1U46A

Crystal structure of the unphosphorylated kinase domain of the tyrosine kinase ack1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
255
Chain Sequence
b'LTCLIGEKDLRLLEKLGGVVRRGEWDAPSGKTVSVAVKCPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQDDHYVMVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activated CDC42 kinase 1
publication title Crystal Structures of the Phosphorylated and Unphosphorylated Kinase Domains of the Cdc42-associated Tyrosine Kinase ACK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 255
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u46A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u46A01
5L6PA 4EH5A 5KNJA 4YBJA 3BQRA 3GXLA 4XV9A 4V04A 3GCUA 1IG1A 2QKWB 2X7GA 5E8YA 3VO3A 5J7BA 4OAVB 1YXVA 1WBTA 3HA8A 3QTQA 4XBUA 1RDQE 1JWHA 2OKRA 2DQ7X 3KRRA 5AA8A 2CCIA 3Q04A 5B2KA 2WKMA 3LXKA 4AG8A 3UYTA 3TV4A 3OG7A 5M09A 3LM0A 1IA8A 3NUYA 4DH7A 4ZLZA 4IAYA 4FKQA 1UWJA 3LLTA 4A4LA 2XJ0A 3I6UA 3QHRA 3BLQA 2QC6A 4G3EA 4V0GA 5J8IA 5LVLA 3UIMA 1NY3A 4U0IA 4B99A 3V5WA 3I1AA 2ITQA 2XNGA 4Q5HA 4F63A 2W4JA 3OW4A 4EK4A 1PXOA 5LVPA 4I22A 3JR1A 2WZJA 3G6HA 2HZIA 5FXRA 3G90X 2W96B 3FMDA 3OFMA 5FWKK 3QQUA 4C36A 1OKWA 2WQNA 3HX4A 3UO4A 2QOFA 3COMA 3QCXA 4X2JA 5IQEA 1P4OA 4MXAA 4FEWA 4DYMA 3PPZA 3UGCA 3BHVA 4XP0A 3KXMA 4KKHA 3HAVA 2PUNA 1FPUA 1DM2A 3DOGA 4RVKA 5DT4A 3S2PA 4PDYA 2PULA 2KTYA 2WMVA 3MW1A 2WQOA 3CSVA 3RPRA 3F5UA 3BU3A 3ZLXA 4CQEA 2ITZA 4D28A 4BZNA 4I4EA 2BMCA 3EQHA 3TJCA 4BDHA 3FYJX 4D4RA 4CZUA 2XH5A 2YIQA 3DAJA 3MH0A 3RI1A 5HU3A 3AC2A 4FIJA 3CGFA 4KAOA 3Q96A 4WD5A 4BKZA 2PWLA 3D14A 3QUDA 4NW5A 4ZTQA 2CNQA 3F7ZA 1R78A 1YDSE 3G15A 2W9FB 1W82A 4AA0A 4UMRA 4I94A 1SZMA 4RA4A 1QPDA 4JS8A 1KE5A 4WKQA 3D7TB 4JBQA 2B7AA 1PMEA 3MDYA 4C57A 4RX5A 3TKHA 4MVFA 3EN7A 3IG7A 2WO6A 4QO9A 4YNEA 3FI4A 5HBJA 4TWPA 3OTVA 3Q9XA 3UZPA 2J5EA 2YDIA 3V5PA 3O8UA 4ZJJA 3BIZA 1W83A 2FSOX 2ERKA 4TWCA 4FV5A 4AN2A 3EZVA 4S32A 2YM7A 3BE2A 5DBXA 4M14A 4FKIA 4ZEGA 2B9HA 3T3UA 3UTOA 4AWIA 5HLNA 2C1BA 2QO9A 4ZTHA 5HG5A 2A2AA 3DA6A 4NKAA 3A7FA 4FYOA 4R7BA 3OOGA 1JLUE 3U6JA 4ID7A 2F9GA 2GHLA 4NIFB 1R0PA 3Q9WA 5BMSA 1CTPE 4QP6A 4EEVA 4QNYA 1CKIA 5D10A 3UIBA 4ZY5A 3ZONA 3CJFA 2OJFE 1M52A 3EOCA 2VGPA 4FK6A 2XRUA 2VTNA 3QX2A 3ELJA 1M2QA 1UV5A 2UUEA 1CSNA 2XNBA 5AJQA 2WEVA 5AR5A 4EI4A 4MBJA 3RHXA 3R0TA 2V55A 2C5NA 4KABA 3ITZA 4FNXA 4G2FA 3U6HA 1IAHA 4FIIA 5KMKA 2NPQA 2OK1A 4BI1A 3ZBXA 2P2IA 3OCGA 5FQDC 1JAMA 4V01A 2PMLX 2O0UA 4GT5A 3OBGA 3ENHA 3W32A 1FMOE 3E5AA 2XK6A 3BZ3A 3IDBA 4AW0A 5CF8A 1K3AA 1LEZA 3D2KA 4L68A 2JDOA 2VTPA 3PY0A 4ZS0A 2YIXA 3ORMA 3QZFA 3R01A 2BHHA 3SV0A 4MBLA 4CG8A 2F57A 3OVVA 3SOAA 2QU6A 3MSSA 4ANMA 1U5RA 4R1VA 3U8WA 3EYHA 4UY9A 3QRUA 4JR7A 3OW3A 2J50A 4S33A 3DXPA 4CRSA 2ONLA 5CENA 4TYHB 4J95A 2B9JA 2XIYA 3C50A 4A9UA 4O7TA 2XS0A 1WVWA 5IA0A 3DKGA 2GQSA 3A61A 3EN5A 3Q60A 5L2QA 3ZHPC 2BAKA 1PYXA 2X0GA 4WHZA 3BRBA 4PNIA 4IX5A 1F0QA 4FV8A 2WHBA 4KKEA 4IANA 2HWOA 4QMZA 5I3RA 3RPVA 4YC3A 1GIHA 3UVQA 5J7HA 3KMUA 3ZM9A 3HKOA 1PY5A 1OMWA 2OO8X 4MWIA 1PXIA 3CCNA 1J7LA 3WE8A 4U45A 4F7LA 3E63A 4JQ8A 3QQKA 3EIDA 4OTDA 2GCDA 4DT8A 4O6EA 4AZEA 3DBEA 3MJ2A 2PZPA 5E8SA 3QQLA 3V04A 4E5WA 4BTKA 3LFNA 2CNVA 4AOIA 4YJUA 3JPVA 4O81A 4F0GA 4JVGA 5F20A 4EYJA 3TNIA 1Q8TA 2IVVA 2R3KA 4NM3A 4YNOA 4WNMA 5IKWA 4EBVA 4O7NA 3BE9A 3K3IA 3VUDA 5IA3A 3CPBA 3H3CA 4RWKA 3UC4A 4ASEA 4CTCA 4AP7A 4WBBB 4X2FA 2R3HA 2E9PA 2WTCA 3BBWA 4IACA 4D58A 4FKVA 4GYGA 4O83A 2A0CX 4F4PA 4CMOA 3NS9A 1ZOGA 5FBOA 3Q2JA 1PMNA 5EHOA 2YAKA 4Z3VA 4XP3A 2IN6A 5EHYA 3HAMA 1SM2A 2WNTA 3DDQA 2VWVA 4FSMA 4Q5EA 2XK3A 4ORKA 1UWHA 3VUKA 5EI8A 4CVAA 5EH0A 2J0LA 2WAJA 4TPTA 3GGFA 2EB2A 4E6QA 3QBNA 2JIVA 4EOQA 5HZNA 5L2IA 3KF7A 5KO1A 1H1QA 4W9XA 4HVSA 4ANBA 1H24A 2B4SB 1YHWA 2OZOA 3HV7A 3U54A 3NVKI 3R7EA 4FSNA 1MRVA 4IZAA 3QKKA 4NU1A 2FYSA 4RVMA 3OXTA 3QGYA 2W05A 3GCSA 5I0BA 3S0OA 4GJ3A 4ONAA 3TDWA 5J95A 3P7BA 3ZSHA 4O6LA 4IVCA 3H0YA 3DGKA 1MUOA 2ZAZA 4C58A 4QTCA 4OTQA 4BTMA 3P9JA 3ORPA 5JGBA 2UW4A 4L7SA 2UW0A 3F2NA 5D11A 4E5BA 1RJBA 4YO6A 5GHVA 3VS0A 2XVDA 4FSUA 4HZRA 3U9NA 2QU5A 2V5QA 5CF4A 4I6HA 4M0ZA 4OAUC 4S31A 2HENA 4BL1A 2JKQA 3UG2A 4WG5A 2VZ6A 4KIOA 3SDJA 3PJ3A 3VUGA 2UW9A 2PPQA 4FTCA 3U6IA 4FOBA 4ALVA 4DEEA 3MPTA 4FMQA 5J9YA 2VAGA 4DA5A 3GENA 4M8TA 3E64A 4LRKA 4AZFA 3QL8A 5LVMA 2ZM4A 3DKOA 2OFUA 2WMUA 3G0FA 3CTQA 3SOCA 4BWKA 4OUCA 4YHFA 5AAFA 3NUUA 2YHVA 4FKJA 3N4UA 1YQJA 4FV3A 4DH5A 1ZYSA 3UPZA 2OF2A 3DJ5A 3ALNA 3PJ8A 5I9UA 3ORTA 3UOHA 3P4KA 3RBWA 2JLDA 5EKNA 4ZP5A 4WNKA 4PL4A 2QLQA 4FEVA 2QR8A 5T3QA 4I4FA 2XIKA 2GDOA 2UZBA 4GT4A 5EK7A 3VUMA 1CDKA 4ACGA 5HTBA 5I3OA 4G16A 4EOOA 3L9NA 2B54A 3DTWA 3Q6WA 3QZIA 2P55A 1B39A 2WTVA 3FSFA 3LFBA 1WMKA 3EQRA 4AN9A 2UW3A 1CKJA 4KRCA 4A4XA 4ZTMA 5CWZA 2XNMA 1W84A 4RX8A 2HELA 3VHEA 4A06A 2QOIA 5I9XA 3QTWA 3QQHA 2R3MA 3CKWA 4OLIA 3R7YA 4F6SA 4RIYB 4O96A 2FH9A 4I5CA 3RK7A 2ITPA 2EU9A 4L53A 4FNZA 4DINA 4W4WA 4ENYA 4GK2A 2WOTA 2PVJA 3OWJA 4FEUA 1JKLA 3OCSA 2BZIB 5LARA 5EYDA 2WIPA 2PVHA 3VVHA 3NNWA 4E26A 4KRDA 4EH9A 4II5A 4X3JA 4MCVA 4KIKB 4XRJA 1GZOA 5DEWA 3RVGA 3DFAA 3FUPA 4DEIA 3PXRA 4HCUA 1NT2A 5HD7A 5KX8A 4UN0C 2XK4A 4QP9A 1M7QA 4YZMA 2PSQA 4RFMA 4FSRA 1GJOA 4XJ0A 3D5VA 4JQEA 4XOYA 5JQ5A 1OM1A 5HD4A 1DI9A 5CEOA 2YIYA 1F3MC 2CGUA 2R3PA 2VO6A 4K8AA 5AR3A 4CXAA 3L8XA 1Z9XA 1GIJA 2JKOA 3BU5A 1XBCA 2ETMA 3CR0A 4U3YA 4XS2A 5D1JA 4YU2A 5CANA 1OITA 4I6FA 4RIOA 4HCVA 1OGUA 4PPBA 3HMMA 5EQEA 3GCPA 1QMZA 4OBPA 4NUSA 5FTQA 3NUXA 4F9AA 5JFXA 1WBPA 4Z7HA 1FMKA 3GQIA 5E4HA 5CXZA 3FXXA 3I79A 5AR8A 3C4EA 4ZSAA 5DMZA 2HZ4A 3ZRLA 3UO6A 1PJKA 4I1ZA 3MA3A 3EN6A 4LQMA 5CVGA 5A4QA 1OKZA 2VV9A 3ZSGA 4MXOA 3NYOA 4M97A 3VS4A 2CN8A 2V7OA 4R3CA 3VHKA 2PZ5A 1PHKA 2I0HA 2QNJA 3NCZA 3Q3BA 5HIDA 2WEIA 4OBQA 5JGAA 5HESA 4FUYA 1VZOA 3CBLA 2BRNA 4AOTA 3QX4A 4I20A 5DE2A 3ZFXA 4HVHA 4RA5A 4M69A 4A4OA 3ORNA 3R8PA 5EW3A 4G3DA 5AV4A 5ICPA 4YLJA 1TQIA 4IAAA 5EI2A 5I9VA 4ZS4A 4UV0A 3V5QA 4QQJA 3RWQA 3ZTXA 1NW1A 5E1EA 3ZH8A 3AD6A 1GY3A 1XJDA 3ODYX 5E1SA 4EUUA 2XNEA 2FB8A 5H9BA 3KB7A 3MY5A 3LFQA 2IW9A 2ZDUA 3DBCA 4JDJA 4IZ7A 2BROA 2CGWA 3CC6A 3PLSA 5C8KA 5JN2A 2UZVA 3DCVA 4FIHA 4C3FA 2BR1A 3QCSA 4LRMA 3C5IA 4WNOA 4F64A 5K5XA 3M2WA 2CN5A 3OMVA 4WA9A 3FXZA 4FSYA 1OIUA 1Y6AA 5HCZA 3DXQA 1TVOA 4EJ7A 4IM3A 4CZTA 1LP4A 1W0XC 3TL8A 4FX3A 4YSJA 5AADA 1KE8A 4JT3A 2W17A 4KNBA 1V1KA 2JFLA 2WELA 5HIBA 4U7ZA 3FPQA 2YEXA 2OH0E 2XNOA 5AM6A 4PPCA 2JBOA 3EWHA 3R6XA 2B9FA 3GI3A 4S2ZA 4BFMA 2JAVA 5GZAA 2B9IA 2R3QA 4JBOA 4MH7A 5HBHA 5IEXA 3VBWA 2NNWB 3HUCA 4KBAA 1K9AA 2VTTA 4BC6A 3BLRA 4NCTC 4CGAA 3QTZA 2JKMA 3ZU7A 4PPAA 5AP3A 5J5TA 4MAOA 1W7HA 2YWPA 4U42A 4CFWA 3S95A 1PXKA 3DB6A 3JVRA 5H3QA 4BTFA 4O7WA 4FK3A 3PXQA 2Q83A 4XMOA 4FV2A 4O7ZA 2VWYA 3AOXA 4TWNA 2YJRA 4DEDA 4PL3A 2YITA 5GJDA 4PTGA 4F0IA 3EQBA 3W2SA 5FD2A 3K54A 3VS7A 4IB5A 3NNUA 1BMKA 3OHTA 2IZSA 4DGNA 4HW7A 1BKXA 4KB8A 4BB4A 4D4SA 2GNJA 2IW6A 4IIRA 4QRCA 5KKRC 5J1VA 4FV6A 4BIBA 3CQUA 2R3RA 4K2RA 3RK9A 3PDTA 1SVEA 3L9LA 3QC4A 4JDKA 3EZRA 4L44A 4BCJA 4D2RA 5L6WL 3O23A 4BCPA 3R9RA 2R3NA 4USDA 3Q9YA 5IUIA 3FEGA 3RNYA 3FZTA 4BZOA 3Q4TA 2ZB1A 1SYKA 4P5ZA 5BUJA 1L8TA 5HEZA 1L3RE 2F2CB 2ETRA 4X2KA 4ZZMA 5EDRA 5HBEA 4M12A 3MVMA 2EUFB 4FG9A 3JVSA 4GUBA 5CEKA 4WO5A 3QQFA 4IFGA 1ZARA 1ZLTA 3A7IA 3DKCA 5C8NA 3DTCA 3MFTA 4RBLA 3H9FA 4O1PA 4PL5A 4YTCA 1ND4A 4HGLA 5CT7A 4DF3A 3D15A 4FG7A 5KCVA 1Q5KA 4O27B 5GJGA 3TUDA 3D7TA 3A62A 3DU8A 4X6QC 3SG8A 3DAEA 2QONA 5EOLA 1REKA 2OIBA 5KMLA 3KC3A 4O38A 3C5UA 5CAQA 4QMPA 2W5AA 5HOAA 5BVFA 4CV9A 3GB2A 1O9UA 4AX8A 3SX9A 3KKVA 3FZOA 3TG1A 4F1OA 4O84A 1BLXA 4K1BA 3NWWA 5AUWA 3LCTA 3PA5A 2J9MA 2QOQA 2BDJA 3LJ2A 5ANOA 2BCJA 2YFXA 4O0XA 4C35A 4D9TA 3MH1A 3PRFA 3PSBA 4EHZA 4FVPA 1AD5A 1MP8A 4EQUA 3C4FA 3QZHA 2ITYA 3NYXA 3OT3A 3WZKA 2QR7A 2CKOA 5LCJA 5M4CA 4OTFA 1DI8A 2JITA 3NRMA 2XYUA 4I0SA 5L4QA 3PY3A 5L6OA 5M56A 4GFGA 2PVFA 4AA4A 5IA1A 3C7QA 3ZMMA 1WVYA 3QTXA 4FZ6A 1H1RA 1ZMWA 1V0PA 3MPAA 5HHWA 4IVBA 3PTGA 3OF0A 3P86A 4XG7A 4DG3E 1UVRA 2VTIA 5BVKA 2DUVA 4FT9A 4YZ9A 5L2WA 4FZAB 2X9FA 1ZXEA 1PMUA 4MXYA 5DT0A 2PYWA 4FZDB 4BRXA 3F3TA 3EN4A 4FTJA 3BEGA 2XF0A 4L8MA 4AZWA 3NYVA 5EOBA 4YBKA 4FOCA 3NW7A 4XG2A 3EMGA 3MY1A 2OSCA 3CGOA 3KXNA 2ZJWA 4MHAA 4WOVA 4QMVA 5DR2A 2GNIA 3ZRMA 2C1AA 5CU2A 3V8WA 1Q41A 4RJ5A 5IQCA 3KQ7A 4ZXTA 4TY1A 2GU8A 4H39A 2G15A 3G51A 3OS3A 4KS7A 4X2GA 3V3VA 3WZJA 4FTNA 3LQ5A 4MNEB 4Z7GA 2YACA 3LCKA 3HRBA 5CU6A 4AU8A 2VUWA 2UW5A 3CY3A 1GAGA 4QMSA 4IVDA 2CLXA 3FLWA 4FV4A 3Q32A 4W8EA 2QOCA 2XB7A 4M3QA 4TYHA 3PXYA 2H96A 1H1SA 1OIRA 5FG8A 3LCOA 4FV7A 3VRZA 4APCA 1GZKA 2B55A 2PVNA 3F61A 4KSPA 4Y5QA 1FGIA 5CEPA 3OXZA 4X2NA 2CKEA 5LWMA 1H00A 2ITUA 2R3IA 5AX3A 5CAOA 4FNWA 3ZFMA 5IQFA 3DS6A 5KMIA 3GC0A 3GOKA 3PXFA 4KSQA 3SAYA 3ROCA 3FKNA 1UU7A 1OUKA 2RG5A 4L45A 1J7UA 2YZLA 4YMJA 4D55A 4DGMA 2XKCA 3VBYA 3VF8A 1M14A 1MQ4A 2ZV2A 3VW6A 1Q24A 2NRUA 4E7WA 3KREA 3DK6A 4YTIA 4YO4A 1TQPA 4JLCA 3R83A 2G2IA 3HLLA 4N70A 3IECA 3BYOA 3FY2A 4GV1A 3BHUA 4I21A 2IG7A 3IONA 4Y72A 5E8ZA 5CU0A 1UU8A 1CM8A 3LFFA 3COHA 4HNIA 2C4GA 3ORKA 4KKGA 5ACKA 5B7VA 4MXCA 5KUPA 4RZWA 4TT7A 5H2UA 4XG3A 4K77A 3KGAA 3E8NA 2YZAA 4KIPA 2VTHA 3Q5IA 2W1GA 3ZZEA 3UBDA 2Y6MA 1WCCA 5DVRA 5EDQA 4C2WA 2EXMA 1YW2A 5AUYA 5HKMA 4EBWA 2J0MB 5FGKA 5FXSA 2Q0NA 5AV1A 2CKPA 4BDAA 2XA4A 3WOWA 1UKHA 4I92A 5D12A 2BHEA 1J91A 3QWKA 4ERWA 2EXEA 1S9JA 2PY3A 4D1ZA 3PXZA 5GIOE 3BV2A 3LW0A 1OUYA 5DEYA 4O7VA 3VBQA 4D2SA 4BR3A 4LFIA 2UZLA 3F5GA 2X2MA 5EQYA 3WF8A 4PTEA 1JKKA 2UVXA 5HQ0A 3PYYA 4IB0A 2F7EE 2J4ZA 5EM5A 1JBPE 3FQEA 5CU4A 4CZYB 3FDNA 1YXUA 5L8KA 3SRVB 1ZWSA 2ESMA 4AGCA 3PPKA 4RJ8A 4BI0A 5HLWA 1DAWA 3P08A 3ATSA 3W2RA 3QU0A 3ODZX 5DH3A 4LG4A 5B2LA 5LVNA 3DAKA 4E93A 5CU3A 4JG7A 3ZRKA 3TV6A 1OPLA 2WQBA 4UBAA 5JFWA 3UJGA 3S00A 1P5EA 3OEZA 2C68A 4Y83A 1OKYA 5J5SA 3MA6A 4U43A 5J9ZA 5M44A 4QTAA 3A4PA 4GCJA 4FL3A 3U51A 2CLQA 1U59A 4JG8A 4LMNA 5BQ0A 5L3AA 4B8MA 3ZC5A 2XMYA 3Q53A 5CI7A 4IMYA 2ONLC 3PPJA 3DV3A 4DC2A 2PUUA 3PZHA 5J9LA 5CX9A 1PYEA 2R2PA 3QCQA 4DT9A 2W1HA 4JDIA 4IZYA 2OW3A 3WE4A 3GOPA 4JL9A 5HVJA 5ANIA 1U46A 2JIIA 3I0OA 3WARA 4J8NA 2BALA 5A4EA 5CAVA 2YAAA 5FP6A 2OICA 3AC1A 3N51A 3F3ZA 4I5HA 4K11A 5IDNA 2X2LA 3EH9A 4O22A 4O7RA 3F5PA 5HNBA 3P5KA 3WIGA 4FG8A 4FVQA 3FAAA 2ERZE 4HVGA 5CALA 3KRXA 3HMNA 3QCYA 2NO3A 3A4OX 4IB1A 2JKKA 2HY0A 4IW0A 3RPOA 2PE1A 2VWUA 3HDMA 5L2TA 4KUJA 2WPAA 3QD2B 3FPMA 4JDHA 3H0ZA 5CSPA 4AOJA 1JKSA 5HO6A 2OFVA 4LRJA 4O0SA 4UMPA 4RVTA 2FSMX 4L67A 5AEPA 1URWA 4ACHA 4GT3A 4A9YA 4W9WA 2QCSA 5JMSA 4YJQA 3UOJA 1XHAA 2GSFA 3QRIA 1OI9A 3C0HA 3N9XA 5K4JA 4MXZA 4DTKA 4ZSEA 4PF4A 2AYPA 3T9IA 4EQMA 3FXWA 1BL6A 4GIHA 4L9IA 1Q8WA 4C4FA 1E1XA 2CCHA 5E8TA 4RJ4A 4YHTA 4EOMA 3U55A 4GU6A 5KMJA 1PXMA 2F7ZE 4E6CA 2VWIA 5ETAA 5LQFA 3R30A 4RJ3A 5EI6A 3DBQA 2LAVA 5KBRA 4AGWA 4BF2A 3I7BA 3IPHA 3O71A 4KIKA 2EXCX 3MVJA 4IDTA 4Y8DA 4XX9A 5CI6A 3R7UA 4EJNA 4N6YA 2RFDA 2A27A 3FLZA 3R1NA 4QP4A 1ZYLA 4ZTNA 5HG8A 3E8DA 4GIIA 2VTRA 1W98A 3KMWA 3QKMA 3EKNA 4EWQA 4EK5A 3TIYA 1IEPA 5BYZA 2ITOA 2C6LA 4U80A 5LVOA 3CJGA 4XH6A 3NZ0A 4K33A 2OXDA 3CE3A 4I5MA 4TRLA 3VBVA 4C0TA 3R73A 1I44A 5LMKA 3PIYA 3VS3A 1XH9A 4O82A 5CSWA 2GHGA 2BDWA 4RIXB 3F7WA 2QKRA 2XKDA 3SW4A 4GS6A 5ETIA 3IO7A 2CSNA 3VBXA 5IMEA 4QMMA 1VEBA 5E92A 2GFSA 5CLPA 5ACBC 5C26A 2Y9QA 3DLSA 1Y6BA 3ZS5A 4MXXA 4FIFA 4EH7A 5HE0A 3S3IA 2WMWA 3HL7A 3VC4A 4NM7A 3POOA 3RMFA 3UQCA 4YR8A 3GC9A 4D0XA 4NTTA 2F49A 3NYNA 5AWMA 3REPA 4EL9A 4FSZA 2WMAA 4L3LA 3MYGA 2AC3A 3FMJA 3QXPA 4AXAA 3DK3A 3G9NA 1ZRZA 2YABA 3HV4A 3R7IA 3QXOA 4D4YA 4ZOGA 5KBQA 3SVVA 1YI3A 3ZO2A 4DG0E 1FINA 4FKGA 5CEMA 2G2FA 4GRBA 4HPTE 1XH7A 4HYIA 4FKRA 4HVIA 4CEGA 1YXSA 2BPMA 2XK7A 5IQGA 3TT0A 2KULA 2RSVA 3Q4ZA 3NLBA 5HI2A 2Y8OA 4TN6A 2WOUA 4DGOA 4U5JA 3PZEA 5JRQA 4TYJA 4F08A 3VQHA 5DA3A 3LXNA 5FLFA 3IW5A 5F94A 3HMOA 2IZRA 3HP2A 4HGEA 4L7FA 1H0VA 3NPCA 1Q99A 2Z7LA 3FZ1A 2VTSA 2B53A 1Q8UA 3ZDIA 5HVYA 1ATPE 3BV3A 3HGKA 3FBVA 2VWWA 4XP2A 2BZKB 4XG4A 2J0JA 3BGQA 5KZ0A 4C33A 4LL0A 4MK0A 2C3KA 1VJYA 4RFZA 3IKAA 3BYUA 5K5NA 2E9VA 5DOSA 4C4IA 4DFLA 5IQAA 4WSQA 5AUVA 5IDPA 5J87A 3EQGA 2P0CA 4FUXA 2VU3A 1H0WA 3HV6A 4FTOA 2OWBA 3H30A 4ANLA 4Q9ZA 3GC8A 3MPMA 3QFVA 4C3PA 4FTIA 2WTKB 4E20A 2HZ0A 4L3JA 3BGZA 4EKKA 4E3CA 5IQIA 4FIEA 4U41A 5EYMA 5EW8A 4DCEA 4FTRA 2PZRA 4GG7A 5IH4A 2XKFA 3QLFA 3ULZA 3FLQA 4BCIA 3HMIA 2OIDA 3H9OA 4CFVA 3GCVA 3GC7A 4IEBA 1VYWA 2QQ7A 4KA3A 4PQNA 5J79A 2PMNX 4EKLA 2FUMA 3U87A 2Q0BA 3AGLA 4YZBA 2OBJA 1JSUA 2C0OA 5E7RA 4AT4A 2XIZA 4L46A 1YVJA 2GMXA 3E87A 3FMKA 3KN6A 3OCTA 3VRYA 4XNEA 3K5VA 4A9RA 4NH1A 2GNLA 5FTOA 2I7QA 1DS5A 4LGGA 5BYYA 2C47A 3DQXA 5EDPA 2R5TA 3COIA 3C4ZA 3L1SA 2OZAA 3R28A 5L2SA 2X6DA 2O64A 2YIWA 2HXQA 3UO5A 4LGHA 4B9DA 2QOHA 1V0OA 5LXMA 2W1FA 3CLYA 4BKJA 4X21A 3R7VA 3M42A 4XOZA 4O1OA 3L8PA 4L01A 4A7CA 2QG5A 4J52A 5IQBA 4BBEA 3VWAA 3WIKA 2YDJA 1A06A 2R64A 4UMQA 1FVRA 3MIYA 3OZ6A 4FNYA 3S4QA 4K0YA 3EFLA 1VR2A 4ZTLA 3W8QA 4MD8E 4DH3A 3GUBA 3KRLA 4YLLA 1Z5MA 2F4JA 2YCSA 3QRKA 4WRGA 5A6NA 3UP2A 3NUAA 4C34A 3JUHA 4E1ZA 1IA9A 3SD0A 5LJJA 3DQWA 4W4YA 4JBPA 4QPMA 3TNQB 5FM3A 2HWPA 3RM6A 3WI6A 4ZMEA 2YDKA 4AF3A 3PJCA 5HU9A 3QTUA 5AUXA 3NUSA 5F9EA 2JEDA 4BDGA 1OPJA 4U9AA 4EZ3A 5M07A 4JRVA 4A07A 3LFEA 4AA5A 2C6EA 4D2TA 5EM7A 3DNEA 5M4UA 3G6GA 2OI4X 5GIPE 4GSBA 4G9CA 5AIKA 4PDPA 3W1FA 4NM5A 2UZDA 3II5A 3ANQA 4JNWA 2FVDA 5CNOA 5IUHA 2CKQA 4DCAA 2XK8A 2BAQA 4O0WA 4G5JA 3LCSA 1RW8A 3IGGA 1UNHA 1G3NA 4M0YA 1YKRA 2PVYA 3R8MA 4AAAA 1YHVA 3TZMA 1WBNA 4X3FC 5F1ZA 5IEVA 4MQ2A 3FMLA 2JIUA 4D4VA 3D5XA 5HTCA 3MBLA 2Y7JA 5CSVA 3QUPA 1KE7A 2YA9A 4I23A 4ZTSA 1J1CA 4KS8A 1OBGA 5L8JA 4G3GA 4ASZA 4TYGA 2V0DA 2VWZA 2W1DA 3I7CA 3FZRA 1KV2A 3R1YA 3DZOA 4U81A 4UMUA 3H10A 3IS5A 5HE3A 3V5JA 5GZ9A 2QURA 2JBPA 3UVPA 2PE0A 4O0VA 3F2AA 3QYZA 3W33A 1BYGA 2E9OA 2YM3A 4NJDA 2R0IA 3FC2A 5AP0A 4DEAA 3OY1A 4BBFA 4AW2A 3OBJA 1Q3WA 3L8SA 5D7VA 2C30A 2J6MA 3WF5A 4EC9A 3ZXTA 4NYEA 4FL1A 5C9CA 4DFYA 3KY2A 4JX3A 3HEGA 3I0QA 4AGDA 5JEBA 5DNRA 3W55A 5BUEA 3O0GA 3IOPA 4FKTA 3DT1A 4YJRA 3QYWA 3F5XA 3FWQA 1BI7A 3NCGA 4Y85A 1H08A 5AV2A 3AC8A 3IW4A 4DEGA 1F5QA 4CV8A 3G0EA 4PV0A 4EK6A 2VNWA 3THBA 3E8EA 3ZBFA 4BTJA 1AQ1A 2OJIA 4B4LA 4ERKA 4TTHB 4K6ZA 5FEDA 4BZDA 2XCKA 4F9YA 2OG8A 3V5LA 2XJ1A 2QHNA 3TUBA 2VX3A 5DT3A 2WB8A 4FTQA 1Q8ZA 4G3FA 4U8ZA 5IA4A 3F82A 3MB6A 3TTIA 5ANGA 4EC8A 2JDTA 2UZOA 3L9PA 3PIZA 3R7OA 3KVXA 2G01A 3C0GA 3BU6A 4FV9A 2BUJA 4H1MA 4I3ZA 4NT4A 4RJ7A 3T8OA 4LUEA 4WUAA 3ZYAA 4BCMA 2YIRA 4QMQA 5I9YA 2I40A 3OWPA 4GVJA 3ZC6A 4H3QA 2I0EA 3FV8A 4M7IA 3CXWA 3R63A 4GKHA 4FI1A 4JQ7A 2YM6A 2B52A 4B0GA 4RJ6A 3MH3A 3Q5ZA 4IAKA 3VQUA 2PL0A 5EM8A 3ZZWA 4C4EA 5CAPA 4O7YA 4OT6A 4NKSA 4GJ2A 1KV1A 5E90A 3GP0A 4ACMA 2FSTX 3A2CA 4BCQA 3AC5A 1UU3A 2UW7A 4QT1A 5LMAA 2OXYA 1YWNA 3ZLWA 2QG7A 4GU9A 1GNGA 5H8BA 3TNHA 5J1WA 4HYSA 1MRYA 4X6RA 3HECA 3R21A 4BDDA 3QTRA 2X2KA 3NIZA 4FGBA 3MTFA 3V5TA 4EOIA 3LMHA 4EONA 1XH4A 2H6DA 3TI1A 4IJ9A 3NW6A 3ZLYA 1KOBA 4NEUA 2EVAA 5KMMA 3H4JA 2V62A 4KWPA 3OOMA 4BDBA 3QD4A 3TV7A 2UV2A 4U3ZA 1OBDA 3KK8A 1U4DA 4X7QA 3PJ1A 1B38A 2BDFA 2RIOA 2Z7RA 3AT4A 1E1VA 2BFYA 3I5NA 3MFUA 1J3HA 3E3PA 4C3RA 4A9SA 4ASDA 2BIYA 2P4IA 3LFAA 2XCHA 3E8CA 4C8BA 4EWHA 3CIKA 4FIGA 3DY7A 4FKLA 4TXCA 4C02A 1S9IA 3F2RA 1JVPP 2WMXA 1U5QA 2PMOX 1LR4A 4JAJA 4LMUA 4NFMA 4BCHA 3FL4A 1KOAA 1TQMA 2C6TA 3I81A 3UODA 1E9HA 4I24A 4BCKA 1Q8YA 3HV5A 3SGCA 4DAWA 2VO7A 3IDPA 3VN9A 3FL5A 5A4TA 4LV5A 5DHJA 4BCNA 4QTEA 3QD3A 2W5HA 2G9XA 2XEYA 4RX9A 1FVVA 2HAKA 4FEQA 5FDXA 5KZIA 1ZOEA 5TT7A 1Y8YA 1IR3A 1HCKA 2R7BA 2CGVA 1QPCA 3COKA 3GU8A 4G9RA 1O6YA 2QVSE 4IFCA 4BIEA 4CMUA 2E9UA 4DGLC 4IC8A 3QTIA 4MTAA 3D5WA 1U54B 2X39A 1UU9A 4HGSA 3WF6A 4BDJA 4E6DA 1H27A 3VS2A 3W18A 5IMXA 2DYLA 4IWDA 2CNUA 3ACKA 4OBOA 3TIZA 3AGMA 5A46A 2R7IA 4FT0A 3OUNB 3U4WA 2CPKE 2PVLA 4QPSA 4HGTA 5IA5A 3LFDA 3F66A 2ITWA 4XG9A 4YPDA 5KMNA 3RM7A 2VNYA 3FY0A 4P7EA 1JSTA 1H1WA 1PW2A 2VRXA 4R7IA 4RWJA 3TWJA 3KULB 2ITTA 3FLYA 4LOPA 3VNTA 3KXHA 1R39A 5CEIA 3NIEA 5DG5A 1H25A 5F4NA 3TZ8A 1WFCA 3ZUTA 3R2BA 3HZTA 4FTUA 4BHNA 2JD5A 3K3JA 3ENMA 2R3JA 3RPYA 4U40A 3LMGA 2W06A 4ZY6A 2I0VA 5CQUA 2HOGA 1HOWA 5C01A 3UPXA 2P2HA 3VBTA 3BX5A 2I0YA 2C3JA 3P23A 5HX8A 3MV5A 4RT7A 4JOAA 2BZHB 1T45A 3HUBA 5HCYA 4EK8A 4CG9A 2VTMA 4AE9A 5JQ8A 1OVEA 1SVHA 5CSXA 5DWRA 5HNIX 4HZSA 4QYGA 4NFNA 3ATTA 4DE4A 4I93A 2OXXA 4Z9LA 2PU8A 2ZM3A 4YSMA 5CSHA 2VX1A 4IZ5A 3BHTA 2X4FA 3IQ7A 3NW5A 4LYNA 4NIFA 4MX9A 3AXWA 3RZFA 4AW1A 3MB7A 4PMMA 1PKGA 3QA8A 5IPJA 5AP7A 1Q62A 3R1QA 2WTIA 3UQGA 4BICA 2VTOA 1Z57A 4BY9E 4F6WA 1HCLA 2YLFA 2W5BA 4C7TA 4ZY4A 2V22A 1V0BA 2UZNA 3W2CA 1NA7A 4F7SA 4XYFA 4DTAA 2GPHA 2BRGA 3A8XA 1PXLA 3D9VA 3ETAA 4LOQA 4YJNA 3RHKA 4CLIA 1QCFA 3PVBA 4G6NA 3VIDA 3C4CA 1M2RA 4EOSA 5CF6A 5IG1A 3KK9A 2EWAA 3BQCA 3BYSA 4J96A 4HNFA 4CQGA 1JPAA 3VS6A 4QTBA 4EH3A 3MN3A 1RE8A 2P3GX 3O51A 4YJOA 3WBLA 2H9VA 2W7XA 1M17A 5TR6A 2JC6A 5C4LA 4YC8A 1YWRA 5LCKA 4IH8A 3MI9A 2ITVA 4O21A 2WMRA 3I5ZA 3OWLA 4TKSA 4N0SA 2ZVAA 4YLKA 1A48A 3HA6A 4OR5A 1O6LA 1JKTA 3TNPC 4AFJA 4YZCA 5M4IA 3MFSA 4OTRA 4QMOA 2GNHA 2YISA 3VUTA 1A9UA 3UDBA 4ACCA 4ANQA 4BDCA 1VYZA 4AE6A 5BNJA 2BRMA 2A1AB 3PRIA 1Q61A 1QPEA 4BCFA 5EG3A 2O65A 4EQCA 3PG1A 3ORXA 5CEQA 3MESA 2WQEA 2YERA 5EHLA 2Y6OA 3UZTA 2JDVA 2C0TA 2W1CA 4NTSA 4QYHA 3WF9A 4P4CA 4TWOA 4NZWB 1PMVA 4NCTA 4UWCA 3NDMA 5CVHA 3QD0A 4YURA 4RSSA 4MWHA 2YM5A 3BHYA 4GK3A 4PDOA 4WG3A 5FEEA 2IW8A 2XYNA 4FT5A 4YPSA 4M15A 4H58A 5I9WA 3E88A 4PP7A 3P79A 2BIKB 4MF1A 4DLIA 5KE0A 3LVPA 1UNGA 2VWBA 2C69A 2HW6A 4PRJA 4UWYA 4AZVA 3E93A 5AR4A 4BYIA 1YOJA 5FDPA 4FICA 4FL2A 2R3LA 4ZJVA 3E92A 2JGZA 4ITHA 4CT1A 5C4KA 2VO0A 4N4SA 4E4NA 4R5YA 1FVTA 4AQCA 4FEXA 1FGKA 4BGGA 2I1MA 1KWPA 4MEDA 4XRLA 4XLVA 5M57A 1G8SA 4ZMFA 2ZB0A 4WNPA 2OJJA 5JSMA 2J2IB 5DRDA 4G31A 4CFXA 2WMQA 4OW8A 3LFCA 4M84A 2BTSA 4PY1A 2VWXA 4R5SA 4C4GA 4E4MA 5BVOA 4DH1A 3RTPA 4QMYA 2GNFA 3R8UA 4ACDA 3R7GA 5HICA 3F3VA 2FO0A 2X6EA 4J7BA 4EHGA 3VJNA 4UYAA 4D5KA 3SG9A 4JAIA 3ZEWA 4IX6A 5HCXA 3LQ3A 3ZFYA 3KCFA 3BGPA 3M11A 3VJOA 4PX6A 4ANOA 4MD7E 5LMKC 2H34A 3F3WA 3GVUA 2XNNA 4XBRA 3MS9A 5BX0A 3GFWA 3IW8A 1XR1A 1EH4A 4PTCA 2QO2A 4BGHA 4BYJA 4ZZNA 4UMTA 4ZZOA 4E8AA 4FV1A 4EHVA 2NRYA 3BBTB 4R7HA 1OECA 5G6VA 1ZY5A 4U6RA 4CKIA 2PZIA 3G2FA 3P0MA 4ZLOA 2W4KA 3OY3A 5DLSA 4QQCA 4CT2A 3P7AA 3EQPA 4RLKA 4YGAA 2OU7A 3UP7A 4DFNA 2J0KA 5CS6A 4G34A 4C38A 4D0WA 4QQTA 4MF0A 3FI8A 2F7XE 5A9UA 4XCUA 3MH2A 1GIIA 3NAYA 3SKCA 4USEA 4FKSA 1ZZ2A 5BVNA 2Y4PA 2CJMA 3KXXA 4AN3A 4P90A 1H01A 2J7TA 2ZV8A 3E7OA 2WMSA 4WIHA 2WFYA 5E91A 5A4CA 4PMSA 2CDZA 5H8EA 4F1MA 5AUUA 3FE3A 5JZNA 5AP1A 4X3FB 2B1PA 5TOZA 4E73A 5L8LA 4MKCA 4RGJA 5EFQA 2HIWA 4BDEA 2QLUA 4O2ZA 1ZOHA 3A60A 1LUFA 4RWIA 2R3GA 4PMPA 5HORA 4QP1A 1PRYA 2HCKA 2VX0A 2C5VA 5KHWA 5AP6A 3WILA 2IVUA 2WMBA 3C13A 5I9ZA 4XUFA 1IAJA 4G5PA 3OTUA 2XRWA 5GNKA 4R6VA 5E8XA 5ANJA 4UEUA 4XLIA 5M06A 3W2OA 4EH2A 1J1BA 4XG6A 3U4UA 2W1EA 2C6IA 4IWQA 2BRBA 1JSVA 5CASA 1I09A 2QOKA 4J8MA 3LMIA 2DWBA 4ZLYA 4QMUA 3FMHA 5K0XA 5ANKA 4MD9E 3NNXA 4IQ6A 2GHMA 2XEZA 3R22A 5KMOA 3OROA 3KCKA 5DR9A 3ZO3A 4YZNA 2VTLA 3SC1A 2G2HA 2ETKA 2XP2A 3KN5A 3RK5A 5ETCA 2UW6A 3QZGA 3SXRA 3LCDA 5JRSA 4EOJA 2WMTA 4RRVA 4WRSA 3GFEA 5BVWA 2O63A 4B6LA 5AP2A 4DBNA 3QRTA 3DBFA 4YJTA 4AS0A 2ZMDA 4BWPA 2Z02A 4HYUA 4OTGA 5HE1A 4E4LA 4I5PA 4RIYA 4CMTA 4EOLA 4IAZA 3PWDA 3VAPA 4Q2AA 3L9MA 3PFQA 5D9HA 5CY3A 1GZ8A 2J90A 3ANRA 3JS2A 3CS9A 4XV3A 2WTWA 4KINA 5CVFA 1AGWA 3FYKX 2RGPA 3LOKA 2VTJA 3QA0A 3RAHA 1Y8GA 3QQGA 4XG8A 4E4XA 4ANSA 1XQZA 5ITAA 2VD5A 4KIQA 2QI8A 3PA3A 3KEXA 1LPUA 3O8TA 4DG2E 4OTWA 5E9EA 3L8VA 3UG1A 4O0UA 3AMYA 4J53A 3RZBA 3WF7A 4CFFA 3QALE 2GQRA 2PUIA 2PVMA 4DN5A 4HJOA 1PF8A 3LLAA 4ITIA 4FT3A 1BUHA 1XH5A 2VO3A 4AGUA 4IDVA 3EJ1A 4EUTA 3NGAA 5EM6A 3KU2A 4MBIA 3A7HA 1H1PA 4L43A 4N6ZA 4IB3A 4UXLA 5DIAA 4F09A 4WG4A 3DJ7A 2HZNA 4YHJA 5IISA 5LOHA 3WZEA 4AZSA 3MIAA 4BIDA 3ZUVA 1Q97A 3BELA 3AT2A 2RFSA 3IDCA 1SVGA 2LGCA 4EOKA 1PKDA 3O17A 4OTHA 2XKEA 3AD5A 4HYHA 1M7NA 3O8PA 5AAGA 2HY81 3SQQA 4I0RA 4UXQA 3ACJA 4F9BA 3VS1A 5JK3A 3C4XA 4UX9A 4RIWB 2A4LA 5BPYA 4JIAA 4X0MA 4ZJIA 3GU7A 3EKKA 2Z7QA 3D4QA 5HG7A 5IUGA 2RFNA 4EK3A 3TNWA 5IZFA 1OL5A 1JQHA 3BWJA 4BGQA 4C2VA 3FMEA 2GNGA 4D1SA 2X8IA 3ZOSA 1YRPA 5CXHA 1MQBA 2C0IA 3LQ8A 5I4NA 4O0TA 3P7CA 3TN8A 4IBMA 3PJ2A 2AUHA 4TYIA 3MFRA 5FRIA 3AC3A 3FKOA 3LFSA 5DYJA 2A19B 3LJ0A 3TXOA 2YCQA 3FMMA 5CAUA 2W4OA 4P5QA 4BN1A 1STCE 2AC5A 3G5DA 5IU2A 4GH2A 3RINA 3PVGA 4FF8A 4FSQA 4ZSJA 2JFMA 5JH6A 4C59A 3Q9ZA 4O91A 3ALOA 3FZPA 4OTIA 4CKRA 5HO8A 3DZQA 5HLPA 4ALUA 3IW6A 3KXGA 2O2UA 3BKBA 1MRUA 3KRWA 2IVSA 3FHIA 4M66A 5DR6A 5KKRB 2XJ2A 3KA0A 4D9UA 1YHSA 3RP9A 5DPVA 2UZEA 1G5SA 3JYAA 3PVWA 5AAEA 4U44A 1QL6A 4DFZE 2FA2A 3K5UA 2XIXA 3BYMA 4TNBA 4L3PA 3LE6A 2JDRA 2VTQA 3FZSA 3GBZA 4JX7A 3VUHA 4HCTA 1XBBA 2IJMA 2WTJA 3Q4CA 3OT8A 3F88A 4M67A 2JDSA 4O7LA 5ANEA 3FLSA 3VW8A 3B8QA 3RPSA 4R1YA 4RWLA 3Q4UA 1M2PA 2E9NA 2XK9A 4IX3A 4KBCA 4DLJA 4RC3A 2Z2WA 4DFUA 4Y73A 2YM4A 3R8ZA 2C3IB 4S30A 3TACA 3UMXA 2I6LA 4EH4A 2GS7A 4F70A 2OH4A 3OWKA 4TW9A 2RF9A 1K2PA 4TL0A 2J51A 3EQCA 3FHRA 3R00A 1SNXA 2RFEA 3GEQA 4CNHA 2R9SA 1U54A 5AR7A 4U97A 2PZYA 3D7ZA 2YJSA 3M1SA 3ROYA 2PHKA 3O7LB 2BVAA 3C0IA 4YJPA 3V6SA 4O7SA 3EQFA 3OC1A 4D1XA 1YDTE 3CPCA 3RAIA 3B2WA 3UNZA 2J0IA 3A8WA 4MNFA 3PA4A 3LPBA 3EYGA 1ZYJA 4ZK5A 2GTMA 5EQPA 1OPKA 3NSZA 4AT5A 3D5UA 5JGDA 5D41A 3KXZA 3W8LA 1PXNA 4UYNA 4L42A 4WBOA 3UZRA 4BI2A 3C1XA 4K9YA 2YWVA 5JT2A 4ANNA 2UZWE 5B0XA 3RALA 3KULA 5E8UA 1APME 3PP0A 3DFCB 4I6QA 4MQ1A 1YI6A 3ET7A 3TUCA 1BL7A 4DTBA 4F9WA 4O0YA 2WU6A 2Y4IC 4EHEA 3PIXA 5BUIA 5IEYA 1H07A 3KVWA 5FM2A 2H8HA 4H05A 3PE1A 2CHLA 2FSLX 4NJ3A 3O50A 5FP5A 5G1XA 4CRLA 3BI6A 3Q6UA 4QOXA 3HV3A 4V0GB 4YP8A 4QMNA 4UWBA 1B6CB 4JBVA 1OB3A 4F6UA 1XKKA 2C5OA 2DS1A 2HK5A 1JOWB 3ULIA 2QOBA 3G9LX 3TJDA 4EH8A 5K3YA 4PNKA 5AV3A 2PK9A 5TF9A 3F6XA 3PSCA 3UYSA 3RKBA 1J7IA 3QGWA 1SMHA 5FTGA 3PXKA 3AMAA 1H26A 3OP5A 3N4TA 4C37A 4CKJA 4XV2A 1X8BA 3CY2A 1OL6A 3NMUF 5BVEA 4R78A 3KF4A 1WBOA 2BTRA 4BWXA 5ETFA 1Q4LA 4FC0A 4ALWA 5C1QB 3UQFA 3E62A 3A7GA 5A14A 4CFNA 4YJVA 4BCGA 2CMWA 3PE2A 3TCPA 3RWPA 4C4HA 2PTKA 5AIRA 3AT3A 3RNIA 4DITA 4CD0A 3DDPA 3E7VA 4IE9A 4TYEA 3TZ9A 4FODA 2WD1A 3C9WA 2ACXA 4BCOA 2WU7A 2YCFA 3JY9A 3ZO1A 4Z16A 4GL9A 4C61A 5IQHA 1W8CA 4YTHA 1Y57A 2UZUE 3E3BX 4BBMA 2BZJA 3TDVA 2JAMA 4M68A 4EZ5A 3UIUA 4ZSGA 2E2BA 2PVKA 2X81A 3SA0A 1R3CA 3MVLA 3O96A 3UOKA 1YDRE 2WGJA 2RKUA 3R8LA 3TKUA 4GW8A 4GFOA 5E8VA 3F3UA 1OKVA 3W10A 3W2QA 4F9CA 4F1TA 4HOKA 3QAME 4Q9SA 4U79A 3GNIB 4RG0A 4E5AX 4KD1A 1RQQA 4MNEA 4JXFA 3SW7A 1ZYDA 3OD6X 4I41A 4EYMA 1XBAA 4B7TA 3WZUA 3LAUA 3TTJA 4G1WA 2WIHA 4ITJA 4FKWA 4H1JA 3UNJA 4QYEA 3NEWA 3RJCA 3ZXZA 3QLGA 3SXFA 4LOOA 3CTJA 3EB0A 3R9DA 3UNKA 4J1RA 4USFA 4RZVA 5LWNA 3RGFA 5JKGA 4EH6A 5FBNC 4ASXA 2QODA 3ZCLA 4IXPA 4FTMA 4DEBA 4CFUA 2XM8A 5EW9A 2UW8A 2NP8A 2ZMCA 2X7FA 5CZHA 1UKIA 2O3PA 4FTKA 4H36A 4IM2A 4DH8A 1KUTA 1WBSA 1YWVA 1PXPA 3FQHA 3NUNA 3NX8A 1P14A 1G8AA 4OGRA 5EYKA 4FKUA 2QOLA 3EQDA 3MWUA 3PG3A 4LV8A 4UALA 5CQWA 5H8GA 5M53A 3ORLA 2C6DA 2X1NA 4E6AA 5JFSA 3CTHA 4B8LA 3B8RA 5K4IA 4R77A 3P1AA 4FVRA 4J98A 2R3OA 4V05A 3LZBA 1YOLA 3DB8A 1R1WA 5BMMA 4PWNA 4QMXA 4DFBA 5M08A 2W9ZB 3IW7A 4D2VA 2J5FA 3GCQA 2BKZA 4RLLA 5IF1A 3RCDA 5EYCA 4BDFA 4NW6A 3H9RA 1Y91A 4CSVA 5IH5A 4L52A 3MVHA 4XEYA 1NVSA 4YC6A 2QHMA 5EKOA 5CYIA 4C4JA 2WTDA 3ZEPA 4I0TA 4UB7A 4A9TA 4ARKA 2REIA 2ZYBA 4NSTA 5FEQA 2UZTA 5JZJA 2WQMA 5C03A 5D7AA 4JG6A 5CT0A 2ITNA 2X4ZA 5F95A 3AG9A 4H3PA 3R9NA 2OIQA 2OGVA 5HGIA 4D5HA 5AUZA 3GU6A 2X8EA 3NNVA 2ITXA 4UZDA 3RAWA 2ZDTA 3MTLA 4RPVA 2W1ZA 4IADA 1OIYA 3R8VA 2GQGA 2C6KA 4FZFB 4QMLA 3AC4A 4R8QA 4RQVA 3RCJA 3VUIA 5K9IA 2GFCA 3EHAA 2PVRA 1NVQA 3HRFA 5DFPA 5AM7A 5K0KA 3A99A 4BVUA 3EFWA 4D2PA 1BX6A 4PP9A 2PUPA 3A7JA 5JFVA 1ZMUA 3Q52A 1O6KA 5AX9A 4FZ7A 5KHXA 4LM5A 2IWIA 1SNUA 1ZY4A 3SRVA 3DNDA 4NM0A 4ZIMA 4Z55A 4H3BA 5A6OA 2R3FA 4G6OA 2Y0AA 3OCBA 4RQKA 2CGXA 4W4VA 4AACA 4GFMA 1WAKA 1FBNA 5AUTA 4WUNA 4JR3A 4QYYA 3S1HA 2HW7A 3POZA 3QWJA 4YJSA 4FGRA 4AFEA 4W8DA 5AP4A 1H4LA 2HXLA 3TZ7A 3QQJA 3DPKA 3FKLA 5HIEA 2XIRA 3PY1A 4G17A 4TZRA 3ZLSA 4NL0A 2Z8CA 4RFYA 1ZYCA 2XBAA 3QRJA 4FTAA 3FC1X 2RG6A 3LXLA 4FT7A 1CKPA 4PMTA 4C62A 4GKIA 2IO6A 4QMTA 4FE2A 4F99A 3PUPA 3PWYA 3B2TA 4BKYA 3FSKA 4X3FA 3MGYA 5BVDA 2VN9A 3DXNA 4ENXA 2XM9A 4DFXE 1KE9A 3UMWA 3QC9A 4HPUE 4OTPA 1FOTA 1WZYA 3LM5A 2EB3A 3EFKA 5C27A 5CTPA 4F7NA 3LKMA 1JNKA 3ORZA 3CD3A 1R0EA 5AV0A 4FR4A 4IAIA 4MYGA 3HMPA 2OJGA 3CD8A 5CNNA 2VTAA 3FI2A 3PSDA 4I6BA 1NXKA 3D83A 3I60A 3DBDA 4IX4A 4QD6A 3BLHA 4YTFA 3LJ1A 1WBVA 1UNLA 4IC7A 4R3RA 4CFMA 2X7OA 2RL5A 3R04A 4GG5A 3TKIA 2Z60A 3I4BA 3GU5A 5A54A 4BHZA 3BPRA 4M13A 3ZSIA 1ZAOA 2IZTA 2IPXA 2OF4A 1IRKA 3EL7A 3V51A 3FQSA 2C5YA 1H28A 4TNDA 4CCUA 4IVAA 1P2AA 2OZAB 2WXVA 3NAXA 3HVCA 4GMYA 3HYHA 4PUZA 3HRCA 4IWPA 5HNGA 2BKKA 3HDNA 2WTKC 3V8TA 4BDKA 4JI9A 2PE2A 4GK4A 3R2YA 3V01A 3R9OA 3VULA 3BHHA 3KMMA 3CKXA 2BFXA 4O0RA 5TE0A 1LEWA 1ERKA 4FSTA 2C6OA 1WVXA 4JIKA 4LUDA 2ZM1A 4N57A 2BILB 3D94A 4G3CA 3W16A 5BYLA 5B2MA 3EQIA 3FI3A 1URCA 2G1TA 2O5KA 4L00A 1Q3DA 2UVZA 2P33A 3HNGA 3KL8A 3LHJA 2R0UA 1XWSA 3MY0A 4GEOA 3EL8A 2W1IA 5DI1A 2SRCA 4LI5A 4DEHA 5HX6A 2XBJA 3AD4A 2O8YA 4AT3A 4GUEA 1UA2A 1DAYA 5IH6A 5GZ8A 4LL5A 5IQDA 2W99B 4J97A 4QP2A 3TM0A 3AMBA 2YLEA 3LIJA 3O7LD 1OL7A 4UZHA 5TKDA 3EFJA 4NK9A 4O86A 3AQVA 3QKLA 3V6RA 3Q2MA 4DHFA 5AFVA 3EN9A 4QYFA 3R9HA 2YCRA 2VGOA 5AMNA 1YXTA 1GZNA 1NVRA 3FLNC 4RIXA 5T6KA 3ZM4A 1ZMVA 4OT5A 4IWOA 4PDSA 4D2WA 3UE4A 1OZ1A 2BRHA 4FTLA 4DGGA 5LMBA 4O2PA 4FKOA 3ZO4A 1FQ1B 2XUUA 3IOKA 4IAFA 2PMIA 1KSWA 3UIXA 4CCBA 4EORA 4F65A 3DJ6A 3D0EA 3R71A 3ZDUA 1XH6A 3BEAA 4RIWA 5M55A 5HO7A 2IZUA 1XO2B 4XHKB 5IA2A 5CF5A 1IASA 3DLZA 2BAJA 3W2PA 3CQWA 2C5XA 4RMZA 5TO8A 3MJ1A 5FXQA 4AUAA 2GTNA 1BI8A 3C51A 2YN8A 4DBXA 4IJPA 4KBKA 4CYIA 4J71A 4QP7A 3VF9A 2HYYA 4IM0A 5C8MA 3V8SA 3PVUA 4WSYA 3T3VA 5M4FA 3F69A 2X8DA 3NUPA 3DKFA 4G6LA 3WZDA 1GOLA 5AA9A 1ZZLA 3PP1A 3WYXA 2ZV7A 4J99A 3UOLA 3P78A 3FJQE 1TKIA 1WBWA 4FA2A 3CEKA 4K18A 4XV1A 3OUKA 4S34A 4CLJA 3CP9A 1YOMA 1PXJA 4W4XA 4AZTA 5AR2A 2UVYA 5AP5A 4RVLA 3BYVA 5GJFA 4CYJA 3IGOA 5DN3A 3ORIA 4WT6A 4FV0A 4AW5A 4RC4A 2XNPA 5ANDA 3VS5A 3N4VA 2W0JA 4ZAUA 4QP8A 4YZDA 2XZSA 4F0FA 1OL2A 3PLAE 2FGIA 4ZTRA 5CZIA 4HVDA 3GT8A 3UVRA 3JY0A 1OIQA 4ZSLA 3O2MA 5A3XA 2OJ9A 4FKPA 3KRJA 4P2KA 4Y95A 1YXXA 3I6WA 4RX7A 3OXIA 3SHEA 2R4BA 3RAKA 4CTBA 4Y46A 4QTDA 4EOPA 4APPA 2V7AA 4EZ7A 5HVKA 1REJA 2B0QA 3GU4A 4GVAA 3ID6C 4YUQA 3JXWA 2QD9A 1P4FA 3QF9A 1T46A 4QP3A 3BWFA 3TEIA 4L6QA 3NVMB 4FBXA 2GS6A 3R1SA 5DRBA 3K2LA 4GYIA 5HE2A 2GS2A 3NR9A 4QPAA 4Y5HA 1XH8A 3T9TA 4F7JA 5M51A 4JJRA 4R3PA 5E8WA 1KE6A 3KFAA 3C4WA 1OL1A 4LGDA 3GQLA 5I5ZA 2IVTA 4FYNA 3QHWA 3BCEA 3UC3A 4FTTA 5DGZA 3CQEA 5HG9A 4M69B 1QPJA 2F2UA 2OLCA 5FUTA 3R02A 4FSWA 5GINE 4JRNA 3U9CA 4BDIA 2Y4IB 3FMNA 2ZOQA 3DK7A 3QUEA 4QQ5A 3IK3A 3HP5A 3ZUUA 1YI4A 1CMKE 2YM8A 2ZV9A 3ERKA 1H8FA 2QOOA 2X9EA 3F9NA 4IHPA 4QMWA 3SXSA 5T68A 3QTSA 2C6MA 2QO7A 3D2IA 3OEFX 3G33A 3WYYA 3LXPA 5HTIA 3SLSA 4QNAA 4NWMA 2Z7SA 2C3LA 5A4LA 4RC2A
chains in the Genus database with same CATH superfamily
5L6PA 4EH5A 5KNJA 4YBJA 3BQRA 3GXLA 4XV9A 4V04A 3GCUA 1IG1A 2QKWB 2X7GA 5E8YA 3VO3A 5J7BA 4OAVB 1YXVA 1WBTA 3HA8A 3QTQA 4XBUA 1RDQE 1JWHA 2OKRA 2DQ7X 3KRRA 5AA8A 2CCIA 3Q04A 5B2KA 2WKMA 3LXKA 4AG8A 3UYTA 3TV4A 3OG7A 5M09A 3LM0A 1IA8A 3NUYA 4DH7A 4ZLZA 4IAYA 4FKQA 1UWJA 3LLTA 4A4LA 2XJ0A 3I6UA 3QHRA 3BLQA 2QC6A 4G3EA 4V0GA 5J8IA 5LVLA 3UIMA 1NY3A 4U0IA 4B99A 3V5WA 3I1AA 2ITQA 2XNGA 4Q5HA 2XARA 4F63A 2W4JA 3OW4A 4EK4A 1PXOA 5LVPA 4I22A 3JR1A 2WZJA 3G6HA 2HZIA 5FXRA 3G90X 2W96B 3FMDA 3OFMA 5FWKK 3QQUA 4C36A 1OKWA 2WQNA 3HX4A 3UO4A 2QOFA 3COMA 3QCXA 4X2JA 5IQEA 1P4OA 4MXAA 4FEWA 4DYMA 3PPZA 3UGCA 3BHVA 4XP0A 3KXMA 4KKHA 3HAVA 2PUNA 1FPUA 1DM2A 3DOGA 4RVKA 5DT4A 3S2PA 4PDYA 2PULA 2KTYA 2WMVA 3MW1A 2WQOA 3CSVA 3RPRA 3F5UA 3BU3A 3ZLXA 4CQEA 2ITZA 4D28A 4BZNA 4I4EA 2BMCA 3EQHA 3TJCA 4BDHA 3FYJX 4D4RA 4CZUA 2XH5A 2YIQA 3DAJA 3MH0A 3RI1A 5HU3A 3AC2A 4FIJA 3CGFA 4KAOA 3Q96A 4WD5A 4BKZA 2PWLA 3D14A 3QUDA 4NW5A 4ZTQA 2CNQA 3F7ZA 1R78A 1YDSE 3G15A 2W9FB 1W82A 4AA0A 4UMRA 4I94A 1SZMA 4RA4A 1QPDA 4JS8A 1KE5A 4WKQA 3D7TB 4JBQA 2B7AA 1PMEA 3MDYA 4C57A 4RX5A 3TKHA 4MVFA 3EN7A 3IG7A 2WO6A 4QO9A 4YNEA 3FI4A 5HBJA 4TWPA 3OTVA 3Q9XA 3UZPA 2J5EA 2YDIA 3V5PA 3O8UA 3BL9A 4ZJJA 3BIZA 1W83A 2FSOX 2ERKA 4TWCA 4FV5A 4AN2A 3EZVA 4S32A 2YM7A 3BE2A 5DBXA 4M14A 4FKIA 4ZEGA 2B9HA 3T3UA 3UTOA 4AWIA 5HLNA 2C1BA 2QO9A 4ZTHA 5HG5A 2A2AA 3DA6A 4NKAA 3A7FA 4FYOA 4R7BA 3OOGA 1JLUE 3U6JA 4ID7A 2F9GA 2GHLA 4NIFB 1R0PA 3Q9WA 5BMSA 1CTPE 4QP6A 4EEVA 4QNYA 1CKIA 5D10A 3UIBA 4ZY5A 3ZONA 3CJFA 2OJFE 1M52A 3EOCA 2VGPA 4AAYA 4FK6A 2XRUA 2VTNA 3QX2A 3ELJA 1M2QA 1UV5A 2UUEA 1CSNA 2XNBA 5AJQA 2WEVA 5AR5A 4EI4A 4MBJA 3RHXA 3R0TA 2V55A 2C5NA 4KABA 3ITZA 4FNXA 4G2FA 3U6HA 1IAHA 4FIIA 5KMKA 2NPQA 2OK1A 4BI1A 3ZBXA 2P2IA 3OCGA 5FQDC 1JAMA 4V01A 2PMLX 2O0UA 4GT5A 3OBGA 3ENHA 3W32A 1FMOE 3E5AA 2XK6A 3BZ3A 3IDBA 4AW0A 5CF8A 1K3AA 1LEZA 3D2KA 4L68A 2JDOA 2VTPA 3PY0A 4ZS0A 2YIXA 3ORMA 3QZFA 3R01A 2BHHA 3SV0A 4MBLA 4CG8A 2F57A 3OVVA 3SOAA 2QU6A 3MSSA 4ANMA 1U5RA 4R1VA 3U8WA 3EYHA 4UY9A 3QRUA 4JR7A 3OW3A 1G8JA 2J50A 4S33A 3DXPA 4CRSA 2ONLA 5CENA 4TYHB 4J95A 2B9JA 2XIYA 3C50A 4A9UA 4O7TA 2XS0A 1WVWA 5IA0A 3DKGA 2GQSA 3A61A 3EN5A 3Q60A 5L2QA 3ZHPC 2BAKA 1PYXA 2X0GA 4WHZA 3BRBA 4PNIA 4IX5A 1F0QA 4FV8A 2WHBA 4KKEA 4IANA 2HWOA 4QMZA 5I3RA 3RPVA 4YC3A 1GIHA 3UVQA 5J7HA 3KMUA 3ZM9A 3HKOA 1PY5A 1ST4A 1OMWA 2OO8X 4MWIA 1PXIA 3CCNA 1J7LA 3WE8A 4U45A 4F7LA 3E63A 4JQ8A 3QQKA 3EIDA 4OTDA 2GCDA 4DT8A 4O6EA 4AZEA 3DBEA 3MJ2A 2PZPA 5E8SA 3QQLA 3V04A 4E5WA 4BTKA 3LFNA 2CNVA 4AOIA 4YJUA 3JPVA 4O81A 4F0GA 4JVGA 5F20A 4EYJA 3TNIA 1Q8TA 2IVVA 2R3KA 4NM3A 4YNOA 4WNMA 5IKWA 4EBVA 4O7NA 3BE9A 3K3IA 3VUDA 5IA3A 3CPBA 3H3CA 4RWKA 3UC4A 4ASEA 4CTCA 4AP7A 4WBBB 4X2FA 2R3HA 2E9PA 2WTCA 3BBWA 4IACA 4D58A 4FKVA 4GYGA 4O83A 2A0CX 4F4PA 4CMOA 3NS9A 1ZOGA 5FBOA 3Q2JA 2XAOA 1PMNA 5EHOA 2YAKA 4Z3VA 4XP3A 2IN6A 5EHYA 3HAMA 1SM2A 2WNTA 3DDQA 2VWVA 4FSMA 4Q5EA 2XK3A 4ORKA 1UWHA 3VUKA 5EI8A 4CVAA 5EH0A 2J0LA 2WAJA 4TPTA 3GGFA 2EB2A 4E6QA 3QBNA 2JIVA 4EOQA 5HZNA 5L2IA 3KF7A 5KO1A 1H1QA 4W9XA 4HVSA 4ANBA 1H24A 2B4SB 1YHWA 2OZOA 3HV7A 3U54A 3NVKI 3R7EA 4FSNA 1MRVA 4IZAA 3QKKA 4NU1A 2FYSA 4RVMA 3OXTA 3QGYA 2W05A 3GCSA 5I0BA 3S0OA 4GJ3A 4ONAA 3TDWA 5J95A 3P7BA 3ZSHA 4O6LA 4IVCA 3H0YA 3DGKA 1MUOA 2ZAZA 4C58A 4QTCA 4OTQA 4BTMA 3P9JA 3ORPA 5JGBA 2UW4A 4L7SA 2UW0A 3F2NA 5D11A 4E5BA 1RJBA 4YO6A 5GHVA 3VS0A 2XVDA 4FSUA 4HZRA 3U9NA 2QU5A 2V5QA 5CF4A 4I6HA 4M0ZA 4OAUC 4S31A 2HENA 4BL1A 2JKQA 3UG2A 4WG5A 2VZ6A 4KIOA 3SDJA 3PJ3A 3VUGA 2UW9A 2PPQA 4FTCA 3U6IA 4FOBA 4ALVA 4DEEA 3MPTA 4FMQA 5J9YA 2VAGA 4DA5A 3GENA 4M8TA 3E64A 4LRKA 4AZFA 3QL8A 5LVMA 2ZM4A 3DKOA 2OFUA 2WMUA 3G0FA 3CTQA 3SOCA 4BWKA 4OUCA 4YHFA 5AAFA 3NUUA 2YHVA 4FKJA 3N4UA 1YQJA 4FV3A 4DH5A 1ZYSA 4AXEA 3UPZA 2OF2A 3DJ5A 3ALNA 3PJ8A 5I9UA 3ORTA 3UOHA 3P4KA 3RBWA 2JLDA 5EKNA 4ZP5A 4WNKA 4PL4A 2QLQA 4FEVA 2QR8A 5T3QA 4I4FA 2XIKA 2GDOA 2UZBA 4GT4A 5EK7A 3VUMA 1CDKA 4ACGA 5HTBA 5I3OA 4G16A 4EOOA 3L9NA 2B54A 3DTWA 3Q6WA 3QZIA 2P55A 1B39A 2WTVA 3FSFA 3LFBA 1WMKA 3EQRA 4AN9A 2UW3A 1CKJA 4KRCA 4A4XA 4ZTMA 5CWZA 2XNMA 1W84A 4RX8A 2HELA 3VHEA 4A06A 2QOIA 5I9XA 3QTWA 3QQHA 2R3MA 3CKWA 4OLIA 3R7YA 4F6SA 4RIYB 4O96A 2FH9A 4I5CA 3RK7A 2ITPA 2EU9A 4L53A 4FNZA 4DINA 4W4WA 4ENYA 4GK2A 2WOTA 2PVJA 3OWJA 4FEUA 1JKLA 3OCSA 2BZIB 5LARA 5EYDA 2WIPA 2PVHA 3VVHA 3NNWA 4E26A 4KRDA 4EH9A 4II5A 4X3JA 4MCVA 4KIKB 4XRJA 1GZOA 5DEWA 3RVGA 3DFAA 3FUPA 4DEIA 3PXRA 4HCUA 1NT2A 5HD7A 5KX8A 4UN0C 2XK4A 4QP9A 1M7QA 4YZMA 2PSQA 4RFMA 4FSRA 1GJOA 4XJ0A 3D5VA 4JQEA 4XOYA 5JQ5A 1OM1A 5HD4A 1DI9A 5CEOA 2YIYA 1F3MC 2CGUA 2R3PA 2VO6A 4K8AA 5AR3A 4CXAA 3L8XA 1Z9XA 1GIJA 2JKOA 3BU5A 1XBCA 2ETMA 3CR0A 4U3YA 4XS2A 5D1JA 4YU2A 5CANA 1OITA 4I6FA 4RIOA 4HCVA 1OGUA 4PPBA 3HMMA 5EQEA 3GCPA 1QMZA 4OBPA 4NUSA 5FTQA 3NUXA 4F9AA 5JFXA 1WBPA 4Z7HA 4QEBA 1FMKA 3GQIA 5E4HA 5CXZA 3FXXA 3I79A 5AR8A 3C4EA 4ZSAA 5DMZA 2HZ4A 3ZRLA 3UO6A 1PJKA 4I1ZA 3MA3A 3EN6A 4LQMA 5CVGA 5A4QA 1OKZA 2VV9A 3ZSGA 4MXOA 1XMMA 3NYOA 4M97A 3VS4A 2CN8A 3AKLA 2V7OA 4R3CA 3VHKA 2PZ5A 1PHKA 2I0HA 2QNJA 3NCZA 3Q3BA 5HIDA 2WEIA 4OBQA 5JGAA 5HESA 4FUYA 1VZOA 3CBLA 2BRNA 4AOTA 3QX4A 4I20A 5DE2A 3ZFXA 4HVHA 4RA5A 4M69A 4A4OA 3ORNA 3R8PA 5EW3A 4G3DA 5AV4A 5ICPA 4YLJA 1TQIA 4IAAA 5EI2A 5I9VA 4QDEA 4ZS4A 4UV0A 3V5QA 4QQJA 3RWQA 3ZTXA 1NW1A 5E1EA 3ZH8A 3AD6A 1GY3A 1XJDA 3ODYX 5E1SA 4EUUA 2XNEA 2FB8A 5H9BA 3KB7A 3MY5A 3LFQA 2IW9A 2XANA 2ZDUA 3DBCA 4JDJA 4IZ7A 2BROA 2CGWA 3CC6A 3PLSA 5C8KA 5JN2A 2UZVA 3DCVA 4FIHA 4C3FA 2BR1A 3QCSA 4LRMA 3C5IA 4WNOA 4F64A 5K5XA 3M2WA 2CN5A 3OMVA 4WA9A 3FXZA 4FSYA 1OIUA 1Y6AA 5HCZA 3DXQA 1TVOA 4EJ7A 4IM3A 4I6LA 4CZTA 1LP4A 1W0XC 3TL8A 4FX3A 4YSJA 5AADA 1KE8A 4JT3A 2W17A 4KNBA 1V1KA 2JFLA 2WELA 5HIBA 4U7ZA 3FPQA 3UDZA 3W0RA 2YEXA 2OH0E 2XNOA 5AM6A 4PPCA 2JBOA 3EWHA 3R6XA 2B9FA 3GI3A 4S2ZA 4BFMA 2JAVA 5GZAA 2B9IA 2R3QA 4JBOA 4MH7A 5HBHA 5IEXA 3VBWA 2NNWB 3HUCA 4KBAA 1K9AA 2VTTA 4BC6A 3BLRA 4NCTC 4CGAA 3QTZA 2JKMA 3ZU7A 4PPAA 5AP3A 5J5TA 4MAOA 1W7HA 2YWPA 4U42A 4CFWA 3S95A 1PXKA 3DB6A 3JVRA 5H3QA 4BTFA 4O7WA 4FK3A 3PXQA 2Q83A 4XMOA 4FV2A 4O7ZA 2VWYA 3AOXA 4TWNA 2YJRA 4DEDA 4PL3A 2YITA 5GJDA 4PTGA 4F0IA 3EQBA 3W2SA 5FD2A 3K54A 3VS7A 4IB5A 3NNUA 1BMKA 3OHTA 2IZSA 4DGNA 4HW7A 1BKXA 4KB8A 4BB4A 4D4SA 2GNJA 2IW6A 4IIRA 4QRCA 5KKRC 5J1VA 4FV6A 4BIBA 3CQUA 2R3RA 4K2RA 3RK9A 3PDTA 1SVEA 3L9LA 3QC4A 4JDKA 3EZRA 4L44A 4BCJA 4D2RA 5L6WL 3O23A 4BCPA 3R9RA 2R3NA 4USDA 3Q9YA 5IUIA 3FEGA 3RNYA 3FZTA 4BZOA 3Q4TA 2ZB1A 1SYKA 4P5ZA 5BUJA 1L8TA 5HEZA 1L3RE 2F2CB 2ETRA 4X2KA 4ZZMA 5EDRA 5HBEA 4M12A 3MVMA 2EUFB 4FG9A 3JVSA 4GUBA 5CEKA 4WO5A 3QQFA 4IFGA 1ZARA 1ZLTA 3A7IA 3BLAA 3DKCA 5C8NA 3DTCA 3MFTA 4RBLA 3H9FA 4O1PA 4PL5A 4YTCA 1ND4A 4HGLA 5CT7A 4DF3A 3D15A 4FG7A 5KCVA 1Q5KA 4O27B 5GJGA 3TUDA 3D7TA 3A62A 3DU8A 4JMQA 4X6QC 3SG8A 3DAEA 2QONA 5EOLA 4BJJB 1REKA 2OIBA 5KMLA 3KC3A 4O38A 3C5UA 5CAQA 4QMPA 2W5AA 4F78A 5HOAA 5BVFA 4CV9A 3GB2A 1O9UA 4AX8A 4O4DA 3SX9A 3KKVA 3FZOA 3TG1A 4F1OA 4O84A 1BLXA 4K1BA 3NWWA 5AUWA 3LCTA 3PA5A 2J9MA 2QOQA 2BDJA 3LJ2A 5ANOA 2BCJA 2YFXA 4O0XA 4C35A 4D9TA 3MH1A 3PRFA 3PSBA 4EHZA 4FVPA 1AD5A 1MP8A 4EQUA 3KIOC 3C4FA 3QZHA 2ITYA 3NYXA 3OT3A 3WZKA 2QR7A 2CKOA 5LCJA 5M4CA 4OTFA 1DI8A 2JITA 3NRMA 2XYUA 4I0SA 5L4QA 3PY3A 5L6OA 5M56A 4GFGA 2PVFA 4AA4A 5IA1A 3C7QA 3ZMMA 1WVYA 3QTXA 4FZ6A 1H1RA 1ZMWA 1V0PA 3MPAA 5HHWA 4IVBA 3PTGA 3OF0A 3P86A 4XG7A 4DG3E 2XALA 1UVRA 2VTIA 5BVKA 2DUVA 5BV3A 4FT9A 4YZ9A 5L2WA 4FZAB 2X9FA 1ZXEA 1PMUA 4MXYA 5DT0A 2PYWA 4FZDB 4BRXA 3F3TA 3EN4A 4FTJA 3BEGA 2XF0A 4L8MA 4AZWA 4DHJA 3NYVA 5EOBA 4YBKA 4FOCA 3NW7A 4XG2A 3EMGA 3MY1A 2OSCA 3CGOA 3KXNA 2ZJWA 4MHAA 4WOVA 4QMVA 5DR2A 2GNIA 3ZRMA 2C1AA 5CU2A 3V8WA 1Q41A 4RJ5A 5IQCA 3KQ7A 4ZXTA 4TY1A 2GU8A 4H39A 2G15A 3G51A 3OS3A 4KS7A 4X2GA 3V3VA 3WZJA 4FTNA 3LQ5A 4MNEB 4Z7GA 2YACA 3LCKA 3HRBA 5CU6A 4AU8A 2VUWA 2UW5A 3CY3A 1GAGA 4QMSA 4IVDA 2CLXA 3FLWA 4FV4A 3Q32A 4W8EA 2QOCA 2XB7A 4M3QA 4TYHA 3PXYA 2H96A 1H1SA 1OIRA 5FG8A 3LCOA 4FV7A 3VRZA 4APCA 1GZKA 2A98A 2B55A 2PVNA 3F61A 4KSPA 1FGIA 4Y5QA 5CEPA 3OXZA 4X2NA 2CKEA 5LWMA 1H00A 2ITUA 2R3IA 5AX3A 5CAOA 4FNWA 3ZFMA 5IQFA 3DS6A 5KMIA 3GC0A 3GOKA 3PXFA 4KSQA 3SAYA 3ROCA 3FKNA 1UU7A 1OUKA 2RG5A 4L45A 4DHZA 1J7UA 2YZLA 4YMJA 4D55A 4DGMA 2XKCA 3VBYA 3VF8A 1M14A 1MQ4A 2ZV2A 3VW6A 1TFFA 1Q24A 2NRUA 4E7WA 3KREA 3DK6A 4YTIA 4YO4A 1TQPA 4JLCA 3R83A 4DHIB 2G2IA 2X0OA 3HLLA 4N70A 3IECA 3BYOA 3FY2A 4GV1A 3BHUA 4I21A 2IG7A 3IONA 4Y72A 5E8ZA 5CU0A 1UU8A 1CM8A 3LFFA 3COHA 4HNIA 2C4GA 3ORKA 4KKGA 5ACKA 5B7VA 4MXCA 5KUPA 4RZWA 4TT7A 5H2UA 4XG3A 4K77A 3KGAA 3E8NA 2YZAA 4KIPA 2VTHA 3Q5IA 2W1GA 3ZZEA 3UBDA 2Y6MA 1WCCA 5DVRA 5EDQA 4C2WA 2EXMA 1YW2A 5AUYA 5HKMA 4EBWA 2J0MB 5FGKA 5FXSA 2Q0NA 5AV1A 2CKPA 4BDAA 2XA4A 3WOWA 3BL7A 1UKHA 4I92A 5D12A 2BHEA 1J91A 3QWKA 4ERWA 2EXEA 1S9JA 2PY3A 4D1ZA 3PXZA 5GIOE 3BV2A 3LW0A 1OUYA 5DEYA 4O7VA 3VBQA 4D2SA 4BR3A 4LFIA 2UZLA 3F5GA 2X2MA 5EQYA 3WF8A 4PTEA 1JKKA 2UVXA 5HQ0A 3PYYA 4IB0A 2F7EE 2J4ZA 5EM5A 1JBPE 3FQEA 5CU4A 4CZYB 3FDNA 1YXUA 5L8KA 3SRVB 1ZWSA 2ESMA 4AGCA 3PPKA 4RJ8A 4BI0A 5HLWA 1DAWA 3P08A 3ATSA 3W2RA 3QU0A 3ODZX 5DH3A 4LG4A 5B2LA 5LVNA 3DAKA 4E93A 5CU3A 4JG7A 3ZRKA 1OGYA 3TV6A 1OPLA 2WQBA 4UBAA 5JFWA 3UJGA 3S00A 1P5EA 3OEZA 2C68A 4O4FA 1OKYA 4Y83A 3MA6A 4U43A 5J5SA 5J9ZA 5M44A 4QTAA 3A4PA 4GCJA 4FL3A 3U51A 2CLQA 1U59A 4JG8A 4LMNA 5BQ0A 5L3AA 4B8MA 3ZC5A 2XMYA 3Q53A 5CI7A 4IMYA 2ONLC 3PPJA 3DV3A 4DC2A 2PUUA 3PZHA 5J9LA 5CX9A 1PYEA 2R2PA 3QCQA 4DT9A 2W1HA 4JDIA 4IZYA 2OW3A 3WE4A 3GOPA 4JL9A 5HVJA 5ANIA 1U46A 2JIIA 3I0OA 3WARA 4J8NA 2BALA 5A4EA 5CAVA 2YAAA 5FP6A 2OICA 3AC1A 3N51A 3F3ZA 4I5HA 4K11A 5IDNA 2X2LA 3EH9A 4O22A 4O7RA 3F5PA 5HNBA 3P5KA 3WIGA 4FG8A 4FVQA 3FAAA 2ERZE 4HVGA 5CALA 3KRXA 3HMNA 3QCYA 2NO3A 3A4OX 4IB1A 4FRFA 2JKKA 2HY0A 4IW0A 3RPOA 2PE1A 2VWUA 3HDMA 5L2TA 4KUJA 2WPAA 3QD2B 3FPMA 4JDHA 3H0ZA 5CSPA 4AOJA 1JKSA 5HO6A 4LV7A 2OFVA 4LRJA 4O0SA 4UMPA 4RVTA 2FSMX 4L67A 5AEPA 1URWA 4ACHA 4GT3A 4A9YA 4W9WA 2QCSA 5JMSA 4YJQA 3UOJA 1XHAA 2GSFA 3QRIA 1OI9A 3C0HA 3N9XA 5K4JA 4MXZA 4DTKA 4ZSEA 4PF4A 2AYPA 3T9IA 4EQMA 3FXWA 1BL6A 4GIHA 4L9IA 1Q8WA 4C4FA 1E1XA 2CCHA 5E8TA 4RJ4A 4YHTA 4EOMA 3U55A 4GU6A 5KMJA 1PXMA 2F7ZE 4E6CA 2VWIA 5ETAA 5LQFA 3R30A 4RJ3A 5EI6A 3DBQA 2LAVA 5KBRA 4AGWA 4BF2A 3I7BA 3IPHA 3O71A 4KIKA 2EXCX 3MVJA 4IDTA 4Y8DA 4XX9A 5CI6A 3R7UA 4EJNA 4N6YA 2RFDA 2A27A 3FLZA 3R1NA 4QP4A 1ZYLA 4ZTNA 3W0MA 5HG8A 3E8DA 4GIIA 2VTRA 1W98A 3KMWA 3QKMA 3EKNA 4EWQA 4EK5A 3TIYA 1IEPA 5BYZA 2ITOA 2C6LA 4U80A 5LVOA 3CJGA 4XH6A 3NZ0A 4K33A 2OXDA 3CE3A 4I5MA 4TRLA 3VBVA 4C0TA 4LDTA 3R73A 1I44A 5LMKA 3PIYA 3VS3A 1XH9A 4O82A 5CSWA 2GHGA 2BDWA 4RIXB 3F7WA 2QKRA 2XKDA 3SW4A 4GS6A 5ETIA 3IO7A 2CSNA 3VBXA 5IMEA 4QMMA 1VEBA 5E92A 2GFSA 5CLPA 5ACBC 5C26A 2Y9QA 3DLSA 1Y6BA 3ZS5A 4MXXA 4FIFA 4EH7A 5HE0A 3S3IA 2WMWA 3HL7A 3VC4A 4NM7A 3POOA 3RMFA 3UQCA 4YR8A 3GC9A 4D0XA 4NTTA 2F49A 3NYNA 5AWMA 3REPA 4EL9A 4FSZA 2WMAA 4L3LA 3MYGA 2AC3A 3FMJA 3QXPA 4AXAA 3DK3A 3G9NA 1ZRZA 2YABA 3HV4A 3R7IA 3QXOA 4D4YA 4ZOGA 5KBQA 3SVVA 1YI3A 3ZO2A 4DG0E 1FINA 4FKGA 5CEMA 2G2FA 4GRBA 4HPTE 1XH7A 4HYIA 4FKRA 4HVIA 4CEGA 1YXSA 2BPMA 2XK7A 5IQGA 3TT0A 2KULA 2RSVA 2X0QA 3Q4ZA 3NLBA 5HI2A 2Y8OA 4TN6A 2WOUA 4DGOA 4U5JA 3PZEA 5JRQA 4TYJA 4F08A 3VQHA 5DA3A 3LXNA 5FLFA 3IW5A 5F94A 3HMOA 2IZRA 3HP2A 4HGEA 4L7FA 1H0VA 3NPCA 1Q99A 2Z7LA 3FZ1A 2VTSA 2B53A 1Q8UA 3ZDIA 5HVYA 1ATPE 3BV3A 3HGKA 3FBVA 2VWWA 4XP2A 2BZKB 4XG4A 2J0JA 3BGQA 5KZ0A 4C33A 4LL0A 4MK0A 2C3KA 1VJYA 4RFZA 3IKAA 3BYUA 5K5NA 2E9VA 5DOSA 4C4IA 4DFLA 5IQAA 4WSQA 5AUVA 5IDPA 5J87A 3EQGA 2P0CA 4FUXA 2VU3A 1H0WA 3HV6A 4FTOA 2OWBA 3H30A 4ANLA 4Q9ZA 3GC8A 3MPMA 3QFVA 4C3PA 4FTIA 2WTKB 4E20A 2HZ0A 4L3JA 3BGZA 4EKKA 4E3CA 5IQIA 4FIEA 4U41A 5EYMA 5EW8A 4DCEA 4FTRA 2PZRA 4GG7A 5IH4A 2XKFA 3QLFA 3ULZA 3FLQA 4BCIA 3HMIA 2OIDA 3H9OA 4CFVA 3GCVA 3GC7A 4IEBA 1VYWA 2QQ7A 4KA3A 4PQNA 5J79A 2PMNX 4EKLA 2FUMA 3U87A 2Q0BA 3AGLA 4YZBA 2OBJA 1JSUA 2C0OA 5E7RA 4AT4A 2XIZA 4L46A 1YVJA 2GMXA 3E87A 3FMKA 3KN6A 3OCTA 3VRYA 4XNEA 3K5VA 4A9RA 4NH1A 2GNLA 5FTOA 2I7QA 1DS5A 4LGGA 5BYYA 2C47A 3DQXA 5EDPA 2XAMA 2R5TA 3COIA 3C4ZA 3L1SA 2OZAA 3R28A 5L2SA 2X6DA 2O64A 2YIWA 2HXQA 3UO5A 4LGHA 4B9DA 2QOHA 1V0OA 5LXMA 2W1FA 3CLYA 4BKJA 4X21A 3R7VA 3M42A 4XOZA 4O1OA 3L8PA 4L01A 4A7CA 2QG5A 4J52A 5IQBA 4BBEA 3VWAA 3WIKA 2YDJA 1A06A 2R64A 4UMQA 1FVRA 3MIYA 3OZ6A 4FNYA 3S4QA 4K0YA 3EFLA 1VR2A 4ZTLA 3W8QA 4MD8E 4DH3A 3GUBA 3KRLA 4YLLA 1Z5MA 2F4JA 2YCSA 3QRKA 4WRGA 5A6NA 3UP2A 3NUAA 4BJJA 4C34A 3JUHA 4E1ZA 1IA9A 3SD0A 5LJJA 3DQWA 4W4YA 4JBPA 4QPMA 3W0NA 3TNQB 5FM3A 2HWPA 3RM6A 3WI6A 4ZMEA 2AQXA 2YDKA 4AF3A 3PJCA 5HU9A 3QTUA 5AUXA 3TMOA 3NUSA 5F9EA 2JEDA 4BDGA 1OPJA 4U9AA 4AQKA 4EZ3A 5M07A 4JRVA 4A07A 3LFEA 4AA5A 2C6EA 4D2TA 5EM7A 3DNEA 5M4UA 3G6GA 2OI4X 5GIPE 4GSBA 4G9CA 5AIKA 4PDPA 3W1FA 4NM5A 2UZDA 3II5A 3ANQA 4JNWA 2FVDA 5CNOA 5IUHA 2CKQA 4DCAA 2XK8A 2BAQA 4O0WA 4G5JA 3LCSA 1RW8A 3IGGA 1UNHA 1G3NA 4M0YA 1YKRA 2PVYA 3R8MA 4AAAA 1YHVA 3TZMA 1WBNA 4X3FC 5F1ZA 5IEVA 4MQ2A 3FMLA 2JIUA 4D4VA 3D5XA 5HTCA 4AXDA 3MBLA 2Y7JA 5CSVA 3QUPA 1KE7A 2YA9A 4I23A 4ZTSA 1J1CA 4KS8A 1OBGA 5L8JA 4G3GA 4ASZA 4TYGA 2V0DA 2VWZA 2W1DA 3I7CA 3FZRA 1KV2A 3R1YA 3DZOA 4U81A 4UMUA 3H10A 3IS5A 5HE3A 4AXCA 3V5JA 5GZ9A 2QURA 3VONA 2JBPA 3UVPA 2PE0A 4O0VA 3F2AA 3QYZA 3W33A 1BYGA 2E9OA 2YM3A 4NJDA 2R0IA 3FC2A 5AP0A 4DEAA 3OY1A 4BBFA 4AW2A 3OBJA 1Q3WA 3L8SA 5D7VA 2C30A 2J6MA 3WF5A 4EC9A 3ZXTA 4NYEA 4FL1A 5C9CA 4DFYA 3KY2A 4JX3A 3HEGA 3I0QA 4AGDA 5JEBA 5DNRA 3W55A 5BUEA 4MUQA 3O0GA 3IOPA 4FKTA 3DT1A 4YJRA 3QYWA 3F5XA 3FWQA 1BI7A 3NCGA 4Y85A 1H08A