1U4PA

Crystal structure of human rantes mutant k45e
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
b'SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRENRQVCANPEKKWVREYINSLEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A5
molecule tags Attractant
source organism Homo sapiens
publication title The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors.
pubmed doi rcsb
total genus 12
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u4pA00
3R93A 2HCCA 2J7ZA 1RHPA 1AZQA 1BNZA 2DY7A 3HP3A 2EOTA 1WTXA 3N52A 1S4ZA 5EQ0A 4U68A 1JICA 1NCVA 5E4XA 3MWYW 3UI2A 4ZLTF 1RTOA 2K1BA 1TVXA 3D6WA 1DONA 3F2UA 5AFWA 1EIGA 2SDFA 1KNEA 2L4NA 2B2UC 1O7YA 2N88A 3KUPA 4NW2A 4QUFA 4IUQA 1PFMA 1WTRA 1XYIA 1CA6A 3TZDA 4HAEA 1WD1A 3SVMA 3QO2A 2D9UA 4OIKA 4CJ0B 1ML0D 4R9WA 2FMMA 2L12A 4IUTA 4ZKBB 2L9HA 3MTSA 5D65A 1PLFA 4R8IA 2K05A 2B2TA 1B4OA 1ILQA 4OIJA 1SSOA 4MHEA 4IUVA 2XIWA 2RSOA 4CJ2C 3Q6SA 5T1IA 1IKLA 4IUPA 2FINB 2JP1A 1EL0A 1DZ1A 1AP0A 3FDTA 2NZ1D 1BO0A 2L1BA 3KBXA 5EPJA 1VMCA 3GV6A 3GV3A 1B53A 2KECA 4DN4M 4ZK9B 4HEDA 4UAIA 2H1EA 1MGSA 4ZKCB 1MI2A 1RTNA 5EKIA 1IKMA 3IFDA 2EE1A 2B2TC 2HDLA 3IL8A 1NR2A 1ICWA 1MSGA 1RJTA 2K03A 1X3QA 2B2WC 1U4RA 1F2LA 3I8ZA 1ZXTA 3TN2A 5EPLA 1XX8A 2B2UA 2MPMA 1WD0A 3I91A 4IURA 1WTOA 2B2VA 2NWGA 4X3KA 5D14A 1VMPA 1F9RA 5CBEE 1QG7A 2JYOA 1QE6A 2Q8RE 5COYA 4XDXA 1WTWA 1G91A 1X3PA 3DM1A 2B2YC 2IL8A 1WTVA 2HDMA 2KEDA 1U4MA 1CM9A 1F9PA 2KUMA 1HUMA 3DEOA 2B2YA 1G2SA 1CA5A 1HUNA 5T1GA 5EJWA 3LWEA 4X3TA 1SAPA 1IL8A 2MJ8A 1QNKA 1ILPA 4LMQD 1NAPA 2HUGA 1U4LA 2KOLA 1DOMA 3P7JA 2Q8TA 5JJZA 4XT3B 1EQTA 2FHTA 2FJ2A 1PFBA 2M2LA 3FPUB 3I90A 5E4WC 1HRJA 4RA8A 1B50A 1U4PA 3H91A 2K01A 4QUCA 1EIHA 1GUWA 1J8IA 1J9OA 1ESRA 2RA4A 5CBAE 5CMDA 1HHVA 4O42A 2N55A 4MN3A 1RODA 1Q3LA 1NR4A 2RSNA 1SDFA 2BDNA 2X6LA 1WTPA 5DNFA 2KEEA 4X3UA 1O7ZA 2FFKB 3ONAB 1G2TA 3DEPA 1DOKA 1M8AA 1HA6A 1PDQA 5CORA 1HFGA 1KNAA 2K04A 1WVLA 4HSVA 2NYZD 1A15A 3I3CA 3G7LA 2K28A 4X3SA 2B2WA 4HCSA 1HFNA 1AZPA 4XT1B 1B2TA 4RWSC 1G6ZA 1O80A 2MGSA 1DOLA 1X32A 2B2VC 1JE4A 4ZAIA 1C8CA 2X69A 1LV9A 4RAUC 1BF4A 5EPKA 1WTQA 1F9SA 2DY8A 2RVLA 4CJ1B 2KVMA 2CVRA 1B3AA 1PFNA 2X6GA 2L11A 4IUUA 2VXWA 2EPBA 1F9QA 2MP1A 2R3ZA 2HCIA 1E0BA 1BBXC 1MSHA 1EOTA
chains in the Genus database with same CATH superfamily
2KCNA 1SR3A 4RGOS 3BG3A 3GTJB 2B63B 1JICA 1KLGD 5FO7B 1PHJA 4DFAA 2L4NA 4X66L 4LF6Q 5ISRA 4QIWB 5FJ8H 4JI1L 5EBCA 4DV4L 3H09A 4RH6A 5IGFA 3GTPH 4I65A 1BDOA 1ASYA 4B3SL 2Q2TA 2M00A 2XVSA 4L5TA 1CUKA 1TWGH 2R93H 1VQ9A 2K6AA 5IT9c 4Q5VA 1D7QA 5IP9G 1IKLA 1WFQA 1Z47A 4KKSA 1K9MC 4OX9L 1VQ8A 4HTHA 2L1BA 2NVTB 4KKUA 4QQBX 1HJPA 3E9IA 4BY7B 3ND9A 4CKBA 4KLKA 3W2DA 1MGSA 2SEBD 1MI2A 1SNCA 3CD6A 4J1MA 5C4XG 1JR0D 2B2TC 2UU9Q 4BY1G 3CCUA 3C2PA 1L1OC 3E6ZX 4HJ5A 1MSGA 1MKHA 4DV0L 3I8ZA 1Q46A 2Z9HA 3RLNA 2YU9B 2A6HD 4R4TA 4DPGA 5M3FB 1TWCH 5D14A 3QOJA 1SNOA 4X62Q 3DM1A 5LMNQ 4A3MB 3OMGA 2E2IH 1A2UA 4NPSA 3FKIH 1G2SA 4KTAA 1HNZL 3LWEA 1EYGA 2G5DA 4JC0A 4DV7L 1LABA 1DOMA 3D0FA 5JJZA 1SEBD 1T5EA 2PNHA 4A3KB 1JWMD 4A3DG 4OELB 1S72A 5M3FH 3GTOB 3N6RA 5C4ZA 1X3EA 1P8LA 3K59A 1TU2B 3S9WA 4B3TQ 1VQAA 4QL5A 2PI2A 4A3GH 1MIUA 1HFGA 4Q0FA 4P75A 3TP6A 2WIIB 4AYBB 2EXZA 1AZPA 3HOYG 4KJNA 3WOFA 3HOZH 1PV4A 1GOZA 3PUYA 1SNPA 3R2TA 2NBFA 1YIJA 3RNUA 3VYSA 3GTKB 2KHIA 1HQMC 1FNUA 3EQLC 3H15A 1HNZQ 2F0JA 4CJ1B 3C1FA 1JCKB 1PFSA 3KYHC 4H02A 1X6OA 3SK8A 2G9DA 2JQOA 1YNJC 2EJGC 4LFAQ 5JEAJ 4ZLTF 1HA5A 4A3JH 5FK9C 1Q82C 3KUPA 4MTNA 5ELCA 4DUYL 4DNIA 2EY2A 5M5WB 1E2VA 4A4IA 2EYFA 1N9WA 2PO4A 3CRKC 1KD1C 1FGBD 3QO2A 3QR8A 4IQZA 4B3TL 1PRTD 4CJ0B 4A3EH 5G3LD 2RDHA 3KDFA 4C3IH 3IAYA 3D4WA 4GNXB 1PLFA 2NVYH 4GLAC 1RDPD 1EU3A 1SSOA 4UP9A 4JPBW 3DMUA 3RZDH 4LF6L 1LTAD 1WJJA 2F0WA 1JB7A 1VQGA 3SK6A 2I5MX 2PMZE 3J80E 3TS2A 1K8GA 2ZTDA 5E7NA 5DM63 1I6HB 2N49A 2A1AA 3KLSX 2A69C 2UXDL 1IKMA 2QF7A 2VQFQ 2JA7H 1GUSA 1OXUA 1OO9B 3S16H 5M3FG 3RLOA 4RGMA 1F77A 2JA5G 3W5OA 4A3JG 5LMUL 2VUMB 4A3IH 4A3FG 3QG1A 5CBEE 1WTWA 1YJ9A 2ZJPA 3S14B 5C44G 1X54A 2UUCQ 4BBSH 3A56A 2RDFA 4PZ8A 5CV7A 2K5NA 5IGCA 4FO2A 1JWSD 4WFN3 3EVQA 1QNKA 4A3DB 4HR7B 2Q8TA 1NSNS 1SFOB 3VYTA 1A62A 3GDEA 5KEEA 1HNXL 1MJEA 3CMEA 2RA4A 4MN3A 3W1BA 3H6MA 3HOXH 2PCFB 3J80i 1PH4A 1NMGA 2PZWA 4GN5A 2NYZD 1HR0L 3S17B 1KABA 4C3JG 1VQCA 1OXSC 5C4XB 4OO1H 1IBLL 3P1HA 4RAUC 2IT1A 1H95A 4YCWA 1I5FA 5C44H 1GHKA 1QJOA 4PMBA 4GNXA 4KI0A 1A3UA 3PO3H 4L5QA 1Y8OB 3CC2A 4JOIA 1QVGA 2G9HD 1RHPA 1JWUD 3PF5A 3ZJYC 1M1KC 1A6XA 1BBWA 4IALA 3F2UA 2EYJA 5I6WA 1KNEA 1XMQQ 1AE2A 1ENFA 2B3GA 4LW1A 3Q22A 5AJ3L 3I2ZA 3HOXG 3H0GB 4QMGA 4QGUA 2E2JH 4IUTA 2YTYA 1VQ6A 1PH1A 3V05A 1LT6D 1NTGA 4PG3A 2A69D 3FVQA 4UHVA 4QB4A 4JI6Q 1N34L 3E0EA 1EYCA 1BOSA 2EYMA 4ZRZA 4FVMA 1UE7A 4DR2Q 2F0VA 3RZDB 4JI1Q 4JOIC 3H0GH 3HOYB 2WKDA 1FJGQ 3NQIA 2KCMA 1RJTA 2Z6KA 1K28A 4UP8A 3DXJC 3MFYA 2VNUD 5EPLA 1WTOA 2QDBA 3T56B 5GAGC 3M4OH 4A3BH 2HDMA 1CM9A 3DWPA 3FP9A 5KIXA 1CKNB 3E3XA 3KF8A 4CKCA 1J5EL 2L5TA 2C5CA 3K58A 1BXTA 3MA2B 4OWWB 3CW2C 3GTKH 4DV0Q 5E4WC 3IRBA 1CFMA 2WAQE 1LACA 2CKZB 2H5XA 2K32A 4J8QA 3H91A 3D31A 2I5LX 1VQPA 5CMDA 3I4NH 3S1NB 4Y52H 4DKAC 1WTPA 4LFBL 2FFKB 4DAYB 2Z1CA 3UDGA 1I4XA 4PZ6A 1PRTC 1QOHA 2MO1A 2LSSA 1GUGA 1HFNA 1XPOA 1B44D 1VCIA 3A7LA 3FEWX 1JJ2A 5TSSA 2XWJB 1H9SA 4A3BB 2R7ZB 3JAML 3HZXA 2OXPA 3CCMA 4IFDG 2L0CA 5DAUA 3TBIB 3S14H 3HP3A 3PO3B 3HGBA 2GA4B 1TVXA 2E2HH 2DUDA 1OXVA 3H0GG 4DV4Q 4LWCA 4QCLA 4IFDH 2GN5A 3A74A 4TQUS 1Z9FA 4JI5Q 4MNOA 1M90C 2VZAA 3GTMB 4JI4L 3MZ5A 2CQAA 1SYFA 1P16A 1ILQA 5DM73 2MNAA 5IWAQ 4A3CG 4MZ9A 4IUVA 4C3HG 4GKKL 2VL6A 1V9PA 2D0PA 4AQYL 3G6JB 2PQEA 3HKZG 1SNDA 3NQTA 4DR7Q 3GV6A 3GV3A 2F0SA 3NE5B 4HJAA 2RCNA 2QA4A 2NVQB 2Z4HA 3U9OA 2O4XA 4C3HH 2F0NA 1VQ5A 1YJWA 3I70A 3J7ZC 2XTIA 3OW2A 3T53B 3I91A 5C3EB 1XWEA 1EOVA 4XXEA 1WCMH 3MXNA 1LT5D 1C9OA 1ONLA 2JXMB 2A73B 3HOWB 1I4GA 5EJWA 5I4DA 3AQQA 2MJ8A 3KOJA 3KFUA 1EY9A 3O13A 4S3SA 1HCZA 1I50B 4IJLA 1AH9A 2AQ2B 1ESFA 1V8QA 1YNXA 3OPOA 1ET9A 5C3EH 1TS4A 4QIWE 3JC66 1GUTA 1A2TA 3BVGA 4JV5Q 1BR9A 4DR7L 1XNQQ 5JEAG 4HIOA 2PZTA 1DXMA 1O7IA 4JCVE 3QOLA 1VF7A 1N36L 1A3TA 5C0XH 2O5JC 4IPHA 5IP7G 3HOYH 5LL6X 5C3WA 1STEA 3B6YA 3VR5A 4LF8L 4I7AA 2X69A 1PRTF 1LV9A 1B8AA 2O2LD 4JI8L 1WCMB 1JOQA 1B3AA 5D3DA 4F87A 1KLUD 4AYBE 2EPBA 2R3ZA 5BN3A 1II3A 4FP5D 3R2IA 1XNRL 4H0LC 2HCCA 1S5ED 4KD4A 5IT9E 1HR0Q 1YEZA 2AHOB 1W6JA 1WTXA 1NJIC 1IBMQ 2IX3A 3BJUA 4BA1I 3RZOB 2XNAC 2LXJA 4K5WA 4BWGB 2RHSB 1WTRA 4DUZL 4JI0L 4HAEA 5ELOA 2EJMA 4DK6C 2AWNA 4JG2A 5E3FA 4EX5A 2MHVA 5EGTA 3T4AC 1FR3A 3K7UC 2YTXA 1YZ6A 2E76C 4I7ZC 1X9NA 5T1IA 2QW7A 3CC7A 2NZ1D 4YWMA 4DV6L 1XMQL 1D1KA 2WINB 1BCPD 4KKTA 1QUQA 3LGJA 1SE3A 1SE8A 1YNJD 4B3RL 1ZEQX 3NENA 3VDYA 3HOVG 2Q8IB 5A35A 2A19A 5C3EG 3EFXD 1SYEA 4GS3A 5IP9H 1I94L 1L1OB 2R61A 1W2BA 2NWGA 4X3KA 3EJIA 2JN4A 2Q8RE 2KCTA 1G6PA 4DR2L 3PUZA 3PO3G 3T16A 3M4YA 2CHBD 2F1MA 1PFBA 3FPUB 1D5ZC 1ENAA 1HZCA 4RA8A 1A63A 3TSSA 4P72A 1TQOA 3ULPA 3F2BA 4IPDA 1NE3A 2EIFA 3AFQA 3HOUG 2Z0SA 1DCZA 4YIJA 3OTOQ 1R9TH 3MEFA 5KNBA 1ET6A 4DV2L 4A75A 2K04A 1KNAA 3I72A 1LO5D 1QUQB 1X3GA 4U673 4BY7H 2JA7B 3HKZB 1L0XB 3FMCA 2ES2A 4XIGS 1STHA 3BVMA 3CKIB 1VDZA 2VUMH 4ZYSA 3M7NA 1E1OA 2R93B 2RCFA 3TEHB 4ZCKA 4JBMA 2F3VA 4FF2A 4JI7L 1F9SA 4KHPL 4WRDA 3NK9A 3U4VA 2AUKA 1GUNA 1QCBD 1Q86C 1EY5A 4ILWA 3DUZA 3KBGA 2ZT9C 1N8RC 2WACA 4A3IG 1TT2A 3FKIB 5E4XA 1MBYA 5IT9L 4LF9Q 5AFWA 4QUFA 1K3RA 1O7YA 4NW2A 1GUOA 2SOBA 3A0JA 4JYAQ 4JI2L 1WD1A 4YCVA 1WYDA 5LMNW 1EIYB 2L12A 1B3QA 3S2HB 2I0QA 1CKOA 2I46A 5M5YH 2JA6B 3RUZA 4A3MH 4DR5Q 3PIO3 3A5ZB 4OIJA 5IGEA 5HURA 3V2TA 2EJFC 4DUZQ 5I9OA 2F0QA 3FDTA 1LTID 4P2CB 1CI3M 1VS0A 1EEFD 2PQAB 4KV6A 4ZK9B 2IHFA 2ICIA 4DAPA 3HOZB 2ENBA 4PQXA 3CQZB 4JK1C 2IX1A 2XGTA 1Q81C 4DV6Q 1PXUA 4WJWA 2K50A 5LHY1 1QZHA 1DD2A 1MD2D 3ULJA 2F52A 4QF4A 4K2KA 1E7ZA 1YI2A 2A6HC 1J5EQ 2E2JB 3VYRA 4LMQD 4DV5Q 5J22A 2RBMA 1Z6HA 2HHHQ 3K80C 5FO8B 2MFIA 1U4PA 3H94A 3L0OA 5CBAE 4Y7NB 2BDNA 2A5HA 3J7AV 3ONAB 4IPCA 1HA6A 3M7GA 1JMCA 3S1RH 1EY7A 3MXGA 4HSVA 1A15A 1SYGA 2K14A 1EYAA 3L2PA 3CAMA 3W1GA 4RWSC 4K14A 2ATWA 2MGSA 2QKIC 2CWAA 5F2DA 1K8OA 4G7HC 4DK3C 2FMCA 3A54A 4DF7A 1F2YA 5JVG3 1KXLA 1XNQL 4DR3Q 2L11A 2C35B 2EY6A 3OWFA 4A3IB 1E22A 3A8KE 3PF4A 2NVXB 1QILA 1AZQA 1BNZA 1UE6A 5KYIA 1D5MC 3C3LA 3BYYB 4JW0A 5CV4A 3FRPB 1S5DD 5IP7H 4JI7Q 4KHPQ 3HG9A 2OF1A 4LF8Q 3GD7A 1PH9A 4JI5L 1CA6A 3TZDA 2OCEA 2JA6G 1XTDA 4HJ7A 1ML0D 1LTGD 4R9WA 4ZKBB 2NVXH 1L0YB 4C1NK 4KHZA 1XNRQ 3HOUB 3M4PA 1JT8A 2F0DA 2RSOA 3S2HH 3VR4A 4R1JA 4X62L 1V1QA 2K33A 2NZOA 2FXQA 4UPAA 1B70B 4DA2A 5HGQA 2HQEA 4DN4M 4HEDA 3ERSX 4GNXC 4X6AH 1N32L 3KJOA 1GO3E 1W3SA 4NP5A 2F0UA 4DV7Q 1I4RA 3GTGB 5JJLA 3OMCA 2R93G 4HMIA 4RGNA 3KLSA 5FLMG 3OOCA 5M3MG 5K5PA 2ZTCA 5LMUQ 1CZWA 3U4ZA 2IJ0A 4LNQA 1RKNA 5JJIA 4A93G 1DM0B 1LTSD 4G57A 4LUOA 4LJZC 4L63B 5ELDA 2EVBA 2EZVA 2AQ1B 5CV8A 4B9XA 1TY2A 3GTQB 2R6GA 1RIPA 1STNA 2TSSA 4DR1L 1KIXA 3MFGA 2JA6H 4L6TB 1HNWL 3WDNA 5C4HA 5DNFA 2K4KA 3AB9A 3EIVA 2ZM6Q 1O7ZA 1V1PB 1N36Q 3ZYYX 3PIPA 4LUVA 2HHHL 2K5QA 1GKHA 1PTOB 1XMOL 1TKWB 1FVIA 5FLXc 2N3SA 3STBD 4LFCL 3LNNA 1Y1VB 3D4RA 1PTOC 4X65Q 5BR8L 3K5LA 1TWHH 1KDCA 2E2IB 1EIFA 1IBLQ 5EPKA 4OO1G 2PNRC 1PFNA 1SNMA 3QJYA 4YY3L 1IW7D 4BA2I 2BE5D 3R3OA 4YWKA 5I2XA 1X65A 3NWSA 3BVZA 3J7AF 4RKLA 2BDOA 1Y1WB 3D6WA 4JVZA 3TQYA 5IYBG 1SE2A 3J7A5 4GOPA 2LKVA 4NMZA 2EY1A 2WAQB 1GJXA 1LT3D 2JJQA 2JK8A 5KRUA 4IUNA 3TREA 2D9UA 3MXNB 1CSPA 3NBHB 1AE3A 2FMMA 3I7FA 5CYUA 2NVYB 3KF6B 4TRDA 2MQHA 2K5WA 1VQNA 3R8BA 1I3QH 1FD7D 4O0AA 3K0YA 2F0TA 1TWFH 3EA6A 4BXXH 4GKJL 1RTNA 2RDGA 3IL8A 4OWTB 5JJKA 1NR2A 1D1IA 2J4XA 2K52A 1EEID 4A3CH 1IYUA 4N9TA 2A68D 3J81j 4DR5L 2SNSA 1YITA 3WWVA 2Z8LA 3KF6A 5JPNC 1BUVT 1TR5A 1QG7A 4H13C 2PW7A 2PPBC 2IL8A 2GVAA 4A3EG 4BBRG 1NBWA 1KQSA 1HUNA 3PUXA 1JOKA 3NTKA 4DXGA 2RHQB 2SNMA 5KYLA 5C0XI 1PYBA 2KHJA 4KN4C 2FJ2A 2JEBI 3NEMA 3U50C 3GTMH 2IW3A 3IKJA 4ME3A 4X66Q 1ESRA 1EY8A 4O42A 4CDDC 4BY1H 1NR4A 1HZ9A 5M5WH 3KLRA 3DLLA 3MXUA 2OEOA 3OYYA 5IIFA 3BZKA 4EQPA 3G4SA 1M8AA 4IN3A 5JAVA 1U5KA 2HQLA 4V0BA 4XTCS 3MHBA 2UXCQ 3G7LA 3S1NH 1Y1VG 2AKWB 1GHJA 2JA8H 1LTLA 2CW0C 1A8VA 1O80A 1UAPA 3CU7A 1JE4A 5CV6A 4UP7A 3A55A 3UDIA 2OTLA 4BBSG 4OL7A 2ALYB 4JBWA 1E2WA 4PMWA 4K8JA 5FJ8G 5M9OA 4A3DH 5M3MB 5JVH3 2B39A 1JB3A 1HR0W 5IYDH 4JI3Q 4BY7G 4MIUA 4LFCQ 1X3FA 1SBBB 4B3ML 5CR3A 1NCVA 4X65L 3D4DA 4A93B 2A8VA 1TIID 2N88A 4JI2Q 3GTGH 4BXXG 1CTMA 2A6ED 2F0FA 3AYHB 1ZYRD 4F8MA 1Y69U 4DXFA 4FYDA 1TS5A 4OIKA 1SMXA 4XQNA 4RG1A 4A3BG 3VR2A 4H44C 1AW7A 1ENCA 2Y0SB 2UXCL 4A3MG 1GM5A 3PCOB 3UE1A 1SFOH 1AN8A 5IWAL 1IL2A 2JP1A 2LFNA 4A93H 4A3LH 3S1MH 4DAMA 1YBYA 5IGGA 3NXWA 1K3BC 2K03A 4NDXA 4L8JA 1XX8A 2MPMA 3E9HA 3VA5A 4F7XA 2B2VA 3D6CA 3MC0B 4C3HB 1HNXQ 4GKJQ 2K5DA 1G91A 1LTRD 2ZTEA 1Y1WH 5T1GA 4DV5L 1PA6A 1SAPA 1IL8A 1ILPA 1JC7A 5IGDA 3P7JA 4EGVA 4RGTA 4FXGC 2FHTA 2WAQG 5IYCG 3S1QB 4GN3B 5ELFA 3CCRA 2CCZA 4KJOA 4DNRB 4K0KL 3KLWA 1SDFA 1I50H 4FF4A 3NP8A 3OIQA 4X3UA 2EYHA 4CGYB 2XN9C 1EYDA 1Q8KA 2NTSA 4JBKA 2KHSA 3I3CA 4R4CA 1S40A 1UE5A 3S2DB 3H3VI 1DJRD 1TWHB 2HIVA 1UEBA 4J6HA 4UDUC 4XT1B 3F8TA 4DAVA 3C46A 2RQXA 1FL0A 1LUZA 1BBUA 3M3YH 1C8CA 1CSQA 2HIXA 3VR6A 2OTJA 1EU4A 4IFDI 4YWLA 5LMNL 2KVMA 1IW7C 3Q0AA 5IOCA 1U9RA 1VQFA 1IBKQ 5J3BA 1HZBA 2QDLA 3A8IE 2E5LQ 3R93A 3AU7A 2KBNA 4FF1A 4GKKQ 2EOTA 1S4ZA 5EQ0A 1PTOD 4LF7L 3MWYW 3UI2A 4A3EB 1RTOA 3NTIA 1DONA 1CKNA 1KAWA 3KF8B 1UWVA 4CDEC 4E6IA 1QB5D 2VW9A 3I4NB 2SDFA 3M4OB 1PFMA 1QWYA 3E0JA 2CQOA 4LAAA 2HT1A 1RF2D 1A3VA 1G291 4A3JB 1WCMG 3CF5A 1BVSA 4APVA 3S1RB 1PYWD 4XYQA 1VQ4A 5HY6A 5CV5A 3KK7A 2F4VL 2WP8J 1EZ8A 4FXDA 3BDLA 1H9MA 1DGSA 4M8AA 1RL2A 2NZHA 5GAEC 1YJNA 1W6KA 4L5SA 4EQ5A 3CHBD 3FPPA 3J7YW 4A3FH 3IFDA 2EE1A 1NNXA 3FHWA 4PZ7A 3QB3A 3VA7A 1Q12A 4BBSB 2NTTA 3K5OA 3I55A 1S5FD 5C0XG 1D6EC 4ZUJA 2AUJD 1SYCA 1FYCA 3WOEA 5GROA 4G4KA 3UE0A 2ASBA 1KDBA 2KOLA 1EQTA 2M2LA 2R7FA 3T13A 4L5RC 1CHPD 3TRZA 3CCQA 1B9NA 1HHVA 1TS2A 2KQ3A 3I4MB 3S24A 2X6LA 5DLQE 1G8ZD 2VUMG 4LF5L 2UXDQ 2OT2A 1I4HA 4A3FB 1RCVD 4OWXB 2MO0A 1YNND 3J81i 5C44B 1N34Q 1MHWC 2K28A 4TKOB 3U9SA 3HOXB 3GTQH 1G6ZA 3T1HL 5BR8Q 1D5XC 1DOLA 3L9AX 4ZAIA 3RLFA 3T51B 2NVTH 4POFA 1WTQA 2CW0D 1K83H 3TZUA 3OW7A 4DAYA 4RKBA 2NUCA 2KA7A 1LLRD 1EUJA 2CWPA 4J15A 3I4NG 4RHSA 3CC4A 2VQEL 1SMYC 2JA7G 4AH6A 1XPRA 2KJXA 4IUQA 5GADC 4ZQ3A 4C3JB 1SROA 3GTLH 1VQIA 2F0HA 2B8GA 1CQFA 4K6LA 3VR3A 4R8IA 3I56A 2WB1G 2B2TA 1B9MA 2QGQA 4LFAL 1C48A 1T9HA 1EQQA 5FLMH 2KCCA 2EYOA 4OONA 4JI3L 4UY8C 1D2BA 4DUYQ 2A6EC 2F0GA 4B3MQ 1EL0A 1QVCA 1TWFB 3GTOH 5LL6S 3HS0C 5G3LF 2R92G 1VMCA 4LF4Q 4HIDA 1SN8A 3PIP3 4RFBA 5JEAH 3GTLB 3SDZA 4XQJA 2YYZA 2E8GA 5IY0A 5JPMC 1L0WA 3HEJA 1YHAA 3BDOA 1H9KA 1KTKA 2VQEQ 4IURA 1HH2P 3NBHA 3RMHA 3CCJA 1VMPA 2F0OA 2KENA 3OTOL 1WTVA 2VQFL 4G7ZC 1F9PA 2F0PA 4A3LG 3X3NA 5CV9A 4C3IB 2EQSA 1VQLA 3OIPA 2ZJQA 4GLXA 3I4MG 4DV1Q 2JSOA 5FOBB 2IY5B 2PYKA 4ULLA 1ICFB 3BZCA 4OHJA 4PNYA 3HOUH 5GQOA 4CDCC 2WFWA 5CGKA 1DOKA 1BKBA 4JI4Q 1PDQA 1C7YA 1XTCD 2D0OA 4TVAB 1WVLA 2XRSD 5A2QE 2K5VA 2R7ZH 2B2WA 4HCSA 1TWAB 2DJGC 5BN4A 3PO2H 4CBVA 2F0MA 1QVFA 1KC8C 4JYAL 1IBML 3CCVA 1V1PA 2DNCA 2I5HA 2BA1A 1V43A 2ZXPA 2CVRA 2VB2X 2ZXOA 3SK4A 1UNSA 3F2CA 5M3MH 4POGA 4DNTB 4IJHA 1EOTA 3LWUA 4ALPA 2UUBL 2DY7A 3T1HQ 2Z4IA 5KGUA 3NELA 3PGZA 2O5IC 3M9BA 3L3OC 3G6EA 1O78A 4BY1B 2WB1B 3ER0A 1YVCA 2XSCA 2RKSA 1IBKL 4X64L 1UE1A 2AQ3B 2BOSA 2YV5A 2DGYA 1VQDA 3GO5A 4MHEA 5IYDG 3OHXC 4P71A 5ELNA 1Z7TA 2L55A 2D5DA 1CT1D 3Q6SA 5I2YA 4G7OC 4R4IA 1OTCA 1PH8A 1AP0A 1LYLA 3CPWA 1I4PA 3P20A 1JORA 1Y14B 3S15H 4B08A 3H3VC 1KL9A 1SMYD 1KHIA 2CH4A 2HDLA 5DEHA 2BE5C 2JE6I 3QWNA 1HQRD 1ZYRC 2B2WC 3TN2A 5I9PA 3GTPB 2J0TD 1STYA 4K5VA 1F2ZA 3NBIA 3NSWA 4RCNA 3RD4A 1FNWA 1EQRA 4C3IG 3KDFB 1STBA 1BCPB 3GTJH 2B63H 1FJGL 3BS1A 1YNNC 5ELBA 2HUGA 4X64Q 4OEMB 2EDGA 1JQYD 3K8AA 3PO2G 1PMRA 2AMCB 1HRJA 5FO9B 1J9OA 3ERQA 1VQMA 1IYJB 2V1CC 3HOVH 1Q3LA 4RCOA 4DK0A 1H9SB 2KEEA 1VQJA 2K7VA 2VY3A 1HNWQ 4TSSA 2EXDA 2ZM6L 4IO9A 2QEJC 1F2MA 5IGBA 4DV1L 1X56A 3GP7A 4X3SA 2BH2A 3SXHA 5FLXE 1H9JA 1SLJA 2B2VC 3ITPA 1KRSA 3RN2A 4FNFA 2M9VA 3CMAA 4B3RQ 1WI5A 3M4QA 3DM3A 1E0BA 1JOOA 4KK7A 1PH6A 1MSHA 2J7ZA 1IHZA 5KNDA 2OQKA 3S2DH 3NWTA 4CKEA 3AMUA 1XJVA 3K6OA 1GVPA 3NPPA 4A3GG 1K0SA 1K8AC 3UDFA 3M3YB 3K57A 4OO1I 1CKMA 3M85A 4RMFA 4JV5L 4C56C 1E24A 4IPGA 2A68C 1N32Q 2N8NA 5C0XJ 3PIOA 5I6YA 3T1YL 3MXPA 3TP5A 2E74C 3CPFA 1SE4A 4HJ9A 3MTSA 3X3MA 1B4OA 2NN6H 4DR6Q 1L1OA 4M1UB 4ID6A 4CJ2C 4LUZA 4HJ8A 1EY4A 2Q2HA 4IUPA 3CXCA 5EBDA 5EPJA 1Y1WG 1Y8PB 5EKKA 2GVBA 2R92H 1EWHA 5C5LA 1I3QB 4K5XA 5EKIA 2F0EA 2YTVA 3A8JE 3EBEA 1QNUA 4KD3A 1ICWA 3K7AB 2NN6I 4O2DA 1MJCA 1S3OA 1IZ6A 1V1OA 1QE6A 5COYA 4XDXA 1X3PA 2K5HA 1KAAA 1U4MA 2DJFC 2JA8B 3SR1A 1HUMA 1R4QB 2H4OA 2B2YA 3DEOA 1CA5A 3PO2B 3G71A 4DR4Q 3NUCA 3E5SA 5D3IB 5A2QL 4LF9L 4K2LA 4QUCA 3TP8A 3K5MA 1HTLD 4P74A 1PZID 3DHQA 3DEPA 1TWAH 1TWGB 3W3AA 3I4OA 4DV3Q 3D8GA 3VYUA 1OXTA 3HKSA 1B2TA 1R9TB 3AFPA 4IOCA 2PQAA 1I94Q 1Y1VH 3BYTB 2VB3X 1X32A 4R4QA 3K5NA 3I4LA 2D2CC 4YHHQ 1TY0A 3LX0A 2RVLA 1O7LA 2X6GA 3PQIA 4KY6A 5C4JB 1YHQA 4FXKC 3C1EA 1ZKOA 3CP0A 1GXDC 1VQBA 2HCIA 3SGIA 2NVQH 2CFMA 4EQNA 4PV1C 2BA0A 4AIMA 3DWQA 1HXYD 2K1BA 4JI8Q 4R4OA 1EIGA 1HTPA 5EAYA 2RF4A 5AJ3Q 1PZKD 2ID0A 2P5ZX 2BH8A 4A76A 4RHRA 3S17H 3SVMA 5CC4A 1CQVA 1IYVA 1PZJD 3F1ZA 1LTTD 4WJ4A 1SRUA 1YHBA 2K05A 3PUWA 3TMEA 4CDFC 4N9PA 4DK1A 2UUBQ 2XIWA 2QEXA 4GOPC 4DU9A 2NB0A 2FINB 1DZ1A 4ME5A 5J39A 1BO0A 4LF4L 5M5YB 4JBJA 1I4QA 2V4DA 2KECA 3FKIG 3P75A 4UAIA 2H1EA 4ZKCB 5M5XH 1VF5C 1C0AA 1EZ6A 4DR6L 2LS01 2UU9L 1RD9D 2Q2UA 1PH7A 2JA9A 1X3QA 4O1NA 3S1MB 5IE8A 1F2LA 3PV0A 1ZXTA 2N78A 1M4VA 5EKLA 3SHLA 1TS3A 3V96A 2YU9H 4LK1C 3RZOH 4HMJA 4ODGA 3NTHA 4YCUA 2F03A 2KEDA 2F3IA 2E75C 2BCOA 2IHEA 2XRQD 3RR5A 2F0IA 4B9WA 4A3GB 4V190 3HOWH 1WTHA 2VS1A 1NAPA 2EY5A 1EY6A 1U4LA 3OWEB 5C6AA 2C9OA 3HOZG 3TDQA 2UUAQ 4ABNA 1EIHA 1B1ZA 1GUWA 2R7ZG 2LXKA 2N55A 5FKAC 1VQOA 4LFBQ 3A7AB 4HIMA 4K0KQ 3PMFA 3S1QH 1U0LA 3SEBA 1OXXK 5NUCA 4ZUIA 4N8FA 4MTKA 2EYLA 4FF3A 4YY3Q 1STGA 1Y8NB 1NUCA 2UXBL 1NY4A 4Z9CB 2LY7A 4BBRH 3G48A 3MEHA 4KY5A 1KDAA 1K73C 1J6QA 1BBXC 1Q1BA 1PRTB 1IXRA 1VQHA 2PZUA 4IUUA 5JOBA 3MAQA 4C2MB 4QJFA 1LM0A 4KMUC 1Q7YC 4EQOA 1S5BD 5C4JH 2E5LL 3Q23A 1AFPA 4U68A 4OX9Q 4NKLA 2JA8G 2F0KA 1QZGA 2UUAL 4YHHL 4GOPB 3J81L 1XYIA 4NXNL 1PVOA 1GD7A 3MVVA 1STAA 4XQQA 3S16B 4AQYQ 1PH2A 2L15A 3L7ZC 4KN7C 4DR1Q 4HIKA 1CHQD 1Q8IA 3BZDB 2IWHA 3HOWG 1VQKA 2ZJRA 3RN5A 2MUYA 4PMCA 2F0LA 1KRTA 1EFID 1JJCB 4DR3L 1SYDA 2E2HB 4IFDJ 2JEAI 3DWAA 4HN7A 1H9RA 1JE5A 5M5XB 2WV6D 1K0RA 4GLVB 1E2ZA 1FNVA 4P73A 2JA5H 5HGTA 1G51A 1WD0A 1SNQA 3CCSA 3EN2A 5C4XH 1I6VC 3EROA 2LMCB 3A5UA 2HD3A 1JJGA 4R8NA 1VQ7A 4NXNQ 5ELEA 4CHTB 2Y0SE 2Z6KC 3BDCA 1LTBD 3QIAA 4IZ8A 3H3VH 1CK1A 5IYCH 3ICEA 3I90A 5KNCA 3ULLA 3JAMi 3UDXA 1B50A 1C4QA 1N33L 1T5XD 1EQVA 2A74C 2B8FA 1J8IA 1Q90A 1DYQA 2B29A 1RODA 2RSNA 4N8X1 2QILA 4H7BA 4KY7A 1E1TA 1EWIA 1G2TA 2QCPX 2D62A 5E1FA 1LT4D 5CORA 2DNEA 3I73A 1A0IA 3CQZH 1WOCA 2IX0A 3GQBA 5C5MA 3I4MH 4DR4L 2I07B 4WJ3M 4F88A 4C3JH 3IFTA 1ASZA 3TP7A 3SE0A 4GN4B 1PH3A 2DY8A 1PTOH 2CH4W 2ZXRA 3TS0A 3SK5A 4A3KH 1UEAB 2VXWA 1F9QA 2MP1A 2Z6BA 4XYOA 5K36G 3PUVA 4DV2Q 2UXBQ 1PTOF 4K8IA 3JAMc 4DV3L 2F4VQ 3N52A 1VQEA 4EVOA 1BCPF 1K83B 3J81c 1N33Q 2B2UC 2K75A 4JI0Q 2B63G 1R4PB 4Y7NH 2WKCA 3T1YQ 1SYBA 4K6DA 1TXYA 2PW5A 4QY7A 3HOVB 4WORA 1D8LA 3STBC 2F4IA 2L9HA 4NB3A 5D65A 3HFZB 1PH5A 4FDBA 1HPCA 4KHVA 2NN6G 3KJPA 2PMZB 4JI6L 3CRLC 5BN5A 1X55A 3KBXA 2R7DA 2UUCL 1B53A 1S5CD 1SJHD 3CCEA 1EFWA 2PI2E 3K81C 2EYPA 2OWOA 3U58A 3CCLA 2AWOA 2TMPA 1TWCB 1U4RA 1AEXA 2B2UA 4GZYC 4DGZA 1SXTA 4C2MH 1F9RA 1Q1EA 1CZGA 2JYOA 4BS9A 1B7YB 4NXML 1HZAA 2B2YC 5K36H 4LF5Q 2KUMA 3J81E 2R92B 3K0XA 1EY0A 3AEVA 5IYBH 2ICEC 1UUPA 4X3TA 1SJED 2DN8A 5L37A 1BCPC 3JAME 3D3RA 4XT3B 4IOAA 1BQQT 1I6HH 4OGQC 2Q2IA 2WB1E 3HRZC 5GAHC 3F2DA 4HSPA 2K01A 5FLXL 5C3XA 1EWCA 1XXGA 4A3KG 5J1ZA 1NMFA 3Q24A 2F3WA 3HKZE 4B3SQ 4OXPA 1PYSB 3J80c 5IODA 1FGUA 3S15B 3K7AH 3OSOA 3NHHA 3URYA 5H1SE 4BBRB 1K8MA 4C1NI 1XPUA 3J80L 1E3PA 3PSIA 4AYBG 4LF7Q 3Q8DA 2XWBB 1L2FA 2Y0SG 1BF4A 2E2DC 4NXMQ 2JA5B 3BU2A 4HCEA 2IPKD 2OQ0A 3ND8A 1XMOQ
chains in the Genus database with same CATH topology
2KCNA 4RGOS 3BG3A 3GTJB 2B63B 1JICA 1KLGD 5FO7B 4DFAA 2L4NA 5ISRA 4QIWB 5EBCA 3H09A 4RH6A 5IGFA 4I65A 1BDOA 2M00A 2XVSA 2K6AA 4Q5VA 1IKLA 1Z47A 4KKSA 4HTHA 2L1BA 2NVTB 4KKUA 4BY7B 3ND9A 4CKBA 3W2DA 1MGSA 2SEBD 1MI2A 1SNCA 4J1MA 1JR0D 2B2TC 3C2PA 3E6ZX 1MSGA 3I8ZA 2YU9B 2A6HD 5M3FB 5D14A 3QOJA 1SNOA 3DM1A 4A3MB 3OMGA 1A2UA 1G2SA 4KTAA 3LWEA 1LABA 5JJZA 1DOMA 1SEBD 1T5EA 4A3KB 1JWMD 3GTOB 3N6RA 5C4ZA 3K59A 1TU2B 3S9WA 1HFGA 4Q0FA 3TP6A 2WIIB 4AYBB 2EXZA 1AZPA 4KJNA 3WOFA 1GOZA 3PUYA 1SNPA 3R2TA 2NBFA 3GTKB 3VYSA 1HQMC 1FNUA 3EQLC 2F0JA 4CJ1B 3C1FA 1JCKB 3SK8A 2G9DA 1YNJC 2EJGC 4ZLTF 5JEAJ 1HA5A 5FK9C 3KUPA 5ELCA 2EY2A 5M5WB 1E2VA 2EYFA 2PO4A 3CRKC 1FGBD 3QO2A 4IQZA 1PRTD 4CJ0B 5G3LD 2RDHA 3IAYA 3D4WA 1PLFA 1RDPD 1EU3A 1SSOA 3DMUA 1LTAD 2F0WA 3SK6A 3J80E 5DM63 1I6HB 3KLSX 2A69C 1IKMA 2QF7A 1GUSA 1OXUA 1OO9B 4RGMA 1F77A 2VUMB 3QG1A 5CBEE 1WTWA 3S14B 3A56A 2RDFA 5CV7A 5IGCA 4FO2A 1JWSD 4WFN3 3EVQA 1QNKA 4A3DB 4HR7B 2Q8TA 1NSNS 1SFOB 3VYTA 5KEEA 2RA4A 4MN3A 3H6MA 2PCFB 2PZWA 2NYZD 3S17B 1KABA 4C3JG 1OXSC 5C4XB 4OO1H 3P1HA 4RAUC 2IT1A 1GHKA 1QJOA 4PMBA 4KI0A 1A3UA 1Y8OB 2G9HD 1RHPA 1JWUD 1A6XA 4IALA 3F2UA 2EYJA 5I6WA 1KNEA 1ENFA 3Q22A 3H0GB 4QMGA 4IUTA 3V05A 1LT6D 2A69D 3FVQA 4QB4A 1EYCA 1BOSA 2EYMA 4ZRZA 4FVMA 2F0VA 3RZDB 3HOYB 2WKDA 3NQIA 1RJTA 3DXJC 3MFYA 2VNUD 5EPLA 1WTOA 2QDBA 3T56B 2HDMA 1CM9A 3DWPA 5KIXA 3KF8A 4CKCA 2L5TA 2C5CA 3K58A 1BXTA 3MA2B 5E4WC 1CFMA 3H91A 1LACA 2K32A 4J8QA 3D31A 5CMDA 3S1NB 1WTPA 2FFKB 2Z1CA 1I4XA 1PRTC 1QOHA 1GUGA 1HFNA 1B44D 1VCIA 3A7LA 3FEWX 5TSSA 2XWJB 1H9SA 4A3BB 2R7ZB 3JAML 3HZXA 2OXPA 4IFDG 2L0CA 5DAUA 3TBIB 3HP3A 3PO3B 3HGBA 2GA4B 1TVXA 1OXVA 4QCLA 4IFDH 4TQUS 3GTMB 3MZ5A 2CQAA 1SYFA 1ILQA 5DM73 4IUVA 4C3HG 3G6JB 2PQEA 3NQTA 1SNDA 3GV6A 3GV3A 2F0SA 3NE5B 2NVQB 2Z4HA 3U9OA 2O4XA 2F0NA 3I70A 3T53B 3I91A 5C3EB 1XWEA 4XXEA 3MXNA 1LT5D 1ONLA 2JXMB 2A73B 3HOWB 1I4GA 5EJWA 5I4DA 2MJ8A 1EY9A 3O13A 4S3SA 1HCZA 1I50B 2AQ2B 1ESFA 1V8QA 3OPOA 1ET9A 1TS4A 1GUTA 1A2TA 3BVGA 1BR9A 5JEAG 2PZTA 1DXMA 3QOLA 1VF7A 1A3TA 5C0XH 2O5JC 5LL6X 5C3WA 1STEA 3VR5A 2X69A 1PRTF 1LV9A 2O2LD 1WCMB 1JOQA 1B3AA 5D3DA 4F87A 1KLUD 2EPBA 2R3ZA 5BN3A 1II3A 4FP5D 3R2IA 4H0LC 2HCCA 1S5ED 4KD4A 5IT9E 1WTXA 1W6JA 2IX3A 4BA1I 3RZOB 2XNAC 4K5WA 4BWGB 1WTRA 4HAEA 2EJMA 2AWNA 5E3FA 2MHVA 5EGTA 3T4AC 1FR3A 2E76C 4I7ZC 5T1IA 2NZ1D 1D1KA 2WINB 1BCPD 4KKTA 1SE3A 1YNJD 1ZEQX 2Q8IB 5A35A 3EFXD 1SYEA 2R61A 2NWGA 4X3KA 3EJIA 2Q8RE 3PUZA 3T16A 3M4YA 2CHBD 2F1MA 1PFBA 3FPUB 1D5ZC 1ENAA 4RA8A 3TSSA 1TQOA 1DCZA 4YIJA 5KNBA 1ET6A 2K04A 1KNAA 3I72A 1LO5D 4U673 2JA7B 3HKZB 1L0XB 3FMCA 4XIGS 1STHA 3BVMA 3CKIB 1VDZA 4ZYSA 3M7NA 2R93B 4FF2A 2F3VA 1F9SA 4WRDA 3NK9A 2AUKA 1GUNA 1QCBD 1EY5A 4ILWA 3DUZA 3KBGA 2ZT9C 2WACA 1TT2A 3FKIB 5E4XA 1MBYA 5IT9L 5AFWA 4QUFA 1O7YA 4NW2A 1GUOA 2SOBA 1WD1A 2L12A 3S2HB 2I46A 2JA6B 3RUZA 3PIO3 4OIJA 5IGEA 5HURA 3V2TA 2EJFC 5I9OA 2F0QA 3FDTA 1LTID 4P2CB 1CI3M 1EEFD 4KV6A 4ZK9B 2ICIA 4DAPA 3HOZB 2ENBA 4PQXA 3CQZB 4JK1C 2IX1A 1PXUA 4WJWA 5LHY1 1DD2A 1MD2D 4QF4A 4K2KA 2A6HC 2E2JB 3VYRA 4LMQD 5J22A 2RBMA 1Z6HA 5FO8B 1U4PA 3H94A 5CBAE 4Y7NB 2BDNA 2A5HA 3J7AV 3ONAB 1HA6A 3M7GA 1EY7A 3MXGA 4HSVA 1A15A 1SYGA 1EYAA 4RWSC 4K14A 2MGSA 2QKIC 5F2DA 1K8OA 4G7HC 2FMCA 3A54A 4DF7A 1F2YA 5JVG3 2L11A 3OWFA 2EY6A 4A3IB 3A8KE 2NVXB 1QILA 1AZQA 1BNZA 5KYIA 1D5MC 3C3LA 3BYYB 5CV4A 3FRPB 1S5DD 3HG9A 2OF1A 3GD7A 1CA6A 3TZDA 1ML0D 1LTGD 4R9WA 4ZKBB 1L0YB 4C1NK 4KHZA 3HOUB 2F0DA 2RSOA 3VR4A 2K33A 4DA2A 2HQEA 4DN4M 4HEDA 4NP5A 2F0UA 1I4RA 3GTGB 3OMCA 4HMIA 4RGNA 3KLSA 3OOCA 5K5PA 1CZWA 2IJ0A 1RKNA 1DM0B 1LTSD 4G57A 4LJZC 4L63B 5ELDA 2EVBA 2EZVA 2AQ1B 5CV8A 4B9XA 1TY2A 3GTQB 2R6GA 1STNA 2TSSA 3MFGA 4L6TB 3WDNA 5C4HA 5DNFA 3AB9A 1O7ZA 1V1PB 3ZYYX 2K5QA 1PTOB 1TKWB 3LNNA 1Y1VB 3D4RA 1PTOC 3K5LA 1KDCA 2E2IB 5EPKA 4OO1G 2PNRC 1PFNA 1SNMA 3QJYA 1IW7D 4BA2I 2BE5D 3R3OA 5I2XA 3NWSA 3J7AF 3BVZA 4RKLA 2BDOA 1Y1WB 3D6WA 1SE2A 2LKVA 4NMZA 2EY1A 2WAQB 1GJXA 1LT3D 5KRUA 4IUNA 2D9UA 2FMMA 5CYUA 2NVYB 4TRDA 2K5WA 3R8BA 1FD7D 3K0YA 2F0TA 3EA6A 1RTNA 2RDGA 3IL8A 1NR2A 1D1IA 2J4XA 1EEID 1IYUA 4N9TA 2A68D 2SNSA 2Z8LA 5JPNC 1BUVT 1TR5A 1QG7A 4H13C 2PW7A 2PPBC 2IL8A 1HUNA 3PUXA 1JOKA 3NTKA 4DXGA 2SNMA 5KYLA 5C0XI 4KN4C 2FJ2A 2JEBI 2IW3A 3IKJA 1ESRA 1EY8A 4O42A 1NR4A 3KLRA 3MXUA 2OEOA 5IIFA 4EQPA 1M8AA 4IN3A 5JAVA 4V0BA 4XTCS 3MHBA 3G7LA 1GHJA 2CW0C 1O80A 1UAPA 3CU7A 1JE4A 5CV6A 3A55A 4OL7A 4JBWA 1E2WA 4PMWA 4K8JA 5M9OA 5M3MB 5JVH3 2B39A 1JB3A 4MIUA 1SBBB 5CR3A 1NCVA 3D4DA 4A93B 1TIID 2N88A 1CTMA 2A6ED 2F0FA 4F8MA 1ZYRD 1Y69U 4FYDA 4DXFA 1TS5A 4OIKA 4XQNA 3VR2A 4H44C 1AW7A 1ENCA 2Y0SB 1AN8A 2JP1A 2LFNA 5IGGA 3NXWA 2K03A 4NDXA 4L8JA 1XX8A 2MPMA 3VA5A 4F7XA 2B2VA 3D6CA 3MC0B 4C3HB 2K5DA 1G91A 1LTRD 5T1GA 1SAPA 1IL8A 1ILPA 1JC7A 5IGDA 3P7JA 4EGVA 4RGTA 4FXGC 2FHTA 3S1QB 5ELFA 4KJOA 4DNRB 1SDFA 4FF4A 3NP8A 3OIQA 4X3UA 2EYHA 4CGYB 2XN9C 1EYDA 2NTSA 2KHSA 3I3CA 3S2DB 1DJRD 1TWHB 4UDUC 4J6HA 4XT1B 3C46A 4DAVA 2RQXA 1C8CA 3VR6A 1EU4A 4IFDI 2KVMA 1IW7C 3Q0AA 5IOCA 1U9RA 3A8IE 3R93A 3AU7A 4FF1A 2EOTA 1S4ZA 5EQ0A 1PTOD 3MWYW 3UI2A 4A3EB 1RTOA 3NTIA 1DONA 4E6IA 3I4NB 1QB5D 2SDFA 3M4OB 1PFMA 1QWYA 3E0JA 4LAAA 1RF2D 1A3VA 1G291 4A3JB 3S1RB 1PYWD 4XYQA 5CV5A 3KK7A 2WP8J 1EZ8A 4FXDA 3BDLA 1H9MA 4M8AA 1W6KA 3CHBD 3FPPA 3J7YW 3IFDA 2EE1A 3QB3A 3VA7A 1Q12A 4BBSB 2NTTA 3K5OA 1S5FD 5C0XG 1D6EC 4ZUJA 2AUJD 1SYCA 1FYCA 3WOEA 4G4KA 1KDBA 2KOLA 1EQTA 2M2LA 3T13A 1CHPD 1B9NA 1HHVA 1TS2A 2KQ3A 3I4MB 2X6LA 1G8ZD 2OT2A 1I4HA 4A3FB 1RCVD 1YNND 5C44B 2K28A 4TKOB 3U9SA 3HOXB 1G6ZA 1D5XC 1DOLA 3L9AX 4ZAIA 3RLFA 3T51B 1WTQA 2CW0D 4DAYA 3TZUA 3OW7A 4RKBA 2NUCA 2KA7A 1LLRD 4RHSA 1SMYC 2KJXA 4IUQA 4ZQ3A 4C3JB 2F0HA 2B8GA 1CQFA 4K6LA 3VR3A 4R8IA 2B2TA 1B9MA 1C48A 2KCCA 2EYOA 1D2BA 2A6EC 2F0GA 1EL0A 1TWFB 5LL6S 3HS0C 5G3LF 1VMCA 3PIP3 4RFBA 5JEAH 3GTLB 3SDZA 4XQJA 2YYZA 5JPMC 3HEJA 3BDOA 1H9KA 1KTKA 4IURA 3NBHA 3RMHA 1VMPA 2F0OA 1WTVA 4G7ZC 1F9PA 2F0PA 3X3NA 5CV9A 4C3IB 3OIPA 2JSOA 5FOBB 2PYKA 4ULLA 4OHJA 4PNYA 5CGKA 1DOKA 1PDQA 1XTCD 1WVLA 2XRSD 5A2QE 2B2WA 4HCSA 1TWAB 5BN4A 4CBVA 2F0MA 1V1PA 2DNCA 3ND8A 2BA1A 1V43A 2ZXPA 2CVRA 2VB2X 2ZXOA 3SK4A 1UNSA 4DNTB 1EOTA 3LWUA 2DY7A 2Z4IA 5KGUA 2O5IC 3L3OC 4BY1B 1O78A 2WB1B 2XSCA 2RKSA 2AQ3B 2BOSA 3GO5A 4MHEA 3OHXC 5I2YA 4G7OC 1Z7TA 2L55A 2D5DA 1CT1D 3Q6SA 1AP0A 1I4PA 3P20A 1JORA 4B08A 3H3VC 1SMYD 2HDLA 5DEHA 2BE5C 2JE6I 3QWNA 1HQRD 1ZYRC 2B2WC 3TN2A 5I9PA 3GTPB 2J0TD 1STYA 4K5VA 1F2ZA 3NBIA 3NSWA 4RCNA 3RD4A 1FNWA 4C3IG 1STBA 1BCPB 3BS1A 1YNNC 5ELBA 2HUGA 2EDGA 1JQYD 1PMRA 1HRJA 5FO9B 1J9OA 3ERQA 1Q3LA 4RCOA 4DK0A 1H9SB 2KEEA 2K7VA 4TSSA 2QEJC 1F2MA 5IGBA 3GP7A 4X3SA 3SXHA 5FLXE 1H9JA 2B2VC 3ITPA 4FNFA 2M9VA 1E0BA 1JOOA 4KK7A 1MSHA 2J7ZA 1IHZA 5KNDA 3NWTA 3AMUA 4CKEA 3K6OA 3NPPA 3M3YB 3K57A 4OO1I 3M85A 4C56C 2A68C 5C0XJ 5I6YA 3MXPA 3TP5A 2E74C 1SE4A 3MTSA 3X3MA 1B4OA 2NN6H 4M1UB 4ID6A 4CJ2C 1EY4A 4IUPA 5EBDA 5EPJA 1Y8PB 5EKKA 1EWHA 5C5LA 1I3QB 4K5XA 5EKIA 2F0EA 3A8JE 1QNUA 4KD3A 1ICWA 3K7AB 2NN6I 1V1OA 1QE6A 5COYA 4XDXA 1X3PA 1KAAA 1U4MA 2JA8B 3SR1A 1HUMA 1R4QB 2H4OA 2B2YA 3DEOA 1CA5A 3PO2B 3NUCA 3E5SA 5D3IB 5A2QL 4K2LA 4QUCA 3TP8A 3K5MA 1HTLD 1PZID 3DHQA 3DEPA 1TWGB 3W3AA 3D8GA 3VYUA 1OXTA 1B2TA 1R9TB 3BYTB 2VB3X 1X32A 3K5NA 3I4LA 2D2CC 1TY0A 3LX0A 2RVLA 1O7LA 2X6GA 4KY6A 5C4JB 4FXKC 3C1EA 1ZKOA 1GXDC 2HCIA 4EQNA 4PV1C 2BA0A 3DWQA 1HXYD 2K1BA 1EIGA 1HTPA 1PZKD 2ID0A 4RHRA 3SVMA 5CC4A 1CQVA 1IYVA 1PZJD 1LTTD 2K05A 3TMEA 3PUWA 4N9PA 4DK1A 2XIWA 4DU9A 2NB0A 2FINB 1DZ1A 4ME5A 5J39A 1BO0A 5M5YB 1I4QA 2V4DA 2KECA 3P75A 4UAIA 2H1EA 4ZKCB 1VF5C 1EZ6A 2LS01 1RD9D 1X3QA 4O1NA 3S1MB 1F2LA 3PV0A 1ZXTA 1M4VA 5EKLA 3SHLA 1TS3A 3V96A 4LK1C 4HMJA 4ODGA 3NTHA 2F03A 2KEDA 2E75C 2BCOA 2XRQD 2F0IA 4B9WA 4A3GB 4V190 1NAPA 2EY5A 1EY6A 1U4LA 3OWEB 5C6AA 2C9OA 3TDQA 4ABNA 1EIHA 1B1ZA 1GUWA 2N55A 5FKAC 3A7AB 3PMFA 3SEBA 1OXXK 5NUCA 4ZUIA 4FF3A 2EYLA 1STGA 1Y8NB 1NUCA 4Z9CB 2LY7A 3MEHA 4KY5A 1KDAA 1Q1BA 1PRTB 2PZUA 4IUUA 5JOBA 3MAQA 4C2MB 4KMUC 4EQOA 1S5BD 3Q23A 1AFPA 4U68A 4NKLA 2F0KA 3J81L 1XYIA 3MVVA 1STAA 4XQQA 3S16B 3L7ZC 4KN7C 1CHQD 1Q8IA 3BZDB 2IWHA 2MUYA 4PMCA 2F0LA 1EFID 1SYDA 2E2HB 4IFDJ 2JEAI 3DWAA 4HN7A 1H9RA 5M5XB 2WV6D 1E2ZA 1FNVA 5HGTA 1WD0A 1SNQA 1I6VC 3EROA 2LMCB 4R8NA 5ELEA 4CHTB 3BDCA 1LTBD 3QIAA 4IZ8A 1CK1A 3I90A 5KNCA 1B50A 1C4QA 1T5XD 1EQVA 2A74C 2B8FA 1J8IA 1Q90A 1DYQA 1RODA 2RSNA 2QILA 4H7BA 4KY7A 1G2TA 2QCPX 2D62A 5E1FA 1LT4D 5CORA 2DNEA 3I73A 2IX0A 5C5MA 3GQBA 2I07B 4F88A 3IFTA 3TP7A 3SE0A 2DY8A 1PTOH 2ZXRA 3SK5A 1UEAB 2VXWA 1F9QA 2MP1A 4XYOA 5K36G 3PUVA 1PTOF 4K8IA 3N52A 4EVOA 1BCPF 1K83B 2B2UC 1R4PB 2WKCA 3HOVB 1SYBA 2PW5A 4K6DA 4WORA 2F4IA 2L9HA 5D65A 1HPCA 4KHVA 2NN6G 2PMZB 3CRLC 5BN5A 3KBXA 1B53A 1S5CD 1SJHD 2EYPA 2AWOA 2TMPA 1TWCB 1U4RA 1AEXA 2B2UA 4GZYC 4DGZA 1SXTA 1F9RA 1Q1EA 1CZGA 2JYOA 4BS9A 2B2YC 5K36H 2KUMA 3J81E 2R92B 1EY0A 2ICEC 1UUPA 4X3TA 1SJED 2DN8A 1BCPC 3JAME 3D3RA 4XT3B 1BQQT 4OGQC 3HRZC 4HSPA 2K01A 5FLXL 5C3XA 1EWCA 1XXGA 5J1ZA 3Q24A 2F3WA 5IODA 3S15B 3URYA 3OSOA 3NHHA 4BBRB 1K8MA 4C1NI 3J80L 2XWBB 1BF4A 2E2DC 2JA5B 4HCEA 2IPKD 1BBXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R93 A;  2HCC A;  2J7Z A;  1RHP A;  1AZQ A;  1BNZ A;  2DY7 A;  3HP3 A;  2EOT A;  1WTX A;  3N52 A;  1S4Z A;  5EQ0 A;  4U68 A;  1JIC A;  1NCV A;  5E4X A;  3MWY W;  3UI2 A;  4ZLT F;  1RTO A;  2K1B A;  1TVX A;  3D6W A;  1DON A;  3F2U A;  5AFW A;  1EIG A;  2SDF A;  1KNE A;  2L4N A;  2B2U C;  1O7Y A;  2N88 A;  3KUP A;  4NW2 A;  4QUF A;  4IUQ A;  1PFM A;  1WTR A;  1XYI A;  1CA6 A;  3TZD A;  4HAE A;  1WD1 A;  3SVM A;  3QO2 A;  2D9U A;  4OIK A;  4CJ0 B;  1ML0 D;  4R9W A;  2FMM A;  2L12 A;  4IUT A;  4ZKB B;  2L9H A;  3MTS A;  5D65 A;  1PLF A;  4R8I A;  2K05 A;  2B2T A;  1B4O A;  1ILQ A;  4OIJ A;  1SSO A;  4MHE A;  4IUV A;  2XIW A;  2RSO A;  4CJ2 C;  3Q6S A;  5T1I A;  1IKL A;  4IUP A;  2FIN B;  2JP1 A;  1EL0 A;  1DZ1 A;  1AP0 A;  3FDT A;  2NZ1 D;  1BO0 A;  2L1B A;  3KBX A;  5EPJ A;  1VMC A;  3GV6 A;  3GV3 A;  1B53 A;  2KEC A;  4DN4 M;  4ZK9 B;  4HED A;  4UAI A;  2H1E A;  1MGS A;  4ZKC B;  1MI2 A;  1RTN A;  5EKI A;  1IKM A;  3IFD A;  2EE1 A;  2B2T C;  2HDL A;  3IL8 A;  1NR2 A;  1ICW A;  1MSG A;  1RJT A;  2K03 A;  1X3Q A;  2B2W C;  1U4R A;  1F2L A;  3I8Z A;  1ZXT A;  3TN2 A;  5EPL A;  1XX8 A;  2B2U A;  2MPM A;  1WD0 A;  3I91 A;  4IUR A;  1WTO A;  2B2V A;  2NWG A;  4X3K A;  5D14 A;  1VMP A;  1F9R A;  5CBE E;  1QG7 A;  2JYO A;  1QE6 A;  2Q8R E;  5COY A;  4XDX A;  1WTW A;  1G91 A;  1X3P A;  3DM1 A;  2B2Y C;  2IL8 A;  1WTV A;  2HDM A;  2KED A;  1U4M A;  1CM9 A;  1F9P A;  2KUM A;  1HUM A;  3DEO A;  2B2Y A;  1G2S A;  1CA5 A;  1HUN A;  5T1G A;  5EJW A;  3LWE A;  4X3T A;  1SAP A;  1IL8 A;  2MJ8 A;  1QNK A;  1ILP A;  4LMQ D;  1NAP A;  2HUG A;  1U4L A;  2KOL A;  1DOM A;  3P7J A;  2Q8T A;  5JJZ A;  4XT3 B;  1EQT A;  2FHT A;  2FJ2 A;  1PFB A;  2M2L A;  3FPU B;  3I90 A;  5E4W C;  1HRJ A;  4RA8 A;  1B50 A;  1U4P A;  3H91 A;  2K01 A;  4QUC A;  1EIH A;  1GUW A;  1J8I A;  1J9O A;  1ESR A;  2RA4 A;  5CBA E;  5CMD A;  1HHV A;  4O42 A;  2N55 A;  4MN3 A;  1ROD A;  1Q3L A;  1NR4 A;  2RSN A;  1SDF A;  2BDN A;  2X6L A;  1WTP A;  5DNF A;  2KEE A;  4X3U A;  1O7Z A;  2FFK B;  3ONA B;  1G2T A;  3DEP A;  1DOK A;  1M8A A;  1HA6 A;  1PDQ A;  5COR A;  1HFG A;  1KNA A;  2K04 A;  1WVL A;  4HSV A;  2NYZ D;  1A15 A;  3I3C A;  3G7L A;  2K28 A;  4X3S A;  2B2W A;  4HCS A;  1HFN A;  1AZP A;  4XT1 B;  1B2T A;  4RWS C;  1G6Z A;  1O80 A;  2MGS A;  1DOL A;  1X32 A;  2B2V C;  1JE4 A;  4ZAI A;  1C8C A;  2X69 A;  1LV9 A;  4RAU C;  1BF4 A;  5EPK A;  1WTQ A;  1F9S A;  2DY8 A;  2RVL A;  4CJ1 B;  2KVM A;  2CVR A;  1B3A A;  1PFN A;  2X6G A;  2L11 A;  4IUU A;  2VXW A;  2EPB A;  1F9Q A;  2MP1 A;  2R3Z A;  2HCI A;  1E0B A;  1BBX C;  1MSH A;  1EOT A; 
#chains in the Genus database with same CATH topology
 2KCN A;  1SR3 A;  4RGO S;  3BG3 A;  3GTJ B;  2B63 B;  1JIC A;  1KLG D;  5FO7 B;  1PHJ A;  4DFA A;  2L4N A;  4X66 L;  4LF6 Q;  5ISR A;  4QIW B;  5FJ8 H;  4JI1 L;  5EBC A;  4DV4 L;  3H09 A;  4RH6 A;  5IGF A;  3GTP H;  4I65 A;  1BDO A;  1ASY A;  4B3S L;  2Q2T A;  2M00 A;  2XVS A;  4L5T A;  1CUK A;  1TWG H;  2R93 H;  1VQ9 A;  2K6A A;  5IT9 c;  4Q5V A;  1D7Q A;  5IP9 G;  1IKL A;  1WFQ A;  1Z47 A;  4KKS A;  1K9M C;  4OX9 L;  1VQ8 A;  4HTH A;  2L1B A;  2NVT B;  4KKU A;  4QQB X;  1HJP A;  3E9I A;  4BY7 B;  3ND9 A;  4CKB A;  4KLK A;  3W2D A;  1MGS A;  2SEB D;  1MI2 A;  1SNC A;  3CD6 A;  4J1M A;  5C4X G;  1JR0 D;  2B2T C;  2UU9 Q;  4BY1 G;  3CCU A;  3C2P A;  1L1O C;  3E6Z X;  4HJ5 A;  1MSG A;  1MKH A;  4DV0 L;  3I8Z A;  1Q46 A;  2Z9H A;  3RLN A;  2YU9 B;  2A6H D;  4R4T A;  4DPG A;  5M3F B;  1TWC H;  5D14 A;  3QOJ A;  1SNO A;  4X62 Q;  3DM1 A;  5LMN Q;  4A3M B;  3OMG A;  2E2I H;  1A2U A;  4NPS A;  3FKI H;  1G2S A;  4KTA A;  1HNZ L;  3LWE A;  1EYG A;  2G5D A;  4JC0 A;  4DV7 L;  1LAB A;  1DOM A;  3D0F A;  5JJZ A;  1SEB D;  1T5E A;  2PNH A;  4A3K B;  1JWM D;  4A3D G;  4OEL B;  1S72 A;  5M3F H;  3GTO B;  3N6R A;  5C4Z A;  1X3E A;  1P8L A;  3K59 A;  1TU2 B;  3S9W A;  4B3T Q;  1VQA A;  4QL5 A;  2PI2 A;  4A3G H;  1MIU A;  1HFG A;  4Q0F A;  4P75 A;  3TP6 A;  2WII B;  4AYB B;  2EXZ A;  1AZP A;  3HOY G;  4KJN A;  3WOF A;  3HOZ H;  1PV4 A;  1GOZ A;  3PUY A;  1SNP A;  3R2T A;  2NBF A;  1YIJ A;  3RNU A;  3VYS A;  3GTK B;  2KHI A;  1HQM C;  1FNU A;  3EQL C;  3H15 A;  1HNZ Q;  2F0J A;  4CJ1 B;  3C1F A;  1JCK B;  1PFS A;  3KYH C;  4H02 A;  1X6O A;  3SK8 A;  2G9D A;  2JQO A;  1YNJ C;  2EJG C;  4LFA Q;  5JEA J;  4ZLT F;  1HA5 A;  4A3J H;  5FK9 C;  1Q82 C;  3KUP A;  4MTN A;  5ELC A;  4DUY L;  4DNI A;  2EY2 A;  5M5W B;  1E2V A;  4A4I A;  2EYF A;  1N9W A;  2PO4 A;  3CRK C;  1KD1 C;  1FGB D;  3QO2 A;  3QR8 A;  4IQZ A;  4B3T L;  1PRT D;  4CJ0 B;  4A3E H;  5G3L D;  2RDH A;  3KDF A;  4C3I H;  3IAY A;  3D4W A;  4GNX B;  1PLF A;  2NVY H;  4GLA C;  1RDP D;  1EU3 A;  1SSO A;  4UP9 A;  4JPB W;  3DMU A;  3RZD H;  4LF6 L;  1LTA D;  1WJJ A;  2F0W A;  1JB7 A;  1VQG A;  3SK6 A;  2I5M X;  2PMZ E;  3J80 E;  3TS2 A;  1K8G A;  2ZTD A;  5E7N A;  5DM6 3;  1I6H B;  2N49 A;  2A1A A;  3KLS X;  2A69 C;  2UXD L;  1IKM A;  2QF7 A;  2VQF Q;  2JA7 H;  1GUS A;  1OXU A;  1OO9 B;  3S16 H;  5M3F G;  3RLO A;  4RGM A;  1F77 A;  2JA5 G;  3W5O A;  4A3J G;  5LMU L;  2VUM B;  4A3I H;  4A3F G;  3QG1 A;  5CBE E;  1WTW A;  1YJ9 A;  2ZJP A;  3S14 B;  5C44 G;  1X54 A;  2UUC Q;  4BBS H;  3A56 A;  2RDF A;  4PZ8 A;  5CV7 A;  2K5N A;  5IGC A;  4FO2 A;  1JWS D;  4WFN 3;  3EVQ A;  1QNK A;  4A3D B;  4HR7 B;  2Q8T A;  1NSN S;  1SFO B;  3VYT A;  1A62 A;  3GDE A;  5KEE A;  1HNX L;  1MJE A;  3CME A;  2RA4 A;  4MN3 A;  3W1B A;  3H6M A;  3HOX H;  2PCF B;  3J80 i;  1PH4 A;  1NMG A;  2PZW A;  4GN5 A;  2NYZ D;  1HR0 L;  3S17 B;  1KAB A;  4C3J G;  1VQC A;  1OXS C;  5C4X B;  4OO1 H;  1IBL L;  3P1H A;  4RAU C;  2IT1 A;  1H95 A;  4YCW A;  1I5F A;  5C44 H;  1GHK A;  1QJO A;  4PMB A;  4GNX A;  4KI0 A;  1A3U A;  3PO3 H;  4L5Q A;  1Y8O B;  3CC2 A;  4JOI A;  1QVG A;  2G9H D;  1RHP A;  1JWU D;  3PF5 A;  3ZJY C;  1M1K C;  1A6X A;  1BBW A;  4IAL A;  3F2U A;  2EYJ A;  5I6W A;  1KNE A;  1XMQ Q;  1AE2 A;  1ENF A;  2B3G A;  4LW1 A;  3Q22 A;  5AJ3 L;  3I2Z A;  3HOX G;  3H0G B;  4QMG A;  4QGU A;  2E2J H;  4IUT A;  2YTY A;  1VQ6 A;  1PH1 A;  3V05 A;  1LT6 D;  1NTG A;  4PG3 A;  2A69 D;  3FVQ A;  4UHV A;  4QB4 A;  4JI6 Q;  1N34 L;  3E0E A;  1EYC A;  1BOS A;  2EYM A;  4ZRZ A;  4FVM A;  1UE7 A;  4DR2 Q;  2F0V A;  3RZD B;  4JI1 Q;  4JOI C;  3H0G H;  3HOY B;  2WKD A;  1FJG Q;  3NQI A;  2KCM A;  1RJT A;  2Z6K A;  1K28 A;  4UP8 A;  3DXJ C;  3MFY A;  2VNU D;  5EPL A;  1WTO A;  2QDB A;  3T56 B;  5GAG C;  3M4O H;  4A3B H;  2HDM A;  1CM9 A;  3DWP A;  3FP9 A;  5KIX A;  1CKN B;  3E3X A;  3KF8 A;  4CKC A;  1J5E L;  2L5T A;  2C5C A;  3K58 A;  1BXT A;  3MA2 B;  4OWW B;  3CW2 C;  3GTK H;  4DV0 Q;  5E4W C;  3IRB A;  1CFM A;  2WAQ E;  1LAC A;  2CKZ B;  2H5X A;  2K32 A;  4J8Q A;  3H91 A;  3D31 A;  2I5L X;  1VQP A;  5CMD A;  3I4N H;  3S1N B;  4Y52 H;  4DKA C;  1WTP A;  4LFB L;  2FFK B;  4DAY B;  2Z1C A;  3UDG A;  1I4X A;  4PZ6 A;  1PRT C;  1QOH A;  2MO1 A;  2LSS A;  1GUG A;  1HFN A;  1XPO A;  1B44 D;  1VCI A;  3A7L A;  3FEW X;  1JJ2 A;  5TSS A;  2XWJ B;  1H9S A;  4A3B B;  2R7Z B;  3JAM L;  3HZX A;  2OXP A;  3CCM A;  4IFD G;  2L0C A;  5DAU A;  3TBI B;  3S14 H;  3HP3 A;  3PO3 B;  3HGB A;  2GA4 B;  1TVX A;  2E2H H;  2DUD A;  1OXV A;  3H0G G;  4DV4 Q;  4LWC A;  4QCL A;  4IFD H;  2GN5 A;  3A74 A;  4TQU S;  1Z9F A;  4JI5 Q;  4MNO A;  1M90 C;  2VZA A;  3GTM B;  4JI4 L;  3MZ5 A;  2CQA A;  1SYF A;  1P16 A;  1ILQ A;  5DM7 3;  2MNA A;  5IWA Q;  4A3C G;  4MZ9 A;  4IUV A;  4C3H G;  4GKK L;  2VL6 A;  1V9P A;  2D0P A;  4AQY L;  3G6J B;  2PQE A;  3HKZ G;  1SND A;  3NQT A;  4DR7 Q;  3GV6 A;  3GV3 A;  2F0S A;  3NE5 B;  4HJA A;  2RCN A;  2QA4 A;  2NVQ B;  2Z4H A;  3U9O A;  2O4X A;  4C3H H;  2F0N A;  1VQ5 A;  1YJW A;  3I70 A;  3J7Z C;  2XTI A;  3OW2 A;  3T53 B;  3I91 A;  5C3E B;  1XWE A;  1EOV A;  4XXE A;  1WCM H;  3MXN A;  1LT5 D;  1C9O A;  1ONL A;  2JXM B;  2A73 B;  3HOW B;  1I4G A;  5EJW A;  5I4D A;  3AQQ A;  2MJ8 A;  3KOJ A;  3KFU A;  1EY9 A;  3O13 A;  4S3S A;  1HCZ A;  1I50 B;  4IJL A;  1AH9 A;  2AQ2 B;  1ESF A;  1V8Q A;  1YNX A;  3OPO A;  1ET9 A;  5C3E H;  1TS4 A;  4QIW E;  3JC6 6;  1GUT A;  1A2T A;  3BVG A;  4JV5 Q;  1BR9 A;  4DR7 L;  1XNQ Q;  5JEA G;  4HIO A;  2PZT A;  1DXM A;  1O7I A;  4JCV E;  3QOL A;  1VF7 A;  1N36 L;  1A3T A;  5C0X H;  2O5J C;  4IPH A;  5IP7 G;  3HOY H;  5LL6 X;  5C3W A;  1STE A;  3B6Y A;  3VR5 A;  4LF8 L;  4I7A A;  2X69 A;  1PRT F;  1LV9 A;  1B8A A;  2O2L D;  4JI8 L;  1WCM B;  1JOQ A;  1B3A A;  5D3D A;  4F87 A;  1KLU D;  4AYB E;  2EPB A;  2R3Z A;  5BN3 A;  1II3 A;  4FP5 D;  3R2I A;  1XNR L;  4H0L C;  2HCC A;  1S5E D;  4KD4 A;  5IT9 E;  1HR0 Q;  1YEZ A;  2AHO B;  1W6J A;  1WTX A;  1NJI C;  1IBM Q;  2IX3 A;  3BJU A;  4BA1 I;  3RZO B;  2XNA C;  2LXJ A;  4K5W A;  4BWG B;  2RHS B;  1WTR A;  4DUZ L;  4JI0 L;  4HAE A;  5ELO A;  2EJM A;  4DK6 C;  2AWN A;  4JG2 A;  5E3F A;  4EX5 A;  2MHV A;  5EGT A;  3T4A C;  1FR3 A;  3K7U C;  2YTX A;  1YZ6 A;  2E76 C;  4I7Z C;  1X9N A;  5T1I A;  2QW7 A;  3CC7 A;  2NZ1 D;  4YWM A;  4DV6 L;  1XMQ L;  1D1K A;  2WIN B;  1BCP D;  4KKT A;  1QUQ A;  3LGJ A;  1SE3 A;  1SE8 A;  1YNJ D;  4B3R L;  1ZEQ X;  3NEN A;  3VDY A;  3HOV G;  2Q8I B;  5A35 A;  2A19 A;  5C3E G;  3EFX D;  1SYE A;  4GS3 A;  5IP9 H;  1I94 L;  1L1O B;  2R61 A;  1W2B A;  2NWG A;  4X3K A;  3EJI A;  2JN4 A;  2Q8R E;  2KCT A;  1G6P A;  4DR2 L;  3PUZ A;  3PO3 G;  3T16 A;  3M4Y A;  2CHB D;  2F1M A;  1PFB A;  3FPU B;  1D5Z C;  1ENA A;  1HZC A;  4RA8 A;  1A63 A;  3TSS A;  4P72 A;  1TQO A;  3ULP A;  3F2B A;  4IPD A;  1NE3 A;  2EIF A;  3AFQ A;  3HOU G;  2Z0S A;  1DCZ A;  4YIJ A;  3OTO Q;  1R9T H;  3MEF A;  5KNB A;  1ET6 A;  4DV2 L;  4A75 A;  2K04 A;  1KNA A;  3I72 A;  1LO5 D;  1QUQ B;  1X3G A;  4U67 3;  4BY7 H;  2JA7 B;  3HKZ B;  1L0X B;  3FMC A;  2ES2 A;  4XIG S;  1STH A;  3BVM A;  3CKI B;  1VDZ A;  2VUM H;  4ZYS A;  3M7N A;  1E1O A;  2R93 B;  2RCF A;  3TEH B;  4ZCK A;  4JBM A;  2F3V A;  4FF2 A;  4JI7 L;  1F9S A;  4KHP L;  4WRD A;  3NK9 A;  3U4V A;  2AUK A;  1GUN A;  1QCB D;  1Q86 C;  1EY5 A;  4ILW A;  3DUZ A;  3KBG A;  2ZT9 C;  1N8R C;  2WAC A;  4A3I G;  1TT2 A;  3FKI B;  5E4X A;  1MBY A;  5IT9 L;  4LF9 Q;  5AFW A;  4QUF A;  1K3R A;  1O7Y A;  4NW2 A;  1GUO A;  2SOB A;  3A0J A;  4JYA Q;  4JI2 L;  1WD1 A;  4YCV A;  1WYD A;  5LMN W;  1EIY B;  2L12 A;  1B3Q A;  3S2H B;  2I0Q A;  1CKO A;  2I46 A;  5M5Y H;  2JA6 B;  3RUZ A;  4A3M H;  4DR5 Q;  3PIO 3;  3A5Z B;  4OIJ A;  5IGE A;  5HUR A;  3V2T A;  2EJF C;  4DUZ Q;  5I9O A;  2F0Q A;  3FDT A;  1LTI D;  4P2C B;  1CI3 M;  1VS0 A;  1EEF D;  2PQA B;  4KV6 A;  4ZK9 B;  2IHF A;  2ICI A;  4DAP A;  3HOZ B;  2ENB A;  4PQX A;  3CQZ B;  4JK1 C;  2IX1 A;  2XGT A;  1Q81 C;  4DV6 Q;  1PXU A;  4WJW A;  2K50 A;  5LHY 1;  1QZH A;  1DD2 A;  1MD2 D;  3ULJ A;  2F52 A;  4QF4 A;  4K2K A;  1E7Z A;  1YI2 A;  2A6H C;  1J5E Q;  2E2J B;  3VYR A;  4LMQ D;  4DV5 Q;  5J22 A;  2RBM A;  1Z6H A;  2HHH Q;  3K80 C;  5FO8 B;  2MFI A;  1U4P A;  3H94 A;  3L0O A;  5CBA E;  4Y7N B;  2BDN A;  2A5H A;  3J7A V;  3ONA B;  4IPC A;  1HA6 A;  3M7G A;  1JMC A;  3S1R H;  1EY7 A;  3MXG A;  4HSV A;  1A15 A;  1SYG A;  2K14 A;  1EYA A;  3L2P A;  3CAM A;  3W1G A;  4RWS C;  4K14 A;  2ATW A;  2MGS A;  2QKI C;  2CWA A;  5F2D A;  1K8O A;  4G7H C;  4DK3 C;  2FMC A;  3A54 A;  4DF7 A;  1F2Y A;  5JVG 3;  1KXL A;  1XNQ L;  4DR3 Q;  2L11 A;  2C35 B;  2EY6 A;  3OWF A;  4A3I B;  1E22 A;  3A8K E;  3PF4 A;  2NVX B;  1QIL A;  1AZQ A;  1BNZ A;  1UE6 A;  5KYI A;  1D5M C;  3C3L A;  3BYY B;  4JW0 A;  5CV4 A;  3FRP B;  1S5D D;  5IP7 H;  4JI7 Q;  4KHP Q;  3HG9 A;  2OF1 A;  4LF8 Q;  3GD7 A;  1PH9 A;  4JI5 L;  1CA6 A;  3TZD A;  2OCE A;  2JA6 G;  1XTD A;  4HJ7 A;  1ML0 D;  1LTG D;  4R9W A;  4ZKB B;  2NVX H;  1L0Y B;  4C1N K;  4KHZ A;  1XNR Q;  3HOU B;  3M4P A;  1JT8 A;  2F0D A;  2RSO A;  3S2H H;  3VR4 A;  4R1J A;  4X62 L;  1V1Q A;  2K33 A;  2NZO A;  2FXQ A;  4UPA A;  1B70 B;  4DA2 A;  5HGQ A;  2HQE A;  4DN4 M;  4HED A;  3ERS X;  4GNX C;  4X6A H;  1N32 L;  3KJO A;  1GO3 E;  1W3S A;  4NP5 A;  2F0U A;  4DV7 Q;  1I4R A;  3GTG B;  5JJL A;  3OMC A;  2R93 G;  4HMI A;  4RGN A;  3KLS A;  5FLM G;  3OOC A;  5M3M G;  5K5P A;  2ZTC A;  5LMU Q;  1CZW A;  3U4Z A;  2IJ0 A;  4LNQ A;  1RKN A;  5JJI A;  4A93 G;  1DM0 B;  1LTS D;  4G57 A;  4LUO A;  4LJZ C;  4L63 B;  5ELD A;  2EVB A;  2EZV A;  2AQ1 B;  5CV8 A;  4B9X A;  1TY2 A;  3GTQ B;  2R6G A;  1RIP A;  1STN A;  2TSS A;  4DR1 L;  1KIX A;  3MFG A;  2JA6 H;  4L6T B;  1HNW L;  3WDN A;  5C4H A;  5DNF A;  2K4K A;  3AB9 A;  3EIV A;  2ZM6 Q;  1O7Z A;  1V1P B;  1N36 Q;  3ZYY X;  3PIP A;  4LUV A;  2HHH L;  2K5Q A;  1GKH A;  1PTO B;  1XMO L;  1TKW B;  1FVI A;  5FLX c;  2N3S A;  3STB D;  4LFC L;  3LNN A;  1Y1V B;  3D4R A;  1PTO C;  4X65 Q;  5BR8 L;  3K5L A;  1TWH H;  1KDC A;  2E2I B;  1EIF A;  1IBL Q;  5EPK A;  4OO1 G;  2PNR C;  1PFN A;  1SNM A;  3QJY A;  4YY3 L;  1IW7 D;  4BA2 I;  2BE5 D;  3R3O A;  4YWK A;  5I2X A;  1X65 A;  3NWS A;  3BVZ A;  3J7A F;  4RKL A;  2BDO A;  1Y1W B;  3D6W A;  4JVZ A;  3TQY A;  5IYB G;  1SE2 A;  3J7A 5;  4GOP A;  2LKV A;  4NMZ A;  2EY1 A;  2WAQ B;  1GJX A;  1LT3 D;  2JJQ A;  2JK8 A;  5KRU A;  4IUN A;  3TRE A;  2D9U A;  3MXN B;  1CSP A;  3NBH B;  1AE3 A;  2FMM A;  3I7F A;  5CYU A;  2NVY B;  3KF6 B;  4TRD A;  2MQH A;  2K5W A;  1VQN A;  3R8B A;  1I3Q H;  1FD7 D;  4O0A A;  3K0Y A;  2F0T A;  1TWF H;  3EA6 A;  4BXX H;  4GKJ L;  1RTN A;  2RDG A;  3IL8 A;  4OWT B;  5JJK A;  1NR2 A;  1D1I A;  2J4X A;  2K52 A;  1EEI D;  4A3C H;  1IYU A;  4N9T A;  2A68 D;  3J81 j;  4DR5 L;  2SNS A;  1YIT A;  3WWV A;  2Z8L A;  3KF6 A;  5JPN C;  1BUV T;  1TR5 A;  1QG7 A;  4H13 C;  2PW7 A;  2PPB C;  2IL8 A;  2GVA A;  4A3E G;  4BBR G;  1NBW A;  1KQS A;  1HUN A;  3PUX A;  1JOK A;  3NTK A;  4DXG A;  2RHQ B;  2SNM A;  5KYL A;  5C0X I;  1PYB A;  2KHJ A;  4KN4 C;  2FJ2 A;  2JEB I;  3NEM A;  3U50 C;  3GTM H;  2IW3 A;  3IKJ A;  4ME3 A;  4X66 Q;  1ESR A;  1EY8 A;  4O42 A;  4CDD C;  4BY1 H;  1NR4 A;  1HZ9 A;  5M5W H;  3KLR A;  3DLL A;  3MXU A;  2OEO A;  3OYY A;  5IIF A;  3BZK A;  4EQP A;  3G4S A;  1M8A A;  4IN3 A;  5JAV A;  1U5K A;  2HQL A;  4V0B A;  4XTC S;  3MHB A;  2UXC Q;  3G7L A;  3S1N H;  1Y1V G;  2AKW B;  1GHJ A;  2JA8 H;  1LTL A;  2CW0 C;  1A8V A;  1O80 A;  1UAP A;  3CU7 A;  1JE4 A;  5CV6 A;  4UP7 A;  3A55 A;  3UDI A;  2OTL A;  4BBS G;  4OL7 A;  2ALY B;  4JBW A;  1E2W A;  4PMW A;  4K8J A;  5FJ8 G;  5M9O A;  4A3D H;  5M3M B;  5JVH 3;  2B39 A;  1JB3 A;  1HR0 W;  5IYD H;  4JI3 Q;  4BY7 G;  4MIU A;  4LFC Q;  1X3F A;  1SBB B;  4B3M L;  5CR3 A;  1NCV A;  4X65 L;  3D4D A;  4A93 B;  2A8V A;  1TII D;  2N88 A;  4JI2 Q;  3GTG H;  4BXX G;  1CTM A;  2A6E D;  2F0F A;  3AYH B;  1ZYR D;  4F8M A;  1Y69 U;  4DXF A;  4FYD A;  1TS5 A;  4OIK A;  1SMX A;  4XQN A;  4RG1 A;  4A3B G;  3VR2 A;  4H44 C;  1AW7 A;  1ENC A;  2Y0S B;  2UXC L;  4A3M G;  1GM5 A;  3PCO B;  3UE1 A;  1SFO H;  1AN8 A;  5IWA L;  1IL2 A;  2JP1 A;  2LFN A;  4A93 H;  4A3L H;  3S1M H;  4DAM A;  1YBY A;  5IGG A;  3NXW A;  1K3B C;  2K03 A;  4NDX A;  4L8J A;  1XX8 A;  2MPM A;  3E9H A;  3VA5 A;  4F7X A;  2B2V A;  3D6C A;  3MC0 B;  4C3H B;  1HNX Q;  4GKJ Q;  2K5D A;  1G91 A;  1LTR D;  2ZTE A;  1Y1W H;  5T1G A;  4DV5 L;  1PA6 A;  1SAP A;  1IL8 A;  1ILP A;  1JC7 A;  5IGD A;  3P7J A;  4EGV A;  4RGT A;  4FXG C;  2FHT A;  2WAQ G;  5IYC G;  3S1Q B;  4GN3 B;  5ELF A;  3CCR A;  2CCZ A;  4KJO A;  4DNR B;  4K0K L;  3KLW A;  1SDF A;  1I50 H;  4FF4 A;  3NP8 A;  3OIQ A;  4X3U A;  2EYH A;  4CGY B;  2XN9 C;  1EYD A;  1Q8K A;  2NTS A;  4JBK A;  2KHS A;  3I3C A;  4R4C A;  1S40 A;  1UE5 A;  3S2D B;  3H3V I;  1DJR D;  1TWH B;  2HIV A;  1UEB A;  4J6H A;  4UDU C;  4XT1 B;  3F8T A;  4DAV A;  3C46 A;  2RQX A;  1FL0 A;  1LUZ A;  1BBU A;  3M3Y H;  1C8C A;  1CSQ A;  2HIX A;  3VR6 A;  2OTJ A;  1EU4 A;  4IFD I;  4YWL A;  5LMN L;  2KVM A;  1IW7 C;  3Q0A A;  5IOC A;  1U9R A;  1VQF A;  1IBK Q;  5J3B A;  1HZB A;  2QDL A;  3A8I E;  2E5L Q;  3R93 A;  3AU7 A;  2KBN A;  4FF1 A;  4GKK Q;  2EOT A;  1S4Z A;  5EQ0 A;  1PTO D;  4LF7 L;  3MWY W;  3UI2 A;  4A3E B;  1RTO A;  3NTI A;  1DON A;  1CKN A;  1KAW A;  3KF8 B;  1UWV A;  4CDE C;  4E6I A;  1QB5 D;  2VW9 A;  3I4N B;  2SDF A;  3M4O B;  1PFM A;  1QWY A;  3E0J A;  2CQO A;  4LAA A;  2HT1 A;  1RF2 D;  1A3V A;  1G29 1;  4A3J B;  1WCM G;  3CF5 A;  1BVS A;  4APV A;  3S1R B;  1PYW D;  4XYQ A;  1VQ4 A;  5HY6 A;  5CV5 A;  3KK7 A;  2F4V L;  2WP8 J;  1EZ8 A;  4FXD A;  3BDL A;  1H9M A;  1DGS A;  4M8A A;  1RL2 A;  2NZH A;  5GAE C;  1YJN A;  1W6K A;  4L5S A;  4EQ5 A;  3CHB D;  3FPP A;  3J7Y W;  4A3F H;  3IFD A;  2EE1 A;  1NNX A;  3FHW A;  4PZ7 A;  3QB3 A;  3VA7 A;  1Q12 A;  4BBS B;  2NTT A;  3K5O A;  3I55 A;  1S5F D;  5C0X G;  1D6E C;  4ZUJ A;  2AUJ D;  1SYC A;  1FYC A;  3WOE A;  5GRO A;  4G4K A;  3UE0 A;  2ASB A;  1KDB A;  2KOL A;  1EQT A;  2M2L A;  2R7F A;  3T13 A;  4L5R C;  1CHP D;  3TRZ A;  3CCQ A;  1B9N A;  1HHV A;  1TS2 A;  2KQ3 A;  3I4M B;  3S24 A;  2X6L A;  5DLQ E;  1G8Z D;  2VUM G;  4LF5 L;  2UXD Q;  2OT2 A;  1I4H A;  4A3F B;  1RCV D;  4OWX B;  2MO0 A;  1YNN D;  3J81 i;  5C44 B;  1N34 Q;  1MHW C;  2K28 A;  4TKO B;  3U9S A;  3HOX B;  3GTQ H;  1G6Z A;  3T1H L;  5BR8 Q;  1D5X C;  1DOL A;  3L9A X;  4ZAI A;  3RLF A;  3T51 B;  2NVT H;  4POF A;  1WTQ A;  2CW0 D;  1K83 H;  3TZU A;  3OW7 A;  4DAY A;  4RKB A;  2NUC A;  2KA7 A;  1LLR D;  1EUJ A;  2CWP A;  4J15 A;  3I4N G;  4RHS A;  3CC4 A;  2VQE L;  1SMY C;  2JA7 G;  4AH6 A;  1XPR A;  2KJX A;  4IUQ A;  5GAD C;  4ZQ3 A;  4C3J B;  1SRO A;  3GTL H;  1VQI A;  2F0H A;  2B8G A;  1CQF A;  4K6L A;  3VR3 A;  4R8I A;  3I56 A;  2WB1 G;  2B2T A;  1B9M A;  2QGQ A;  4LFA L;  1C48 A;  1T9H A;  1EQQ A;  5FLM H;  2KCC A;  2EYO A;  4OON A;  4JI3 L;  4UY8 C;  1D2B A;  4DUY Q;  2A6E C;  2F0G A;  4B3M Q;  1EL0 A;  1QVC A;  1TWF B;  3GTO H;  5LL6 S;  3HS0 C;  5G3L F;  2R92 G;  1VMC A;  4LF4 Q;  4HID A;  1SN8 A;  3PIP 3;  4RFB A;  5JEA H;  3GTL B;  3SDZ A;  4XQJ A;  2YYZ A;  2E8G A;  5IY0 A;  5JPM C;  1L0W A;  3HEJ A;  1YHA A;  3BDO A;  1H9K A;  1KTK A;  2VQE Q;  4IUR A;  1HH2 P;  3NBH A;  3RMH A;  3CCJ A;  1VMP A;  2F0O A;  2KEN A;  3OTO L;  1WTV A;  2VQF L;  4G7Z C;  1F9P A;  2F0P A;  4A3L G;  3X3N A;  5CV9 A;  4C3I B;  2EQS A;  1VQL A;  3OIP A;  2ZJQ A;  4GLX A;  3I4M G;  4DV1 Q;  2JSO A;  5FOB B;  2IY5 B;  2PYK A;  4ULL A;  1ICF B;  3BZC A;  4OHJ A;  4PNY A;  3HOU H;  5GQO A;  4CDC C;  2WFW A;  5CGK A;  1DOK A;  1BKB A;  4JI4 Q;  1PDQ A;  1C7Y A;  1XTC D;  2D0O A;  4TVA B;  1WVL A;  2XRS D;  5A2Q E;  2K5V A;  2R7Z H;  2B2W A;  4HCS A;  1TWA B;  2DJG C;  5BN4 A;  3PO2 H;  4CBV A;  2F0M A;  1QVF A;  1KC8 C;  4JYA L;  1IBM L;  3CCV A;  1V1P A;  2DNC A;  2I5H A;  2BA1 A;  1V43 A;  2ZXP A;  2CVR A;  2VB2 X;  2ZXO A;  3SK4 A;  1UNS A;  3F2C A;  5M3M H;  4POG A;  4DNT B;  4IJH A;  1EOT A;  3LWU A;  4ALP A;  2UUB L;  2DY7 A;  3T1H Q;  2Z4I A;  5KGU A;  3NEL A;  3PGZ A;  2O5I C;  3M9B A;  3L3O C;  3G6E A;  1O78 A;  4BY1 B;  2WB1 B;  3ER0 A;  1YVC A;  2XSC A;  2RKS A;  1IBK L;  4X64 L;  1UE1 A;  2AQ3 B;  2BOS A;  2YV5 A;  2DGY A;  1VQD A;  3GO5 A;  4MHE A;  5IYD G;  3OHX C;  4P71 A;  5ELN A;  1Z7T A;  2L55 A;  2D5D A;  1CT1 D;  3Q6S A;  5I2Y A;  4G7O C;  4R4I A;  1OTC A;  1PH8 A;  1AP0 A;  1LYL A;  3CPW A;  1I4P A;  3P20 A;  1JOR A;  1Y14 B;  3S15 H;  4B08 A;  3H3V C;  1KL9 A;  1SMY D;  1KHI A;  2CH4 A;  2HDL A;  5DEH A;  2BE5 C;  2JE6 I;  3QWN A;  1HQR D;  1ZYR C;  2B2W C;  3TN2 A;  5I9P A;  3GTP B;  2J0T D;  1STY A;  4K5V A;  1F2Z A;  3NBI A;  3NSW A;  4RCN A;  3RD4 A;  1FNW A;  1EQR A;  4C3I G;  3KDF B;  1STB A;  1BCP B;  3GTJ H;  2B63 H;  1FJG L;  3BS1 A;  1YNN C;  5ELB A;  2HUG A;  4X64 Q;  4OEM B;  2EDG A;  1JQY D;  3K8A A;  3PO2 G;  1PMR A;  2AMC B;  1HRJ A;  5FO9 B;  1J9O A;  3ERQ A;  1VQM A;  1IYJ B;  2V1C C;  3HOV H;  1Q3L A;  4RCO A;  4DK0 A;  1H9S B;  2KEE A;  1VQJ A;  2K7V A;  2VY3 A;  1HNW Q;  4TSS A;  2EXD A;  2ZM6 L;  4IO9 A;  2QEJ C;  1F2M A;  5IGB A;  4DV1 L;  1X56 A;  3GP7 A;  4X3S A;  2BH2 A;  3SXH A;  5FLX E;  1H9J A;  1SLJ A;  2B2V C;  3ITP A;  1KRS A;  3RN2 A;  4FNF A;  2M9V A;  3CMA A;  4B3R Q;  1WI5 A;  3M4Q A;  3DM3 A;  1E0B A;  1JOO A;  4KK7 A;  1PH6 A;  1MSH A;  2J7Z A;  1IHZ A;  5KND A;  2OQK A;  3S2D H;  3NWT A;  4CKE A;  3AMU A;  1XJV A;  3K6O A;  1GVP A;  3NPP A;  4A3G G;  1K0S A;  1K8A C;  3UDF A;  3M3Y B;  3K57 A;  4OO1 I;  1CKM A;  3M85 A;  4RMF A;  4JV5 L;  4C56 C;  1E24 A;  4IPG A;  2A68 C;  1N32 Q;  2N8N A;  5C0X J;  3PIO A;  5I6Y A;  3T1Y L;  3MXP A;  3TP5 A;  2E74 C;  3CPF A;  1SE4 A;  4HJ9 A;  3MTS A;  3X3M A;  1B4O A;  2NN6 H;  4DR6 Q;  1L1O A;  4M1U B;  4ID6 A;  4CJ2 C;  4LUZ A;  4HJ8 A;  1EY4 A;  2Q2H A;  4IUP A;  3CXC A;  5EBD A;  5EPJ A;  1Y1W G;  1Y8P B;  5EKK A;  2GVB A;  2R92 H;  1EWH A;  5C5L A;  1I3Q B;  4K5X A;  5EKI A;  2F0E A;  2YTV A;  3A8J E;  3EBE A;  1QNU A;  4KD3 A;  1ICW A;  3K7A B;  2NN6 I;  4O2D A;  1MJC A;  1S3O A;  1IZ6 A;  1V1O A;  1QE6 A;  5COY A;  4XDX A;  1X3P A;  2K5H A;  1KAA A;  1U4M A;  2DJF C;  2JA8 B;  3SR1 A;  1HUM A;  1R4Q B;  2H4O A;  2B2Y A;  3DEO A;  1CA5 A;  3PO2 B;  3G71 A;  4DR4 Q;  3NUC A;  3E5S A;  5D3I B;  5A2Q L;  4LF9 L;  4K2L A;  4QUC A;  3TP8 A;  3K5M A;  1HTL D;  4P74 A;  1PZI D;  3DHQ A;  3DEP A;  1TWA H;  1TWG B;  3W3A A;  3I4O A;  4DV3 Q;  3D8G A;  3VYU A;  1OXT A;  3HKS A;  1B2T A;  1R9T B;  3AFP A;  4IOC A;  2PQA A;  1I94 Q;  1Y1V H;  3BYT B;  2VB3 X;  1X32 A;  4R4Q A;  3K5N A;  3I4L A;  2D2C C;  4YHH Q;  1TY0 A;  3LX0 A;  2RVL A;  1O7L A;  2X6G A;  3PQI A;  4KY6 A;  5C4J B;  1YHQ A;  4FXK C;  3C1E A;  1ZKO A;  3CP0 A;  1GXD C;  1VQB A;  2HCI A;  3SGI A;  2NVQ H;  2CFM A;  4EQN A;  4PV1 C;  2BA0 A;  4AIM A;  3DWQ A;  1HXY D;  2K1B A;  4JI8 Q;  4R4O A;  1EIG A;  1HTP A;  5EAY A;  2RF4 A;  5AJ3 Q;  1PZK D;  2ID0 A;  2P5Z X;  2BH8 A;  4A76 A;  4RHR A;  3S17 H;  3SVM A;  5CC4 A;  1CQV A;  1IYV A;  1PZJ D;  3F1Z A;  1LTT D;  4WJ4 A;  1SRU A;  1YHB A;  2K05 A;  3PUW A;  3TME A;  4CDF C;  4N9P A;  4DK1 A;  2UUB Q;  2XIW A;  2QEX A;  4GOP C;  4DU9 A;  2NB0 A;  2FIN B;  1DZ1 A;  4ME5 A;  5J39 A;  1BO0 A;  4LF4 L;  5M5Y B;  4JBJ A;  1I4Q A;  2V4D A;  2KEC A;  3FKI G;  3P75 A;  4UAI A;  2H1E A;  4ZKC B;  5M5X H;  1VF5 C;  1C0A A;  1EZ6 A;  4DR6 L;  2LS0 1;  2UU9 L;  1RD9 D;  2Q2U A;  1PH7 A;  2JA9 A;  1X3Q A;  4O1N A;  3S1M B;  5IE8 A;  1F2L A;  3PV0 A;  1ZXT A;  2N78 A;  1M4V A;  5EKL A;  3SHL A;  1TS3 A;  3V96 A;  2YU9 H;  4LK1 C;  3RZO H;  4HMJ A;  4ODG A;  3NTH A;  4YCU A;  2F03 A;  2KED A;  2F3I A;  2E75 C;  2BCO A;  2IHE A;  2XRQ D;  3RR5 A;  2F0I A;  4B9W A;  4A3G B;  4V19 0;  3HOW H;  1WTH A;  2VS1 A;  1NAP A;  2EY5 A;  1EY6 A;  1U4L A;  3OWE B;  5C6A A;  2C9O A;  3HOZ G;  3TDQ A;  2UUA Q;  4ABN A;  1EIH A;  1B1Z A;  1GUW A;  2R7Z G;  2LXK A;  2N55 A;  5FKA C;  1VQO A;  4LFB Q;  3A7A B;  4HIM A;  4K0K Q;  3PMF A;  3S1Q H;  1U0L A;  3SEB A;  1OXX K;  5NUC A;  4ZUI A;  4N8F A;  4MTK A;  2EYL A;  4FF3 A;  4YY3 Q;  1STG A;  1Y8N B;  1NUC A;  2UXB L;  1NY4 A;  4Z9C B;  2LY7 A;  4BBR H;  3G48 A;  3MEH A;  4KY5 A;  1KDA A;  1K73 C;  1J6Q A;  1BBX C;  1Q1B A;  1PRT B;  1IXR A;  1VQH A;  2PZU A;  4IUU A;  5JOB A;  3MAQ A;  4C2M B;  4QJF A;  1LM0 A;  4KMU C;  1Q7Y C;  4EQO A;  1S5B D;  5C4J H;  2E5L L;  3Q23 A;  1AFP A;  4U68 A;  4OX9 Q;  4NKL A;  2JA8 G;  2F0K A;  1QZG A;  2UUA L;  4YHH L;  4GOP B;  3J81 L;  1XYI A;  4NXN L;  1PVO A;  1GD7 A;  3MVV A;  1STA A;  4XQQ A;  3S16 B;  4AQY Q;  1PH2 A;  2L15 A;  3L7Z C;  4KN7 C;  4DR1 Q;  4HIK A;  1CHQ D;  1Q8I A;  3BZD B;  2IWH A;  3HOW G;  1VQK A;  2ZJR A;  3RN5 A;  2MUY A;  4PMC A;  2F0L A;  1KRT A;  1EFI D;  1JJC B;  4DR3 L;  1SYD A;  2E2H B;  4IFD J;  2JEA I;  3DWA A;  4HN7 A;  1H9R A;  1JE5 A;  5M5X B;  2WV6 D;  1K0R A;  4GLV B;  1E2Z A;  1FNV A;  4P73 A;  2JA5 H;  5HGT A;  1G51 A;  1WD0 A;  1SNQ A;  3CCS A;  3EN2 A;  5C4X H;  1I6V C;  3ERO A;  2LMC B;  3A5U A;  2HD3 A;  1JJG A;  4R8N A;  1VQ7 A;  4NXN Q;  5ELE A;  4CHT B;  2Y0S E;  2Z6K C;  3BDC A;  1LTB D;  3QIA A;  4IZ8 A;  3H3V H;  1CK1 A;  5IYC H;  3ICE A;  3I90 A;  5KNC A;  3ULL A;  3JAM i;  3UDX A;  1B50 A;  1C4Q A;  1N33 L;  1T5X D;  1EQV A;  2A74 C;  2B8F A;  1J8I A;  1Q90 A;  1DYQ A;  2B29 A;  1ROD A;  2RSN A;  4N8X 1;  2QIL A;  4H7B A;  4KY7 A;  1E1T A;  1EWI A;  1G2T A;  2QCP X;  2D62 A;  5E1F A;  1LT4 D;  5COR A;  2DNE A;  3I73 A;  1A0I A;  3CQZ H;  1WOC A;  2IX0 A;  3GQB A;  5C5M A;  3I4M H;  4DR4 L;  2I07 B;  4WJ3 M;  4F88 A;  4C3J H;  3IFT A;  1ASZ A;  3TP7 A;  3SE0 A;  4GN4 B;  1PH3 A;  2DY8 A;  1PTO H;  2CH4 W;  2ZXR A;  3TS0 A;  3SK5 A;  4A3K H;  1UEA B;  2VXW A;  1F9Q A;  2MP1 A;  2Z6B A;  4XYO A;  5K36 G;  3PUV A;  4DV2 Q;  2UXB Q;  1PTO F;  4K8I A;  3JAM c;  4DV3 L;  2F4V Q;  3N52 A;  1VQE A;  4EVO A;  1BCP F;  1K83 B;  3J81 c;  1N33 Q;  2B2U C;  2K75 A;  4JI0 Q;  2B63 G;  1R4P B;  4Y7N H;  2WKC A;  3T1Y Q;  1SYB A;  4K6D A;  1TXY A;  2PW5 A;  4QY7 A;  3HOV B;  4WOR A;  1D8L A;  3STB C;  2F4I A;  2L9H A;  4NB3 A;  5D65 A;  3HFZ B;  1PH5 A;  4FDB A;  1HPC A;  4KHV A;  2NN6 G;  3KJP A;  2PMZ B;  4JI6 L;  3CRL C;  5BN5 A;  1X55 A;  3KBX A;  2R7D A;  2UUC L;  1B53 A;  1S5C D;  1SJH D;  3CCE A;  1EFW A;  2PI2 E;  3K81 C;  2EYP A;  2OWO A;  3U58 A;  3CCL A;  2AWO A;  2TMP A;  1TWC B;  1U4R A;  1AEX A;  2B2U A;  4GZY C;  4DGZ A;  1SXT A;  4C2M H;  1F9R A;  1Q1E A;  1CZG A;  2JYO A;  4BS9 A;  1B7Y B;  4NXM L;  1HZA A;  2B2Y C;  5K36 H;  4LF5 Q;  2KUM A;  3J81 E;  2R92 B;  3K0X A;  1EY0 A;  3AEV A;  5IYB H;  2ICE C;  1UUP A;  4X3T A;  1SJE D;  2DN8 A;  5L37 A;  1BCP C;  3JAM E;  3D3R A;  4XT3 B;  4IOA A;  1BQQ T;  1I6H H;  4OGQ C;  2Q2I A;  2WB1 E;  3HRZ C;  5GAH C;  3F2D A;  4HSP A;  2K01 A;  5FLX L;  5C3X A;  1EWC A;  1XXG A;  4A3K G;  5J1Z A;  1NMF A;  3Q24 A;  2F3W A;  3HKZ E;  4B3S Q;  4OXP A;  1PYS B;  3J80 c;  5IOD A;  1FGU A;  3S15 B;  3K7A H;  3OSO A;  3NHH A;  3URY A;  5H1S E;  4BBR B;  1K8M A;  4C1N I;  1XPU A;  3J80 L;  1E3P A;  3PSI A;  4AYB G;  4LF7 Q;  3Q8D A;  2XWB B;  1L2F A;  2Y0S G;  1BF4 A;  2E2D C;  4NXM Q;  2JA5 B;  3BU2 A;  4HCE A;  2IPK D;  2OQ0 A;  3ND8 A;  1XMO Q; 
#chains in the Genus database with same CATH homology
 2KCN A;  4RGO S;  3BG3 A;  3GTJ B;  2B63 B;  1JIC A;  1KLG D;  5FO7 B;  4DFA A;  2L4N A;  5ISR A;  4QIW B;  5EBC A;  3H09 A;  4RH6 A;  5IGF A;  4I65 A;  1BDO A;  2M00 A;  2XVS A;  2K6A A;  4Q5V A;  1IKL A;  1Z47 A;  4KKS A;  4HTH A;  2L1B A;  2NVT B;  4KKU A;  4BY7 B;  3ND9 A;  4CKB A;  3W2D A;  1MGS A;  2SEB D;  1MI2 A;  1SNC A;  4J1M A;  1JR0 D;  2B2T C;  3C2P A;  3E6Z X;  1MSG A;  3I8Z A;  2YU9 B;  2A6H D;  5M3F B;  5D14 A;  3QOJ A;  1SNO A;  3DM1 A;  4A3M B;  3OMG A;  1A2U A;  1G2S A;  4KTA A;  3LWE A;  1LAB A;  5JJZ A;  1DOM A;  1SEB D;  1T5E A;  4A3K B;  1JWM D;  3GTO B;  3N6R A;  5C4Z A;  3K59 A;  1TU2 B;  3S9W A;  1HFG A;  4Q0F A;  3TP6 A;  2WII B;  4AYB B;  2EXZ A;  1AZP A;  4KJN A;  3WOF A;  1GOZ A;  3PUY A;  1SNP A;  3R2T A;  2NBF A;  3GTK B;  3VYS A;  1HQM C;  1FNU A;  3EQL C;  2F0J A;  4CJ1 B;  3C1F A;  1JCK B;  3SK8 A;  2G9D A;  1YNJ C;  2EJG C;  4ZLT F;  5JEA J;  1HA5 A;  5FK9 C;  3KUP A;  5ELC A;  2EY2 A;  5M5W B;  1E2V A;  2EYF A;  2PO4 A;  3CRK C;  1FGB D;  3QO2 A;  4IQZ A;  1PRT D;  4CJ0 B;  5G3L D;  2RDH A;  3IAY A;  3D4W A;  1PLF A;  1RDP D;  1EU3 A;  1SSO A;  3DMU A;  1LTA D;  2F0W A;  3SK6 A;  3J80 E;  5DM6 3;  1I6H B;  3KLS X;  2A69 C;  1IKM A;  2QF7 A;  1GUS A;  1OXU A;  1OO9 B;  4RGM A;  1F77 A;  2VUM B;  3QG1 A;  5CBE E;  1WTW A;  3S14 B;  3A56 A;  2RDF A;  5CV7 A;  5IGC A;  4FO2 A;  1JWS D;  4WFN 3;  3EVQ A;  1QNK A;  4A3D B;  4HR7 B;  2Q8T A;  1NSN S;  1SFO B;  3VYT A;  5KEE A;  2RA4 A;  4MN3 A;  3H6M A;  2PCF B;  2PZW A;  2NYZ D;  3S17 B;  1KAB A;  4C3J G;  1OXS C;  5C4X B;  4OO1 H;  3P1H A;  4RAU C;  2IT1 A;  1GHK A;  1QJO A;  4PMB A;  4KI0 A;  1A3U A;  1Y8O B;  2G9H D;  1RHP A;  1JWU D;  1A6X A;  4IAL A;  3F2U A;  2EYJ A;  5I6W A;  1KNE A;  1ENF A;  3Q22 A;  3H0G B;  4QMG A;  4IUT A;  3V05 A;  1LT6 D;  2A69 D;  3FVQ A;  4QB4 A;  1EYC A;  1BOS A;  2EYM A;  4ZRZ A;  4FVM A;  2F0V A;  3RZD B;  3HOY B;  2WKD A;  3NQI A;  1RJT A;  3DXJ C;  3MFY A;  2VNU D;  5EPL A;  1WTO A;  2QDB A;  3T56 B;  2HDM A;  1CM9 A;  3DWP A;  5KIX A;  3KF8 A;  4CKC A;  2L5T A;  2C5C A;  3K58 A;  1BXT A;  3MA2 B;  5E4W C;  1CFM A;  3H91 A;  1LAC A;  2K32 A;  4J8Q A;  3D31 A;  5CMD A;  3S1N B;  1WTP A;  2FFK B;  2Z1C A;  1I4X A;  1PRT C;  1QOH A;  1GUG A;  1HFN A;  1B44 D;  1VCI A;  3A7L A;  3FEW X;  5TSS A;  2XWJ B;  1H9S A;  4A3B B;  2R7Z B;  3JAM L;  3HZX A;  2OXP A;  4IFD G;  2L0C A;  5DAU A;  3TBI B;  3HP3 A;  3PO3 B;  3HGB A;  2GA4 B;  1TVX A;  1OXV A;  4QCL A;  4IFD H;  4TQU S;  3GTM B;  3MZ5 A;  2CQA A;  1SYF A;  1ILQ A;  5DM7 3;  4IUV A;  4C3H G;  3G6J B;  2PQE A;  3NQT A;  1SND A;  3GV6 A;  3GV3 A;  2F0S A;  3NE5 B;  2NVQ B;  2Z4H A;  3U9O A;  2O4X A;  2F0N A;  3I70 A;  3T53 B;  3I91 A;  5C3E B;  1XWE A;  4XXE A;  3MXN A;  1LT5 D;  1ONL A;  2JXM B;  2A73 B;  3HOW B;  1I4G A;  5EJW A;  5I4D A;  2MJ8 A;  1EY9 A;  3O13 A;  4S3S A;  1HCZ A;  1I50 B;  2AQ2 B;  1ESF A;  1V8Q A;  3OPO A;  1ET9 A;  1TS4 A;  1GUT A;  1A2T A;  3BVG A;  1BR9 A;  5JEA G;  2PZT A;  1DXM A;  3QOL A;  1VF7 A;  1A3T A;  5C0X H;  2O5J C;  5LL6 X;  5C3W A;  1STE A;  3VR5 A;  2X69 A;  1PRT F;  1LV9 A;  2O2L D;  1WCM B;  1JOQ A;  1B3A A;  5D3D A;  4F87 A;  1KLU D;  2EPB A;  2R3Z A;  5BN3 A;  1II3 A;  4FP5 D;  3R2I A;  4H0L C;  2HCC A;  1S5E D;  4KD4 A;  5IT9 E;  1WTX A;  1W6J A;  2IX3 A;  4BA1 I;  3RZO B;  2XNA C;  4K5W A;  4BWG B;  1WTR A;  4HAE A;  2EJM A;  2AWN A;  5E3F A;  2MHV A;  5EGT A;  3T4A C;  1FR3 A;  2E76 C;  4I7Z C;  5T1I A;  2NZ1 D;  1D1K A;  2WIN B;  1BCP D;  4KKT A;  1SE3 A;  1YNJ D;  1ZEQ X;  2Q8I B;  5A35 A;  3EFX D;  1SYE A;  2R61 A;  2NWG A;  4X3K A;  3EJI A;  2Q8R E;  3PUZ A;  3T16 A;  3M4Y A;  2CHB D;  2F1M A;  1PFB A;  3FPU B;  1D5Z C;  1ENA A;  4RA8 A;  3TSS A;  1TQO A;  1DCZ A;  4YIJ A;  5KNB A;  1ET6 A;  2K04 A;  1KNA A;  3I72 A;  1LO5 D;  4U67 3;  2JA7 B;  3HKZ B;  1L0X B;  3FMC A;  4XIG S;  1STH A;  3BVM A;  3CKI B;  1VDZ A;  4ZYS A;  3M7N A;  2R93 B;  4FF2 A;  2F3V A;  1F9S A;  4WRD A;  3NK9 A;  2AUK A;  1GUN A;  1QCB D;  1EY5 A;  4ILW A;  3DUZ A;  3KBG A;  2ZT9 C;  2WAC A;  1TT2 A;  3FKI B;  5E4X A;  1MBY A;  5IT9 L;  5AFW A;  4QUF A;  1O7Y A;  4NW2 A;  1GUO A;  2SOB A;  1WD1 A;  2L12 A;  3S2H B;  2I46 A;  2JA6 B;  3RUZ A;  3PIO 3;  4OIJ A;  5IGE A;  5HUR A;  3V2T A;  2EJF C;  5I9O A;  2F0Q A;  3FDT A;  1LTI D;  4P2C B;  1CI3 M;  1EEF D;  4KV6 A;  4ZK9 B;  2ICI A;  4DAP A;  3HOZ B;  2ENB A;  4PQX A;  3CQZ B;  4JK1 C;  2IX1 A;  1PXU A;  4WJW A;  5LHY 1;  1DD2 A;  1MD2 D;  4QF4 A;  4K2K A;  2A6H C;  2E2J B;  3VYR A;  4LMQ D;  5J22 A;  2RBM A;  1Z6H A;  5FO8 B;  1U4P A;  3H94 A;  5CBA E;  4Y7N B;  2BDN A;  2A5H A;  3J7A V;  3ONA B;  1HA6 A;  3M7G A;  1EY7 A;  3MXG A;  4HSV A;  1A15 A;  1SYG A;  1EYA A;  4RWS C;  4K14 A;  2MGS A;  2QKI C;  5F2D A;  1K8O A;  4G7H C;  2FMC A;  3A54 A;  4DF7 A;  1F2Y A;  5JVG 3;  2L11 A;  3OWF A;  2EY6 A;  4A3I B;  3A8K E;  2NVX B;  1QIL A;  1AZQ A;  1BNZ A;  5KYI A;  1D5M C;  3C3L A;  3BYY B;  5CV4 A;  3FRP B;  1S5D D;  3HG9 A;  2OF1 A;  3GD7 A;  1CA6 A;  3TZD A;  1ML0 D;  1LTG D;  4R9W A;  4ZKB B;  1L0Y B;  4C1N K;  4KHZ A;  3HOU B;  2F0D A;  2RSO A;  3VR4 A;  2K33 A;  4DA2 A;  2HQE A;  4DN4 M;  4HED A;  4NP5 A;  2F0U A;  1I4R A;  3GTG B;  3OMC A;  4HMI A;  4RGN A;  3KLS A;  3OOC A;  5K5P A;  1CZW A;  2IJ0 A;  1RKN A;  1DM0 B;  1LTS D;  4G57 A;  4LJZ C;  4L63 B;  5ELD A;  2EVB A;  2EZV A;  2AQ1 B;  5CV8 A;  4B9X A;  1TY2 A;  3GTQ B;  2R6G A;  1STN A;  2TSS A;  3MFG A;  4L6T B;  3WDN A;  5C4H A;  5DNF A;  3AB9 A;  1O7Z A;  1V1P B;  3ZYY X;  2K5Q A;  1PTO B;  1TKW B;  3LNN A;  1Y1V B;  3D4R A;  1PTO C;  3K5L A;  1KDC A;  2E2I B;  5EPK A;  4OO1 G;  2PNR C;  1PFN A;  1SNM A;  3QJY A;  1IW7 D;  4BA2 I;  2BE5 D;  3R3O A;  5I2X A;  3NWS A;  3J7A F;  3BVZ A;  4RKL A;  2BDO A;  1Y1W B;  3D6W A;  1SE2 A;  2LKV A;  4NMZ A;  2EY1 A;  2WAQ B;  1GJX A;  1LT3 D;  5KRU A;  4IUN A;  2D9U A;  2FMM A;  5CYU A;  2NVY B;  4TRD A;  2K5W A;  3R8B A;  1FD7 D;  3K0Y A;  2F0T A;  3EA6 A;  1RTN A;  2RDG A;  3IL8 A;  1NR2 A;  1D1I A;  2J4X A;  1EEI D;  1IYU A;  4N9T A;  2A68 D;  2SNS A;  2Z8L A;  5JPN C;  1BUV T;  1TR5 A;  1QG7 A;  4H13 C;  2PW7 A;  2PPB C;  2IL8 A;  1HUN A;  3PUX A;  1JOK A;  3NTK A;  4DXG A;  2SNM A;  5KYL A;  5C0X I;  4KN4 C;  2FJ2 A;  2JEB I;  2IW3 A;  3IKJ A;  1ESR A;  1EY8 A;  4O42 A;  1NR4 A;  3KLR A;  3MXU A;  2OEO A;  5IIF A;  4EQP A;  1M8A A;  4IN3 A;  5JAV A;  4V0B A;  4XTC S;  3MHB A;  3G7L A;  1GHJ A;  2CW0 C;  1O80 A;  1UAP A;  3CU7 A;  1JE4 A;  5CV6 A;  3A55 A;  4OL7 A;  4JBW A;  1E2W A;  4PMW A;  4K8J A;  5M9O A;  5M3M B;  5JVH 3;  2B39 A;  1JB3 A;  4MIU A;  1SBB B;  5CR3 A;  1NCV A;  3D4D A;  4A93 B;  1TII D;  2N88 A;  1CTM A;  2A6E D;  2F0F A;  4F8M A;  1ZYR D;  1Y69 U;  4FYD A;  4DXF A;  1TS5 A;  4OIK A;  4XQN A;  3VR2 A;  4H44 C;  1AW7 A;  1ENC A;  2Y0S B;  1AN8 A;  2JP1 A;  2LFN A;  5IGG A;  3NXW A;  2K03 A;  4NDX A;  4L8J A;  1XX8 A;  2MPM A;  3VA5 A;  4F7X A;  2B2V A;  3D6C A;  3MC0 B;  4C3H B;  2K5D A;  1G91 A;  1LTR D;  5T1G A;  1SAP A;  1IL8 A;  1ILP A;  1JC7 A;  5IGD A;  3P7J A;  4EGV A;  4RGT A;  4FXG C;  2FHT A;  3S1Q B;  5ELF A;  4KJO A;  4DNR B;  1SDF A;  4FF4 A;  3NP8 A;  3OIQ A;  4X3U A;  2EYH A;  4CGY B;  2XN9 C;  1EYD A;  2NTS A;  2KHS A;  3I3C A;  3S2D B;  1DJR D;  1TWH B;  4UDU C;  4J6H A;  4XT1 B;  3C46 A;  4DAV A;  2RQX A;  1C8C A;  3VR6 A;  1EU4 A;  4IFD I;  2KVM A;  1IW7 C;  3Q0A A;  5IOC A;  1U9R A;  3A8I E;  3R93 A;  3AU7 A;  4FF1 A;  2EOT A;  1S4Z A;  5EQ0 A;  1PTO D;  3MWY W;  3UI2 A;  4A3E B;  1RTO A;  3NTI A;  1DON A;  4E6I A;  3I4N B;  1QB5 D;  2SDF A;  3M4O B;  1PFM A;  1QWY A;  3E0J A;  4LAA A;  1RF2 D;  1A3V A;  1G29 1;  4A3J B;  3S1R B;  1PYW D;  4XYQ A;  5CV5 A;  3KK7 A;  2WP8 J;  1EZ8 A;  4FXD A;  3BDL A;  1H9M A;  4M8A A;  1W6K A;  3CHB D;  3FPP A;  3J7Y W;  3IFD A;  2EE1 A;  3QB3 A;  3VA7 A;  1Q12 A;  4BBS B;  2NTT A;  3K5O A;  1S5F D;  5C0X G;  1D6E C;  4ZUJ A;  2AUJ D;  1SYC A;  1FYC A;  3WOE A;  4G4K A;  1KDB A;  2KOL A;  1EQT A;  2M2L A;  3T13 A;  1CHP D;  1B9N A;  1HHV A;  1TS2 A;  2KQ3 A;  3I4M B;  2X6L A;  1G8Z D;  2OT2 A;  1I4H A;  4A3F B;  1RCV D;  1YNN D;  5C44 B;  2K28 A;  4TKO B;  3U9S A;  3HOX B;  1G6Z A;  1D5X C;  1DOL A;  3L9A X;  4ZAI A;  3RLF A;  3T51 B;  1WTQ A;  2CW0 D;  4DAY A;  3TZU A;  3OW7 A;  4RKB A;  2NUC A;  2KA7 A;  1LLR D;  4RHS A;  1SMY C;  2KJX A;  4IUQ A;  4ZQ3 A;  4C3J B;  2F0H A;  2B8G A;  1CQF A;  4K6L A;  3VR3 A;  4R8I A;  2B2T A;  1B9M A;  1C48 A;  2KCC A;  2EYO A;  1D2B A;  2A6E C;  2F0G A;  1EL0 A;  1TWF B;  5LL6 S;  3HS0 C;  5G3L F;  1VMC A;  3PIP 3;  4RFB A;  5JEA H;  3GTL B;  3SDZ A;  4XQJ A;  2YYZ A;  5JPM C;  3HEJ A;  3BDO A;  1H9K A;  1KTK A;  4IUR A;  3NBH A;  3RMH A;  1VMP A;  2F0O A;  1WTV A;  4G7Z C;  1F9P A;  2F0P A;  3X3N A;  5CV9 A;  4C3I B;  3OIP A;  2JSO A;  5FOB B;  2PYK A;  4ULL A;  4OHJ A;  4PNY A;  5CGK A;  1DOK A;  1PDQ A;  1XTC D;  1WVL A;  2XRS D;  5A2Q E;  2B2W A;  4HCS A;  1TWA B;  5BN4 A;  4CBV A;  2F0M A;  1V1P A;  2DNC A;  3ND8 A;  2BA1 A;  1V43 A;  2ZXP A;  2CVR A;  2VB2 X;  2ZXO A;  3SK4 A;  1UNS A;  4DNT B;  1EOT A;  3LWU A;  2DY7 A;  2Z4I A;  5KGU A;  2O5I C;  3L3O C;  4BY1 B;  1O78 A;  2WB1 B;  2XSC A;  2RKS A;  2AQ3 B;  2BOS A;  3GO5 A;  4MHE A;  3OHX C;  5I2Y A;  4G7O C;  1Z7T A;  2L55 A;  2D5D A;  1CT1 D;  3Q6S A;  1AP0 A;  1I4P A;  3P20 A;  1JOR A;  4B08 A;  3H3V C;  1SMY D;  2HDL A;  5DEH A;  2BE5 C;  2JE6 I;  3QWN A;  1HQR D;  1ZYR C;  2B2W C;  3TN2 A;  5I9P A;  3GTP B;  2J0T D;  1STY A;  4K5V A;  1F2Z A;  3NBI A;  3NSW A;  4RCN A;  3RD4 A;  1FNW A;  4C3I G;  1STB A;  1BCP B;  3BS1 A;  1YNN C;  5ELB A;  2HUG A;  2EDG A;  1JQY D;  1PMR A;  1HRJ A;  5FO9 B;  1J9O A;  3ERQ A;  1Q3L A;  4RCO A;  4DK0 A;  1H9S B;  2KEE A;  2K7V A;  4TSS A;  2QEJ C;  1F2M A;  5IGB A;  3GP7 A;  4X3S A;  3SXH A;  5FLX E;  1H9J A;  2B2V C;  3ITP A;  4FNF A;  2M9V A;  1E0B A;  1JOO A;  4KK7 A;  1MSH A;  2J7Z A;  1IHZ A;  5KND A;  3NWT A;  3AMU A;  4CKE A;  3K6O A;  3NPP A;  3M3Y B;  3K57 A;  4OO1 I;  3M85 A;  4C56 C;  2A68 C;  5C0X J;  5I6Y A;  3MXP A;  3TP5 A;  2E74 C;  1SE4 A;  3MTS A;  3X3M A;  1B4O A;  2NN6 H;  4M1U B;  4ID6 A;  4CJ2 C;  1EY4 A;  4IUP A;  5EBD A;  5EPJ A;  1Y8P B;  5EKK A;  1EWH A;  5C5L A;  1I3Q B;  4K5X A;  5EKI A;  2F0E A;  3A8J E;  1QNU A;  4KD3 A;  1ICW A;  3K7A B;  2NN6 I;  1V1O A;  1QE6 A;  5COY A;  4XDX A;  1X3P A;  1KAA A;  1U4M A;  2JA8 B;  3SR1 A;  1HUM A;  1R4Q B;  2H4O A;  2B2Y A;  3DEO A;  1CA5 A;  3PO2 B;  3NUC A;  3E5S A;  5D3I B;  5A2Q L;  4K2L A;  4QUC A;  3TP8 A;  3K5M A;  1HTL D;  1PZI D;  3DHQ A;  3DEP A;  1TWG B;  3W3A A;  3D8G A;  3VYU A;  1OXT A;  1B2T A;  1R9T B;  3BYT B;  2VB3 X;  1X32 A;  3K5N A;  3I4L A;  2D2C C;  1TY0 A;  3LX0 A;  2RVL A;  1O7L A;  2X6G A;  4KY6 A;  5C4J B;  4FXK C;  3C1E A;  1ZKO A;  1GXD C;  2HCI A;  4EQN A;  4PV1 C;  2BA0 A;  3DWQ A;  1HXY D;  2K1B A;  1EIG A;  1HTP A;  1PZK D;  2ID0 A;  4RHR A;  3SVM A;  5CC4 A;  1CQV A;  1IYV A;  1PZJ D;  1LTT D;  2K05 A;  3TME A;  3PUW A;  4N9P A;  4DK1 A;  2XIW A;  4DU9 A;  2NB0 A;  2FIN B;  1DZ1 A;  4ME5 A;  5J39 A;  1BO0 A;  5M5Y B;  1I4Q A;  2V4D A;  2KEC A;  3P75 A;  4UAI A;  2H1E A;  4ZKC B;  1VF5 C;  1EZ6 A;  2LS0 1;  1RD9 D;  1X3Q A;  4O1N A;  3S1M B;  1F2L A;  3PV0 A;  1ZXT A;  1M4V A;  5EKL A;  3SHL A;  1TS3 A;  3V96 A;  4LK1 C;  4HMJ A;  4ODG A;  3NTH A;  2F03 A;  2KED A;  2E75 C;  2BCO A;  2XRQ D;  2F0I A;  4B9W A;  4A3G B;  4V19 0;  1NAP A;  2EY5 A;  1EY6 A;  1U4L A;  3OWE B;  5C6A A;  2C9O A;  3TDQ A;  4ABN A;  1EIH A;  1B1Z A;  1GUW A;  2N55 A;  5FKA C;  3A7A B;  3PMF A;  3SEB A;  1OXX K;  5NUC A;  4ZUI A;  4FF3 A;  2EYL A;  1STG A;  1Y8N B;  1NUC A;  4Z9C B;  2LY7 A;  3MEH A;  4KY5 A;  1KDA A;  1Q1B A;  1PRT B;  2PZU A;  4IUU A;  5JOB A;  3MAQ A;  4C2M B;  4KMU C;  4EQO A;  1S5B D;  3Q23 A;  1AFP A;  4U68 A;  4NKL A;  2F0K A;  3J81 L;  1XYI A;  3MVV A;  1STA A;  4XQQ A;  3S16 B;  3L7Z C;  4KN7 C;  1CHQ D;  1Q8I A;  3BZD B;  2IWH A;  2MUY A;  4PMC A;  2F0L A;  1EFI D;  1SYD A;  2E2H B;  4IFD J;  2JEA I;  3DWA A;  4HN7 A;  1H9R A;  5M5X B;  2WV6 D;  1E2Z A;  1FNV A;  5HGT A;  1WD0 A;  1SNQ A;  1I6V C;  3ERO A;  2LMC B;  4R8N A;  5ELE A;  4CHT B;  3BDC A;  1LTB D;  3QIA A;  4IZ8 A;  1CK1 A;  3I90 A;  5KNC A;  1B50 A;  1C4Q A;  1T5X D;  1EQV A;  2A74 C;  2B8F A;  1J8I A;  1Q90 A;  1DYQ A;  1ROD A;  2RSN A;  2QIL A;  4H7B A;  4KY7 A;  1G2T A;  2QCP X;  2D62 A;  5E1F A;  1LT4 D;  5COR A;  2DNE A;  3I73 A;  2IX0 A;  5C5M A;  3GQB A;  2I07 B;  4F88 A;  3IFT A;  3TP7 A;  3SE0 A;  2DY8 A;  1PTO H;  2ZXR A;  3SK5 A;  1UEA B;  2VXW A;  1F9Q A;  2MP1 A;  4XYO A;  5K36 G;  3PUV A;  1PTO F;  4K8I A;  3N52 A;  4EVO A;  1BCP F;  1K83 B;  2B2U C;  1R4P B;  2WKC A;  3HOV B;  1SYB A;  2PW5 A;  4K6D A;  4WOR A;  2F4I A;  2L9H A;  5D65 A;  1HPC A;  4KHV A;  2NN6 G;  2PMZ B;  3CRL C;  5BN5 A;  3KBX A;  1B53 A;  1S5C D;  1SJH D;  2EYP A;  2AWO A;  2TMP A;  1TWC B;  1U4R A;  1AEX A;  2B2U A;  4GZY C;  4DGZ A;  1SXT A;  1F9R A;  1Q1E A;  1CZG A;  2JYO A;  4BS9 A;  2B2Y C;  5K36 H;  2KUM A;  3J81 E;  2R92 B;  1EY0 A;  2ICE C;  1UUP A;  4X3T A;  1SJE D;  2DN8 A;  1BCP C;  3JAM E;  3D3R A;  4XT3 B;  1BQQ T;  4OGQ C;  3HRZ C;  4HSP A;  2K01 A;  5FLX L;  5C3X A;  1EWC A;  1XXG A;  5J1Z A;  3Q24 A;  2F3W A;  5IOD A;  3S15 B;  3URY A;  3OSO A;  3NHH A;  4BBR B;  1K8M A;  4C1N I;  3J80 L;  2XWB B;  1BF4 A;  2E2D C;  2JA5 B;  4HCE A;  2IPK D;  1BBX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...