1U46A

Crystal structure of the unphosphorylated kinase domain of the tyrosine kinase ack1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
255
Chain Sequence
LTCLIGEKDLRLLEKLGGVVRRGEWDAPSGKTVSVAVKCPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQDDHYVMVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Phosphorylated and Unphosphorylated Kinase Domains of the Cdc42-associated Tyrosine Kinase ACK1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Activated CDC42 kinase 1
total genus 83
structure length 255
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u46A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u46A01
5JFSA 4LQMA 3QL8A 2XVDA 3WF5A 4ACDA 3OY1A 2UVZA 3AC3A 3LFBA 4YP8A 5I4NA 4DFLA 4NW5A 3PSDA 4UMPA 2OLCA 3G33A 3NUYA 3P79A 3QZFA 1SNUA 4OT6A 4J97A 4KA3A 3C0HA 3O8UA 4QP9A 4PMMA 2R64A 3ALNA 3KMMA 3MYGA 5GZAA 3HMMA 4HCVA 2ONLA 5IQBA 4ANQA 3U4WA 3QRUA 3HEGA 3KGAA 4G3GA 3QQFA 4EH8A 5EQEA 1WCCA 3V3VA 5T68A 3OOMA 3MB6A 2ETMA 4A06A 4ACMA 2JIIA 4FVQA 3TDWA 5FG8A 4FEWA 5IQHA 5EKOA 3JY0A 4ASEA 4L8MA 3W2SA 5DMZA 1KV2A 2WIPA 3MVJA 4LRMA 4GG7A 2VN9A 5KBQA 4JBVA 4YZ9A 4AA0A 5JMSA 1SZMA 2W1IA 4PX6A 3VHKA 2OK1A 3NYVA 4E4NA 4ANSA 2WD1A 2R3PA 4YNEA 4USDA 3TKIA 4QMMA 4D28A 5L8LA 4ZTSA 3VW8A 1FMKA 3UVPA 3LVPA 4ZY5A 2PZYA 2JDSA 3E8DA 3NYOA 2PMOX 1XR1A 3PJ1A 5HBEA 3KL8A 4B9DA 3NS9A 4KBKA 5IA1A 3WZKA 3R21A 2Z7RA 3MIAA 3PXKA 3AT3A 4IHPA 1VYZA 1W84A 5L8JA 3PPJA 1IR3A 2OJGA 4RJ8A 5I9XA 5CAVA 3GOKA 4QQTA 1WAKA 2ITOA 2GFCA 1UNGA 2FUMA 2R0UA 4PPBA 2I0VA 5BNJA 4DF3A 5FDPA 1OIYA 3Q2MA 1H8FA 4PL3A 5CI7A 4I6QA 4FTRA 4FZDB 4PNKA 4HYHA 3NWWA 5ANGA 4IEBA 1OUKA 3LMHA 2GFSA 2YZAA 2BAJA 3CR0A 5DPVA 4F99A 3ZSHA 3MVLA 2YA9A 1ZLTA 4O1OA 2ACXA 1YI4A 3DBDA 5CVFA 5AP6A 5AAEA 4HCTA 3MDYA 4QP3A 5CEIA 3HAMA 4BDEA 1NT2A 2WMUA 1AD5A 4XV9A 5I3OA 1Q5KA 4I41A 4FZ6A 4LGGA 1R1WA 1W83A 2C30A 5K0KA 4QD6A 5GIOE 4RC3A 3AGMA 4AF3A 4ZS4A 3CQEA 3O2MA 3FHIA 4RA4A 2J0JA 1PXLA 2KTYA 3Q52A 2PVJA 4UY9A 4FSUA 4CKRA 1KOAA 3FEGA 3OTVA 2ITZA 4LL5A 3HX4A 5E8XA 5GJDA 4A7CA 3TV4A 3OW3A 5CXZA 4ORKA 5HIEA 3NUAA 1YI6A 4FR4A 4XG2A 4XBUA 3ZZEA 2PMIA 5AIKA 3RWQA 3UP2A 3DY7A 4X3JA 3UPZA 5BQ0A 4ITIA 4PMPA 4F1OA 3BCEA 3CBLA 3JY9A 1M2PA 2E9PA 4FKVA 3ID6C 5C8NA 3FMNA 4LUDA 3ELJA 1O6LA 2J4ZA 3ZLXA 1AGWA 5FQDC 4GJ2A 3MIYA 2WGJA 3ZDUA 3D7TA 1CKIA 4FI1A 4Q9SA 2YIRA 3W8LA 3CY3A 1YHWA 3O8PA 2E9OA 2B55A 2C6DA 3OOGA 5C01A 2R3RA 3QLFA 5LWMA 2YABA 4IBMA 1JWHA 3VUKA 2FA2A 3VULA 4U43A 3QKKA 4U6RA 5JH6A 3DGKA 3AD5A 3GGFA 4QNYA 4Z3VA 4EORA 3MA6A 4JVGA 4RQVA 2X0GA 1QCFA 4CMTA 3MN3A 4U8ZA 5AP4A 1Z5MA 2J0IA 3NUSA 3EHAA 3E7OA 4FG9A 4R7BA 3C0IA 1JNKA 1ZYCA 2VX1A 2XNOA 4BDHA 4XEYA 2KULA 3UG2A 4YTCA 4EJ7A 4IH8A 3IW6A 3UIMA 4MVFA 3LLAA 3QRIA 1P2AA 3DKOA 2WU6A 5AM7A 3ZUTA 3MVMA 5HX6A 3ORXA 2YWPA 4F9BA 5AV0A 5I0BA 3WI6A 5CAOA 5EK7A 4U3YA 3WE8A 5JGAA 5IDNA 3ATSA 3UOLA 1OL1A 1HOWA 4IVDA 5FUTA 5J5TA 4S2ZA 4F0IA 2GQRA 2JKMA 4KIKB 4R6VA 5F1ZA 1ZY4A 4RJ5A 5LVOA 5EHOA 3FAAA 1QPCA 1MRUA 4O2ZA 2YJSA 3W18A 1OKZA 1R39A 5IPJA 4LRJA 4JDKA 3DB8A 2R7IA 1ZYDA 4JR3A 4FZ7A 4YURA 2IVUA 2PZPA 5CXHA 2NRYA 2UZDA 3RPYA 2ITQA 5EM7A 2CGVA 4WUNA 4OTFA 3V5TA 4OBQA 4RRVA 1XHAA 3E93A 3LZBA 4RJ7A 1Y91A 4W9WA 1V0OA 3D5WA 1S9JA 5LWNA 4OTPA 5C8KA 4L7SA 3N9XA 4YBJA 4ZLYA 2EB3A 2QOQA 4FV0A 3TNIA 3GC0A 4U80A 1YOMA 3OCGA 4U3ZA 1FBNA 2P2HA 3VW6A 3QTWA 5EDQA 4F1TA 4BL1A 4B4LA 2QOCA 1GZNA 3UVQA 4EKKA 4FIHA 4H58A 4CQGA 5E8SA 5JK3A 4C3FA 5CZIA 2Q83A 2WKMA 3PY0A 5G1XA 3P1AA 2VTPA 4K0YA 5DVRA 5KMLA 3Q4UA 1UU7A 5AUVA 4EHGA 2XKCA 2VTHA 2C0OA 4RIXA 1H4LA 3RGFA 1PXIA 3E63A 3LM5A 4XS2A 2VTAA 5FWKK 3UIXA 2Y6OA 4DINA 2YHVA 3DXQA 3LFSA 2O3PA 3TN8A 2WMAA 3PRFA 4IB3A 3RHXA 3AC2A 4GJ3A 3ZLYA 1XQZA 1O9UA 4K2RA 4BTJA 2AC3A 2R3FA 4AG8A 4II5A 2QG5A 3FZSA 4KBAA 3VS0A 3ORNA 3R2YA 4JRNA 3HNGA 3KK8A 3W2CA 3ZYAA 4C57A 4UMUA 1H0VA 2JDTA 4GUEA 2DUVA 2WTIA 1JLUE 4EOLA 2DWBA 2WMQA 3P0MA 2X6EA 2BIKB 2FSTX 4QP7A 5ACBC 4DFXE 3DDQA 4FE2A 1YKRA 4C34A 2V0DA 3EL7A 3FMLA 4DEEA 2XZSA 4MD7E 3UQFA 4CNHA 4J95A 4KIKA 4HZRA 1LR4A 3GNIB 3VBYA 5AFVA 4H05A 2E9VA 5D1JA 1REKA 3I0QA 4XG4A 2X9EA 1L8TA 1MRVA 1H25A 2UW9A 3KK9A 4AA5A 4CFWA 3DPKA 3QKLA 1UKIA 3EQCA 1JKLA 3H4JA 3LJ1A 3QXPA 4TYIA 4DBNA 3KXZA 4LV8A 5JFVA 1B39A 1DI9A 4F0GA 4BI0A 5CAUA 4DFNA 5E8TA 3MJ2A 3DAKA 3SQQA 5CT0A 2ITUA 1ZXEA 2VU3A 2Y9QA 3WYYA 4YU2A 4TWPA 1XH9A 2FH9A 2R4BA 4Y46A 3UODA 5JRSA 3TUDA 1H01A 2X2KA 3A7JA 3H0YA 1ZOEA 4V0GB 3UJGA 1WBTA 3L8XA 3LCOA 3PY1A 1LP4A 4TNDA 2WMXA 2C69A 4O0WA 3LW0A 1FQ1B 3AOXA 4M69A 1JKKA 4IX4A 2J2IB 2R3HA 4PWNA 5H3QA 3DFAA 4IM3A 4E26A 4FKTA 3TIZA 4APCA 2J0KA 5ETCA 3FI8A 5C27A 4E8AA 4DTAA 4FSYA 2XIRA 3KRXA 5F4NA 4IDTA 3F2RA 1JQHA 2QHNA 2YM4A 3GENA 4BCFA 3FY2A 3RJCA 3FYJX 3R30A 4LMUA 3MA3A 5DE2A 3IS5A 3WE4A 3VBQA 3CKWA 4W4XA 3E87A 3UNZA 3O8TA 4UALA 4UWYA 4EBVA 5CSXA 4WG4A 5EQYA 3ORPA 4U41A 4AACA 3PXZA 1GY3A 3UNKA 4P7EA 4RBLA 5KNJA 2WQEA 3LCKA 2OBJA 4FKOA 4PDOA 4ZOGA 4RPVA 1JBPE 4PY1A 1A06A 1SYKA 1OVEA 2H6DA 3AGLA 2VAGA 3OWLA 4NL0A 1TVOA 3BGZA 1OPKA 4HGSA 2ZYBA 4QMTA 4BGQA 4EK3A 4FTKA 4O7LA 4LGHA 2OU7A 3Q4CA 4G3DA 2PZ5A 3R0TA 4J98A 5B7VA 1BKXA 5KHWA 5JZNA 4BDAA 3GBZA 4PPCA 4AZTA 3NLBA 3CC6A 4GK4A 1Z9XA 1ZZLA 4HGTA 3RCDA 2I0YA 3BYOA 4FSQA 3CSVA 1JKTA 3OXTA 4AW1A 4PDYA 3FC2A 3MBLA 5DG5A 3FXZA 3PJ2A 4QMZA 4BHNA 4MWIA 5F9EA 4O0UA 4M8TA 2UZWE 4H3QA 4CEGA 3II5A 4F6SA 4FG8A 4IWOA 4EHVA 2XRWA 4N4SA 5A4QA 3EN4A 3E5AA 3P7AA 1CTPE 2W4KA 3PYYA 3JYAA 2YIYA 3QTZA 1QL6A 3R6XA 4FIEA 2OIQA 4GFMA 4I93A 5CS6A 5TE0A 2CKPA 3ERKA 4GEOA 5KKRB 3UBDA 2QCSA 4P4CA 3V01A 3DT1A 2G2HA 4BKJA 3IOPA 5A6OA 5CEQA 4EOQA 2GHMA 5GJGA 2PZIA 2BFXA 3EFWA 1H1PA 2RFNA 5EHYA 3EQIA 3D2IA 1PHKA 3SOCA 4ANOA 4ERKA 4E93A 2IVVA 5ANIA 2VNWA 1YXXA 4YZCA 2B52A 5BVEA 3A62A 4ZY6A 3U9NA 2HYYA 4X2JA 3S3IA 3TIYA 5TKDA 4AGDA 3QQJA 3CXWA 3MB7A 2AC5A 2OI4X 2GPHA 3L8PA 3OUNB 5T6KA 4MWHA 4NSTA 2B54A 2HZIA 4L3PA 2J51A 3LM0A 5EYCA 5LMAA 1Q8WA 3IG7A 3F61A 4MNEA 3RK5A 5JQ5A 4U40A 5KO1A 2C5OA 4HNFA 5KMMA 3CPBA 4KD1A 4O6LA 4QMXA 2PZRA 4EONA 3AMYA 5BVFA 4QPMA 3PIZA 4NEUA 4KWPA 1F3MC 3TJCA 4YLKA 3EQRA 2R3QA 4ZSLA 4C62A 3ZO2A 5BUJA 5M4FA 3PFQA 3E3PA 4XRJA 4PMSA 3GQLA 4F7LA 4QYGA 4QMSA 3OHTA 3FXWA 5CALA 5J8IA 2XK8A 3OT3A 2QOOA 3PPKA 1FVTA 1VJYA 2E9NA 2YLEA 4FUYA 4FV2A 5E8UA 3ZUVA 4GK3A 5CEOA 3NZ0A 4DFYA 1WBNA 3P86A 5LXMA 4RT7A 2RFSA 3OD6X 5IDPA 2WTKC 5GNKA 2XK4A 2YN8A 4F9WA 4JT3A 4G3FA 2YAKA 3KXMA 4C3RA 1Q8UA 4ZMEA 3ACKA 4X2GA 5CNNA 4UYNA 1NW1A 4X21A 4LOQA 2OFVA 5ANEA 3WBLA 4ONAA 4BB4A 1GZ8A 3ZM4A 5M44A 4HJOA 5M09A 3DQWA 2GTMA 5J9LA 4IZAA 2VD5A 4PRJA 3MFSA 3OUKA 3KN6A 4O0YA 4YTFA 2F7XE 4FTUA 5EH0A 4IQ6A 3IW4A 4JRVA 4MXAA 4XOZA 4EZ7A 3DAEA 2W99B 3FMHA 4FV6A 3ANRA 3AG9A 5HU9A 2C6EA 3FLNC 3QHWA 3VS5A 2QOLA 5L6WL 2XA4A 2YIQA 3KULB 3Q4TA 3R8ZA 4AN9A 5AX3A 5IMXA 4BKYA 4GYGA 2HWPA 3BU3A 1Y57A 1OL6A 2YACA 2I0EA 2WELA 4MK0A 4RJ3A 4AXAA 5DGZA 2XRUA 1O6KA 3VUGA 4O7TA 3L1SA 3FZPA 1ZOGA 4GIIA 5EOLA 3CLYA 3Q96A 4QO9A 3RBWA 5LQFA 3O7LB 2UZBA 2NP8A 4UB7A 2OW3A 1IG1A 3DV3A 1Y6BA 3MH3A 4S30A 5LARA 2IZUA 4I92A 1K2PA 1GNGA 1IAHA 4BCIA 4QTCA 2WHBA 4YR8A 3SG8A 2ZDTA 4H3BA 2OFUA 2VRXA 2ITNA 2W96B 5HI2A 4ALUA 4CKJA 4RIOA 3ET7A 2YCQA 5TOZA 3D2KA 3FQSA 3R7VA 4D4SA 4YC3A 4QMYA 3I0OA 4K11A 4L68A 4XLVA 5BUEA 2O8YA 4C8BA 2UW5A 1Q3DA 3KB7A 3V8TA 4YNOA 2WTDA 4E6AA 2PL0A 3O23A 3FLWA 3R7IA 3KFAA 2BZKB 3ITZA 1E9HA 3BZ3A 3QLGA 4O0XA 4TYHA 3AMAA 2ITVA 3ZC5A 5EDPA 3ODYX 2VWXA 3VWAA 4FL2A 4EOJA 2RL5A 4H36A 4JQEA 4LG4A 5LVLA 4R78A 1P5EA 5HTBA 2PPQA 1YRPA 5K4IA 2R3KA 4YJUA 2GHLA 3LPBA 3NIZA 4D2WA 4EOMA 2W1GA 5CWZA 3R02A 1YWVA 5D10A 3H10A 4Y83A 5HIDA 4TYGA 4C2VA 1Q41A 2W05A 3R28A 4XV1A 2CN8A 2FSOX 1CMKE 3DJ6A 4E4MA 1XBCA 4DGMA 2PSQA 4O38A 5BYYA 5HX8A 2YDIA 3I5ZA 4O6EA 3EKKA 3R22A 4NJDA 5CSHA 3SHEA 4QTDA 4BIBA 1J7UA 4F9AA 4JLCA 4IM0A 2QO9A 4G6NA 4BYJA 2X8EA 4M12A 3W33A 5EYMA 5IZFA 4I0SA 5KUPA 5LCJA 4UV0A 4QMPA 4ZTLA 3TKUA 3M2WA 3IONA 3GP0A 2XJ1A 3W1FA 2WTWA 4ANLA 4D1XA 3P4KA 4AE9A 3Q6UA 2BTSA 4CFNA 3CP9A 3L9PA 5FRIA 3PWYA 2CNVA 2ITTA 3UE4A 3KCFA 1OPJA 5HE3A 4I5HA 4S33A 4IXPA 4ITJA 3H9FA 1CSNA 3B8QA 4EJNA 3Q9XA 3Q5IA 4RIWA 5IH6A 5K9IA 5DR9A 3RCJA 4L52A 1PMVA 2JAVA 4D5HA 4HPUE 3VF9A 1HCKA 3DKGA 4RWJA 5GJFA 3HMPA 4RMZA 3RAIA 2JITA 4FT7A 4QYYA 4E5AX 5LMBA 4X6RA 4RVKA 5E92A 4G3EA 5CF5A 5JFXA 4L3LA 4A9TA 4EH2A 4X2NA 2Y4PA 3CY2A 1W7HA 1XH4A 2HELA 3IPHA 4U5JA 4ZS0A 4NZWB 4J1RA 3RM7A 3SXSA 4BCJA 2OXYA 3UQGA 4I94A 2ZMDA 5CF6A 1E1XA 2IW8A 1YDSE 1OECA 2OXXA 4BDIA 2IG7A 4C02A 3F3UA 4M69B 5E1SA 3W2RA 3BV2A 4FSWA 4IX3A 3CEKA 1KE8A 4WOVA 5IA3A 3F2AA 2W9FB 5HVYA 2AYPA 3Q9ZA 3PWDA 1SNXA 5L2QA 4CT2A 4FV9A 2BCJA 2ETRA 3QD0A 3QQLA 3O51A 4IB1A 4NK9A 5HG9A 4FT0A 3KMUA 2XKFA 4ASXA 5LVMA 3RI1A 4QMOA 1VR2A 3AC4A 3NCZA 4LGDA 4N6YA 4DTKA 3V5JA 2PMNX 2WNTA 3PG1A 3ROCA 2OIBA 3VUTA 5AIRA 2I7QA 4F09A 3MV5A 4MHAA 5HCYA 3UMXA 4YZMA 4HGLA 2V62A 3V5WA 3LXLA 5EI6A 3FYKX 3EQDA 4UWBA 1FOTA 4RC2A 4AZEA 5HZNA 4UMRA 2ZOQA 2F9GA 5CEKA 4XLIA 3VO3A 1XO2B 3JS2A 4ZP5A 2A1AB 2VWZA 4CLJA 2C6LA 3I60A 3QALE 2HY0A 2X4ZA 2NRUA 3FE3A 3AC5A 4G5PA 4QPSA 4EH4A 2GQSA 4M15A 4ZZNA 4EUTA 3FQHA 2XB7A 1XBBA 2QO2A 3HVCA 3D7ZA 4JR7A 1GIJA 3MJ1A 2HAKA 2VTQA 4BN1A 3UP7A 4GCJA 4EOIA 1J3HA 4M66A 3EQGA 2QNJA 4H3PA 3LHJA 3I1AA 3IW7A 3DBFA 5HCZA 1WBWA 3WF7A 3PA3A 5BVNA 4WIHA 3K5UA 4JG6A 3KRJA 5EM8A 5HE1A 2R3GA 1OL7A 4IZ7A 5EOBA 3PJCA 2WMSA 4C36A 4CV9A 5G6VA 3QD3A 1YDTE 2G01A 4A07A 2C68A 4G5JA 2ERZE 3LCDA 5JEBA 2SRCA 3QQHA 1ZOHA 3K3JA 3PSBA 2OZAA 2VTSA 4I20A 4XG7A 3T9TA 1URWA 5I9WA 1J7IA 2YM8A 2F4JA 4XUFA 2OF4A 4ZTHA 2PE0A 4TN6A 3OS3A 4FEUA 4QQCA 1WMKA 4M13A 3RHKA 4YJPA 4YO6A 4DH5A 2BZHB 2BRHA 1OKYA 4DGOA 2C4GA 4M0ZA 5EW8A 2DS1A 2J5FA 2JBOA 4C38A 1G8SA 3RPOA 4GUBA 4JIAA 4USEA 3COHA 3R9DA 3ULZA 3BGPA 5FTOA 3IK3A 4D0XA 2C5NA 4D9TA 4QYHA 3EMGA 2EXMA 4WKQA 1U54B 3TWJA 4JDJA 2X39A 2XCHA 1XWSA 3NYNA 4R1YA 3LCSA 4LMNA 5J1VA 2NNWB 2JFMA 4CT1A 2QODA 2IVSA 3PE2A 4B6LA 2HIWA 3VS1A 3MWUA 1SVGA 3F82A 3ZSGA 3ORTA 2UW7A 3ZHPC 4CSVA 3Q3BA 5H2UA 4G34A 4FV4A 3AD4A 4HVIA 3DS6A 4FODA 4UEUA 2RGPA 3EIDA 2Z60A 3G6HA 3C5IA 3NR9A 4JJRA 3QRTA 3TNQB 2BALA 3FMMA 4XYFA 5FEEA 4JBQA 4NH1A 3TZMA 5I5ZA 4K8AA 2CKQA 3E3BX 4EQUA 2E9UA 3F3ZA 4MXXA 3WOWA 1PF8A 4C4HA 1Q8TA 5AA9A 5ETIA 3FI2A 3QA0A 1K3AA 3FMEA 5HU3A 3GCPA 4L45A 2A4LA 4C58A 3P7BA 2CKOA 1V1KA 5CQWA 5DOSA 4KB8A 4EL9A 3Q6WA 2ERKA 4QMVA 3D0EA 4R5SA 3VUHA 4BCKA 4XP2A 5KMJA 3SVVA 3EN9A 5J87A 4TYHB 2VX3A 3HUBA 5D12A 3QQKA 2QHMA 3QYZA 3E8NA 2W17A 3MSSA 3VRYA 3QTSA 4FV1A 1KOBA 3NGAA 4KNBA 4MNEB 5BUIA 3LFCA 3IKAA 5DT0A 2UZLA 3A7HA 1YVJA 4OR5A 1W98A 2UZTA 2XMYA 4LRKA 3WARA 3QWKA 3NUNA 4O0SA 4CZUA 2BTRA 3BHHA 4EK6A 5DEWA 3O50A 4UWCA 5ETFA 2J5EA 5CVGA 2PVRA 3KA0A 1NA7A 2V22A 2WPAA 1Q97A 2PVLA 4O81A 5HO7A 3PJ8A 1DM2A 3KREA 1OKWA 4YC8A 3QQUA 4IC8A 5L4QA 2XK9A 3M11A 5HG8A 3BX5A 4C2WA 2YDJA 4KAOA 5AUZA 3SXFA 4RIWB 4K6ZA 1JSVA 3BPRA 5K0XA 3D9VA 4R5YA 4AW2A 4FNYA 3REPA 5GZ9A 2WQOA 1H26A 4O91A 3KCKA 3QKMA 4IANA 4FKLA 3OEZA 1FVRA 3GCQA 3LFFA 3HV3A 3EZRA 1UU3A 3E92A 3EOCA 4FSRA 3NIEA 4PV0A 3RK9A 1JKSA 2BR1A 3R00A 2GHGA 2J90A 2XIYA 3DQXA 2WU7A 4Z7GA 2CJMA 3CCNA 4AX8A 2YDKA 3L8SA 3NUXA 5EFQA 2HW7A 3UGCA 4I5CA 3OP5A 3UYTA 3V8SA 1H27A 4UMTA 2B9FA 4AWIA 1H08A 1YDRE 2W1EA 5J95A 3CD3A 3Q04A 5DNRA 3TEIA 4BBMA 5HCXA 4AW0A 4CG8A 3Q9WA 4IB5A 4B7TA 3R01A 2HW6A 1PYEA 4FKPA 3LFDA 3IQ7A 5CEPA 3UG1A 4CGAA 3UO5A 5JRQA 4E7WA 3A8XA 5ANJA 3C4ZA 1PXMA 2FSMX 4DEBA 4QYFA 4Z55A 1UV5A 5A4LA 2A2AA 4E1ZA 5DLSA 2YAAA 1U46A 3ANQA 5AP3A 1URCA 5EYDA 3VC4A 1A48A 1X8BA 3DZOA 3IW5A 5GIPE 4FTJA 5AV3A 4AN2A 3R7GA 4IAYA 3DU8A 3BLQA 1PYXA 3MW1A 3ORZA 4FKIA 3ORKA 1LUFA 4HGEA 1WBSA 4ANNA 4I24A 2G9XA 2ZV7A 3H9RA 4PDSA 1PY5A 1Q61A 3GQIA 4RLLA 3VRZA 3QZGA 3WF9A 4E4XA 2BZJA 2JEDA 1R3CA 5DEYA 5AUTA 2X8DA 5CI6A 1IA8A 3THBA 3OEFX 4GVAA 2X9FA 4B99A 3BU5A 1RDQE 2CNQA 2QG7A 3IDCA 5HBHA 3F3TA 4ACGA 4DE4A 4FEQA 4YSMA 1AQ1A 2UV2A 4I4FA 2Y6MA 3POZA 2WIHA 3OT8A 2OGVA 3R1NA 5HOAA 3ZLWA 3D83A 2R3NA 2VGPA 5ACKA 4IB0A 3E64A 2WOTA 4EYJA 3CD8A 4V01A 3FI3A 3ZBFA 5C26A 2CHLA 4TZRA 2Y4IB 1CM8A 1WBPA 5B2KA 1M7QA 4HVGA 2R0IA 5LCKA 2YM3A 4BWKA 5HQ0A 4P2KA 4JDHA 2PYWA 4EBWA 4G31A 4L67A 3ZTXA 4AGUA 5AR2A 4BDGA 3CE3A 2W06A 3MFTA 2IWIA 5M55A 3G0FA 5CF4A 4RWKA 4C61A 2YEXA 4F0FA 4AZSA 3GVUA 4FTQA 4ACHA 1IRKA 3CGFA 4QP4A 2B9HA 1ZAOA 3KRLA 4NW6A 5KKRC 3LE6A 5IA5A 4F64A 1PMEA 1WBVA 2HXLA 4JAJA 3ETAA 3OXIA 3RNYA 3C4WA 3P7CA 2JDVA 1H1WA 3K54A 2C6TA 3ORLA 5AADA 3AMBA 3FMDA 1ZYLA 2W4OA 2XKEA 5FD2A 5FTQA 1KUTA 4EH5A 3QU0A 1YXSA 2XK6A 4EOKA 4ZTRA 1RE8A 2XS0A 4BWPA 4ZXTA 4ZJVA 4WUAA 1ZMVA 3R8PA 4XV3A 4E20A 1T46A 5FM3A 3JXWA 5DRDA 5E8YA 3CTHA 3QD2B 3OFMA 4NIFB 4DEDA 3A60A 5FEDA 5A6NA 1UNHA 3HKOA 3N4TA 5I9VA 2WTVA 4I5MA 3FC1X 1U5RA 3C50A 3RZBA 4ZJJA 4D5KA 4N70A 4UMQA 3Q2JA 4IWDA 2EU9A 1M2RA 4ASZA 2XYUA 4R3CA 4FL3A 4UXLA 3A8WA 3RMFA 2W7XA 3OWKA 5D41A 4DGGA 2YIWA 3DAJA 3LQ3A 5BX0A 4W4YA 4FNXA 4H1MA 3RNIA 2UZNA 4KSPA 4LFIA 4W8EA 4BC6A 4NKSA 3WIKA 5E9EA 1PXNA 4GSBA 4HYUA 4GL9A 3R9HA 5EI2A 4WA9A 4WNKA 1UU8A 2QQ7A 3HMNA 1BYGA 2X2LA 1OBGA 3LQ8A 2PU8A 2WTKB 3P5KA 2UZEA 2YWVA 4FA2A 4JQ8A 2O64A 2XKDA 4FZFB 5IKWA 3BHTA 4I6HA 2V55A 2VTRA 3ROYA 3PXRA 3W2PA 3F7ZA 4PP9A 3PDTA 5HE2A 5IH4A 1BMKA 3A7IA 5E8VA 4C4IA 4GK2A 4YJQA 3F2NA 4GH2A 4G1WA 3R7EA 1PMNA 5IG1A 2BRBA 1RW8A 5K4JA 3GU7A 4BI1A 4EHEA 5CZHA 2CNUA 4ZTNA 3AD6A 1SMHA 2B9JA 3QBNA 4O7VA 4O86A 4HCUA 2R5TA 1OL2A 3SX9A 1NY3A 2W1ZA 4TW9A 1WVWA 5HICA 5IA4A 3KXHA 3ZDIA 4NYEA 5M07A 2P3GX 1JSTA 3U8WA 4EK4A 1XBAA 4FSMA 4RWIA 4O7ZA 4TKSA 2DQ7X 4FTCA 4MCVA 4U79A 4GMYA 4ARKA 3MESA 4Y85A 3R73A 4F7JA 3DXNA 4Y8DA 2JAMA 3LLTA 4DH7A 5DWRA 3DK3A 3QUEA 4FTIA 3ENMA 2OZOA 2XBJA 4IFGA 3SXRA 2ZV9A 4BBFA 2NPQA 4GYIA 3EQBA 2I0HA 4BGHA 2C6MA 4F7SA 3FSKA 4IAFA 5AR3A 5FBOA 2FO0A 2YJRA 1YOJA 3H3CA 2J50A 3T8OA 5JGDA 5KHXA 4YPSA 2IW6A 2GCDA 3L9MA 5AR4A 3G2FA 4L6QA 5M06A 4RIYA 4RJ6A 1PMUA 1MRYA 4JG7A 4ZJIA 3UO6A 3VHEA 4BDKA 4BICA 4KABA 4YJTA 4ANBA 2YITA 2X6DA 3C5UA 1VZOA 4E6CA 4I6FA 2JD5A 4UN0C 5LJJA 2X81A 3QHRA 4FTAA 3OMVA 2OJJA 4KRCA 3C51A 4ANMA 4D4YA 3EZVA 5CAPA 1LEWA 4KKEA 3OCBA 4D58A 3G51A 3G90X 4AZWA 2GS2A 3SRVA 2QKRA 5HG7A 2BUJA 5HLNA 3PXYA 2BKKA 2Z02A 5H9BA 3HA8A 4GFOA 4FIFA 5FGKA 2EB2A 2UW4A 4XV2A 3QGWA 5AUXA 5F95A 4AFEA 1PXKA 1GOLA 4BHZA 4HVDA 5IEXA 3OF0A 4XP0A 2JKKA 4PQNA 4F7NA 2XF0A 2F2CB 4CTBA 5CU2A 1VYWA 3HV5A 1OIUA 3H9OA 5CSVA 5AR8A 2R9SA 4TWNA 2BFYA 1GAGA 2W1CA 3DNEA 1ZARA 3JVRA 1GJOA 2GTNA 3VS4A 5IUGA 2OSCA 3QD4A 4C4JA 4ZK5A 2CGWA 4GT3A 4M7IA 2XUUA 1M2QA 1QPDA 3C4CA 3BYUA 4EH7A 2XEYA 4Y73A 4F70A 5A3XA 3EYHA 4J7BA 4ITHA 4RG0A 2YM7A 3KF7A 4FK3A 4V0GA 3U51A 3UTOA 3FDNA 4R7HA 3QCXA 4RGJA 4Z9LA 3TV7A 4RSSA 4BDBA 4FIIA 4DITA 4IIRA 2ZVAA 3I7BA 4LV5A 2QLUA 5AX9A 4FF8A 1QMZA 3ZCLA 3KXXA 3FQEA 4KS7A 1IEPA 3DXPA 3WYXA 4EWQA 1FMOE 4PL4A 5LMKC 4F9YA 5HIBA 2BROA 2YIXA 2Y7JA 5AR5A 4E5BA 3FZOA 3M1SA 4DFZE 2WOUA 4ASDA 4ZLZA 4ZTMA 2C47A 3R7YA 5M56A 5C4KA 4QTEA 3M42A 3DFCB 3E8EA 3R8MA 5AUUA 3U6HA 3B2TA 2HK5A 3BE2A 4QMLA 5DT3A 5EKNA 3PA5A 4RLKA 5FLFA 4N57A 2ZM1A 1UWHA 3VQHA 3NNWA 4YZBA 2BAKA 4NTTA 1YOLA 4A9YA 3WZDA 4IE9A 4IZ5A 4U42A 4DCAA 2W1FA 2W4JA 2Z7SA 3ZSIA 4WO5A 4AQCA 2PUIA 3HDMA 5FTGA 5GINE 5DI1A 1M17A 4BCHA 2BRMA 3DZQA 4BDFA 2PUNA 4CRLA 2Z7QA 2CPKE 2VUWA 4Y72A 3RPRA 1PW2A 4WSYA 4BTFA 1U54A 5DIAA 2X7FA 5HE0A 1VEBA 1TQMA 2WFYA 3FMKA 3FWQA 3D4QA 3MGYA 4QNAA 4C35A 2ZAZA 4FBXA 2VTIA 1XH7A 1Q3WA 5FP5A 3D14A 4GT4A 5IUIA 2LAVA 3KKVA 2PUPA 3PPZA 4RZVA 3C7QA 4BIDA 4YLLA 3U87A 4QT1A 3NX8A 1GIIA 5CVHA 4E6QA 3O0GA 2ITPA 3QTUA 5FM2A 2O63A 1OZ1A 4DG2E 1TQIA 4QPAA 1PKDA 5HLPA 2RF9A 4BF2A 5AR7A 3CTQA 5CU4A 4RIXB 2J7TA 3PZHA 3F5XA 4YHJA 4J8MA 3VUIA 4BCGA 4I3ZA 4I5PA 2OZAB 4ERWA 3HRFA 3ZEWA 1UNLA 4CFMA 3QXOA 4WG5A 2C5VA 3HYHA 3F88A 3TT0A 3PG3A 3A99A 5D7AA 1H24A 4NUSA 4APPA 3I79A 3F69A 4EYMA 1XKKA 1RQQA 4USFA 5L2TA 2B0QA 2QKWB 4YBKA 3ZO3A 5B2MA 4AU8A 3TI1A 4KS8A 1DAYA 4FKWA 3O71A 4MXCA 1OUYA 1XH5A 1APME 4J96A 2VO0A 3QA8A 4IJPA 4Y95A 3TTJA 4PTEA 5A14A 5B2LA 3Q5ZA 5I9UA 4R77A 4S34A 3BBTB 4FTOA 2XBAA 4O0VA 3MPTA 4V05A 3R7UA 2CMWA 3MFUA 3SA0A 3R9RA 4LOPA 1Y6AA 3A4OX 4YC6A 3V6RA 2RFEA 4KBCA 3W2QA 2GNLA 4NCTA 4CFXA 1GZOA 3HECA 5C4LA 1KV1A 2ZB0A 2JIVA 3FMJA 4AGCA 4D2RA 3FXXA 3Q4ZA 2BRNA 5ETAA 2UZUE 3QTIA 5IQIA 2P0CA 1SVEA 5AWMA 2V5QA 1UKHA 4YTIA 3V5LA 1Q8ZA 4NT4A 3ZM9A 3DBEA 3CQUA 3KVXA 3OROA 4WBOA 2QO7A 3VUMA 2JBPA 1BL6A 4D55A 3PIXA 4YHFA 2J6MA 4RVTA 4YO4A 1YWRA 2HENA 3D5VA 3AC8A 3BWFA 3FPQA 4L46A 4EC8A 1KSWA 4PPAA 5D11A 3R9OA 3TUCA 1I44A 2PVFA 2RKUA 3R2BA 2QD9A 3B2WA 3DNDA 4S31A 4JIKA 5LVPA 2XNMA 4YHTA 1U4DA 2QVSE 3MY0A 2BDWA 2OJ9A 2V7AA 2F57A 4RJ4A 4FL1A 4JBOA 2X1NA 2PUUA 4OAVB 4F6UA 4EQMA 4NKAA 4WNMA 3A7GA 1K9AA 3NAXA 2XEZA 3VBXA 4EH3A 2R3IA 3DK6A 4MH7A 4EH9A 3WF8A 4BCNA 4DT8A 2BVAA 3KXGA 3ZRLA 3VN9A 3FKOA 4ZZMA 3UZTA 1STCE 2JFLA 5DH3A 5EM5A 4YUQA 1YWNA 1T45A 3MTLA 3Q9YA 2IN6A 5HO6A 3UOHA 3LFNA 2I6LA 4MTAA 5A9UA 1P14A 1ZZ2A 4FYNA 3Q32A 4JOAA 5E8ZA 3O7LD 4FYOA 3R71A 5CASA 3B8RA 3BELA 3HLLA 3SOAA 3S00A 4QYEA 3K2LA 3HMIA 2ZMCA 2FVDA 3FZ1A 5H8GA 3MPMA 4ZSJA 5A46A 3EFLA 4G9CA 3S4QA 2UVYA 4CFFA 3QC4A 3QX4A 3IOKA 1OBDA 2GSFA 2RG6A 4A9SA 5KCVA 5LOHA 1G3NA 1S9IA 4YZDA 4NIFA 4OTIA 4EOOA 4YZNA 5L6OA 5DFPA 4XX9A 3OWPA 4JQ7A 4I1ZA 5IF1A 3WZUA 3GCUA 4Q2AA 2J0LA 5IUHA 4XCUA 3VNTA 4FSZA 2VTLA 3RP9A 4KSQA 2QU5A 2B9IA 2H9VA 4RVLA 4O83A 3TM0A 4WBBB 4X3FB 4E5WA 4H39A 4Q5EA 5AAGA 4A9RA 4M97A 5CEMA 2A0CX 3U55A 5HORA 3DLSA 3QTXA 2JC6A 3PZEA 3WZJA 3A2CA 4YJVA 3UC4A 3NPCA 3DLZA 3FZTA 2OH0E 4RWLA 3TL8A 2G15A 2G2IA 4NFMA 4AE6A 2JDRA 4U0IA 3UO4A 4NM0A 1G5SA 3KMWA 4RQKA 4PL5A 2I40A 4MKCA 4OT5A 2B53A 3CPCA 2BAQA 4Z16A 3DTWA 5E7RA 3G15A 4K77A 2BDFA 5FEQA 3W2OA 1PKGA 1NXKA 1WBOA 3NEWA 3IW8A 2EVAA 4G16A 3VS6A 2VO6A 3MH1A 2IZSA 3G5DA 3KULA 3OCTA 4X7QA 3VS7A 3IGOA 5K3YA 2F2UA 2R3LA 3PLSA 1BL7A 4FGBA 1REJA 4YJNA 2W1DA 4J71A 5CQUA 1ZWSA 3ZBXA 3RAWA 4LL0A 2PTKA 1WFCA 1KE6A 2J0MB 2PVYA 3E62A 3BEGA 5AV4A 3PLAE 3Q60A 3OC1A 1RJBA 4DG0E 3W16A 2W5HA 5JGBA 3KVWA 3PP1A 1R0EA 2ESMA 4MEDA 4ZEGA 4IAZA 4AOIA 4AS0A 4B8LA 5J9YA 3MI9A 3TZ8A 3GOPA 4P5QA 3TXOA 4O0TA 4CQEA 2W9ZB 5CSPA 5AUYA 4BDCA 4XRLA 5JSMA 1H1RA 4IACA 3I6WA 4JL9A 2WQBA 4C4FA 1ZMUA 2JKQA 3GFWA 4JBPA 2VWVA 2FSLX 4L3JA 3UQCA 2XH5A 1B38A 2QOIA 4OUCA 4AOTA 3EJ1A 1ZY5A 5T3QA 3CIKA 4MXYA 5J7HA 4YLJA 4MF1A 3LQ5A 4IM2A 4C3PA 3S0OA 2O0UA 4RX9A 4O82A 2P33A 4E3CA 5JT2A 3DB6A 3UZRA 4D1SA 4QQ5A 3DDPA 2X8IA 1Y8YA 3L9LA 4QMUA 4NM5A 3HL7A 4IC7A 4C0TA 2YISA 2R3JA 2Z2WA 4GV1A 4KKHA 3DJ7A 3SW4A 1DS5A 3DBQA 2A27A 3GU6A 3PUPA 3SKCA 4W9XA 4BZDA 4QMWA 5M57A 4HPTE 3LJ2A 4IADA 3Q53A 5L2WA 3SGCA 5IQDA 3F3WA 2YCFA 5HKMA 5KBRA 4CG9A 4QMNA 3VBVA 3ZUUA 3ZXTA 4PTCA 4B8MA 4IDVA 4O0RA 4Y5HA 4M68A 4YJSA 5AP5A 3WF6A 3ZO1A 4JS8A 4NCTC 4AGWA 1ND4A 3BHVA 4DT9A 3BBWA 4XG3A 2PVKA 3NUPA 2C1AA 2OIDA 1MQBA 3QUDA 3F5PA 4AUAA 4WNOA 5AP0A 2I1MA 2LGCA 3V6SA 3GUBA 2YM5A 4BYIA 2VTJA 4CLIA 5IQEA 3VBTA 5ITAA 1UWJA 4HYIA 1TQPA 2XM9A 2H8HA 3N4VA 1UU9A 2P2IA 3HUCA 4FKQA 2XIZA 4RA5A 3TCPA 4AT5A 3I5NA 2WEVA 4C4GA 3ORMA 5JZJA 5L6PA 1Q4LA 3KRWA 3WZEA 4DLJA 3ACJA 3KY2A 3UC3A 2Y4IC 4GU6A 1WZYA 3VVHA 4L43A 5HD4A 1YW2A 2PVHA 4BRXA 5I9YA 4BCOA 2X2MA 3W32A 3LMIA 1KWPA 1Q24A 4MXOA 4I0TA 2XM8A 4V04A 3CTJA 3IGGA 2CN5A 4FG7A 4LI5A 4A4XA 3HDNA 2XJ2A 3COKA 2BIYA 4DC2A 1OM1A 2CLQA 3FHRA 3QYWA 4C4EA 5IU2A 2GMXA 3UVRA 3BU6A 5HBJA 4DA5A 3I7CA 1OL5A 3QRKA 5C1QB 3ZU7A 4M14A 3C1XA 4QMQA 5JKGA 1YXTA 2OJFE 2C6IA 3C4EA 3LXKA 4KRDA 3R8LA 2VO3A 3ZXZA 3HV4A 5IEVA 3GT8A 2BRGA 4F6WA 1CDKA 3KN5A 5A54A 3QAME 4XG6A 4NU1A 2X7OA 5AMNA 5M4CA 2QURA 4ENYA 4O7SA 4FKGA 3EQPA 2ITXA 4J52A 4MD9E 4IX5A 4R1VA 4D2SA 3KQ7A 4YJOA 5TR6A 3LOKA 4LM5A 4L01A 4X3FC 4ENXA 4BKZA 2IZTA 3VS3A 2B4SB 4DBXA 1FGKA 3EQFA 5FP6A 4FX3A 2VTMA 3P9JA 3PVWA 2QOFA 1MQ4A 4NTSA 2BILB 1ZYSA 3ZS5A 5HNBA 4AAAA 3PSCA 3UZPA 3LJ0A 2PMLX 5HG5A 3ORIA 1M52A 4FIGA 1JPAA 4QP8A 5AP2A 5AJQA 1OMWA 2C6OA 4IVBA 4QP6A 4CD0A 2QOHA 2EWAA 1U5QA 3QZIA 3NNXA 5CU6A 1FVVA 3BQRA 3FLYA 3VJNA 4UXQA 3MTFA 3ZZWA 5CU0A 2OWBA 3ATTA 4KIPA 5DRBA 2ZM4A 3DCVA 2XCKA 4U9AA 3OBJA 4IVCA 5CNOA 2HY81 3ZONA 4CCUA 5LMKA 2UW6A 4TT7A 4O7RA 2RSVA 4HZSA 5AUWA 3VIDA 2BHEA 2OJIA 2VNYA 1W8CA 4ZSGA 3LFAA 1BI8A 2ZJWA 5AP1A 3P78A 2UW0A 1J91A 3PRIA 2NO3A 3NSZA 2YFXA 4FUXA 2GQGA 3ULIA 4IAIA 4FNWA 5CT7A 1V0PA 2C3JA 4M84A 2O65A 3FPMA 4OTRA 4AP7A 2ITWA 3QC9A 4ZAUA 5DT4A 4ZMFA 4RIYB 1XH8A 4AZVA 1MP8A 1PXPA 3E8CA 5BVDA 2YZLA 2ZM3A 1OIQA 2ONLC 3RVGA 4DFBA 1F5QA 4EC9A 4RC4A 3N4UA 4M3QA 2O2UA 3OY3A 1BX6A 1KE7A 3G9LX 4I21A 4AT3A 4JX3A 1H1SA 1NVSA 4IW0A 4EI4A 3PJ3A 3NVKI 3TNWA 5AP7A 2WMTA 1J1BA 3QCSA 2WMBA 4NWMA 4C37A 4F4PA 2QOBA 2REIA 4XBRA 4PTGA 2CLXA 2WQNA 4QRCA 3T3UA 2CCIA 4KIOA 5HD7A 3C0GA 2IPXA 4S32A 4UBAA 4W4VA 4EK8A 4PMTA 5CANA 5LVNA 4TNBA 2GS6A 4GKIA 5BYZA 5IQCA 4EK5A 4RX5A 5A4TA 2QOKA 3QQGA 3WIGA 1E1VA 2HOGA 3PXFA 1IASA 4FTNA 3V5PA 5DN3A 1IA9A 4OW8A 4RVMA 3G0EA 1YQJA 5BVKA 4BCPA 3QCYA 5FXSA 4CYJA 1SVHA 1QPEA 4FK6A 5IH5A 4J8NA 2Y0AA 1H07A 5B0XA 2IJMA 2UW3A 4UZDA 5BMMA 1H1QA 4FV3A 3QFVA 4MQ2A 4YGAA 5E1EA 4G17A 5L2SA 2X7GA 5J7BA 4OAUC 4XG9A 2JLDA 2XNEA 2ZDUA 4FV5A 2C1BA 3EL8A 4L7FA 4CYIA 2HWOA 5IISA 1XH6A 4MF0A 4PUZA 3TJDA 2F49A 4IX6A 3UNJA 2Z7LA 5D7VA 3QCQA 3C9WA 2XJ0A 2HCKA 4JX7A 3BIZA 3QF9A 2F7ZE 3LIJA 4GRBA 3VAPA 4FKJA 4F63A 1H00A 3VQUA 5AV1A 4CMUA 2WMVA 2JKOA 4TYJA 4CFUA 3QX2A 4K9YA 3V04A 4TL0A 3NYXA 4AN3A 2ZB1A 1R78A 4I0RA 3COMA 4UZHA 4EZ5A 3PTGA 3HRBA 3K5VA 4Y5QA 4UYAA 4ZTQA 2R3MA 4BDDA 5KX8A 4IZYA 1PXJA 2Q0BA 3FUPA 3E88A 4FTMA 2VWBA 4PF4A 2VTTA 3LFEA 4YMJA 1ZMWA 3W10A 2B1PA 2QONA 3BRBA 4X6QC 2R7BA 2C0TA 3FLSA 3GCSA 2UUEA 3QTQA 3DK7A 2GS7A 4IWPA 3NW5A 4IWQA 4LUEA 3LMGA 2VWIA 1NVQA 4G9RA 4TY1A 4BZOA 2PHKA 5AAFA 3SAYA 3TZ7A 1H28A 4JNWA 1IAJA 5IQFA 4OTWA 3GU4A 5J1WA 3NW6A 5IQAA 5AV2A 2AUHA 4TPTA 5F20A 5H8BA 4JXFA 3G9NA 3HMOA 5HTIA 4FOBA 3IO7A 5EDRA 4QP2A 2R3OA 3UIBA 3V5QA 3CJFA 4D4RA 3QZHA 3ZMMA 2RG5A 5EM6A 5HHWA 4Q9ZA 4L53A 4OTGA 1F0QA 4MBLA 5M51A 4EQCA 3MY5A 3QTRA 1BI7A 5TO8A 1CKJA 4PNIA 2QC6A 3SG9A 4FTTA 3HV6A 2W0JA 1EH4A 3PVUA 4IFCA 4ID7A 3ZEPA 5IQGA 3PY3A 3QWJA 3DTCA 4JDIA 4G6OA 1YHVA 5BVWA 4UX9A 3D5XA 4O27B 2OF2A 2VWYA 4P90A 4GT5A 4BBEA 4CV8A 2C0IA 3D7TB 3EWHA 4RX7A 5CENA 5E4HA 5A4CA 3VS2A 4I22A 4BCMA 5I9ZA 3ALOA 3PXQA 2C5YA 3NUUA 3ZRMA 3U6JA 3UYSA 4RZWA 3IDBA 2VGOA 2HZ4A 3H0ZA 2W1HA 5ANDA 5HTCA 3HAVA 4ALVA 3KU2A 3ZH8A 2OXDA 3NW7A 4D2VA 3RAHA 3BV3A 5AEPA 4O22A 5BPYA 3BYMA 4MNFA 2VV9A 1MUOA 2CKEA 5EW9A 3D5UA 3PE1A 5JQ8A 1TKIA 3GC9A 4FVPA 4FNZA 3GEQA 4KUJA 5D9HA 2UZOA 4XOYA 5KZIA 2C3IB 3MVHA 2J9MA 2RFDA 4N6ZA 2YCRA 4PDPA 3BGQA 1FINA 1Q99A 3BKBA 5ICPA 2X4FA 4O7WA 3NCGA 4FGRA 4R7IA 4HVSA 5CX9A 3W55A 3COIA 4BY9E 2YM6A 5KZ0A 3TZ9A 4O7NA 2UW8A 3I6UA 3ZC6A 2FGIA 3D15A 3NNUA 5ANOA 4AT4A 1OB3A 3NVMB 1W0XC 1BUHA 5K5XA 4M0YA 3F3VA 3TNPC 4ZZOA 2WXVA 1JSUA 4IVAA 2VTOA 4EOPA 4X3FA 4MX9A 4XNEA 5F94A 4TWCA 5M53A 4O21A 2XNNA 2WQMA 5CAQA 4DG3E 1UVRA 4E4LA 1OIRA 2G1TA 5IEYA 3RAKA 4FEXA 3IECA 3QGYA 5L2IA 2A19B 4FVRA 4AA4A 2PE2A 3TG1A 5J5SA 2XNBA 4HVHA 3OCSA 2Y8OA 3LKMA 4E6DA 3VUDA 3QUPA 3CQWA 5HNGA 4WSQA 3UIUA 1H0WA 3TNHA 5HESA 2EUFB 4BDJA 3C13A 4EH6A 3RK7A 3BHUA 3BWJA 3KEXA 4FV8A 4GIHA 4CXAA 4AZFA 1SM2A 1LEZA 3DOGA 3FLZA 4FIJA 2JIUA 2C3KA 5KMKA 4O1PA 2CGUA 4N0SA 3F5UA 4A9UA 4FC0A 4FEVA 1KE5A 3RTPA 1J7LA 4FSNA 5EQPA 2QI8A 3FY0A 3ZFMA 5FXQA 5CF8A 5TF9A 3TDVA 2PVMA 4F08A 2GNHA 2QLQA 2XP2A 4WHZA 4XJ0A 3ZLSA 4CRSA 4D2PA 4BI2A 4DEIA 5L3AA 4FICA 5L8KA 2PVNA 4QTBA 5EG3A 2ZV2A 5HLWA 4FMQA 1R0PA 1ATPE 3C4FA 5KE0A 3RZFA 1DI8A 1PJKA 5JN2A 3R8UA 2YLFA 3C4XA 2EXEA 3ZO4A 3MH2A 1M14A 5FXRA 1I09A 2VO7A 3TTIA 2E2BA 1YXVA 3F66A 4MBIA 4A4LA 4OTDA 1WVXA 2PY3A 3HP5A 4TXCA 4YPDA 3HP2A 2OICA 4IAKA 3T9IA 2YERA 4F1MA 2OG8A 5J79A 4A4OA 2XNGA 1OITA 3OW4A 3EKNA 4FZAB 4L42A 3FI4A 4OTHA 3U6IA 3NMUF 5CU3A 4WT6A 4MYGA 4P5ZA 4R3RA 4DN5A 4BFMA 2CSNA 2PWLA 3EFKA 3ZFYA 1BLXA 2BHHA 3I81A 3DA6A 3SLSA 3BI6A 2OKRA 3I4BA 4HOKA 2IVTA 2VWWA 4NM7A 1PRYA 3U54A 4X2FA 3L9NA 4WG3A 1YI3A 4U44A 4WRSA 1JVPP 3GC8A 4GS6A 5H8EA 3BYVA 3GB2A 4U45A 4IAAA 1Q8YA 2VZ6A 4B0GA 4DH3A 4I6BA 2WMRA 3U4UA 4HYSA 2C5XA 3OXZA 3R1QA 5EHLA 3R04A 4FOCA 4YSJA 2P4IA 3E7VA 2QR7A 3W8QA 2V7OA 3ODZX 3CKXA 3A7FA 4KKGA 3AT2A 4HNIA 4EHZA 1OI9A 1QPJA 2HZNA 5CTPA 4K33A 5DA3A 5HO8A 2IO6A 4DYMA 3EN7A 3EYGA 3SDJA 3O96A 3LAUA 3RALA 2XK7A 4KIQA 5M4IA 3A61A 4MXZA 3D94A 5HVJA 1CKPA 4O96A 4R3PA 4JAIA 4XP3A 4NJ3A 3FLQA 4DHFA 4E73A 3PIYA 3EFJA 3AT4A 3P23A 4X2KA 2WB8A 4BVUA 3SC1A 2GNJA 2XNPA 4CZTA 2PULA 3U9CA 1Z57A 5BYLA 1L3RE 1ZYJA 5CY3A 3IDPA 3FSFA 5M4UA 5EW3A 3PVBA 4FT5A 2R2PA 4DEAA 3BLRA 1HCLA 3KF4A 3FKNA 4J53A 2GDOA 5CLPA 1FGIA 5C8MA 4EUUA 1J1CA 3F9NA 3R63A 4BR3A 4LYNA 2ZV8A 5E91A 1M7NA 3R7OA 4EOSA 4BZNA 3OG7A 4DH1A 2HZ0A 2XIKA 5C9CA 1XJDA 4FT3A 4ZY4A 4D1ZA 4OGRA 5AA8A 2JGZA 5IA0A 4I4EA 4JI9A 4CMOA 4C33A 2BZIB 3T3VA 3HRCA 3V8WA 4M67A 3G6GA 3RINA 4L00A 5DBXA 2XYNA 2GNFA 1Q62A 3EN6A 1YHSA 3FBVA 3HA6A 2G2FA 4MD8E 3UDBA 4NM3A 2IW9A 3ZFXA 4GKHA 4F9CA 3FL5A 2W5AA 1OGUA 4TYEA 4CVAA 2W5BA 2VX0A 4D2TA 5EYKA 4CCBA 4QOXA 5BVOA 3HV7A 4XH6A 3R1SA 4O7YA 3NAYA 3PVGA 3BE9A 5KMNA 4O84A 4R8QA 1A9UA 2WMWA 1GIHA 3F7WA 3AQVA 1P4FA 5ANKA 5EI8A 4EEVA 3UMWA 4YTHA 1WVYA 5IA2A 4Z7HA 3O17A 4ACCA 3H30A 1PXOA 2OH4A 3BLHA 4G6LA 4CFVA 4ZLOA 2QR8A 3ENHA 3HZTA 2BMCA 2CDZA 3OVVA 4ZSEA 4IJ9A 3FJQE 2PE1A 2FB8A 3S95A 4RFZA 5HNIX 5M08A 3R83A 4DAWA 4EWHA 4HW7A 4W4WA 3JR1A 4O2PA 3DKCA 4WNPA 3CGOA 2ETKA 4RFYA 1UA2A 3ZOSA 3OTUA 2FYSA 4EKLA 3TKHA 3LCTA 2EXCX 4XHKB 4FKUA 3S1HA 3JUHA 3KC3A 4QP1A 4TTHB 4BIEA 1ERKA 1DAWA 2VWUA 4FT9A 3SRVB 1V0BA 3JVSA 3AXWA 2UZVA 4GVJA 4LOOA 1O6YA 4WD5A 4XMOA 3FKLA 3LXNA 2H34A 3EB0A 3EQHA 1Y8GA 2BDJA 4C59A 3R1YA 5IMEA 3R9NA 4OBPA 2VTNA 2PK9A 3TUBA 1JAMA 3GU5A 3EN5A 3BQCA 3CS9A 3SD0A 4D4VA 4L44A 2HXQA 3V51A 2P55A 5CYIA 2F7EE 1W82A 2H96A 2WTJA 3LXPA 5GHVA 3PP0A 4F65A 4H1JA 4X0MA 4DGNA 3DBCA 3NNVA 2O5KA 4G3CA 3MY1A 3MFRA 1ZRZA 3JPVA 4U81A 4MAOA 4DEHA 2QU6A 4J99A 4D0WA 3DKFA 5E90A 3CJGA 3OWJA 2XIXA 4XG8A 4C7TA 3UOJA 4NFNA 4DFUA 5KMIA 4K18A 4PP7A 4BGGA 4MBJA 3BHYA 3KXNA 4DGLC 3FV8A 5CSWA 3GCVA 4GFGA 3SV0A 3OBGA 5FBNC 3GU8A 3PA4A 5C03A 3RWPA 3A4PA 3ZRKA 3GFEA 2WZJA 3EH9A 4DEGA 4CKIA 3F6XA 5TT7A 3RKBA 3BEAA 4GU9A 4ZIMA 5JFWA 2XK3A 2UVXA 3P08A 4RFMA 3VBWA 1OPLA 4ALWA 2WO6A 5HGIA 5DR6A 4TRLA 4DCEA 3WILA 3UPXA 4KINA 3VJOA 2GNGA 4AFJA 2CGXA 4K1BA 1U59A 5AM6A 3GC7A 5GZ8A 4CZYB 1FPUA 2Z8CA 4FTLA 5E8WA 3AC1A 5HEZA 4AOJA 2BPMA 2BKZA 5DR2A 4AW5A 4BWXA 5J9ZA 3HGKA 3F5GA 4JG8A 3VF8A 5KMOA 3N51A 3GXLA 3UOKA 3FZRA 3QRJA 3SW7A 3L8VA 3NDMA 3R8VA 5A4EA 3RPSA 5BMSA 4RX8A 1OKVA 4QTAA 2YCSA 4BTMA 3KRRA 2IZRA 1B6CB 1JOWB 5HVKA 3MPAA 2GNIA 4L9IA 4MQ1A 3MS9A 4GG5A 5DHJA 4D9UA 3RM6A 3S2PA 5K5NA 2C3LA 4I23A 4W8DA 4U97A 4YJRA 5FDXA 3K3IA 4OBOA 3BYSA 4ZSAA 1G8AA 4FKSA 2GU8A 2B7AA 3MH0A 2OO8X 2WAJA 4G2FA 3TV6A 1GZKA 2CCHA 4FSTA 2JDOA 3NRMA 4WRGA 4FKRA 2WTCA 5DYJA 4FV7A 4DTBA 2DYLA 4DLIA 3GI3A 2C6KA 4BTKA 5I3RA 1KE9A 1LPUA 4IMYA 4QQJA 2ITYA 2Q0NA 2RIOA 4DH8A 4EZ3A 2WEIA 4Q5HA 1P4OA 4OLIA 3OZ6A 3POOA 4CTCA 3TACA 3RPVA 1NVRA 3DJ5A 4GW8A 4TWOA 3FL4A 4OTQA 4BCQA 3LFQA 4U7ZA 1YXUA
chains in the Genus database with same CATH superfamily
5JFSA 4LQMA 3QL8A 2XVDA 3WF5A 4ACDA 3OY1A 2UVZA 3AC3A 3LFBA 4YP8A 5I4NA 4DFLA 4NW5A 3PSDA 4UMPA 2OLCA 3G33A 1W2CA 3NUYA 3P79A 2IEWA 3QZFA 1SNUA 4OT6A 4J97A 4KA3A 3C0HA 3O8UA 4QP9A 4PMMA 2R64A 3ALNA 3KMMA 3MYGA 5GZAA 3HMMA 4HCVA 2ONLA 5IQBA 4ANQA 3U4WA 3QRUA 3HEGA 3KGAA 4G3GA 3QQFA 4EH8A 5EQEA 1WCCA 3V3VA 5T68A 3OOMA 3MB6A 2ETMA 4A06A 4ACMA 2JIIA 4FVQA 3TDWA 5FG8A 4FEWA 5IQHA 5EKOA 3JY0A 4ASEA 4L8MA 3W2SA 5DMZA 1KV2A 2WIPA 3MVJA 4LRMA 4GG7A 2VN9A 5KBQA 4JBVA 4YZ9A 4AA0A 5JMSA 1SZMA 2W1IA 4PX6A 3VHKA 2OK1A 3NYVA 4E4NA 4ANSA 2WD1A 2R3PA 4YNEA 4USDA 3TKIA 4QMMA 4D28A 5L8LA 4ZTSA 3VW8A 1FMKA 3UVPA 3LVPA 4ZY5A 2PZYA 2JDSA 3BLAA 3E8DA 3NYOA 2PMOX 1XR1A 3PJ1A 5HBEA 3KL8A 4B9DA 3NS9A 4KBKA 5IA1A 3WZKA 3R21A 2Z7RA 3MIAA 3PXKA 3AT3A 4IHPA 1VYZA 1W84A 5L8JA 3PPJA 1IR3A 2OJGA 4RJ8A 5I9XA 5CAVA 4DDIA 3GOKA 4QQTA 1WAKA 2ITOA 2GFCA 1UNGA 2FUMA 2R0UA 4PPBA 2I0VA 5BNJA 4DF3A 5FDPA 1OIYA 3Q2MA 3VONA 1H8FA 4PL3A 5CI7A 4I6QA 4FTRA 4FZDB 4PNKA 4HYHA 3NWWA 5ANGA 4IEBA 1OUKA 3LMHA 2GFSA 2YZAA 2BAJA 3CR0A 5DPVA 4F99A 3ZSHA 3MVLA 2YA9A 1ZLTA 4O1OA 2ACXA 1YI4A 3DBDA 5CVFA 5AP6A 5AAEA 4HCTA 3MDYA 4QP3A 5CEIA 3HAMA 4BDEA 1NT2A 2WMUA 1AD5A 3AKKA 4XV9A 5I3OA 1Q5KA 4I41A 4FZ6A 4LGGA 1R1WA 1W83A 2C30A 4DHZA 5K0KA 4QD6A 5GIOE 4RC3A 3AGMA 4AF3A 4ZS4A 3CQEA 3O2MA 3FHIA 4RA4A 2J0JA 1PXLA 2KTYA 3Q52A 2PVJA 4UY9A 4FSUA 4CKRA 1KOAA 3FEGA 3OTVA 2ITZA 4LL5A 3HX4A 5E8XA 5GJDA 4A7CA 3TV4A 3OW3A 5CXZA 4ORKA 5HIEA 3NUAA 1YI6A 4FR4A 4XG2A 4XBUA 3ZZEA 2PMIA 5AIKA 3RWQA 3UP2A 3DY7A 4X3JA 3UPZA 5BQ0A 4ITIA 4PMPA 4F1OA 3BCEA 3CBLA 3JY9A 1M2PA 2E9PA 4FKVA 3ID6C 5C8NA 3FMNA 4LUDA 3ELJA 1O6LA 2J4ZA 3ZLXA 1AGWA 5FQDC 4GJ2A 3MIYA 2WGJA 3ZDUA 3D7TA 1CKIA 4FI1A 4Q9SA 2YIRA 3W8LA 3CY3A 1YHWA 3O8PA 2E9OA 2B55A 1TZDA 2C6DA 3OOGA 5C01A 2R3RA 3QLFA 5LWMA 1G8JA 2YABA 4IBMA 1JWHA 3VUKA 2FA2A 3VULA 4U43A 3QKKA 4U6RA 4DHJA 5JH6A 3DGKA 3AD5A 3GGFA 4QNYA 4Z3VA 4EORA 3MA6A 4JVGA 4RQVA 2X0GA 1QCFA 4CMTA 3MN3A 4U8ZA 5AP4A 1Z5MA 2J0IA 3NUSA 3EHAA 3E7OA 4FG9A 4R7BA 3C0IA 1JNKA 4DDGA 1ZYCA 2VX1A 2XNOA 4BDHA 4XEYA 2KULA 3UG2A 4YTCA 4EJ7A 4IH8A 3IW6A 3UIMA 4MVFA 3LLAA 4AXCA 3QRIA 1P2AA 3DKOA 2WU6A 5AM7A 3ZUTA 3MVMA 5HX6A 3ORXA 2YWPA 4F9BA 5AV0A 5I0BA 3WI6A 5CAOA 5EK7A 4U3YA 3WE8A 5JGAA 5IDNA 3ATSA 3UOLA 1OL1A 1HOWA 4IVDA 5FUTA 5J5TA 4S2ZA 4F0IA 2GQRA 2JKMA 4KIKB 4R6VA 5F1ZA 1ZY4A 4RJ5A 5LVOA 5EHOA 3FAAA 1QPCA 1MRUA 4O2ZA 2YJSA 3W18A 1OKZA 1R39A 5IPJA 4LRJA 4JDKA 3DB8A 2R7IA 1ZYDA 4JR3A 4FZ7A 4YURA 2IVUA 2PZPA 5CXHA 2NRYA 2UZDA 3RPYA 2ITQA 5EM7A 2CGVA 4WUNA 4OTFA 3V5TA 4OBQA 4RRVA 1XHAA 3E93A 3LZBA 4RJ7A 1Y91A 4W9WA 1V0OA 3D5WA 1S9JA 5LWNA 4OTPA 5C8KA 4L7SA 3N9XA 4YBJA 4ZLYA 2EB3A 2QOQA 4FV0A 3TNIA 3GC0A 4U80A 1YOMA 3OCGA 4U3ZA 1FBNA 2P2HA 3VW6A 3QTWA 5EDQA 4F1TA 3O5AA 4BL1A 4B4LA 2QOCA 1GZNA 3UVQA 4EKKA 4FIHA 4H58A 4CQGA 5E8SA 5JK3A 4C3FA 5CZIA 2Q83A 2WKMA 3PY0A 5G1XA 3P1AA 2VTPA 4K0YA 5DVRA 5KMLA 3Q4UA 1UU7A 5AUVA 4EHGA 2XKCA 2VTHA 2C0OA 4RIXA 1H4LA 3RGFA 1PXIA 3E63A 3LM5A 4XS2A 2VTAA 5FWKK 3UIXA 2Y6OA 4DINA 2YHVA 3DXQA 3LFSA 2O3PA 3TN8A 2WMAA 3PRFA 4IB3A 3RHXA 3AC2A 4GJ3A 3ZLYA 1XQZA 1O9UA 4K2RA 4BTJA 2AC3A 2R3FA 4AG8A 3W0RA 4II5A 2QG5A 3FZSA 4KBAA 3VS0A 3ORNA 3R2YA 4JRNA 3HNGA 3KK8A 3W2CA 3ZYAA 4C57A 4UMUA 1H0VA 2JDTA 4GUEA 2DUVA 2WTIA 1JLUE 4EOLA 4AQKA 2DWBA 2WMQA 3P0MA 2X6EA 2BIKB 2FSTX 4QP7A 5ACBC 4DFXE 3DDQA 4FE2A 3UDZA 1YKRA 4C34A 2V0DA 3EL7A 3FMLA 4DEEA 2XZSA 4MD7E 3UQFA 4CNHA 4J95A 4KIKA 4HZRA 1LR4A 3GNIB 3VBYA 5AFVA 4H05A 2E9VA 5D1JA 1REKA 3I0QA 4XG4A 2X9EA 1L8TA 1MRVA 1H25A 2UW9A 3KK9A 4AA5A 4CFWA 3DPKA 3QKLA 1UKIA 3EQCA 1JKLA 3H4JA 3LJ1A 3QXPA 4TYIA 4DBNA 3KXZA 4LV8A 5JFVA 1B39A 1DI9A 4F0GA 4BI0A 5CAUA 4DFNA 5E8TA 3MJ2A 3DAKA 3SQQA 5CT0A 2ITUA 1ZXEA 2VU3A 2Y9QA 3WYYA 4YU2A 4TWPA 1XH9A 2FH9A 2R4BA 4Y46A 3UODA 5JRSA 3TUDA 1H01A 2X2KA 3A7JA 3H0YA 1ZOEA 4V0GB 3UJGA 1WBTA 3L8XA 3LCOA 3PY1A 1LP4A 4TNDA 2WMXA 2C69A 4O0WA 3LW0A 1FQ1B 3AOXA 4M69A 1JKKA 4IX4A 2J2IB 2R3HA 4PWNA 5H3QA 3DFAA 4IM3A 4E26A 4FKTA 3TIZA 4APCA 2J0KA 3TYKA 5ETCA 3FI8A 5C27A 4E8AA 4DTAA 4FSYA 2AQXA 2XIRA 3KRXA 5F4NA 4IDTA 3F2RA 1JQHA 2QHNA 2YM4A 3GENA 4BCFA 3FY2A 3RJCA 3FYJX 3R30A 4LMUA 3MA3A 5DE2A 3IS5A 3WE4A 3VBQA 3CKWA 4W4XA 3E87A 3UNZA 3O8TA 4UALA 4UWYA 4EBVA 5CSXA 4WG4A 5EQYA 3ORPA 4U41A 4AACA 3PXZA 1GY3A 3UNKA 4P7EA 4RBLA 5KNJA 2WQEA 3LCKA 2OBJA 4FKOA 4PDOA 4ZOGA 4RPVA 1JBPE 4PY1A 1A06A 1SYKA 1OVEA 2H6DA 3AGLA 2VAGA 3OWLA 4NL0A 1TVOA 3BGZA 1OPKA 4HGSA 2ZYBA 4QMTA 4BGQA 4EK3A 4FTKA 4O7LA 4LGHA 2OU7A 3Q4CA 4G3DA 2PZ5A 3R0TA 4J98A 5B7VA 1BKXA 5KHWA 5JZNA 4BDAA 3GBZA 4PPCA 4AZTA 3NLBA 3CC6A 4GK4A 1Z9XA 1ZZLA 4HGTA 3RCDA 2I0YA 3BYOA 4FSQA 3CSVA 1JKTA 3OXTA 4AW1A 4PDYA 3FC2A 3MBLA 5DG5A 3FXZA 3PJ2A 4QMZA 4BHNA 4MWIA 5F9EA 4O0UA 4M8TA 2UZWE 4H3QA 4CEGA 3II5A 4F6SA 4FG8A 4IWOA 4EHVA 2XRWA 4N4SA 5A4QA 3EN4A 3E5AA 3P7AA 1CTPE 2W4KA 3PYYA 3JYAA 2YIYA 3QTZA 1QL6A 3R6XA 4FIEA 2OIQA 4GFMA 4I93A 5CS6A 5TE0A 2CKPA 3ERKA 4GEOA 5KKRB 3UBDA 2QCSA 4P4CA 3V01A 3DT1A 2G2HA 4BKJA 3IOPA 5A6OA 5CEQA 4EOQA 2GHMA 5GJGA 2PZIA 2BFXA 3EFWA 1H1PA 2RFNA 5EHYA 3EQIA 3D2IA 1PHKA 3SOCA 4ANOA 4ERKA 4I6LA 4E93A 2IVVA 5ANIA 2VNWA 1YXXA 2XARA 4YZCA 2B52A 5BVEA 3A62A 4ZY6A 3U9NA 2HYYA 4X2JA 3S3IA 3TIYA 5TKDA 4AGDA 3QQJA 3CXWA 3MB7A 2AC5A 2OI4X 2GPHA 3L8PA 3OUNB 5T6KA 4MWHA 4NSTA 2B54A 2HZIA 4L3PA 4O4BB 2J51A 3LM0A 5EYCA 5LMAA 1Q8WA 3IG7A 3F61A 4MNEA 3RK5A 5JQ5A 4U40A 5KO1A 2C5OA 4HNFA 5KMMA 3CPBA 4KD1A 4O6LA 4QMXA 2PZRA 4EONA 3AMYA 5BVFA 4QPMA 3PIZA 4NEUA 4KWPA 1F3MC 3TJCA 4YLKA 3EQRA 2R3QA 4ZSLA 4C62A 3ZO2A 5BUJA 5M4FA 3PFQA 3E3PA 4XRJA 4PMSA 3GQLA 4F7LA 4QYGA 4QMSA 3OHTA 3FXWA 5CALA 5J8IA 2XK8A 3OT3A 2QOOA 3PPKA 1FVTA 1VJYA 2E9NA 2YLEA 4FUYA 4FV2A 5E8UA 3ZUVA 4GK3A 5CEOA 3NZ0A 4DFYA 1WBNA 3P86A 5LXMA 4RT7A 2RFSA 3OD6X 5IDPA 2WTKC 5GNKA 2XK4A 2YN8A 4F9WA 4JT3A 4G3FA 2YAKA 3KXMA 4C3RA 1Q8UA 4ZMEA 3ACKA 4X2GA 5CNNA 4UYNA 1NW1A 4X21A 4LOQA 2OFVA 5ANEA 3WBLA 4ONAA 4BB4A 1GZ8A 3ZM4A 5M44A 4HJOA 5M09A 3DQWA 2GTMA 5J9LA 4IZAA 2VD5A 4PRJA 3P5JC 3MFSA 3OUKA 3KN6A 4O0YA 4YTFA 2F7XE 4FTUA 5EH0A 4IQ6A 3IW4A 4JRVA 4MXAA 4XOZA 4EZ7A 2XAMA 3DAEA 2W99B 3FMHA 4FV6A 3ANRA 3AG9A 5HU9A 2C6EA 3FLNC 3QHWA 3VS5A 2QOLA 5L6WL 2XA4A 2YIQA 3KULB 3Q4TA 3R8ZA 4AN9A 5AX3A 5IMXA 4BKYA 4GYGA 2HWPA 3BU3A 1Y57A 1OL6A 2YACA 2I0EA 2WELA 4MK0A 4RJ3A 4AXAA 5DGZA 2XRUA 1O6KA 3VUGA 4O7TA 3L1SA 3FZPA 1ZOGA 4GIIA 5EOLA 3CLYA 3Q96A 4QO9A 3RBWA 5LQFA 3O7LB 2UZBA 2NP8A 4UB7A 2OW3A 1IG1A 3DV3A 1Y6BA 3MH3A 4S30A 5LARA 2IZUA 4I92A 1K2PA 1GNGA 1IAHA 4BCIA 4QTCA 2WHBA 4YR8A 3SG8A 2ZDTA 4H3BA 2OFUA 2VRXA 2ITNA 2W96B 5HI2A 4ALUA 4CKJA 3BL9A 4RIOA 3ET7A 2YCQA 5TOZA 3D2KA 3FQSA 3R7VA 4D4SA 4YC3A 4QMYA 3I0OA 4K11A 4L68A 4XLVA 5BUEA 1ST0A 3BL7A 2O8YA 4C8BA 2UW5A 1Q3DA 3KB7A 3V8TA 4YNOA 2WTDA 4E6AA 2PL0A 3O23A 3FLWA 3R7IA 3NFGB 3KFAA 2BZKB 3ITZA 1E9HA 3BZ3A 3QLGA 4O0XA 4TYHA 3AMAA 2ITVA 3ZC5A 5EDPA 3ODYX 2VWXA 3VWAA 4FL2A 4EOJA 2RL5A 4H36A 4JQEA 4LG4A 5LVLA 4R78A 1P5EA 5HTBA 2PPQA 1YRPA 5K4IA 2R3KA 4YJUA 2GHLA 3LPBA 3NIZA 4D2WA 4EOMA 2W1GA 5CWZA 3R02A 1YWVA 5D10A 3H10A 4Y83A 5HIDA 4TYGA 4C2VA 1Q41A 2W05A 3R28A 4XV1A 2CN8A 2FSOX 1CMKE 3DJ6A 4E4MA 1XBCA 4DGMA 2PSQA 4O38A 5BYYA 3PFYA 5HX8A 2YDIA 3I5ZA 4O6EA 3EKKA 3R22A 4NJDA 5CSHA 3SHEA 4QTDA 4BIBA 1J7UA 4F9AA 4JLCA 4IM0A 2QO9A 4G6NA 4BYJA 2X8EA 4M12A 3W33A 5EYMA 5IZFA 4I0SA 5KUPA 5LCJA 4UV0A 4QMPA 4ZTLA 3TKUA 3M2WA 3IONA 3GP0A 2XJ1A 3W1FA 2WTWA 4ANLA 4D1XA 3P4KA 4AE9A 3Q6UA 2BTSA 4CFNA 3CP9A 3L9PA 5FRIA 3PWYA 2CNVA 2ITTA 3UE4A 3KCFA 1OPJA 5HE3A 4I5HA 4S33A 4IXPA 4ITJA 3H9FA 1CSNA 3B8QA 4EJNA 3Q9XA 3Q5IA 4RIWA 5IH6A 5K9IA 5DR9A 3RCJA 4L52A 1PMVA 2JAVA 4D5HA 4HPUE 3VF9A 1HCKA 3DKGA 4RWJA 5GJFA 3HMPA 4RMZA 3RAIA 2JITA 4FT7A 4QYYA 4E5AX 5LMBA 4X6RA 4RVKA 5E92A 4G3EA 5CF5A 5JFXA 4L3LA 4A9TA 4EH2A 4X2NA 2Y4PA 3CY2A 1W7HA 1XH4A 2HELA 3IPHA 4U5JA 4ZS0A 4NZWB 4J1RA 3RM7A 3SXSA 4BCJA 2OXYA 3UQGA 4I94A 2ZMDA 5CF6A 1E1XA 2IW8A 1YDSE 1OECA 2OXXA 4BDIA 2IG7A 4C02A 3F3UA 4M69B 5E1SA 3W2RA 3BV2A 4FSWA 4IX3A 3CEKA 1KE8A 4WOVA 5IA3A 3F2AA 2W9FB 5HVYA 2AYPA 3Q9ZA 3PWDA 1SNXA 5L2QA 4CT2A 4FV9A 2BCJA 2ETRA 3QD0A 3QQLA 3O51A 4IB1A 4NK9A 5HG9A 4FT0A 3KMUA 2XKFA 4ASXA 5LVMA 4F78A 3RI1A 4QMOA 1VR2A 3AC4A 3NCZA 4LGDA 4N6YA 4DTKA 3V5JA 2PMNX 2WNTA 3PG1A 3ROCA 2OIBA 3VUTA 5AIRA 2I7QA 4F09A 3MV5A 4MHAA 5HCYA 3UMXA 4YZMA 4HGLA 2V62A 3V5WA 3LXLA 5EI6A 3FYKX 3EQDA 4UWBA 1FOTA 4RC2A 4AZEA 5HZNA 4UMRA 2ZOQA 2F9GA 5CEKA 4XLIA 3VO3A 1XO2B 3JS2A 4ZP5A 2A1AB 2VWZA 4CLJA 2C6LA 3I60A 3QALE 2HY0A 2X4ZA 2NRUA 3FE3A 3AC5A 4G5PA 4QPSA 4EH4A 2GQSA 4M15A 4ZZNA 4EUTA 3FQHA 2XB7A 1XBBA 2QO2A 3HVCA 3D7ZA 4JR7A 1GIJA 3MJ1A 2HAKA 2VTQA 4BN1A 3UP7A 4GCJA 4EOIA 1J3HA 4M66A 3EQGA 2QNJA 4H3PA 3LHJA 3I1AA 3IW7A 3DBFA 5HCZA 1WBWA 3WF7A 3PA3A 3UDTA 5BVNA 4WIHA 3K5UA 4JG6A 3KRJA 5EM8A 5HE1A 2R3GA 1OL7A 4IZ7A 5EOBA 3PJCA 2WMSA 4C36A 4CV9A 5G6VA 3QD3A 1YDTE 2G01A 4A07A 2C68A 4G5JA 2ERZE 3LCDA 5JEBA 2SRCA 3QQHA 1ZOHA 3K3JA 3PSBA 2OZAA 2VTSA 4I20A 4XG7A 3T9TA 1URWA 5I9WA 1J7IA 2YM8A 2F4JA 4XUFA 2OF4A 4ZTHA 2PE0A 4TN6A 3OS3A 4JMQA 4FEUA 4QQCA 1WMKA 4M13A 3RHKA 4YJPA 4YO6A 4DH5A 2BZHB 2BRHA 1OKYA 4DGOA 2C4GA 4M0ZA 5EW8A 2DS1A 2J5FA 2JBOA 4C38A 1G8SA 3RPOA 4GUBA 4JIAA 4USEA 3COHA 3R9DA 3ULZA 3BGPA 5FTOA 3IK3A 4D0XA 2C5NA 4D9TA 4QYHA 3EMGA 2EXMA 4WKQA 1U54B 3TWJA 4JDJA 2X39A 2XCHA 1XWSA 3NYNA 4R1YA 3LCSA 4LMNA 5J1VA 2NNWB 2JFMA 4CT1A 2QODA 2IVSA 3PE2A 4B6LA 2HIWA 3VS1A 3MWUA 1SVGA 3F82A 3ZSGA 3ORTA 2UW7A 3ZHPC 4CSVA 3Q3BA 5H2UA 4G34A 4FV4A 3AD4A 4HVIA 3DS6A 4FODA 4UEUA 2RGPA 3EIDA 2Z60A 3G6HA 3C5IA 3NR9A 4JJRA 3QRTA 3TNQB 2BALA 3FMMA 4XYFA 5FEEA 4JBQA 4NH1A 3TZMA 5I5ZA 4K8AA 2CKQA 3E3BX 4EQUA 2E9UA 3F3ZA 4MXXA 3WOWA 1PF8A 4C4HA 1Q8TA 5AA9A 5ETIA 3FI2A 3QA0A 1K3AA 3FMEA 5HU3A 3GCPA 4L45A 2A4LA 4C58A 3P7BA 2CKOA 1V1KA 5CQWA 5DOSA 4KB8A 4EL9A 3Q6WA 2ERKA 4QMVA 3D0EA 4R5SA 3VUHA 4BCKA 4XP2A 5KMJA 3SVVA 3EN9A 5J87A 4TYHB 2VX3A 3HUBA 5D12A 3QQKA 2QHMA 3QYZA 3E8NA 2W17A 3MSSA 3VRYA 3QTSA 4FV1A 1KOBA 3NGAA 4KNBA 4MNEB 5BUIA 3LFCA 3IKAA 5DT0A 2UZLA 3A7HA 1YVJA 4OR5A 1W98A 2UZTA 2XMYA 4LRKA 3WARA 3QWKA 3NUNA 4O0SA 4CZUA 2BTRA 3BHHA 4EK6A 5DEWA 3O50A 4UWCA 5ETFA 2J5EA 5CVGA 2PVRA 3KA0A 1NA7A 2V22A 2WPAA 1Q97A 2PVLA 4O81A 5HO7A 3PJ8A 1DM2A 3KREA 1OKWA 4YC8A 3QQUA 4IC8A 5L4QA 2XK9A 3M11A 5HG8A 3BX5A 4C2WA 2YDJA 4KAOA 5AUZA 3SXFA 4RIWB 4K6ZA 1JSVA 3BPRA 5K0XA 3D9VA 4R5YA 4AW2A 4FNYA 3REPA 5GZ9A 2WQOA 1H26A 4O91A 3KCKA 3QKMA 4IANA 4FKLA 3OEZA 1FVRA 3GCQA 3LFFA 3HV3A 3EZRA 1UU3A 3E92A 3EOCA 4FSRA 1G8KA 2X0OA 3NIEA 4PV0A 3RK9A 1JKSA 2BR1A 3R00A 2GHGA 2J90A 1XMLA 2XIYA 3DQXA 2WU7A 4Z7GA 2CJMA 3CCNA 4AX8A 2YDKA 3L8SA 3NUXA 5EFQA 2HW7A 3UGCA 4I5CA 3OP5A 3UYTA 3V8SA 1H27A 4UMTA 2B9FA 4AWIA 1H08A 1YDRE 2W1EA 5J95A 3CD3A 3Q04A 5DNRA 3TEIA 4BBMA 5HCXA 4AW0A 4CG8A 3Q9WA 4IB5A 4B7TA 3R01A 2HW6A 1PYEA 4FKPA 3LFDA 3IQ7A 5CEPA 3UG1A 4CGAA 3UO5A 5JRQA 4E7WA 3A8XA 5ANJA 3C4ZA 1PXMA 2FSMX 4DEBA 4QYFA 4Z55A 1UV5A 5A4LA 2A2AA 4E1ZA 5DLSA 2YAAA 1U46A 3ANQA 5AP3A 1URCA 5EYDA 3VC4A 1A48A 1X8BA 3DZOA 3IW5A 5GIPE 4FTJA 5AV3A 4AN2A 3R7GA 4IAYA 3DU8A 3BLQA 1PYXA 3MW1A 3ORZA 4FKIA 3ORKA 1LUFA 4HGEA 1WBSA 4ANNA 4I24A 2G9XA 2ZV7A 3H9RA 4PDSA 1PY5A 1Q61A 3GQIA 4RLLA 3VRZA 3QZGA 3WF9A 4E4XA 2BZJA 2JEDA 1R3CA 5DEYA 5AUTA 2X8DA 5CI6A 1IA8A 3THBA 3OEFX 4GVAA 2X9FA 4B99A 3BU5A 1RDQE 2CNQA 2QG7A 3IDCA 5HBHA 3F3TA 4ACGA 4DE4A 4FEQA 4YSMA 1AQ1A 2UV2A 4I4FA 2Y6MA 3POZA 2WIHA 3OT8A 2OGVA 3R1NA 5HOAA 3ZLWA 3D83A 2R3NA 2VGPA 5ACKA 4IB0A 3E64A 2WOTA 4EYJA 3CD8A 4V01A 3FI3A 3ZBFA 5C26A 2CHLA 4TZRA 2Y4IB 1CM8A 1WBPA 5B2KA 1M7QA 4HVGA 2R0IA 5LCKA 2YM3A 4BWKA 5HQ0A 4P2KA 4JDHA 2PYWA 4EBWA 4G31A 4L67A 3ZTXA 4AGUA 5AR2A 4BDGA 3CE3A 2W06A 3MFTA 2IWIA 5M55A 3G0FA 5CF4A 4RWKA 4C61A 2YEXA 4F0FA 4AZSA 3GVUA 4FTQA 4ACHA 1IRKA 3CGFA 4QP4A 2B9HA 1ZAOA 3KRLA 4NW6A 5KKRC 3LE6A 5IA5A 4F64A 1PMEA 1WBVA 2HXLA 4JAJA 3ETAA 3OXIA 3RNYA 3C4WA 3P7CA 2JDVA 1H1WA 3K54A 2C6TA 3ORLA 5AADA 3AMBA 3FMDA 1ZYLA 2W4OA 2XKEA 5FD2A 5FTQA 1KUTA 4EH5A 3QU0A 1YXSA 2XK6A 4EOKA 4ZTRA 1RE8A 2XS0A 4BWPA 4ZXTA 4ZJVA 4WUAA 1ZMVA 3R8PA 4XV3A 4E20A 1T46A 5FM3A 3JXWA 5DRDA 5E8YA 3CTHA 3QD2B 3OFMA 4NIFB 4DEDA 3W0MA 3A60A 5FEDA 5A6NA 1UNHA 3HKOA 3N4TA 5I9VA 2WTVA 4I5MA 3FC1X 1U5RA 3C50A 3RZBA 4ZJJA 4D5KA 4N70A 4UMQA 3Q2JA 4IWDA 2EU9A 1M2RA 4ASZA 2XYUA 4R3CA 4FL3A 4UXLA 3A8WA 3RMFA 2W7XA 3OWKA 5D41A 4DGGA 2YIWA 3DAJA 3LQ3A 5BX0A 4W4YA 4FNXA 4H1MA 3RNIA 2UZNA 4KSPA 4LFIA 4W8EA 4BC6A 4NKSA 3WIKA 4QDVA 5E9EA 1PXNA 4GSBA 4HYUA 2A98A 4GL9A 3R9HA 5EI2A 4WA9A 4WNKA 1UU8A 2QQ7A 3HMNA 1BYGA 2X2LA 1OBGA 3LQ8A 2PU8A 2WTKB 3P5KA 2UZEA 2YWVA 4FA2A 4JQ8A 2O64A 2XKDA 4FZFB 5IKWA 3BHTA 4I6HA 2V55A 2VTRA 3ROYA 3PXRA 3W2PA 3F7ZA 4PP9A 3W0PA 3PDTA 5HE2A 5IH4A 1BMKA 3A7IA 5E8VA 4C4IA 4GK2A 4YJQA 3F2NA 4GH2A 4G1WA 3R7EA 1PMNA 5IG1A 2BRBA 1RW8A 5K4JA 3GU7A 4BI1A 4EHEA 5CZHA 2CNUA 4ZTNA 3AD6A 1SMHA 2B9JA 3QBNA 4O7VA 4O86A 4HCUA 2R5TA 1OL2A 3SX9A 1NY3A 2W1ZA 4TW9A 1WVWA 5HICA 5IA4A 3KXHA 3ZDIA 4NYEA 5M07A 2P3GX 1JSTA 3U8WA 4EK4A 1XBAA 4FSMA 4RWIA 4O7ZA 4TKSA 2DQ7X 4FTCA 4MCVA 4U79A 4GMYA 4ARKA 3MESA 4Y85A 3R73A 4F7JA 3DXNA 4Y8DA 2JAMA 3LLTA 4DH7A 5DWRA 3DK3A 3QUEA 4FTIA 3ENMA 2OZOA 2XBJA 4IFGA 3SXRA 2ZV9A 4BBFA 2NPQA 4GYIA 3EQBA 2I0HA 4BGHA 2C6MA 4F7SA 3FSKA 4IAFA 5AR3A 4AXFA 5FBOA 2FO0A 2YJRA 1YOJA 3H3CA 2J50A 3T8OA 5JGDA 5KHXA 4YPSA 2IW6A 2GCDA 3L9MA 5AR4A 3G2FA 4L6QA 5M06A 4RIYA 4RJ6A 1PMUA 1MRYA 4JG7A 4ZJIA 3UO6A 3VHEA 4BDKA 4BICA 4KABA 4YJTA 4ANBA 2YITA 2X6DA 3C5UA 1VZOA 4E6CA 4I6FA 2JD5A 4UN0C 5LJJA 2X81A 3QHRA 4FTAA 3OMVA 2OJJA 4KRCA 3C51A 4ANMA 4D4YA 3EZVA 5CAPA 1LEWA 4KKEA 3OCBA 4D58A 3G51A 3G90X 4AZWA 2GS2A 3SRVA 2QKRA