1U4RA

Crystal structure of human rantes mutant 44-aana-47
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
62
Chain Sequence
b'SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTNAQVCANPEKKWVREYINSLEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A5
publication title The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Attractant
total genus 11
structure length 62
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u4rA00
1ZXTA 2IL8A 3H91A 5EPJA 5EPKA 4CJ2C 5DNFA 2HCIA 2FINB 4MHEA 1HA6A 2EOTA 1KNAA 5D65A 5AFWA 1B2TA 3MWYW 1G91A 2FHTA 1KNEA 4X3KA 4U68A 2EPBA 1B50A 3D6WA 3I8ZA 1QNKA 1PFBA 1J9OA 1X32A 1JICA 1NR2A 1QG7A 4UAIA 2B2WC 4HAEA 4R8IA 2FMMA 4IUQA 2K03A 2XIWA 1F9QA 1VMCA 2SDFA 1NAPA 3FDTA 1QE6A 1BO0A 1NR4A 1WTPA 5D14A 1LV9A 1BNZA 1ESRA 3UI2A 1E0BA 3I90A 1XYIA 3IL8A 2RA4A 4O42A 5EQ0A 4DN4M 4CJ1B 1U4MA 1IL8A 1M8AA 2JP1A 2K28A 1SSOA 1RJTA 2X6GA 3F2UA 1U4PA 5COYA 3R93A 2KEEA 2L9HA 1O7YA 2X6LA 2J7ZA 1CA6A 1WD0A 2HDLA 3ONAB 2FJ2A 3I91A 2MGSA 5CBAE 1F9RA 1U4LA 1EOTA 1GUWA 4OIKA 3HP3A 2MPMA 4HEDA 2FFKB 4X3UA 1EL0A 2D9UA 1RHPA 4ZLTF 2MP1A 2B2TA 1PDQA 4ZKBB 3MTSA 4IURA 1WTRA 1RTNA 1HFGA 1X3QA 1IKMA 2B2YA 1ML0D 1X3PA 4LMQD 2K05A 2L1BA 2BDNA 2X69A 3I3CA 1RTOA 1MI2A 3GV6A 4QUCA 3FPUB 3LWEA 1B53A 2B2VA 4CJ0B 1EQTA 1O7ZA 5T1GA 1CA5A 1HUMA 2RVLA 1MSHA 2RSNA 1F2LA 4R9WA 4MN3A 5T1IA 1S4ZA 2HCCA 1J8IA 1F9SA 1HUNA 1MGSA 3DM1A 1TVXA 1DOKA 4X3TA 1EIGA 5CBEE 4X3SA 2KOLA 1WTVA 1CM9A 1G2TA 1VMPA 3KUPA 1F9PA 2JYOA 3GV3A 5EJWA 4ZKCB 2DY7A 2B2UA 1WTOA 1A15A 2Q8RE 1B3AA 1PLFA 2HDMA 4HCSA 2NYZD 2K04A 2HUGA 2N88A 3DEOA 2NZ1D 4IUTA 5E4WC 1C8CA 4IUPA 1DONA 1ILPA 3TZDA 1SAPA 2DY8A 2L11A 1EIHA 4ZAIA 2M2LA 2NWGA 1DOMA 2KEDA 1B4OA 2RSOA 1WD1A 1BBXC 1HRJA 1G6ZA 5E4XA 3TN2A 3SVMA 1WTXA 2KECA 2CVRA 4ZK9B 1HHVA 2N55A 5JJZA 2B2WA 1MSGA 2KVMA 2K1BA 2EE1A 1DOLA 1HFNA 3KBXA 1ILQA 3IFDA 5EPLA 1WVLA 2L12A 3P7JA 1AZPA 2B2YC 2K01A 4RWSC 3DEPA 1SDFA 1PFNA 3G7LA 1JE4A 4IUUA 5CORA 4IUVA 1DZ1A 4RA8A 2B2VC 1WTQA 4OIJA 1U4RA 5CMDA 1Q3LA 2R3ZA 1RODA 1XX8A 4XT1B 4QUFA 1PFMA 3Q6SA 1AZQA 4XT3B 1ICWA 2B2UC 2MJ8A 5EKIA 1G2SA 1O80A 1AP0A 4NW2A 1BF4A 2VXWA 2Q8TA 3QO2A 1IKLA 1NCVA 3N52A 2L4NA 4RAUC 2B2TC 4XDXA 1WTWA 2KUMA 2H1EA 4HSVA
chains in the Genus database with same CATH superfamily
3BU2A 3GTLB 3GTPB 2J4XA 3J80L 4AYBG 4X62Q 1Q90A 3J80c 2F1MA 5IYBH 3W3AA 5IWAQ 1X32A 5NUCA 1BCPD 2BA0A 1SRUA 1VQKA 4H02A 1Y1WH 3IL8A 1M1KC 1SSOA 1QZGA 5C4JH 2X6LA 4AQYL 1SROA 1QOHA 1PH6A 1RIPA 1F9RA 2I5HA 1Q1BA 4IURA 2AWNA 5EBCA 3NTKA 2A8VA 2I5MX 4OONA 4C2MB 3I3CA 4L5TA 1GXDC 1C9OA 2ES2A 4ALPA 3A8KE 2WV6D 4IN3A 2B2VA 4CJ0B 4JBMA 3P1HA 2B63H 1JOOA 1F2ZA 1E3PA 1W6JA 3K7AH 3PO3G 4UDUC 1WTHA 2ZTEA 3CQZH 3K8AA 1VQOA 1TVXA 2JA6G 2XRSD 1NUCA 3S2DB 3DHQA 1V43A 3J81E 4MTKA 4RG1A 4RGNA 4K2LA 1X56A 4KI0A 3GTGH 5FLMH 1LTRD 4LF5L 2G9DA 1DONA 5CV8A 4LF6L 2KEDA 4RCOA 2RSOA 1G6ZA 1AW7A 2MO1A 3S2HB 3H0GH 1BKBA 1CHQD 5D3IB 4PNYA 4JI5L 4KHZA 5GAEC 1L0XB 2K1BA 4UPAA 3KLRA 1YHAA 3RLFA 4A3IH 1I4RA 2VUMB 3IAYA 1KQSA 4DV7Q 1CK1A 1VQEA 2D0OA 2Z1CA 2PMZE 3K5MA 4GOPC 1H9SB 1RODA 4KMUC 2D62A 4OWTB 1IZ6A 3I72A 1Y1VB 4NMZA 1F77A 5JEAH 3IRBA 4QIWB 1KC8C 4L6TB 1HQMC 1YNXA 2UXBL 1I50B 3CF5A 2ZXOA 2TSSA 2IHFA 4AQYQ 3KOJA 2Y0SE 4PZ6A 1QNUA 3I4MB 3T4AC 3E9IA 4HIDA 4B08A 1Y8NB 4HIOA 1KL9A 4AYBB 4HAEA 2R7ZG 3SXHA 3I73A 2DUDA 1BOSA 2HD3A 1L1OA 4NB3A 5C44G 5EQ0A 1PRTD 3R2IA 4A3DG 5FLXE 1FNWA 1TKWB 2JN4A 1CA6A 4A3MG 1MHWC 1RHPA 3D0FA 1LABA 3BVGA 1HFGA 1XTCD 4LF5Q 1D7QA 3KJOA 4A3GG 4I65A 2LSSA 3HOZG 4A3EG 1J6QA 4N9PA 1LTID 1K0SA 3W2DA 1OXSC 1MSHA 3C2PA 4LWCA 3Q8DA 1CUKA 4MN3A 1S4ZA 3TZUA 3DM1A 1VQHA 4JI5Q 3KFUA 4YHHL 3PO2B 3D6CA 3HOUG 1W6KA 2JEBI 3Q0AA 2PW5A 4IUPA 1PHJA 1LTSD 1VF5C 2NUCA 4JG2A 3RZDH 2NBFA 4TSSA 3C3LA 4UY8C 4R4OA 3PIO3 2UUCL 3ND8A 5E3FA 2B2WA 2J0TD 3PIP3 1S5CD 1PH7A 1G51A 1QJOA 2VB2X 4GN3B 3S15H 3K59A 1HNXL 3ITPA 1J5EL 3MXNB 1DZ1A 1FJGL 3BYYB 1CKNB 2QDBA 3SK4A 1U4RA 2H5XA 3NHHA 1I3QH 4LUOA 4G57A 2K7VA 5C3XA 4KKTA 2MJ8A 5JEAJ 2E74C 3EROA 2YU9H 5IYDG 3TEHB 1GUGA 3A8JE 4DU9A 3N52A 1SNPA 5JVG3 3H91A 3NELA 4JOIA 1MBYA 1PV4A 5AFWA 2AMCB 4BY7G 4U68A 3EFXD 4CBVA 1PTOC 2R93B 2VY3A 2XTIA 2QF7A 3OOCA 1HZAA 2VS1A 2XIWA 4PMCA 1OXTA 3I55A 2SDFA 2C35B 3MFYA 1BNZA 5C4ZA 5C6AA 1E0BA 3L9AX 4FP5D 1EWHA 1UUPA 1O7LA 3R93A 4PZ8A 5C44B 1O7YA 3A56A 1EU4A 2F0VA 3BDLA 5HY6A 1DGSA 3HZXA 4YHHQ 5EKLA 1HNWL 1ET9A 5ELEA 5A2QE 1SFOH 2A6ED 3V96A 3EN2A 3W5OA 3F8TA 4DAYA 5J39A 1KDCA 4A3LH 1QB5D 4IJLA 1RTOA 4EQOA 2WB1E 1O78A 1T9HA 1VQPA 4DR3L 1VQBA 4BBRG 1EYAA 1JJ2A 1EQTA 5T1GA 2UUCQ 2QEJC 2OWOA 4C3JG 3B6YA 1Q81C 4JI2L 2NB0A 1JE5A 1YNNC 3E3XA 1K9MC 4NPSA 1WTOA 2RCFA 5E4WC 2BDOA 4I7ZC 4C1NI 1HNXQ 1EQQA 1J5EQ 4C3HH 2E2JB 3HOUB 2VB3X 1RCVD 4BWGB 2NWGA 1QVGA 1BBXC 4DV0Q 1JWSD 1G291 2F0DA 1YI2A 1SR3A 5C3EH 1XNRL 2OT2A 1PYWD 5KGUA 4P71A 1N8RC 1VQAA 3UDFA 1ILQA 5EPLA 2R92G 1STAA 4N8X1 4YWMA 1YIJA 3TS2A 3TP6A 2JE6I 4IUVA 2DJGC 1SYGA 1PYBA 2IX0A 2ZJQA 3T53B 3ULJA 3HKZE 3JAME 3HOYB 1XX8A 5HGTA 5K36H 1ENAA 3S1NH 1FGBD 5GADC 2Q2UA 3GQBA 3SK8A 4EVOA 1O80A 2C9OA 1WI5A 4X64L 3KJPA 1TWCH 1PA6A 1BBWA 3J81i 4LFAL 2F0EA 3S16H 5IP9G 1QVCA 1YJNA 4R4TA 3A54A 1QWYA 1HA6A 1CSQA 5M5YB 4HSPA 3NQIA 1G91A 1LM0A 4YY3L 2AQ1B 2JA7H 1HNWQ 3G6JB 3MEFA 4R8IA 2LKVA 1QE6A 4QIWE 4KJOA 2XWJB 3S1QB 4UP9A 3BJUA 4DN4M 4DR3Q 3CC2A 3K0YA 4F8MA 3S1RH 3URYA 2KEEA 4PMWA 3FPPA 1ZKOA 4UP8A 4XQQA 3RD4A 1JB3A 4GZYC 3RZOB 1A2UA 1BXTA 3RLNA 4AYBE 2B2TA 3HKSA 1X6OA 4IPCA 5ELCA 1X3PA 4C3IH 2D5DA 1HZ9A 4A3FB 3PF5A 4QMGA 5C0XH 5CV4A 1O7ZA 3MHBA 1Q82C 4GOPA 1XNRQ 4BBRB 5KNDA 1HUNA 5IOCA 4LFCQ 1N9WA 4R4IA 3M4OB 2N78A 4C3JB 1WTXA 3PIOA 3T13A 1EY5A 2HUGA 5IYCG 1TS4A 1KD1C 1U9RA 4ZRZA 3PIPA 2O5IC 1EIHA 1LTGD 4LAAA 1E1OA 3CC7A 2PI2E 2IWHA 1LT5D 3PCOB 3E5SA 1EY0A 5IE8A 5JOBA 1GOZA 1LTBD 4XXEA 4QL5A 4MTNA 5C4JB 1CQVA 1DOLA 2XGTA 4ABNA 3O13A 4HMJA 4X64Q 1EQRA 4LFAQ 1AZPA 4JV5L 4LK1C 1K28A 4CKBA 4IOCA 3ERSX 3A7LA 4DR1L 3UE1A 4WRDA 4JYAL 3QR8A 1UE6A 2MHVA 3X3NA 2DJFC 4OIJA 3J80E 2UXCL 5FO9B 4YY3Q 1SYFA 1LO5D 2PI2A 1PFMA 1BCPC 4Y7NB 1TWFH 2NN6G 5KYLA 2B63B 3K7AB 1SJED 4NXML 3CQZB 1FGUA 3CCMA 4OHJA 4XDXA 4RAUC 1I6HB 2DNCA 3HOXH 1K3BC 5IT9L 5M3FG 4JI1L 5IT9c 1SMYD 2FINB 3CCRA 3KF8B 2PZTA 3MWYW 2PPBC 4LUZA 4BBSB 3I8ZA 5C5MA 1QNKA 5IP7H 4IUQA 1VMCA 4XTCS 1ESRA 2SNSA 3U4VA 2ENBA 1VQIA 3H15A 4JI0L 2OXPA 1PTOH 3ZYYX 5KRUA 1WJJA 4KHPL 2ATWA 2L9HA 2E2HH 3A5UA 4B3ML 5KNBA 3HOWB 1PH4A 1NMFA 1SYCA 4OX9L 2XSCA 4OIKA 4PMBA 4ZLTF 1IYUA 3MTSA 4RGMA 2IX3A 1Y8PB 1JOQA 4LMQD 2AUJD 3J7ZC 4DV6L 4PQXA 1YHBA 5M5WH 1T5XD 5IGCA 5C0XJ 4A3GH 1CA5A 3HOZH 4G4KA 4NXNL 3M7GA 2LMCB 1F9SA 3T1HQ 1MGSA 1IW7C 5K5PA 1F9PA 4GN4B 2F3VA 2Q8RE 1B3AA 1N34L 4UHVA 4JV5Q 2E76C 3CCUA 1PH1A 4DR1Q 2AHOB 1STYA 4JYAQ 1RD9D 3OWFA 4DKAC 1VQDA 2UXCQ 2HIVA 1NNXA 1V9PA 2HT1A 2KECA 1Z9FA 4P72A 3EIVA 5ELDA 5EAYA 1GHKA 2CQOA 1Z47A 1EY9A 3DWAA 1DJRD 1L2FA 1PZJD 4ZCKA 4NXMQ 3WDNA 1EIFA 3F1ZA 1CSPA 2K01A 4ZQ3A 3F2DA 3VR2A 1JT8A 3G7LA 4JI1Q 5J3BA 4PZ7A 2ZJPA 2WAQG 4IOAA 2JA5H 2B3GA 3UE0A 5KYIA 3A0JA 4QUFA 2M9VA 3ER0A 4K6LA 1H9RA 1D5XC 4QJFA 1QZHA 2NVTH 2VUMG 1CQFA 4WFN3 4QY7A 4JI0Q 4ME3A 5JJIA 4GKKL 2Q2TA 4KHPQ 3QB3A 5IYDH 5I6WA 3QOLA 4B3MQ 1NE3A 2VL6A 4OX9Q 1K83H 1A0IA 2CH4A 3HS0C 1TWAH 3RZDB 1PRTB 4KJNA 5ELFA 2F0WA 2FMMA 2I5LX 3S9WA 5AJ3L 1Y1VG 1F9QA 2CWPA 3FDTA 1R9TH 1JCKB 4DV6Q 3TRZA 5CGKA 3SE0A 1JB7A 5M3MH 1SNMA 1A3TA 3GTMH 3BVMA 2K28A 1STEA 5DM73 3KBGA 4NXNQ 5KIXA 3I56A 2AWOA 3J7AF 2A6HD 1TR5A 1B3QA 2HDLA 3I91A 5CBAE 4B3SL 3I4MG 1K3RA 2F4VL 5BN4A 4QQBX 5JJLA 4KN7C 2RBMA 1AN8A 1N34Q 3JAMi 1I4QA 2ZJRA 3KLSX 3KK7A 3G71A 2AUKA 1IXRA 4J8QA 1LTAD 1XNQL 4A3KH 1VQ6A 4WJ3M 3C46A 5BN5A 1BDOA 1GHJA 4IO9A 2JA8G 3MXGA 1G2TA 3KUPA 3QWNA 2JYOA 4ZKCB 1C4QA 1JJGA 4DK0A 2F0SA 2NYZD 5DAUA 2VZAA 4K8IA 5CV7A 1CT1D 1GVPA 1B4OA 2BCOA 1X55A 5FO7B 3CP0A 4MNOA 4XQJA 1EY4A 3PGZA 1HZBA 4IFDH 1AH9A 4L8JA 2F4IA 3FKIH 2EE1A 2O4XA 4EQ5A 2KCMA 3IKJA 1VF7A 4JPBW 3PO2G 1BR9A 4GKKQ 5JPNC 2F0UA 2R7FA 2V4DA 1FVIA 1SFOB 5EGTA 1CZWA 3OMGA 2A68C 1X3GA 3CCVA 3GO5A 4QGUA 2WAQB 1TWHH 3M85A 1GO3E 1VQGA 2BE5D 3J7A5 1E22A 5AJ3Q 1SE4A 4FNFA 2NVQB 3HFZB 4A75A 1NJIC 3I7FA 2IHEA 2JQOA 1WTWA 2EYHA 1Y14B 2B2TC 1ZXTA 2EYLA 2LXKA 3PF4A 1SNOA 2DGYA 4B3SQ 1B2TA 2F4VQ 2R7DA 1OXVA 2AQ2B 1Q12A 4GLVB 2EYPA 4R4CA 4DUZL 1S40A 2A6EC 3GTOH 3DWPA 2LXJA 3D8GA 3DLLA 5C3EB 4DV2L 3K81C 5FJ8G 4KN4C 4K2KA 3IFTA 4KK7A 2XN9C 2F0LA 2KENA 1EY6A 2X6GA 1Z6HA 4POFA 1XNQQ 3WWVA 1BBUA 4DUYL 4DF7A 1VDZA 3PQIA 3MXUA 3RUZA 4HIKA 1HZCA 3G48A 1EL0A 4K5WA 3TSSA 2YYZA 4H13C 3J80i 2R93G 2ASBA 1RDPD 2EQSA 4RH6A 2QILA 1MD2D 4OO1H 3K57A 1CTMA 2KA7A 4A93H 1VQ4A 4DFAA 2F0PA 5IGFA 3S1NB 1E2VA 2C5CA 2QDLA 3SR1A 1D1KA 1I4PA 1ONLA 3T56B 4N8FA 2JSOA 4BY1H 4X3TA 3S16B 1EY7A 2KOLA 3QG1A 5I2YA 3E6ZX 1KRTA 5I9PA 3M3YB 4HJ7A 1SXTA 3I4LA 4YCUA 4HCSA 2JA8B 2OTJA 2NZ1D 1TT2A 1YNJD 5LHY1 4JBJA 2K32A 1XPOA 1M4VA 2BOSA 3WOFA 4A3JH 2PZWA 1VCIA 2CVRA 5CC4A 1LT4D 4IALA 4WJ4A 2L55A 5C0XI 1YITA 4IFDJ 5ELNA 2DNEA 4K5VA 4J6HA 3CHBD 2KCCA 1HA5A 1JWMD 5CORA 1TXYA 2E2IH 3RNUA 2ZM6L 2EXDA 1WTQA 4JVZA 3D4DA 4GNXB 2CW0D 2HQLA 4K14A 5CMDA 2EJMA 2F0TA 4GLXA 2PW7A 3CMAA 1X9NA 1MKHA 3CC4A 4TQUS 4DUZQ 2QKIC 4DV2Q 3H3VC 1X65A 2NN6H 1PMRA 1SYDA 4KY7A 1GD7A 1IKLA 4FXGC 1FL0A 1NCVA 2L4NA 4IPGA 3TP5A 1D2BA 4RHRA 4G7OC 4DUYQ 3VYSA 4K8JA 3KLSA 3I4NH 3VA5A 2UUAL 1KAAA 3K6OA 4DA2A 2BH2A 3KDFA 4S3SA 4A3BG 4YIJA 1S5DD 4B9XA 4DV0L 3HOYG 1QG7A 4DPGA 3GTQH 1HTPA 1S5BD 4FXDA 1WTPA 5CV6A 3K5NA 1I94L 1B1ZA 1U4MA 1EZ8A 1M8AA 3GTJH 3A5ZB 5C4XH 2RHSB 1HCZA 1ZEQX 4JI6L 3HOVG 5IGGA 3ONAB 2QCPX 5GROA 3GTLH 1GUWA 3BVZA 2B8FA 2NZOA 5EKKA 1FR3A 2VQFL 1TS2A 2R6GA 1EY8A 2SNMA 4CHTB 2EY5A 3CAMA 2L1BA 4DV4L 2UXDL 2IPKD 3BZKA 4LF4L 3BDOA 2PQAA 1IL2A 1A3VA 3GD7A 3R2TA 5D3DA 3U9SA 3J81L 4DGZA 5DEHA 3J81c 3HOXB 4TVAB 3BG3A 3NPPA 5ELOA 1D5MC 1TY0A 2YTVA 2CH4W 1AFPA 2Z8LA 4JI8L 3TZDA 1WFQA 4ID6A 1UNSA 2ZM6Q 1PTOF 4RFBA 4ZAIA 4A3FG 2F3WA 3NENA 5E4XA 3KLWA 4JW0A 4R4QA 4WORA 4U673 2CQAA 3OW7A 3D3RA 1EIYB 2E2HB 2Z0SA 3LGJA 1PH3A 3IFDA 3KF6B 3NTIA 2K5VA 2EY1A 1X54A 1VQ9A 1KXLA 2I07B 4QF4A 5IYBG 2K75A 1A6XA 2UUAQ 3D4WA 5M5XB 4P73A 1SYEA 3HGBA 3SK6A 1WCMH 1Y1WG 2RKSA 1TS3A 1UEBA 1QUQB 1UEAB 3S2HH 2N49A 5EKIA 1G2SA 4FVMA 3NBHB 4LFCL 1I94Q 5ISRA 4X65L 3OMCA 2VUMH 1FNUA 2JK8A 4A76A 1LYLA 5EPKA 3CCJA 4JI6Q 4Q0FA 2WAQE 3FP9A 3TMEA 5CR3A 2VQFQ 1JICA 3V2TA 4XYQA 2A69D 4A3BB 5A35A 2B63G 1SE2A 1UE1A 4DV4Q 5I2XA 2UXDQ 4LF4Q 3ULLA 3L7ZC 1E2WA 5JAVA 2JP1A 4KD3A 5G3LF 1R4PB 3E9HA 1GJXA 3GTKB 5FLMG 1CZGA 1XMOL 3T51B 4O0AA 3HOVB 4DK3C 5H1SE 4HEDA 4X3UA 4O1NA 2XRQD 1GUNA 4BBSG 1KDBA 1RTNA 4JI8Q 2WACA 1SE8A 1RF2D 2BDNA 2RQXA 2CWAA 4JI3L 1Q86C 1E7ZA 1E1TA 1WOCA 3SGIA 1MIUA 1MI2A 1STNA 4X6AH 4HN7A 4B3TL 1B53A 1JOKA 2ID0A 1KAWA 3DXJC 1CFMA 3CW2C 1F2LA 3S14H 3M9BA 3HOWG 1OO9B 1FD7D 4DR5L 3U58A 1LT6D 1B9NA 4FYDA 2KCNA 1TWGB 5EJWA 2DY7A 1K83B 1FYCA 3G4SA 2L0CA 4JCVE 1TWAB 4JC0A 1H9SA 2ZTDA 1A8VA 2M2LA 3V05A 4R8NA 2E8GA 3OSOA 5JEAG 4GLAC 3CPWA 5M3MB 1PH8A 4MIUA 2QEXA 4RGOS 4ZK9B 2E5LL 4KY6A 3VR3A 3VR4A 2K5WA 4KD4A 4B3RL 1GM5A 3PO3H 1SBBB 2HQEA 3D4RA 4X65Q 2JA6H 3HRZC 4P2CB 3HEJA 5LMNW 1GUTA 3VYUA 1B9MA 1UE5A 1EYGA 1W3SA 1LT3D 3CCEA 2GVAA 3A74A 3SDZA 4XT1B 3OTOL 5JPMC 3CXCA 1VQMA 1KDAA 1OTCA 1Y1WB 2GVBA 4IUNA 2IJ0A 3T1HL 4NW2A 1BF4A 3Q23A 1D1IA 4HR7B 1IBML 1V8QA 1B8AA 1VQFA 4DR6L 1PTOD 4IFDI 5IGEA 4DR2L 1XMOQ 2A6HC 4MHEA 3H3VH 1KTKA 2A5HA 2GA4B 3CPFA 2K03A 2F0KA 2P5ZX 3S24A 3CU7A 1YJ9A 5D14A 5M9OA 4JI3Q 1S3OA 3VR5A 1JQYD 1E24A 1TQOA 1XYIA 1A3UA 5FJ8H 3NWTA 1JMCA 4B3TQ 3F2UA 3FKIB 4HMIA 5IY0A 4P74A 5TSSA 1S72A 2Z9HA 3AFQA 1LUZA 2A19A 5IGBA 3E0EA 4DR5Q 4DNRB 5I9OA 3GTGB 2V1CC 2FFKB 4IQZA 2MP1A 4TKOB 1X3QA 3STBD 1Q7YC 3TQYA 2X69A 3NEMA 2JJQA 2ZXPA 1O7IA 2R7ZH 3H0GB 1BCPF 1NMGA 4OL7A 2XWBB 3A7AB 1L1OB 1KLGD 4X66L 5C44H 4A3IB 2E5LQ 1EIGA 1KHIA 4A3DH 2XNAC 5I6YA 3MXNA 4B3RQ 2ICEC 1A15A 2CCZA 3HG9A 2EY6A 3DEOA 4Q5VA 4A3MH 1SNQA 1CKNA 2LY7A 4RCNA 1PZID 2Y0SB 1SAPA 1XWEA 2DY8A 3OHXC 2LS01 3J7AV 1DOMA 2RCNA 1N33L 2XVSA 4CKEA 2AQ3B 3ERQA 4OO1I 2K14A 4DK1A 1PZKD 3OTOQ 3VYRA 4LF7L 4A3EH 1UE7A 4N9TA 2Z6KC 2EY2A 2F3IA 1WVLA 3P7JA 2B2YC 2Z6BA 3ZJYC 1PFNA 3TDQA 1IBMQ 4DR6Q 4YWKA 4DR2Q 2NVXH 1K8AC 3HOUH 2VQEL 4HIMA 4A93B 2Q2HA 4DNIA 3Q6SA 2RDFA 4XT3B 1Z7TA 2B2UC 4BY1B 1STHA 5J22A 2D0PA 4LUVA 4Y52H 1QVFA 4DXFA 2BA1A 4M1UB 3CRLC 4KKUA 3M4PA 3EQLC 4HJAA 1PYSB 1D8LA 4A3LG 4X3KA 3TBIB 1J9OA 1P8LA 4A3JB 4ZYSA 4L5RC 1NAPA 1STGA 1CI3M 3ND9A 4F7XA 3UI2A 3W1GA 2RA4A 4O42A 1VQ7A 2N8NA 1MJEA 4L5QA 4X66Q 1PRTC 1EFID 4HJ9A 2NN6I 2E2IB 4ZUJA 4DV1L 1A63A 2CKZB 1PDQA 2EJGC 1TIID 5LL6S 4DNTB 3G6EA 1HNZL 4V0BA 4BY7H 5C3EG 3NTHA 3Q24A 4OEMB 3FPUB 1SJHD 2VNUD 1N33Q 5BN3A 4ZUIA 4CDFC 2KHSA 4K5XA 4R9WA 1SNCA 4LF7Q 4LF9Q 4F88A 1WTVA 1N36L 1K8MA 1D6EC 3S15B 3RZOH 3KYHC 4IUTA 4O2DA 2UU9L 3CKIB 1JC7A 2Q8IB 1H95A 5JVH3 3GTQB 2E75C 1I3QB 5K36G 4DAYB 1WD1A 1HRJA 2VQEQ 2NVYH 3TN2A 2HHHL 3WOEA 5EBDA 4J15A 2ICIA 2HIXA 3PMFA 2IW3A 5C4XB 4RKLA 1MSGA 4BBRH 4NP5A 2YU9B 3GDEA 3H6MA 4LF8L 3M4OH 2EYOA 2F0IA 1HQRD 1AE2A 4C3JH 4QCLA 3QOJA 2JA7G 1JE4A 3PSIA 4JI4Q 1NY4A 4RA8A 4OWWB 1EEFD 4DV3L 2G5DA 3NK9A 5E1FA 5E7NA 3R3OA 2LFNA 1C0AA 4H44C 2YTYA 1EYDA 3OWEB 4HJ5A 3U9OA 4OXPA 2KCTA 5I4DA 2EYFA 2I0QA 2WB1B 4PG3A 5GAHC 4A3CG 1A62A 1EU3A 4HSVA 4LFBQ 3AU7A 5ELBA 3OPOA 1QCBD 2B39A 2KHIA 5D65A 2R92H 1PH5A 4C3IG 3I70A 2FHTA 1B50A 4DV1Q 4DV5L 1OXUA 2I46A 5C0XG 1HNZQ 1C7YA 1JWUD 4EGVA 1LV9A 3FHWA 4CDEC 4Y7NH 3F2CA 3I90A 1XXGA 5C4HA 1YHQA 3S17H 1IL8A 2IY5B 1RJTA 3AYHB 3D31A 1I6HH 3RMHA 4K0KL 2MGSA 3CD6A 2PZUA 5IP9H 1N36Q 3MFGA 3HP3A 2MPMA 4GS3A 4KKSA 4HTHA 3U4ZA 1ENFA 4ZKBB 4C3HB 4GN5A 1EYCA 4DR7L 4FO2A 2UU9Q 2SOBA 4BBSH 2FXQA 1IKMA 2G9HD 2MUYA 1ML0D 1WCMB 1ZYRD 4APVA 3I2ZA 2F0OA 1CHPD 4QUCA 4H0LC 3HKZB 2K5HA 2HHHQ 1IW7D 4R1JA 1AEXA 4RKBA 1PH9A 1ASZA 1L0WA 2GN5A 3H94A 4DAPA 5CBEE 3HOWH 1CM9A 3R8BA 4LF8Q 4XIGS 2K50A 2HDMA 3RN5A 1RL2A 2K04A 4XQNA 1UAPA 3PUYA 3K0XA 1YBYA 1SN8A 1NSNS 1B44D 1U5KA 4PV1C 4MZ9A 4DV3Q 3AEVA 2MNAA 2EVBA 3K5OA 2N55A 1KLUD 3HOXG 2KVMA 1TWCB 3P20A 4GOPB 1XMQL 5IIFA 1BVSA 1EUJA 4RMFA 1VS0A 2KJXA 2WINB 3AQQA 3KF8A 1SDFA 4IUUA 4JBKA 1GUOA 1TS5A 1YVCA 3M4YA 5IP7G 2JA7B 3LX0A 5IYCH 1PXUA 2O5JC 4DXGA 1DD2A 2OTLA 4DV5Q 1IYJB 5GAGC 2EXZA 2IT1A 2A69C 1Y8OB 1TY2A 4V190 3S14B 3PUWA 3S1RB 1HXYD 1TU2B 2KBNA 4GNXC 3QIAA 2Z4HA 2K5DA 2OQ0A 2PO4A 2N3SA 4K0KQ 1BUVT 4GKJL 4L5SA 1KNEA 2EPBA 2UUBL 3MAQA 3D6WA 1SE3A 1PFBA 3TP8A 4LF6Q 3DWQA 4C3IB 4DR7Q 3P75A 4ME5A 1HH2P 1I4HA 1V1OA 1NR4A 1VQ5A 3OIPA 1Q8KA 2QGQA 1EEID 1SLJA 5J1ZA 1EWCA 2WFWA 1U4PA 4FF4A 3EVQA 3ULPA 1DYQA 3PO3B 3MZ5A 1GKHA 2JA6B 2RDHA 3NBIA 3I4OA 3E0JA 5M3FH 1S5FD 2D9UA 2Z6KA 3H09A 3MEHA 1WTRA 5HGQA 2B2YA 1BQQT 3H3VI 4ILWA 2EZVA 4BXXG 3VDYA 1HTLD 3LWEA 1V1PA 4FDBA 1XTDA 2A1AA 1K8GA 2RVLA 1ET6A 3S1MH 3PUVA 3PUZA 1DM0B 2HCCA 2SEBD 5FKAC 1W2BA 2EYJA 1HPCA 1E2ZA 1XMQQ 1VMPA 2UXBQ 2B2UA 3GTPH 3M7NA 5IGDA 2N88A 4TRDA 2JA5G 1C8CA 4OELB 2QW7A 2L11A 2FMCA 1K73C 5C3WA 4IPHA 5CV5A 1EQVA 1SMXA 4OWXB 3LNNA 2NTSA 3UDXA 1I4XA 1TWFB 2BH8A 1K8OA 1JR0D 2L5TA 4DK6C 4J1MA 5C5LA 1PVOA 1IBLL 2EDGA 1EFWA 2F03A 2A68D 1H9KA 3CCLA 3AMUA 3RN2A 1IBKL 1WYDA 1A2TA 2F0NA 2YV5A 4I7AA 4GKJQ 4NDXA 3A55A 2UUBQ 5LL6X 1YZ6A 5M3MG 3U50C 4C2MH 2R7ZB 2K6AA 2WIIB 1ICWA 1PTOB 1PFSA 1KRSA 3JC66 3PV0A 3BDCA 4IPDA 4A3DB 4AH6A 5FOBB 2KUMA 5IODA 3S2DH 1KIXA 4JI7L 5LMNL 4CJ2C 3NUCA 4A3MB 5IT9E 3K7UC 4DAVA 1GUSA 1SMYC 4A4IA 3C1EA 4M8AA 1NR2A 4UAIA 4P75A 2D2CC 3VR6A 5M5WB 4K6DA 3STBC 4A3KG 2ZT9C 3BYTB 4A3GB 3HOZB 4A3EB 2NVQH 1G6PA 3NWSA 1DXMA 1EZ6A 3MA2B 2MFIA 1WD0A 4IJHA 4XYOA 1YJWA 2F0QA 4QB4A 4DAMA 4FF1A 2OQKA 1U4LA 1C48A 2NVXB 1I4GA 3CMEA 3TS0A 1XJVA 1X3EA 3RLOA 1FJGQ 3FEWX 1IHZA 2K05A 5JJKA 3GV6A 4E6IA 3CCSA 4IFDG 5FLXL 2NZHA 1Y1VH 1HUMA 3FKIG 2PCFB 5FLXc 1XPUA 2RSNA 1DOKA 3K58A 2R61A 1VQNA 1I50H 2ALYB 3TREA 3ICEA 5DNFA 1IBLQ 3SK5A 4FF2A 1L0YB 2PQEA 1VQLA 5BR8L 3I4MH 4JBWA 3J7YW 3L2PA 1UWVA 1IBKQ 2JA5B 3M4QA 1H9JA 3TP7A 1F2YA 5GQOA 4BS9A 4HJ8A 3T1YL 1H9MA 3H0GG 1KABA 3J81j 4KHVA 1MJCA 1ESFA 4A3IG 2JXMB 2NVTB 2MO0A 3SEBA 2F0MA 1HFNA 3KBXA 3QJYA 1QILA 3X3MA 1S5ED 2L12A 4RWSC 3M3YH 2AKWB 3DEPA 3MVVA 2K5NA 4G7ZC 4JI7Q 2JA8H 5LMNQ 2Y0SG 3T16A 4CKCA 1G8ZD 2B2VC 2VW9A 4BY7B 2JEAI 2R3ZA 4G7HC 3VA7A 1R9TB 4KLKA 1AZQA 2K52A 1JORA 1M90C 3BS1A 3GTMB 1AP0A 2VXWA 2Q8TA 1RKNA 4YCWA 3Q22A 5CV9A 1ICFB 1I6VC 2H1EA 3EJIA 4JI2Q 4CDCC 5EPJA 4A3CH 3PO2H 2OEOA 2EOTA 4EX5A 4OO1G 2B8GA 1XPRA 4JK1C 4A93G 3K80C 4KY5A 5F2DA 2NVYB 5CYUA 5HURA 1F2MA 1BO0A 4NKLA 1OXXK 2ZXRA 3SHLA 2WKDA 4BY1G 4CDDC 4A3KB 1HJPA 2KQ3A 3MC0B 2FJ2A 1T5EA 1Q8IA 1EOTA 3W1BA 1LACA 2WP8J 4BA1I 1K0RA 2F0GA 4RHSA 5BR8Q 4C56C 4A3JG 4H7BA 2A73B 2CFMA 3UDGA 3BZCA 3T1YQ 2K33A 1HR0L 4L63B 3RR5A 4ULLA 5T1IA 2NTTA 1NBWA 3L3OC 1N32L 1I5FA 3FVQA 3GV3A 2RHQB 5A2QL 2RF4A 2R92B 3L0OA 4GNXA 2Z4IA 1AE3A 1Q46A 1L1OC 2R93H 5FK9C 1JJCB 1TWHB 4POGA 1EOVA 2PMZB 3CCQA 3AFPA 3S17B 5JJZA 1YNND 4KV6A 2JA9A 2F0HA 3I4NG 1LTTD 3EA6A 1P16A 1ASYA 1Q1EA 1BCPB 3NP8A 2ZTCA 5LMUL 3MXPA 3CRKC 3GTOB 4F87A 1CKOA 5G3LD 4OGQC 5C4XG 3NQTA 2PNRC 2WKCA 2A74C 2TMPA 4YCVA 1ENCA 1DCZA 1EWIA 2BE5C 4LF9L 4EQNA 4FXKC 1STBA 2K4KA 2DN8A 2F0FA 2Q2IA 2IL8A 2HCIA 4DR4L 3A8IE 1KNAA 1R4QB 2CHBD 5M5XH 3JAML 1X3FA 2E2JH 3JAMc 5KEEA 2B2WC 1VQCA 1SYBA 1NTGA 1CKMA 1ZYRC 3K5LA 2WB1G 1HR0Q 1SEBD 4CJ1B 4YWLA 5COYA 3DM3A 2M00A 4CGYB 2OCEA 1Y69U 2J7ZA 4RGTA 1N32Q 4JI4L 4X62L 2RDGA 4LW1A 4BA2I 5IWAL 2O2LD 1VQ8A 3KDFB 3OW2A 1LLRD 4KTAA 2PNHA 5L37A 3PUXA 4A3BH 3F2BA 4B9WA 4UP7A 3HOYH 4ODGA 1V1PB 4AIMA 4LJZC 2EYMA 4BXXH 4JOIC 2PYKA 4HCEA 1HR0W 1J8IA 2OF1A 3GTKH 3KF6A 4LFBL 3DMUA 2B29A 2IX1A 3HOVH 1PLFA 2F52A 3SVMA 1IYVA 4C3HG 3FMCA 1B70B 5M5YH 2F0JA 1ILPA 1WCMG 5DM63 2EIFA 3FRPB 1YEZA 3LWUA 3C1FA 3HKZG 1B7YB 4EQPA 1QUQA 1YNJC 3NSWA 3OIQA 1SNDA 2E2DC 5LMUQ 3NE5B 3N6RA 5KNCA 2PQAB 1HHVA 3GP7A 3NBHA 3S1QH 3EBEA 4Z9CB 1D5ZC 4LNQA 3UDIA 3VYTA 2MQHA 2EJFC 1VQJA 2YTXA 1TWGH 1PRTF 3NXWA 5M3FB 3I4NB 1II3A 1U0LA 4IZ8A 2H4OA 2KHJA 5FO8B 4DR4Q 1V1QA 1Q3LA 4C1NK 2QA4A 3AB9A 2L15A 4A3FH 2CW0C 3S1MB 3GTJB 4FF3A 4WJWA 3BZDB 1PH2A 3DUZA 3QO2A 2K5QA 1FNVA 1LTLA 3OYYA 4DV7L 5DLQE 4X3SA
chains in the Genus database with same CATH topology
3GTLB 3GTPB 2J4XA 3J80L 1Q90A 2F1MA 3W3AA 1X32A 5NUCA 1BCPD 2BA0A 3IL8A 1SSOA 2X6LA 1QOHA 1F9RA 1Q1BA 4IURA 2AWNA 5EBCA 3NTKA 4C2MB 3I3CA 1GXDC 3A8KE 2WV6D 4IN3A 2B2VA 4CJ0B 3P1HA 1JOOA 1F2ZA 1W6JA 4UDUC 1TVXA 2XRSD 1NUCA 3S2DB 3DHQA 1V43A 3J81E 4RGNA 4K2LA 4KI0A 1LTRD 2G9DA 1DONA 5CV8A 2KEDA 4RCOA 2RSOA 1G6ZA 1AW7A 3S2HB 1CHQD 5D3IB 4PNYA 4KHZA 1L0XB 2K1BA 3KLRA 3RLFA 1I4RA 2VUMB 3IAYA 1CK1A 2Z1CA 3K5MA 1H9SB 1RODA 4KMUC 2D62A 3I72A 1Y1VB 4NMZA 1F77A 5JEAH 4QIWB 4L6TB 1HQMC 1I50B 2ZXOA 2TSSA 1QNUA 3I4MB 3T4AC 4B08A 1Y8NB 4AYBB 4HAEA 3SXHA 3I73A 1BOSA 5EQ0A 1PRTD 3R2IA 5FLXE 1FNWA 1TKWB 1CA6A 1RHPA 1LABA 3BVGA 1HFGA 1XTCD 4I65A 4N9PA 1LTID 3W2DA 1OXSC 1MSHA 3C2PA 4MN3A 1S4ZA 3TZUA 3DM1A 3PO2B 3D6CA 1W6KA 2JEBI 3Q0AA 2PW5A 4IUPA 1LTSD 1VF5C 2NUCA 2NBFA 4TSSA 3C3LA 3PIO3 3ND8A 5E3FA 2B2WA 2J0TD 3PIP3 1S5CD 1QJOA 2VB2X 3K59A 3ITPA 1DZ1A 3BYYB 2QDBA 3SK4A 1U4RA 3NHHA 4G57A 2K7VA 5C3XA 4KKTA 2MJ8A 5JEAJ 2E74C 3EROA 1GUGA 3A8JE 4DU9A 3N52A 1SNPA 5JVG3 3H91A 1MBYA 5AFWA 4U68A 3EFXD 4CBVA 1PTOC 2R93B 2QF7A 3OOCA 2XIWA 4PMCA 1OXTA 2SDFA 3MFYA 1BNZA 5C4ZA 5C6AA 1E0BA 3L9AX 4FP5D 1EWHA 1UUPA 1O7LA 3R93A 5C44B 1O7YA 3A56A 1EU4A 2F0VA 3BDLA 3HZXA 5EKLA 1ET9A 5ELEA 5A2QE 2A6ED 3V96A 4DAYA 5J39A 1KDCA 1QB5D 1RTOA 4EQOA 1O78A 1EYAA 1EQTA 5T1GA 2QEJC 4C3JG 2NB0A 1YNNC 1WTOA 5E4WC 2BDOA 4I7ZC 4C1NI 2E2JB 3HOUB 2VB3X 1RCVD 4BWGB 2NWGA 1BBXC 1JWSD 1G291 2F0DA 2OT2A 1PYWD 5KGUA 1ILQA 5EPLA 1STAA 3TP6A 2JE6I 4IUVA 1SYGA 2IX0A 3T53B 3JAME 3HOYB 1XX8A 5HGTA 5K36H 1ENAA 1FGBD 3GQBA 3SK8A 4EVOA 1O80A 2C9OA 2F0EA 3A54A 1QWYA 1HA6A 5M5YB 4HSPA 3NQIA 1G91A 2AQ1B 3G6JB 4R8IA 2LKVA 1QE6A 4KJOA 2XWJB 3S1QB 4DN4M 4F8MA 3K0YA 3URYA 2KEEA 4PMWA 3FPPA 1ZKOA 4XQQA 3RD4A 1JB3A 4GZYC 3RZOB 1A2UA 1BXTA 2B2TA 5ELCA 1X3PA 2D5DA 4A3FB 4QMGA 5C0XH 5CV4A 1O7ZA 3MHBA 4BBRB 5KNDA 1HUNA 5IOCA 3M4OB 4C3JB 1WTXA 3T13A 1EY5A 2HUGA 1TS4A 1U9RA 4ZRZA 2O5IC 1EIHA 1LTGD 4LAAA 2IWHA 1LT5D 3E5SA 1EY0A 5JOBA 1GOZA 1LTBD 4XXEA 5C4JB 1CQVA 1DOLA 4ABNA 3O13A 4HMJA 1AZPA 4LK1C 4CKBA 3A7LA 4WRDA 2MHVA 3X3NA 4OIJA 3J80E 5FO9B 1SYFA 1LO5D 1PFMA 1BCPC 4Y7NB 5KYLA 2NN6G 2B63B 3K7AB 1SJED 3CQZB 4OHJA 4XDXA 4RAUC 1I6HB 2DNCA 5IT9L 1SMYD 2FINB 2PZTA 3MWYW 2PPBC 4BBSB 3I8ZA 5C5MA 1QNKA 4IUQA 1VMCA 4XTCS 1ESRA 2SNSA 2ENBA 2OXPA 1PTOH 3ZYYX 5KRUA 2L9HA 5KNBA 3HOWB 1SYCA 2XSCA 4OIKA 4PMBA 4ZLTF 1IYUA 3MTSA 4RGMA 2IX3A 1Y8PB 1JOQA 4LMQD 2AUJD 4PQXA 1T5XD 5IGCA 5C0XJ 1CA5A 4G4KA 3M7GA 2LMCB 1F9SA 1MGSA 1IW7C 5K5PA 1F9PA 2F3VA 2Q8RE 1B3AA 2E76C 1STYA 1RD9D 3OWFA 2KECA 5ELDA 1GHKA 1Z47A 1EY9A 3DWAA 1DJRD 1PZJD 3WDNA 2K01A 4ZQ3A 3VR2A 3G7LA 5KYIA 4QUFA 2M9VA 4K6LA 1H9RA 1D5XC 1CQFA 4WFN3 3QB3A 5I6WA 3QOLA 3HS0C 3RZDB 1PRTB 4KJNA 5ELFA 2F0WA 2FMMA 3S9WA 1F9QA 3FDTA 1JCKB 5CGKA 3SE0A 1SNMA 1A3TA 3BVMA 2K28A 1STEA 5DM73 3KBGA 5KIXA 2AWOA 3J7AF 2A6HD 1TR5A 2HDLA 3I91A 5CBAE 5BN4A 4KN7C 2RBMA 1AN8A 1I4QA 3KLSX 3KK7A 2AUKA 4J8QA 1LTAD 3C46A 5BN5A 1BDOA 1GHJA 3MXGA 1G2TA 3KUPA 3QWNA 2JYOA 4ZKCB 1C4QA 4DK0A 2F0SA 2NYZD 5DAUA 4K8IA 5CV7A 1CT1D 1B4OA 2BCOA 5FO7B 4XQJA 1EY4A 4IFDH 4L8JA 2F4IA 2EE1A 2O4XA 3IKJA 1VF7A 1BR9A 5JPNC 2F0UA 2V4DA 1SFOB 5EGTA 1CZWA 3OMGA 2A68C 3GO5A 2WAQB 3M85A 2BE5D 1SE4A 4FNFA 2NVQB 1WTWA 2EYHA 2B2TC 1ZXTA 2EYLA 1SNOA 1B2TA 1OXVA 2AQ2B 1Q12A 2EYPA 2A6EC 3DWPA 3D8GA 5C3EB 4KN4C 4K2KA 3IFTA 4KK7A 2XN9C 2F0LA 1EY6A 2X6GA 1Z6HA 4DF7A 1VDZA 3MXUA 3RUZA 1EL0A 4K5WA 3TSSA 2YYZA 4H13C 1RDPD 4RH6A 2QILA 1MD2D 4OO1H 3K57A 1CTMA 2KA7A 4DFAA 2F0PA 5IGFA 3S1NB 1E2VA 2C5CA 3SR1A 1D1KA 1I4PA 1ONLA 3T56B 2JSOA 3S16B 4X3TA 1EY7A 2KOLA 3QG1A 5I2YA 3E6ZX 5I9PA 3M3YB 1SXTA 3I4LA 4HCSA 2JA8B 2NZ1D 1TT2A 1YNJD 5LHY1 2K32A 1M4VA 2BOSA 3WOFA 2PZWA 1VCIA 2CVRA 5CC4A 1LT4D 4IALA 2L55A 5C0XI 4IFDJ 2DNEA 4K5VA 4J6HA 3CHBD 2KCCA 1HA5A 1JWMD 5CORA 1WTQA 3D4DA 2CW0D 5CMDA 4K14A 2EJMA 2F0TA 2PW7A 4TQUS 2QKIC 3H3VC 4KY7A 2NN6H 1PMRA 1SYDA 1IKLA 4FXGC 1NCVA 2L4NA 3TP5A 1D2BA 4RHRA 4G7OC 3VYSA 4K8JA 3KLSA 3VA5A 1KAAA 3K6OA 4DA2A 4S3SA 4YIJA 1S5DD 4B9XA 1QG7A 1HTPA 1S5BD 4FXDA 1WTPA 5CV6A 3K5NA 1B1ZA 1U4MA 1EZ8A 1M8AA 1HCZA 1ZEQX 5IGGA 3ONAB 2QCPX 1GUWA 3BVZA 2B8FA 5EKKA 1FR3A 1TS2A 2R6GA 1EY8A 2SNMA 4CHTB 2EY5A 2L1BA 2IPKD 3BDOA 1A3VA 3GD7A 3R2TA 5D3DA 3U9SA 3J81L 4DGZA 5DEHA 3HOXB 3BG3A 3NPPA 1D5MC 1TY0A 1AFPA 2Z8LA 3TZDA 4ID6A 1UNSA 1PTOF 4RFBA 4ZAIA 2F3WA 5E4XA 4WORA 4U673 2CQAA 3OW7A 3D3RA 2E2HB 3IFDA 3NTIA 2EY1A 2I07B 4QF4A 1A6XA 3D4WA 5M5XB 1SYEA 3HGBA 3SK6A 2RKSA 1TS3A 1UEAB 5EKIA 1G2SA 4FVMA 5ISRA 3OMCA 1FNUA 5EPKA 4Q0FA 3TMEA 5CR3A 1JICA 3V2TA 4XYQA 2A69D 4A3BB 5A35A 1SE2A 5I2XA 3L7ZC 1E2WA 5JAVA 2JP1A 4KD3A 5G3LF 1R4PB 1GJXA 3GTKB 1CZGA 3T51B 3HOVB 4HEDA 4X3UA 4O1NA 2XRQD 1GUNA 1KDBA 1RTNA 2WACA 1RF2D 2BDNA 2RQXA 1MI2A 1STNA 4HN7A 1B53A 1JOKA 2ID0A 3DXJC 1CFMA 1F2LA 1OO9B 1FD7D 1LT6D 1B9NA 4FYDA 2KCNA 1TWGB 5EJWA 2DY7A 1K83B 1FYCA 2L0CA 1TWAB 1H9SA 3V05A 2M2LA 4R8NA 3OSOA 5JEAG 5M3MB 4MIUA 4RGOS 4ZK9B 4KY6A 3VR3A 3VR4A 2K5WA 4KD4A 1SBBB 2HQEA 3D4RA 3HRZC 4P2CB 3HEJA 1GUTA 3VYUA 1B9MA 1LT3D 3SDZA 4XT1B 5JPMC 1KDAA 1Y1WB 4IUNA 2IJ0A 4NW2A 1BF4A 3Q23A 1D1IA 4HR7B 1V8QA 1PTOD 4IFDI 5IGEA 2A6HC 4MHEA 1KTKA 2A5HA 2GA4B 2K03A 2F0KA 3CU7A 5D14A 5M9OA 3VR5A 1JQYD 1TQOA 1XYIA 1A3UA 3NWTA 3F2UA 3FKIB 4HMIA 5TSSA 3GTGB 5IGBA 4DNRB 5I9OA 2FFKB 4IQZA 2MP1A 4TKOB 1X3QA 2X69A 2ZXPA 3H0GB 1BCPF 4OL7A 2XWBB 3A7AB 1KLGD 4A3IB 1EIGA 2XNAC 5I6YA 3MXNA 2ICEC 1A15A 3HG9A 2EY6A 3DEOA 4Q5VA 1SNQA 4RCNA 2LY7A 1PZID 2Y0SB 1SAPA 1XWEA 2DY8A 3OHXC 2LS01 3J7AV 1DOMA 2XVSA 4CKEA 2AQ3B 3ERQA 4OO1I 4DK1A 1PZKD 3VYRA 4N9TA 2EY2A 1WVLA 3P7JA 2B2YC 1PFNA 3TDQA 4A93B 3Q6SA 2RDFA 4XT3B 1Z7TA 2B2UC 4BY1B 1STHA 5J22A 4DXFA 2BA1A 4M1UB 3CRLC 4KKUA 3EQLC 4X3KA 3TBIB 1J9OA 4A3JB 4ZYSA 1NAPA 1STGA 1CI3M 3ND9A 4F7XA 3UI2A 2RA4A 4O42A 1PRTC 1EFID 2NN6I 2E2IB 4ZUJA 1PDQA 2EJGC 1TIID 5LL6S 4DNTB 4V0BA 3NTHA 3Q24A 3FPUB 1SJHD 2VNUD 5BN3A 4ZUIA 2KHSA 4K5XA 4R9WA 1SNCA 4F88A 1WTVA 3S15B 1K8MA 1D6EC 4IUTA 3CKIB 1JC7A 2Q8IB 5JVH3 3GTQB 2E75C 1I3QB 5K36G 1WD1A 1HRJA 3TN2A 3WOEA 5EBDA 2ICIA 3PMFA 2IW3A 5C4XB 4RKLA 1MSGA 4NP5A 2YU9B 3H6MA 2EYOA 2F0IA 1HQRD 4QCLA 3QOJA 1JE4A 4RA8A 1EEFD 3NK9A 5E1FA 3R3OA 2LFNA 4H44C 1EYDA 3OWEB 3U9OA 5I4DA 2EYFA 2WB1B 1EU3A 4HSVA 3AU7A 5ELBA 3OPOA 1QCBD 2B39A 5D65A 4C3IG 3I70A 2FHTA 1B50A 1OXUA 2I46A 5C0XG 1JWUD 4EGVA 1LV9A 3I90A 1XXGA 5C4HA 1IL8A 1RJTA 3D31A 3RMHA 2MGSA 2PZUA 3MFGA 3HP3A 2MPMA 4KKSA 4HTHA 1ENFA 4ZKBB 4C3HB 1EYCA 4FO2A 2SOBA 1IKMA 2G9HD 2MUYA 1ML0D 1WCMB 1ZYRD 2F0OA 1CHPD 4QUCA 4H0LC 3HKZB 1IW7D 1AEXA 4RKBA 3H94A 4DAPA 5CBEE 1CM9A 3R8BA 4XIGS 2HDMA 2K04A 4XQNA 1UAPA 3PUYA 1NSNS 1B44D 4PV1C 2EVBA 3K5OA 2N55A 1KLUD 2KVMA 1TWCB 3P20A 5IIFA 2KJXA 2WINB 3KF8A 1SDFA 4IUUA 1GUOA 1TS5A 3M4YA 2JA7B 3LX0A 1PXUA 2O5JC 4DXGA 1DD2A 2EXZA 2IT1A 2A69C 1Y8OB 1TY2A 4V190 3S14B 3PUWA 3S1RB 1HXYD 1TU2B 3QIAA 2Z4HA 2K5DA 2PO4A 1BUVT 1KNEA 2EPBA 3MAQA 3D6WA 1SE3A 1PFBA 3TP8A 3DWQA 4C3IB 3P75A 4ME5A 1I4HA 1V1OA 1NR4A 3OIPA 1EEID 5J1ZA 1EWCA 1U4PA 4FF4A 3EVQA 1DYQA 3PO3B 3MZ5A 2JA6B 2RDHA 3NBIA 3E0JA 1S5FD 2D9UA 3H09A 3MEHA 1WTRA 2B2YA 1BQQT 4ILWA 2EZVA 1HTLD 3LWEA 1V1PA 2RVLA 1ET6A 3PUVA 3PUZA 1DM0B 2HCCA 2SEBD 5FKAC 2EYJA 1HPCA 1E2ZA 1VMPA 2B2UA 3M7NA 5IGDA 2N88A 4TRDA 1C8CA 2L11A 2FMCA 5C3WA 5CV5A 1EQVA 3LNNA 2NTSA 1I4XA 1TWFB 1K8OA 1JR0D 2L5TA 4J1MA 5C5LA 2EDGA 2F03A 2A68D 1H9KA 3AMUA 1A2TA 2F0NA 4NDXA 3A55A 5LL6X 2R7ZB 2K6AA 2WIIB 1ICWA 1PTOB 3PV0A 4A3DB 3BDCA 5FOBB 2KUMA 5IODA 4CJ2C 3NUCA 4A3MB 5IT9E 4DAVA 1GUSA 1SMYC 3C1EA 4M8AA 1NR2A 4UAIA 2D2CC 3VR6A 5M5WB 4K6DA 2ZT9C 3BYTB 4A3GB 3HOZB 4A3EB 3NWSA 1DXMA 1EZ6A 3MA2B 1WD0A 4XYOA 2F0QA 4QB4A 4FF1A 1U4LA 1C48A 2NVXB 1I4GA 3FEWX 1IHZA 2K05A 3GV6A 4E6IA 4IFDG 5FLXL 1HUMA 2PCFB 2RSNA 1DOKA 3K58A 2R61A 5DNFA 3SK5A 4FF2A 1L0YB 2PQEA 4JBWA 3J7YW 2JA5B 1H9JA 3TP7A 1F2YA 4BS9A 1H9MA 1KABA 4KHVA 1ESFA 2JXMB 2NVTB 3SEBA 2F0MA 1HFNA 3KBXA 3QJYA 1QILA 3X3MA 1S5ED 2L12A 4RWSC 3DEPA 3MVVA 4G7ZC 3T16A 4CKCA 1G8ZD 2B2VC 4BY7B 2JEAI 2R3ZA 4G7HC 3VA7A 1R9TB 1AZQA 1JORA 3BS1A 3GTMB 1AP0A 2VXWA 2Q8TA 1RKNA 3Q22A 5CV9A 1I6VC 2H1EA 3EJIA 5EPJA 2OEOA 2EOTA 4OO1G 2B8GA 4JK1C 4KY5A 5F2DA 2NVYB 5HURA 5CYUA 1F2MA 1BO0A 4NKLA 1OXXK 2ZXRA 3SHLA 2WKDA 4A3KB 2KQ3A 3MC0B 2FJ2A 1T5EA 1Q8IA 1EOTA 1LACA 2WP8J 4BA1I 2F0GA 4RHSA 4C56C 4H7BA 2A73B 2K33A 4L63B 4ULLA 5T1IA 2NTTA 3L3OC 3FVQA 3GV3A 5A2QL 2R92B 2Z4IA 5FK9C 1TWHB 2PMZB 3S17B 5JJZA 1YNND 4KV6A 2F0HA 1LTTD 3EA6A 1Q1EA 1BCPB 3NP8A 3MXPA 3CRKC 3GTOB 4F87A 5G3LD 4OGQC 3NQTA 2PNRC 2WKCA 2A74C 2TMPA 1ENCA 1DCZA 2BE5C 4EQNA 4FXKC 1STBA 2DN8A 2F0FA 2IL8A 2HCIA 3A8IE 1KNAA 1R4QB 2CHBD 3JAML 5KEEA 2B2WC 1SYBA 1ZYRC 3K5LA 4CJ1B 1SEBD 5COYA 4CGYB 2M00A 1Y69U 2J7ZA 4RGTA 2RDGA 4BA2I 2O2LD 1LLRD 4KTAA 3PUXA 4B9WA 4ODGA 1V1PB 4LJZC 2EYMA 2PYKA 4HCEA 1J8IA 2OF1A 3DMUA 2IX1A 1PLFA 3SVMA 1IYVA 4C3HG 3FMCA 2F0JA 1ILPA 5DM63 3FRPB 3LWUA 3C1FA 4EQPA 1YNJC 3NSWA 3OIQA 1SNDA 2E2DC 3NE5B 3N6RA 5KNCA 1HHVA 3GP7A 3NBHA 4Z9CB 1D5ZC 3VYTA 2EJFC 1PRTF 3NXWA 5M3FB 3I4NB 1II3A 4IZ8A 2H4OA 5FO8B 1Q3LA 4C1NK 3AB9A 2CW0C 3S1MB 3GTJB 4FF3A 4WJWA 3BZDB 3DUZA 3QO2A 2K5QA 1FNVA 4X3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXT A;  2IL8 A;  3H91 A;  5EPJ A;  5EPK A;  4CJ2 C;  5DNF A;  2HCI A;  2FIN B;  4MHE A;  1HA6 A;  2EOT A;  1KNA A;  5D65 A;  5AFW A;  1B2T A;  3MWY W;  1G91 A;  2FHT A;  1KNE A;  4X3K A;  4U68 A;  2EPB A;  1B50 A;  3D6W A;  3I8Z A;  1QNK A;  1PFB A;  1J9O A;  1X32 A;  1JIC A;  1NR2 A;  1QG7 A;  4UAI A;  2B2W C;  4HAE A;  4R8I A;  2FMM A;  4IUQ A;  2K03 A;  2XIW A;  1F9Q A;  1VMC A;  2SDF A;  1NAP A;  3FDT A;  1QE6 A;  1BO0 A;  1NR4 A;  1WTP A;  5D14 A;  1LV9 A;  1BNZ A;  1ESR A;  3UI2 A;  1E0B A;  3I90 A;  1XYI A;  3IL8 A;  2RA4 A;  4O42 A;  5EQ0 A;  4DN4 M;  4CJ1 B;  1U4M A;  1IL8 A;  1M8A A;  2JP1 A;  2K28 A;  1SSO A;  1RJT A;  2X6G A;  3F2U A;  1U4P A;  5COY A;  3R93 A;  2KEE A;  2L9H A;  1O7Y A;  2X6L A;  2J7Z A;  1CA6 A;  1WD0 A;  2HDL A;  3ONA B;  2FJ2 A;  3I91 A;  2MGS A;  5CBA E;  1F9R A;  1U4L A;  1EOT A;  1GUW A;  4OIK A;  3HP3 A;  2MPM A;  4HED A;  2FFK B;  4X3U A;  1EL0 A;  2D9U A;  1RHP A;  4ZLT F;  2MP1 A;  2B2T A;  1PDQ A;  4ZKB B;  3MTS A;  4IUR A;  1WTR A;  1RTN A;  1HFG A;  1X3Q A;  1IKM A;  2B2Y A;  1ML0 D;  1X3P A;  4LMQ D;  2K05 A;  2L1B A;  2BDN A;  2X69 A;  3I3C A;  1RTO A;  1MI2 A;  3GV6 A;  4QUC A;  3FPU B;  3LWE A;  1B53 A;  2B2V A;  4CJ0 B;  1EQT A;  1O7Z A;  5T1G A;  1CA5 A;  1HUM A;  2RVL A;  1MSH A;  2RSN A;  1F2L A;  4R9W A;  4MN3 A;  5T1I A;  1S4Z A;  2HCC A;  1J8I A;  1F9S A;  1HUN A;  1MGS A;  3DM1 A;  1TVX A;  1DOK A;  4X3T A;  1EIG A;  5CBE E;  4X3S A;  2KOL A;  1WTV A;  1CM9 A;  1G2T A;  1VMP A;  3KUP A;  1F9P A;  2JYO A;  3GV3 A;  5EJW A;  4ZKC B;  2DY7 A;  2B2U A;  1WTO A;  1A15 A;  2Q8R E;  1B3A A;  1PLF A;  2HDM A;  4HCS A;  2NYZ D;  2K04 A;  2HUG A;  2N88 A;  3DEO A;  2NZ1 D;  4IUT A;  5E4W C;  1C8C A;  4IUP A;  1DON A;  1ILP A;  3TZD A;  1SAP A;  2DY8 A;  2L11 A;  1EIH A;  4ZAI A;  2M2L A;  2NWG A;  1DOM A;  2KED A;  1B4O A;  2RSO A;  1WD1 A;  1BBX C;  1HRJ A;  1G6Z A;  5E4X A;  3TN2 A;  3SVM A;  1WTX A;  2KEC A;  2CVR A;  4ZK9 B;  1HHV A;  2N55 A;  5JJZ A;  2B2W A;  1MSG A;  2KVM A;  2K1B A;  2EE1 A;  1DOL A;  1HFN A;  3KBX A;  1ILQ A;  3IFD A;  5EPL A;  1WVL A;  2L12 A;  3P7J A;  1AZP A;  2B2Y C;  2K01 A;  4RWS C;  3DEP A;  1SDF A;  1PFN A;  3G7L A;  1JE4 A;  4IUU A;  5COR A;  4IUV A;  1DZ1 A;  4RA8 A;  2B2V C;  1WTQ A;  4OIJ A;  1U4R A;  5CMD A;  1Q3L A;  2R3Z A;  1ROD A;  1XX8 A;  4XT1 B;  4QUF A;  1PFM A;  3Q6S A;  1AZQ A;  4XT3 B;  1ICW A;  2B2U C;  2MJ8 A;  5EKI A;  1G2S A;  1O80 A;  1AP0 A;  4NW2 A;  1BF4 A;  2VXW A;  2Q8T A;  3QO2 A;  1IKL A;  1NCV A;  3N52 A;  2L4N A;  4RAU C;  2B2T C;  4XDX A;  1WTW A;  2KUM A;  2H1E A;  4HSV A; 
#chains in the Genus database with same CATH topology
 3BU2 A;  3GTL B;  3GTP B;  2J4X A;  3J80 L;  4AYB G;  4X62 Q;  1Q90 A;  3J80 c;  2F1M A;  5IYB H;  3W3A A;  5IWA Q;  1X32 A;  5NUC A;  1BCP D;  2BA0 A;  1SRU A;  1VQK A;  4H02 A;  1Y1W H;  3IL8 A;  1M1K C;  1SSO A;  1QZG A;  5C4J H;  2X6L A;  4AQY L;  1SRO A;  1QOH A;  1PH6 A;  1RIP A;  1F9R A;  2I5H A;  1Q1B A;  4IUR A;  2AWN A;  5EBC A;  3NTK A;  2A8V A;  2I5M X;  4OON A;  4C2M B;  3I3C A;  4L5T A;  1GXD C;  1C9O A;  2ES2 A;  4ALP A;  3A8K E;  2WV6 D;  4IN3 A;  2B2V A;  4CJ0 B;  4JBM A;  3P1H A;  2B63 H;  1JOO A;  1F2Z A;  1E3P A;  1W6J A;  3K7A H;  3PO3 G;  4UDU C;  1WTH A;  2ZTE A;  3CQZ H;  3K8A A;  1VQO A;  1TVX A;  2JA6 G;  2XRS D;  1NUC A;  3S2D B;  3DHQ A;  1V43 A;  3J81 E;  4MTK A;  4RG1 A;  4RGN A;  4K2L A;  1X56 A;  4KI0 A;  3GTG H;  5FLM H;  1LTR D;  4LF5 L;  2G9D A;  1DON A;  5CV8 A;  4LF6 L;  2KED A;  4RCO A;  2RSO A;  1G6Z A;  1AW7 A;  2MO1 A;  3S2H B;  3H0G H;  1BKB A;  1CHQ D;  5D3I B;  4PNY A;  4JI5 L;  4KHZ A;  5GAE C;  1L0X B;  2K1B A;  4UPA A;  3KLR A;  1YHA A;  3RLF A;  4A3I H;  1I4R A;  2VUM B;  3IAY A;  1KQS A;  4DV7 Q;  1CK1 A;  1VQE A;  2D0O A;  2Z1C A;  2PMZ E;  3K5M A;  4GOP C;  1H9S B;  1ROD A;  4KMU C;  2D62 A;  4OWT B;  1IZ6 A;  3I72 A;  1Y1V B;  4NMZ A;  1F77 A;  5JEA H;  3IRB A;  4QIW B;  1KC8 C;  4L6T B;  1HQM C;  1YNX A;  2UXB L;  1I50 B;  3CF5 A;  2ZXO A;  2TSS A;  2IHF A;  4AQY Q;  3KOJ A;  2Y0S E;  4PZ6 A;  1QNU A;  3I4M B;  3T4A C;  3E9I A;  4HID A;  4B08 A;  1Y8N B;  4HIO A;  1KL9 A;  4AYB B;  4HAE A;  2R7Z G;  3SXH A;  3I73 A;  2DUD A;  1BOS A;  2HD3 A;  1L1O A;  4NB3 A;  5C44 G;  5EQ0 A;  1PRT D;  3R2I A;  4A3D G;  5FLX E;  1FNW A;  1TKW B;  2JN4 A;  1CA6 A;  4A3M G;  1MHW C;  1RHP A;  3D0F A;  1LAB A;  3BVG A;  1HFG A;  1XTC D;  4LF5 Q;  1D7Q A;  3KJO A;  4A3G G;  4I65 A;  2LSS A;  3HOZ G;  4A3E G;  1J6Q A;  4N9P A;  1LTI D;  1K0S A;  3W2D A;  1OXS C;  1MSH A;  3C2P A;  4LWC A;  3Q8D A;  1CUK A;  4MN3 A;  1S4Z A;  3TZU A;  3DM1 A;  1VQH A;  4JI5 Q;  3KFU A;  4YHH L;  3PO2 B;  3D6C A;  3HOU G;  1W6K A;  2JEB I;  3Q0A A;  2PW5 A;  4IUP A;  1PHJ A;  1LTS D;  1VF5 C;  2NUC A;  4JG2 A;  3RZD H;  2NBF A;  4TSS A;  3C3L A;  4UY8 C;  4R4O A;  3PIO 3;  2UUC L;  3ND8 A;  5E3F A;  2B2W A;  2J0T D;  3PIP 3;  1S5C D;  1PH7 A;  1G51 A;  1QJO A;  2VB2 X;  4GN3 B;  3S15 H;  3K59 A;  1HNX L;  3ITP A;  1J5E L;  3MXN B;  1DZ1 A;  1FJG L;  3BYY B;  1CKN B;  2QDB A;  3SK4 A;  1U4R A;  2H5X A;  3NHH A;  1I3Q H;  4LUO A;  4G57 A;  2K7V A;  5C3X A;  4KKT A;  2MJ8 A;  5JEA J;  2E74 C;  3ERO A;  2YU9 H;  5IYD G;  3TEH B;  1GUG A;  3A8J E;  4DU9 A;  3N52 A;  1SNP A;  5JVG 3;  3H91 A;  3NEL A;  4JOI A;  1MBY A;  1PV4 A;  5AFW A;  2AMC B;  4BY7 G;  4U68 A;  3EFX D;  4CBV A;  1PTO C;  2R93 B;  2VY3 A;  2XTI A;  2QF7 A;  3OOC A;  1HZA A;  2VS1 A;  2XIW A;  4PMC A;  1OXT A;  3I55 A;  2SDF A;  2C35 B;  3MFY A;  1BNZ A;  5C4Z A;  5C6A A;  1E0B A;  3L9A X;  4FP5 D;  1EWH A;  1UUP A;  1O7L A;  3R93 A;  4PZ8 A;  5C44 B;  1O7Y A;  3A56 A;  1EU4 A;  2F0V A;  3BDL A;  5HY6 A;  1DGS A;  3HZX A;  4YHH Q;  5EKL A;  1HNW L;  1ET9 A;  5ELE A;  5A2Q E;  1SFO H;  2A6E D;  3V96 A;  3EN2 A;  3W5O A;  3F8T A;  4DAY A;  5J39 A;  1KDC A;  4A3L H;  1QB5 D;  4IJL A;  1RTO A;  4EQO A;  2WB1 E;  1O78 A;  1T9H A;  1VQP A;  4DR3 L;  1VQB A;  4BBR G;  1EYA A;  1JJ2 A;  1EQT A;  5T1G A;  2UUC Q;  2QEJ C;  2OWO A;  4C3J G;  3B6Y A;  1Q81 C;  4JI2 L;  2NB0 A;  1JE5 A;  1YNN C;  3E3X A;  1K9M C;  4NPS A;  1WTO A;  2RCF A;  5E4W C;  2BDO A;  4I7Z C;  4C1N I;  1HNX Q;  1EQQ A;  1J5E Q;  4C3H H;  2E2J B;  3HOU B;  2VB3 X;  1RCV D;  4BWG B;  2NWG A;  1QVG A;  1BBX C;  4DV0 Q;  1JWS D;  1G29 1;  2F0D A;  1YI2 A;  1SR3 A;  5C3E H;  1XNR L;  2OT2 A;  1PYW D;  5KGU A;  4P71 A;  1N8R C;  1VQA A;  3UDF A;  1ILQ A;  5EPL A;  2R92 G;  1STA A;  4N8X 1;  4YWM A;  1YIJ A;  3TS2 A;  3TP6 A;  2JE6 I;  4IUV A;  2DJG C;  1SYG A;  1PYB A;  2IX0 A;  2ZJQ A;  3T53 B;  3ULJ A;  3HKZ E;  3JAM E;  3HOY B;  1XX8 A;  5HGT A;  5K36 H;  1ENA A;  3S1N H;  1FGB D;  5GAD C;  2Q2U A;  3GQB A;  3SK8 A;  4EVO A;  1O80 A;  2C9O A;  1WI5 A;  4X64 L;  3KJP A;  1TWC H;  1PA6 A;  1BBW A;  3J81 i;  4LFA L;  2F0E A;  3S16 H;  5IP9 G;  1QVC A;  1YJN A;  4R4T A;  3A54 A;  1QWY A;  1HA6 A;  1CSQ A;  5M5Y B;  4HSP A;  3NQI A;  1G91 A;  1LM0 A;  4YY3 L;  2AQ1 B;  2JA7 H;  1HNW Q;  3G6J B;  3MEF A;  4R8I A;  2LKV A;  1QE6 A;  4QIW E;  4KJO A;  2XWJ B;  3S1Q B;  4UP9 A;  3BJU A;  4DN4 M;  4DR3 Q;  3CC2 A;  3K0Y A;  4F8M A;  3S1R H;  3URY A;  2KEE A;  4PMW A;  3FPP A;  1ZKO A;  4UP8 A;  4XQQ A;  3RD4 A;  1JB3 A;  4GZY C;  3RZO B;  1A2U A;  1BXT A;  3RLN A;  4AYB E;  2B2T A;  3HKS A;  1X6O A;  4IPC A;  5ELC A;  1X3P A;  4C3I H;  2D5D A;  1HZ9 A;  4A3F B;  3PF5 A;  4QMG A;  5C0X H;  5CV4 A;  1O7Z A;  3MHB A;  1Q82 C;  4GOP A;  1XNR Q;  4BBR B;  5KND A;  1HUN A;  5IOC A;  4LFC Q;  1N9W A;  4R4I A;  3M4O B;  2N78 A;  4C3J B;  1WTX A;  3PIO A;  3T13 A;  1EY5 A;  2HUG A;  5IYC G;  1TS4 A;  1KD1 C;  1U9R A;  4ZRZ A;  3PIP A;  2O5I C;  1EIH A;  1LTG D;  4LAA A;  1E1O A;  3CC7 A;  2PI2 E;  2IWH A;  1LT5 D;  3PCO B;  3E5S A;  1EY0 A;  5IE8 A;  5JOB A;  1GOZ A;  1LTB D;  4XXE A;  4QL5 A;  4MTN A;  5C4J B;  1CQV A;  1DOL A;  2XGT A;  4ABN A;  3O13 A;  4HMJ A;  4X64 Q;  1EQR A;  4LFA Q;  1AZP A;  4JV5 L;  4LK1 C;  1K28 A;  4CKB A;  4IOC A;  3ERS X;  3A7L A;  4DR1 L;  3UE1 A;  4WRD A;  4JYA L;  3QR8 A;  1UE6 A;  2MHV A;  3X3N A;  2DJF C;  4OIJ A;  3J80 E;  2UXC L;  5FO9 B;  4YY3 Q;  1SYF A;  1LO5 D;  2PI2 A;  1PFM A;  1BCP C;  4Y7N B;  1TWF H;  2NN6 G;  5KYL A;  2B63 B;  3K7A B;  1SJE D;  4NXM L;  3CQZ B;  1FGU A;  3CCM A;  4OHJ A;  4XDX A;  4RAU C;  1I6H B;  2DNC A;  3HOX H;  1K3B C;  5IT9 L;  5M3F G;  4JI1 L;  5IT9 c;  1SMY D;  2FIN B;  3CCR A;  3KF8 B;  2PZT A;  3MWY W;  2PPB C;  4LUZ A;  4BBS B;  3I8Z A;  5C5M A;  1QNK A;  5IP7 H;  4IUQ A;  1VMC A;  4XTC S;  1ESR A;  2SNS A;  3U4V A;  2ENB A;  1VQI A;  3H15 A;  4JI0 L;  2OXP A;  1PTO H;  3ZYY X;  5KRU A;  1WJJ A;  4KHP L;  2ATW A;  2L9H A;  2E2H H;  3A5U A;  4B3M L;  5KNB A;  3HOW B;  1PH4 A;  1NMF A;  1SYC A;  4OX9 L;  2XSC A;  4OIK A;  4PMB A;  4ZLT F;  1IYU A;  3MTS A;  4RGM A;  2IX3 A;  1Y8P B;  1JOQ A;  4LMQ D;  2AUJ D;  3J7Z C;  4DV6 L;  4PQX A;  1YHB A;  5M5W H;  1T5X D;  5IGC A;  5C0X J;  4A3G H;  1CA5 A;  3HOZ H;  4G4K A;  4NXN L;  3M7G A;  2LMC B;  1F9S A;  3T1H Q;  1MGS A;  1IW7 C;  5K5P A;  1F9P A;  4GN4 B;  2F3V A;  2Q8R E;  1B3A A;  1N34 L;  4UHV A;  4JV5 Q;  2E76 C;  3CCU A;  1PH1 A;  4DR1 Q;  2AHO B;  1STY A;  4JYA Q;  1RD9 D;  3OWF A;  4DKA C;  1VQD A;  2UXC Q;  2HIV A;  1NNX A;  1V9P A;  2HT1 A;  2KEC A;  1Z9F A;  4P72 A;  3EIV A;  5ELD A;  5EAY A;  1GHK A;  2CQO A;  1Z47 A;  1EY9 A;  3DWA A;  1DJR D;  1L2F A;  1PZJ D;  4ZCK A;  4NXM Q;  3WDN A;  1EIF A;  3F1Z A;  1CSP A;  2K01 A;  4ZQ3 A;  3F2D A;  3VR2 A;  1JT8 A;  3G7L A;  4JI1 Q;  5J3B A;  4PZ7 A;  2ZJP A;  2WAQ G;  4IOA A;  2JA5 H;  2B3G A;  3UE0 A;  5KYI A;  3A0J A;  4QUF A;  2M9V A;  3ER0 A;  4K6L A;  1H9R A;  1D5X C;  4QJF A;  1QZH A;  2NVT H;  2VUM G;  1CQF A;  4WFN 3;  4QY7 A;  4JI0 Q;  4ME3 A;  5JJI A;  4GKK L;  2Q2T A;  4KHP Q;  3QB3 A;  5IYD H;  5I6W A;  3QOL A;  4B3M Q;  1NE3 A;  2VL6 A;  4OX9 Q;  1K83 H;  1A0I A;  2CH4 A;  3HS0 C;  1TWA H;  3RZD B;  1PRT B;  4KJN A;  5ELF A;  2F0W A;  2FMM A;  2I5L X;  3S9W A;  5AJ3 L;  1Y1V G;  1F9Q A;  2CWP A;  3FDT A;  1R9T H;  1JCK B;  4DV6 Q;  3TRZ A;  5CGK A;  3SE0 A;  1JB7 A;  5M3M H;  1SNM A;  1A3T A;  3GTM H;  3BVM A;  2K28 A;  1STE A;  5DM7 3;  3KBG A;  4NXN Q;  5KIX A;  3I56 A;  2AWO A;  3J7A F;  2A6H D;  1TR5 A;  1B3Q A;  2HDL A;  3I91 A;  5CBA E;  4B3S L;  3I4M G;  1K3R A;  2F4V L;  5BN4 A;  4QQB X;  5JJL A;  4KN7 C;  2RBM A;  1AN8 A;  1N34 Q;  3JAM i;  1I4Q A;  2ZJR A;  3KLS X;  3KK7 A;  3G71 A;  2AUK A;  1IXR A;  4J8Q A;  1LTA D;  1XNQ L;  4A3K H;  1VQ6 A;  4WJ3 M;  3C46 A;  5BN5 A;  1BDO A;  1GHJ A;  4IO9 A;  2JA8 G;  3MXG A;  1G2T A;  3KUP A;  3QWN A;  2JYO A;  4ZKC B;  1C4Q A;  1JJG A;  4DK0 A;  2F0S A;  2NYZ D;  5DAU A;  2VZA A;  4K8I A;  5CV7 A;  1CT1 D;  1GVP A;  1B4O A;  2BCO A;  1X55 A;  5FO7 B;  3CP0 A;  4MNO A;  4XQJ A;  1EY4 A;  3PGZ A;  1HZB A;  4IFD H;  1AH9 A;  4L8J A;  2F4I A;  3FKI H;  2EE1 A;  2O4X A;  4EQ5 A;  2KCM A;  3IKJ A;  1VF7 A;  4JPB W;  3PO2 G;  1BR9 A;  4GKK Q;  5JPN C;  2F0U A;  2R7F A;  2V4D A;  1FVI A;  1SFO B;  5EGT A;  1CZW A;  3OMG A;  2A68 C;  1X3G A;  3CCV A;  3GO5 A;  4QGU A;  2WAQ B;  1TWH H;  3M85 A;  1GO3 E;  1VQG A;  2BE5 D;  3J7A 5;  1E22 A;  5AJ3 Q;  1SE4 A;  4FNF A;  2NVQ B;  3HFZ B;  4A75 A;  1NJI C;  3I7F A;  2IHE A;  2JQO A;  1WTW A;  2EYH A;  1Y14 B;  2B2T C;  1ZXT A;  2EYL A;  2LXK A;  3PF4 A;  1SNO A;  2DGY A;  4B3S Q;  1B2T A;  2F4V Q;  2R7D A;  1OXV A;  2AQ2 B;  1Q12 A;  4GLV B;  2EYP A;  4R4C A;  4DUZ L;  1S40 A;  2A6E C;  3GTO H;  3DWP A;  2LXJ A;  3D8G A;  3DLL A;  5C3E B;  4DV2 L;  3K81 C;  5FJ8 G;  4KN4 C;  4K2K A;  3IFT A;  4KK7 A;  2XN9 C;  2F0L A;  2KEN A;  1EY6 A;  2X6G A;  1Z6H A;  4POF A;  1XNQ Q;  3WWV A;  1BBU A;  4DUY L;  4DF7 A;  1VDZ A;  3PQI A;  3MXU A;  3RUZ A;  4HIK A;  1HZC A;  3G48 A;  1EL0 A;  4K5W A;  3TSS A;  2YYZ A;  4H13 C;  3J80 i;  2R93 G;  2ASB A;  1RDP D;  2EQS A;  4RH6 A;  2QIL A;  1MD2 D;  4OO1 H;  3K57 A;  1CTM A;  2KA7 A;  4A93 H;  1VQ4 A;  4DFA A;  2F0P A;  5IGF A;  3S1N B;  1E2V A;  2C5C A;  2QDL A;  3SR1 A;  1D1K A;  1I4P A;  1ONL A;  3T56 B;  4N8F A;  2JSO A;  4BY1 H;  4X3T A;  3S16 B;  1EY7 A;  2KOL A;  3QG1 A;  5I2Y A;  3E6Z X;  1KRT A;  5I9P A;  3M3Y B;  4HJ7 A;  1SXT A;  3I4L A;  4YCU A;  4HCS A;  2JA8 B;  2OTJ A;  2NZ1 D;  1TT2 A;  1YNJ D;  5LHY 1;  4JBJ A;  2K32 A;  1XPO A;  1M4V A;  2BOS A;  3WOF A;  4A3J H;  2PZW A;  1VCI A;  2CVR A;  5CC4 A;  1LT4 D;  4IAL A;  4WJ4 A;  2L55 A;  5C0X I;  1YIT A;  4IFD J;  5ELN A;  2DNE A;  4K5V A;  4J6H A;  3CHB D;  2KCC A;  1HA5 A;  1JWM D;  5COR A;  1TXY A;  2E2I H;  3RNU A;  2ZM6 L;  2EXD A;  1WTQ A;  4JVZ A;  3D4D A;  4GNX B;  2CW0 D;  2HQL A;  4K14 A;  5CMD A;  2EJM A;  2F0T A;  4GLX A;  2PW7 A;  3CMA A;  1X9N A;  1MKH A;  3CC4 A;  4TQU S;  4DUZ Q;  2QKI C;  4DV2 Q;  3H3V C;  1X65 A;  2NN6 H;  1PMR A;  1SYD A;  4KY7 A;  1GD7 A;  1IKL A;  4FXG C;  1FL0 A;  1NCV A;  2L4N A;  4IPG A;  3TP5 A;  1D2B A;  4RHR A;  4G7O C;  4DUY Q;  3VYS A;  4K8J A;  3KLS A;  3I4N H;  3VA5 A;  2UUA L;  1KAA A;  3K6O A;  4DA2 A;  2BH2 A;  3KDF A;  4S3S A;  4A3B G;  4YIJ A;  1S5D D;  4B9X A;  4DV0 L;  3HOY G;  1QG7 A;  4DPG A;  3GTQ H;  1HTP A;  1S5B D;  4FXD A;  1WTP A;  5CV6 A;  3K5N A;  1I94 L;  1B1Z A;  1U4M A;  1EZ8 A;  1M8A A;  3GTJ H;  3A5Z B;  5C4X H;  2RHS B;  1HCZ A;  1ZEQ X;  4JI6 L;  3HOV G;  5IGG A;  3ONA B;  2QCP X;  5GRO A;  3GTL H;  1GUW A;  3BVZ A;  2B8F A;  2NZO A;  5EKK A;  1FR3 A;  2VQF L;  1TS2 A;  2R6G A;  1EY8 A;  2SNM A;  4CHT B;  2EY5 A;  3CAM A;  2L1B A;  4DV4 L;  2UXD L;  2IPK D;  3BZK A;  4LF4 L;  3BDO A;  2PQA A;  1IL2 A;  1A3V A;  3GD7 A;  3R2T A;  5D3D A;  3U9S A;  3J81 L;  4DGZ A;  5DEH A;  3J81 c;  3HOX B;  4TVA B;  3BG3 A;  3NPP A;  5ELO A;  1D5M C;  1TY0 A;  2YTV A;  2CH4 W;  1AFP A;  2Z8L A;  4JI8 L;  3TZD A;  1WFQ A;  4ID6 A;  1UNS A;  2ZM6 Q;  1PTO F;  4RFB A;  4ZAI A;  4A3F G;  2F3W A;  3NEN A;  5E4X A;  3KLW A;  4JW0 A;  4R4Q A;  4WOR A;  4U67 3;  2CQA A;  3OW7 A;  3D3R A;  1EIY B;  2E2H B;  2Z0S A;  3LGJ A;  1PH3 A;  3IFD A;  3KF6 B;  3NTI A;  2K5V A;  2EY1 A;  1X54 A;  1VQ9 A;  1KXL A;  2I07 B;  4QF4 A;  5IYB G;  2K75 A;  1A6X A;  2UUA Q;  3D4W A;  5M5X B;  4P73 A;  1SYE A;  3HGB A;  3SK6 A;  1WCM H;  1Y1W G;  2RKS A;  1TS3 A;  1UEB A;  1QUQ B;  1UEA B;  3S2H H;  2N49 A;  5EKI A;  1G2S A;  4FVM A;  3NBH B;  4LFC L;  1I94 Q;  5ISR A;  4X65 L;  3OMC A;  2VUM H;  1FNU A;  2JK8 A;  4A76 A;  1LYL A;  5EPK A;  3CCJ A;  4JI6 Q;  4Q0F A;  2WAQ E;  3FP9 A;  3TME A;  5CR3 A;  2VQF Q;  1JIC A;  3V2T A;  4XYQ A;  2A69 D;  4A3B B;  5A35 A;  2B63 G;  1SE2 A;  1UE1 A;  4DV4 Q;  5I2X A;  2UXD Q;  4LF4 Q;  3ULL A;  3L7Z C;  1E2W A;  5JAV A;  2JP1 A;  4KD3 A;  5G3L F;  1R4P B;  3E9H A;  1GJX A;  3GTK B;  5FLM G;  1CZG A;  1XMO L;  3T51 B;  4O0A A;  3HOV B;  4DK3 C;  5H1S E;  4HED A;  4X3U A;  4O1N A;  2XRQ D;  1GUN A;  4BBS G;  1KDB A;  1RTN A;  4JI8 Q;  2WAC A;  1SE8 A;  1RF2 D;  2BDN A;  2RQX A;  2CWA A;  4JI3 L;  1Q86 C;  1E7Z A;  1E1T A;  1WOC A;  3SGI A;  1MIU A;  1MI2 A;  1STN A;  4X6A H;  4HN7 A;  4B3T L;  1B53 A;  1JOK A;  2ID0 A;  1KAW A;  3DXJ C;  1CFM A;  3CW2 C;  1F2L A;  3S14 H;  3M9B A;  3HOW G;  1OO9 B;  1FD7 D;  4DR5 L;  3U58 A;  1LT6 D;  1B9N A;  4FYD A;  2KCN A;  1TWG B;  5EJW A;  2DY7 A;  1K83 B;  1FYC A;  3G4S A;  2L0C A;  4JCV E;  1TWA B;  4JC0 A;  1H9S A;  2ZTD A;  1A8V A;  2M2L A;  3V05 A;  4R8N A;  2E8G A;  3OSO A;  5JEA G;  4GLA C;  3CPW A;  5M3M B;  1PH8 A;  4MIU A;  2QEX A;  4RGO S;  4ZK9 B;  2E5L L;  4KY6 A;  3VR3 A;  3VR4 A;  2K5W A;  4KD4 A;  4B3R L;  1GM5 A;  3PO3 H;  1SBB B;  2HQE A;  3D4R A;  4X65 Q;  2JA6 H;  3HRZ C;  4P2C B;  3HEJ A;  5LMN W;  1GUT A;  3VYU A;  1B9M A;  1UE5 A;  1EYG A;  1W3S A;  1LT3 D;  3CCE A;  2GVA A;  3A74 A;  3SDZ A;  4XT1 B;  3OTO L;  5JPM C;  3CXC A;  1VQM A;  1KDA A;  1OTC A;  1Y1W B;  2GVB A;  4IUN A;  2IJ0 A;  3T1H L;  4NW2 A;  1BF4 A;  3Q23 A;  1D1I A;  4HR7 B;  1IBM L;  1V8Q A;  1B8A A;  1VQF A;  4DR6 L;  1PTO D;  4IFD I;  5IGE A;  4DR2 L;  1XMO Q;  2A6H C;  4MHE A;  3H3V H;  1KTK A;  2A5H A;  2GA4 B;  3CPF A;  2K03 A;  2F0K A;  2P5Z X;  3S24 A;  3CU7 A;  1YJ9 A;  5D14 A;  5M9O A;  4JI3 Q;  1S3O A;  3VR5 A;  1JQY D;  1E24 A;  1TQO A;  1XYI A;  1A3U A;  5FJ8 H;  3NWT A;  1JMC A;  4B3T Q;  3F2U A;  3FKI B;  4HMI A;  5IY0 A;  4P74 A;  5TSS A;  1S72 A;  2Z9H A;  3AFQ A;  1LUZ A;  2A19 A;  5IGB A;  3E0E A;  4DR5 Q;  4DNR B;  5I9O A;  3GTG B;  2V1C C;  2FFK B;  4IQZ A;  2MP1 A;  4TKO B;  1X3Q A;  3STB D;  1Q7Y C;  3TQY A;  2X69 A;  3NEM A;  2JJQ A;  2ZXP A;  1O7I A;  2R7Z H;  3H0G B;  1BCP F;  1NMG A;  4OL7 A;  2XWB B;  3A7A B;  1L1O B;  1KLG D;  4X66 L;  5C44 H;  4A3I B;  2E5L Q;  1EIG A;  1KHI A;  4A3D H;  2XNA C;  5I6Y A;  3MXN A;  4B3R Q;  2ICE C;  1A15 A;  2CCZ A;  3HG9 A;  2EY6 A;  3DEO A;  4Q5V A;  4A3M H;  1SNQ A;  1CKN A;  2LY7 A;  4RCN A;  1PZI D;  2Y0S B;  1SAP A;  1XWE A;  2DY8 A;  3OHX C;  2LS0 1;  3J7A V;  1DOM A;  2RCN A;  1N33 L;  2XVS A;  4CKE A;  2AQ3 B;  3ERQ A;  4OO1 I;  2K14 A;  4DK1 A;  1PZK D;  3OTO Q;  3VYR A;  4LF7 L;  4A3E H;  1UE7 A;  4N9T A;  2Z6K C;  2EY2 A;  2F3I A;  1WVL A;  3P7J A;  2B2Y C;  2Z6B A;  3ZJY C;  1PFN A;  3TDQ A;  1IBM Q;  4DR6 Q;  4YWK A;  4DR2 Q;  2NVX H;  1K8A C;  3HOU H;  2VQE L;  4HIM A;  4A93 B;  2Q2H A;  4DNI A;  3Q6S A;  2RDF A;  4XT3 B;  1Z7T A;  2B2U C;  4BY1 B;  1STH A;  5J22 A;  2D0P A;  4LUV A;  4Y52 H;  1QVF A;  4DXF A;  2BA1 A;  4M1U B;  3CRL C;  4KKU A;  3M4P A;  3EQL C;  4HJA A;  1PYS B;  1D8L A;  4A3L G;  4X3K A;  3TBI B;  1J9O A;  1P8L A;  4A3J B;  4ZYS A;  4L5R C;  1NAP A;  1STG A;  1CI3 M;  3ND9 A;  4F7X A;  3UI2 A;  3W1G A;  2RA4 A;  4O42 A;  1VQ7 A;  2N8N A;  1MJE A;  4L5Q A;  4X66 Q;  1PRT C;  1EFI D;  4HJ9 A;  2NN6 I;  2E2I B;  4ZUJ A;  4DV1 L;  1A63 A;  2CKZ B;  1PDQ A;  2EJG C;  1TII D;  5LL6 S;  4DNT B;  3G6E A;  1HNZ L;  4V0B A;  4BY7 H;  5C3E G;  3NTH A;  3Q24 A;  4OEM B;  3FPU B;  1SJH D;  2VNU D;  1N33 Q;  5BN3 A;  4ZUI A;  4CDF C;  2KHS A;  4K5X A;  4R9W A;  1SNC A;  4LF7 Q;  4LF9 Q;  4F88 A;  1WTV A;  1N36 L;  1K8M A;  1D6E C;  3S15 B;  3RZO H;  3KYH C;  4IUT A;  4O2D A;  2UU9 L;  3CKI B;  1JC7 A;  2Q8I B;  1H95 A;  5JVH 3;  3GTQ B;  2E75 C;  1I3Q B;  5K36 G;  4DAY B;  1WD1 A;  1HRJ A;  2VQE Q;  2NVY H;  3TN2 A;  2HHH L;  3WOE A;  5EBD A;  4J15 A;  2ICI A;  2HIX A;  3PMF A;  2IW3 A;  5C4X B;  4RKL A;  1MSG A;  4BBR H;  4NP5 A;  2YU9 B;  3GDE A;  3H6M A;  4LF8 L;  3M4O H;  2EYO A;  2F0I A;  1HQR D;  1AE2 A;  4C3J H;  4QCL A;  3QOJ A;  2JA7 G;  1JE4 A;  3PSI A;  4JI4 Q;  1NY4 A;  4RA8 A;  4OWW B;  1EEF D;  4DV3 L;  2G5D A;  3NK9 A;  5E1F A;  5E7N A;  3R3O A;  2LFN A;  1C0A A;  4H44 C;  2YTY A;  1EYD A;  3OWE B;  4HJ5 A;  3U9O A;  4OXP A;  2KCT A;  5I4D A;  2EYF A;  2I0Q A;  2WB1 B;  4PG3 A;  5GAH C;  4A3C G;  1A62 A;  1EU3 A;  4HSV A;  4LFB Q;  3AU7 A;  5ELB A;  3OPO A;  1QCB D;  2B39 A;  2KHI A;  5D65 A;  2R92 H;  1PH5 A;  4C3I G;  3I70 A;  2FHT A;  1B50 A;  4DV1 Q;  4DV5 L;  1OXU A;  2I46 A;  5C0X G;  1HNZ Q;  1C7Y A;  1JWU D;  4EGV A;  1LV9 A;  3FHW A;  4CDE C;  4Y7N H;  3F2C A;  3I90 A;  1XXG A;  5C4H A;  1YHQ A;  3S17 H;  1IL8 A;  2IY5 B;  1RJT A;  3AYH B;  3D31 A;  1I6H H;  3RMH A;  4K0K L;  2MGS A;  3CD6 A;  2PZU A;  5IP9 H;  1N36 Q;  3MFG A;  3HP3 A;  2MPM A;  4GS3 A;  4KKS A;  4HTH A;  3U4Z A;  1ENF A;  4ZKB B;  4C3H B;  4GN5 A;  1EYC A;  4DR7 L;  4FO2 A;  2UU9 Q;  2SOB A;  4BBS H;  2FXQ A;  1IKM A;  2G9H D;  2MUY A;  1ML0 D;  1WCM B;  1ZYR D;  4APV A;  3I2Z A;  2F0O A;  1CHP D;  4QUC A;  4H0L C;  3HKZ B;  2K5H A;  2HHH Q;  1IW7 D;  4R1J A;  1AEX A;  4RKB A;  1PH9 A;  1ASZ A;  1L0W A;  2GN5 A;  3H94 A;  4DAP A;  5CBE E;  3HOW H;  1CM9 A;  3R8B A;  4LF8 Q;  4XIG S;  2K50 A;  2HDM A;  3RN5 A;  1RL2 A;  2K04 A;  4XQN A;  1UAP A;  3PUY A;  3K0X A;  1YBY A;  1SN8 A;  1NSN S;  1B44 D;  1U5K A;  4PV1 C;  4MZ9 A;  4DV3 Q;  3AEV A;  2MNA A;  2EVB A;  3K5O A;  2N55 A;  1KLU D;  3HOX G;  2KVM A;  1TWC B;  3P20 A;  4GOP B;  1XMQ L;  5IIF A;  1BVS A;  1EUJ A;  4RMF A;  1VS0 A;  2KJX A;  2WIN B;  3AQQ A;  3KF8 A;  1SDF A;  4IUU A;  4JBK A;  1GUO A;  1TS5 A;  1YVC A;  3M4Y A;  5IP7 G;  2JA7 B;  3LX0 A;  5IYC H;  1PXU A;  2O5J C;  4DXG A;  1DD2 A;  2OTL A;  4DV5 Q;  1IYJ B;  5GAG C;  2EXZ A;  2IT1 A;  2A69 C;  1Y8O B;  1TY2 A;  4V19 0;  3S14 B;  3PUW A;  3S1R B;  1HXY D;  1TU2 B;  2KBN A;  4GNX C;  3QIA A;  2Z4H A;  2K5D A;  2OQ0 A;  2PO4 A;  2N3S A;  4K0K Q;  1BUV T;  4GKJ L;  4L5S A;  1KNE A;  2EPB A;  2UUB L;  3MAQ A;  3D6W A;  1SE3 A;  1PFB A;  3TP8 A;  4LF6 Q;  3DWQ A;  4C3I B;  4DR7 Q;  3P75 A;  4ME5 A;  1HH2 P;  1I4H A;  1V1O A;  1NR4 A;  1VQ5 A;  3OIP A;  1Q8K A;  2QGQ A;  1EEI D;  1SLJ A;  5J1Z A;  1EWC A;  2WFW A;  1U4P A;  4FF4 A;  3EVQ A;  3ULP A;  1DYQ A;  3PO3 B;  3MZ5 A;  1GKH A;  2JA6 B;  2RDH A;  3NBI A;  3I4O A;  3E0J A;  5M3F H;  1S5F D;  2D9U A;  2Z6K A;  3H09 A;  3MEH A;  1WTR A;  5HGQ A;  2B2Y A;  1BQQ T;  3H3V I;  4ILW A;  2EZV A;  4BXX G;  3VDY A;  1HTL D;  3LWE A;  1V1P A;  4FDB A;  1XTD A;  2A1A A;  1K8G A;  2RVL A;  1ET6 A;  3S1M H;  3PUV A;  3PUZ A;  1DM0 B;  2HCC A;  2SEB D;  5FKA C;  1W2B A;  2EYJ A;  1HPC A;  1E2Z A;  1XMQ Q;  1VMP A;  2UXB Q;  2B2U A;  3GTP H;  3M7N A;  5IGD A;  2N88 A;  4TRD A;  2JA5 G;  1C8C A;  4OEL B;  2QW7 A;  2L11 A;  2FMC A;  1K73 C;  5C3W A;  4IPH A;  5CV5 A;  1EQV A;  1SMX A;  4OWX B;  3LNN A;  2NTS A;  3UDX A;  1I4X A;  1TWF B;  2BH8 A;  1K8O A;  1JR0 D;  2L5T A;  4DK6 C;  4J1M A;  5C5L A;  1PVO A;  1IBL L;  2EDG A;  1EFW A;  2F03 A;  2A68 D;  1H9K A;  3CCL A;  3AMU A;  3RN2 A;  1IBK L;  1WYD A;  1A2T A;  2F0N A;  2YV5 A;  4I7A A;  4GKJ Q;  4NDX A;  3A55 A;  2UUB Q;  5LL6 X;  1YZ6 A;  5M3M G;  3U50 C;  4C2M H;  2R7Z B;  2K6A A;  2WII B;  1ICW A;  1PTO B;  1PFS A;  1KRS A;  3JC6 6;  3PV0 A;  3BDC A;  4IPD A;  4A3D B;  4AH6 A;  5FOB B;  2KUM A;  5IOD A;  3S2D H;  1KIX A;  4JI7 L;  5LMN L;  4CJ2 C;  3NUC A;  4A3M B;  5IT9 E;  3K7U C;  4DAV A;  1GUS A;  1SMY C;  4A4I A;  3C1E A;  4M8A A;  1NR2 A;  4UAI A;  4P75 A;  2D2C C;  3VR6 A;  5M5W B;  4K6D A;  3STB C;  4A3K G;  2ZT9 C;  3BYT B;  4A3G B;  3HOZ B;  4A3E B;  2NVQ H;  1G6P A;  3NWS A;  1DXM A;  1EZ6 A;  3MA2 B;  2MFI A;  1WD0 A;  4IJH A;  4XYO A;  1YJW A;  2F0Q A;  4QB4 A;  4DAM A;  4FF1 A;  2OQK A;  1U4L A;  1C48 A;  2NVX B;  1I4G A;  3CME A;  3TS0 A;  1XJV A;  1X3E A;  3RLO A;  1FJG Q;  3FEW X;  1IHZ A;  2K05 A;  5JJK A;  3GV6 A;  4E6I A;  3CCS A;  4IFD G;  5FLX L;  2NZH A;  1Y1V H;  1HUM A;  3FKI G;  2PCF B;  5FLX c;  1XPU A;  2RSN A;  1DOK A;  3K58 A;  2R61 A;  1VQN A;  1I50 H;  2ALY B;  3TRE A;  3ICE A;  5DNF A;  1IBL Q;  3SK5 A;  4FF2 A;  1L0Y B;  2PQE A;  1VQL A;  5BR8 L;  3I4M H;  4JBW A;  3J7Y W;  3L2P A;  1UWV A;  1IBK Q;  2JA5 B;  3M4Q A;  1H9J A;  3TP7 A;  1F2Y A;  5GQO A;  4BS9 A;  4HJ8 A;  3T1Y L;  1H9M A;  3H0G G;  1KAB A;  3J81 j;  4KHV A;  1MJC A;  1ESF A;  4A3I G;  2JXM B;  2NVT B;  2MO0 A;  3SEB A;  2F0M A;  1HFN A;  3KBX A;  3QJY A;  1QIL A;  3X3M A;  1S5E D;  2L12 A;  4RWS C;  3M3Y H;  2AKW B;  3DEP A;  3MVV A;  2K5N A;  4G7Z C;  4JI7 Q;  2JA8 H;  5LMN Q;  2Y0S G;  3T16 A;  4CKC A;  1G8Z D;  2B2V C;  2VW9 A;  4BY7 B;  2JEA I;  2R3Z A;  4G7H C;  3VA7 A;  1R9T B;  4KLK A;  1AZQ A;  2K52 A;  1JOR A;  1M90 C;  3BS1 A;  3GTM B;  1AP0 A;  2VXW A;  2Q8T A;  1RKN A;  4YCW A;  3Q22 A;  5CV9 A;  1ICF B;  1I6V C;  2H1E A;  3EJI A;  4JI2 Q;  4CDC C;  5EPJ A;  4A3C H;  3PO2 H;  2OEO A;  2EOT A;  4EX5 A;  4OO1 G;  2B8G A;  1XPR A;  4JK1 C;  4A93 G;  3K80 C;  4KY5 A;  5F2D A;  2NVY B;  5CYU A;  5HUR A;  1F2M A;  1BO0 A;  4NKL A;  1OXX K;  2ZXR A;  3SHL A;  2WKD A;  4BY1 G;  4CDD C;  4A3K B;  1HJP A;  2KQ3 A;  3MC0 B;  2FJ2 A;  1T5E A;  1Q8I A;  1EOT A;  3W1B A;  1LAC A;  2WP8 J;  4BA1 I;  1K0R A;  2F0G A;  4RHS A;  5BR8 Q;  4C56 C;  4A3J G;  4H7B A;  2A73 B;  2CFM A;  3UDG A;  3BZC A;  3T1Y Q;  2K33 A;  1HR0 L;  4L63 B;  3RR5 A;  4ULL A;  5T1I A;  2NTT A;  1NBW A;  3L3O C;  1N32 L;  1I5F A;  3FVQ A;  3GV3 A;  2RHQ B;  5A2Q L;  2RF4 A;  2R92 B;  3L0O A;  4GNX A;  2Z4I A;  1AE3 A;  1Q46 A;  1L1O C;  2R93 H;  5FK9 C;  1JJC B;  1TWH B;  4POG A;  1EOV A;  2PMZ B;  3CCQ A;  3AFP A;  3S17 B;  5JJZ A;  1YNN D;  4KV6 A;  2JA9 A;  2F0H A;  3I4N G;  1LTT D;  3EA6 A;  1P16 A;  1ASY A;  1Q1E A;  1BCP B;  3NP8 A;  2ZTC A;  5LMU L;  3MXP A;  3CRK C;  3GTO B;  4F87 A;  1CKO A;  5G3L D;  4OGQ C;  5C4X G;  3NQT A;  2PNR C;  2WKC A;  2A74 C;  2TMP A;  4YCV A;  1ENC A;  1DCZ A;  1EWI A;  2BE5 C;  4LF9 L;  4EQN A;  4FXK C;  1STB A;  2K4K A;  2DN8 A;  2F0F A;  2Q2I A;  2IL8 A;  2HCI A;  4DR4 L;  3A8I E;  1KNA A;  1R4Q B;  2CHB D;  5M5X H;  3JAM L;  1X3F A;  2E2J H;  3JAM c;  5KEE A;  2B2W C;  1VQC A;  1SYB A;  1NTG A;  1CKM A;  1ZYR C;  3K5L A;  2WB1 G;  1HR0 Q;  1SEB D;  4CJ1 B;  4YWL A;  5COY A;  3DM3 A;  2M00 A;  4CGY B;  2OCE A;  1Y69 U;  2J7Z A;  4RGT A;  1N32 Q;  4JI4 L;  4X62 L;  2RDG A;  4LW1 A;  4BA2 I;  5IWA L;  2O2L D;  1VQ8 A;  3KDF B;  3OW2 A;  1LLR D;  4KTA A;  2PNH A;  5L37 A;  3PUX A;  4A3B H;  3F2B A;  4B9W A;  4UP7 A;  3HOY H;  4ODG A;  1V1P B;  4AIM A;  4LJZ C;  2EYM A;  4BXX H;  4JOI C;  2PYK A;  4HCE A;  1HR0 W;  1J8I A;  2OF1 A;  3GTK H;  3KF6 A;  4LFB L;  3DMU A;  2B29 A;  2IX1 A;  3HOV H;  1PLF A;  2F52 A;  3SVM A;  1IYV A;  4C3H G;  3FMC A;  1B70 B;  5M5Y H;  2F0J A;  1ILP A;  1WCM G;  5DM6 3;  2EIF A;  3FRP B;  1YEZ A;  3LWU A;  3C1F A;  3HKZ G;  1B7Y B;  4EQP A;  1QUQ A;  1YNJ C;  3NSW A;  3OIQ A;  1SND A;  2E2D C;  5LMU Q;  3NE5 B;  3N6R A;  5KNC A;  2PQA B;  1HHV A;  3GP7 A;  3NBH A;  3S1Q H;  3EBE A;  4Z9C B;  1D5Z C;  4LNQ A;  3UDI A;  3VYT A;  2MQH A;  2EJF C;  1VQJ A;  2YTX A;  1TWG H;  1PRT F;  3NXW A;  5M3F B;  3I4N B;  1II3 A;  1U0L A;  4IZ8 A;  2H4O A;  2KHJ A;  5FO8 B;  4DR4 Q;  1V1Q A;  1Q3L A;  4C1N K;  2QA4 A;  3AB9 A;  2L15 A;  4A3F H;  2CW0 C;  3S1M B;  3GTJ B;  4FF3 A;  4WJW A;  3BZD B;  1PH2 A;  3DUZ A;  3QO2 A;  2K5Q A;  1FNV A;  1LTL A;  3OYY A;  4DV7 L;  5DLQ E;  4X3S A; 
#chains in the Genus database with same CATH homology
 3GTL B;  3GTP B;  2J4X A;  3J80 L;  1Q90 A;  2F1M A;  3W3A A;  1X32 A;  5NUC A;  1BCP D;  2BA0 A;  3IL8 A;  1SSO A;  2X6L A;  1QOH A;  1F9R A;  1Q1B A;  4IUR A;  2AWN A;  5EBC A;  3NTK A;  4C2M B;  3I3C A;  1GXD C;  3A8K E;  2WV6 D;  4IN3 A;  2B2V A;  4CJ0 B;  3P1H A;  1JOO A;  1F2Z A;  1W6J A;  4UDU C;  1TVX A;  2XRS D;  1NUC A;  3S2D B;  3DHQ A;  1V43 A;  3J81 E;  4RGN A;  4K2L A;  4KI0 A;  1LTR D;  2G9D A;  1DON A;  5CV8 A;  2KED A;  4RCO A;  2RSO A;  1G6Z A;  1AW7 A;  3S2H B;  1CHQ D;  5D3I B;  4PNY A;  4KHZ A;  1L0X B;  2K1B A;  3KLR A;  3RLF A;  1I4R A;  2VUM B;  3IAY A;  1CK1 A;  2Z1C A;  3K5M A;  1H9S B;  1ROD A;  4KMU C;  2D62 A;  3I72 A;  1Y1V B;  4NMZ A;  1F77 A;  5JEA H;  4QIW B;  4L6T B;  1HQM C;  1I50 B;  2ZXO A;  2TSS A;  1QNU A;  3I4M B;  3T4A C;  4B08 A;  1Y8N B;  4AYB B;  4HAE A;  3SXH A;  3I73 A;  1BOS A;  5EQ0 A;  1PRT D;  3R2I A;  5FLX E;  1FNW A;  1TKW B;  1CA6 A;  1RHP A;  1LAB A;  3BVG A;  1HFG A;  1XTC D;  4I65 A;  4N9P A;  1LTI D;  3W2D A;  1OXS C;  1MSH A;  3C2P A;  4MN3 A;  1S4Z A;  3TZU A;  3DM1 A;  3PO2 B;  3D6C A;  1W6K A;  2JEB I;  3Q0A A;  2PW5 A;  4IUP A;  1LTS D;  1VF5 C;  2NUC A;  2NBF A;  4TSS A;  3C3L A;  3PIO 3;  3ND8 A;  5E3F A;  2B2W A;  2J0T D;  3PIP 3;  1S5C D;  1QJO A;  2VB2 X;  3K59 A;  3ITP A;  1DZ1 A;  3BYY B;  2QDB A;  3SK4 A;  1U4R A;  3NHH A;  4G57 A;  2K7V A;  5C3X A;  4KKT A;  2MJ8 A;  5JEA J;  2E74 C;  3ERO A;  1GUG A;  3A8J E;  4DU9 A;  3N52 A;  1SNP A;  5JVG 3;  3H91 A;  1MBY A;  5AFW A;  4U68 A;  3EFX D;  4CBV A;  1PTO C;  2R93 B;  2QF7 A;  3OOC A;  2XIW A;  4PMC A;  1OXT A;  2SDF A;  3MFY A;  1BNZ A;  5C4Z A;  5C6A A;  1E0B A;  3L9A X;  4FP5 D;  1EWH A;  1UUP A;  1O7L A;  3R93 A;  5C44 B;  1O7Y A;  3A56 A;  1EU4 A;  2F0V A;  3BDL A;  3HZX A;  5EKL A;  1ET9 A;  5ELE A;  5A2Q E;  2A6E D;  3V96 A;  4DAY A;  5J39 A;  1KDC A;  1QB5 D;  1RTO A;  4EQO A;  1O78 A;  1EYA A;  1EQT A;  5T1G A;  2QEJ C;  4C3J G;  2NB0 A;  1YNN C;  1WTO A;  5E4W C;  2BDO A;  4I7Z C;  4C1N I;  2E2J B;  3HOU B;  2VB3 X;  1RCV D;  4BWG B;  2NWG A;  1BBX C;  1JWS D;  1G29 1;  2F0D A;  2OT2 A;  1PYW D;  5KGU A;  1ILQ A;  5EPL A;  1STA A;  3TP6 A;  2JE6 I;  4IUV A;  1SYG A;  2IX0 A;  3T53 B;  3JAM E;  3HOY B;  1XX8 A;  5HGT A;  5K36 H;  1ENA A;  1FGB D;  3GQB A;  3SK8 A;  4EVO A;  1O80 A;  2C9O A;  2F0E A;  3A54 A;  1QWY A;  1HA6 A;  5M5Y B;  4HSP A;  3NQI A;  1G91 A;  2AQ1 B;  3G6J B;  4R8I A;  2LKV A;  1QE6 A;  4KJO A;  2XWJ B;  3S1Q B;  4DN4 M;  4F8M A;  3K0Y A;  3URY A;  2KEE A;  4PMW A;  3FPP A;  1ZKO A;  4XQQ A;  3RD4 A;  1JB3 A;  4GZY C;  3RZO B;  1A2U A;  1BXT A;  2B2T A;  5ELC A;  1X3P A;  2D5D A;  4A3F B;  4QMG A;  5C0X H;  5CV4 A;  1O7Z A;  3MHB A;  4BBR B;  5KND A;  1HUN A;  5IOC A;  3M4O B;  4C3J B;  1WTX A;  3T13 A;  1EY5 A;  2HUG A;  1TS4 A;  1U9R A;  4ZRZ A;  2O5I C;  1EIH A;  1LTG D;  4LAA A;  2IWH A;  1LT5 D;  3E5S A;  1EY0 A;  5JOB A;  1GOZ A;  1LTB D;  4XXE A;  5C4J B;  1CQV A;  1DOL A;  4ABN A;  3O13 A;  4HMJ A;  1AZP A;  4LK1 C;  4CKB A;  3A7L A;  4WRD A;  2MHV A;  3X3N A;  4OIJ A;  3J80 E;  5FO9 B;  1SYF A;  1LO5 D;  1PFM A;  1BCP C;  4Y7N B;  5KYL A;  2NN6 G;  2B63 B;  3K7A B;  1SJE D;  3CQZ B;  4OHJ A;  4XDX A;  4RAU C;  1I6H B;  2DNC A;  5IT9 L;  1SMY D;  2FIN B;  2PZT A;  3MWY W;  2PPB C;  4BBS B;  3I8Z A;  5C5M A;  1QNK A;  4IUQ A;  1VMC A;  4XTC S;  1ESR A;  2SNS A;  2ENB A;  2OXP A;  1PTO H;  3ZYY X;  5KRU A;  2L9H A;  5KNB A;  3HOW B;  1SYC A;  2XSC A;  4OIK A;  4PMB A;  4ZLT F;  1IYU A;  3MTS A;  4RGM A;  2IX3 A;  1Y8P B;  1JOQ A;  4LMQ D;  2AUJ D;  4PQX A;  1T5X D;  5IGC A;  5C0X J;  1CA5 A;  4G4K A;  3M7G A;  2LMC B;  1F9S A;  1MGS A;  1IW7 C;  5K5P A;  1F9P A;  2F3V A;  2Q8R E;  1B3A A;  2E76 C;  1STY A;  1RD9 D;  3OWF A;  2KEC A;  5ELD A;  1GHK A;  1Z47 A;  1EY9 A;  3DWA A;  1DJR D;  1PZJ D;  3WDN A;  2K01 A;  4ZQ3 A;  3VR2 A;  3G7L A;  5KYI A;  4QUF A;  2M9V A;  4K6L A;  1H9R A;  1D5X C;  1CQF A;  4WFN 3;  3QB3 A;  5I6W A;  3QOL A;  3HS0 C;  3RZD B;  1PRT B;  4KJN A;  5ELF A;  2F0W A;  2FMM A;  3S9W A;  1F9Q A;  3FDT A;  1JCK B;  5CGK A;  3SE0 A;  1SNM A;  1A3T A;  3BVM A;  2K28 A;  1STE A;  5DM7 3;  3KBG A;  5KIX A;  2AWO A;  3J7A F;  2A6H D;  1TR5 A;  2HDL A;  3I91 A;  5CBA E;  5BN4 A;  4KN7 C;  2RBM A;  1AN8 A;  1I4Q A;  3KLS X;  3KK7 A;  2AUK A;  4J8Q A;  1LTA D;  3C46 A;  5BN5 A;  1BDO A;  1GHJ A;  3MXG A;  1G2T A;  3KUP A;  3QWN A;  2JYO A;  4ZKC B;  1C4Q A;  4DK0 A;  2F0S A;  2NYZ D;  5DAU A;  4K8I A;  5CV7 A;  1CT1 D;  1B4O A;  2BCO A;  5FO7 B;  4XQJ A;  1EY4 A;  4IFD H;  4L8J A;  2F4I A;  2EE1 A;  2O4X A;  3IKJ A;  1VF7 A;  1BR9 A;  5JPN C;  2F0U A;  2V4D A;  1SFO B;  5EGT A;  1CZW A;  3OMG A;  2A68 C;  3GO5 A;  2WAQ B;  3M85 A;  2BE5 D;  1SE4 A;  4FNF A;  2NVQ B;  1WTW A;  2EYH A;  2B2T C;  1ZXT A;  2EYL A;  1SNO A;  1B2T A;  1OXV A;  2AQ2 B;  1Q12 A;  2EYP A;  2A6E C;  3DWP A;  3D8G A;  5C3E B;  4KN4 C;  4K2K A;  3IFT A;  4KK7 A;  2XN9 C;  2F0L A;  1EY6 A;  2X6G A;  1Z6H A;  4DF7 A;  1VDZ A;  3MXU A;  3RUZ A;  1EL0 A;  4K5W A;  3TSS A;  2YYZ A;  4H13 C;  1RDP D;  4RH6 A;  2QIL A;  1MD2 D;  4OO1 H;  3K57 A;  1CTM A;  2KA7 A;  4DFA A;  2F0P A;  5IGF A;  3S1N B;  1E2V A;  2C5C A;  3SR1 A;  1D1K A;  1I4P A;  1ONL A;  3T56 B;  2JSO A;  3S16 B;  4X3T A;  1EY7 A;  2KOL A;  3QG1 A;  5I2Y A;  3E6Z X;  5I9P A;  3M3Y B;  1SXT A;  3I4L A;  4HCS A;  2JA8 B;  2NZ1 D;  1TT2 A;  1YNJ D;  5LHY 1;  2K32 A;  1M4V A;  2BOS A;  3WOF A;  2PZW A;  1VCI A;  2CVR A;  5CC4 A;  1LT4 D;  4IAL A;  2L55 A;  5C0X I;  4IFD J;  2DNE A;  4K5V A;  4J6H A;  3CHB D;  2KCC A;  1HA5 A;  1JWM D;  5COR A;  1WTQ A;  3D4D A;  2CW0 D;  5CMD A;  4K14 A;  2EJM A;  2F0T A;  2PW7 A;  4TQU S;  2QKI C;  3H3V C;  4KY7 A;  2NN6 H;  1PMR A;  1SYD A;  1IKL A;  4FXG C;  1NCV A;  2L4N A;  3TP5 A;  1D2B A;  4RHR A;  4G7O C;  3VYS A;  4K8J A;  3KLS A;  3VA5 A;  1KAA A;  3K6O A;  4DA2 A;  4S3S A;  4YIJ A;  1S5D D;  4B9X A;  1QG7 A;  1HTP A;  1S5B D;  4FXD A;  1WTP A;  5CV6 A;  3K5N A;  1B1Z A;  1U4M A;  1EZ8 A;  1M8A A;  1HCZ A;  1ZEQ X;  5IGG A;  3ONA B;  2QCP X;  1GUW A;  3BVZ A;  2B8F A;  5EKK A;  1FR3 A;  1TS2 A;  2R6G A;  1EY8 A;  2SNM A;  4CHT B;  2EY5 A;  2L1B A;  2IPK D;  3BDO A;  1A3V A;  3GD7 A;  3R2T A;  5D3D A;  3U9S A;  3J81 L;  4DGZ A;  5DEH A;  3HOX B;  3BG3 A;  3NPP A;  1D5M C;  1TY0 A;  1AFP A;  2Z8L A;  3TZD A;  4ID6 A;  1UNS A;  1PTO F;  4RFB A;  4ZAI A;  2F3W A;  5E4X A;  4WOR A;  4U67 3;  2CQA A;  3OW7 A;  3D3R A;  2E2H B;  3IFD A;  3NTI A;  2EY1 A;  2I07 B;  4QF4 A;  1A6X A;  3D4W A;  5M5X B;  1SYE A;  3HGB A;  3SK6 A;  2RKS A;  1TS3 A;  1UEA B;  5EKI A;  1G2S A;  4FVM A;  5ISR A;  3OMC A;  1FNU A;  5EPK A;  4Q0F A;  3TME A;  5CR3 A;  1JIC A;  3V2T A;  4XYQ A;  2A69 D;  4A3B B;  5A35 A;  1SE2 A;  5I2X A;  3L7Z C;  1E2W A;  5JAV A;  2JP1 A;  4KD3 A;  5G3L F;  1R4P B;  1GJX A;  3GTK B;  1CZG A;  3T51 B;  3HOV B;  4HED A;  4X3U A;  4O1N A;  2XRQ D;  1GUN A;  1KDB A;  1RTN A;  2WAC A;  1RF2 D;  2BDN A;  2RQX A;  1MI2 A;  1STN A;  4HN7 A;  1B53 A;  1JOK A;  2ID0 A;  3DXJ C;  1CFM A;  1F2L A;  1OO9 B;  1FD7 D;  1LT6 D;  1B9N A;  4FYD A;  2KCN A;  1TWG B;  5EJW A;  2DY7 A;  1K83 B;  1FYC A;  2L0C A;  1TWA B;  1H9S A;  3V05 A;  2M2L A;  4R8N A;  3OSO A;  5JEA G;  5M3M B;  4MIU A;  4RGO S;  4ZK9 B;  4KY6 A;  3VR3 A;  3VR4 A;  2K5W A;  4KD4 A;  1SBB B;  2HQE A;  3D4R A;  3HRZ C;  4P2C B;  3HEJ A;  1GUT A;  3VYU A;  1B9M A;  1LT3 D;  3SDZ A;  4XT1 B;  5JPM C;  1KDA A;  1Y1W B;  4IUN A;  2IJ0 A;  4NW2 A;  1BF4 A;  3Q23 A;  1D1I A;  4HR7 B;  1V8Q A;  1PTO D;  4IFD I;  5IGE A;  2A6H C;  4MHE A;  1KTK A;  2A5H A;  2GA4 B;  2K03 A;  2F0K A;  3CU7 A;  5D14 A;  5M9O A;  3VR5 A;  1JQY D;  1TQO A;  1XYI A;  1A3U A;  3NWT A;  3F2U A;  3FKI B;  4HMI A;  5TSS A;  3GTG B;  5IGB A;  4DNR B;  5I9O A;  2FFK B;  4IQZ A;  2MP1 A;  4TKO B;  1X3Q A;  2X69 A;  2ZXP A;  3H0G B;  1BCP F;  4OL7 A;  2XWB B;  3A7A B;  1KLG D;  4A3I B;  1EIG A;  2XNA C;  5I6Y A;  3MXN A;  2ICE C;  1A15 A;  3HG9 A;  2EY6 A;  3DEO A;  4Q5V A;  1SNQ A;  4RCN A;  2LY7 A;  1PZI D;  2Y0S B;  1SAP A;  1XWE A;  2DY8 A;  3OHX C;  2LS0 1;  3J7A V;  1DOM A;  2XVS A;  4CKE A;  2AQ3 B;  3ERQ A;  4OO1 I;  4DK1 A;  1PZK D;  3VYR A;  4N9T A;  2EY2 A;  1WVL A;  3P7J A;  2B2Y C;  1PFN A;  3TDQ A;  4A93 B;  3Q6S A;  2RDF A;  4XT3 B;  1Z7T A;  2B2U C;  4BY1 B;  1STH A;  5J22 A;  4DXF A;  2BA1 A;  4M1U B;  3CRL C;  4KKU A;  3EQL C;  4X3K A;  3TBI B;  1J9O A;  4A3J B;  4ZYS A;  1NAP A;  1STG A;  1CI3 M;  3ND9 A;  4F7X A;  3UI2 A;  2RA4 A;  4O42 A;  1PRT C;  1EFI D;  2NN6 I;  2E2I B;  4ZUJ A;  1PDQ A;  2EJG C;  1TII D;  5LL6 S;  4DNT B;  4V0B A;  3NTH A;  3Q24 A;  3FPU B;  1SJH D;  2VNU D;  5BN3 A;  4ZUI A;  2KHS A;  4K5X A;  4R9W A;  1SNC A;  4F88 A;  1WTV A;  3S15 B;  1K8M A;  1D6E C;  4IUT A;  3CKI B;  1JC7 A;  2Q8I B;  5JVH 3;  3GTQ B;  2E75 C;  1I3Q B;  5K36 G;  1WD1 A;  1HRJ A;  3TN2 A;  3WOE A;  5EBD A;  2ICI A;  3PMF A;  2IW3 A;  5C4X B;  4RKL A;  1MSG A;  4NP5 A;  2YU9 B;  3H6M A;  2EYO A;  2F0I A;  1HQR D;  4QCL A;  3QOJ A;  1JE4 A;  4RA8 A;  1EEF D;  3NK9 A;  5E1F A;  3R3O A;  2LFN A;  4H44 C;  1EYD A;  3OWE B;  3U9O A;  5I4D A;  2EYF A;  2WB1 B;  1EU3 A;  4HSV A;  3AU7 A;  5ELB A;  3OPO A;  1QCB D;  2B39 A;  5D65 A;  4C3I G;  3I70 A;  2FHT A;  1B50 A;  1OXU A;  2I46 A;  5C0X G;  1JWU D;  4EGV A;  1LV9 A;  3I90 A;  1XXG A;  5C4H A;  1IL8 A;  1RJT A;  3D31 A;  3RMH A;  2MGS A;  2PZU A;  3MFG A;  3HP3 A;  2MPM A;  4KKS A;  4HTH A;  1ENF A;  4ZKB B;  4C3H B;  1EYC A;  4FO2 A;  2SOB A;  1IKM A;  2G9H D;  2MUY A;  1ML0 D;  1WCM B;  1ZYR D;  2F0O A;  1CHP D;  4QUC A;  4H0L C;  3HKZ B;  1IW7 D;  1AEX A;  4RKB A;  3H94 A;  4DAP A;  5CBE E;  1CM9 A;  3R8B A;  4XIG S;  2HDM A;  2K04 A;  4XQN A;  1UAP A;  3PUY A;  1NSN S;  1B44 D;  4PV1 C;  2EVB A;  3K5O A;  2N55 A;  1KLU D;  2KVM A;  1TWC B;  3P20 A;  5IIF A;  2KJX A;  2WIN B;  3KF8 A;  1SDF A;  4IUU A;  1GUO A;  1TS5 A;  3M4Y A;  2JA7 B;  3LX0 A;  1PXU A;  2O5J C;  4DXG A;  1DD2 A;  2EXZ A;  2IT1 A;  2A69 C;  1Y8O B;  1TY2 A;  4V19 0;  3S14 B;  3PUW A;  3S1R B;  1HXY D;  1TU2 B;  3QIA A;  2Z4H A;  2K5D A;  2PO4 A;  1BUV T;  1KNE A;  2EPB A;  3MAQ A;  3D6W A;  1SE3 A;  1PFB A;  3TP8 A;  3DWQ A;  4C3I B;  3P75 A;  4ME5 A;  1I4H A;  1V1O A;  1NR4 A;  3OIP A;  1EEI D;  5J1Z A;  1EWC A;  1U4P A;  4FF4 A;  3EVQ A;  1DYQ A;  3PO3 B;  3MZ5 A;  2JA6 B;  2RDH A;  3NBI A;  3E0J A;  1S5F D;  2D9U A;  3H09 A;  3MEH A;  1WTR A;  2B2Y A;  1BQQ T;  4ILW A;  2EZV A;  1HTL D;  3LWE A;  1V1P A;  2RVL A;  1ET6 A;  3PUV A;  3PUZ A;  1DM0 B;  2HCC A;  2SEB D;  5FKA C;  2EYJ A;  1HPC A;  1E2Z A;  1VMP A;  2B2U A;  3M7N A;  5IGD A;  2N88 A;  4TRD A;  1C8C A;  2L11 A;  2FMC A;  5C3W A;  5CV5 A;  1EQV A;  3LNN A;  2NTS A;  1I4X A;  1TWF B;  1K8O A;  1JR0 D;  2L5T A;  4J1M A;  5C5L A;  2EDG A;  2F03 A;  2A68 D;  1H9K A;  3AMU A;  1A2T A;  2F0N A;  4NDX A;  3A55 A;  5LL6 X;  2R7Z B;  2K6A A;  2WII B;  1ICW A;  1PTO B;  3PV0 A;  4A3D B;  3BDC A;  5FOB B;  2KUM A;  5IOD A;  4CJ2 C;  3NUC A;  4A3M B;  5IT9 E;  4DAV A;  1GUS A;  1SMY C;  3C1E A;  4M8A A;  1NR2 A;  4UAI A;  2D2C C;  3VR6 A;  5M5W B;  4K6D A;  2ZT9 C;  3BYT B;  4A3G B;  3HOZ B;  4A3E B;  3NWS A;  1DXM A;  1EZ6 A;  3MA2 B;  1WD0 A;  4XYO A;  2F0Q A;  4QB4 A;  4FF1 A;  1U4L A;  1C48 A;  2NVX B;  1I4G A;  3FEW X;  1IHZ A;  2K05 A;  3GV6 A;  4E6I A;  4IFD G;  5FLX L;  1HUM A;  2PCF B;  2RSN A;  1DOK A;  3K58 A;  2R61 A;  5DNF A;  3SK5 A;  4FF2 A;  1L0Y B;  2PQE A;  4JBW A;  3J7Y W;  2JA5 B;  1H9J A;  3TP7 A;  1F2Y A;  4BS9 A;  1H9M A;  1KAB A;  4KHV A;  1ESF A;  2JXM B;  2NVT B;  3SEB A;  2F0M A;  1HFN A;  3KBX A;  3QJY A;  1QIL A;  3X3M A;  1S5E D;  2L12 A;  4RWS C;  3DEP A;  3MVV A;  4G7Z C;  3T16 A;  4CKC A;  1G8Z D;  2B2V C;  4BY7 B;  2JEA I;  2R3Z A;  4G7H C;  3VA7 A;  1R9T B;  1AZQ A;  1JOR A;  3BS1 A;  3GTM B;  1AP0 A;  2VXW A;  2Q8T A;  1RKN A;  3Q22 A;  5CV9 A;  1I6V C;  2H1E A;  3EJI A;  5EPJ A;  2OEO A;  2EOT A;  4OO1 G;  2B8G A;  4JK1 C;  4KY5 A;  5F2D A;  2NVY B;  5HUR A;  5CYU A;  1F2M A;  1BO0 A;  4NKL A;  1OXX K;  2ZXR A;  3SHL A;  2WKD A;  4A3K B;  2KQ3 A;  3MC0 B;  2FJ2 A;  1T5E A;  1Q8I A;  1EOT A;  1LAC A;  2WP8 J;  4BA1 I;  2F0G A;  4RHS A;  4C56 C;  4H7B A;  2A73 B;  2K33 A;  4L63 B;  4ULL A;  5T1I A;  2NTT A;  3L3O C;  3FVQ A;  3GV3 A;  5A2Q L;  2R92 B;  2Z4I A;  5FK9 C;  1TWH B;  2PMZ B;  3S17 B;  5JJZ A;  1YNN D;  4KV6 A;  2F0H A;  1LTT D;  3EA6 A;  1Q1E A;  1BCP B;  3NP8 A;  3MXP A;  3CRK C;  3GTO B;  4F87 A;  5G3L D;  4OGQ C;  3NQT A;  2PNR C;  2WKC A;  2A74 C;  2TMP A;  1ENC A;  1DCZ A;  2BE5 C;  4EQN A;  4FXK C;  1STB A;  2DN8 A;  2F0F A;  2IL8 A;  2HCI A;  3A8I E;  1KNA A;  1R4Q B;  2CHB D;  3JAM L;  5KEE A;  2B2W C;  1SYB A;  1ZYR C;  3K5L A;  4CJ1 B;  1SEB D;  5COY A;  4CGY B;  2M00 A;  1Y69 U;  2J7Z A;  4RGT A;  2RDG A;  4BA2 I;  2O2L D;  1LLR D;  4KTA A;  3PUX A;  4B9W A;  4ODG A;  1V1P B;  4LJZ C;  2EYM A;  2PYK A;  4HCE A;  1J8I A;  2OF1 A;  3DMU A;  2IX1 A;  1PLF A;  3SVM A;  1IYV A;  4C3H G;  3FMC A;  2F0J A;  1ILP A;  5DM6 3;  3FRP B;  3LWU A;  3C1F A;  4EQP A;  1YNJ C;  3NSW A;  3OIQ A;  1SND A;  2E2D C;  3NE5 B;  3N6R A;  5KNC A;  1HHV A;  3GP7 A;  3NBH A;  4Z9C B;  1D5Z C;  3VYT A;  2EJF C;  1PRT F;  3NXW A;  5M3F B;  3I4N B;  1II3 A;  4IZ8 A;  2H4O A;  5FO8 B;  1Q3L A;  4C1N K;  3AB9 A;  2CW0 C;  3S1M B;  3GTJ B;  4FF3 A;  4WJW A;  3BZD B;  3DUZ A;  3QO2 A;  2K5Q A;  1FNV A;  4X3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...