4CA 1O6YA 1LR4A 4IZAA 3EZVA 5E9EA 3FLYA 5CU6A 3TJDA 4D2RA 3ZO1A 5EDRA 5ACBC 5CS6A 1IAHA 3LLAA 4JG7A 4FKSA 4IAAA 5HBJA 2XANA 1YXVA 1OIUA 2E9VA 2YEXA 4EYJA 4L01A 4NU1A 4JBQA 4TYIA 2V22A 3HA8A 2GSFA 1TZDA 3SDJA 4DH1A 3BZ3A 4DG3E 4M0YA 4QMXA 1XH9A 3NDMA 1G8SA 1U5QA 3DBEA 2VTTA 3G0EA 1NVSA 2HXQA 3DK6A 3ORMA 4ANSA 4F0GA 3ACJA 1H8FA 3MB7A 3AGMA 3G9LX 3L9PA 1VEBA 2JD5A 4ZTRA 4EK8A 3LMIA 4EOMA 3RK5A 4FNYA 4F7NA 4DEEA 5ETCA 4FKUA 4ALWA 3BV3A 1UA2A 4V0GA 3RK9A 3VQHA 1O6LA 1O6KA 5HNIX 1YWVA 2HWPA 1WBSA 2HZIA 4G2FA 3ANRA 2BMCA 3PPJA 4IMYA 4LGGA 4O2PA 3O2MA 1XBCA 3RAWA 3ZSIA 2YN8A 4EOPA 2VTSA 3V5TA 4O4FA 3ZLXA 2Z7SA 3KK9A 4G3CA 4HCUA 4FRFA 4DINA 4BR3A 5C03A 3DZQA 2P33A 3S00A 3V8WA 4O7VA 2XZSA 3IK3A 4FKGA 1UKIA 4LUEA 1ZWSA 1QPCA 2AC5A 3LCKA 4G31A 1Q62A 5D10A 3D5UA 4YGAA 4O0UA 3IW4A 1TVOA 5BQ0A 2B1PA 3FMEA 3SOCA 2A1AB 4S34A 2IZRA 4FNXA 4GT5A 2EXEA 3FMHA 3MV5A 4JR3A 1IA8A 3RPVA 3ZLSA 4DH7A 3DQWA 4D2PA 3Q4TA 4RBLA 5ANJA 4D55A 3AT3A 4PWNA 5IEYA 5D12A 4DC2A 4I93A 4G17A 2GQSA 3PXFA 5IA4A 4TL0A 4G3GA 2CMWA 2WHBA 3SG9A 3RNYA 3O96A 3PY1A 4F7SA 5E8XA 2GNHA 1XKKA 3EWHA 3QA0A 4FKOA 5AP6A 3N51A 1NY3A 3MFRA 2W1FA 5DT4A 2A0CX 3EYGA 3IW5A 3IW8A 4RMZA 4HGSA 3DCVA 3Q2JA 3KC3A 3VS6A 2FYSA 3KXMA 4AN2A 3BWJA 4K1BA 4ACDA 2X0QA 4FKWA 4BCMA 4BCGA 4CV9A 3QYZA 4I5HA 4V0GB 2P0CA 4BFMA 3NW7A 2BRGA 3KRLA 2GQRA 2W5BA 2JGZA 4W9XA 3E62A 3LFEA 4Y83A 3UG1A 4AZVA 4EI4A 4HVDA 4NYEA 2XNPA 2GNFA 3GVUA 3G6GA 4TTHB 3LCTA 3RKBA 1ZRZA 4IX5A 5DRDA 5AR8A 2H96A 4D58A 4E26A 4EK3A 2BAJA 3ACKA 3QTXA 5B2LA 5FXRA 5KUPA 2CNUA 4L6QA 3GCUA 1Q8YA 3MVHA 2GPHA 3COHA 3NYOA 4FKPA 2PVMA 3A7HA 3QWKA 1OBDA 2HYYA 3F5GA 4DTKA 2RIOA 2XKEA 1ATPE 4NM7A 2W1DA 1A9UA 4RIYA 4J96A 3VAPA 5DVRA 1U4DA 4DEHA 3QCSA 3F7ZA 5H3QA 3HAVA 2ZV2A 3LPBA 1YRPA 2ZDTA 4CZUA 4HZSA 2OBJA 1GZNA 3ZRLA 1MRUA 2CNVA 4QYGA 2Q0BA 4A9TA 3ULZA 5C26A 4GT3A 2QG5A 2HW7A 2OIBA 1EH4A 3JPVA 4F09A 2QODA 3Q52A 4U43A 4X2KA 5HG7A 4AQCA 3C7QA 5DG5A 4XV9A 5BPYA 3CTHA 4O0SA 5GZ8A 2YIQA 2CLQA 2C68A 3NW6A 1YXSA 3CC6A 4F9BA 4YC3A 4FEXA 4I3ZA 4QD6A 1P2AA 2OZOA 1UU9A 3ERKA 5GJDA 3W18A 1K3AA 4QMOA 4XOYA 5FDXA 3WYXA 3C5UA 4DITA 1BL6A 2PMNX 1GZKA 4QPAA 5CWZA 2UUEA 3VBQA 5CT7A 1IASA 5IQAA 3BBTB 2VWZA 3NAXA 4JS8A 4YJOA 2QO2A 2WMXA 3FUPA 5HE1A 3AKJA 4PDYA 4D4YA 4ITJA 3HMIA 3JY9A 4ZZOA 3LXNA 1RQQA 3TNIA 4D4SA 3W10A 3ZUVA 5CAPA 4FGRA 4IB5A 4KBKA 4N70A 1KOAA 4JBOA 3GNIB 3AMYA 2OIDA 2GS7A 2PMLX 3UBDA 5FD2A 4N4SA 1G5SA 3W2QA 4F6UA 2HXLA 1MUOA 2PTKA 1JVPP 3EH9A 4TYGA 3P7AA 3F3TA 5CANA 3QLGA 1UNHA 1OKVA 4I5CA 2RFDA 3I1AA 4OBQA 5AEPA 4CYIA 4ZJVA 4ZTMA 3OF0A 2WMWA 3UVRA 2UZEA 4AGWA 4EKKA 5KBRA 4IM2A 2Y6OA 4C33A 5EYMA 5J1WA 1OBGA 4NIFA 4O7SA 3FXXA 4USFA 3DAKA 4ZSGA 4J8NA 4JAJA 3UP2A 2RL5A 3ZRMA 3SAYA 3F69A 4ZSEA 1FPUA 3BIZA 3PLAE 3B8QA 1E1VA 2V7OA 4EH7A 2BCJA 3PG3A 4FTQA 5EQPA 4HPUE 3VO3A 4ERKA 3E8NA 4BDJA 4FEWA 1Q24A 4QPMA 5ANDA 2QCSA 3PYYA 2WIPA 3QHWA 3H0ZA 1GNGA 4O0WA 4PPBA 4HW7A 3V8SA 4GIHA 3T8OA 4NTTA 3KFAA 2BZIB 2CKEA 2J5EA 4KIQA 2OGVA 3GENA 3NS9A 3FI4A 2VWXA 4UMUA 3PJ1A 4FTUA 2JBOA 3OBJA 2WQOA 3HNGA 3QKLA 4CQGA 3S2PA 5AP5A 1T45A 3A62A 4M15A 5EW8A 2DQ7X 3RM7A 3KXHA 4O91A 4ASXA 3BE2A 1Y6AA 3EFWA 5A4TA 1RE8A 1YI6A 4TN6A 4C58A 1FMOE 4GG5A 5IISA 2YCQA 5J7BA 3HL7A 2A4LA 1OL2A 2X2KA 1OECA 4BTFA 2XYNA 2R2PA 3QQUA 4BWKA 2H8HA 5HE0A 3VS0A 2WELA 5AV2A 4BIBA 4JDIA 5CZHA 1XMMA 4C61A 3EL7A 3NW5A 1ZMUA 3F61A 1TKIA 3EN9A 4FR4A 5H2UA 2JDOA 3MFUA 1DI9A 2PZRA 3V5JA 2XK3A 5DH3A 2OH0E 3MA3A 3GCQA 3QTRA 4MTAA 5DNRA 3QZFA 2UZTA 4GCJA 5HO8A 5K3YA 3SXSA 5DMZA 1UNGA 2GNLA 4MX9A 2OWBA 3AC5A 3MYGA 5JKGA 3ATTA 1W2FA 2YIWA 3LQ5A 4L52A 4MBJA 5JEBA 4ZIMA 4GU9A 1PXKA 4IAZA 4AZSA 3QD3A 5KCVA 1PMUA 4RVTA 3DXPA 5J5TA 2ZOQA 5HNGA 4G6LA 4ACCA 2UW7A 3UPXA 3G33A 5KX8A 4K8AA 3R02A 4KSPA 3SXFA 1UWHA 3TZ7A 3GC8A 3BCEA 2O63A 2QC6A 3E88A 5HBEA 2IPXA 2GMXA 4PF4A 1KV1A 3PFQA 5E90A 4FVQA 4QMYA 4HGTA 1PXLA 4C4GA 1H28A 3KU2A 3UJGA 4I6LA 2XUUA 4CFWA 1YI3A 5ANIA 2JKMA 3ZMMA 4FEQA 2WB8A 2BRNA 3CSVA 4CV8A 5F4NA 3FAAA 3MFSA 3VUHA 1P4FA 4XOZA 4BZOA 3DT1A 4ZK5A 4FV9A 4YO4A 3V5LA 3VUGA 4AGDA 3TDVA 3QRJA 3VHEA 5JFVA 1CMKE 4U9AA 4ENYA 4R1VA 3R0TA 5CEQA 2W1HA 3WOWA 4ZTSA 5IA3A 3KRRA 5AP2A 4GG7A 5CAVA 5CEMA 5EKNA 4WD5A 1ZARA 2PE2A 4E73A 3UQFA 5AA8A 3COMA 2F49A 2VX3A 3A7GA 2F7ZE 1PXNA 4I92A 2YDIA 2VNYA 2XVDA 4AXFA 3FLNC 3OC1A 1PMNA 3ORLA 3PXZA