1U4RA

Crystal structure of human rantes mutant 44-aana-47
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
62
Chain Sequence
SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTNAQVCANPEKKWVREYINSLEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A5
publication title The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Attractant
total genus 11
structure length 62
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u4rA00
1EL0A 2DY8A 1KNEA 1RJTA 1SDFA 4ZLTF 1HUNA 4CJ0B 1J9OA 5EPKA 1F9QA 4X3TA 5EPJA 5E4WC 3I3CA 1IKLA 2J7ZA 3IL8A 4ZAIA 1RTNA 1EIHA 4IUPA 1EOTA 2K28A 4RWSC 3QO2A 3N52A 2VXWA 4RA8A 4U68A 5T1IA 1WD1A 1ILQA 5D14A 2X6LA 2HCCA 5D65A 1WTVA 2FFKB 1AZQA 1F9PA 2B2VA 2K05A 1MI2A 4IUVA 1QNKA 5DNFA 1WTQA 4X3UA 2SDFA 1BBXC 1HFNA 2NWGA 1B4OA 3IFDA 1B3AA 2L12A 1DOLA 1WTWA 1PLFA 1MGSA 2BDNA 5EJWA 3LWEA 1A15A 5T1GA 4HEDA 1F9RA 3UI2A 1XYIA 5EQ0A 2B2YC 4XT1B 2RSNA 2N55A 4ZKBB 1DZ1A 2KEEA 2B2UA 3HP3A 2K1BA 3I90A 4XT3B 1SSOA 1HHVA 4OIJA 1F2LA 3KUPA 2H1EA 1NAPA 4MN3A 4IUTA 4IUUA 3I91A 2K03A 3FDTA 2KUMA 5EPLA 1WTPA 3TN2A 2HDLA 5JJZA 5E4XA 1S4ZA 1MSHA 3MTSA 2CVRA 2HUGA 2B2TA 1IKMA 2B2WC 4X3SA 5EKIA 1XX8A 2N88A 1U4PA 1WTXA 2MPMA 4QUCA 1WD0A 2MP1A 2IL8A 1EQTA 1DONA 2JP1A 4O42A 1HUMA 2B2VC 2FJ2A 2L1BA 3GV6A 4HCSA 2FINB 2KOLA 3SVMA 2EE1A 3MWYW 4LMQD 1KNAA 1WTRA 1G91A 1CM9A 3I8ZA 1J8IA 1C8CA 1IL8A 1G2TA 3ONAB 1HRJA 1B53A 1X3PA 1ZXTA 2MJ8A 3H91A 2RA4A 3KBXA 1ML0D 1AP0A 1O7ZA 4IURA 2EPBA 4CJ2C 1JICA 1M8AA 3DM1A 4IUQA 1F9SA 1MSGA 1TVXA 2Q8TA 2L11A 1E0BA 2KECA 4DN4M 2B2YA 2XIWA 5CBAE 2DY7A 1PFBA 1BO0A 1RTOA 4ZK9B 2NZ1D 2RVLA 4CJ1B 4R8IA 2RSOA 3TZDA 1G2SA 1NCVA 4XDXA 1ESRA 1B50A 1CA5A 2JYOA 3DEOA 1QE6A 2MGSA 1HA6A 1QG7A 1SAPA 1PDQA 5COYA 2FHTA 1G6ZA 3FPUB 2KVMA 1PFMA 1LV9A 2K04A 2K01A 1CA6A 4X3KA 1RHPA 1WVLA 4HSVA 3R93A 1BF4A 1O7YA 1RODA 4QUFA 2B2WA 3F2UA 2M2LA 3G7LA 1NR2A 1U4LA 2HDMA 1ICWA 4MHEA 2EOTA 1O80A 1U4RA 2B2UC 2HCIA 2X6GA 1EIGA 4UAIA 3P7JA 2R3ZA 4HAEA 1AZPA 1BNZA 1HFGA 4OIKA 2KEDA 2L4NA 2L9HA 1X32A 3Q6SA 4R9WA 5CORA 5CBEE 1WTOA 1B2TA 1GUWA 1ILPA 1VMPA 1NR4A 5AFWA 1JE4A 1U4MA 2D9UA 3D6WA 4ZKCB 1DOMA 3GV3A 1PFNA 4NW2A 1DOKA 5CMDA 1Q3LA 2Q8RE 2FMMA 3DEPA 4RAUC 1VMCA 2B2TC 2X69A 2NYZD 1X3QA
chains in the Genus database with same CATH superfamily
1SE3A 1A3UA 3DMUA 3HKSA 5IP7H 1U9RA 1FGUA 1TWCB 4KN4C 1BCPF 2EIFA 4A3IB 1EWIA 1WTQA 1K3RA 4P73A 1R4PB 3TQYA 5ELCA 1PH4A 2EYMA 5NUCA 3VR4A 3CC7A 4YIJA 3OTOL 1TR5A 1GUSA 1F9RA 2XRQD 2MNAA 1SXTA 4XT1B 2B63G 1CTMA 1K73C 1PTOD 1K28A 3T1HQ 3JC66 5IY0A 4IUTA 3E0EA 3PF4A 2PCFB 3FP9A 4QIWB 1JJ2A 1FL0A 3I4MG 2A6HD 2C35B 4RGOS 4AH6A 4LFCQ 1QB5D 1L2FA 2IHFA 4JI8Q 3MEFA 1X55A 1QZGA 3CCMA 2KCCA 1Q86C 1CSQA 1CM9A 1KL9A 2D62A 4DR6Q 1HQRD 1SYEA 3C46A 5H1SE 1NUCA 1X3PA 3KBXA 4RMFA 4NDXA 1GUNA 1OXXK 4I65A 2N78A 4GLVB 2K5VA 1HR0W 2PW7A 2E2IB 5FO7B 1PFSA 2I5HA 4F87A 3TMEA 1EYDA 1D2BA 4K6LA 1D8LA 1NCVA 4LF6Q 2MGSA 2WKDA 3H09A 4QIWE 1BKBA 2PNHA 3QJYA 4R4IA 2F3IA 1JOKA 4X3KA 2QDBA 4WJWA 5C3EH 3BDOA 1RODA 3K7AB 2NZOA 1L0XB 3G7LA 1A3TA 2R7ZB 3I7FA 4H0LC 1BNZA 2CW0C 3S2DH 1PVOA 1LLRD 4CDCC 4C2MH 1I3QB 2IW3A 5I6WA 5HY6A 1X54A 2ZTDA 1DOMA 2LKVA 1TQOA 3UE0A 2KHSA 3S1RH 4NPSA 3MFYA 5M3MH 3OSOA 3U50C 5E4WC 3I3CA 1JOQA 1QVGA 3NTKA 1LABA 2A68C 1TWCH 4LW1A 1WTVA 1JORA 4POFA 4GN5A 1VQMA 1F9PA 4HJ8A 5KGUA 1JE5A 1ET9A 5I9OA 3QOJA 4A3JG 3KJOA 4A93H 4JI3L 4C3IG 3S9WA 2K50A 3GTOB 2HT1A 4LFBL 1JJCB 2B2YC 3FKIB 1MKHA 1MJEA 2IWHA 3SHLA 3WOEA 3D4RA 1NAPA 2WB1B 4UPAA 1D7QA 2KUMA 1U5KA 1LT3D 5JJKA 2CVRA 4IN3A 4MNOA 2JQOA 4YHHQ 2EY5A 1YJ9A 1YZ6A 4UP7A 4BA2I 4KMUC 1Q46A 2I5MX 2F0KA 4KKTA 1YNNC 2FJ2A 3GV6A 3HRZC 4HCSA 3GTQH 2Z6BA 4RGTA 4JI1Q 3U4ZA 4KLKA 4JVZA 1AE3A 2DUDA 3CQZB 3ULLA 5IT9c 4KHPL 4BY7B 1AP0A 4B3TQ 1PRTB 4IURA 4YCVA 1I4QA 1NY4A 3W1GA 3S17B 4BWGB 1TVXA 5GAHC 1I50B 2ASBA 2VZAA 5LMUL 2B8FA 2WB1E 2PW5A 4LF5Q 3IRBA 4NXML 1N33L 5A2QE 4LUZA 1GD7A 3I4OA 1PDQA 4A3IG 4G4KA 3KDFA 4RGMA 1JB7A 4WORA 2LMCB 1O7YA 2CH4W 1Q82C 1YI2A 4LF4L 1NR2A 3BU2A 2R7ZH 1EIGA 2BA1A 3R2IA 4GLAC 1B2TA 1I3QH 2KBNA 2R93H 3HOXB 1I4GA 1VQ5A 4NW2A 3RZDB 4JK1C 4R4CA 2X69A 3H3VH 3J80E 1SNCA 3NP8A 2DY8A 2PNRC 3HKZB 1HUNA 3GTKB 2NVXH 4X3TA 2AQ2B 1KLUD 2XSCA 1HTPA 4A3EH 4RWSC 2CCZA 4JI5L 5ELBA 3N6RA 2AQ1B 4DR1L 2JXMB 1NJIC 4A3LG 1DD2A 2IHEA 4IJHA 3K5LA 5M3FH 2BDOA 2F0WA 3PUXA 3J7YW 1EOVA 3OTOQ 1STAA 2L12A 3E3XA 3AU7A 4XTCS 2AWOA 4A4IA 5KYLA 2NVTB 4CBVA 1M1KC 1X56A 3J7AV 4C3JB 2VNUD 1PTOH 3PMFA 3JAMi 1SSOA 1KRSA 2NTSA 1SFOH 2QGQA 4ME5A 3MXNB 1PV4A 3HKZE 3RN5A 2VL6A 1K8MA 1VDZA 4A3KG 3DWQA 4V0BA 4FXDA 1S3OA 5C4XG 2I07B 1H9SB 1WJJA 2DNCA 4GN4B 2R92B 2F0OA 3DUZA 3W5OA 1S5DD 4ODGA 1WD0A 1LACA 3X3NA 1FGBD 1EQTA 1KABA 1HZAA 2CWPA 3G6EA 3CRKC 3HOYH 3QWNA 1I6HB 2KOLA 1G6PA 1G91A 1OXTA 3A54A 1YITA 4JI0Q 3R8BA 1SE2A 2DGYA 4KD3A 4A3CG 5TSSA 4HMIA 3PF5A 2EQSA 1KAAA 4R4OA 3S17H 1CI3M 1K0SA 3VR5A 3PO2B 5DEHA 3GO5A 2XIWA 2OQ0A 4JC0A 4CKBA 3HEJA 2ZJQA 1SMYD 4FXGC 4UHVA 1CA5A 1BXTA 2J0TD 5E7NA 4CKCA 2F0JA 3D6CA 4C56C 4XQQA 2OXPA 3SEBA 2RHSB 4DV6Q 3RLOA 4KV6A 4HR7B 4JBWA 4DR5L 1C0AA 1XMQL 3KLWA 3I4NB 2JEAI 4IOCA 3FKIG 2KHJA 2KEDA 1X32A 4KI0A 3JAML 3S1MB 4A3BB 2K4KA 3VR3A 1PMRA 5CYUA 4FF4A 1N32Q 4ZKCB 2Y0SG 3OPOA 2R6GA 2NN6G 1Z6HA 4RAUC 2Z4HA 1KNEA 3GTKH 4CJ0B 1EYCA 2EYFA 1ENFA 2F0IA 3IL8A 3BJUA 2PQEA 1RTNA 2KCTA 1SYBA 4LNQA 1I4XA 3HOUG 1ZYRD 1YNJC 4H02A 2L15A 2OEOA 1YHAA 4HSPA 5DM73 3SK4A 1SRUA 1R9TB 5IIFA 1ONLA 4JI3Q 1XNQQ 1BBWA 3CC2A 5IP9G 4IFDH 3OIPA 3RZOH 3HG9A 3MXUA 3T51B 1XYIA 3GTLH 1YJNA 3EJIA 2ZXRA 3BVGA 4CDDC 2XRSD 1E2ZA 4OO1H 2D2CC 2YU9B 3PV0A 3I70A 2PYKA 4L8JA 1TS2A 3BDCA 3OOCA 5ELFA 1VQHA 1EWHA 1QJOA 2RBMA 1M90C 1S4ZA 3AMUA 2R92H 4HN7A 4X3SA 3F2BA 1UEAB 1MBYA 5JPMC 1IBML 5KEEA 1STEA 4B3ML 2JA5G 4Y7NH 1IYUA 4FF3A 1SE8A 2ZXOA 1I94L 5CV5A 5LMNW 1XNRL 1HRJA 3HOXG 2M00A 2JA7B 5ELOA 4DF7A 2RA4A 2JA8H 2VB3X 5FLMH 2V1CC 1IL2A 5I4DA 1D1KA 3T1HL 3DM1A 3HKZG 2BE5C 1V1OA 4LUVA 1RIPA 4TKOB 4NXMQ 1EYAA 1N33Q 1Y69U 1HJPA 4PZ7A 1PFBA 2EYOA 3SR1A 3HOZB 2KJXA 4PQXA 2JYOA 1VQJA 3S2HB 2LXJA 1YNXA 1TWGB 1H9JA 4JI8L 2Q2IA 2N49A 3F2CA 4LF4Q 2YTVA 4KK7A 2BCOA 3PO3G 2CHBD 4A3GG 1TKWB 1LTSD 3LNNA 3I4NH 1EZ8A 3FVQA 3V96A 3P7JA 2K14A 2QCPX 3P1HA 4C3JG 1XPOA 1VMPA 1ASZA 4DV2Q 4PMBA 2JA9A 3E0JA 3TBIB 1Q8KA 2NTTA 5L37A 2Q2TA 3I72A 1VQ8A 1NBWA 4HCEA 1B70B 4JI5Q 4WRDA 4LF6L 4UP9A 1TWHB 4DR1Q 1D5ZC 4X66L 5T1IA 4GKKL 2Q2UA 1MI2A 4K2LA 3U9OA 3L0OA 1BBXC 1LTTD 2NWGA 4RCOA 3BG3A 3M85A 3PUZA 4R1JA 4KHZA 5C4JB 5FLXL 2L0CA 3EBEA 5EQ0A 1S72A 2B2UA 1STBA 3WWVA 2YU9H 1F2LA 1SNOA 2EY6A 3H6MA 3I91A 4PV1C 3S14B 2J4XA 3Q8DA 3TN2A 3M4PA 5JJZA 2PZUA 1PXUA 1V1PB 1K8OA 2ZXPA 3NHHA 5M5YH 1EY9A 2N88A 1A8VA 3ND9A 2JK8A 1KC8C 5GAGC 4S3SA 2IX3A 4IO9A 1AN8A 1G2TA 1IL8A 1WOCA 4DR4Q 1TY0A 1EIYB 4DU9A 1WCMG 1SROA 1K9MC 1HR0L 3OHXC 1JICA 3G4SA 2LS01 4DV1Q 1LT4D 3F2DA 1F9SA 1ET6A 1EY6A 1Q1BA 4JI6L 2L11A 1DCZA 4EGVA 1Y1WG 5F2DA 1WI5A 4I7ZC 3CCQA 3TREA 3VR2A 3G6JB 3HOZH 3GQBA 1B50A 4YHHL 2R7FA 4BY1G 1H9SA 2F0QA 4RKLA 3FPUB 2F0PA 3OWEB 3S15H 2FXQA 2KQ3A 4JBKA 2SNSA 3IKJA 3EA6A 4HSVA 1XMQQ 4FDBA 1K0RA 3KFUA 4A3DH 3EFXD 3X3MA 1O80A 3CCVA 4JYAQ 1D5XC 2GN5A 1X3FA 5IGGA 3PIPA 1JWUD 4Q5VA 1PZJD 4PNYA 5CORA 1LTAD 5CBEE 3ND8A 1XWEA 3TSSA 4ZQ3A 3FMCA 4QF4A 1WFQA 1P8LA 3Q23A 2IT1A 5IYBH 4LF5L 4A3MG 1F9QA 4AYBB 1X3EA 4K14A 3TDQA 1VQDA 4EVOA 1TWHH 3A55A 4KY7A 5CR3A 3UDFA 1O7LA 1TT2A 1AZQA 2R7DA 1EYGA 3S2DB 2YV5A 1UE6A 3A56A 2PQAB 3GD7A 3H94A 4C2MB 1T5EA 3NWSA 2F0GA 3MZ5A 1Y8PB 2WP8J 3S1RB 4FNFA 1XPUA 1KDCA 4JV5Q 2XN9C 3Q0AA 4HTHA 1STNA 1K8GA 3BS1A 2I5LX 4J8QA 4IUUA 3S14H 3S1QH 1WTPA 5D3IB 4DA2A 4A3FB 3MTSA 1MJCA 3T56B 4FYDA 3J81i 1IBMQ 3FPPA 4B3MQ 4XXEA 2Z8LA 1LUZA 1XMOL 2UUAL 1I94Q 5FO9B 4A93B 4UP8A 5IOCA 3H3VI 4XIGS 4LMQD 1XNRQ 1HNWQ 3DXJC 2NUCA 4G7HC 1Y8NB 1PHJA 1GHJA 4WFN3 5IYCH 4K8IA 1B53A 1UAPA 1HQMC 1ICFB 2OTLA 2EPBA 3TZUA 4QQBX 3CMAA 1IW7C 4FP5D 3CCSA 4B3SQ 2CW0D 1A62A 1VS0A 3S1NB 1CKOA 5EBCA 3CMEA 4R8IA 3HOWG 3TZDA 1S40A 2F0EA 1FNWA 5FLXc 4C3HG 3J80c 4DR3Q 4JI7Q 3GTQB 1PH6A 3MXPA 1EUJA 3WOFA 2K01A 3NBHB 4NMZA 1BF4A 1RF2D 1MIUA 5JEAH 3NE5B 4JI0L 3K59A 4ILWA 4KY6A 1ICWA 3OMGA 2X6GA 5FJ8G 5C0XI 3GTPH 3G48A 2EXDA 4DR2L 1HNZL 2BA0A 1AW7A 1PH7A 1I5FA 5IGDA 4GOPC 3JAME 3DWAA 1ENCA 2YTXA 4GKJL 1VQIA 1F2YA 2G5DA 4BBRG 1HA5A 3J81L 2JJQA 2Z6KA 3DWPA 4X66Q 5EPJA 3C1EA 3CHBD 1B8AA 2J7ZA 4GKKQ 4ZAIA 1EIHA 5EBDA 3KLRA 1PH5A 3SK8A 1CZWA 2K5NA 1JJGA 4DV6L 3U4VA 1VQKA 2FFKB 2AWNA 2EYLA 2ICIA 3AFQA 3I2ZA 1Y1VH 2P5ZX 2HQEA 2G9HD 3GTMB 2R93B 1B3AA 3NTIA 2BOSA 2LXKA 5FOBB 1MGSA 1EY4A 1LTRD 4GOPB 1N32L 2C5CA 5M5XH 3PIOA 1KXLA 1MHWC 2N55A 4OX9L 5KYIA 2NVXB 3HP3A 2K6AA 4OIJA 2F1MA 3KUPA 4N9PA 4A3EB 3J7A5 1YJWA 3IFTA 1B3QA 2A6HC 2AUKA 3QG1A 4A3FH 1AE2A 4Y52H 1VQ4A 4DAVA 5M3FB 4R4QA 3T1YL 3LWUA 4CDEC 4J1MA 5E1FA 1VQ7A 1ENAA 2IX1A 3KF6B 4DNIA 2WKCA 1XNQL 3NXWA 5HGQA 2VUMH 1SNQA 2F3VA 3ONAB 4PG3A 1PRTC 5JJLA 1PTOB 1KHIA 2XWBB 4BA1I 1HR0Q 1SFOB 1B44D 1O7ZA 1RL2A 4JI6Q 5DAUA 1A0IA 4IPCA 3NSWA 3RUZA 4KN7C 4EQOA 1EFID 4DN4M 3RLNA 1VQFA 5C3EG 4ZK9B 3S1NH 4IFDI 4NXNQ 1BR9A 2NZ1D 1PZID 2ES2A 1W6KA 1QUQB 3HOYB 1V1PA 3AB9A 2F0TA 2H5XA 1E24A 1CA6A 4OO1I 1WYDA 4K5VA 1DM0B 4F7XA 5KNCA 1VQEA 2M2LA 5C5LA 3SK5A 4DV5L 1HNXL 4DPGA 2QKIC 2B2UC 5M3MG 5K36H 4OIKA 2CQOA 4DV7Q 1O78A 1QCBD 3PUYA 4B9XA 2FMMA 2QDLA 4G7ZC 2UU9Q 3BYTB 1BOSA 2VQFL 1KAWA 2LFNA 2K75A 5IGEA 3K58A 3J81j 1D5MC 4L6TB 3NWTA 1EOTA 3VYUA 3QO2A 1X3GA 4RA8A 1H9MA 3RD4A 1PH8A 3M7NA 5CV9A 5DM63 1QNKA 4K0KL 2ENBA 4FF1A 4L5TA 1MD2D 3GTMH 1SNDA 2F0NA 4JG2A 3A7AB 1CK1A 5C4XH 2RHQB 4DV2L 5FLXE 2JA6H 2D0PA 1EY5A 4XT3B 4ID6A 1E22A 1QZHA 1CKMA 4A3CH 1TY2A 1XMOQ 2UUAQ 3IAYA 2E5LL 2BH8A 3RZOB 2E75C 4P74A 3SXHA 4DUYL 3GTLB 1RDPD 3J81c 1KTKA 5LMNL 2PQAA 1EWCA 2A69C 3AYHB 1EQVA 1HZ9A 3BDLA 2I0QA 1SE4A 1Y14B 3GP7A 3HOVB 2B39A 2ZTEA 4K6DA 3T16A 5BN4A 3CCUA 4JI2L 1BDOA 5C0XH 2VQEQ 4BXXG 1H9RA 1BCPD 4KY5A 1A63A 3PUWA 1YBYA 2NVQB 1QILA 2YYZA 2B29A 2R7ZG 1HA6A 4Y7NB 1QG7A 5COYA 1G6ZA 1AH9A 1WVLA 2KCNA 3OYYA 2R93G 1JCKB 4O2DA 2JA8B 4DR2Q 1HNZQ 3UDXA 4DR4L 4IJLA 2HCIA 3I73A 4IZ8A 2PZTA 2XWJB 1YNJD 3NK9A 4K8JA 1WTOA 2A19A 4GKJQ 2OQKA 5AFWA 4DV1L 1EZ6A 4DK3C 1ASYA 3W1BA 1DOKA 3B6YA 3QIAA 4DK6C 4O1NA 1LT5D 1RJTA 5EPKA 1E7ZA 3DM3A 3DHQA 1JWSD 4IUPA 2IPKD 4LAAA 1J6QA 5D14A 2X6LA 1J5EQ 1N9WA 4X65L 4EQ5A 2DJGC 5C44H 5I2YA 1T5XD 4JYAL 3E5SA 1A2UA 1WTWA 1OXUA 4KJNA 2B8GA 2WB1G 1HH2P 3K5NA 4OX9Q 3P75A 2B3GA 2E2JB 2RDFA 4DV3L 2HIXA 2JA5H 4HJAA 3M9BA 2Z4IA 3VA7A 2RCFA 3HOYG 3T1YQ 3P20A 3C3LA 1JOOA 2B2TA 4K5XA 1WTXA 1N8RC 3NBIA 4LF8Q 4BY7G 1DONA 4PZ8A 3CCRA 5IGBA 3KLSA 1LTLA 2VS1A 1FNUA 2AHOB 1VQBA 1G291 1YEZA 4QB4A 4JV5L 4QL5A 2NZHA 5IYDH 3HOVH 3STBC 2Z6KC 3BVZA 3H0GH 1PYWD 1TWAH 4GOPA 1EQQA 2PZWA 4CGYB 1EU3A 2PMZB 1IYJB 1BCPB 1D6EC 3HFZB 1SMYC 3NQIA 2NVQH 5M5YB 3CD6A 4A3GH 3AEVA 2K7VA 4HIKA 4XDXA 2MUYA 3DEOA 2QEJC 4N9TA 4NKLA 3OMCA 2H4OA 3WDNA 1SAPA 1X6OA 2Z0SA 5BN5A 1EEID 3TS2A 4DV5Q 4UY8C 1HNXQ 3H15A 2UXBQ 3ERSX 1HNWL 4GN3B 2YTYA 4DFAA 4JOIC 3KF6A 2HDMA 4M1UB 2OF1A 4ZCKA 4MIUA 3M3YH 1GOZA 1W6JA 3D6WA 3GV3A 3NPPA 5CMDA 4B3SL 4QJFA 5CGKA 2VQFQ 2PMZE 4M8AA 1EL0A 1P16A 4ZLTF 3J81E 4DAMA 3S15B 3EVQA 2ICEC 2TSSA 3MHBA 4DR3L 2RF4A 4JI7L 1PRTF 3N52A 2N3SA 4E6IA 4A3DB 2A6EC 2K5HA 1QUQA 2SEBD 2D5DA 4K0KQ 4OL7A 4XYQA 1H9KA 2A73B 4IOAA 3EIVA 4OO1G 2K32A 2F0DA 5ELNA 1S5FD 1CHQD 1QWYA 1G51A 3DLLA 2MHVA 1E1OA 2E2JH 2KEEA 2V4DA 4FXKC 4LWCA 4L5SA 2R92G 1HHVA 1LTID 2H1EA 4DV0L 5EPLA 2C9OA 2EY1A 2B63B 3QOLA 1D1IA 2E5LQ 1IKMA 1V43A 1VQLA 2K5DA 1XX8A 1UWVA 4FF2A 5C6AA 4JPBW 4QUCA 3RR5A 3SGIA 1WCMH 2JSOA 4DUYQ 2JA8G 5FLMG 2L1BA 1KRTA 3T53B 1VQPA 5LMNQ 1KNAA 4U673 3SK6A 2IX0A 1Y1WH 1J8IA 3MA2B 3PO2G 2GVBA 4JI2Q 3VYTA 1PH3A 1Q90A 2MFIA 4BY1H 2F0HA 3K6OA 2L55A 5CC4A 1OXVA 3S1QB 4Q0FA 4IUQA 4DKAC 1C48A 1KDAA 3HZXA 1E0BA 3JAMc 2DY7A 4IPHA 2RDHA 2UXDL 5GQOA 2ZT9C 5IGFA 1QE6A 3I4NG 3PCOB 4O0AA 2VW9A 2E74C 2GA4B 3TP7A 5IODA 4ALPA 4A3BG 2JE6I 4BBSH 2XGTA 3D4WA 3UDGA 4H13C 2CKZB 3RLFA 5A35A 3J7ZC 2QEXA 4HJ9A 2HHHL 3K5MA 2F0SA 2R3ZA 4L5QA 3KF8B 4IUNA 4DV4L 2LY7A 4KKUA 4Z9CB 3MXNA 3VR6A 1V1QA 1XXGA 2NYZD 1KLGD 4TQUS 4NXNL 3D4DA 3L3OC 1F2MA 1BVSA 2IJ0A 3OW7A 4A75A 2VXWA 4X65Q 1ILQA 5D65A 3NEMA 3A74A 1QOHA 3GTPB 1SYCA 4IUVA 5EAYA 4P75A 1VQNA 1CQFA 1B4OA 1IBLQ 4HIOA 5ELEA 1PLFA 2BDNA 5EJWA 4DV7L 1BQQT 3L2PA 1FJGL 2D0OA 1II3A 1A6XA 4DV3Q 5I9PA 1YHQA 4XYOA 3I90A 1S5CD 2UU9L 1SYDA 1G8ZD 2EDGA 4A3JB 4MN3A 3OW2A 4JW0A 2K03A 3FDTA 3URYA 5E4XA 2B63H 4MTKA 2HUGA 3ZJYC 4DUZL 1E2WA 1KD1C 1IW7D 2WFWA 1SR3A 1BBUA 5JVH3 2JA7G 1Y1VB 1FYCA 3HGBA 3CPFA 1TU2B 4ME3A 1FR3A 1L1OB 3VDYA 3E6ZX 2M9VA 2O5IC 5M5XB 3EROA 1WTRA 3I4MH 1HCZA 5IWAL 1NNXA 3ULJA 5M9OA 2RQXA 4H44C 3L9AX 5C3XA 3HOZG 1OXSC 4AYBE 4DAPA 1KQSA 2CWAA 4FVMA 4OWXB 4GNXB 5KIXA 4RCNA 4A3DG 1ESRA 1NSNS 1FD7D 2FHTA 4FO2A 3FRPB 1FNVA 2KVMA 4LF7L 2VUMB 1LYLA 1LV9A 1L0WA 5IT9L 2EJMA 1EY8A 3MVVA 5BR8Q 2B2WA 4BBRH 3PIP3 3A7LA 2EXZA 1U4LA 2CH4A 1DGSA 3A5UA 2A8VA 1CZGA 2EOTA 1U4RA 3HS0C 1BUVT 5IYBG 3K0YA 2L9HA 5C4ZA 1K83H 3W3AA 3I55A 4K2KA 1LO5D 1QVCA 4EQPA 2VQEL 4YWKA 2Q8RE 2HIVA 2B2TC 1JQYD 3VA5A 2I46A 1SYFA 1X3QA 4CKEA 2EYJA 1IKLA 2DJFC 2L5TA 4APVA 4XQNA 4OHJA 3K7UC 3PUVA 1T9HA 1VQ9A 4YCWA 4F88A 2A68D 3M4QA 2SOBA 5C0XJ 4J15A 5IP7G 4TSSA 3CU7A 3H3VC 2CQAA 2N8NA 4OWWB 1A15A 1NMFA 4L63B 3UI2A 2AUJD 1NTGA 2EVBA 2RCNA 4DV0Q 2UUBQ 2NN6I 1C7YA 3VYRA 4A3JH 3Q22A 3A8JE 2QILA 4C3IH 3CCLA 1PRTD 3BZKA 2FMCA 1FVIA 1MSHA 2WIIB 4P2CB 2ZJPA 4JCVE 1J5EL 1B9NA 2MPMA 5IYCG 3CCEA 5EKLA 3PSIA 2QW7A 2JP1A 1JC7A 2B2VC 5D3DA 4A3KB 1W2BA 1ESFA 1PTOC 1OTCA 5C4XB 1PYSB 1YNND 2SNMA 4JOIA 2JA6B 4G7OC 5EGTA 1L0YB 1STHA 2O5JC 3TS0A 4DR7L 1F2ZA 4UDUC 1GHKA 3PGZA 4X62Q 3D3RA 2Q8TA 2UXDQ 3U9SA 1UE5A 3F8TA 2RVLA 1PZKD 1TWFB 1Q8IA 3RMHA 1G2SA 5JEAG 1XJVA 2F4VL 3A5ZB 4DXGA 4LF8L 5CV7A 1RD9D 3FHWA 2DN8A 1R4QB 4NB3A 1PA6A 1B7YB 4JBJA 2HHHQ 3NUCA 4L5RC 4QUFA 5AJ3L 4KJOA 1PYBA 4UAIA 2MQHA 4DV4Q 4A3IH 4HAEA 1HFGA 1VCIA 5G3LF 3R2TA 4LJZC 4AYBG 5J39A 2D9UA 2OTJA 3O13A 4RFBA 1W3SA 1YHBA 1Q7YC 3E9IA 2GVAA 2K5QA 4OXPA 2KENA 5IGCA 4IFDJ 1CHPD 1SYGA 2QF7A 1GVPA 2Y0SB 1Y1VG 1GO3E 1WD1A 1YIJA 3BYYB 4MTNA 1V9PA 1PH2A 2UXBL 1IYVA 3F1ZA 1OO9B 5DNFA 1E2VA 3R3OA 3HOUB 3PIO3 1FJGQ 1EFWA 2EZVA 3LX0A 2PI2A 4A3LH 2ZM6L 4A3FG 2ID0A 2R61A 4ZKBB 1DZ1A 3KF8A 1EQRA 1GUTA 2NB0A 4IALA 2A69D 3MEHA 3NQTA 4RG1A 1UUPA 3Q24A 4A93G 2NBFA 1HZBA 4DUZQ 2WAQB 2E2IH 5C44B 1F77A 3AQQA 2Y0SE 1N36Q 2VUMG 3M7GA 1CKNB 2O2LD 3W2DA 2UUCL 4BS9A 1HPCA 3TP8A 4J6HA 4O42A 4POGA 4B9WA 4HJ5A 4A3KH 3KYHC 5IWAQ 1LT6D 2EE1A 3MWYW 4BXXH 2F03A 1EY7A 1ZEQX 1I4PA 3K7AH 4X64L 2UXCL 1ZXTA 2TMPA 3K81C 1GKHA 2Z1CA 2E76C 1SBBB 2JA5B 4YY3Q 1M8AA 5ELDA 5JAVA 4YCUA 2G9DA 3KJPA 2KECA 4F8MA 1RTOA 5GROA 1TWFH 4PMWA 4LF7Q 2WAQE 2CFMA 1DJRD 1STYA 3ULPA 3NTHA 5K36G 4LUOA 4AQYL 1PFMA 3KOJA 5LL6X 1K8AC 1SJED 1CSPA 4DK0A 4HIMA 3F2UA 4B08A 5JOBA 1SLJA 3CF5A 1L1OA 4DNTB 2A5HA 3H0GB 1TWAB 5C5MA 4G57A 1AZPA 1I6VC 4KKSA 2F0VA 4NP5A 3K0XA 1NR4A 3KBGA 3PO3B 4B3RL 4YWLA 4A3GB 1UE1A 1NMGA 3GTOH 3DEPA 3MFGA 3CKIB 3FKIH 1J9OA 4YWMA 2EY2A 2NN6H 1X65A 3E9HA 5HURA 4GNXA 5KRUA 5FO8B 4OELB 4A76A 2KA7A 4K5WA 3TP5A 1TS5A 3UE1A 2JA6G 4GZYC 2K05A 5K5PA 3M3YB 1HFNA 4X3UA 2SDFA 2RKSA 1HTLD 4DXFA 3IFDA 3HOUH 3L7ZC 4QY7A 4A3EG 1ZKOA 3A8KE 5C4HA 3CRLC 4OWTB 1VF7A 3QB3A 5J3BA 2RSNA 2XNAC 2ALYB 3CQZH 4PZ6A 1RCVD 5M3FG 4BY7H 5IP9H 4V190 2JEBI 4C1NK 1S5BD 3GTJB 1RKNA 5LHY1 3EQLC 3S16B 3ZYYX 1JWMD 5M5WB 2OT2A 3STBD 1I50H 4LK1C 5CV6A 2B2WC 4OONA 4GS3A 1SJHD 1C9OA 4C1NI 3M4YA 3NBHA 5ISRA 1PH1A 1JR0D 4P72A 3U58A 4DAYB 1HXYD 3AFPA 1HUMA 1UNSA 2FINB 1IBLL 2PPBC 3SVMA 2BH2A 5C0XG 4N8FA 2F0FA 3CW2C 2F3WA 2WACA 1C8CA 4EQNA 1VQ6A 3ICEA 4DR7Q 1GUOA 3ERQA 1XPRA 2Z9HA 4HMJA 2MJ8A 4OEMB 3OWFA 3TRZA 3I4LA 1BCPC 1E3PA 1MSGA 3OIQA 5JPNC 1UEBA 3HOXH 3K5OA 2BE5D 2Q8IB 5CBAE 3RZDH 2F4VQ 1IBKL 4CJ1B 1WCMB 2RSOA 1TXYA 3V05A 4AIMA 1N34L 3T13A 1GUGA 4LF9L 1SNMA 2MO0A 5AJ3Q 1Y1WB 1U0LA 5IT9E 3T4AC 1A2TA 2RDGA 1VQAA 1LTGD 2DNEA 1Z9FA 4MHEA 5CV8A 4BY1B 1QVFA 3M4OB 3NELA 4KHVA 4CDFC 2QA4A 2A6ED 3BVMA 3Q6SA 1HZCA 1S5ED 3CPWA 4P71A 3PO3H 4LFBQ 4JI4L 1Q3LA 2ZTCA 4GLXA 5IE8A 1LTBD 2NVTH 3ER0A 3NENA 4LFAL 2NVYB 1SDFA 3EN2A 4DNRB 2WAQG 3C1FA 3K80C 4C3JH 5C44G 1PTOF 1CT1D 4CHTB 5J1ZA 2E8GA 4ULLA 5DLQE 4BBSB 2K28A 5HGTA 4U68A 2HCCA 2EYHA 5BR8L 4A3MB 2B2VA 2PO4A 4N8X1 5G3LD 5LL6S 4X6AH 2ZM6Q 1I6HH 3LWEA 2AQ3B 5T1GA 3ITPA 1TIID 4KHPQ 2XVSA 3D0FA 2K1BA 1ZYRC 2O4XA 1Q1EA 3MXGA 5EKKA 1A3VA 3GTJH 1SN8A 4IFDG 1KDBA 2EJGC 5LMUQ 3S16H 1Z47A 1DYQA 2HDLA 3J80i 5M5WH 1IZ6A 3PO2H 1B1ZA 2F0MA 2UUCQ 2F4IA 4R4TA 3SDZA 4R8NA 4ZYSA 2IL8A 4TVAB 5IYDG 2ZJRA 5I2XA 3HOVG 1TS4A 1M4VA 4LFCL 3H0GG 1SMXA 2KCMA 1Q81C 4X64Q 2UXCQ 4TRDA 1Y8OB 1SEBD 4DR6L 3H91A 5KNDA 3RN2A 1AFPA 2UUBL 2ATWA 3GTGB 4CJ2C 4QCLA 3K8AA 3D31A 1XTDA 5JEAJ 4A3BH 3S1MH 1EY0A 4H7BA 2VB2X 3CC4A 4ZRZA 3RNUA 2B2YA 2XTIA 1STGA 3K57A 5A2QL 4JBMA 3LGJA 4AQYQ 1UE7A 3GDEA 1CUKA 2AMCB 2HD3A 5GADC 3BZDB 1PH9A 1CKNA 3G71A 2K04A 4EX5A 2OWOA 3I4MB 2F0LA 3J7AF 1RHPA 2WINB 1QNUA 1AEXA 3HOWB 4HIDA 4HJ7A 5C3WA 3M4OH 1O7IA 4C3HB 5E3FA 1R9TH 4B3RQ 1ILPA 1H95A 1VQOA 1U4MA 3S24A 1LM0A 4DK1A 2AKWB 1I4HA 4X62L 1GJXA 3J80L 2E2HB 2NVYH 1EU4A 2JN4A 3CAMA 5BN3A 1B9MA 4DGZA 2OCEA 1IHZA 5CV4A 5JJIA 4ABNA 4BBRB 3TEHB 1X9NA 4A3MH 1DXMA 5FK9C 4I7AA 3KLSX 1K83B 2KHIA 3MAQA 1TS3A 1DOLA 3A8IE 4HEDA 2K33A 4IPDA 3VYSA 3I56A 2JA7H 3TP6A 4ZUJA 1EEFD 3A0JA 2A1AA 5I6YA 2EJFC 4RHRA 3C2PA 3FEWX 1JT8A 3BZCA 1JMCA 4IQZA 2K52A 2VY3A 5EKIA 1E1TA 1U4PA 3KDFB 3D8GA 1L1OC 4PMCA 2MP1A 3QR8A 5GAEC 1GM5A 2PI2E 2EYPA 3S2HH 2IY5B 1V8QA 3PQIA 5FKAC 1VF5C 1TWGH 3V2TA 4RGNA 3I8ZA 4DR5Q 1XTCD 4ZUIA 3CXCA 4JI1L 4RKBA 5JVG3 1NE3A 2F0UA 1ML0D 1IXRA 3CP0A 2MO1A 4C3IB 3GTGH 4RH6A 2HQLA 1WTHA 4XQJA 4B3TL 1VQGA 2E2DC 1EIFA 4GNXC 1IBKQ 4KD4A 1K3BC 1C4QA 1I4RA 4BBSG 1BO0A 1GXDC 1N34Q 1SNPA 1N36L 4LF9Q 1CFMA 4RHSA 1YVCA 1KIXA 1JB3A 1CQVA 1Z7TA 4IPGA 3R93A 5C3EB 1Q12A 4DAYA 3HOWH 2LSSA 4WJ3M 3CCJA 3SE0A 2Q2HA 3MC0B 4C3HH 2K5WA 2L4NA 3UDIA 4R9WA 4JI4Q 1GUWA 2WV6D 5J22A 4YY3L 3KK7A 5KNBA 1VQCA 4KTAA 4OGQC 1JE4A 4LFAQ 1PFNA 2A74C 5C4JH 4QMGA 4WJ4A 2F52A 4QGUA 1VMCA 5FJ8H 2E2HH 4MZ9A 5M3MB
chains in the Genus database with same CATH topology
1SE3A 1A3UA 3DMUA 1U9RA 1TWCB 4KN4C 1BCPF 4A3IB 1WTQA 1R4PB 5ELCA 2EYMA 5NUCA 3VR4A 4YIJA 1TR5A 1GUSA 1F9RA 2XRQD 1SXTA 4XT1B 1CTMA 1PTOD 4IUTA 2PCFB 4QIWB 2A6HD 4RGOS 1QB5D 2KCCA 1CM9A 2D62A 1HQRD 1SYEA 3C46A 1NUCA 1X3PA 3KBXA 4NDXA 1GUNA 1OXXK 4I65A 2PW7A 2E2IB 5FO7B 4F87A 3TMEA 1EYDA 1D2BA 4K6LA 1NCVA 2MGSA 2WKDA 3H09A 3QJYA 1JOKA 4X3KA 2QDBA 4WJWA 3BDOA 1RODA 3K7AB 1L0XB 3G7LA 1A3TA 2R7ZB 4H0LC 1BNZA 2CW0C 1LLRD 1I3QB 2IW3A 5I6WA 1DOMA 2LKVA 1TQOA 2KHSA 3MFYA 3OSOA 5E4WC 3I3CA 1JOQA 3NTKA 1LABA 2A68C 1WTVA 1JORA 1F9PA 5KGUA 1ET9A 5I9OA 3QOJA 4C3IG 3S9WA 3GTOB 2B2YC 3FKIB 2IWHA 3SHLA 3WOEA 3D4RA 1NAPA 2WB1B 2KUMA 1LT3D 2CVRA 4IN3A 4BA2I 2EY5A 4KMUC 4KKTA 2F0KA 1YNNC 2FJ2A 3GV6A 3HRZC 4HCSA 4RGTA 3CQZB 4BY7B 1AP0A 1PRTB 4IURA 1I4QA 3S17B 4BWGB 1TVXA 1I50B 2B8FA 2PW5A 5A2QE 1PDQA 4G4KA 4RGMA 4WORA 2LMCB 1O7YA 1NR2A 1EIGA 2BA1A 3R2IA 1B2TA 3HOXB 1I4GA 4NW2A 3RZDB 4JK1C 2X69A 3J80E 1SNCA 2DY8A 2PNRC 3HKZB 3NP8A 1HUNA 3GTKB 4X3TA 2AQ2B 1KLUD 2XSCA 1HTPA 4RWSC 5ELBA 3N6RA 2AQ1B 2JXMB 1DD2A 3K5LA 2BDOA 2F0WA 3PUXA 3J7YW 1STAA 2L12A 3AU7A 4XTCS 2AWOA 5KYLA 2NVTB 4CBVA 3J7AV 4C3JB 2VNUD 1PTOH 3PMFA 1SSOA 2NTSA 4ME5A 1K8MA 1VDZA 3DWQA 4V0BA 4FXDA 2I07B 1H9SB 2DNCA 2R92B 2F0OA 3DUZA 1S5DD 4ODGA 1WD0A 1LACA 3X3NA 1FGBD 1EQTA 1KABA 3CRKC 3QWNA 1I6HB 2KOLA 1G91A 1OXTA 3A54A 3R8BA 1SE2A 4KD3A 5TSSA 4HMIA 1KAAA 1CI3M 3VR5A 3PO2B 5DEHA 3GO5A 2XIWA 4CKBA 3HEJA 1SMYD 4FXGC 1CA5A 1BXTA 2J0TD 4CKCA 2F0JA 3D6CA 4C56C 4XQQA 2OXPA 3SEBA 4KV6A 4HR7B 4JBWA 3I4NB 2JEAI 2KEDA 1X32A 4KI0A 3JAML 3S1MB 4A3BB 3VR3A 1PMRA 5CYUA 4FF4A 4ZKCB 3OPOA 2R6GA 2NN6G 1Z6HA 4RAUC 2Z4HA 1KNEA 4CJ0B 1EYCA 2EYFA 1ENFA 2F0IA 3IL8A 2PQEA 1RTNA 1SYBA 1I4XA 1ZYRD 1YNJC 2OEOA 4HSPA 5DM73 3SK4A 1R9TB 5IIFA 1ONLA 4IFDH 3OIPA 3HG9A 3MXUA 3T51B 1XYIA 3EJIA 2ZXRA 3BVGA 2XRSD 1E2ZA 4OO1H 2D2CC 2YU9B 3PV0A 3I70A 2PYKA 4L8JA 1TS2A 3BDCA 3OOCA 5ELFA 1EWHA 1QJOA 2RBMA 1S4ZA 3AMUA 4HN7A 4X3SA 1UEAB 1MBYA 5JPMC 5KEEA 1STEA 1IYUA 4FF3A 2ZXOA 5CV5A 1HRJA 2M00A 2JA7B 4DF7A 2RA4A 2VB3X 5I4DA 1D1KA 3DM1A 2BE5C 1V1OA 4TKOB 1EYAA 1Y69U 1PFBA 2EYOA 3SR1A 3HOZB 2KJXA 4PQXA 2JYOA 3S2HB 1TWGB 1H9JA 4KK7A 2BCOA 2CHBD 1TKWB 1LTSD 3LNNA 3V96A 1EZ8A 3FVQA 3P7JA 2QCPX 3P1HA 4C3JG 1VMPA 4PMBA 3E0JA 3TBIB 2NTTA 3I72A 4HCEA 4WRDA 1TWHB 1D5ZC 5T1IA 1MI2A 4K2LA 3U9OA 1BBXC 1LTTD 2NWGA 4RCOA 3BG3A 3M85A 3PUZA 5C4JB 4KHZA 5FLXL 2L0CA 5EQ0A 2B2UA 1STBA 1F2LA 1SNOA 2EY6A 3H6MA 3I91A 4PV1C 3S14B 2J4XA 3TN2A 5JJZA 2PZUA 1PXUA 1V1PB 1K8OA 2ZXPA 3NHHA 1EY9A 2N88A 3ND9A 4S3SA 2IX3A 1AN8A 1G2TA 1IL8A 1TY0A 4DU9A 3OHXC 1JICA 2LS01 1LT4D 1F9SA 1ET6A 1EY6A 1Q1BA 2L11A 1DCZA 4EGVA 5F2DA 4I7ZC 3VR2A 3G6JB 3GQBA 1B50A 1H9SA 2F0QA 4RKLA 3FPUB 2F0PA 3OWEB 2KQ3A 2SNSA 3IKJA 3EA6A 4HSVA 3EFXD 3X3MA 1O80A 1D5XC 5IGGA 1JWUD 4Q5VA 1PZJD 4PNYA 5CORA 1LTAD 5CBEE 3ND8A 1XWEA 3TSSA 4ZQ3A 3FMCA 4QF4A 3Q23A 2IT1A 1F9QA 4AYBB 4K14A 3TDQA 4EVOA 3A55A 4KY7A 5CR3A 1O7LA 1TT2A 1AZQA 3S2DB 3A56A 3GD7A 3H94A 4C2MB 1T5EA 3NWSA 2F0GA 3MZ5A 1Y8PB 2WP8J 3S1RB 4FNFA 1KDCA 2XN9C 3Q0AA 4HTHA 1STNA 3BS1A 4J8QA 4IUUA 1WTPA 5D3IB 4DA2A 4A3FB 3MTSA 3T56B 4FYDA 3FPPA 4XXEA 2Z8LA 5FO9B 4A93B 5IOCA 4XIGS 4LMQD 3DXJC 2NUCA 4G7HC 1Y8NB 1GHJA 4WFN3 4K8IA 1B53A 1UAPA 1HQMC 2EPBA 3TZUA 1IW7C 4FP5D 2CW0D 3S1NB 5EBCA 4R8IA 3TZDA 2F0EA 1FNWA 4C3HG 3GTQB 3MXPA 3WOFA 2K01A 4NMZA 1BF4A 1RF2D 5JEAH 3NE5B 3K59A 4ILWA 4KY6A 1ICWA 3OMGA 2X6GA 5C0XI 2BA0A 1AW7A 5IGDA 3JAME 3DWAA 1ENCA 1F2YA 1HA5A 3J81L 3DWPA 5EPJA 3C1EA 3CHBD 2J7ZA 4ZAIA 1EIHA 5EBDA 3KLRA 3SK8A 1CZWA 2FFKB 2AWNA 2EYLA 2ICIA 2HQEA 2G9HD 3GTMB 2R93B 1B3AA 3NTIA 2BOSA 5FOBB 1MGSA 1EY4A 1LTRD 2C5CA 2N55A 5KYIA 2NVXB 3HP3A 2K6AA 4OIJA 2F1MA 3KUPA 4N9PA 4A3EB 3IFTA 2A6HC 2AUKA 3QG1A 4DAVA 5M3FB 3LWUA 4J1MA 5E1FA 1ENAA 2IX1A 2WKCA 3NXWA 1SNQA 2F3VA 3ONAB 1PRTC 1PTOB 2XWBB 4BA1I 1SFOB 1B44D 1O7ZA 5DAUA 3NSWA 3RUZA 4KN7C 4EQOA 1EFID 4DN4M 4ZK9B 4IFDI 1BR9A 2NZ1D 1PZID 1W6KA 3HOYB 1V1PA 3AB9A 2F0TA 1CA6A 4OO1I 4K5VA 1DM0B 4F7XA 5KNCA 2M2LA 5C5LA 3SK5A 2QKIC 2B2UC 5K36H 4OIKA 1O78A 1QCBD 3PUYA 4B9XA 2FMMA 4G7ZC 3BYTB 1BOSA 2LFNA 3K58A 5IGEA 1D5MC 4L6TB 3NWTA 1EOTA 3VYUA 3QO2A 4RA8A 3RD4A 1H9MA 3M7NA 5CV9A 5DM63 1QNKA 2ENBA 4FF1A 1MD2D 1SNDA 2F0NA 3A7AB 1CK1A 5FLXE 1EY5A 4XT3B 4ID6A 1TY2A 3IAYA 3RZOB 2E75C 3SXHA 3GTLB 1RDPD 1KTKA 1EWCA 2A69C 1EQVA 3BDLA 1SE4A 3GP7A 3HOVB 2B39A 4K6DA 3T16A 5BN4A 1BDOA 5C0XH 1H9RA 1BCPD 4KY5A 3PUWA 2NVQB 1QILA 2YYZA 1HA6A 4Y7NB 1QG7A 5COYA 1G6ZA 1WVLA 2KCNA 1JCKB 2JA8B 2HCIA 3I73A 4IZ8A 2PZTA 2XWJB 1YNJD 3NK9A 4K8JA 1WTOA 5AFWA 1EZ6A 1DOKA 3QIAA 4O1NA 1LT5D 1RJTA 5EPKA 3DHQA 1JWSD 4IUPA 2IPKD 4LAAA 5D14A 2X6LA 5I2YA 1T5XD 3E5SA 1A2UA 1WTWA 1OXUA 4KJNA 2B8GA 3K5NA 3P75A 2E2JB 2RDFA 2Z4IA 3VA7A 3P20A 3C3LA 1JOOA 2B2TA 4K5XA 1WTXA 3NBIA 1DONA 5IGBA 3KLSA 1FNUA 1G291 4QB4A 3BVZA 1PYWD 2PZWA 4CGYB 1EU3A 2PMZB 1BCPB 1D6EC 1SMYC 3NQIA 5M5YB 2K7VA 4XDXA 2MUYA 3DEOA 2QEJC 4N9TA 4NKLA 3OMCA 2H4OA 3WDNA 1SAPA 5BN5A 1EEID 4DFAA 2HDMA 4M1UB 2OF1A 4MIUA 1GOZA 1W6JA 3D6WA 3GV3A 3NPPA 5CMDA 5CGKA 4M8AA 1EL0A 4ZLTF 3J81E 3S15B 3EVQA 2ICEC 2TSSA 3MHBA 1PRTF 3N52A 4E6IA 4A3DB 2A6EC 2SEBD 2D5DA 4OL7A 4XYQA 1H9KA 2A73B 4OO1G 2K32A 2F0DA 1S5FD 1CHQD 1QWYA 2MHVA 2KEEA 2V4DA 4FXKC 1HHVA 1LTID 2H1EA 5EPLA 2C9OA 2EY1A 2B63B 3QOLA 1D1IA 1IKMA 1V43A 2K5DA 1XX8A 4FF2A 5C6AA 4QUCA 2JSOA 2L1BA 3T53B 1KNAA 4U673 3SK6A 2IX0A 1J8IA 3MA2B 3VYTA 1Q90A 2F0HA 3K6OA 2L55A 5CC4A 1OXVA 3S1QB 4Q0FA 4IUQA 1C48A 1KDAA 3HZXA 1E0BA 2DY7A 2RDHA 2ZT9C 5IGFA 1QE6A 2E74C 2GA4B 3TP7A 5IODA 2JE6I 3D4WA 4H13C 3RLFA 5A35A 3K5MA 2F0SA 2R3ZA 4IUNA 2LY7A 4KKUA 4Z9CB 3MXNA 3VR6A 1XXGA 2NYZD 1KLGD 4TQUS 3D4DA 3L3OC 1F2MA 2IJ0A 3OW7A 2VXWA 1ILQA 5D65A 1QOHA 3GTPB 1SYCA 4IUVA 1CQFA 1B4OA 5ELEA 1PLFA 2BDNA 5EJWA 1BQQT 1II3A 1A6XA 5I9PA 4XYOA 1S5CD 3I90A 1SYDA 1G8ZD 2EDGA 4A3JB 4MN3A 2K03A 3FDTA 3URYA 5E4XA 2HUGA 1E2WA 1IW7D 5JVH3 1Y1VB 1FYCA 3HGBA 1TU2B 1FR3A 3E6ZX 2M9VA 2O5IC 5M5XB 3EROA 1WTRA 1HCZA 5M9OA 2RQXA 4H44C 3L9AX 5C3XA 1OXSC 4DAPA 4FVMA 5KIXA 4RCNA 1ESRA 1NSNS 1FD7D 2FHTA 1FNVA 3FRPB 4FO2A 2KVMA 2VUMB 1LV9A 5IT9L 2EJMA 1EY8A 3MVVA 2B2WA 3PIP3 3A7LA 2EXZA 1U4LA 1CZGA 2EOTA 1U4RA 3HS0C 1BUVT 3K0YA 2L9HA 5C4ZA 3W3AA 4K2KA 1LO5D 4EQPA 2Q8RE 2B2TC 1JQYD 3VA5A 2I46A 1SYFA 1X3QA 4CKEA 2EYJA 1IKLA 2L5TA 4XQNA 4OHJA 3PUVA 4F88A 2A68D 2SOBA 5C0XJ 4TSSA 3CU7A 3H3VC 2CQAA 1A15A 4L63B 3UI2A 2AUJD 2EVBA 2NN6I 3VYRA 3Q22A 3A8JE 2QILA 1PRTD 2FMCA 1MSHA 2WIIB 4P2CB 1B9NA 2MPMA 5EKLA 2JP1A 1JC7A 2B2VC 5D3DA 4A3KB 1ESFA 1PTOC 5C4XB 1YNND 2SNMA 2JA6B 4G7OC 5EGTA 1L0YB 1STHA 2O5JC 1F2ZA 4UDUC 1GHKA 3D3RA 2Q8TA 3U9SA 2RVLA 1PZKD 1TWFB 1Q8IA 3RMHA 1G2SA 5JEAG 4DXGA 5CV7A 1RD9D 2DN8A 1R4QB 3NUCA 4QUFA 4KJOA 4UAIA 4HAEA 1HFGA 1VCIA 5G3LF 3R2TA 4LJZC 5J39A 2D9UA 3O13A 4RFBA 2K5QA 5IGCA 4IFDJ 1CHPD 1SYGA 2QF7A 2Y0SB 1WD1A 3BYYB 1IYVA 1OO9B 5DNFA 1E2VA 3R3OA 3HOUB 3PIO3 2EZVA 3LX0A 2ID0A 2R61A 4ZKBB 1DZ1A 3KF8A 1GUTA 2NB0A 4IALA 2A69D 3MEHA 3NQTA 3Q24A 1UUPA 2NBFA 2WAQB 5C44B 1F77A 3M7GA 2O2LD 3W2DA 4BS9A 1HPCA 3TP8A 4J6HA 4O42A 4B9WA 1LT6D 2EE1A 3MWYW 2F03A 1EY7A 1ZEQX 1I4PA 1ZXTA 2TMPA 2Z1CA 2E76C 1SBBB 2JA5B 1M8AA 5ELDA 5JAVA 2G9DA 2KECA 4F8MA 1RTOA 4PMWA 1DJRD 1STYA 3NTHA 5K36G 1PFMA 5LL6X 1SJED 4DK0A 3F2UA 4B08A 5JOBA 4DNTB 2A5HA 3H0GB 1TWAB 5C5MA 4G57A 1AZPA 1I6VC 4KKSA 2F0VA 4NP5A 1NR4A 3KBGA 3PO3B 4A3GB 3DEPA 3MFGA 3CKIB 1J9OA 2EY2A 2NN6H 5HURA 5KRUA 5FO8B 2KA7A 4K5WA 3TP5A 1TS5A 4GZYC 2K05A 5K5PA 3M3YB 1HFNA 4X3UA 2SDFA 2RKSA 1HTLD 4DXFA 3IFDA 3L7ZC 1ZKOA 3A8KE 5C4HA 3CRLC 1VF7A 3QB3A 2RSNA 2XNAC 1RCVD 4V190 2JEBI 4C1NK 1S5BD 3GTJB 1RKNA 5LHY1 3EQLC 3S16B 3ZYYX 1JWMD 5M5WB 2OT2A 4LK1C 5CV6A 2B2WC 1SJHD 4C1NI 3M4YA 3NBHA 5ISRA 1JR0D 1HXYD 1HUMA 1UNSA 2FINB 2PPBC 3SVMA 5C0XG 2F0FA 2F3WA 2WACA 1C8CA 4EQNA 1GUOA 3ERQA 4HMJA 2MJ8A 3OWFA 3I4LA 1BCPC 1MSGA 3OIQA 5JPNC 3K5OA 2BE5D 2Q8IB 5CBAE 4CJ1B 1WCMB 2RSOA 3V05A 3T13A 1GUGA 1SNMA 1Y1WB 5IT9E 3T4AC 1A2TA 2RDGA 1LTGD 2DNEA 4MHEA 5CV8A 4BY1B 3M4OB 4KHVA 2A6ED 3BVMA 3Q6SA 1S5ED 1Q3LA 1LTBD 2NVYB 1SDFA 4DNRB 3C1FA 1PTOF 4CHTB 1CT1D 5J1ZA 4ULLA 4BBSB 2K28A 5HGTA 4U68A 2HCCA 2EYHA 4A3MB 2B2VA 2PO4A 5G3LD 5LL6S 3LWEA 2AQ3B 5T1GA 3ITPA 1TIID 2XVSA 2K1BA 1ZYRC 2O4XA 1Q1EA 3MXGA 5EKKA 1A3VA 4IFDG 1KDBA 2EJGC 1Z47A 1DYQA 2HDLA 1B1ZA 2F0MA 2F4IA 3SDZA 4R8NA 4ZYSA 2IL8A 5I2XA 1TS4A 1M4VA 4TRDA 1Y8OB 1SEBD 3H91A 5KNDA 1AFPA 3GTGB 4CJ2C 4QCLA 3D31A 5JEAJ 1EY0A 4H7BA 2VB2X 4ZRZA 2B2YA 1STGA 3K57A 5A2QL 3BZDB 2K04A 3I4MB 2F0LA 3J7AF 1RHPA 2WINB 1QNUA 1AEXA 3HOWB 5C3WA 4C3HB 5E3FA 1ILPA 1U4MA 4DK1A 1I4HA 1GJXA 3J80L 2E2HB 1EU4A 5BN3A 1B9MA 4DGZA 1IHZA 5CV4A 4ABNA 4BBRB 1DXMA 5FK9C 3KLSX 1K83B 3MAQA 1TS3A 1DOLA 3A8IE 4HEDA 2K33A 3VYSA 3TP6A 4ZUJA 1EEFD 5I6YA 2EJFC 4RHRA 3C2PA 3FEWX 4IQZA 5EKIA 1U4PA 3D8GA 4PMCA 2MP1A 2EYPA 1V8QA 5FKAC 1VF5C 3V2TA 4RGNA 3I8ZA 1XTCD 4ZUIA 4RKBA 5JVG3 2F0UA 1ML0D 4C3IB 4RH6A 4XQJA 2E2DC 4KD4A 1C4QA 1I4RA 1BO0A 1GXDC 1SNPA 1CFMA 4RHSA 1JB3A 1CQVA 1Z7TA 3R93A 5C3EB 1Q12A 4DAYA 3SE0A 3MC0B 2K5WA 2L4NA 4R9WA 1GUWA 2WV6D 5J22A 3KK7A 5KNBA 4KTAA 4OGQC 1JE4A 1PFNA 2A74C 4QMGA 1VMCA 5M3MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EL0 A;  2DY8 A;  1KNE A;  1RJT A;  1SDF A;  4ZLT F;  1HUN A;  4CJ0 B;  1J9O A;  5EPK A;  1F9Q A;  4X3T A;  5EPJ A;  5E4W C;  3I3C A;  1IKL A;  2J7Z A;  3IL8 A;  4ZAI A;  1RTN A;  1EIH A;  4IUP A;  1EOT A;  2K28 A;  4RWS C;  3QO2 A;  3N52 A;  2VXW A;  4RA8 A;  4U68 A;  5T1I A;  1WD1 A;  1ILQ A;  5D14 A;  2X6L A;  2HCC A;  5D65 A;  1WTV A;  2FFK B;  1AZQ A;  1F9P A;  2B2V A;  2K05 A;  1MI2 A;  4IUV A;  1QNK A;  5DNF A;  1WTQ A;  4X3U A;  2SDF A;  1BBX C;  1HFN A;  2NWG A;  1B4O A;  3IFD A;  1B3A A;  2L12 A;  1DOL A;  1WTW A;  1PLF A;  1MGS A;  2BDN A;  5EJW A;  3LWE A;  1A15 A;  5T1G A;  4HED A;  1F9R A;  3UI2 A;  1XYI A;  5EQ0 A;  2B2Y C;  4XT1 B;  2RSN A;  2N55 A;  4ZKB B;  1DZ1 A;  2KEE A;  2B2U A;  3HP3 A;  2K1B A;  3I90 A;  4XT3 B;  1SSO A;  1HHV A;  4OIJ A;  1F2L A;  3KUP A;  2H1E A;  1NAP A;  4MN3 A;  4IUT A;  4IUU A;  3I91 A;  2K03 A;  3FDT A;  2KUM A;  5EPL A;  1WTP A;  3TN2 A;  2HDL A;  5JJZ A;  5E4X A;  1S4Z A;  1MSH A;  3MTS A;  2CVR A;  2HUG A;  2B2T A;  1IKM A;  2B2W C;  4X3S A;  5EKI A;  1XX8 A;  2N88 A;  1U4P A;  1WTX A;  2MPM A;  4QUC A;  1WD0 A;  2MP1 A;  2IL8 A;  1EQT A;  1DON A;  2JP1 A;  4O42 A;  1HUM A;  2B2V C;  2FJ2 A;  2L1B A;  3GV6 A;  4HCS A;  2FIN B;  2KOL A;  3SVM A;  2EE1 A;  3MWY W;  4LMQ D;  1KNA A;  1WTR A;  1G91 A;  1CM9 A;  3I8Z A;  1J8I A;  1C8C A;  1IL8 A;  1G2T A;  3ONA B;  1HRJ A;  1B53 A;  1X3P A;  1ZXT A;  2MJ8 A;  3H91 A;  2RA4 A;  3KBX A;  1ML0 D;  1AP0 A;  1O7Z A;  4IUR A;  2EPB A;  4CJ2 C;  1JIC A;  1M8A A;  3DM1 A;  4IUQ A;  1F9S A;  1MSG A;  1TVX A;  2Q8T A;  2L11 A;  1E0B A;  2KEC A;  4DN4 M;  2B2Y A;  2XIW A;  5CBA E;  2DY7 A;  1PFB A;  1BO0 A;  1RTO A;  4ZK9 B;  2NZ1 D;  2RVL A;  4CJ1 B;  4R8I A;  2RSO A;  3TZD A;  1G2S A;  1NCV A;  4XDX A;  1ESR A;  1B50 A;  1CA5 A;  2JYO A;  3DEO A;  1QE6 A;  2MGS A;  1HA6 A;  1QG7 A;  1SAP A;  1PDQ A;  5COY A;  2FHT A;  1G6Z A;  3FPU B;  2KVM A;  1PFM A;  1LV9 A;  2K04 A;  2K01 A;  1CA6 A;  4X3K A;  1RHP A;  1WVL A;  4HSV A;  3R93 A;  1BF4 A;  1O7Y A;  1ROD A;  4QUF A;  2B2W A;  3F2U A;  2M2L A;  3G7L A;  1NR2 A;  1U4L A;  2HDM A;  1ICW A;  4MHE A;  2EOT A;  1O80 A;  1U4R A;  2B2U C;  2HCI A;  2X6G A;  1EIG A;  4UAI A;  3P7J A;  2R3Z A;  4HAE A;  1AZP A;  1BNZ A;  1HFG A;  4OIK A;  2KED A;  2L4N A;  2L9H A;  1X32 A;  3Q6S A;  4R9W A;  5COR A;  5CBE E;  1WTO A;  1B2T A;  1GUW A;  1ILP A;  1VMP A;  1NR4 A;  5AFW A;  1JE4 A;  1U4M A;  2D9U A;  3D6W A;  4ZKC B;  1DOM A;  3GV3 A;  1PFN A;  4NW2 A;  1DOK A;  5CMD A;  1Q3L A;  2Q8R E;  2FMM A;  3DEP A;  4RAU C;  1VMC A;  2B2T C;  2X69 A;  2NYZ D;  1X3Q A; 
#chains in the Genus database with same CATH topology
 1SE3 A;  1A3U A;  3DMU A;  3HKS A;  5IP7 H;  1U9R A;  1FGU A;  1TWC B;  4KN4 C;  1BCP F;  2EIF A;  4A3I B;  1EWI A;  1WTQ A;  1K3R A;  4P73 A;  1R4P B;  3TQY A;  5ELC A;  1PH4 A;  2EYM A;  5NUC A;  3VR4 A;  3CC7 A;  4YIJ A;  3OTO L;  1TR5 A;  1GUS A;  1F9R A;  2XRQ D;  2MNA A;  1SXT A;  4XT1 B;  2B63 G;  1CTM A;  1K73 C;  1PTO D;  1K28 A;  3T1H Q;  3JC6 6;  5IY0 A;  4IUT A;  3E0E A;  3PF4 A;  2PCF B;  3FP9 A;  4QIW B;  1JJ2 A;  1FL0 A;  3I4M G;  2A6H D;  2C35 B;  4RGO S;  4AH6 A;  4LFC Q;  1QB5 D;  1L2F A;  2IHF A;  4JI8 Q;  3MEF A;  1X55 A;  1QZG A;  3CCM A;  2KCC A;  1Q86 C;  1CSQ A;  1CM9 A;  1KL9 A;  2D62 A;  4DR6 Q;  1HQR D;  1SYE A;  3C46 A;  5H1S E;  1NUC A;  1X3P A;  3KBX A;  4RMF A;  4NDX A;  1GUN A;  1OXX K;  4I65 A;  2N78 A;  4GLV B;  2K5V A;  1HR0 W;  2PW7 A;  2E2I B;  5FO7 B;  1PFS A;  2I5H A;  4F87 A;  3TME A;  1EYD A;  1D2B A;  4K6L A;  1D8L A;  1NCV A;  4LF6 Q;  2MGS A;  2WKD A;  3H09 A;  4QIW E;  1BKB A;  2PNH A;  3QJY A;  4R4I A;  2F3I A;  1JOK A;  4X3K A;  2QDB A;  4WJW A;  5C3E H;  3BDO A;  1ROD A;  3K7A B;  2NZO A;  1L0X B;  3G7L A;  1A3T A;  2R7Z B;  3I7F A;  4H0L C;  1BNZ A;  2CW0 C;  3S2D H;  1PVO A;  1LLR D;  4CDC C;  4C2M H;  1I3Q B;  2IW3 A;  5I6W A;  5HY6 A;  1X54 A;  2ZTD A;  1DOM A;  2LKV A;  1TQO A;  3UE0 A;  2KHS A;  3S1R H;  4NPS A;  3MFY A;  5M3M H;  3OSO A;  3U50 C;  5E4W C;  3I3C A;  1JOQ A;  1QVG A;  3NTK A;  1LAB A;  2A68 C;  1TWC H;  4LW1 A;  1WTV A;  1JOR A;  4POF A;  4GN5 A;  1VQM A;  1F9P A;  4HJ8 A;  5KGU A;  1JE5 A;  1ET9 A;  5I9O A;  3QOJ A;  4A3J G;  3KJO A;  4A93 H;  4JI3 L;  4C3I G;  3S9W A;  2K50 A;  3GTO B;  2HT1 A;  4LFB L;  1JJC B;  2B2Y C;  3FKI B;  1MKH A;  1MJE A;  2IWH A;  3SHL A;  3WOE A;  3D4R A;  1NAP A;  2WB1 B;  4UPA A;  1D7Q A;  2KUM A;  1U5K A;  1LT3 D;  5JJK A;  2CVR A;  4IN3 A;  4MNO A;  2JQO A;  4YHH Q;  2EY5 A;  1YJ9 A;  1YZ6 A;  4UP7 A;  4BA2 I;  4KMU C;  1Q46 A;  2I5M X;  2F0K A;  4KKT A;  1YNN C;  2FJ2 A;  3GV6 A;  3HRZ C;  4HCS A;  3GTQ H;  2Z6B A;  4RGT A;  4JI1 Q;  3U4Z A;  4KLK A;  4JVZ A;  1AE3 A;  2DUD A;  3CQZ B;  3ULL A;  5IT9 c;  4KHP L;  4BY7 B;  1AP0 A;  4B3T Q;  1PRT B;  4IUR A;  4YCV A;  1I4Q A;  1NY4 A;  3W1G A;  3S17 B;  4BWG B;  1TVX A;  5GAH C;  1I50 B;  2ASB A;  2VZA A;  5LMU L;  2B8F A;  2WB1 E;  2PW5 A;  4LF5 Q;  3IRB A;  4NXM L;  1N33 L;  5A2Q E;  4LUZ A;  1GD7 A;  3I4O A;  1PDQ A;  4A3I G;  4G4K A;  3KDF A;  4RGM A;  1JB7 A;  4WOR A;  2LMC B;  1O7Y A;  2CH4 W;  1Q82 C;  1YI2 A;  4LF4 L;  1NR2 A;  3BU2 A;  2R7Z H;  1EIG A;  2BA1 A;  3R2I A;  4GLA C;  1B2T A;  1I3Q H;  2KBN A;  2R93 H;  3HOX B;  1I4G A;  1VQ5 A;  4NW2 A;  3RZD B;  4JK1 C;  4R4C A;  2X69 A;  3H3V H;  3J80 E;  1SNC A;  3NP8 A;  2DY8 A;  2PNR C;  3HKZ B;  1HUN A;  3GTK B;  2NVX H;  4X3T A;  2AQ2 B;  1KLU D;  2XSC A;  1HTP A;  4A3E H;  4RWS C;  2CCZ A;  4JI5 L;  5ELB A;  3N6R A;  2AQ1 B;  4DR1 L;  2JXM B;  1NJI C;  4A3L G;  1DD2 A;  2IHE A;  4IJH A;  3K5L A;  5M3F H;  2BDO A;  2F0W A;  3PUX A;  3J7Y W;  1EOV A;  3OTO Q;  1STA A;  2L12 A;  3E3X A;  3AU7 A;  4XTC S;  2AWO A;  4A4I A;  5KYL A;  2NVT B;  4CBV A;  1M1K C;  1X56 A;  3J7A V;  4C3J B;  2VNU D;  1PTO H;  3PMF A;  3JAM i;  1SSO A;  1KRS A;  2NTS A;  1SFO H;  2QGQ A;  4ME5 A;  3MXN B;  1PV4 A;  3HKZ E;  3RN5 A;  2VL6 A;  1K8M A;  1VDZ A;  4A3K G;  3DWQ A;  4V0B A;  4FXD A;  1S3O A;  5C4X G;  2I07 B;  1H9S B;  1WJJ A;  2DNC A;  4GN4 B;  2R92 B;  2F0O A;  3DUZ A;  3W5O A;  1S5D D;  4ODG A;  1WD0 A;  1LAC A;  3X3N A;  1FGB D;  1EQT A;  1KAB A;  1HZA A;  2CWP A;  3G6E A;  3CRK C;  3HOY H;  3QWN A;  1I6H B;  2KOL A;  1G6P A;  1G91 A;  1OXT A;  3A54 A;  1YIT A;  4JI0 Q;  3R8B A;  1SE2 A;  2DGY A;  4KD3 A;  4A3C G;  5TSS A;  4HMI A;  3PF5 A;  2EQS A;  1KAA A;  4R4O A;  3S17 H;  1CI3 M;  1K0S A;  3VR5 A;  3PO2 B;  5DEH A;  3GO5 A;  2XIW A;  2OQ0 A;  4JC0 A;  4CKB A;  3HEJ A;  2ZJQ A;  1SMY D;  4FXG C;  4UHV A;  1CA5 A;  1BXT A;  2J0T D;  5E7N A;  4CKC A;  2F0J A;  3D6C A;  4C56 C;  4XQQ A;  2OXP A;  3SEB A;  2RHS B;  4DV6 Q;  3RLO A;  4KV6 A;  4HR7 B;  4JBW A;  4DR5 L;  1C0A A;  1XMQ L;  3KLW A;  3I4N B;  2JEA I;  4IOC A;  3FKI G;  2KHJ A;  2KED A;  1X32 A;  4KI0 A;  3JAM L;  3S1M B;  4A3B B;  2K4K A;  3VR3 A;  1PMR A;  5CYU A;  4FF4 A;  1N32 Q;  4ZKC B;  2Y0S G;  3OPO A;  2R6G A;  2NN6 G;  1Z6H A;  4RAU C;  2Z4H A;  1KNE A;  3GTK H;  4CJ0 B;  1EYC A;  2EYF A;  1ENF A;  2F0I A;  3IL8 A;  3BJU A;  2PQE A;  1RTN A;  2KCT A;  1SYB A;  4LNQ A;  1I4X A;  3HOU G;  1ZYR D;  1YNJ C;  4H02 A;  2L15 A;  2OEO A;  1YHA A;  4HSP A;  5DM7 3;  3SK4 A;  1SRU A;  1R9T B;  5IIF A;  1ONL A;  4JI3 Q;  1XNQ Q;  1BBW A;  3CC2 A;  5IP9 G;  4IFD H;  3OIP A;  3RZO H;  3HG9 A;  3MXU A;  3T51 B;  1XYI A;  3GTL H;  1YJN A;  3EJI A;  2ZXR A;  3BVG A;  4CDD C;  2XRS D;  1E2Z A;  4OO1 H;  2D2C C;  2YU9 B;  3PV0 A;  3I70 A;  2PYK A;  4L8J A;  1TS2 A;  3BDC A;  3OOC A;  5ELF A;  1VQH A;  1EWH A;  1QJO A;  2RBM A;  1M90 C;  1S4Z A;  3AMU A;  2R92 H;  4HN7 A;  4X3S A;  3F2B A;  1UEA B;  1MBY A;  5JPM C;  1IBM L;  5KEE A;  1STE A;  4B3M L;  2JA5 G;  4Y7N H;  1IYU A;  4FF3 A;  1SE8 A;  2ZXO A;  1I94 L;  5CV5 A;  5LMN W;  1XNR L;  1HRJ A;  3HOX G;  2M00 A;  2JA7 B;  5ELO A;  4DF7 A;  2RA4 A;  2JA8 H;  2VB3 X;  5FLM H;  2V1C C;  1IL2 A;  5I4D A;  1D1K A;  3T1H L;  3DM1 A;  3HKZ G;  2BE5 C;  1V1O A;  4LUV A;  1RIP A;  4TKO B;  4NXM Q;  1EYA A;  1N33 Q;  1Y69 U;  1HJP A;  4PZ7 A;  1PFB A;  2EYO A;  3SR1 A;  3HOZ B;  2KJX A;  4PQX A;  2JYO A;  1VQJ A;  3S2H B;  2LXJ A;  1YNX A;  1TWG B;  1H9J A;  4JI8 L;  2Q2I A;  2N49 A;  3F2C A;  4LF4 Q;  2YTV A;  4KK7 A;  2BCO A;  3PO3 G;  2CHB D;  4A3G G;  1TKW B;  1LTS D;  3LNN A;  3I4N H;  1EZ8 A;  3FVQ A;  3V96 A;  3P7J A;  2K14 A;  2QCP X;  3P1H A;  4C3J G;  1XPO A;  1VMP A;  1ASZ A;  4DV2 Q;  4PMB A;  2JA9 A;  3E0J A;  3TBI B;  1Q8K A;  2NTT A;  5L37 A;  2Q2T A;  3I72 A;  1VQ8 A;  1NBW A;  4HCE A;  1B70 B;  4JI5 Q;  4WRD A;  4LF6 L;  4UP9 A;  1TWH B;  4DR1 Q;  1D5Z C;  4X66 L;  5T1I A;  4GKK L;  2Q2U A;  1MI2 A;  4K2L A;  3U9O A;  3L0O A;  1BBX C;  1LTT D;  2NWG A;  4RCO A;  3BG3 A;  3M85 A;  3PUZ A;  4R1J A;  4KHZ A;  5C4J B;  5FLX L;  2L0C A;  3EBE A;  5EQ0 A;  1S72 A;  2B2U A;  1STB A;  3WWV A;  2YU9 H;  1F2L A;  1SNO A;  2EY6 A;  3H6M A;  3I91 A;  4PV1 C;  3S14 B;  2J4X A;  3Q8D A;  3TN2 A;  3M4P A;  5JJZ A;  2PZU A;  1PXU A;  1V1P B;  1K8O A;  2ZXP A;  3NHH A;  5M5Y H;  1EY9 A;  2N88 A;  1A8V A;  3ND9 A;  2JK8 A;  1KC8 C;  5GAG C;  4S3S A;  2IX3 A;  4IO9 A;  1AN8 A;  1G2T A;  1IL8 A;  1WOC A;  4DR4 Q;  1TY0 A;  1EIY B;  4DU9 A;  1WCM G;  1SRO A;  1K9M C;  1HR0 L;  3OHX C;  1JIC A;  3G4S A;  2LS0 1;  4DV1 Q;  1LT4 D;  3F2D A;  1F9S A;  1ET6 A;  1EY6 A;  1Q1B A;  4JI6 L;  2L11 A;  1DCZ A;  4EGV A;  1Y1W G;  5F2D A;  1WI5 A;  4I7Z C;  3CCQ A;  3TRE A;  3VR2 A;  3G6J B;  3HOZ H;  3GQB A;  1B50 A;  4YHH L;  2R7F A;  4BY1 G;  1H9S A;  2F0Q A;  4RKL A;  3FPU B;  2F0P A;  3OWE B;  3S15 H;  2FXQ A;  2KQ3 A;  4JBK A;  2SNS A;  3IKJ A;  3EA6 A;  4HSV A;  1XMQ Q;  4FDB A;  1K0R A;  3KFU A;  4A3D H;  3EFX D;  3X3M A;  1O80 A;  3CCV A;  4JYA Q;  1D5X C;  2GN5 A;  1X3F A;  5IGG A;  3PIP A;  1JWU D;  4Q5V A;  1PZJ D;  4PNY A;  5COR A;  1LTA D;  5CBE E;  3ND8 A;  1XWE A;  3TSS A;  4ZQ3 A;  3FMC A;  4QF4 A;  1WFQ A;  1P8L A;  3Q23 A;  2IT1 A;  5IYB H;  4LF5 L;  4A3M G;  1F9Q A;  4AYB B;  1X3E A;  4K14 A;  3TDQ A;  1VQD A;  4EVO A;  1TWH H;  3A55 A;  4KY7 A;  5CR3 A;  3UDF A;  1O7L A;  1TT2 A;  1AZQ A;  2R7D A;  1EYG A;  3S2D B;  2YV5 A;  1UE6 A;  3A56 A;  2PQA B;  3GD7 A;  3H94 A;  4C2M B;  1T5E A;  3NWS A;  2F0G A;  3MZ5 A;  1Y8P B;  2WP8 J;  3S1R B;  4FNF A;  1XPU A;  1KDC A;  4JV5 Q;  2XN9 C;  3Q0A A;  4HTH A;  1STN A;  1K8G A;  3BS1 A;  2I5L X;  4J8Q A;  4IUU A;  3S14 H;  3S1Q H;  1WTP A;  5D3I B;  4DA2 A;  4A3F B;  3MTS A;  1MJC A;  3T56 B;  4FYD A;  3J81 i;  1IBM Q;  3FPP A;  4B3M Q;  4XXE A;  2Z8L A;  1LUZ A;  1XMO L;  2UUA L;  1I94 Q;  5FO9 B;  4A93 B;  4UP8 A;  5IOC A;  3H3V I;  4XIG S;  4LMQ D;  1XNR Q;  1HNW Q;  3DXJ C;  2NUC A;  4G7H C;  1Y8N B;  1PHJ A;  1GHJ A;  4WFN 3;  5IYC H;  4K8I A;  1B53 A;  1UAP A;  1HQM C;  1ICF B;  2OTL A;  2EPB A;  3TZU A;  4QQB X;  3CMA A;  1IW7 C;  4FP5 D;  3CCS A;  4B3S Q;  2CW0 D;  1A62 A;  1VS0 A;  3S1N B;  1CKO A;  5EBC A;  3CME A;  4R8I A;  3HOW G;  3TZD A;  1S40 A;  2F0E A;  1FNW A;  5FLX c;  4C3H G;  3J80 c;  4DR3 Q;  4JI7 Q;  3GTQ B;  1PH6 A;  3MXP A;  1EUJ A;  3WOF A;  2K01 A;  3NBH B;  4NMZ A;  1BF4 A;  1RF2 D;  1MIU A;  5JEA H;  3NE5 B;  4JI0 L;  3K59 A;  4ILW A;  4KY6 A;  1ICW A;  3OMG A;  2X6G A;  5FJ8 G;  5C0X I;  3GTP H;  3G48 A;  2EXD A;  4DR2 L;  1HNZ L;  2BA0 A;  1AW7 A;  1PH7 A;  1I5F A;  5IGD A;  4GOP C;  3JAM E;  3DWA A;  1ENC A;  2YTX A;  4GKJ L;  1VQI A;  1F2Y A;  2G5D A;  4BBR G;  1HA5 A;  3J81 L;  2JJQ A;  2Z6K A;  3DWP A;  4X66 Q;  5EPJ A;  3C1E A;  3CHB D;  1B8A A;  2J7Z A;  4GKK Q;  4ZAI A;  1EIH A;  5EBD A;  3KLR A;  1PH5 A;  3SK8 A;  1CZW A;  2K5N A;  1JJG A;  4DV6 L;  3U4V A;  1VQK A;  2FFK B;  2AWN A;  2EYL A;  2ICI A;  3AFQ A;  3I2Z A;  1Y1V H;  2P5Z X;  2HQE A;  2G9H D;  3GTM B;  2R93 B;  1B3A A;  3NTI A;  2BOS A;  2LXK A;  5FOB B;  1MGS A;  1EY4 A;  1LTR D;  4GOP B;  1N32 L;  2C5C A;  5M5X H;  3PIO A;  1KXL A;  1MHW C;  2N55 A;  4OX9 L;  5KYI A;  2NVX B;  3HP3 A;  2K6A A;  4OIJ A;  2F1M A;  3KUP A;  4N9P A;  4A3E B;  3J7A 5;  1YJW A;  3IFT A;  1B3Q A;  2A6H C;  2AUK A;  3QG1 A;  4A3F H;  1AE2 A;  4Y52 H;  1VQ4 A;  4DAV A;  5M3F B;  4R4Q A;  3T1Y L;  3LWU A;  4CDE C;  4J1M A;  5E1F A;  1VQ7 A;  1ENA A;  2IX1 A;  3KF6 B;  4DNI A;  2WKC A;  1XNQ L;  3NXW A;  5HGQ A;  2VUM H;  1SNQ A;  2F3V A;  3ONA B;  4PG3 A;  1PRT C;  5JJL A;  1PTO B;  1KHI A;  2XWB B;  4BA1 I;  1HR0 Q;  1SFO B;  1B44 D;  1O7Z A;  1RL2 A;  4JI6 Q;  5DAU A;  1A0I A;  4IPC A;  3NSW A;  3RUZ A;  4KN7 C;  4EQO A;  1EFI D;  4DN4 M;  3RLN A;  1VQF A;  5C3E G;  4ZK9 B;  3S1N H;  4IFD I;  4NXN Q;  1BR9 A;  2NZ1 D;  1PZI D;  2ES2 A;  1W6K A;  1QUQ B;  3HOY B;  1V1P A;  3AB9 A;  2F0T A;  2H5X A;  1E24 A;  1CA6 A;  4OO1 I;  1WYD A;  4K5V A;  1DM0 B;  4F7X A;  5KNC A;  1VQE A;  2M2L A;  5C5L A;  3SK5 A;  4DV5 L;  1HNX L;  4DPG A;  2QKI C;  2B2U C;  5M3M G;  5K36 H;  4OIK A;  2CQO A;  4DV7 Q;  1O78 A;  1QCB D;  3PUY A;  4B9X A;  2FMM A;  2QDL A;  4G7Z C;  2UU9 Q;  3BYT B;  1BOS A;  2VQF L;  1KAW A;  2LFN A;  2K75 A;  5IGE A;  3K58 A;  3J81 j;  1D5M C;  4L6T B;  3NWT A;  1EOT A;  3VYU A;  3QO2 A;  1X3G A;  4RA8 A;  1H9M A;  3RD4 A;  1PH8 A;  3M7N A;  5CV9 A;  5DM6 3;  1QNK A;  4K0K L;  2ENB A;  4FF1 A;  4L5T A;  1MD2 D;  3GTM H;  1SND A;  2F0N A;  4JG2 A;  3A7A B;  1CK1 A;  5C4X H;  2RHQ B;  4DV2 L;  5FLX E;  2JA6 H;  2D0P A;  1EY5 A;  4XT3 B;  4ID6 A;  1E22 A;  1QZH A;  1CKM A;  4A3C H;  1TY2 A;  1XMO Q;  2UUA Q;  3IAY A;  2E5L L;  2BH8 A;  3RZO B;  2E75 C;  4P74 A;  3SXH A;  4DUY L;  3GTL B;  1RDP D;  3J81 c;  1KTK A;  5LMN L;  2PQA A;  1EWC A;  2A69 C;  3AYH B;  1EQV A;  1HZ9 A;  3BDL A;  2I0Q A;  1SE4 A;  1Y14 B;  3GP7 A;  3HOV B;  2B39 A;  2ZTE A;  4K6D A;  3T16 A;  5BN4 A;  3CCU A;  4JI2 L;  1BDO A;  5C0X H;  2VQE Q;  4BXX G;  1H9R A;  1BCP D;  4KY5 A;  1A63 A;  3PUW A;  1YBY A;  2NVQ B;  1QIL A;  2YYZ A;  2B29 A;  2R7Z G;  1HA6 A;  4Y7N B;  1QG7 A;  5COY A;  1G6Z A;  1AH9 A;  1WVL A;  2KCN A;  3OYY A;  2R93 G;  1JCK B;  4O2D A;  2JA8 B;  4DR2 Q;  1HNZ Q;  3UDX A;  4DR4 L;  4IJL A;  2HCI A;  3I73 A;  4IZ8 A;  2PZT A;  2XWJ B;  1YNJ D;  3NK9 A;  4K8J A;  1WTO A;  2A19 A;  4GKJ Q;  2OQK A;  5AFW A;  4DV1 L;  1EZ6 A;  4DK3 C;  1ASY A;  3W1B A;  1DOK A;  3B6Y A;  3QIA A;  4DK6 C;  4O1N A;  1LT5 D;  1RJT A;  5EPK A;  1E7Z A;  3DM3 A;  3DHQ A;  1JWS D;  4IUP A;  2IPK D;  4LAA A;  1J6Q A;  5D14 A;  2X6L A;  1J5E Q;  1N9W A;  4X65 L;  4EQ5 A;  2DJG C;  5C44 H;  5I2Y A;  1T5X D;  4JYA L;  3E5S A;  1A2U A;  1WTW A;  1OXU A;  4KJN A;  2B8G A;  2WB1 G;  1HH2 P;  3K5N A;  4OX9 Q;  3P75 A;  2B3G A;  2E2J B;  2RDF A;  4DV3 L;  2HIX A;  2JA5 H;  4HJA A;  3M9B A;  2Z4I A;  3VA7 A;  2RCF A;  3HOY G;  3T1Y Q;  3P20 A;  3C3L A;  1JOO A;  2B2T A;  4K5X A;  1WTX A;  1N8R C;  3NBI A;  4LF8 Q;  4BY7 G;  1DON A;  4PZ8 A;  3CCR A;  5IGB A;  3KLS A;  1LTL A;  2VS1 A;  1FNU A;  2AHO B;  1VQB A;  1G29 1;  1YEZ A;  4QB4 A;  4JV5 L;  4QL5 A;  2NZH A;  5IYD H;  3HOV H;  3STB C;  2Z6K C;  3BVZ A;  3H0G H;  1PYW D;  1TWA H;  4GOP A;  1EQQ A;  2PZW A;  4CGY B;  1EU3 A;  2PMZ B;  1IYJ B;  1BCP B;  1D6E C;  3HFZ B;  1SMY C;  3NQI A;  2NVQ H;  5M5Y B;  3CD6 A;  4A3G H;  3AEV A;  2K7V A;  4HIK A;  4XDX A;  2MUY A;  3DEO A;  2QEJ C;  4N9T A;  4NKL A;  3OMC A;  2H4O A;  3WDN A;  1SAP A;  1X6O A;  2Z0S A;  5BN5 A;  1EEI D;  3TS2 A;  4DV5 Q;  4UY8 C;  1HNX Q;  3H15 A;  2UXB Q;  3ERS X;  1HNW L;  4GN3 B;  2YTY A;  4DFA A;  4JOI C;  3KF6 A;  2HDM A;  4M1U B;  2OF1 A;  4ZCK A;  4MIU A;  3M3Y H;  1GOZ A;  1W6J A;  3D6W A;  3GV3 A;  3NPP A;  5CMD A;  4B3S L;  4QJF A;  5CGK A;  2VQF Q;  2PMZ E;  4M8A A;  1EL0 A;  1P16 A;  4ZLT F;  3J81 E;  4DAM A;  3S15 B;  3EVQ A;  2ICE C;  2TSS A;  3MHB A;  4DR3 L;  2RF4 A;  4JI7 L;  1PRT F;  3N52 A;  2N3S A;  4E6I A;  4A3D B;  2A6E C;  2K5H A;  1QUQ A;  2SEB D;  2D5D A;  4K0K Q;  4OL7 A;  4XYQ A;  1H9K A;  2A73 B;  4IOA A;  3EIV A;  4OO1 G;  2K32 A;  2F0D A;  5ELN A;  1S5F D;  1CHQ D;  1QWY A;  1G51 A;  3DLL A;  2MHV A;  1E1O A;  2E2J H;  2KEE A;  2V4D A;  4FXK C;  4LWC A;  4L5S A;  2R92 G;  1HHV A;  1LTI D;  2H1E A;  4DV0 L;  5EPL A;  2C9O A;  2EY1 A;  2B63 B;  3QOL A;  1D1I A;  2E5L Q;  1IKM A;  1V43 A;  1VQL A;  2K5D A;  1XX8 A;  1UWV A;  4FF2 A;  5C6A A;  4JPB W;  4QUC A;  3RR5 A;  3SGI A;  1WCM H;  2JSO A;  4DUY Q;  2JA8 G;  5FLM G;  2L1B A;  1KRT A;  3T53 B;  1VQP A;  5LMN Q;  1KNA A;  4U67 3;  3SK6 A;  2IX0 A;  1Y1W H;  1J8I A;  3MA2 B;  3PO2 G;  2GVB A;  4JI2 Q;  3VYT A;  1PH3 A;  1Q90 A;  2MFI A;  4BY1 H;  2F0H A;  3K6O A;  2L55 A;  5CC4 A;  1OXV A;  3S1Q B;  4Q0F A;  4IUQ A;  4DKA C;  1C48 A;  1KDA A;  3HZX A;  1E0B A;  3JAM c;  2DY7 A;  4IPH A;  2RDH A;  2UXD L;  5GQO A;  2ZT9 C;  5IGF A;  1QE6 A;  3I4N G;  3PCO B;  4O0A A;  2VW9 A;  2E74 C;  2GA4 B;  3TP7 A;  5IOD A;  4ALP A;  4A3B G;  2JE6 I;  4BBS H;  2XGT A;  3D4W A;  3UDG A;  4H13 C;  2CKZ B;  3RLF A;  5A35 A;  3J7Z C;  2QEX A;  4HJ9 A;  2HHH L;  3K5M A;  2F0S A;  2R3Z A;  4L5Q A;  3KF8 B;  4IUN A;  4DV4 L;  2LY7 A;  4KKU A;  4Z9C B;  3MXN A;  3VR6 A;  1V1Q A;  1XXG A;  2NYZ D;  1KLG D;  4TQU S;  4NXN L;  3D4D A;  3L3O C;  1F2M A;  1BVS A;  2IJ0 A;  3OW7 A;  4A75 A;  2VXW A;  4X65 Q;  1ILQ A;  5D65 A;  3NEM A;  3A74 A;  1QOH A;  3GTP B;  1SYC A;  4IUV A;  5EAY A;  4P75 A;  1VQN A;  1CQF A;  1B4O A;  1IBL Q;  4HIO A;  5ELE A;  1PLF A;  2BDN A;  5EJW A;  4DV7 L;  1BQQ T;  3L2P A;  1FJG L;  2D0O A;  1II3 A;  1A6X A;  4DV3 Q;  5I9P A;  1YHQ A;  4XYO A;  3I90 A;  1S5C D;  2UU9 L;  1SYD A;  1G8Z D;  2EDG A;  4A3J B;  4MN3 A;  3OW2 A;  4JW0 A;  2K03 A;  3FDT A;  3URY A;  5E4X A;  2B63 H;  4MTK A;  2HUG A;  3ZJY C;  4DUZ L;  1E2W A;  1KD1 C;  1IW7 D;  2WFW A;  1SR3 A;  1BBU A;  5JVH 3;  2JA7 G;  1Y1V B;  1FYC A;  3HGB A;  3CPF A;  1TU2 B;  4ME3 A;  1FR3 A;  1L1O B;  3VDY A;  3E6Z X;  2M9V A;  2O5I C;  5M5X B;  3ERO A;  1WTR A;  3I4M H;  1HCZ A;  5IWA L;  1NNX A;  3ULJ A;  5M9O A;  2RQX A;  4H44 C;  3L9A X;  5C3X A;  3HOZ G;  1OXS C;  4AYB E;  4DAP A;  1KQS A;  2CWA A;  4FVM A;  4OWX B;  4GNX B;  5KIX A;  4RCN A;  4A3D G;  1ESR A;  1NSN S;  1FD7 D;  2FHT A;  4FO2 A;  3FRP B;  1FNV A;  2KVM A;  4LF7 L;  2VUM B;  1LYL A;  1LV9 A;  1L0W A;  5IT9 L;  2EJM A;  1EY8 A;  3MVV A;  5BR8 Q;  2B2W A;  4BBR H;  3PIP 3;  3A7L A;  2EXZ A;  1U4L A;  2CH4 A;  1DGS A;  3A5U A;  2A8V A;  1CZG A;  2EOT A;  1U4R A;  3HS0 C;  1BUV T;  5IYB G;  3K0Y A;  2L9H A;  5C4Z A;  1K83 H;  3W3A A;  3I55 A;  4K2K A;  1LO5 D;  1QVC A;  4EQP A;  2VQE L;  4YWK A;  2Q8R E;  2HIV A;  2B2T C;  1JQY D;  3VA5 A;  2I46 A;  1SYF A;  1X3Q A;  4CKE A;  2EYJ A;  1IKL A;  2DJF C;  2L5T A;  4APV A;  4XQN A;  4OHJ A;  3K7U C;  3PUV A;  1T9H A;  1VQ9 A;  4YCW A;  4F88 A;  2A68 D;  3M4Q A;  2SOB A;  5C0X J;  4J15 A;  5IP7 G;  4TSS A;  3CU7 A;  3H3V C;  2CQA A;  2N8N A;  4OWW B;  1A15 A;  1NMF A;  4L63 B;  3UI2 A;  2AUJ D;  1NTG A;  2EVB A;  2RCN A;  4DV0 Q;  2UUB Q;  2NN6 I;  1C7Y A;  3VYR A;  4A3J H;  3Q22 A;  3A8J E;  2QIL A;  4C3I H;  3CCL A;  1PRT D;  3BZK A;  2FMC A;  1FVI A;  1MSH A;  2WII B;  4P2C B;  2ZJP A;  4JCV E;  1J5E L;  1B9N A;  2MPM A;  5IYC G;  3CCE A;  5EKL A;  3PSI A;  2QW7 A;  2JP1 A;  1JC7 A;  2B2V C;  5D3D A;  4A3K B;  1W2B A;  1ESF A;  1PTO C;  1OTC A;  5C4X B;  1PYS B;  1YNN D;  2SNM A;  4JOI A;  2JA6 B;  4G7O C;  5EGT A;  1L0Y B;  1STH A;  2O5J C;  3TS0 A;  4DR7 L;  1F2Z A;  4UDU C;  1GHK A;  3PGZ A;  4X62 Q;  3D3R A;  2Q8T A;  2UXD Q;  3U9S A;  1UE5 A;  3F8T A;  2RVL A;  1PZK D;  1TWF B;  1Q8I A;  3RMH A;  1G2S A;  5JEA G;  1XJV A;  2F4V L;  3A5Z B;  4DXG A;  4LF8 L;  5CV7 A;  1RD9 D;  3FHW A;  2DN8 A;  1R4Q B;  4NB3 A;  1PA6 A;  1B7Y B;  4JBJ A;  2HHH Q;  3NUC A;  4L5R C;  4QUF A;  5AJ3 L;  4KJO A;  1PYB A;  4UAI A;  2MQH A;  4DV4 Q;  4A3I H;  4HAE A;  1HFG A;  1VCI A;  5G3L F;  3R2T A;  4LJZ C;  4AYB G;  5J39 A;  2D9U A;  2OTJ A;  3O13 A;  4RFB A;  1W3S A;  1YHB A;  1Q7Y C;  3E9I A;  2GVA A;  2K5Q A;  4OXP A;  2KEN A;  5IGC A;  4IFD J;  1CHP D;  1SYG A;  2QF7 A;  1GVP A;  2Y0S B;  1Y1V G;  1GO3 E;  1WD1 A;  1YIJ A;  3BYY B;  4MTN A;  1V9P A;  1PH2 A;  2UXB L;  1IYV A;  3F1Z A;  1OO9 B;  5DNF A;  1E2V A;  3R3O A;  3HOU B;  3PIO 3;  1FJG Q;  1EFW A;  2EZV A;  3LX0 A;  2PI2 A;  4A3L H;  2ZM6 L;  4A3F G;  2ID0 A;  2R61 A;  4ZKB B;  1DZ1 A;  3KF8 A;  1EQR A;  1GUT A;  2NB0 A;  4IAL A;  2A69 D;  3MEH A;  3NQT A;  4RG1 A;  1UUP A;  3Q24 A;  4A93 G;  2NBF A;  1HZB A;  4DUZ Q;  2WAQ B;  2E2I H;  5C44 B;  1F77 A;  3AQQ A;  2Y0S E;  1N36 Q;  2VUM G;  3M7G A;  1CKN B;  2O2L D;  3W2D A;  2UUC L;  4BS9 A;  1HPC A;  3TP8 A;  4J6H A;  4O42 A;  4POG A;  4B9W A;  4HJ5 A;  4A3K H;  3KYH C;  5IWA Q;  1LT6 D;  2EE1 A;  3MWY W;  4BXX H;  2F03 A;  1EY7 A;  1ZEQ X;  1I4P A;  3K7A H;  4X64 L;  2UXC L;  1ZXT A;  2TMP A;  3K81 C;  1GKH A;  2Z1C A;  2E76 C;  1SBB B;  2JA5 B;  4YY3 Q;  1M8A A;  5ELD A;  5JAV A;  4YCU A;  2G9D A;  3KJP A;  2KEC A;  4F8M A;  1RTO A;  5GRO A;  1TWF H;  4PMW A;  4LF7 Q;  2WAQ E;  2CFM A;  1DJR D;  1STY A;  3ULP A;  3NTH A;  5K36 G;  4LUO A;  4AQY L;  1PFM A;  3KOJ A;  5LL6 X;  1K8A C;  1SJE D;  1CSP A;  4DK0 A;  4HIM A;  3F2U A;  4B08 A;  5JOB A;  1SLJ A;  3CF5 A;  1L1O A;  4DNT B;  2A5H A;  3H0G B;  1TWA B;  5C5M A;  4G57 A;  1AZP A;  1I6V C;  4KKS A;  2F0V A;  4NP5 A;  3K0X A;  1NR4 A;  3KBG A;  3PO3 B;  4B3R L;  4YWL A;  4A3G B;  1UE1 A;  1NMG A;  3GTO H;  3DEP A;  3MFG A;  3CKI B;  3FKI H;  1J9O A;  4YWM A;  2EY2 A;  2NN6 H;  1X65 A;  3E9H A;  5HUR A;  4GNX A;  5KRU A;  5FO8 B;  4OEL B;  4A76 A;  2KA7 A;  4K5W A;  3TP5 A;  1TS5 A;  3UE1 A;  2JA6 G;  4GZY C;  2K05 A;  5K5P A;  3M3Y B;  1HFN A;  4X3U A;  2SDF A;  2RKS A;  1HTL D;  4DXF A;  3IFD A;  3HOU H;  3L7Z C;  4QY7 A;  4A3E G;  1ZKO A;  3A8K E;  5C4H A;  3CRL C;  4OWT B;  1VF7 A;  3QB3 A;  5J3B A;  2RSN A;  2XNA C;  2ALY B;  3CQZ H;  4PZ6 A;  1RCV D;  5M3F G;  4BY7 H;  5IP9 H;  4V19 0;  2JEB I;  4C1N K;  1S5B D;  3GTJ B;  1RKN A;  5LHY 1;  3EQL C;  3S16 B;  3ZYY X;  1JWM D;  5M5W B;  2OT2 A;  3STB D;  1I50 H;  4LK1 C;  5CV6 A;  2B2W C;  4OON A;  4GS3 A;  1SJH D;  1C9O A;  4C1N I;  3M4Y A;  3NBH A;  5ISR A;  1PH1 A;  1JR0 D;  4P72 A;  3U58 A;  4DAY B;  1HXY D;  3AFP A;  1HUM A;  1UNS A;  2FIN B;  1IBL L;  2PPB C;  3SVM A;  2BH2 A;  5C0X G;  4N8F A;  2F0F A;  3CW2 C;  2F3W A;  2WAC A;  1C8C A;  4EQN A;  1VQ6 A;  3ICE A;  4DR7 Q;  1GUO A;  3ERQ A;  1XPR A;  2Z9H A;  4HMJ A;  2MJ8 A;  4OEM B;  3OWF A;  3TRZ A;  3I4L A;  1BCP C;  1E3P A;  1MSG A;  3OIQ A;  5JPN C;  1UEB A;  3HOX H;  3K5O A;  2BE5 D;  2Q8I B;  5CBA E;  3RZD H;  2F4V Q;  1IBK L;  4CJ1 B;  1WCM B;  2RSO A;  1TXY A;  3V05 A;  4AIM A;  1N34 L;  3T13 A;  1GUG A;  4LF9 L;  1SNM A;  2MO0 A;  5AJ3 Q;  1Y1W B;  1U0L A;  5IT9 E;  3T4A C;  1A2T A;  2RDG A;  1VQA A;  1LTG D;  2DNE A;  1Z9F A;  4MHE A;  5CV8 A;  4BY1 B;  1QVF A;  3M4O B;  3NEL A;  4KHV A;  4CDF C;  2QA4 A;  2A6E D;  3BVM A;  3Q6S A;  1HZC A;  1S5E D;  3CPW A;  4P71 A;  3PO3 H;  4LFB Q;  4JI4 L;  1Q3L A;  2ZTC A;  4GLX A;  5IE8 A;  1LTB D;  2NVT H;  3ER0 A;  3NEN A;  4LFA L;  2NVY B;  1SDF A;  3EN2 A;  4DNR B;  2WAQ G;  3C1F A;  3K80 C;  4C3J H;  5C44 G;  1PTO F;  1CT1 D;  4CHT B;  5J1Z A;  2E8G A;  4ULL A;  5DLQ E;  4BBS B;  2K28 A;  5HGT A;  4U68 A;  2HCC A;  2EYH A;  5BR8 L;  4A3M B;  2B2V A;  2PO4 A;  4N8X 1;  5G3L D;  5LL6 S;  4X6A H;  2ZM6 Q;  1I6H H;  3LWE A;  2AQ3 B;  5T1G A;  3ITP A;  1TII D;  4KHP Q;  2XVS A;  3D0F A;  2K1B A;  1ZYR C;  2O4X A;  1Q1E A;  3MXG A;  5EKK A;  1A3V A;  3GTJ H;  1SN8 A;  4IFD G;  1KDB A;  2EJG C;  5LMU Q;  3S16 H;  1Z47 A;  1DYQ A;  2HDL A;  3J80 i;  5M5W H;  1IZ6 A;  3PO2 H;  1B1Z A;  2F0M A;  2UUC Q;  2F4I A;  4R4T A;  3SDZ A;  4R8N A;  4ZYS A;  2IL8 A;  4TVA B;  5IYD G;  2ZJR A;  5I2X A;  3HOV G;  1TS4 A;  1M4V A;  4LFC L;  3H0G G;  1SMX A;  2KCM A;  1Q81 C;  4X64 Q;  2UXC Q;  4TRD A;  1Y8O B;  1SEB D;  4DR6 L;  3H91 A;  5KND A;  3RN2 A;  1AFP A;  2UUB L;  2ATW A;  3GTG B;  4CJ2 C;  4QCL A;  3K8A A;  3D31 A;  1XTD A;  5JEA J;  4A3B H;  3S1M H;  1EY0 A;  4H7B A;  2VB2 X;  3CC4 A;  4ZRZ A;  3RNU A;  2B2Y A;  2XTI A;  1STG A;  3K57 A;  5A2Q L;  4JBM A;  3LGJ A;  4AQY Q;  1UE7 A;  3GDE A;  1CUK A;  2AMC B;  2HD3 A;  5GAD C;  3BZD B;  1PH9 A;  1CKN A;  3G71 A;  2K04 A;  4EX5 A;  2OWO A;  3I4M B;  2F0L A;  3J7A F;  1RHP A;  2WIN B;  1QNU A;  1AEX A;  3HOW B;  4HID A;  4HJ7 A;  5C3W A;  3M4O H;  1O7I A;  4C3H B;  5E3F A;  1R9T H;  4B3R Q;  1ILP A;  1H95 A;  1VQO A;  1U4M A;  3S24 A;  1LM0 A;  4DK1 A;  2AKW B;  1I4H A;  4X62 L;  1GJX A;  3J80 L;  2E2H B;  2NVY H;  1EU4 A;  2JN4 A;  3CAM A;  5BN3 A;  1B9M A;  4DGZ A;  2OCE A;  1IHZ A;  5CV4 A;  5JJI A;  4ABN A;  4BBR B;  3TEH B;  1X9N A;  4A3M H;  1DXM A;  5FK9 C;  4I7A A;  3KLS X;  1K83 B;  2KHI A;  3MAQ A;  1TS3 A;  1DOL A;  3A8I E;  4HED A;  2K33 A;  4IPD A;  3VYS A;  3I56 A;  2JA7 H;  3TP6 A;  4ZUJ A;  1EEF D;  3A0J A;  2A1A A;  5I6Y A;  2EJF C;  4RHR A;  3C2P A;  3FEW X;  1JT8 A;  3BZC A;  1JMC A;  4IQZ A;  2K52 A;  2VY3 A;  5EKI A;  1E1T A;  1U4P A;  3KDF B;  3D8G A;  1L1O C;  4PMC A;  2MP1 A;  3QR8 A;  5GAE C;  1GM5 A;  2PI2 E;  2EYP A;  3S2H H;  2IY5 B;  1V8Q A;  3PQI A;  5FKA C;  1VF5 C;  1TWG H;  3V2T A;  4RGN A;  3I8Z A;  4DR5 Q;  1XTC D;  4ZUI A;  3CXC A;  4JI1 L;  4RKB A;  5JVG 3;  1NE3 A;  2F0U A;  1ML0 D;  1IXR A;  3CP0 A;  2MO1 A;  4C3I B;  3GTG H;  4RH6 A;  2HQL A;  1WTH A;  4XQJ A;  4B3T L;  1VQG A;  2E2D C;  1EIF A;  4GNX C;  1IBK Q;  4KD4 A;  1K3B C;  1C4Q A;  1I4R A;  4BBS G;  1BO0 A;  1GXD C;  1N34 Q;  1SNP A;  1N36 L;  4LF9 Q;  1CFM A;  4RHS A;  1YVC A;  1KIX A;  1JB3 A;  1CQV A;  1Z7T A;  4IPG A;  3R93 A;  5C3E B;  1Q12 A;  4DAY A;  3HOW H;  2LSS A;  4WJ3 M;  3CCJ A;  3SE0 A;  2Q2H A;  3MC0 B;  4C3H H;  2K5W A;  2L4N A;  3UDI A;  4R9W A;  4JI4 Q;  1GUW A;  2WV6 D;  5J22 A;  4YY3 L;  3KK7 A;  5KNB A;  1VQC A;  4KTA A;  4OGQ C;  1JE4 A;  4LFA Q;  1PFN A;  2A74 C;  5C4J H;  4QMG A;  4WJ4 A;  2F52 A;  4QGU A;  1VMC A;  5FJ8 H;  2E2H H;  4MZ9 A;  5M3M B; 
#chains in the Genus database with same CATH homology
 1SE3 A;  1A3U A;  3DMU A;  1U9R A;  1TWC B;  4KN4 C;  1BCP F;  4A3I B;  1WTQ A;  1R4P B;  5ELC A;  2EYM A;  5NUC A;  3VR4 A;  4YIJ A;  1TR5 A;  1GUS A;  1F9R A;  2XRQ D;  1SXT A;  4XT1 B;  1CTM A;  1PTO D;  4IUT A;  2PCF B;  4QIW B;  2A6H D;  4RGO S;  1QB5 D;  2KCC A;  1CM9 A;  2D62 A;  1HQR D;  1SYE A;  3C46 A;  1NUC A;  1X3P A;  3KBX A;  4NDX A;  1GUN A;  1OXX K;  4I65 A;  2PW7 A;  2E2I B;  5FO7 B;  4F87 A;  3TME A;  1EYD A;  1D2B A;  4K6L A;  1NCV A;  2MGS A;  2WKD A;  3H09 A;  3QJY A;  1JOK A;  4X3K A;  2QDB A;  4WJW A;  3BDO A;  1ROD A;  3K7A B;  1L0X B;  3G7L A;  1A3T A;  2R7Z B;  4H0L C;  1BNZ A;  2CW0 C;  1LLR D;  1I3Q B;  2IW3 A;  5I6W A;  1DOM A;  2LKV A;  1TQO A;  2KHS A;  3MFY A;  3OSO A;  5E4W C;  3I3C A;  1JOQ A;  3NTK A;  1LAB A;  2A68 C;  1WTV A;  1JOR A;  1F9P A;  5KGU A;  1ET9 A;  5I9O A;  3QOJ A;  4C3I G;  3S9W A;  3GTO B;  2B2Y C;  3FKI B;  2IWH A;  3SHL A;  3WOE A;  3D4R A;  1NAP A;  2WB1 B;  2KUM A;  1LT3 D;  2CVR A;  4IN3 A;  4BA2 I;  2EY5 A;  4KMU C;  4KKT A;  2F0K A;  1YNN C;  2FJ2 A;  3GV6 A;  3HRZ C;  4HCS A;  4RGT A;  3CQZ B;  4BY7 B;  1AP0 A;  1PRT B;  4IUR A;  1I4Q A;  3S17 B;  4BWG B;  1TVX A;  1I50 B;  2B8F A;  2PW5 A;  5A2Q E;  1PDQ A;  4G4K A;  4RGM A;  4WOR A;  2LMC B;  1O7Y A;  1NR2 A;  1EIG A;  2BA1 A;  3R2I A;  1B2T A;  3HOX B;  1I4G A;  4NW2 A;  3RZD B;  4JK1 C;  2X69 A;  3J80 E;  1SNC A;  2DY8 A;  2PNR C;  3HKZ B;  3NP8 A;  1HUN A;  3GTK B;  4X3T A;  2AQ2 B;  1KLU D;  2XSC A;  1HTP A;  4RWS C;  5ELB A;  3N6R A;  2AQ1 B;  2JXM B;  1DD2 A;  3K5L A;  2BDO A;  2F0W A;  3PUX A;  3J7Y W;  1STA A;  2L12 A;  3AU7 A;  4XTC S;  2AWO A;  5KYL A;  2NVT B;  4CBV A;  3J7A V;  4C3J B;  2VNU D;  1PTO H;  3PMF A;  1SSO A;  2NTS A;  4ME5 A;  1K8M A;  1VDZ A;  3DWQ A;  4V0B A;  4FXD A;  2I07 B;  1H9S B;  2DNC A;  2R92 B;  2F0O A;  3DUZ A;  1S5D D;  4ODG A;  1WD0 A;  1LAC A;  3X3N A;  1FGB D;  1EQT A;  1KAB A;  3CRK C;  3QWN A;  1I6H B;  2KOL A;  1G91 A;  1OXT A;  3A54 A;  3R8B A;  1SE2 A;  4KD3 A;  5TSS A;  4HMI A;  1KAA A;  1CI3 M;  3VR5 A;  3PO2 B;  5DEH A;  3GO5 A;  2XIW A;  4CKB A;  3HEJ A;  1SMY D;  4FXG C;  1CA5 A;  1BXT A;  2J0T D;  4CKC A;  2F0J A;  3D6C A;  4C56 C;  4XQQ A;  2OXP A;  3SEB A;  4KV6 A;  4HR7 B;  4JBW A;  3I4N B;  2JEA I;  2KED A;  1X32 A;  4KI0 A;  3JAM L;  3S1M B;  4A3B B;  3VR3 A;  1PMR A;  5CYU A;  4FF4 A;  4ZKC B;  3OPO A;  2R6G A;  2NN6 G;  1Z6H A;  4RAU C;  2Z4H A;  1KNE A;  4CJ0 B;  1EYC A;  2EYF A;  1ENF A;  2F0I A;  3IL8 A;  2PQE A;  1RTN A;  1SYB A;  1I4X A;  1ZYR D;  1YNJ C;  2OEO A;  4HSP A;  5DM7 3;  3SK4 A;  1R9T B;  5IIF A;  1ONL A;  4IFD H;  3OIP A;  3HG9 A;  3MXU A;  3T51 B;  1XYI A;  3EJI A;  2ZXR A;  3BVG A;  2XRS D;  1E2Z A;  4OO1 H;  2D2C C;  2YU9 B;  3PV0 A;  3I70 A;  2PYK A;  4L8J A;  1TS2 A;  3BDC A;  3OOC A;  5ELF A;  1EWH A;  1QJO A;  2RBM A;  1S4Z A;  3AMU A;  4HN7 A;  4X3S A;  1UEA B;  1MBY A;  5JPM C;  5KEE A;  1STE A;  1IYU A;  4FF3 A;  2ZXO A;  5CV5 A;  1HRJ A;  2M00 A;  2JA7 B;  4DF7 A;  2RA4 A;  2VB3 X;  5I4D A;  1D1K A;  3DM1 A;  2BE5 C;  1V1O A;  4TKO B;  1EYA A;  1Y69 U;  1PFB A;  2EYO A;  3SR1 A;  3HOZ B;  2KJX A;  4PQX A;  2JYO A;  3S2H B;  1TWG B;  1H9J A;  4KK7 A;  2BCO A;  2CHB D;  1TKW B;  1LTS D;  3LNN A;  3V96 A;  1EZ8 A;  3FVQ A;  3P7J A;  2QCP X;  3P1H A;  4C3J G;  1VMP A;  4PMB A;  3E0J A;  3TBI B;  2NTT A;  3I72 A;  4HCE A;  4WRD A;  1TWH B;  1D5Z C;  5T1I A;  1MI2 A;  4K2L A;  3U9O A;  1BBX C;  1LTT D;  2NWG A;  4RCO A;  3BG3 A;  3M85 A;  3PUZ A;  5C4J B;  4KHZ A;  5FLX L;  2L0C A;  5EQ0 A;  2B2U A;  1STB A;  1F2L A;  1SNO A;  2EY6 A;  3H6M A;  3I91 A;  4PV1 C;  3S14 B;  2J4X A;  3TN2 A;  5JJZ A;  2PZU A;  1PXU A;  1V1P B;  1K8O A;  2ZXP A;  3NHH A;  1EY9 A;  2N88 A;  3ND9 A;  4S3S A;  2IX3 A;  1AN8 A;  1G2T A;  1IL8 A;  1TY0 A;  4DU9 A;  3OHX C;  1JIC A;  2LS0 1;  1LT4 D;  1F9S A;  1ET6 A;  1EY6 A;  1Q1B A;  2L11 A;  1DCZ A;  4EGV A;  5F2D A;  4I7Z C;  3VR2 A;  3G6J B;  3GQB A;  1B50 A;  1H9S A;  2F0Q A;  4RKL A;  3FPU B;  2F0P A;  3OWE B;  2KQ3 A;  2SNS A;  3IKJ A;  3EA6 A;  4HSV A;  3EFX D;  3X3M A;  1O80 A;  1D5X C;  5IGG A;  1JWU D;  4Q5V A;  1PZJ D;  4PNY A;  5COR A;  1LTA D;  5CBE E;  3ND8 A;  1XWE A;  3TSS A;  4ZQ3 A;  3FMC A;  4QF4 A;  3Q23 A;  2IT1 A;  1F9Q A;  4AYB B;  4K14 A;  3TDQ A;  4EVO A;  3A55 A;  4KY7 A;  5CR3 A;  1O7L A;  1TT2 A;  1AZQ A;  3S2D B;  3A56 A;  3GD7 A;  3H94 A;  4C2M B;  1T5E A;  3NWS A;  2F0G A;  3MZ5 A;  1Y8P B;  2WP8 J;  3S1R B;  4FNF A;  1KDC A;  2XN9 C;  3Q0A A;  4HTH A;  1STN A;  3BS1 A;  4J8Q A;  4IUU A;  1WTP A;  5D3I B;  4DA2 A;  4A3F B;  3MTS A;  3T56 B;  4FYD A;  3FPP A;  4XXE A;  2Z8L A;  5FO9 B;  4A93 B;  5IOC A;  4XIG S;  4LMQ D;  3DXJ C;  2NUC A;  4G7H C;  1Y8N B;  1GHJ A;  4WFN 3;  4K8I A;  1B53 A;  1UAP A;  1HQM C;  2EPB A;  3TZU A;  1IW7 C;  4FP5 D;  2CW0 D;  3S1N B;  5EBC A;  4R8I A;  3TZD A;  2F0E A;  1FNW A;  4C3H G;  3GTQ B;  3MXP A;  3WOF A;  2K01 A;  4NMZ A;  1BF4 A;  1RF2 D;  5JEA H;  3NE5 B;  3K59 A;  4ILW A;  4KY6 A;  1ICW A;  3OMG A;  2X6G A;  5C0X I;  2BA0 A;  1AW7 A;  5IGD A;  3JAM E;  3DWA A;  1ENC A;  1F2Y A;  1HA5 A;  3J81 L;  3DWP A;  5EPJ A;  3C1E A;  3CHB D;  2J7Z A;  4ZAI A;  1EIH A;  5EBD A;  3KLR A;  3SK8 A;  1CZW A;  2FFK B;  2AWN A;  2EYL A;  2ICI A;  2HQE A;  2G9H D;  3GTM B;  2R93 B;  1B3A A;  3NTI A;  2BOS A;  5FOB B;  1MGS A;  1EY4 A;  1LTR D;  2C5C A;  2N55 A;  5KYI A;  2NVX B;  3HP3 A;  2K6A A;  4OIJ A;  2F1M A;  3KUP A;  4N9P A;  4A3E B;  3IFT A;  2A6H C;  2AUK A;  3QG1 A;  4DAV A;  5M3F B;  3LWU A;  4J1M A;  5E1F A;  1ENA A;  2IX1 A;  2WKC A;  3NXW A;  1SNQ A;  2F3V A;  3ONA B;  1PRT C;  1PTO B;  2XWB B;  4BA1 I;  1SFO B;  1B44 D;  1O7Z A;  5DAU A;  3NSW A;  3RUZ A;  4KN7 C;  4EQO A;  1EFI D;  4DN4 M;  4ZK9 B;  4IFD I;  1BR9 A;  2NZ1 D;  1PZI D;  1W6K A;  3HOY B;  1V1P A;  3AB9 A;  2F0T A;  1CA6 A;  4OO1 I;  4K5V A;  1DM0 B;  4F7X A;  5KNC A;  2M2L A;  5C5L A;  3SK5 A;  2QKI C;  2B2U C;  5K36 H;  4OIK A;  1O78 A;  1QCB D;  3PUY A;  4B9X A;  2FMM A;  4G7Z C;  3BYT B;  1BOS A;  2LFN A;  3K58 A;  5IGE A;  1D5M C;  4L6T B;  3NWT A;  1EOT A;  3VYU A;  3QO2 A;  4RA8 A;  3RD4 A;  1H9M A;  3M7N A;  5CV9 A;  5DM6 3;  1QNK A;  2ENB A;  4FF1 A;  1MD2 D;  1SND A;  2F0N A;  3A7A B;  1CK1 A;  5FLX E;  1EY5 A;  4XT3 B;  4ID6 A;  1TY2 A;  3IAY A;  3RZO B;  2E75 C;  3SXH A;  3GTL B;  1RDP D;  1KTK A;  1EWC A;  2A69 C;  1EQV A;  3BDL A;  1SE4 A;  3GP7 A;  3HOV B;  2B39 A;  4K6D A;  3T16 A;  5BN4 A;  1BDO A;  5C0X H;  1H9R A;  1BCP D;  4KY5 A;  3PUW A;  2NVQ B;  1QIL A;  2YYZ A;  1HA6 A;  4Y7N B;  1QG7 A;  5COY A;  1G6Z A;  1WVL A;  2KCN A;  1JCK B;  2JA8 B;  2HCI A;  3I73 A;  4IZ8 A;  2PZT A;  2XWJ B;  1YNJ D;  3NK9 A;  4K8J A;  1WTO A;  5AFW A;  1EZ6 A;  1DOK A;  3QIA A;  4O1N A;  1LT5 D;  1RJT A;  5EPK A;  3DHQ A;  1JWS D;  4IUP A;  2IPK D;  4LAA A;  5D14 A;  2X6L A;  5I2Y A;  1T5X D;  3E5S A;  1A2U A;  1WTW A;  1OXU A;  4KJN A;  2B8G A;  3K5N A;  3P75 A;  2E2J B;  2RDF A;  2Z4I A;  3VA7 A;  3P20 A;  3C3L A;  1JOO A;  2B2T A;  4K5X A;  1WTX A;  3NBI A;  1DON A;  5IGB A;  3KLS A;  1FNU A;  1G29 1;  4QB4 A;  3BVZ A;  1PYW D;  2PZW A;  4CGY B;  1EU3 A;  2PMZ B;  1BCP B;  1D6E C;  1SMY C;  3NQI A;  5M5Y B;  2K7V A;  4XDX A;  2MUY A;  3DEO A;  2QEJ C;  4N9T A;  4NKL A;  3OMC A;  2H4O A;  3WDN A;  1SAP A;  5BN5 A;  1EEI D;  4DFA A;  2HDM A;  4M1U B;  2OF1 A;  4MIU A;  1GOZ A;  1W6J A;  3D6W A;  3GV3 A;  3NPP A;  5CMD A;  5CGK A;  4M8A A;  1EL0 A;  4ZLT F;  3J81 E;  3S15 B;  3EVQ A;  2ICE C;  2TSS A;  3MHB A;  1PRT F;  3N52 A;  4E6I A;  4A3D B;  2A6E C;  2SEB D;  2D5D A;  4OL7 A;  4XYQ A;  1H9K A;  2A73 B;  4OO1 G;  2K32 A;  2F0D A;  1S5F D;  1CHQ D;  1QWY A;  2MHV A;  2KEE A;  2V4D A;  4FXK C;  1HHV A;  1LTI D;  2H1E A;  5EPL A;  2C9O A;  2EY1 A;  2B63 B;  3QOL A;  1D1I A;  1IKM A;  1V43 A;  2K5D A;  1XX8 A;  4FF2 A;  5C6A A;  4QUC A;  2JSO A;  2L1B A;  3T53 B;  1KNA A;  4U67 3;  3SK6 A;  2IX0 A;  1J8I A;  3MA2 B;  3VYT A;  1Q90 A;  2F0H A;  3K6O A;  2L55 A;  5CC4 A;  1OXV A;  3S1Q B;  4Q0F A;  4IUQ A;  1C48 A;  1KDA A;  3HZX A;  1E0B A;  2DY7 A;  2RDH A;  2ZT9 C;  5IGF A;  1QE6 A;  2E74 C;  2GA4 B;  3TP7 A;  5IOD A;  2JE6 I;  3D4W A;  4H13 C;  3RLF A;  5A35 A;  3K5M A;  2F0S A;  2R3Z A;  4IUN A;  2LY7 A;  4KKU A;  4Z9C B;  3MXN A;  3VR6 A;  1XXG A;  2NYZ D;  1KLG D;  4TQU S;  3D4D A;  3L3O C;  1F2M A;  2IJ0 A;  3OW7 A;  2VXW A;  1ILQ A;  5D65 A;  1QOH A;  3GTP B;  1SYC A;  4IUV A;  1CQF A;  1B4O A;  5ELE A;  1PLF A;  2BDN A;  5EJW A;  1BQQ T;  1II3 A;  1A6X A;  5I9P A;  4XYO A;  1S5C D;  3I90 A;  1SYD A;  1G8Z D;  2EDG A;  4A3J B;  4MN3 A;  2K03 A;  3FDT A;  3URY A;  5E4X A;  2HUG A;  1E2W A;  1IW7 D;  5JVH 3;  1Y1V B;  1FYC A;  3HGB A;  1TU2 B;  1FR3 A;  3E6Z X;  2M9V A;  2O5I C;  5M5X B;  3ERO A;  1WTR A;  1HCZ A;  5M9O A;  2RQX A;  4H44 C;  3L9A X;  5C3X A;  1OXS C;  4DAP A;  4FVM A;  5KIX A;  4RCN A;  1ESR A;  1NSN S;  1FD7 D;  2FHT A;  1FNV A;  3FRP B;  4FO2 A;  2KVM A;  2VUM B;  1LV9 A;  5IT9 L;  2EJM A;  1EY8 A;  3MVV A;  2B2W A;  3PIP 3;  3A7L A;  2EXZ A;  1U4L A;  1CZG A;  2EOT A;  1U4R A;  3HS0 C;  1BUV T;  3K0Y A;  2L9H A;  5C4Z A;  3W3A A;  4K2K A;  1LO5 D;  4EQP A;  2Q8R E;  2B2T C;  1JQY D;  3VA5 A;  2I46 A;  1SYF A;  1X3Q A;  4CKE A;  2EYJ A;  1IKL A;  2L5T A;  4XQN A;  4OHJ A;  3PUV A;  4F88 A;  2A68 D;  2SOB A;  5C0X J;  4TSS A;  3CU7 A;  3H3V C;  2CQA A;  1A15 A;  4L63 B;  3UI2 A;  2AUJ D;  2EVB A;  2NN6 I;  3VYR A;  3Q22 A;  3A8J E;  2QIL A;  1PRT D;  2FMC A;  1MSH A;  2WII B;  4P2C B;  1B9N A;  2MPM A;  5EKL A;  2JP1 A;  1JC7 A;  2B2V C;  5D3D A;  4A3K B;  1ESF A;  1PTO C;  5C4X B;  1YNN D;  2SNM A;  2JA6 B;  4G7O C;  5EGT A;  1L0Y B;  1STH A;  2O5J C;  1F2Z A;  4UDU C;  1GHK A;  3D3R A;  2Q8T A;  3U9S A;  2RVL A;  1PZK D;  1TWF B;  1Q8I A;  3RMH A;  1G2S A;  5JEA G;  4DXG A;  5CV7 A;  1RD9 D;  2DN8 A;  1R4Q B;  3NUC A;  4QUF A;  4KJO A;  4UAI A;  4HAE A;  1HFG A;  1VCI A;  5G3L F;  3R2T A;  4LJZ C;  5J39 A;  2D9U A;  3O13 A;  4RFB A;  2K5Q A;  5IGC A;  4IFD J;  1CHP D;  1SYG A;  2QF7 A;  2Y0S B;  1WD1 A;  3BYY B;  1IYV A;  1OO9 B;  5DNF A;  1E2V A;  3R3O A;  3HOU B;  3PIO 3;  2EZV A;  3LX0 A;  2ID0 A;  2R61 A;  4ZKB B;  1DZ1 A;  3KF8 A;  1GUT A;  2NB0 A;  4IAL A;  2A69 D;  3MEH A;  3NQT A;  3Q24 A;  1UUP A;  2NBF A;  2WAQ B;  5C44 B;  1F77 A;  3M7G A;  2O2L D;  3W2D A;  4BS9 A;  1HPC A;  3TP8 A;  4J6H A;  4O42 A;  4B9W A;  1LT6 D;  2EE1 A;  3MWY W;  2F03 A;  1EY7 A;  1ZEQ X;  1I4P A;  1ZXT A;  2TMP A;  2Z1C A;  2E76 C;  1SBB B;  2JA5 B;  1M8A A;  5ELD A;  5JAV A;  2G9D A;  2KEC A;  4F8M A;  1RTO A;  4PMW A;  1DJR D;  1STY A;  3NTH A;  5K36 G;  1PFM A;  5LL6 X;  1SJE D;  4DK0 A;  3F2U A;  4B08 A;  5JOB A;  4DNT B;  2A5H A;  3H0G B;  1TWA B;  5C5M A;  4G57 A;  1AZP A;  1I6V C;  4KKS A;  2F0V A;  4NP5 A;  1NR4 A;  3KBG A;  3PO3 B;  4A3G B;  3DEP A;  3MFG A;  3CKI B;  1J9O A;  2EY2 A;  2NN6 H;  5HUR A;  5KRU A;  5FO8 B;  2KA7 A;  4K5W A;  3TP5 A;  1TS5 A;  4GZY C;  2K05 A;  5K5P A;  3M3Y B;  1HFN A;  4X3U A;  2SDF A;  2RKS A;  1HTL D;  4DXF A;  3IFD A;  3L7Z C;  1ZKO A;  3A8K E;  5C4H A;  3CRL C;  1VF7 A;  3QB3 A;  2RSN A;  2XNA C;  1RCV D;  4V19 0;  2JEB I;  4C1N K;  1S5B D;  3GTJ B;  1RKN A;  5LHY 1;  3EQL C;  3S16 B;  3ZYY X;  1JWM D;  5M5W B;  2OT2 A;  4LK1 C;  5CV6 A;  2B2W C;  1SJH D;  4C1N I;  3M4Y A;  3NBH A;  5ISR A;  1JR0 D;  1HXY D;  1HUM A;  1UNS A;  2FIN B;  2PPB C;  3SVM A;  5C0X G;  2F0F A;  2F3W A;  2WAC A;  1C8C A;  4EQN A;  1GUO A;  3ERQ A;  4HMJ A;  2MJ8 A;  3OWF A;  3I4L A;  1BCP C;  1MSG A;  3OIQ A;  5JPN C;  3K5O A;  2BE5 D;  2Q8I B;  5CBA E;  4CJ1 B;  1WCM B;  2RSO A;  3V05 A;  3T13 A;  1GUG A;  1SNM A;  1Y1W B;  5IT9 E;  3T4A C;  1A2T A;  2RDG A;  1LTG D;  2DNE A;  4MHE A;  5CV8 A;  4BY1 B;  3M4O B;  4KHV A;  2A6E D;  3BVM A;  3Q6S A;  1S5E D;  1Q3L A;  1LTB D;  2NVY B;  1SDF A;  4DNR B;  3C1F A;  1PTO F;  4CHT B;  1CT1 D;  5J1Z A;  4ULL A;  4BBS B;  2K28 A;  5HGT A;  4U68 A;  2HCC A;  2EYH A;  4A3M B;  2B2V A;  2PO4 A;  5G3L D;  5LL6 S;  3LWE A;  2AQ3 B;  5T1G A;  3ITP A;  1TII D;  2XVS A;  2K1B A;  1ZYR C;  2O4X A;  1Q1E A;  3MXG A;  5EKK A;  1A3V A;  4IFD G;  1KDB A;  2EJG C;  1Z47 A;  1DYQ A;  2HDL A;  1B1Z A;  2F0M A;  2F4I A;  3SDZ A;  4R8N A;  4ZYS A;  2IL8 A;  5I2X A;  1TS4 A;  1M4V A;  4TRD A;  1Y8O B;  1SEB D;  3H91 A;  5KND A;  1AFP A;  3GTG B;  4CJ2 C;  4QCL A;  3D31 A;  5JEA J;  1EY0 A;  4H7B A;  2VB2 X;  4ZRZ A;  2B2Y A;  1STG A;  3K57 A;  5A2Q L;  3BZD B;  2K04 A;  3I4M B;  2F0L A;  3J7A F;  1RHP A;  2WIN B;  1QNU A;  1AEX A;  3HOW B;  5C3W A;  4C3H B;  5E3F A;  1ILP A;  1U4M A;  4DK1 A;  1I4H A;  1GJX A;  3J80 L;  2E2H B;  1EU4 A;  5BN3 A;  1B9M A;  4DGZ A;  1IHZ A;  5CV4 A;  4ABN A;  4BBR B;  1DXM A;  5FK9 C;  3KLS X;  1K83 B;  3MAQ A;  1TS3 A;  1DOL A;  3A8I E;  4HED A;  2K33 A;  3VYS A;  3TP6 A;  4ZUJ A;  1EEF D;  5I6Y A;  2EJF C;  4RHR A;  3C2P A;  3FEW X;  4IQZ A;  5EKI A;  1U4P A;  3D8G A;  4PMC A;  2MP1 A;  2EYP A;  1V8Q A;  5FKA C;  1VF5 C;  3V2T A;  4RGN A;  3I8Z A;  1XTC D;  4ZUI A;  4RKB A;  5JVG 3;  2F0U A;  1ML0 D;  4C3I B;  4RH6 A;  4XQJ A;  2E2D C;  4KD4 A;  1C4Q A;  1I4R A;  1BO0 A;  1GXD C;  1SNP A;  1CFM A;  4RHS A;  1JB3 A;  1CQV A;  1Z7T A;  3R93 A;  5C3E B;  1Q12 A;  4DAY A;  3SE0 A;  3MC0 B;  2K5W A;  2L4N A;  4R9W A;  1GUW A;  2WV6 D;  5J22 A;  3KK7 A;  5KNB A;  4KTA A;  4OGQ C;  1JE4 A;  1PFN A;  2A74 C;  4QMG A;  1VMC A;  5M3M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...