1U4PA

Crystal structure of human rantes mutant k45e
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRENRQVCANPEKKWVREYINSLEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Attractant
molecule keywords Small inducible cytokine A5
total genus 12
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u4pA00
1U4LA 1U4PA 1S4ZA 2D9UA 1MSHA 2M2LA 4RAUC 2FINB 1B53A 1X3PA 1G91A 1JE4A 5COYA 3P7JA 3KBXA 1U4MA 1XX8A 1WTRA 1DONA 2HCCA 4IUPA 2B2YA 2B2TC 4IUQA 1PDQA 3G7LA 2Q8RE 2H1EA 1QNKA 1IL8A 2RSNA 4X3TA 5CORA 1J9OA 2HUGA 3F2UA 4RA8A 5EKIA 1AZPA 4IUTA 3DM1A 3UI2A 3LWEA 1O80A 1GUWA 1WTWA 5AFWA 2KEEA 4HCSA 2B2WC 1MGSA 5EQ0A 2DY7A 2KOLA 4ZLTF 1Q3LA 1HA6A 1RODA 1NR2A 5D65A 5T1IA 2NWGA 1EOTA 1O7YA 3KUPA 1QE6A 4U68A 2B2WA 1MI2A 2EOTA 2SDFA 4MHEA 1EIGA 1DOKA 3D6WA 4XT1B 4CJ1B 1BBXC 1G6ZA 1HUNA 1MSGA 1VMPA 1RTOA 2JYOA 3MTSA 2L4NA 3H91A 2L1BA 1SDFA 4OIJA 3DEOA 3I3CA 1F2LA 3I8ZA 2Q8TA 3TN2A 4HEDA 1IKLA 2K05A 4R8IA 1WVLA 2KVMA 1NAPA 2K04A 4CJ2C 1DZ1A 1F9PA 2B2UA 1B2TA 2EPBA 4CJ0B 2K28A 2KEDA 1ZXTA 4MN3A 1M8AA 1CA6A 3GV3A 4XT3B 5EPJA 2B2UC 2J7ZA 1JICA 1PFBA 3TZDA 1X3QA 2FHTA 1U4RA 4IURA 2CVRA 2RA4A 4HAEA 2X6GA 4R9WA 1KNEA 1RHPA 4X3UA 1HRJA 1WD1A 2B2YC 2B2TA 5EPKA 2FJ2A 1HHVA 2RSOA 1EIHA 4ZK9B 1CA5A 2FFKB 1PFMA 1SAPA 1F9SA 1B3AA 4XDXA 3IL8A 1IKMA 2RVLA 5JJZA 1J8IA 1KNAA 1TVXA 1F9QA 3N52A 1BNZA 4LMQD 4NW2A 5EJWA 4ZAIA 4QUFA 3Q6SA 5CMDA 1A15A 5D14A 4RWSC 2BDNA 1NR4A 2K03A 2X69A 1PLFA 4IUVA 1X32A 1CM9A 2L12A 2X6LA 3I91A 1PFNA 2MPMA 1WTOA 1WTXA 2XIWA 3I90A 1F9RA 3FDTA 1RTNA 1SSOA 1EQTA 3R93A 4ZKCB 1WTPA 2HDMA 2R3ZA 5EPLA 3GV6A 5CBAE 1HUMA 2L9HA 4ZKBB 2N55A 4QUCA 1WTQA 3MWYW 4UAIA 3QO2A 3FPUB 2KECA 2MP1A 2MGSA 4IUUA 1HFNA 5E4XA 1ESRA 2MJ8A 2FMMA 1WD0A 3IFDA 2JP1A 1E0BA 4O42A 3DEPA 5CBEE 1WTVA 1G2TA 1BF4A 1EL0A 1AP0A 1ML0D 2NYZD 1AZQA 3SVMA 2HCIA 4X3SA 1DOMA 1HFGA 2IL8A 3HP3A 1ICWA 1NCVA 2B2VC 2B2VA 1ILQA 1DOLA 2KUMA 2N88A 4X3KA 1RJTA 1XYIA 1B4OA 5DNFA 1BO0A 5T1GA 4HSVA 4DN4M 2K1BA 2HDLA 3ONAB 2VXWA 1B50A 2DY8A 5E4WC 1C8CA 2K01A 1ILPA 4OIKA 1VMCA 1QG7A 1LV9A 1G2SA 2NZ1D 2EE1A 1O7ZA 2L11A
chains in the Genus database with same CATH superfamily
2M2LA 2FINB 4OWTB 2LFNA 2WIIB 3S9WA 1JORA 4RKLA 3GTPH 4RGOS 3RD4A 1JT8A 2WAQB 2A19A 2DN8A 1GUWA 5EKKA 2ID0A 5KNDA 4P73A 1PH4A 4JVZA 4JI6Q 3NELA 4XQQA 2EY2A 4A3JH 1KQSA 1XJVA 1YZ6A 3QG1A 3PIPA 4GKKL 2B2WA 3CCUA 4CJ1B 1DM0B 3D4RA 2A1AA 4ABNA 1SFOB 3A8KE 5JPMC 3RN2A 4OIJA 5M3FG 3L3OC 4HEDA 2CCZA 2XVSA 2JA6G 3I4MH 2O5JC 4RG1A 4ODGA 1OXTA 2NB0A 2WB1G 1NTGA 4KJOA 1C7YA 4A3MG 1M8AA 4I65A 4QQBX 4QF4A 4JI8L 3VR2A 4L8JA 3OYYA 2NUCA 5CC4A 4TKOB 1Y14B 4KTAA 2LY7A 2RHQB 1EFWA 3CP0A 4NKLA 4ZK9B 2JK8A 3RZOH 1LTBD 3KK7A 4F87A 3IL8A 3SDZA 1TVXA 5IY0A 1KDCA 3F2BA 3S14B 3ULPA 1K83H 3BDLA 5LMNQ 3R2TA 4QY7A 3OHXC 1CKNB 2AUKA 4A3KG 1WTXA 1C48A 3QOLA 3TZUA 4LFCL 1EQTA 1HNWQ 3GDEA 5CV9A 2JXMB 3F2DA 4O1NA 2UUBL 1PTOB 1JJGA 1SE8A 3DM3A 2Q2UA 1YIJA 4NMZA 2OCEA 3GTLH 4FF1A 4DGZA 1Y1WH 4MTNA 2AQ3B 1FVIA 2Z6BA 3E0JA 3PO2G 5CYUA 2BDOA 4A75A 4B3SL 3D8GA 4X3SA 5M5YB 1ILQA 3PO2B 3NBHA 3MXNB 1M4VA 2A69C 3EN2A 3GTLB 2Z4IA 4XYOA 3H94A 1X3PA 1PTOD 1OTCA 1FNWA 3BYYB 4JI3Q 5J22A 3I4NH 1TS4A 1MIUA 5BN5A 3NTKA 2BE5C 1AZPA 2R93G 4ZUIA 3BJUA 1H9RA 4FYDA 4UP9A 4U673 1I4RA 1XMOL 1LYLA 1CSPA 1KRTA 3LX0A 1Z7TA 1VQCA 4FNFA 1LTAD 4GN4B 4B08A 2A8VA 2R92H 1VQNA 1KC8C 4DV0Q 3HOYH 3PMFA 2EY1A 3J81i 2FXQA 1GUGA 1FGUA 5IWAL 1KRSA 1XPUA 1BOSA 3SK8A 2K28A 3VA5A 1CA6A 1QZGA 3M4OH 2CW0D 3RR5A 3P75A 2VZAA 2Y0SB 4JBMA 4Q5VA 2YU9H 5IGGA 4DAPA 1HRJA 4JV5L 5M3MG 1SNCA 4QGUA 1QNUA 4HIOA 2DNCA 3VYRA 1H9KA 2YTVA 1JJCB 3FKIB 2VW9A 3NBIA 4DV6Q 1IBLQ 5EBCA 2BA1A 2J4XA 5C4JH 4P2CB 3T4AC 1X56A 4BWGB 1H9JA 2SOBA 3T1HL 2X69A 2PZUA 1PLFA 4XYQA 5C5LA 3T13A 1NSNS 3HKSA 3CPFA 1ZYRC 4LF5L 3AFPA 2HDMA 3GV6A 4PV1C 2B8GA 2I07B 2SNMA 4ZKBB 4H44C 4LUOA 2C9OA 3K7AH 4DV5Q 4BY1H 1S72A 4BY7B 3E5SA 4M1UB 5CBEE 1PFSA 1WTVA 1TWGH 1CZGA 5ELOA 4DV7L 1SR3A 3W1GA 3CXCA 5FOBB 4LJZC 2HCIA 2VQEL 1I3QB 2N88A 1TWCH 2K5WA 3M4YA 5IT9c 3WOFA 4DN4M 2NN6H 1STAA 3J80L 5E1FA 4A3FH 4KKUA 1VQOA 2A68C 2D9UA 3D4DA 3HOUG 1QOHA 4LF9L 1YNNC 3B6YA 3X3NA 4HMJA 3P7JA 1U4MA 2B2YA 2XGTA 2H1EA 4AYBE 4IPDA 3F2UA 4RA8A 4LF6L 3DM1A 2DJFC 2F4VL 3U4VA 3IKJA 4CKCA 1PMRA 3E9HA 3OWEB 1RODA 5ELCA 3M4QA 4LF4L 1DOKA 5LMNL 4C3IH 4KKSA 1PV4A 2G5DA 1ASZA 1O7LA 5GAGC 2UUCL 3TN2A 1X55A 3VDYA 4LFCQ 1Y1VG 4ILWA 4JI0L 1HZAA 3TREA 2K4KA 1CKNA 3LGJA 3GTMH 3CC4A 3D31A 4JI2L 2B8FA 1JE5A 4LAAA 3NE5B 2WAQE 4K14A 4JBWA 4ME3A 5ELBA 1F77A 2FJ2A 2QILA 2HHHL 4O0AA 3BZDB 4XDXA 1K3RA 2HIXA 5JJZA 1SNMA 1IW7C 4IPCA 1TWAB 3HOUH 3RNUA 3NK9A 2PNHA 5L37A 2H4OA 5GQOA 4E6IA 2MFIA 2NVYH 2A6HD 3VA7A 1STHA 3BVMA 4JYAQ 1B1ZA 3UDGA 1P16A 3HKZB 4KV6A 2ES2A 4X62L 2CH4W 4ZRZA 1HFNA 1D5ZC 2PMZE 1LO5D 2MJ8A 4KY7A 4DR7Q 3EFXD 4M8AA 1PVOA 5I6YA 5KGUA 3G48A 4O42A 3H0GH 2UUAQ 4GLXA 3E0EA 1U5KA 1G2TA 1K0RA 3MXNA 2PMZB 2OT2A 3HP3A 1HFGA 1K8OA 2ZM6Q 4FXKC 4JK1C 1SYGA 5DNFA 4F7XA 5C0XJ 4JI7Q 2VXWA 4CDFC 3K8AA 1ILPA 4V190 2CQOA 2KCTA 3D0FA 2EE1A 1Z47A 4ME5A 2IT1A 2EYLA 1MJCA 2BOSA 3G71A 1HNXL 3K5OA 3H3VC 1RF2D 4KK7A 3HOXH 1EZ8A 1V1QA 1Q8KA 3G7LA 5IYDH 1KDBA 2HUGA 3S1QB 4FDBA 4QL5A 1N34L 4A3EH 4OX9L 2KOLA 3KF6A 5G3LF 4A3GG 4KI0A 2QKIC 1UE7A 3L9AX 4KY6A 4NPSA 1K3BC 1R9TH 2SDFA 4MHEA 4QB4A 2AMCB 3W3AA 1EEID 2L5TA 1YNND 1S40A 1STYA 5LL6S 2JA5G 4V0BA 1D5MC 3EIVA 3S2HH 5JOBA 1FGBD 2IJ0A 3J80c 2K50A 4B3MQ 4GKKQ 4DAYA 4A3JB 3U58A 1PTOC 1LTLA 2J0TD 3V2TA 3J81j 3H3VH 2ZTCA 5IYCH 4XT3B 4WJWA 2F0TA 1X3QA 3PUYA 5IGDA 5E3FA 2RA4A 2F0DA 4DAYB 2NVQB 2OF1A 2RSOA 2A74C 2ZJRA 2PW7A 1NMGA 2K32A 4FF4A 5DAUA 2OQ0A 1Q1EA 5I2YA 1F9QA 5ELEA 1UUPA 1BNZA 1H95A 4NW2A 2VB3X 3RZDB 3NTIA 3Q6SA 1UNSA 2X6LA 1AE3A 4QMGA 1G51A 1IZ6A 3ULLA 1A3TA 2VL6A 3BVZA 2K52A 3NPPA 4C2MB 1XTDA 4FO2A 2YTYA 1T5XD 2MP1A 3GTKB 1BCPB 4LFAL 2F3VA 4WJ4A 1GXDC 4X65Q 1K83B 2D5DA 2NVXH 1SN8A 2RDFA 4ULLA 1UE6A 3K81C 5I6WA 3J7AF 1HNWL 1BF4A 2D0OA 4LW1A 2JSOA 5CV7A 4KN7C 4L63B 2E5LL 4IFDH 2F4IA 1AZQA 4DR4L 2CHBD 1EY7A 1DOMA 2UXDQ 2R7ZB 3PF4A 2XWJB 4R4OA 3ONAB 4DXFA 2PPBC 3ZYYX 4RKBA 2RKSA 4MIUA 3MC0B 2DGYA 2Z4HA 1QUQB 4RAUC 1L0YB 2K33A 2VQFL 1Z6HA 4S3SA 1CZWA 3A8IE 4GOPB 2G9DA 2AKWB 4HR7B 3S14H 2N78A 1VQJA 5C3EB 4A3MH 1G6PA 4DXGA 3G6JB 1H9MA 3KLWA 4MZ9A 3BYTB 5IODA 3VYUA 1MBYA 4AQYL 2F0FA 3H91A 3I4NG 2Q8TA 4LFBQ 2K5VA 3NUCA 4Y7NB 5CV8A 3PO3H 1EU3A 1SE4A 2F1MA 2A68D 4X62Q 1EQQA 2I5LX 2R6GA 3I70A 1ZXTA 4GNXB 5AJ3L 3CCVA 1XPOA 1RCVD 1QJOA 4X6AH 3A55A 2FMCA 2VUMB 2KQ3A 4DV0L 4L5SA 4UPAA 2WB1E 2F0UA 3K58A 5IGEA 5IWAQ 3PO2H 1HHVA 5IP7G 2K5HA 2QDBA 1SAPA 4LF5Q 1J8IA 4JI4Q 2LMCB 5JEAG 4DK3C 1HA5A 1IHZA 4A3KB 2K03A 3SGIA 4LF8Q 4GLVB 5JPNC 1L2FA 2F0QA 3AU7A 2EYJA 4Q0FA 3I90A 4DV7Q 3TEHB 4AH6A 3BDCA 3HOZH 3CCLA 3GTOB 5K36G 1IYUA 4JCVE 4EQNA 1O7IA 3W2DA 4R4IA 3I55A 5JVG3 1TQOA 2NYZD 3GTGB 1JJ2A 1DOLA 3BZCA 3S1MB 4EVOA 5TSSA 3OIQA 3K7AB 5IE8A 3MXPA 1JWSD 3OW7A 1IW7D 5KYIA 3TSSA 3EROA 2K01A 1QILA 1VMCA 4PMBA 4RH6A 3HZXA 1LT4D 4K2LA 2B63G 1PRTD 5GAHC 3UDXA 2JA6H 1TWFH 2ATWA 1PH9A 1XX8A 4C3JG 2KBNA 2H5XA 2ZT9C 1PDQA 1P8LA 1J5EQ 2K5DA 3TBIB 4CHTB 5GAEC 5G3LD 1YNJD 4CKBA 2CH4A 1YHQA 2PYKA 1TWHH 3GD7A 2DY7A 1VQEA 2IX1A 4FVMA 1M90C 3CAMA 4BBRG 1EYCA 1O7YA 2KENA 4K8JA 2BA0A 2EJGC 1K28A 3H09A 1MSGA 3PCOB 1I50H 2A73B 4OXPA 1BQQT 4FF3A 3CCRA 1LM0A 1HZBA 5IYCG 5IYBH 3QB3A 2KCNA 2NBFA 1V8QA 1F2ZA 1L1OC 4K5VA 4IN3A 3Q0AA 1S5FD 4BY7H 2OQKA 2E2JH 1RDPD 1W6KA 3GP7A 1A0IA 1CK1A 4CBVA 2Z9HA 1EWCA 4N9PA 3K7UC 4DFAA 2RDGA 3P20A 1RHPA 4JI0Q 1LTSD 1PA6A 1YITA 3I4OA 4KHPQ 2NVXB 1JB7A 1HNZL 1SYEA 2JJQA 1F9SA 2EDGA 4A3EG 3RLOA 3S16H 1GVPA 1JWUD 2MNAA 1DGSA 1SNOA 3HOUB 4OEMB 2NN6I 1SYCA 3L0OA 2BDNA 1IBKQ 3K80C 4IUVA 3K0YA 1PFNA 5IOCA 1EU4A 3OSOA 3R93A 3HOXG 2EYFA 5EPLA 5CBAE 2L9HA 3S1NH 4XQJA 4GS3A 3FPPA 4PZ6A 3FPUB 3OWFA 2A5HA 3BZKA 4CDEC 1XPRA 4B3SQ 2ZM6L 1LTRD 3IFDA 1QWYA 2Q2HA 1OXUA 1K8MA 3BU2A 3MA2B 3LWUA 3U9SA 2LXKA 4DA2A 5C44H 1I94L 2ICIA 1Y1WB 3SE0A 3J7YW 3V96A 2HDLA 2IX0A 4IO9A 1TS2A 2RHSB 4BA2I 3HOVG 4A3FG 3KOJA 4AYBG 4X66L 3PUVA 3O13A 1B8AA 4DUZL 2KCCA 3IFTA 1E3PA 3BDOA 4C56C 5C4ZA 3S1RH 1DYQA 2JA7H 4NDXA 5EQ0A 1PXUA 4YY3Q 3ERQA 4CGYB 4PZ8A 1GHJA 1NR2A 3AMUA 4BY1G 4L5QA 3FKIH 1G6ZA 4BY1B 1G8ZD 1IYJB 1RTOA 2JYOA 5FLXL 5GADC 4K2KA 1I4GA 4LUVA 3IRBA 4JV5Q 3A7LA 1LTID 2CQAA 5DEHA 5A2QE 4JI1Q 1SYFA 3TQYA 4Z9CB 3RLNA 2WV6D 4YHHQ 1JICA 4J1MA 1PFBA 2VS1A 3RLFA 3KYHC 4R9WA 4HAEA 2X6GA 1ONLA 1WD1A 1SRUA 3ERSX 1D2BA 4K5XA 1J6QA 5A2QL 1PZKD 4A3CH 2CWAA 1V9PA 4QIWE 5HURA 1TR5A 2FFKB 4JI6L 2WAQG 5C4XG 1UE5A 4TVAB 1TY0A 4DK1A 1KDAA 2Y0SE 5IP9H 5FJ8H 1ET9A 4DV5L 5I9PA 5LMNW 1IBMQ 5CV4A 1SE3A 2L12A 3I91A 3K6OA 5IGCA 1HNXQ 1GJXA 1F9RA 3HRZC 3W5OA 4IJHA 1CHPD 1C9OA 2E8GA 2JA6B 5FLXc 1SMYC 2QEJC 5IP9G 2F0SA 1PH8A 4EGVA 3BS1A 3K0XA 5FK9C 3UE0A 2JEAI 1E22A 1YJ9A 1Y8OB 2QEXA 2IL8A 2B2VC 3DWAA 4DU9A 3LNNA 1B4OA 2MO1A 2NZHA 2YV5A 5T1GA 2AWNA 2K1BA 1Q82C 4RMFA 3PV0A 2EJFC 4C1NI 1QG7A 3NQTA 1YNXA 1GKHA 4YCUA 1JMCA 3KDFA 5IIFA 4OWWB 2SEBD 1PHJA 4JYAL 1W2BA 4H0LC 2NTTA 3PUXA 4HJAA 1RD9D 4O2DA 2OXPA 5BR8L 4MTKA 3KJPA 3KLSX 1O80A 1WTHA 5IT9E 3W1BA 2GN5A 1HNZQ 4L6TB 1TS5A 2UUAL 3OIPA 1Q90A 2K7VA 4UHVA 2MQHA 2WP8J 2EYPA 1VQ8A 2JEBI 1EOTA 3OW2A 3D6WA 1HUNA 5M3MH 1O78A 2EY6A 3MXGA 1IBKL 1PTOF 2OTJA 4YWLA 2BH2A 1L1OB 1B7YB 4DPGA 4EQ5A 4XXEA 2OEOA 1CQVA 4P75A 1GM5A 1DZ1A 1B2TA 4RGNA 3MEHA 5J39A 2NVYB 4MN3A 3ER0A 3U9OA 2Y0SG 4C1NK 1EY0A 3NTHA 4RHRA 3IAYA 3UDFA 5M3MB 3Q8DA 2RF4A 3KF6B 1KABA 3SK5A 4DAMA 1OXSC 4LK1C 2PI2E 3I7FA 2E76C 5AJ3Q 2R93B 4LWCA 3MAQA 1WCMH 1S5BD 3E3XA 4DNRB 3CRLC 4PQXA 4B3RQ 4EX5A 2UXCL 1EY9A 4A3BG 2ZXRA 4QUFA 4HMIA 3S2DH 1X32A 2B3GA 4DUYQ 2WKDA 1OXVA 3J81E 1MD2D 4GKJQ 1RTNA 2ZTEA 2L55A 2VB2X 4A3IH 2RCNA 3HOZB 4JI4L 4A93H 4CKEA 3HFZB 3STBD 1N9WA 3MWYW 3HEJA 3JAMi 1X54A 2TSSA 1A63A 1R4QB 2PZTA 1PZJD 4LF8L 3UDIA 2XWBB 3CCJA 4A3LH 1BKBA 3I2ZA 3S1QH 3GTQB 1UE1A 1YJWA 1CUKA 2R92B 1I3QH 4LNQA 2B2VA 3H0GB 4JBJA 4AQYQ 4X3KA 4TRDA 3VYSA 2K75A 2JN4A 3CW2C 1D8LA 4QJFA 1SE2A 4LFBL 5D3IB 1GOZA 1KLGD 3GTJH 2F0MA 3T1HQ 2WKCA 2D2CC 5JAVA 1U4PA 3R8BA 4C3HG 4FF2A 1EWIA 2JE6I 1G91A 3E6ZX 2QCPX 4N8X1 4PZ7A 4JI7L 4DV1L 2EYHA 3L7ZC 3KF8B 1LT3D 3V05A 5IP7H 3WDNA 5EKIA 1ENCA 1VQ9A 4PNYA 1QUQA 2I5HA 2E2IH 4DV2L 5KYLA 4HCSA 1TWHB 3G4SA 1Q3LA 5FO7B 1GO3E 2F0IA 1EEFD 1ENAA 4PMCA 1C0AA 2WACA 4U68A 3NBHB 4NP5A 3SXHA 4KJNA 1PH5A 2UXDL 3PO3G 1STEA 1ET6A 3SHLA 1ASYA 3MTSA 3K5LA 1I50B 4A3IG 3C3LA 4DV3Q 4A93G 1IYVA 2K05A 1NAPA 4POGA 1EY4A 3QJYA 1NUCA 2B63H 2PZWA 2BE5D 3GTMB 3GV3A 1NY4A 3A74A 1VQHA 1N36L 2JA8B 3MZ5A 2CVRA 4ZCKA 4LF6Q 1XMQQ 3MVVA 4H02A 3S1MH 5DM63 4B3ML 4P71A 5EGTA 1NBWA 2EIFA 2R7FA 1CA5A 2K5NA 3T56B 3CF5A 4DR3Q 4LMQD 4ZAIA 1A15A 1NR4A 4XTCS 1LTTD 4X65L 1PTOH 4PG3A 3HG9A 2CFMA 3R3OA 1S5ED 5M3FB 3ULJA 3SR1A 1J5EL 3AEVA 4C3HH 1PYWD 2GVAA 3S15B 5JEAH 1VQ6A 1YNJC 2R7DA 1JQYD 1UEBA 2L15A 4B9XA 3I73A 1Q46A 4HCEA 4BBRB 4BBSG 3A7AB 3S16B 1VS0A 4OO1I 3SEBA 3J7AV 1K9MC 4GOPC 2N8NA 2HHHQ 2HD3A 5KNCA 1TU2B 3OPOA 4LFAQ 1XYIA 3A54A 3M4OB 1BO0A 3UE1A 4HSVA 5C0XI 4PMWA 4XIGS 4A3LG 2EXDA 1C8CA 1S5CD 5C4XB 2ZTDA 2PI2A 1FL0A 2XTIA 1I94Q 1O7ZA 1BUVT 1N8RC 3QR8A 3X3MA 2R7ZH 5COYA 3JAML 3CQZH 3J7ZC 4TQUS 1XNRL 1DONA 1E2ZA 1T5EA 2GA4B 5C0XH 5C4JB 3DHQA 5C3WA 1QNKA 4RFBA 4KD4A 4IUTA 1AEXA 1HR0L 5JJIA 4RGTA 4A3BH 4DR7L 2WINB 2M00A 1SBBB 3DWPA 2JA7B 1MGSA 3JAMc 4A3EB 3MXUA 3C2PA 3J7A5 1SNPA 5LMUL 1X3FA 1YI2A 1HA6A 4DR2Q 1WCMG 3PIOA 1L0XB 1II3A 4RHSA 4IOAA 3GTOH 1WCMB 2UXCQ 4DV4Q 4WFN3 1Q7YC 3DEOA 1K8AC 1F2LA 1SJHD 1NNXA 5ELDA 4R8IA 1RKNA 4BXXH 1F9PA 4LUZA 1LUZA 1HQRD 1EQVA 1Q12A 4RCOA 2J7ZA 1I6HH 1KNEA 5M5XH 3DXJC 4A3CG 1XWEA 5D3DA 3GTPB 1N34Q 1LT6D 3NENA 3KFUA 2VUMH 4OX9Q 1LABA 1PFMA 1K8GA 2OWOA 3HOWB 3MHBA 2BH8A 2RVLA 1DJRD 4YHHL 2ZXPA 5J1ZA 1HZ9A 1R4PB 3I4LA 4RWSC 3HOXB 2N49A 3U4ZA 1STNA 3M9BA 2L0CA 3D3RA 2R3ZA 4OONA 3T1YQ 3OMGA 4K5WA 3AFQA 3HS0C 1TWFB 2JA8H 3VR4A 2AQ1B 1D1IA 1JCKB 2JP1A 4EQOA 3QOJA 3MFGA 4WJ3M 3CCEA 4HJ5A 4YIJA 3NP8A 3TRZA 2PW5A 1NCVA 5HY6A 2EZVA 1EWHA 3TMEA 3FP9A 4JOIC 5C3XA 1Y69U 1LV9A 1I4HA 4GN3B 2KHSA 3NQIA 1S4ZA 1UWVA 1B53A 2M9VA 3P1HA 1B9MA 4IZ8A 3NSWA 3EJIA 1OXXK 4IUPA 3FRPB 4X3TA 1GUOA 5CORA 2K14A 3H3VI 3J80E 3UI2A 4YCVA 2EVBA 5FJ8G 3C1FA 5AFWA 2KEEA 5C44G 3ND9A 2IW3A 4G7OC 1FR3A 5C3EH 2JA9A 2F0KA 3M3YB 1BDOA 5T1IA 1HTPA 4HJ8A 4DR5L 1EY5A 2EOTA 4XT1B 1FYCA 1ENFA 1QVGA 1VMPA 2F0LA 3HKZG 3WWVA 5JEAJ 4WORA 4C2MH 1PRTB 1WVLA 2KVMA 4TSSA 2K04A 5KEEA 3URYA 2B2UA 2EQSA 5IT9L 4KHZA 4A76A 3A5UA 1SMYD 3DMUA 1EYAA 3E9IA 5ELNA 4GZYC 4C3HB 2HQEA 4JG2A 3L2PA 3S17H 1EFID 3M85A 4A3MB 4K0KQ 5GROA 3AB9A 2VY3A 1U4RA 1E1OA 3RN5A 1JC7A 4QIWB 3F2CA 1TS3A 2CWPA 2Q2IA 4IQZA 3ICEA 4YY3L 1EUJA 3CCMA 1KNAA 3T51B 4GN5A 1EIFA 2YTXA 5EJWA 5I4DA 1A6XA 5F2DA 4KHPL 2VNUD 2Z8LA 5ISRA 2NN6G 4F88A 4LF7L 1LTGD 3BVGA 4A3IB 4A93B 1Q86C 3CQZB 1JOQA 3HOVH 1I6HB 1NE3A 1HR0Q 1E7ZA 1Z9FA 1W6JA 3EA6A 2Z1CA 2F0GA 3ND8A 1MKHA 2IHEA 2EYOA 2IY5B 4DK6C 4DR2L 3C46A 4EQPA 4F8MA 2JA8G 1EYDA 1JOKA 5KNBA 2RCFA 3GTGH 2F3IA 1I4XA 2OTLA 1RJTA 4DAVA 3WOEA 4C3JH 4DV1Q 2XSCA 1B50A 1HR0W 3CPWA 3Q22A 5CGKA 2EY5A 2V1CC 1U4LA 1EOVA 4OO1G 4DF7A 1STGA 1Y1VH 1HJPA 5IGFA 1VQLA 1IL8A 3SK6A 4OL7A 1J9OA 4J15A 1SMXA 4X64Q 1Y8NB 1A3VA 4DV3L 1VQFA 4H7BA 3GTJB 3GO5A 1VCIA 4BBSB 2NWGA 1X9NA 3KUPA 3HOWH 1CFMA 3PIO3 3S1RB 4BXXG 1UEAB 1XNQL 2WFWA 1SNDA 3HOZG 3PF5A 1FNVA 2I46A 1EY8A 1L0WA 3M7GA 2KCMA 5M5WB 4BY7G 4QCLA 2E2JB 4YCWA 4HJ9A 2E2HH 2MHVA 4IPHA 3A8JE 5H1SE 2XRQD 2B2UC 5FLMG 1Q81C 2FHTA 4DR3L 3DLLA 4G57A 4FP5D 1KL9A 1S5DD 1TXYA 4DNIA 5EPKA 3MFYA 4Y52H 1B3QA 3RMHA 2DJGC 5C0XG 1KXLA 5FO9B 2B39A 4HIKA 1DCZA 4L5RC 4HN7A 3AYHB 4IFDJ 1IKMA 1AE2A 1BCPD 3G6EA 2V4DA 4ZQ3A 4KD3A 4RCNA 1VQ4A 1E1TA 1IL2A 1K0SA 4GNXC 2MPMA 1V1PA 2XIWA 4WRDA 3PIP3 1YHAA 4HJ7A 2MUYA 1HUMA 2JA5B 3EVQA 4R4CA 3A5ZB 4UP8A 4KN4C 2IPKD 2MGSA 4IUUA 1SFOH 2F0NA 2BCOA 3J80i 5LL6X 4HTHA 4IPGA 4R8NA 1S3OA 1YBYA 3OOCA 3FMCA 1VQIA 3NWSA 4J8QA 1EL0A 4G4KA 1I6VC 1PH6A 4R4TA 1RIPA 3D6CA 4N8FA 3S24A 1B70B 2ZJQA 2RDHA 3OTOQ 3S15H 3TP7A 2NZOA 3EBEA 3TP5A 1SEBD 2QF7A 4OIKA 4A3FB 3C1EA 2YYZA 3GQBA 4ZUJA 1MSHA 1U0LA 2UU9Q 2KJXA 4JI2Q 2NTSA 3HOYG 4GKJL 1EYGA 1H9SA 3HOVB 4C3IB 1WTRA 4JI5Q 1CQFA 4JI8Q 4UP7A 4DR6Q 1PZID 2AHOB 1GUNA 4IFDG 4GLAC 1Q8IA 4NXML 1HTLD 1QVFA 4UDUC 2Z0SA 3FVQA 2ICEC 5EKLA 3PQIA 4K6LA 3I4MG 1PRTC 2L1BA 3TP8A 5M3FH 1H9SB 1OO9B 2QGQA 1B44D 1D5XC 4LF7Q 4CJ2C 4N9TA 2E2DC 2R7ZG 2Q8IB 1K73C 1HXYD 1Y1VB 2QDLA 1X3EA 4ZYSA 3NHHA 1TT2A 3KLSA 1VQAA 5EAYA 2KHJA 3SK4A 1IBLL 3CCSA 3KF8A 4DUZQ 4B3RL 3TZDA 4IURA 1I4PA 5M5XB 2B2YC 1VF7A 3CRKC 2QA4A 3NWTA 5LHY1 2RBMA 1NJIC 1HZCA 1WYDA 5ELFA 4DUYL 1EIHA 1B3AA 1VQGA 1ZEQX 2F0EA 3DUZA 2AWOA 1CHQD 5DLQE 4DKAC 3I56A 3CC2A 1BR9A 1EY6A 2D62A 2RQXA 2ALYB 3I72A 2E2IB 5KRUA 4R1JA 4C3JB 1CT1D 4GNXA 1ESFA 3U50C 1N32Q 1F2YA 1XNRQ 4A3KH 1PH3A 4UAIA 2YU9B 3VR5A 2KECA 1JOOA 4JI1L 1STBA 1YVCA 2WB1B 4NXNL 1CSQA 1X65A 1KHIA 4IJLA 4Y7NH 4JOIA 1BCPC 1V43A 1AP0A 1T9HA 2G9HD 5A35A 4OHJA 3K57A 4JC0A 2PQAA 2F0HA 4HIDA 3J81c 2C35B 1PYBA 2EYMA 3M4PA 4IFDI 1SLJA 4KMUC 5E4WC 3CMEA 3NXWA 4OO1H 3RUZA 1IBML 2F0WA 2XRSD 4HIMA 2VQEQ 4G7ZC 1JE4A 1AH9A 3KBXA 4JPBW 1YHBA 1A2UA 4IUQA 4ALPA 2UUBQ 1I5FA 4APVA 2HQLA 4DR5Q 1TY2A 2LSSA 2I5MX 2Z6KA 4LF9Q 2PQAB 2A6EC 4DV6L 1PYSB 1QZHA 1D6EC 1FNUA 1L1OA 3A56A 5D65A 3S1NB 1D1KA 1A8VA 1MI2A 1BBXC 2E75C 1VQMA 1VQKA 2LXJA 1NMFA 1JWMD 2F4VQ 4DV2Q 1IXRA 3I3CA 4JW0A 5FLMH 1IKLA 3S2HB 1SROA 4IALA 1GD7A 4DNTB 3A0JA 1KIXA 4LF4Q 1JB3A 2KEDA 3CC7A 3CHBD 4I7AA 1B9NA 3MEFA 2JA5H 4X3UA 2E74C 2E5LQ 5BR8Q 1HPCA 1E24A 2F03A 3HOWG 2EJMA 3HGBA 3ZJYC 2P5ZX 5LMUQ 4A3GH 5J3BA 1N36Q 1V1OA 2PQEA 1JR0D 3N52A 1KAAA 4CDCC 4AYBB 4J6HA 1GUTA 4DR1Q 4IUNA 4B3TL 2EXZA 4L5TA 5IYDG 4A3BB 1CM9A 4A4IA 2UU9L 3T16A 1SXTA 3KLRA 5M5YH 1SSOA 4ZKCB 3TS2A 1WTPA 3K5MA 1Y8PB 5JJLA 1XXGA 4QUCA 2AUJD 5C44B 2XN9C 2FMMA 1EQRA 1DXMA 5C3EG 1GHKA 1KAWA 1SYDA 3M3YH 1PH2A 5BN4A 1ZKOA 2F0OA 1BCPF 4GOPA 2O4XA 3CU7A 5I9OA 3K59A 4K6DA 3I4NB 4YWMA 2NVTH 3VYTA 1FJGL 5FO8B 3H0GG 2DY8A 1SYBA 2R61A 1QCBD 2GVBA 4X64L 1G2SA 1AN8A 4R4QA 1Q1BA 2F3WA 2JQOA 3N6RA 4IOCA 5C4XH 2NVTB 2RSNA 1FD7D 2ZJPA 3M7NA 1A3UA 2ZXOA 1BBUA 3LWEA 1XNQQ 1R9TB 1N33L 2UXBL 2MO0A 4JI3L 1VQPA 3HKZE 1VQ5A 1PH1A 1QE6A 5FKAC 1RL2A 2N3SA 2KA7A 5IGBA 4NB3A 1CKOA 3KDFB 2Q2TA 1N32L 5EBDA 1LACA 2C5CA 1XTCD 1XMOQ 4KKTA 3F8TA 1WFQA 1AW7A 1V1PB 2D0PA 4DV4L 4CDDC 1PRTF 2O5IC 3JAME 2F0JA 4NXNQ 1G291 2F0VA 1BXTA 4C3IG 2VUMG 4ID6A 3PUZA 1LT5D 1EZ6A 3BG3A 2DNEA 1A62A 2QW7A 1PH7A 3ITPA 3EQLC 1F2MA 4A3DG 2IHFA 3FHWA 3TS0A 3NEMA 1TWGB 1KTKA 4A3DB 3J81L 5KIXA 5CMDA 1GUSA 3JC66 2F0PA 4POFA 1UAPA 3H15A 1WTOA 3GTKH 1VF5C 1X3GA 2PNRC 3I4MB 1HQMC 3FDTA 3DWQA 1HCZA 3OMCA 1U9RA 4KY5A 4DK0A 1WTQA 4BS9A 1WOCA 4DR4Q 3VR3A 4P72A 4HSPA 2PO4A 2HT1A 4A3DH 5HGQA 2F52A 1A2TA 2B29A 4FXGC 3PGZA 4OWXB 3TP6A 3T1YL 2K6AA 3QIAA 1XMQL 3RZOB 4P74A 5I2XA 1TWCB 1ICWA 5C6AA 5CV5A 5E7NA 1BVSA 3T53B 1SNQA 2B63B 5M5WH 5K5PA 2K5QA 2KUMA 2NZ1D 1CKMA 1TWAH 3STBC 2L11A 2TMPA 1KLUD 2A6HC 3PUWA 1AFPA 2CW0C 2HCCA 2IWHA 1E2WA 2B2TC 5DM73 1MHWC 5JJKA 2ENBA 1CTMA 3AQQA 4G7HC 2Q8RE 3RZDH 4FXDA 3FKIG 4AIMA 4B9WA 3FEWX 3S2DB 1WTWA 3S17B 2UUCQ 2B2WC 2LKVA 4ZLTF 3TDQA 1KD1C 5CV6A 2JA7G 4JI5L 1M1KC 1QVCA 4A3GB 5HGTA 4H13C 1EIGA 4MNOA 4DR6L 2CKZB 3CD6A 3CKIB 4DR1L 4B3TQ 5IYBG 1CI3M 1ICFB 2L4NA 4RGMA 1SDFA 4K0KL 3I8ZA 1VQ7A 1ZYRD 1EIYB 4I7ZC 1C4QA 2EPBA 5JVH3 4CJ0B 4BBRH 1MJEA 2ASBA 5CR3A 5EPJA 2PCFB 4XQNA 2R92G 2B2TA 4OELB 1W3SA 5NUCA 4OGQC 2A6ED 3QWNA 1FJGQ 4KLKA 1WJJA 2SNSA 3K5NA 3OTOL 1D7QA 1VQDA 3F1ZA 2R93H 5D14A 3KBGA 3HOYB 1DD2A 3CMAA 1E2VA 1QB5D 2XNAC 4X66Q 2O2LD 4UY8C 2VQFQ 2A69D 3D4WA 4JBKA 2N55A 1BBWA 1YJNA 3QO2A 3GTQH 5C5MA 5E4XA 1ESRA 1I4QA 3VR6A 4BA1I 1LLRD 1WD0A 2I0QA 4K8IA 1E0BA 4A3JG 3DEPA 1N33Q 1X6OA 2DUDA 2KHIA 4KHVA 4NXMQ 3KJOA 2UXBQ 3CCQA 1VDZA 1VQBA 1TKWB 3PO3B 1ML0D 1TIID 4YWKA 3PSIA 5K36H 3SVMA 1WI5A 3Q23A 1HH2P 2Z6KC 5BN3A 5M9OA 2NVQH 5C4HA 2E2HB 3Q24A 2LS01 1SJED 1Y1WG 4BBSH 1YEZA 2IX3A 3R2IA 3H6MA 2AQ2B 2HIVA 5FLXE
chains in the Genus database with same CATH topology
2M2LA 2FINB 2LFNA 2WIIB 3S9WA 1JORA 4RKLA 4RGOS 3RD4A 2WAQB 2DN8A 1GUWA 5EKKA 2ID0A 5KNDA 4XQQA 2EY2A 3QG1A 2B2WA 4CJ1B 1DM0B 3D4RA 4ABNA 1SFOB 3A8KE 5JPMC 4OIJA 3L3OC 4HEDA 2XVSA 2O5JC 4ODGA 1OXTA 2NB0A 4KJOA 1M8AA 4I65A 4QF4A 3VR2A 4L8JA 5CC4A 2NUCA 4TKOB 4KTAA 2LY7A 4NKLA 4ZK9B 1LTBD 3KK7A 4F87A 3IL8A 3SDZA 1TVXA 1KDCA 3S14B 3BDLA 3R2TA 3OHXC 2AUKA 1WTXA 1C48A 3QOLA 3TZUA 1EQTA 5CV9A 2JXMB 4O1NA 1PTOB 4NMZA 4FF1A 4DGZA 2AQ3B 3E0JA 5CYUA 2BDOA 3D8GA 4X3SA 5M5YB 1ILQA 3PO2B 3NBHA 1M4VA 2A69C 3GTLB 2Z4IA 4XYOA 3H94A 1X3PA 1PTOD 1FNWA 3BYYB 5J22A 1TS4A 5BN5A 3NTKA 2BE5C 1AZPA 4ZUIA 1H9RA 4FYDA 4U673 1I4RA 3LX0A 1Z7TA 4FNFA 1LTAD 4B08A 3PMFA 2EY1A 1GUGA 1BOSA 3SK8A 2K28A 3VA5A 1CA6A 2CW0D 3P75A 2Y0SB 4Q5VA 5IGGA 4DAPA 1HRJA 1SNCA 1QNUA 2DNCA 3VYRA 1H9KA 3FKIB 3NBIA 5EBCA 2BA1A 2J4XA 4P2CB 3T4AC 4BWGB 1H9JA 2SOBA 2X69A 2PZUA 1PLFA 4XYQA 5C5LA 3T13A 1NSNS 1ZYRC 2HDMA 3GV6A 4PV1C 2B8GA 2I07B 2SNMA 4ZKBB 4H44C 2C9OA 4BY7B 3E5SA 4M1UB 5CBEE 1WTVA 1CZGA 5FOBB 4LJZC 2HCIA 1I3QB 2N88A 2K5WA 3M4YA 3WOFA 4DN4M 2NN6H 1STAA 3J80L 5E1FA 4KKUA 2A68C 2D9UA 3D4DA 1QOHA 1YNNC 3X3NA 4HMJA 3P7JA 1U4MA 2B2YA 2H1EA 3F2UA 4RA8A 3DM1A 3IKJA 4CKCA 1PMRA 3OWEB 1RODA 5ELCA 1DOKA 4KKSA 1O7LA 3TN2A 4ILWA 3D31A 2B8FA 4LAAA 3NE5B 4JBWA 4K14A 5ELBA 1F77A 2FJ2A 2QILA 3BZDB 4XDXA 5JJZA 1SNMA 1IW7C 1TWAB 3NK9A 2H4OA 4E6IA 3VA7A 2A6HD 1STHA 3BVMA 1B1ZA 3HKZB 4KV6A 4ZRZA 1HFNA 1D5ZC 1LO5D 2MJ8A 4KY7A 3EFXD 4M8AA 5I6YA 5KGUA 4O42A 1G2TA 3MXNA 2PMZB 2OT2A 3HP3A 1HFGA 1K8OA 4FXKC 4JK1C 1SYGA 5DNFA 4F7XA 5C0XJ 2VXWA 1ILPA 4V190 2EE1A 1Z47A 4ME5A 2IT1A 2EYLA 2BOSA 3K5OA 3H3VC 1RF2D 4KK7A 1EZ8A 3G7LA 1KDBA 2HUGA 3S1QB 2KOLA 5G3LF 4KI0A 2QKIC 3L9AX 4KY6A 2SDFA 4MHEA 4QB4A 3W3AA 1EEID 2L5TA 1YNND 1STYA 5LL6S 4V0BA 1D5MC 5JOBA 1FGBD 2IJ0A 4DAYA 4A3JB 1PTOC 2J0TD 3V2TA 4XT3B 4WJWA 2F0TA 1X3QA 3PUYA 5IGDA 5E3FA 2RA4A 2F0DA 2NVQB 2OF1A 2RSOA 2A74C 2PW7A 2K32A 4FF4A 5DAUA 1Q1EA 5I2YA 1F9QA 5ELEA 1UUPA 1BNZA 4NW2A 2VB3X 3RZDB 3NTIA 3Q6SA 1UNSA 2X6LA 4QMGA 1A3TA 3BVZA 3NPPA 4C2MB 4FO2A 1T5XD 3GTKB 2MP1A 1BCPB 2F3VA 1GXDC 1K83B 2D5DA 2RDFA 4ULLA 3J7AF 5I6WA 1BF4A 2JSOA 5CV7A 4KN7C 4L63B 4IFDH 2F4IA 1AZQA 2CHBD 1EY7A 1DOMA 2R7ZB 2XWJB 3ONAB 4DXFA 2PPBC 3ZYYX 4RKBA 2RKSA 4MIUA 3MC0B 2Z4HA 4RAUC 1L0YB 2K33A 1Z6HA 4S3SA 1CZWA 3A8IE 2G9DA 4HR7B 5C3EB 4DXGA 3G6JB 1H9MA 3BYTB 5IODA 3VYUA 1MBYA 2F0FA 3H91A 2Q8TA 3NUCA 4Y7NB 5CV8A 1EU3A 1SE4A 2F1MA 2A68D 2R6GA 3I70A 1ZXTA 1RCVD 1QJOA 3A55A 2FMCA 2VUMB 2KQ3A 3K58A 2F0UA 5IGEA 1HHVA 2QDBA 1SAPA 1J8IA 2LMCB 5JEAG 1HA5A 1IHZA 4A3KB 2K03A 5JPNC 2F0QA 3AU7A 2EYJA 4Q0FA 3I90A 3BDCA 3GTOB 5K36G 1IYUA 4EQNA 3W2DA 5JVG3 1TQOA 2NYZD 3GTGB 1DOLA 3S1MB 4EVOA 5TSSA 3OIQA 3K7AB 3MXPA 1JWSD 3OW7A 1IW7D 5KYIA 3TSSA 3EROA 2K01A 1QILA 1VMCA 4PMBA 4RH6A 3HZXA 1LT4D 4K2LA 1PRTD 1XX8A 4C3JG 2ZT9C 1PDQA 2K5DA 3TBIB 4CHTB 5G3LD 1YNJD 4CKBA 2PYKA 3GD7A 2DY7A 2IX1A 4FVMA 1EYCA 1O7YA 4K8JA 2BA0A 2EJGC 3H09A 1MSGA 2A73B 1BQQT 4FF3A 3QB3A 2KCNA 2NBFA 1V8QA 1F2ZA 4K5VA 4IN3A 3Q0AA 1S5FD 1RDPD 1W6KA 3GP7A 1CK1A 4CBVA 1EWCA 4N9PA 4DFAA 2RDGA 3P20A 1RHPA 1LTSD 2NVXB 1SYEA 1F9SA 2EDGA 1JWUD 3HOUB 1SNOA 2NN6I 1SYCA 2BDNA 4IUVA 3K0YA 1PFNA 5IOCA 1EU4A 3OSOA 3R93A 2EYFA 5EPLA 5CBAE 2L9HA 4XQJA 3FPPA 3FPUB 3OWFA 2A5HA 1LTRD 3IFDA 1QWYA 1OXUA 1K8MA 3MA2B 3LWUA 3U9SA 4DA2A 2ICIA 1Y1WB 3SE0A 3J7YW 3V96A 2HDLA 2IX0A 1TS2A 4BA2I 3PUVA 3O13A 2KCCA 3IFTA 3BDOA 4C56C 5C4ZA 1DYQA 4NDXA 5EQ0A 1PXUA 3ERQA 4CGYB 1GHJA 1NR2A 3AMUA 1G6ZA 4BY1B 1G8ZD 1RTOA 2JYOA 5FLXL 4K2KA 1I4GA 3A7LA 1LTID 2CQAA 5DEHA 5A2QE 1SYFA 4Z9CB 2WV6D 1JICA 1PFBA 4J1MA 3RLFA 4R9WA 4HAEA 2X6GA 1ONLA 1WD1A 1D2BA 4K5XA 5A2QL 1PZKD 5HURA 1TR5A 2FFKB 1TY0A 4DK1A 1KDAA 1ET9A 5I9PA 5CV4A 1SE3A 2L12A 3I91A 3K6OA 5IGCA 1GJXA 1F9RA 3HRZC 1CHPD 2JA6B 1SMYC 2QEJC 2F0SA 4EGVA 3BS1A 2JEAI 5FK9C 1Y8OB 2IL8A 2B2VC 3DWAA 4DU9A 3LNNA 1B4OA 5T1GA 2AWNA 2K1BA 3PV0A 2EJFC 4C1NI 1QG7A 3NQTA 5IIFA 2SEBD 4H0LC 2NTTA 3PUXA 1RD9D 2OXPA 3KLSX 1O80A 5IT9E 4L6TB 1TS5A 3OIPA 1Q90A 2K7VA 2WP8J 2EYPA 2JEBI 1EOTA 3D6WA 1HUNA 1O78A 2EY6A 3MXGA 1PTOF 4XXEA 2OEOA 1CQVA 1DZ1A 1B2TA 4RGNA 3MEHA 5J39A 2NVYB 4MN3A 3U9OA 4C1NK 1EY0A 3NTHA 4RHRA 3IAYA 5M3MB 1KABA 3SK5A 1OXSC 4LK1C 2E76C 2R93B 3MAQA 1S5BD 4DNRB 3CRLC 4PQXA 1EY9A 2ZXRA 4QUFA 4HMIA 1X32A 2WKDA 1OXVA 3J81E 1MD2D 1RTNA 2L55A 2VB2X 3HOZB 4CKEA 3MWYW 3HEJA 2TSSA 1R4QB 2PZTA 1PZJD 2XWBB 3GTQB 2R92B 2B2VA 3H0GB 4X3KA 4TRDA 3VYSA 1SE2A 5D3IB 1GOZA 1KLGD 2F0MA 2WKCA 2D2CC 5JAVA 1U4PA 3R8BA 4C3HG 4FF2A 2JE6I 1G91A 3E6ZX 2QCPX 2EYHA 3L7ZC 1LT3D 3V05A 3WDNA 5EKIA 1ENCA 4PNYA 5KYLA 4HCSA 1TWHB 1Q3LA 5FO7B 2F0IA 1EEFD 1ENAA 4PMCA 2WACA 4U68A 4NP5A 3SXHA 4KJNA 1STEA 1ET6A 3SHLA 3MTSA 3K5LA 1I50B 3C3LA 1IYVA 2K05A 1NAPA 1EY4A 3QJYA 1NUCA 2PZWA 2BE5D 3GTMB 3GV3A 2JA8B 3MZ5A 2CVRA 3MVVA 5DM63 5EGTA 1CA5A 3T56B 4LMQD 4ZAIA 1A15A 1NR4A 4XTCS 1LTTD 1PTOH 3HG9A 3R3OA 1S5ED 5M3FB 3SR1A 1PYWD 3S15B 5JEAH 1YNJC 1JQYD 4B9XA 3I73A 4HCEA 4BBRB 3A7AB 3S16B 4OO1I 3SEBA 3J7AV 5KNCA 1TU2B 3OPOA 1XYIA 3A54A 3M4OB 1BO0A 4HSVA 5C0XI 4PMWA 4XIGS 1C8CA 1S5CD 5C4XB 1O7ZA 1BUVT 3X3MA 5COYA 3JAML 4TQUS 1DONA 1E2ZA 1T5EA 2GA4B 5C0XH 5C4JB 3DHQA 5C3WA 1QNKA 4RFBA 4KD4A 4IUTA 1AEXA 4RGTA 2WINB 2M00A 1SBBB 3DWPA 2JA7B 1MGSA 3C2PA 4A3EB 3MXUA 1SNPA 1HA6A 1L0XB 1II3A 4RHSA 1WCMB 4WFN3 3DEOA 1F2LA 1SJHD 5ELDA 4R8IA 1RKNA 1F9PA 1HQRD 1EQVA 1Q12A 4RCOA 2J7ZA 1KNEA 3DXJC 1XWEA 5D3DA 3GTPB 1LT6D 1LABA 1PFMA 3HOWB 3MHBA 2RVLA 1DJRD 2ZXPA 5J1ZA 1R4PB 3I4LA 4RWSC 3HOXB 1STNA 2L0CA 3D3RA 2R3ZA 3OMGA 4K5WA 3HS0C 1TWFB 3VR4A 2AQ1B 1D1IA 1JCKB 2JP1A 4EQOA 3QOJA 3MFGA 4YIJA 3NP8A 2PW5A 1NCVA 2EZVA 1EWHA 3TMEA 5C3XA 1Y69U 1LV9A 1I4HA 2KHSA 1S4ZA 3NQIA 1B53A 2M9VA 3P1HA 1B9MA 4IZ8A 3NSWA 3EJIA 1OXXK 4IUPA 3FRPB 4X3TA 1GUOA 5CORA 3J80E 3UI2A 2EVBA 3C1FA 5AFWA 2KEEA 3ND9A 2IW3A 4G7OC 1FR3A 2F0KA 3M3YB 1BDOA 5T1IA 1HTPA 1EY5A 2EOTA 4XT1B 1FYCA 1ENFA 1VMPA 2F0LA 5JEAJ 4WORA 1PRTB 1WVLA 2KVMA 4TSSA 2K04A 5KEEA 3URYA 2B2UA 5IT9L 4KHZA 1SMYD 3DMUA 1EYAA 4GZYC 4C3HB 2HQEA 1EFID 3M85A 4A3MB 3AB9A 1U4RA 1JC7A 4QIWB 1TS3A 4IQZA 1KNAA 3T51B 5EJWA 5I4DA 1A6XA 5F2DA 2VNUD 2Z8LA 5ISRA 2NN6G 4F88A 1LTGD 3BVGA 4A3IB 4A93B 3CQZB 1JOQA 1I6HB 1W6JA 3EA6A 2Z1CA 2F0GA 3ND8A 2EYOA 3C46A 4EQPA 4F8MA 1EYDA 1JOKA 5KNBA 1I4XA 1RJTA 4DAVA 3WOEA 2XSCA 1B50A 3Q22A 5CGKA 2EY5A 1U4LA 4OO1G 4DF7A 1STGA 5IGFA 1IL8A 3SK6A 4OL7A 1J9OA 1Y8NB 1A3VA 4H7BA 3GTJB 3GO5A 1VCIA 4BBSB 2NWGA 3KUPA 1CFMA 3PIO3 3S1RB 1UEAB 1SNDA 1FNVA 2I46A 1EY8A 3M7GA 5M5WB 4QCLA 2E2JB 2MHVA 3A8JE 2XRQD 2B2UC 2FHTA 4G57A 4FP5D 1S5DD 5EPKA 3MFYA 3RMHA 5C0XG 5FO9B 2B39A 1DCZA 4IFDJ 4HN7A 1IKMA 1BCPD 2V4DA 4ZQ3A 4KD3A 4RCNA 2MPMA 1V1PA 2XIWA 4WRDA 3PIP3 2MUYA 1HUMA 2JA5B 3EVQA 4KN4C 2IPKD 2MGSA 4IUUA 2F0NA 2BCOA 5LL6X 4HTHA 4R8NA 3FMCA 3OOCA 3NWSA 4J8QA 1EL0A 4G4KA 1I6VC 3D6CA 2RDHA 3TP7A 3TP5A 1SEBD 2QF7A 4OIKA 4A3FB 3C1EA 2YYZA 3GQBA 4ZUJA 1MSHA 2KJXA 2NTSA 1H9SA 3HOVB 4C3IB 1WTRA 1CQFA 1PZID 1GUNA 4IFDG 1Q8IA 1HTLD 4UDUC 3FVQA 2ICEC 5EKLA 4K6LA 1PRTC 2L1BA 3TP8A 1H9SB 1OO9B 1B44D 1D5XC 4CJ2C 4N9TA 2E2DC 2Q8IB 1HXYD 1Y1VB 4ZYSA 3NHHA 1TT2A 3KLSA 3SK4A 3KF8A 3TZDA 4IURA 1I4PA 5M5XB 2B2YC 1VF7A 3CRKC 3NWTA 5LHY1 2RBMA 5ELFA 1EIHA 1B3AA 1ZEQX 2F0EA 3DUZA 2AWOA 1CHQD 1BR9A 1EY6A 2D62A 2RQXA 3I72A 2E2IB 5KRUA 4C3JB 1CT1D 1ESFA 1F2YA 4UAIA 2YU9B 3VR5A 2KECA 1JOOA 1STBA 2WB1B 1BCPC 1V43A 1AP0A 2G9HD 5A35A 4OHJA 3K57A 2F0HA 2EYMA 4IFDI 4KMUC 5E4WC 3NXWA 4OO1H 3RUZA 2F0WA 2XRSD 4G7ZC 1JE4A 3KBXA 1A2UA 4IUQA 1TY2A 2A6EC 1D6EC 1FNUA 3A56A 5D65A 3S1NB 1D1KA 1MI2A 1BBXC 2E75C 1JWMD 3I3CA 1IKLA 3S2HB 4IALA 4DNTB 1JB3A 2KEDA 3CHBD 1B9NA 4X3UA 2E74C 1HPCA 2F03A 2EJMA 3HGBA 1V1OA 2PQEA 1JR0D 3N52A 1KAAA 4AYBB 4J6HA 1GUTA 4IUNA 2EXZA 4A3BB 1CM9A 3T16A 1SXTA 3KLRA 1SSOA 4ZKCB 1WTPA 3K5MA 1Y8PB 1XXGA 4QUCA 2AUJD 5C44B 2XN9C 2FMMA 1DXMA 1GHKA 1SYDA 5BN4A 1ZKOA 2F0OA 1BCPF 2O4XA 3CU7A 5I9OA 3K59A 4K6DA 3I4NB 3VYTA 5FO8B 2DY8A 1SYBA 2R61A 1QCBD 1G2SA 1AN8A 1Q1BA 2F3WA 3N6RA 2NVTB 2RSNA 1FD7D 3M7NA 1A3UA 2ZXOA 3LWEA 1R9TB 1QE6A 5FKAC 2KA7A 5IGBA 5EBDA 1LACA 2C5CA 1XTCD 4KKTA 1AW7A 1V1PB 1PRTF 2O5IC 3JAME 2F0JA 1G291 2F0VA 1BXTA 4C3IG 4ID6A 3PUZA 1LT5D 1EZ6A 3BG3A 2DNEA 3ITPA 3EQLC 1F2MA 1TWGB 1KTKA 4A3DB 3J81L 5KIXA 5CMDA 1GUSA 2F0PA 1UAPA 1WTOA 1VF5C 3I4MB 2PNRC 1HQMC 3FDTA 3DWQA 1HCZA 3OMCA 1U9RA 4KY5A 4DK0A 1WTQA 4BS9A 3VR3A 4HSPA 2PO4A 1A2TA 4FXGC 3TP6A 2K6AA 3QIAA 3RZOB 5I2XA 1TWCB 1ICWA 5C6AA 5CV5A 3T53B 1SNQA 2B63B 5K5PA 2K5QA 2KUMA 2NZ1D 2L11A 2TMPA 1KLUD 2A6HC 3PUWA 1AFPA 2CW0C 2HCCA 2IWHA 1E2WA 2B2TC 5DM73 2ENBA 1CTMA 4G7HC 2Q8RE 4FXDA 4B9WA 3FEWX 3S2DB 1WTWA 3S17B 2B2WC 2LKVA 4ZLTF 3TDQA 5CV6A 4A3GB 5HGTA 4H13C 1EIGA 3CKIB 1CI3M 2L4NA 4RGMA 1SDFA 3I8ZA 1ZYRD 4I7ZC 1C4QA 2EPBA 5JVH3 4CJ0B 5CR3A 5EPJA 2PCFB 4XQNA 2B2TA 5NUCA 4OGQC 2A6ED 3QWNA 2SNSA 3K5NA 5D14A 3KBGA 3HOYB 1DD2A 1E2VA 1QB5D 2XNAC 2O2LD 2A69D 3D4WA 2N55A 3QO2A 5C5MA 5E4XA 3VR6A 4BA1I 1ESRA 1I4QA 1LLRD 1WD0A 4K8IA 1E0BA 3DEPA 4KHVA 1VDZA 1TKWB 3PO3B 1ML0D 1TIID 5K36H 3SVMA 3Q23A 5BN3A 5M9OA 5C4HA 2E2HB 3Q24A 2LS01 1SJED 2IX3A 3R2IA 3H6MA 2AQ2B 5FLXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4L A;  1U4P A;  1S4Z A;  2D9U A;  1MSH A;  2M2L A;  4RAU C;  2FIN B;  1B53 A;  1X3P A;  1G91 A;  1JE4 A;  5COY A;  3P7J A;  3KBX A;  1U4M A;  1XX8 A;  1WTR A;  1DON A;  2HCC A;  4IUP A;  2B2Y A;  2B2T C;  4IUQ A;  1PDQ A;  3G7L A;  2Q8R E;  2H1E A;  1QNK A;  1IL8 A;  2RSN A;  4X3T A;  5COR A;  1J9O A;  2HUG A;  3F2U A;  4RA8 A;  5EKI A;  1AZP A;  4IUT A;  3DM1 A;  3UI2 A;  3LWE A;  1O80 A;  1GUW A;  1WTW A;  5AFW A;  2KEE A;  4HCS A;  2B2W C;  1MGS A;  5EQ0 A;  2DY7 A;  2KOL A;  4ZLT F;  1Q3L A;  1HA6 A;  1ROD A;  1NR2 A;  5D65 A;  5T1I A;  2NWG A;  1EOT A;  1O7Y A;  3KUP A;  1QE6 A;  4U68 A;  2B2W A;  1MI2 A;  2EOT A;  2SDF A;  4MHE A;  1EIG A;  1DOK A;  3D6W A;  4XT1 B;  4CJ1 B;  1BBX C;  1G6Z A;  1HUN A;  1MSG A;  1VMP A;  1RTO A;  2JYO A;  3MTS A;  2L4N A;  3H91 A;  2L1B A;  1SDF A;  4OIJ A;  3DEO A;  3I3C A;  1F2L A;  3I8Z A;  2Q8T A;  3TN2 A;  4HED A;  1IKL A;  2K05 A;  4R8I A;  1WVL A;  2KVM A;  1NAP A;  2K04 A;  4CJ2 C;  1DZ1 A;  1F9P A;  2B2U A;  1B2T A;  2EPB A;  4CJ0 B;  2K28 A;  2KED A;  1ZXT A;  4MN3 A;  1M8A A;  1CA6 A;  3GV3 A;  4XT3 B;  5EPJ A;  2B2U C;  2J7Z A;  1JIC A;  1PFB A;  3TZD A;  1X3Q A;  2FHT A;  1U4R A;  4IUR A;  2CVR A;  2RA4 A;  4HAE A;  2X6G A;  4R9W A;  1KNE A;  1RHP A;  4X3U A;  1HRJ A;  1WD1 A;  2B2Y C;  2B2T A;  5EPK A;  2FJ2 A;  1HHV A;  2RSO A;  1EIH A;  4ZK9 B;  1CA5 A;  2FFK B;  1PFM A;  1SAP A;  1F9S A;  1B3A A;  4XDX A;  3IL8 A;  1IKM A;  2RVL A;  5JJZ A;  1J8I A;  1KNA A;  1TVX A;  1F9Q A;  3N52 A;  1BNZ A;  4LMQ D;  4NW2 A;  5EJW A;  4ZAI A;  4QUF A;  3Q6S A;  5CMD A;  1A15 A;  5D14 A;  4RWS C;  2BDN A;  1NR4 A;  2K03 A;  2X69 A;  1PLF A;  4IUV A;  1X32 A;  1CM9 A;  2L12 A;  2X6L A;  3I91 A;  1PFN A;  2MPM A;  1WTO A;  1WTX A;  2XIW A;  3I90 A;  1F9R A;  3FDT A;  1RTN A;  1SSO A;  1EQT A;  3R93 A;  4ZKC B;  1WTP A;  2HDM A;  2R3Z A;  5EPL A;  3GV6 A;  5CBA E;  1HUM A;  2L9H A;  4ZKB B;  2N55 A;  4QUC A;  1WTQ A;  3MWY W;  4UAI A;  3QO2 A;  3FPU B;  2KEC A;  2MP1 A;  2MGS A;  4IUU A;  1HFN A;  5E4X A;  1ESR A;  2MJ8 A;  2FMM A;  1WD0 A;  3IFD A;  2JP1 A;  1E0B A;  4O42 A;  3DEP A;  5CBE E;  1WTV A;  1G2T A;  1BF4 A;  1EL0 A;  1AP0 A;  1ML0 D;  2NYZ D;  1AZQ A;  3SVM A;  2HCI A;  4X3S A;  1DOM A;  1HFG A;  2IL8 A;  3HP3 A;  1ICW A;  1NCV A;  2B2V C;  2B2V A;  1ILQ A;  1DOL A;  2KUM A;  2N88 A;  4X3K A;  1RJT A;  1XYI A;  1B4O A;  5DNF A;  1BO0 A;  5T1G A;  4HSV A;  4DN4 M;  2K1B A;  2HDL A;  3ONA B;  2VXW A;  1B50 A;  2DY8 A;  5E4W C;  1C8C A;  2K01 A;  1ILP A;  4OIK A;  1VMC A;  1QG7 A;  1LV9 A;  1G2S A;  2NZ1 D;  2EE1 A;  1O7Z A;  2L11 A; 
#chains in the Genus database with same CATH topology
 2M2L A;  2FIN B;  4OWT B;  2LFN A;  2WII B;  3S9W A;  1JOR A;  4RKL A;  3GTP H;  4RGO S;  3RD4 A;  1JT8 A;  2WAQ B;  2A19 A;  2DN8 A;  1GUW A;  5EKK A;  2ID0 A;  5KND A;  4P73 A;  1PH4 A;  4JVZ A;  4JI6 Q;  3NEL A;  4XQQ A;  2EY2 A;  4A3J H;  1KQS A;  1XJV A;  1YZ6 A;  3QG1 A;  3PIP A;  4GKK L;  2B2W A;  3CCU A;  4CJ1 B;  1DM0 B;  3D4R A;  2A1A A;  4ABN A;  1SFO B;  3A8K E;  5JPM C;  3RN2 A;  4OIJ A;  5M3F G;  3L3O C;  4HED A;  2CCZ A;  2XVS A;  2JA6 G;  3I4M H;  2O5J C;  4RG1 A;  4ODG A;  1OXT A;  2NB0 A;  2WB1 G;  1NTG A;  4KJO A;  1C7Y A;  4A3M G;  1M8A A;  4I65 A;  4QQB X;  4QF4 A;  4JI8 L;  3VR2 A;  4L8J A;  3OYY A;  2NUC A;  5CC4 A;  4TKO B;  1Y14 B;  4KTA A;  2LY7 A;  2RHQ B;  1EFW A;  3CP0 A;  4NKL A;  4ZK9 B;  2JK8 A;  3RZO H;  1LTB D;  3KK7 A;  4F87 A;  3IL8 A;  3SDZ A;  1TVX A;  5IY0 A;  1KDC A;  3F2B A;  3S14 B;  3ULP A;  1K83 H;  3BDL A;  5LMN Q;  3R2T A;  4QY7 A;  3OHX C;  1CKN B;  2AUK A;  4A3K G;  1WTX A;  1C48 A;  3QOL A;  3TZU A;  4LFC L;  1EQT A;  1HNW Q;  3GDE A;  5CV9 A;  2JXM B;  3F2D A;  4O1N A;  2UUB L;  1PTO B;  1JJG A;  1SE8 A;  3DM3 A;  2Q2U A;  1YIJ A;  4NMZ A;  2OCE A;  3GTL H;  4FF1 A;  4DGZ A;  1Y1W H;  4MTN A;  2AQ3 B;  1FVI A;  2Z6B A;  3E0J A;  3PO2 G;  5CYU A;  2BDO A;  4A75 A;  4B3S L;  3D8G A;  4X3S A;  5M5Y B;  1ILQ A;  3PO2 B;  3NBH A;  3MXN B;  1M4V A;  2A69 C;  3EN2 A;  3GTL B;  2Z4I A;  4XYO A;  3H94 A;  1X3P A;  1PTO D;  1OTC A;  1FNW A;  3BYY B;  4JI3 Q;  5J22 A;  3I4N H;  1TS4 A;  1MIU A;  5BN5 A;  3NTK A;  2BE5 C;  1AZP A;  2R93 G;  4ZUI A;  3BJU A;  1H9R A;  4FYD A;  4UP9 A;  4U67 3;  1I4R A;  1XMO L;  1LYL A;  1CSP A;  1KRT A;  3LX0 A;  1Z7T A;  1VQC A;  4FNF A;  1LTA D;  4GN4 B;  4B08 A;  2A8V A;  2R92 H;  1VQN A;  1KC8 C;  4DV0 Q;  3HOY H;  3PMF A;  2EY1 A;  3J81 i;  2FXQ A;  1GUG A;  1FGU A;  5IWA L;  1KRS A;  1XPU A;  1BOS A;  3SK8 A;  2K28 A;  3VA5 A;  1CA6 A;  1QZG A;  3M4O H;  2CW0 D;  3RR5 A;  3P75 A;  2VZA A;  2Y0S B;  4JBM A;  4Q5V A;  2YU9 H;  5IGG A;  4DAP A;  1HRJ A;  4JV5 L;  5M3M G;  1SNC A;  4QGU A;  1QNU A;  4HIO A;  2DNC A;  3VYR A;  1H9K A;  2YTV A;  1JJC B;  3FKI B;  2VW9 A;  3NBI A;  4DV6 Q;  1IBL Q;  5EBC A;  2BA1 A;  2J4X A;  5C4J H;  4P2C B;  3T4A C;  1X56 A;  4BWG B;  1H9J A;  2SOB A;  3T1H L;  2X69 A;  2PZU A;  1PLF A;  4XYQ A;  5C5L A;  3T13 A;  1NSN S;  3HKS A;  3CPF A;  1ZYR C;  4LF5 L;  3AFP A;  2HDM A;  3GV6 A;  4PV1 C;  2B8G A;  2I07 B;  2SNM A;  4ZKB B;  4H44 C;  4LUO A;  2C9O A;  3K7A H;  4DV5 Q;  4BY1 H;  1S72 A;  4BY7 B;  3E5S A;  4M1U B;  5CBE E;  1PFS A;  1WTV A;  1TWG H;  1CZG A;  5ELO A;  4DV7 L;  1SR3 A;  3W1G A;  3CXC A;  5FOB B;  4LJZ C;  2HCI A;  2VQE L;  1I3Q B;  2N88 A;  1TWC H;  2K5W A;  3M4Y A;  5IT9 c;  3WOF A;  4DN4 M;  2NN6 H;  1STA A;  3J80 L;  5E1F A;  4A3F H;  4KKU A;  1VQO A;  2A68 C;  2D9U A;  3D4D A;  3HOU G;  1QOH A;  4LF9 L;  1YNN C;  3B6Y A;  3X3N A;  4HMJ A;  3P7J A;  1U4M A;  2B2Y A;  2XGT A;  2H1E A;  4AYB E;  4IPD A;  3F2U A;  4RA8 A;  4LF6 L;  3DM1 A;  2DJF C;  2F4V L;  3U4V A;  3IKJ A;  4CKC A;  1PMR A;  3E9H A;  3OWE B;  1ROD A;  5ELC A;  3M4Q A;  4LF4 L;  1DOK A;  5LMN L;  4C3I H;  4KKS A;  1PV4 A;  2G5D A;  1ASZ A;  1O7L A;  5GAG C;  2UUC L;  3TN2 A;  1X55 A;  3VDY A;  4LFC Q;  1Y1V G;  4ILW A;  4JI0 L;  1HZA A;  3TRE A;  2K4K A;  1CKN A;  3LGJ A;  3GTM H;  3CC4 A;  3D31 A;  4JI2 L;  2B8F A;  1JE5 A;  4LAA A;  3NE5 B;  2WAQ E;  4K14 A;  4JBW A;  4ME3 A;  5ELB A;  1F77 A;  2FJ2 A;  2QIL A;  2HHH L;  4O0A A;  3BZD B;  4XDX A;  1K3R A;  2HIX A;  5JJZ A;  1SNM A;  1IW7 C;  4IPC A;  1TWA B;  3HOU H;  3RNU A;  3NK9 A;  2PNH A;  5L37 A;  2H4O A;  5GQO A;  4E6I A;  2MFI A;  2NVY H;  2A6H D;  3VA7 A;  1STH A;  3BVM A;  4JYA Q;  1B1Z A;  3UDG A;  1P16 A;  3HKZ B;  4KV6 A;  2ES2 A;  4X62 L;  2CH4 W;  4ZRZ A;  1HFN A;  1D5Z C;  2PMZ E;  1LO5 D;  2MJ8 A;  4KY7 A;  4DR7 Q;  3EFX D;  4M8A A;  1PVO A;  5I6Y A;  5KGU A;  3G48 A;  4O42 A;  3H0G H;  2UUA Q;  4GLX A;  3E0E A;  1U5K A;  1G2T A;  1K0R A;  3MXN A;  2PMZ B;  2OT2 A;  3HP3 A;  1HFG A;  1K8O A;  2ZM6 Q;  4FXK C;  4JK1 C;  1SYG A;  5DNF A;  4F7X A;  5C0X J;  4JI7 Q;  2VXW A;  4CDF C;  3K8A A;  1ILP A;  4V19 0;  2CQO A;  2KCT A;  3D0F A;  2EE1 A;  1Z47 A;  4ME5 A;  2IT1 A;  2EYL A;  1MJC A;  2BOS A;  3G71 A;  1HNX L;  3K5O A;  3H3V C;  1RF2 D;  4KK7 A;  3HOX H;  1EZ8 A;  1V1Q A;  1Q8K A;  3G7L A;  5IYD H;  1KDB A;  2HUG A;  3S1Q B;  4FDB A;  4QL5 A;  1N34 L;  4A3E H;  4OX9 L;  2KOL A;  3KF6 A;  5G3L F;  4A3G G;  4KI0 A;  2QKI C;  1UE7 A;  3L9A X;  4KY6 A;  4NPS A;  1K3B C;  1R9T H;  2SDF A;  4MHE A;  4QB4 A;  2AMC B;  3W3A A;  1EEI D;  2L5T A;  1YNN D;  1S40 A;  1STY A;  5LL6 S;  2JA5 G;  4V0B A;  1D5M C;  3EIV A;  3S2H H;  5JOB A;  1FGB D;  2IJ0 A;  3J80 c;  2K50 A;  4B3M Q;  4GKK Q;  4DAY A;  4A3J B;  3U58 A;  1PTO C;  1LTL A;  2J0T D;  3V2T A;  3J81 j;  3H3V H;  2ZTC A;  5IYC H;  4XT3 B;  4WJW A;  2F0T A;  1X3Q A;  3PUY A;  5IGD A;  5E3F A;  2RA4 A;  2F0D A;  4DAY B;  2NVQ B;  2OF1 A;  2RSO A;  2A74 C;  2ZJR A;  2PW7 A;  1NMG A;  2K32 A;  4FF4 A;  5DAU A;  2OQ0 A;  1Q1E A;  5I2Y A;  1F9Q A;  5ELE A;  1UUP A;  1BNZ A;  1H95 A;  4NW2 A;  2VB3 X;  3RZD B;  3NTI A;  3Q6S A;  1UNS A;  2X6L A;  1AE3 A;  4QMG A;  1G51 A;  1IZ6 A;  3ULL A;  1A3T A;  2VL6 A;  3BVZ A;  2K52 A;  3NPP A;  4C2M B;  1XTD A;  4FO2 A;  2YTY A;  1T5X D;  2MP1 A;  3GTK B;  1BCP B;  4LFA L;  2F3V A;  4WJ4 A;  1GXD C;  4X65 Q;  1K83 B;  2D5D A;  2NVX H;  1SN8 A;  2RDF A;  4ULL A;  1UE6 A;  3K81 C;  5I6W A;  3J7A F;  1HNW L;  1BF4 A;  2D0O A;  4LW1 A;  2JSO A;  5CV7 A;  4KN7 C;  4L63 B;  2E5L L;  4IFD H;  2F4I A;  1AZQ A;  4DR4 L;  2CHB D;  1EY7 A;  1DOM A;  2UXD Q;  2R7Z B;  3PF4 A;  2XWJ B;  4R4O A;  3ONA B;  4DXF A;  2PPB C;  3ZYY X;  4RKB A;  2RKS A;  4MIU A;  3MC0 B;  2DGY A;  2Z4H A;  1QUQ B;  4RAU C;  1L0Y B;  2K33 A;  2VQF L;  1Z6H A;  4S3S A;  1CZW A;  3A8I E;  4GOP B;  2G9D A;  2AKW B;  4HR7 B;  3S14 H;  2N78 A;  1VQJ A;  5C3E B;  4A3M H;  1G6P A;  4DXG A;  3G6J B;  1H9M A;  3KLW A;  4MZ9 A;  3BYT B;  5IOD A;  3VYU A;  1MBY A;  4AQY L;  2F0F A;  3H91 A;  3I4N G;  2Q8T A;  4LFB Q;  2K5V A;  3NUC A;  4Y7N B;  5CV8 A;  3PO3 H;  1EU3 A;  1SE4 A;  2F1M A;  2A68 D;  4X62 Q;  1EQQ A;  2I5L X;  2R6G A;  3I70 A;  1ZXT A;  4GNX B;  5AJ3 L;  3CCV A;  1XPO A;  1RCV D;  1QJO A;  4X6A H;  3A55 A;  2FMC A;  2VUM B;  2KQ3 A;  4DV0 L;  4L5S A;  4UPA A;  2WB1 E;  2F0U A;  3K58 A;  5IGE A;  5IWA Q;  3PO2 H;  1HHV A;  5IP7 G;  2K5H A;  2QDB A;  1SAP A;  4LF5 Q;  1J8I A;  4JI4 Q;  2LMC B;  5JEA G;  4DK3 C;  1HA5 A;  1IHZ A;  4A3K B;  2K03 A;  3SGI A;  4LF8 Q;  4GLV B;  5JPN C;  1L2F A;  2F0Q A;  3AU7 A;  2EYJ A;  4Q0F A;  3I90 A;  4DV7 Q;  3TEH B;  4AH6 A;  3BDC A;  3HOZ H;  3CCL A;  3GTO B;  5K36 G;  1IYU A;  4JCV E;  4EQN A;  1O7I A;  3W2D A;  4R4I A;  3I55 A;  5JVG 3;  1TQO A;  2NYZ D;  3GTG B;  1JJ2 A;  1DOL A;  3BZC A;  3S1M B;  4EVO A;  5TSS A;  3OIQ A;  3K7A B;  5IE8 A;  3MXP A;  1JWS D;  3OW7 A;  1IW7 D;  5KYI A;  3TSS A;  3ERO A;  2K01 A;  1QIL A;  1VMC A;  4PMB A;  4RH6 A;  3HZX A;  1LT4 D;  4K2L A;  2B63 G;  1PRT D;  5GAH C;  3UDX A;  2JA6 H;  1TWF H;  2ATW A;  1PH9 A;  1XX8 A;  4C3J G;  2KBN A;  2H5X A;  2ZT9 C;  1PDQ A;  1P8L A;  1J5E Q;  2K5D A;  3TBI B;  4CHT B;  5GAE C;  5G3L D;  1YNJ D;  4CKB A;  2CH4 A;  1YHQ A;  2PYK A;  1TWH H;  3GD7 A;  2DY7 A;  1VQE A;  2IX1 A;  4FVM A;  1M90 C;  3CAM A;  4BBR G;  1EYC A;  1O7Y A;  2KEN A;  4K8J A;  2BA0 A;  2EJG C;  1K28 A;  3H09 A;  1MSG A;  3PCO B;  1I50 H;  2A73 B;  4OXP A;  1BQQ T;  4FF3 A;  3CCR A;  1LM0 A;  1HZB A;  5IYC G;  5IYB H;  3QB3 A;  2KCN A;  2NBF A;  1V8Q A;  1F2Z A;  1L1O C;  4K5V A;  4IN3 A;  3Q0A A;  1S5F D;  4BY7 H;  2OQK A;  2E2J H;  1RDP D;  1W6K A;  3GP7 A;  1A0I A;  1CK1 A;  4CBV A;  2Z9H A;  1EWC A;  4N9P A;  3K7U C;  4DFA A;  2RDG A;  3P20 A;  1RHP A;  4JI0 Q;  1LTS D;  1PA6 A;  1YIT A;  3I4O A;  4KHP Q;  2NVX B;  1JB7 A;  1HNZ L;  1SYE A;  2JJQ A;  1F9S A;  2EDG A;  4A3E G;  3RLO A;  3S16 H;  1GVP A;  1JWU D;  2MNA A;  1DGS A;  1SNO A;  3HOU B;  4OEM B;  2NN6 I;  1SYC A;  3L0O A;  2BDN A;  1IBK Q;  3K80 C;  4IUV A;  3K0Y A;  1PFN A;  5IOC A;  1EU4 A;  3OSO A;  3R93 A;  3HOX G;  2EYF A;  5EPL A;  5CBA E;  2L9H A;  3S1N H;  4XQJ A;  4GS3 A;  3FPP A;  4PZ6 A;  3FPU B;  3OWF A;  2A5H A;  3BZK A;  4CDE C;  1XPR A;  4B3S Q;  2ZM6 L;  1LTR D;  3IFD A;  1QWY A;  2Q2H A;  1OXU A;  1K8M A;  3BU2 A;  3MA2 B;  3LWU A;  3U9S A;  2LXK A;  4DA2 A;  5C44 H;  1I94 L;  2ICI A;  1Y1W B;  3SE0 A;  3J7Y W;  3V96 A;  2HDL A;  2IX0 A;  4IO9 A;  1TS2 A;  2RHS B;  4BA2 I;  3HOV G;  4A3F G;  3KOJ A;  4AYB G;  4X66 L;  3PUV A;  3O13 A;  1B8A A;  4DUZ L;  2KCC A;  3IFT A;  1E3P A;  3BDO A;  4C56 C;  5C4Z A;  3S1R H;  1DYQ A;  2JA7 H;  4NDX A;  5EQ0 A;  1PXU A;  4YY3 Q;  3ERQ A;  4CGY B;  4PZ8 A;  1GHJ A;  1NR2 A;  3AMU A;  4BY1 G;  4L5Q A;  3FKI H;  1G6Z A;  4BY1 B;  1G8Z D;  1IYJ B;  1RTO A;  2JYO A;  5FLX L;  5GAD C;  4K2K A;  1I4G A;  4LUV A;  3IRB A;  4JV5 Q;  3A7L A;  1LTI D;  2CQA A;  5DEH A;  5A2Q E;  4JI1 Q;  1SYF A;  3TQY A;  4Z9C B;  3RLN A;  2WV6 D;  4YHH Q;  1JIC A;  4J1M A;  1PFB A;  2VS1 A;  3RLF A;  3KYH C;  4R9W A;  4HAE A;  2X6G A;  1ONL A;  1WD1 A;  1SRU A;  3ERS X;  1D2B A;  4K5X A;  1J6Q A;  5A2Q L;  1PZK D;  4A3C H;  2CWA A;  1V9P A;  4QIW E;  5HUR A;  1TR5 A;  2FFK B;  4JI6 L;  2WAQ G;  5C4X G;  1UE5 A;  4TVA B;  1TY0 A;  4DK1 A;  1KDA A;  2Y0S E;  5IP9 H;  5FJ8 H;  1ET9 A;  4DV5 L;  5I9P A;  5LMN W;  1IBM Q;  5CV4 A;  1SE3 A;  2L12 A;  3I91 A;  3K6O A;  5IGC A;  1HNX Q;  1GJX A;  1F9R A;  3HRZ C;  3W5O A;  4IJH A;  1CHP D;  1C9O A;  2E8G A;  2JA6 B;  5FLX c;  1SMY C;  2QEJ C;  5IP9 G;  2F0S A;  1PH8 A;  4EGV A;  3BS1 A;  3K0X A;  5FK9 C;  3UE0 A;  2JEA I;  1E22 A;  1YJ9 A;  1Y8O B;  2QEX A;  2IL8 A;  2B2V C;  3DWA A;  4DU9 A;  3LNN A;  1B4O A;  2MO1 A;  2NZH A;  2YV5 A;  5T1G A;  2AWN A;  2K1B A;  1Q82 C;  4RMF A;  3PV0 A;  2EJF C;  4C1N I;  1QG7 A;  3NQT A;  1YNX A;  1GKH A;  4YCU A;  1JMC A;  3KDF A;  5IIF A;  4OWW B;  2SEB D;  1PHJ A;  4JYA L;  1W2B A;  4H0L C;  2NTT A;  3PUX A;  4HJA A;  1RD9 D;  4O2D A;  2OXP A;  5BR8 L;  4MTK A;  3KJP A;  3KLS X;  1O80 A;  1WTH A;  5IT9 E;  3W1B A;  2GN5 A;  1HNZ Q;  4L6T B;  1TS5 A;  2UUA L;  3OIP A;  1Q90 A;  2K7V A;  4UHV A;  2MQH A;  2WP8 J;  2EYP A;  1VQ8 A;  2JEB I;  1EOT A;  3OW2 A;  3D6W A;  1HUN A;  5M3M H;  1O78 A;  2EY6 A;  3MXG A;  1IBK L;  1PTO F;  2OTJ A;  4YWL A;  2BH2 A;  1L1O B;  1B7Y B;  4DPG A;  4EQ5 A;  4XXE A;  2OEO A;  1CQV A;  4P75 A;  1GM5 A;  1DZ1 A;  1B2T A;  4RGN A;  3MEH A;  5J39 A;  2NVY B;  4MN3 A;  3ER0 A;  3U9O A;  2Y0S G;  4C1N K;  1EY0 A;  3NTH A;  4RHR A;  3IAY A;  3UDF A;  5M3M B;  3Q8D A;  2RF4 A;  3KF6 B;  1KAB A;  3SK5 A;  4DAM A;  1OXS C;  4LK1 C;  2PI2 E;  3I7F A;  2E76 C;  5AJ3 Q;  2R93 B;  4LWC A;  3MAQ A;  1WCM H;  1S5B D;  3E3X A;  4DNR B;  3CRL C;  4PQX A;  4B3R Q;  4EX5 A;  2UXC L;  1EY9 A;  4A3B G;  2ZXR A;  4QUF A;  4HMI A;  3S2D H;  1X32 A;  2B3G A;  4DUY Q;  2WKD A;  1OXV A;  3J81 E;  1MD2 D;  4GKJ Q;  1RTN A;  2ZTE A;  2L55 A;  2VB2 X;  4A3I H;  2RCN A;  3HOZ B;  4JI4 L;  4A93 H;  4CKE A;  3HFZ B;  3STB D;  1N9W A;  3MWY W;  3HEJ A;  3JAM i;  1X54 A;  2TSS A;  1A63 A;  1R4Q B;  2PZT A;  1PZJ D;  4LF8 L;  3UDI A;  2XWB B;  3CCJ A;  4A3L H;  1BKB A;  3I2Z A;  3S1Q H;  3GTQ B;  1UE1 A;  1YJW A;  1CUK A;  2R92 B;  1I3Q H;  4LNQ A;  2B2V A;  3H0G B;  4JBJ A;  4AQY Q;  4X3K A;  4TRD A;  3VYS A;  2K75 A;  2JN4 A;  3CW2 C;  1D8L A;  4QJF A;  1SE2 A;  4LFB L;  5D3I B;  1GOZ A;  1KLG D;  3GTJ H;  2F0M A;  3T1H Q;  2WKC A;  2D2C C;  5JAV A;  1U4P A;  3R8B A;  4C3H G;  4FF2 A;  1EWI A;  2JE6 I;  1G91 A;  3E6Z X;  2QCP X;  4N8X 1;  4PZ7 A;  4JI7 L;  4DV1 L;  2EYH A;  3L7Z C;  3KF8 B;  1LT3 D;  3V05 A;  5IP7 H;  3WDN A;  5EKI A;  1ENC A;  1VQ9 A;  4PNY A;  1QUQ A;  2I5H A;  2E2I H;  4DV2 L;  5KYL A;  4HCS A;  1TWH B;  3G4S A;  1Q3L A;  5FO7 B;  1GO3 E;  2F0I A;  1EEF D;  1ENA A;  4PMC A;  1C0A A;  2WAC A;  4U68 A;  3NBH B;  4NP5 A;  3SXH A;  4KJN A;  1PH5 A;  2UXD L;  3PO3 G;  1STE A;  1ET6 A;  3SHL A;  1ASY A;  3MTS A;  3K5L A;  1I50 B;  4A3I G;  3C3L A;  4DV3 Q;  4A93 G;  1IYV A;  2K05 A;  1NAP A;  4POG A;  1EY4 A;  3QJY A;  1NUC A;  2B63 H;  2PZW A;  2BE5 D;  3GTM B;  3GV3 A;  1NY4 A;  3A74 A;  1VQH A;  1N36 L;  2JA8 B;  3MZ5 A;  2CVR A;  4ZCK A;  4LF6 Q;  1XMQ Q;  3MVV A;  4H02 A;  3S1M H;  5DM6 3;  4B3M L;  4P71 A;  5EGT A;  1NBW A;  2EIF A;  2R7F A;  1CA5 A;  2K5N A;  3T56 B;  3CF5 A;  4DR3 Q;  4LMQ D;  4ZAI A;  1A15 A;  1NR4 A;  4XTC S;  1LTT D;  4X65 L;  1PTO H;  4PG3 A;  3HG9 A;  2CFM A;  3R3O A;  1S5E D;  5M3F B;  3ULJ A;  3SR1 A;  1J5E L;  3AEV A;  4C3H H;  1PYW D;  2GVA A;  3S15 B;  5JEA H;  1VQ6 A;  1YNJ C;  2R7D A;  1JQY D;  1UEB A;  2L15 A;  4B9X A;  3I73 A;  1Q46 A;  4HCE A;  4BBR B;  4BBS G;  3A7A B;  3S16 B;  1VS0 A;  4OO1 I;  3SEB A;  3J7A V;  1K9M C;  4GOP C;  2N8N A;  2HHH Q;  2HD3 A;  5KNC A;  1TU2 B;  3OPO A;  4LFA Q;  1XYI A;  3A54 A;  3M4O B;  1BO0 A;  3UE1 A;  4HSV A;  5C0X I;  4PMW A;  4XIG S;  4A3L G;  2EXD A;  1C8C A;  1S5C D;  5C4X B;  2ZTD A;  2PI2 A;  1FL0 A;  2XTI A;  1I94 Q;  1O7Z A;  1BUV T;  1N8R C;  3QR8 A;  3X3M A;  2R7Z H;  5COY A;  3JAM L;  3CQZ H;  3J7Z C;  4TQU S;  1XNR L;  1DON A;  1E2Z A;  1T5E A;  2GA4 B;  5C0X H;  5C4J B;  3DHQ A;  5C3W A;  1QNK A;  4RFB A;  4KD4 A;  4IUT A;  1AEX A;  1HR0 L;  5JJI A;  4RGT A;  4A3B H;  4DR7 L;  2WIN B;  2M00 A;  1SBB B;  3DWP A;  2JA7 B;  1MGS A;  3JAM c;  4A3E B;  3MXU A;  3C2P A;  3J7A 5;  1SNP A;  5LMU L;  1X3F A;  1YI2 A;  1HA6 A;  4DR2 Q;  1WCM G;  3PIO A;  1L0X B;  1II3 A;  4RHS A;  4IOA A;  3GTO H;  1WCM B;  2UXC Q;  4DV4 Q;  4WFN 3;  1Q7Y C;  3DEO A;  1K8A C;  1F2L A;  1SJH D;  1NNX A;  5ELD A;  4R8I A;  1RKN A;  4BXX H;  1F9P A;  4LUZ A;  1LUZ A;  1HQR D;  1EQV A;  1Q12 A;  4RCO A;  2J7Z A;  1I6H H;  1KNE A;  5M5X H;  3DXJ C;  4A3C G;  1XWE A;  5D3D A;  3GTP B;  1N34 Q;  1LT6 D;  3NEN A;  3KFU A;  2VUM H;  4OX9 Q;  1LAB A;  1PFM A;  1K8G A;  2OWO A;  3HOW B;  3MHB A;  2BH8 A;  2RVL A;  1DJR D;  4YHH L;  2ZXP A;  5J1Z A;  1HZ9 A;  1R4P B;  3I4L A;  4RWS C;  3HOX B;  2N49 A;  3U4Z A;  1STN A;  3M9B A;  2L0C A;  3D3R A;  2R3Z A;  4OON A;  3T1Y Q;  3OMG A;  4K5W A;  3AFQ A;  3HS0 C;  1TWF B;  2JA8 H;  3VR4 A;  2AQ1 B;  1D1I A;  1JCK B;  2JP1 A;  4EQO A;  3QOJ A;  3MFG A;  4WJ3 M;  3CCE A;  4HJ5 A;  4YIJ A;  3NP8 A;  3TRZ A;  2PW5 A;  1NCV A;  5HY6 A;  2EZV A;  1EWH A;  3TME A;  3FP9 A;  4JOI C;  5C3X A;  1Y69 U;  1LV9 A;  1I4H A;  4GN3 B;  2KHS A;  3NQI A;  1S4Z A;  1UWV A;  1B53 A;  2M9V A;  3P1H A;  1B9M A;  4IZ8 A;  3NSW A;  3EJI A;  1OXX K;  4IUP A;  3FRP B;  4X3T A;  1GUO A;  5COR A;  2K14 A;  3H3V I;  3J80 E;  3UI2 A;  4YCV A;  2EVB A;  5FJ8 G;  3C1F A;  5AFW A;  2KEE A;  5C44 G;  3ND9 A;  2IW3 A;  4G7O C;  1FR3 A;  5C3E H;  2JA9 A;  2F0K A;  3M3Y B;  1BDO A;  5T1I A;  1HTP A;  4HJ8 A;  4DR5 L;  1EY5 A;  2EOT A;  4XT1 B;  1FYC A;  1ENF A;  1QVG A;  1VMP A;  2F0L A;  3HKZ G;  3WWV A;  5JEA J;  4WOR A;  4C2M H;  1PRT B;  1WVL A;  2KVM A;  4TSS A;  2K04 A;  5KEE A;  3URY A;  2B2U A;  2EQS A;  5IT9 L;  4KHZ A;  4A76 A;  3A5U A;  1SMY D;  3DMU A;  1EYA A;  3E9I A;  5ELN A;  4GZY C;  4C3H B;  2HQE A;  4JG2 A;  3L2P A;  3S17 H;  1EFI D;  3M85 A;  4A3M B;  4K0K Q;  5GRO A;  3AB9 A;  2VY3 A;  1U4R A;  1E1O A;  3RN5 A;  1JC7 A;  4QIW B;  3F2C A;  1TS3 A;  2CWP A;  2Q2I A;  4IQZ A;  3ICE A;  4YY3 L;  1EUJ A;  3CCM A;  1KNA A;  3T51 B;  4GN5 A;  1EIF A;  2YTX A;  5EJW A;  5I4D A;  1A6X A;  5F2D A;  4KHP L;  2VNU D;  2Z8L A;  5ISR A;  2NN6 G;  4F88 A;  4LF7 L;  1LTG D;  3BVG A;  4A3I B;  4A93 B;  1Q86 C;  3CQZ B;  1JOQ A;  3HOV H;  1I6H B;  1NE3 A;  1HR0 Q;  1E7Z A;  1Z9F A;  1W6J A;  3EA6 A;  2Z1C A;  2F0G A;  3ND8 A;  1MKH A;  2IHE A;  2EYO A;  2IY5 B;  4DK6 C;  4DR2 L;  3C46 A;  4EQP A;  4F8M A;  2JA8 G;  1EYD A;  1JOK A;  5KNB A;  2RCF A;  3GTG H;  2F3I A;  1I4X A;  2OTL A;  1RJT A;  4DAV A;  3WOE A;  4C3J H;  4DV1 Q;  2XSC A;  1B50 A;  1HR0 W;  3CPW A;  3Q22 A;  5CGK A;  2EY5 A;  2V1C C;  1U4L A;  1EOV A;  4OO1 G;  4DF7 A;  1STG A;  1Y1V H;  1HJP A;  5IGF A;  1VQL A;  1IL8 A;  3SK6 A;  4OL7 A;  1J9O A;  4J15 A;  1SMX A;  4X64 Q;  1Y8N B;  1A3V A;  4DV3 L;  1VQF A;  4H7B A;  3GTJ B;  3GO5 A;  1VCI A;  4BBS B;  2NWG A;  1X9N A;  3KUP A;  3HOW H;  1CFM A;  3PIO 3;  3S1R B;  4BXX G;  1UEA B;  1XNQ L;  2WFW A;  1SND A;  3HOZ G;  3PF5 A;  1FNV A;  2I46 A;  1EY8 A;  1L0W A;  3M7G A;  2KCM A;  5M5W B;  4BY7 G;  4QCL A;  2E2J B;  4YCW A;  4HJ9 A;  2E2H H;  2MHV A;  4IPH A;  3A8J E;  5H1S E;  2XRQ D;  2B2U C;  5FLM G;  1Q81 C;  2FHT A;  4DR3 L;  3DLL A;  4G57 A;  4FP5 D;  1KL9 A;  1S5D D;  1TXY A;  4DNI A;  5EPK A;  3MFY A;  4Y52 H;  1B3Q A;  3RMH A;  2DJG C;  5C0X G;  1KXL A;  5FO9 B;  2B39 A;  4HIK A;  1DCZ A;  4L5R C;  4HN7 A;  3AYH B;  4IFD J;  1IKM A;  1AE2 A;  1BCP D;  3G6E A;  2V4D A;  4ZQ3 A;  4KD3 A;  4RCN A;  1VQ4 A;  1E1T A;  1IL2 A;  1K0S A;  4GNX C;  2MPM A;  1V1P A;  2XIW A;  4WRD A;  3PIP 3;  1YHA A;  4HJ7 A;  2MUY A;  1HUM A;  2JA5 B;  3EVQ A;  4R4C A;  3A5Z B;  4UP8 A;  4KN4 C;  2IPK D;  2MGS A;  4IUU A;  1SFO H;  2F0N A;  2BCO A;  3J80 i;  5LL6 X;  4HTH A;  4IPG A;  4R8N A;  1S3O A;  1YBY A;  3OOC A;  3FMC A;  1VQI A;  3NWS A;  4J8Q A;  1EL0 A;  4G4K A;  1I6V C;  1PH6 A;  4R4T A;  1RIP A;  3D6C A;  4N8F A;  3S24 A;  1B70 B;  2ZJQ A;  2RDH A;  3OTO Q;  3S15 H;  3TP7 A;  2NZO A;  3EBE A;  3TP5 A;  1SEB D;  2QF7 A;  4OIK A;  4A3F B;  3C1E A;  2YYZ A;  3GQB A;  4ZUJ A;  1MSH A;  1U0L A;  2UU9 Q;  2KJX A;  4JI2 Q;  2NTS A;  3HOY G;  4GKJ L;  1EYG A;  1H9S A;  3HOV B;  4C3I B;  1WTR A;  4JI5 Q;  1CQF A;  4JI8 Q;  4UP7 A;  4DR6 Q;  1PZI D;  2AHO B;  1GUN A;  4IFD G;  4GLA C;  1Q8I A;  4NXM L;  1HTL D;  1QVF A;  4UDU C;  2Z0S A;  3FVQ A;  2ICE C;  5EKL A;  3PQI A;  4K6L A;  3I4M G;  1PRT C;  2L1B A;  3TP8 A;  5M3F H;  1H9S B;  1OO9 B;  2QGQ A;  1B44 D;  1D5X C;  4LF7 Q;  4CJ2 C;  4N9T A;  2E2D C;  2R7Z G;  2Q8I B;  1K73 C;  1HXY D;  1Y1V B;  2QDL A;  1X3E A;  4ZYS A;  3NHH A;  1TT2 A;  3KLS A;  1VQA A;  5EAY A;  2KHJ A;  3SK4 A;  1IBL L;  3CCS A;  3KF8 A;  4DUZ Q;  4B3R L;  3TZD A;  4IUR A;  1I4P A;  5M5X B;  2B2Y C;  1VF7 A;  3CRK C;  2QA4 A;  3NWT A;  5LHY 1;  2RBM A;  1NJI C;  1HZC A;  1WYD A;  5ELF A;  4DUY L;  1EIH A;  1B3A A;  1VQG A;  1ZEQ X;  2F0E A;  3DUZ A;  2AWO A;  1CHQ D;  5DLQ E;  4DKA C;  3I56 A;  3CC2 A;  1BR9 A;  1EY6 A;  2D62 A;  2RQX A;  2ALY B;  3I72 A;  2E2I B;  5KRU A;  4R1J A;  4C3J B;  1CT1 D;  4GNX A;  1ESF A;  3U50 C;  1N32 Q;  1F2Y A;  1XNR Q;  4A3K H;  1PH3 A;  4UAI A;  2YU9 B;  3VR5 A;  2KEC A;  1JOO A;  4JI1 L;  1STB A;  1YVC A;  2WB1 B;  4NXN L;  1CSQ A;  1X65 A;  1KHI A;  4IJL A;  4Y7N H;  4JOI A;  1BCP C;  1V43 A;  1AP0 A;  1T9H A;  2G9H D;  5A35 A;  4OHJ A;  3K57 A;  4JC0 A;  2PQA A;  2F0H A;  4HID A;  3J81 c;  2C35 B;  1PYB A;  2EYM A;  3M4P A;  4IFD I;  1SLJ A;  4KMU C;  5E4W C;  3CME A;  3NXW A;  4OO1 H;  3RUZ A;  1IBM L;  2F0W A;  2XRS D;  4HIM A;  2VQE Q;  4G7Z C;  1JE4 A;  1AH9 A;  3KBX A;  4JPB W;  1YHB A;  1A2U A;  4IUQ A;  4ALP A;  2UUB Q;  1I5F A;  4APV A;  2HQL A;  4DR5 Q;  1TY2 A;  2LSS A;  2I5M X;  2Z6K A;  4LF9 Q;  2PQA B;  2A6E C;  4DV6 L;  1PYS B;  1QZH A;  1D6E C;  1FNU A;  1L1O A;  3A56 A;  5D65 A;  3S1N B;  1D1K A;  1A8V A;  1MI2 A;  1BBX C;  2E75 C;  1VQM A;  1VQK A;  2LXJ A;  1NMF A;  1JWM D;  2F4V Q;  4DV2 Q;  1IXR A;  3I3C A;  4JW0 A;  5FLM H;  1IKL A;  3S2H B;  1SRO A;  4IAL A;  1GD7 A;  4DNT B;  3A0J A;  1KIX A;  4LF4 Q;  1JB3 A;  2KED A;  3CC7 A;  3CHB D;  4I7A A;  1B9N A;  3MEF A;  2JA5 H;  4X3U A;  2E74 C;  2E5L Q;  5BR8 Q;  1HPC A;  1E24 A;  2F03 A;  3HOW G;  2EJM A;  3HGB A;  3ZJY C;  2P5Z X;  5LMU Q;  4A3G H;  5J3B A;  1N36 Q;  1V1O A;  2PQE A;  1JR0 D;  3N52 A;  1KAA A;  4CDC C;  4AYB B;  4J6H A;  1GUT A;  4DR1 Q;  4IUN A;  4B3T L;  2EXZ A;  4L5T A;  5IYD G;  4A3B B;  1CM9 A;  4A4I A;  2UU9 L;  3T16 A;  1SXT A;  3KLR A;  5M5Y H;  1SSO A;  4ZKC B;  3TS2 A;  1WTP A;  3K5M A;  1Y8P B;  5JJL A;  1XXG A;  4QUC A;  2AUJ D;  5C44 B;  2XN9 C;  2FMM A;  1EQR A;  1DXM A;  5C3E G;  1GHK A;  1KAW A;  1SYD A;  3M3Y H;  1PH2 A;  5BN4 A;  1ZKO A;  2F0O A;  1BCP F;  4GOP A;  2O4X A;  3CU7 A;  5I9O A;  3K59 A;  4K6D A;  3I4N B;  4YWM A;  2NVT H;  3VYT A;  1FJG L;  5FO8 B;  3H0G G;  2DY8 A;  1SYB A;  2R61 A;  1QCB D;  2GVB A;  4X64 L;  1G2S A;  1AN8 A;  4R4Q A;  1Q1B A;  2F3W A;  2JQO A;  3N6R A;  4IOC A;  5C4X H;  2NVT B;  2RSN A;  1FD7 D;  2ZJP A;  3M7N A;  1A3U A;  2ZXO A;  1BBU A;  3LWE A;  1XNQ Q;  1R9T B;  1N33 L;  2UXB L;  2MO0 A;  4JI3 L;  1VQP A;  3HKZ E;  1VQ5 A;  1PH1 A;  1QE6 A;  5FKA C;  1RL2 A;  2N3S A;  2KA7 A;  5IGB A;  4NB3 A;  1CKO A;  3KDF B;  2Q2T A;  1N32 L;  5EBD A;  1LAC A;  2C5C A;  1XTC D;  1XMO Q;  4KKT A;  3F8T A;  1WFQ A;  1AW7 A;  1V1P B;  2D0P A;  4DV4 L;  4CDD C;  1PRT F;  2O5I C;  3JAM E;  2F0J A;  4NXN Q;  1G29 1;  2F0V A;  1BXT A;  4C3I G;  2VUM G;  4ID6 A;  3PUZ A;  1LT5 D;  1EZ6 A;  3BG3 A;  2DNE A;  1A62 A;  2QW7 A;  1PH7 A;  3ITP A;  3EQL C;  1F2M A;  4A3D G;  2IHF A;  3FHW A;  3TS0 A;  3NEM A;  1TWG B;  1KTK A;  4A3D B;  3J81 L;  5KIX A;  5CMD A;  1GUS A;  3JC6 6;  2F0P A;  4POF A;  1UAP A;  3H15 A;  1WTO A;  3GTK H;  1VF5 C;  1X3G A;  2PNR C;  3I4M B;  1HQM C;  3FDT A;  3DWQ A;  1HCZ A;  3OMC A;  1U9R A;  4KY5 A;  4DK0 A;  1WTQ A;  4BS9 A;  1WOC A;  4DR4 Q;  3VR3 A;  4P72 A;  4HSP A;  2PO4 A;  2HT1 A;  4A3D H;  5HGQ A;  2F52 A;  1A2T A;  2B29 A;  4FXG C;  3PGZ A;  4OWX B;  3TP6 A;  3T1Y L;  2K6A A;  3QIA A;  1XMQ L;  3RZO B;  4P74 A;  5I2X A;  1TWC B;  1ICW A;  5C6A A;  5CV5 A;  5E7N A;  1BVS A;  3T53 B;  1SNQ A;  2B63 B;  5M5W H;  5K5P A;  2K5Q A;  2KUM A;  2NZ1 D;  1CKM A;  1TWA H;  3STB C;  2L11 A;  2TMP A;  1KLU D;  2A6H C;  3PUW A;  1AFP A;  2CW0 C;  2HCC A;  2IWH A;  1E2W A;  2B2T C;  5DM7 3;  1MHW C;  5JJK A;  2ENB A;  1CTM A;  3AQQ A;  4G7H C;  2Q8R E;  3RZD H;  4FXD A;  3FKI G;  4AIM A;  4B9W A;  3FEW X;  3S2D B;  1WTW A;  3S17 B;  2UUC Q;  2B2W C;  2LKV A;  4ZLT F;  3TDQ A;  1KD1 C;  5CV6 A;  2JA7 G;  4JI5 L;  1M1K C;  1QVC A;  4A3G B;  5HGT A;  4H13 C;  1EIG A;  4MNO A;  4DR6 L;  2CKZ B;  3CD6 A;  3CKI B;  4DR1 L;  4B3T Q;  5IYB G;  1CI3 M;  1ICF B;  2L4N A;  4RGM A;  1SDF A;  4K0K L;  3I8Z A;  1VQ7 A;  1ZYR D;  1EIY B;  4I7Z C;  1C4Q A;  2EPB A;  5JVH 3;  4CJ0 B;  4BBR H;  1MJE A;  2ASB A;  5CR3 A;  5EPJ A;  2PCF B;  4XQN A;  2R92 G;  2B2T A;  4OEL B;  1W3S A;  5NUC A;  4OGQ C;  2A6E D;  3QWN A;  1FJG Q;  4KLK A;  1WJJ A;  2SNS A;  3K5N A;  3OTO L;  1D7Q A;  1VQD A;  3F1Z A;  2R93 H;  5D14 A;  3KBG A;  3HOY B;  1DD2 A;  3CMA A;  1E2V A;  1QB5 D;  2XNA C;  4X66 Q;  2O2L D;  4UY8 C;  2VQF Q;  2A69 D;  3D4W A;  4JBK A;  2N55 A;  1BBW A;  1YJN A;  3QO2 A;  3GTQ H;  5C5M A;  5E4X A;  1ESR A;  1I4Q A;  3VR6 A;  4BA1 I;  1LLR D;  1WD0 A;  2I0Q A;  4K8I A;  1E0B A;  4A3J G;  3DEP A;  1N33 Q;  1X6O A;  2DUD A;  2KHI A;  4KHV A;  4NXM Q;  3KJO A;  2UXB Q;  3CCQ A;  1VDZ A;  1VQB A;  1TKW B;  3PO3 B;  1ML0 D;  1TII D;  4YWK A;  3PSI A;  5K36 H;  3SVM A;  1WI5 A;  3Q23 A;  1HH2 P;  2Z6K C;  5BN3 A;  5M9O A;  2NVQ H;  5C4H A;  2E2H B;  3Q24 A;  2LS0 1;  1SJE D;  1Y1W G;  4BBS H;  1YEZ A;  2IX3 A;  3R2I A;  3H6M A;  2AQ2 B;  2HIV A;  5FLX E; 
#chains in the Genus database with same CATH homology
 2M2L A;  2FIN B;  2LFN A;  2WII B;  3S9W A;  1JOR A;  4RKL A;  4RGO S;  3RD4 A;  2WAQ B;  2DN8 A;  1GUW A;  5EKK A;  2ID0 A;  5KND A;  4XQQ A;  2EY2 A;  3QG1 A;  2B2W A;  4CJ1 B;  1DM0 B;  3D4R A;  4ABN A;  1SFO B;  3A8K E;  5JPM C;  4OIJ A;  3L3O C;  4HED A;  2XVS A;  2O5J C;  4ODG A;  1OXT A;  2NB0 A;  4KJO A;  1M8A A;  4I65 A;  4QF4 A;  3VR2 A;  4L8J A;  5CC4 A;  2NUC A;  4TKO B;  4KTA A;  2LY7 A;  4NKL A;  4ZK9 B;  1LTB D;  3KK7 A;  4F87 A;  3IL8 A;  3SDZ A;  1TVX A;  1KDC A;  3S14 B;  3BDL A;  3R2T A;  3OHX C;  2AUK A;  1WTX A;  1C48 A;  3QOL A;  3TZU A;  1EQT A;  5CV9 A;  2JXM B;  4O1N A;  1PTO B;  4NMZ A;  4FF1 A;  4DGZ A;  2AQ3 B;  3E0J A;  5CYU A;  2BDO A;  3D8G A;  4X3S A;  5M5Y B;  1ILQ A;  3PO2 B;  3NBH A;  1M4V A;  2A69 C;  3GTL B;  2Z4I A;  4XYO A;  3H94 A;  1X3P A;  1PTO D;  1FNW A;  3BYY B;  5J22 A;  1TS4 A;  5BN5 A;  3NTK A;  2BE5 C;  1AZP A;  4ZUI A;  1H9R A;  4FYD A;  4U67 3;  1I4R A;  3LX0 A;  1Z7T A;  4FNF A;  1LTA D;  4B08 A;  3PMF A;  2EY1 A;  1GUG A;  1BOS A;  3SK8 A;  2K28 A;  3VA5 A;  1CA6 A;  2CW0 D;  3P75 A;  2Y0S B;  4Q5V A;  5IGG A;  4DAP A;  1HRJ A;  1SNC A;  1QNU A;  2DNC A;  3VYR A;  1H9K A;  3FKI B;  3NBI A;  5EBC A;  2BA1 A;  2J4X A;  4P2C B;  3T4A C;  4BWG B;  1H9J A;  2SOB A;  2X69 A;  2PZU A;  1PLF A;  4XYQ A;  5C5L A;  3T13 A;  1NSN S;  1ZYR C;  2HDM A;  3GV6 A;  4PV1 C;  2B8G A;  2I07 B;  2SNM A;  4ZKB B;  4H44 C;  2C9O A;  4BY7 B;  3E5S A;  4M1U B;  5CBE E;  1WTV A;  1CZG A;  5FOB B;  4LJZ C;  2HCI A;  1I3Q B;  2N88 A;  2K5W A;  3M4Y A;  3WOF A;  4DN4 M;  2NN6 H;  1STA A;  3J80 L;  5E1F A;  4KKU A;  2A68 C;  2D9U A;  3D4D A;  1QOH A;  1YNN C;  3X3N A;  4HMJ A;  3P7J A;  1U4M A;  2B2Y A;  2H1E A;  3F2U A;  4RA8 A;  3DM1 A;  3IKJ A;  4CKC A;  1PMR A;  3OWE B;  1ROD A;  5ELC A;  1DOK A;  4KKS A;  1O7L A;  3TN2 A;  4ILW A;  3D31 A;  2B8F A;  4LAA A;  3NE5 B;  4JBW A;  4K14 A;  5ELB A;  1F77 A;  2FJ2 A;  2QIL A;  3BZD B;  4XDX A;  5JJZ A;  1SNM A;  1IW7 C;  1TWA B;  3NK9 A;  2H4O A;  4E6I A;  3VA7 A;  2A6H D;  1STH A;  3BVM A;  1B1Z A;  3HKZ B;  4KV6 A;  4ZRZ A;  1HFN A;  1D5Z C;  1LO5 D;  2MJ8 A;  4KY7 A;  3EFX D;  4M8A A;  5I6Y A;  5KGU A;  4O42 A;  1G2T A;  3MXN A;  2PMZ B;  2OT2 A;  3HP3 A;  1HFG A;  1K8O A;  4FXK C;  4JK1 C;  1SYG A;  5DNF A;  4F7X A;  5C0X J;  2VXW A;  1ILP A;  4V19 0;  2EE1 A;  1Z47 A;  4ME5 A;  2IT1 A;  2EYL A;  2BOS A;  3K5O A;  3H3V C;  1RF2 D;  4KK7 A;  1EZ8 A;  3G7L A;  1KDB A;  2HUG A;  3S1Q B;  2KOL A;  5G3L F;  4KI0 A;  2QKI C;  3L9A X;  4KY6 A;  2SDF A;  4MHE A;  4QB4 A;  3W3A A;  1EEI D;  2L5T A;  1YNN D;  1STY A;  5LL6 S;  4V0B A;  1D5M C;  5JOB A;  1FGB D;  2IJ0 A;  4DAY A;  4A3J B;  1PTO C;  2J0T D;  3V2T A;  4XT3 B;  4WJW A;  2F0T A;  1X3Q A;  3PUY A;  5IGD A;  5E3F A;  2RA4 A;  2F0D A;  2NVQ B;  2OF1 A;  2RSO A;  2A74 C;  2PW7 A;  2K32 A;  4FF4 A;  5DAU A;  1Q1E A;  5I2Y A;  1F9Q A;  5ELE A;  1UUP A;  1BNZ A;  4NW2 A;  2VB3 X;  3RZD B;  3NTI A;  3Q6S A;  1UNS A;  2X6L A;  4QMG A;  1A3T A;  3BVZ A;  3NPP A;  4C2M B;  4FO2 A;  1T5X D;  3GTK B;  2MP1 A;  1BCP B;  2F3V A;  1GXD C;  1K83 B;  2D5D A;  2RDF A;  4ULL A;  3J7A F;  5I6W A;  1BF4 A;  2JSO A;  5CV7 A;  4KN7 C;  4L63 B;  4IFD H;  2F4I A;  1AZQ A;  2CHB D;  1EY7 A;  1DOM A;  2R7Z B;  2XWJ B;  3ONA B;  4DXF A;  2PPB C;  3ZYY X;  4RKB A;  2RKS A;  4MIU A;  3MC0 B;  2Z4H A;  4RAU C;  1L0Y B;  2K33 A;  1Z6H A;  4S3S A;  1CZW A;  3A8I E;  2G9D A;  4HR7 B;  5C3E B;  4DXG A;  3G6J B;  1H9M A;  3BYT B;  5IOD A;  3VYU A;  1MBY A;  2F0F A;  3H91 A;  2Q8T A;  3NUC A;  4Y7N B;  5CV8 A;  1EU3 A;  1SE4 A;  2F1M A;  2A68 D;  2R6G A;  3I70 A;  1ZXT A;  1RCV D;  1QJO A;  3A55 A;  2FMC A;  2VUM B;  2KQ3 A;  3K58 A;  2F0U A;  5IGE A;  1HHV A;  2QDB A;  1SAP A;  1J8I A;  2LMC B;  5JEA G;  1HA5 A;  1IHZ A;  4A3K B;  2K03 A;  5JPN C;  2F0Q A;  3AU7 A;  2EYJ A;  4Q0F A;  3I90 A;  3BDC A;  3GTO B;  5K36 G;  1IYU A;  4EQN A;  3W2D A;  5JVG 3;  1TQO A;  2NYZ D;  3GTG B;  1DOL A;  3S1M B;  4EVO A;  5TSS A;  3OIQ A;  3K7A B;  3MXP A;  1JWS D;  3OW7 A;  1IW7 D;  5KYI A;  3TSS A;  3ERO A;  2K01 A;  1QIL A;  1VMC A;  4PMB A;  4RH6 A;  3HZX A;  1LT4 D;  4K2L A;  1PRT D;  1XX8 A;  4C3J G;  2ZT9 C;  1PDQ A;  2K5D A;  3TBI B;  4CHT B;  5G3L D;  1YNJ D;  4CKB A;  2PYK A;  3GD7 A;  2DY7 A;  2IX1 A;  4FVM A;  1EYC A;  1O7Y A;  4K8J A;  2BA0 A;  2EJG C;  3H09 A;  1MSG A;  2A73 B;  1BQQ T;  4FF3 A;  3QB3 A;  2KCN A;  2NBF A;  1V8Q A;  1F2Z A;  4K5V A;  4IN3 A;  3Q0A A;  1S5F D;  1RDP D;  1W6K A;  3GP7 A;  1CK1 A;  4CBV A;  1EWC A;  4N9P A;  4DFA A;  2RDG A;  3P20 A;  1RHP A;  1LTS D;  2NVX B;  1SYE A;  1F9S A;  2EDG A;  1JWU D;  3HOU B;  1SNO A;  2NN6 I;  1SYC A;  2BDN A;  4IUV A;  3K0Y A;  1PFN A;  5IOC A;  1EU4 A;  3OSO A;  3R93 A;  2EYF A;  5EPL A;  5CBA E;  2L9H A;  4XQJ A;  3FPP A;  3FPU B;  3OWF A;  2A5H A;  1LTR D;  3IFD A;  1QWY A;  1OXU A;  1K8M A;  3MA2 B;  3LWU A;  3U9S A;  4DA2 A;  2ICI A;  1Y1W B;  3SE0 A;  3J7Y W;  3V96 A;  2HDL A;  2IX0 A;  1TS2 A;  4BA2 I;  3PUV A;  3O13 A;  2KCC A;  3IFT A;  3BDO A;  4C56 C;  5C4Z A;  1DYQ A;  4NDX A;  5EQ0 A;  1PXU A;  3ERQ A;  4CGY B;  1GHJ A;  1NR2 A;  3AMU A;  1G6Z A;  4BY1 B;  1G8Z D;  1RTO A;  2JYO A;  5FLX L;  4K2K A;  1I4G A;  3A7L A;  1LTI D;  2CQA A;  5DEH A;  5A2Q E;  1SYF A;  4Z9C B;  2WV6 D;  1JIC A;  1PFB A;  4J1M A;  3RLF A;  4R9W A;  4HAE A;  2X6G A;  1ONL A;  1WD1 A;  1D2B A;  4K5X A;  5A2Q L;  1PZK D;  5HUR A;  1TR5 A;  2FFK B;  1TY0 A;  4DK1 A;  1KDA A;  1ET9 A;  5I9P A;  5CV4 A;  1SE3 A;  2L12 A;  3I91 A;  3K6O A;  5IGC A;  1GJX A;  1F9R A;  3HRZ C;  1CHP D;  2JA6 B;  1SMY C;  2QEJ C;  2F0S A;  4EGV A;  3BS1 A;  2JEA I;  5FK9 C;  1Y8O B;  2IL8 A;  2B2V C;  3DWA A;  4DU9 A;  3LNN A;  1B4O A;  5T1G A;  2AWN A;  2K1B A;  3PV0 A;  2EJF C;  4C1N I;  1QG7 A;  3NQT A;  5IIF A;  2SEB D;  4H0L C;  2NTT A;  3PUX A;  1RD9 D;  2OXP A;  3KLS X;  1O80 A;  5IT9 E;  4L6T B;  1TS5 A;  3OIP A;  1Q90 A;  2K7V A;  2WP8 J;  2EYP A;  2JEB I;  1EOT A;  3D6W A;  1HUN A;  1O78 A;  2EY6 A;  3MXG A;  1PTO F;  4XXE A;  2OEO A;  1CQV A;  1DZ1 A;  1B2T A;  4RGN A;  3MEH A;  5J39 A;  2NVY B;  4MN3 A;  3U9O A;  4C1N K;  1EY0 A;  3NTH A;  4RHR A;  3IAY A;  5M3M B;  1KAB A;  3SK5 A;  1OXS C;  4LK1 C;  2E76 C;  2R93 B;  3MAQ A;  1S5B D;  4DNR B;  3CRL C;  4PQX A;  1EY9 A;  2ZXR A;  4QUF A;  4HMI A;  1X32 A;  2WKD A;  1OXV A;  3J81 E;  1MD2 D;  1RTN A;  2L55 A;  2VB2 X;  3HOZ B;  4CKE A;  3MWY W;  3HEJ A;  2TSS A;  1R4Q B;  2PZT A;  1PZJ D;  2XWB B;  3GTQ B;  2R92 B;  2B2V A;  3H0G B;  4X3K A;  4TRD A;  3VYS A;  1SE2 A;  5D3I B;  1GOZ A;  1KLG D;  2F0M A;  2WKC A;  2D2C C;  5JAV A;  1U4P A;  3R8B A;  4C3H G;  4FF2 A;  2JE6 I;  1G91 A;  3E6Z X;  2QCP X;  2EYH A;  3L7Z C;  1LT3 D;  3V05 A;  3WDN A;  5EKI A;  1ENC A;  4PNY A;  5KYL A;  4HCS A;  1TWH B;  1Q3L A;  5FO7 B;  2F0I A;  1EEF D;  1ENA A;  4PMC A;  2WAC A;  4U68 A;  4NP5 A;  3SXH A;  4KJN A;  1STE A;  1ET6 A;  3SHL A;  3MTS A;  3K5L A;  1I50 B;  3C3L A;  1IYV A;  2K05 A;  1NAP A;  1EY4 A;  3QJY A;  1NUC A;  2PZW A;  2BE5 D;  3GTM B;  3GV3 A;  2JA8 B;  3MZ5 A;  2CVR A;  3MVV A;  5DM6 3;  5EGT A;  1CA5 A;  3T56 B;  4LMQ D;  4ZAI A;  1A15 A;  1NR4 A;  4XTC S;  1LTT D;  1PTO H;  3HG9 A;  3R3O A;  1S5E D;  5M3F B;  3SR1 A;  1PYW D;  3S15 B;  5JEA H;  1YNJ C;  1JQY D;  4B9X A;  3I73 A;  4HCE A;  4BBR B;  3A7A B;  3S16 B;  4OO1 I;  3SEB A;  3J7A V;  5KNC A;  1TU2 B;  3OPO A;  1XYI A;  3A54 A;  3M4O B;  1BO0 A;  4HSV A;  5C0X I;  4PMW A;  4XIG S;  1C8C A;  1S5C D;  5C4X B;  1O7Z A;  1BUV T;  3X3M A;  5COY A;  3JAM L;  4TQU S;  1DON A;  1E2Z A;  1T5E A;  2GA4 B;  5C0X H;  5C4J B;  3DHQ A;  5C3W A;  1QNK A;  4RFB A;  4KD4 A;  4IUT A;  1AEX A;  4RGT A;  2WIN B;  2M00 A;  1SBB B;  3DWP A;  2JA7 B;  1MGS A;  3C2P A;  4A3E B;  3MXU A;  1SNP A;  1HA6 A;  1L0X B;  1II3 A;  4RHS A;  1WCM B;  4WFN 3;  3DEO A;  1F2L A;  1SJH D;  5ELD A;  4R8I A;  1RKN A;  1F9P A;  1HQR D;  1EQV A;  1Q12 A;  4RCO A;  2J7Z A;  1KNE A;  3DXJ C;  1XWE A;  5D3D A;  3GTP B;  1LT6 D;  1LAB A;  1PFM A;  3HOW B;  3MHB A;  2RVL A;  1DJR D;  2ZXP A;  5J1Z A;  1R4P B;  3I4L A;  4RWS C;  3HOX B;  1STN A;  2L0C A;  3D3R A;  2R3Z A;  3OMG A;  4K5W A;  3HS0 C;  1TWF B;  3VR4 A;  2AQ1 B;  1D1I A;  1JCK B;  2JP1 A;  4EQO A;  3QOJ A;  3MFG A;  4YIJ A;  3NP8 A;  2PW5 A;  1NCV A;  2EZV A;  1EWH A;  3TME A;  5C3X A;  1Y69 U;  1LV9 A;  1I4H A;  2KHS A;  1S4Z A;  3NQI A;  1B53 A;  2M9V A;  3P1H A;  1B9M A;  4IZ8 A;  3NSW A;  3EJI A;  1OXX K;  4IUP A;  3FRP B;  4X3T A;  1GUO A;  5COR A;  3J80 E;  3UI2 A;  2EVB A;  3C1F A;  5AFW A;  2KEE A;  3ND9 A;  2IW3 A;  4G7O C;  1FR3 A;  2F0K A;  3M3Y B;  1BDO A;  5T1I A;  1HTP A;  1EY5 A;  2EOT A;  4XT1 B;  1FYC A;  1ENF A;  1VMP A;  2F0L A;  5JEA J;  4WOR A;  1PRT B;  1WVL A;  2KVM A;  4TSS A;  2K04 A;  5KEE A;  3URY A;  2B2U A;  5IT9 L;  4KHZ A;  1SMY D;  3DMU A;  1EYA A;  4GZY C;  4C3H B;  2HQE A;  1EFI D;  3M85 A;  4A3M B;  3AB9 A;  1U4R A;  1JC7 A;  4QIW B;  1TS3 A;  4IQZ A;  1KNA A;  3T51 B;  5EJW A;  5I4D A;  1A6X A;  5F2D A;  2VNU D;  2Z8L A;  5ISR A;  2NN6 G;  4F88 A;  1LTG D;  3BVG A;  4A3I B;  4A93 B;  3CQZ B;  1JOQ A;  1I6H B;  1W6J A;  3EA6 A;  2Z1C A;  2F0G A;  3ND8 A;  2EYO A;  3C46 A;  4EQP A;  4F8M A;  1EYD A;  1JOK A;  5KNB A;  1I4X A;  1RJT A;  4DAV A;  3WOE A;  2XSC A;  1B50 A;  3Q22 A;  5CGK A;  2EY5 A;  1U4L A;  4OO1 G;  4DF7 A;  1STG A;  5IGF A;  1IL8 A;  3SK6 A;  4OL7 A;  1J9O A;  1Y8N B;  1A3V A;  4H7B A;  3GTJ B;  3GO5 A;  1VCI A;  4BBS B;  2NWG A;  3KUP A;  1CFM A;  3PIO 3;  3S1R B;  1UEA B;  1SND A;  1FNV A;  2I46 A;  1EY8 A;  3M7G A;  5M5W B;  4QCL A;  2E2J B;  2MHV A;  3A8J E;  2XRQ D;  2B2U C;  2FHT A;  4G57 A;  4FP5 D;  1S5D D;  5EPK A;  3MFY A;  3RMH A;  5C0X G;  5FO9 B;  2B39 A;  1DCZ A;  4IFD J;  4HN7 A;  1IKM A;  1BCP D;  2V4D A;  4ZQ3 A;  4KD3 A;  4RCN A;  2MPM A;  1V1P A;  2XIW A;  4WRD A;  3PIP 3;  2MUY A;  1HUM A;  2JA5 B;  3EVQ A;  4KN4 C;  2IPK D;  2MGS A;  4IUU A;  2F0N A;  2BCO A;  5LL6 X;  4HTH A;  4R8N A;  3FMC A;  3OOC A;  3NWS A;  4J8Q A;  1EL0 A;  4G4K A;  1I6V C;  3D6C A;  2RDH A;  3TP7 A;  3TP5 A;  1SEB D;  2QF7 A;  4OIK A;  4A3F B;  3C1E A;  2YYZ A;  3GQB A;  4ZUJ A;  1MSH A;  2KJX A;  2NTS A;  1H9S A;  3HOV B;  4C3I B;  1WTR A;  1CQF A;  1PZI D;  1GUN A;  4IFD G;  1Q8I A;  1HTL D;  4UDU C;  3FVQ A;  2ICE C;  5EKL A;  4K6L A;  1PRT C;  2L1B A;  3TP8 A;  1H9S B;  1OO9 B;  1B44 D;  1D5X C;  4CJ2 C;  4N9T A;  2E2D C;  2Q8I B;  1HXY D;  1Y1V B;  4ZYS A;  3NHH A;  1TT2 A;  3KLS A;  3SK4 A;  3KF8 A;  3TZD A;  4IUR A;  1I4P A;  5M5X B;  2B2Y C;  1VF7 A;  3CRK C;  3NWT A;  5LHY 1;  2RBM A;  5ELF A;  1EIH A;  1B3A A;  1ZEQ X;  2F0E A;  3DUZ A;  2AWO A;  1CHQ D;  1BR9 A;  1EY6 A;  2D62 A;  2RQX A;  3I72 A;  2E2I B;  5KRU A;  4C3J B;  1CT1 D;  1ESF A;  1F2Y A;  4UAI A;  2YU9 B;  3VR5 A;  2KEC A;  1JOO A;  1STB A;  2WB1 B;  1BCP C;  1V43 A;  1AP0 A;  2G9H D;  5A35 A;  4OHJ A;  3K57 A;  2F0H A;  2EYM A;  4IFD I;  4KMU C;  5E4W C;  3NXW A;  4OO1 H;  3RUZ A;  2F0W A;  2XRS D;  4G7Z C;  1JE4 A;  3KBX A;  1A2U A;  4IUQ A;  1TY2 A;  2A6E C;  1D6E C;  1FNU A;  3A56 A;  5D65 A;  3S1N B;  1D1K A;  1MI2 A;  1BBX C;  2E75 C;  1JWM D;  3I3C A;  1IKL A;  3S2H B;  4IAL A;  4DNT B;  1JB3 A;  2KED A;  3CHB D;  1B9N A;  4X3U A;  2E74 C;  1HPC A;  2F03 A;  2EJM A;  3HGB A;  1V1O A;  2PQE A;  1JR0 D;  3N52 A;  1KAA A;  4AYB B;  4J6H A;  1GUT A;  4IUN A;  2EXZ A;  4A3B B;  1CM9 A;  3T16 A;  1SXT A;  3KLR A;  1SSO A;  4ZKC B;  1WTP A;  3K5M A;  1Y8P B;  1XXG A;  4QUC A;  2AUJ D;  5C44 B;  2XN9 C;  2FMM A;  1DXM A;  1GHK A;  1SYD A;  5BN4 A;  1ZKO A;  2F0O A;  1BCP F;  2O4X A;  3CU7 A;  5I9O A;  3K59 A;  4K6D A;  3I4N B;  3VYT A;  5FO8 B;  2DY8 A;  1SYB A;  2R61 A;  1QCB D;  1G2S A;  1AN8 A;  1Q1B A;  2F3W A;  3N6R A;  2NVT B;  2RSN A;  1FD7 D;  3M7N A;  1A3U A;  2ZXO A;  3LWE A;  1R9T B;  1QE6 A;  5FKA C;  2KA7 A;  5IGB A;  5EBD A;  1LAC A;  2C5C A;  1XTC D;  4KKT A;  1AW7 A;  1V1P B;  1PRT F;  2O5I C;  3JAM E;  2F0J A;  1G29 1;  2F0V A;  1BXT A;  4C3I G;  4ID6 A;  3PUZ A;  1LT5 D;  1EZ6 A;  3BG3 A;  2DNE A;  3ITP A;  3EQL C;  1F2M A;  1TWG B;  1KTK A;  4A3D B;  3J81 L;  5KIX A;  5CMD A;  1GUS A;  2F0P A;  1UAP A;  1WTO A;  1VF5 C;  3I4M B;  2PNR C;  1HQM C;  3FDT A;  3DWQ A;  1HCZ A;  3OMC A;  1U9R A;  4KY5 A;  4DK0 A;  1WTQ A;  4BS9 A;  3VR3 A;  4HSP A;  2PO4 A;  1A2T A;  4FXG C;  3TP6 A;  2K6A A;  3QIA A;  3RZO B;  5I2X A;  1TWC B;  1ICW A;  5C6A A;  5CV5 A;  3T53 B;  1SNQ A;  2B63 B;  5K5P A;  2K5Q A;  2KUM A;  2NZ1 D;  2L11 A;  2TMP A;  1KLU D;  2A6H C;  3PUW A;  1AFP A;  2CW0 C;  2HCC A;  2IWH A;  1E2W A;  2B2T C;  5DM7 3;  2ENB A;  1CTM A;  4G7H C;  2Q8R E;  4FXD A;  4B9W A;  3FEW X;  3S2D B;  1WTW A;  3S17 B;  2B2W C;  2LKV A;  4ZLT F;  3TDQ A;  5CV6 A;  4A3G B;  5HGT A;  4H13 C;  1EIG A;  3CKI B;  1CI3 M;  2L4N A;  4RGM A;  1SDF A;  3I8Z A;  1ZYR D;  4I7Z C;  1C4Q A;  2EPB A;  5JVH 3;  4CJ0 B;  5CR3 A;  5EPJ A;  2PCF B;  4XQN A;  2B2T A;  5NUC A;  4OGQ C;  2A6E D;  3QWN A;  2SNS A;  3K5N A;  5D14 A;  3KBG A;  3HOY B;  1DD2 A;  1E2V A;  1QB5 D;  2XNA C;  2O2L D;  2A69 D;  3D4W A;  2N55 A;  3QO2 A;  5C5M A;  5E4X A;  3VR6 A;  4BA1 I;  1ESR A;  1I4Q A;  1LLR D;  1WD0 A;  4K8I A;  1E0B A;  3DEP A;  4KHV A;  1VDZ A;  1TKW B;  3PO3 B;  1ML0 D;  1TII D;  5K36 H;  3SVM A;  3Q23 A;  5BN3 A;  5M9O A;  5C4H A;  2E2H B;  3Q24 A;  2LS0 1;  1SJE D;  2IX3 A;  3R2I A;  3H6M A;  2AQ2 B;  5FLX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...