1U4RA

Crystal structure of human rantes mutant 44-aana-47
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
64
structure length
62
Chain Sequence
SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTNAQVCANPEKKWVREYINSLEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Attractant
molecule keywords Small inducible cytokine A5
total genus 11
structure length 62
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u4rA00
1X32A 5AFWA 2MP1A 3TZDA 4O42A 2FINB 4IUVA 2CVRA 3I8ZA 2B2TA 4IUUA 2EE1A 2K05A 2MJ8A 1LV9A 2MPMA 1PDQA 1RTOA 2JP1A 2SDFA 4RA8A 1SDFA 4OIJA 1GUWA 1NR4A 4X3TA 1J8IA 2HCCA 4X3KA 4UAIA 1DOLA 4CJ0B 1WTPA 1F9QA 3IFDA 1WTXA 1HA6A 3G7LA 1SAPA 1O7ZA 5CORA 1ILPA 4XDXA 1ESRA 1HFNA 5T1IA 4MN3A 1TVXA 1KNEA 1B4OA 3TN2A 3DEPA 3I3CA 2B2WC 2BDNA 4QUCA 1Q3LA 2IL8A 1HHVA 2D9UA 2HDMA 4ZLTF 1BBXC 4IUTA 1M8AA 1NAPA 3QO2A 4IURA 5EKIA 1IL8A 2B2YC 1VMCA 1XYIA 2KOLA 3P7JA 2Q8TA 1DZ1A 3FDTA 2RA4A 5CBAE 5EJWA 1G2SA 2KEEA 4LMQD 1DONA 1PFNA 4QUFA 2FMMA 5CMDA 2K04A 1WD1A 3GV3A 5T1GA 1ICWA 1RHPA 2R3ZA 2MGSA 5EQ0A 4X3UA 1WTRA 1S4ZA 1EIGA 1B2TA 2B2WA 3N52A 2XIWA 2EPBA 5DNFA 5E4XA 1B50A 2B2VA 3DEOA 1IKMA 2B2TC 1F9SA 2X69A 1VMPA 2DY8A 3R93A 1B3AA 4ZKBB 1RJTA 1U4LA 4ZK9B 1G2TA 4XT1B 2J7ZA 2Q8RE 3ONAB 5D65A 1CA5A 1EOTA 2HUGA 1WVLA 1U4RA 3I91A 1ML0D 2FHTA 2K1BA 2L1BA 2M2LA 2N88A 3IL8A 2L4NA 1XX8A 2KEDA 1EQTA 3LWEA 4R9WA 1RODA 1IKLA 4IUPA 1F9PA 4CJ1B 2X6GA 3GV6A 1HUMA 1EL0A 1HUNA 1BF4A 1U4MA 1DOKA 2L11A 3KUPA 1AZQA 3DM1A 1NR2A 5EPLA 2B2VC 5EPJA 3MTSA 5JJZA 4R8IA 1WTWA 1MSGA 1QNKA 1X3PA 1G91A 2EOTA 2KECA 1KNAA 1JICA 3I90A 2L9HA 3SVMA 1DOMA 5CBEE 1C8CA 1B53A 1BO0A 2K03A 2KVMA 4HEDA 4U68A 4ZAIA 2NYZD 1F2LA 2B2YA 1HFGA 2RVLA 1EIHA 4HSVA 2L12A 2K28A 1A15A 2DY7A 1O80A 4HAEA 1AP0A 1WD0A 1JE4A 2VXWA 4RWSC 2N55A 1QE6A 1MGSA 3D6WA 2KUMA 1WTQA 2X6LA 1MI2A 1SSOA 1E0BA 1F9RA 1U4PA 2NZ1D 4DN4M 4HCSA 1WTVA 3HP3A 1WTOA 3Q6SA 4NW2A 2HCIA 3KBXA 4MHEA 5EPKA 2FFKB 3UI2A 4CJ2C 1PFMA 2B2UA 2FJ2A 4X3SA 1QG7A 2B2UC 2JYOA 2RSOA 1HRJA 1BNZA 1J9OA 1NCVA 2H1EA 1ILQA 2HDLA 2K01A 1X3QA 3FPUB 1G6ZA 1O7YA 1PFBA 3F2UA 5D14A 4XT3B 2RSNA 1AZPA 1ZXTA 1CM9A 1PLFA 1RTNA 5E4WC 4ZKCB 4OIKA 1CA6A 4IUQA 5COYA 1MSHA 2NWGA 3MWYW 3H91A 4RAUC
chains in the Genus database with same CATH superfamily
5C4JH 3J7AV 2Q2HA 1PDQA 3TBIB 1B9MA 3NTIA 5CR3A 4FF3A 3KDFB 3E3XA 3DUZA 3G7LA 4ODGA 4DR1Q 4XDXA 3NE5B 1CSQA 2QA4A 4BXXH 5J1ZA 5E7NA 1KRTA 1L1OA 3RLFA 1I4GA 1J6QA 1B8AA 5EKIA 2QKIC 3CCEA 1S72A 1BDOA 3A56A 2MQHA 3NWTA 4GKKL 4K8IA 1GUTA 5CMDA 1VF7A 1WCMB 3FHWA 4QCLA 3DMUA 3M4YA 5C5MA 4Q0FA 2UUBQ 4EQPA 2KA7A 3FRPB 1Q8IA 5KNCA 1I3QB 1JE5A 2X69A 1RJTA 2AKWB 2D0OA 5GROA 2IWHA 3W2DA 2HUGA 4LF5Q 1U4RA 4DU9A 3VR6A 1PZKD 2KCMA 3PGZA 2MNAA 3JAMc 2LS01 1A2TA 3SXHA 3KF8B 1C0AA 4DV6L 4JI6L 2XWJB 4A3IG 5FLXE 1VQ5A 1BCPF 3D6CA 3BVGA 2DNEA 3U4VA 4KD4A 3R8BA 4NP5A 4B3MQ 3FEWX 2RVLA 4JYAQ 2QGQA 3G4SA 2DY7A 1HQRD 1SE8A 4IJHA 4PZ7A 4DR2L 3B6YA 3I4LA 1E0BA 3VR4A 2K5WA 4Y52H 1PH8A 4C3JB 5BN4A 4IFDH 4IQZA 1ZYRC 2N49A 5M5YH 1BNZA 1VQOA 4HJ8A 2RDFA 3OW2A 1V1PB 1D1IA 4IUQA 1MSHA 2F0PA 3E0JA 4QL5A 5IP9G 5JJLA 1F2MA 2K6AA 2WAQB 4RHRA 3TZDA 2E5LQ 3HOXG 3I8ZA 1XMQL 2A19A 4RFBA 1S5CD 2O5IC 1J8IA 3GP7A 3AYHB 4XYOA 5LMUQ 3K7AH 3T16A 3F2DA 1O7ZA 1PZID 3BDCA 1NBWA 1S5DD 1T5XD 4FXKC 3NBIA 2AQ2B 1SROA 4ZRZA 2YTXA 3U4ZA 2R93H 2XSCA 2LMCB 1EWIA 1N36Q 4CKEA 3FKIG 1WCMG 2K75A 3J81j 4XYQA 1JC7A 2ICEC 2MO1A 4AYBE 1LLRD 1KLGD 3STBD 4LF6L 2K14A 1CKOA 2V4DA 2A68D 4HJ7A 4C1NI 2R3ZA 3MXNA 2B2WA 4LW1A 3I4MB 3JAML 4J6HA 5IT9E 3GTMH 4K6LA 1U4LA 4A93H 4GZYC 5C3WA 1YBYA 3MXGA 3NK9A 1HXYD 3I91A 3S1NB 2VQFL 5ISRA 5C3EB 4DR2Q 2L4NA 1J5EQ 3W3AA 5LMNQ 1AZQA 4OO1G 2KBNA 1IW7D 2N78A 2Q8IB 1EYGA 1H9JA 1MHWC 3OWFA 4F88A 4IOCA 4A3IH 5IT9c 1SFOB 4GLXA 1S40A 1HNWQ 5GAHC 3TS2A 2MFIA 5CBEE 2K03A 4ZAIA 5M5XB 1QUQB 3C46A 1VQBA 1N9WA 1XTDA 2OQ0A 2XRQD 1K9MC 1AH9A 2PMZB 3HOVG 4QY7A 4BBSH 2XN9C 4LAAA 4C1NK 1PH6A 1KIXA 1BCPB 2RDGA 1BXTA 1TWGB 1IBML 3QOLA 3M3YB 2XNAC 4DV2L 1BCPC 2WIIB 3K5OA 4MHEA 1IYJB 4MIUA 1EFID 4J15A 2K50A 1NMFA 4PZ6A 1SNPA 4JVZA 2RSNA 1RF2D 3OMCA 1IBLL 4ZKCB 3A0JA 5EBCA 1LACA 3GD7A 1EWCA 4QQBX 3H91A 3BU2A 4L8JA 4IUUA 4OWXB 3J80c 1LUZA 4IJLA 3I4MG 2F0WA 3HS0C 3T1YL 4UY8C 4E6IA 3HG9A 4H0LC 5GQOA 3JAME 3A8JE 4ABNA 4K5WA 1VQPA 3V05A 5M3FH 3PUZA 3L7ZC 1T9HA 1YHQA 3I4NB 2Y0SB 2KJXA 4ID6A 3KJPA 4QUCA 4R4QA 1XMOL 5D3IB 4ZQ3A 3EBEA 3GTGB 4EVOA 3D4WA 4KKUA 1JWMD 2AWOA 4RGNA 3RD4A 1NAPA 3BYTB 1SR3A 3NXWA 4H44C 2ALYB 1IYUA 2C9OA 1LTLA 4R4TA 3TDQA 4JI3Q 1I50B 1ESFA 2YV5A 4KLKA 3GTGH 3STBC 4HTHA 1EU3A 1Q1BA 3V96A 4LK1C 2H5XA 2XIWA 1WYDA 1SBBB 2KQ3A 3I4OA 4ZKBB 4ZCKA 1L2FA 4DR6L 2UU9Q 2IHEA 2M2LA 2N88A 2Z0SA 1AE3A 1BUVT 3TZUA 3S1MH 3T51B 1IKLA 3NTKA 3ER0A 1Q46A 2Y0SG 1YHAA 4LFCQ 2B2VC 2ZTEA 1KL9A 1SJED 1MSGA 1X3PA 4I7AA 3CW2C 1TWFH 3A8IE 5KIXA 1K0SA 4A3MG 3T1YQ 3CCLA 3QWNA 3VR2A 4J8QA 4LF4L 4DKAC 4JBMA 2EXDA 2XRSD 1PTOC 1FNVA 1HFGA 1KDAA 2A74C 2K28A 3N6RA 3M85A 4JC0A 1EYAA 3CXCA 5CV8A 2QEXA 4X62Q 4GOPA 4JYAL 4C2MB 3RNUA 4GKJQ 3C2PA 3VYRA 3A55A 4A3GG 1IZ6A 1YVCA 3GTMB 2WV6D 5IE8A 1EIFA 1JB7A 2PCFB 1B44D 5A35A 3Q22A 1F9RA 1U4PA 1IXRA 2VQEL 4HR7B 3PO3G 1AW7A 5ELEA 2R7ZB 3PV0A 5EPKA 2JA5H 1LTTD 1FYCA 1VQLA 1KLUD 3T4AC 3AMUA 1FGUA 3HOYH 1Y14B 2K7VA 4OIKA 2F52A 2I5MX 3TREA 2Z8LA 2LKVA 3MWYW 1FGBD 1ENAA 4BY1G 4IUVA 5GADC 2CVRA 4A76A 1Y69U 3KLRA 5M3FG 2EY6A 3S1NH 3P75A 3F2CA 4PV1C 4DAYA 1TT2A 2GA4B 4DV0Q 3HEJA 1TIID 5M9OA 1HZCA 5C44H 2KENA 1PH1A 4KJNA 3A5ZB 2UXBQ 1H9SB 2BDNA 2F3VA 3TP7A 1N32L 4I65A 1HHVA 4X65Q 4A3IB 4KD3A 3SR1A 3P7JA 2WAQG 1I4PA 1GM5A 4K8JA 1MIUA 3GDEA 1RHPA 2B3GA 1LTBD 3HKZG 1A8VA 4WFN3 3HOVB 2NZHA 2EVBA 3S2DB 1BKBA 1EY7A 2B2TC 2G5DA 1B3AA 4PQXA 2BE5C 5IGEA 4CGYB 1JR0D 2QF7A 3HOVH 1PRTB 3JC66 4BBRB 3LWUA 1G291 3KYHC 1XX8A 5FLMH 1EQTA 4A3EB 1BBWA 2BCOA 3NEMA 1JMCA 3W5OA 2P5ZX 5IGDA 1VDZA 5EPLA 3TP6A 3S1QH 2BDOA 1OO9B 4DV4L 3S2HH 1CK1A 4A3EH 5HURA 5KNBA 2JQOA 5I6WA 1Y1WB 3RR5A 4AH6A 2BH8A 4XQNA 3CMAA 4HSVA 4V190 2OEOA 3U50C 1GUGA 3CPWA 1H95A 2SNSA 4M8AA 1D8LA 4IOAA 3LNNA 2R92G 4DAPA 1S5FD 5KYIA 4QF4A 1DD2A 5DLQE 1E7ZA 1OXSC 2QILA 2VL6A 4A3BB 4HJAA 1EFWA 2IX1A 2EY1A 1X3EA 3R3OA 2XWBB 1RIPA 3KBXA 1LTGD 5JJKA 1QG7A 2B2UC 2EYOA 4HMJA 1Q1EA 1X3QA 3UDFA 2A6EC 3CMEA 1TKWB 2JA7G 5IGGA 5J39A 5IP7G 5JPMC 3DM3A 2Z9HA 1TS2A 5COYA 4DAMA 1JOQA 2K33A 2EIFA 2CW0C 2HQLA 4NB3A 2K5NA 3EQLC 5C44G 4TKOB 1FJGL 2BA0A 5EKLA 4KY6A 1YNND 4UAIA 1DOLA 4JPBW 4CJ0B 3AEVA 4JG2A 3ERSX 3U58A 2PQEA 1E22A 1YNNC 1SNCA 4POFA 1KNEA 3S17B 1OXTA 5I6YA 2CQOA 1AN8A 4DXFA 3TS0A 1M8AA 4IURA 1VMCA 2B2YC 5ELNA 3K57A 4A93G 1EY5A 2UXBL 1A63A 2Q2UA 4QUFA 2K04A 2K52A 4DNIA 1GOZA 4IPDA 1NNXA 2F4VL 2TMPA 3KLSX 1K8GA 4Y7NH 4DR5Q 1STAA 5JEAG 1Y1VG 5F2DA 3I72A 3HOWG 4ZK9B 4A3LH 3FP9A 1EY9A 1ML0D 3PO2G 4TVAB 2FHTA 4L5QA 3C1FA 5FOBB 2F0KA 1RKNA 3K0YA 4LNQA 1JOKA 1SYFA 1HR0L 1XWEA 4JV5L 2IY5B 1DOKA 3HOYB 4C3JG 4LFBL 4DNRB 5EKKA 4CHTB 1EY4A 1BBUA 4N8FA 4LUOA 3L3OC 4YCWA 3DXJC 3RZOB 4G57A 3PCOB 1UNSA 4QIWE 1YIJA 1N8RC 3M9BA 4HEDA 4U68A 2UUAL 4GNXB 3U9SA 1HZAA 4IALA 4C3IG 3GTJB 4O0AA 2F4IA 4K2KA 1SRUA 3D3RA 2VXWA 4IZ8A 2K5QA 2B8GA 4A3EG 1MI2A 3U9OA 2PO4A 1VQAA 3O13A 4X6AH 1YNJC 2PW7A 4DF7A 4QGUA 3I4MH 1PFMA 4JI6Q 3ITPA 5CV6A 1SYGA 1J9OA 4BY7B 1X56A 3V2TA 5JJIA 4A93B 1B1ZA 2ZM6Q 1PH7A 4XT3B 2YTVA 3K5MA 3OTOQ 1NE3A 5E4WC 4CDFC 1Y1VB 1LT5D 4JCVE 4O42A 2F0VA 3OW7A 1Y1WH 5M3MG 1A3VA 2ZXPA 4KHZA 2UUBL 4OX9L 2ZTDA 1BQQT 1HNZL 3BJUA 2WKCA 2YU9H 4LFBQ 1D6EC 1TR5A 4GOPC 1NY4A 3HOZH 5HGQA 3EJIA 1QCBD 3NTHA 4GLAC 3MAQA 1Q3LA 3KF6B 1SMYD 2UXDQ 1YEZA 1BBXC 4JI4Q 5FJ8H 4DV1L 2L5TA 2JA6B 1XMOQ 3I7FA 3RN2A 3K81C 1Q12A 2RA4A 1KAWA 1KXLA 1VQFA 4LMQD 3GTLH 3M4PA 1PYSB 2IJ0A 2FMMA 3CC7A 2F0TA 1R4PB 2EY5A 1EIGA 2ENBA 3K5NA 2RKSA 1H9MA 5E4XA 1EZ8A 1W6KA 2DY8A 2BA1A 5FO8B 1F2YA 1FR3A 1WI5A 2JA8B 2Q8RE 1YJNA 3CRKC 2F0FA 1UUPA 4AYBG 3E0EA 4EGVA 3CCRA 1Q7YC 2UXCQ 4MTKA 1TWFB 1EYDA 1I4QA 2NTTA 3OPOA 3K8AA 3HOWH 4DV4Q 1HUMA 2TSSA 3M7NA 4A3GB 5K36H 1NR2A 4LJZC 1QNKA 3IAYA 3I90A 3SK4A 3G6JB 3T53B 1PH2A 1U0LA 1XNQQ 2JA8G 2FMCA 2QW7A 2F0EA 3OWEB 4DV1Q 1B53A 1BO0A 2KVMA 4YY3Q 1VQ9A 4P2CB 1OXUA 1X65A 4LFAQ 2OTLA 1XNRQ 4GKJL 4JBWA 2Y0SE 2L12A 1EIHA 5CV5A 5C4ZA 4K2LA 2RBMA 1K3BC 2JEAI 4N8X1 2F0SA 3G6EA 1Z6HA 4P73A 4L6TB 1ZKOA 2N55A 5IYCH 5C0XH 2VQFQ 4OWWB 1LO5D 3K58A 1UWVA 1MBYA 1K8AC 3JAMi 2Z1CA 4L5TA 5IYBG 2FFKB 2A73B 2B2UA 3DHQA 3DWQA 1N33Q 1HRJA 5JVG3 2IX0A 4IPGA 4JI1Q 2OTJA 5M5YB 4TRDA 1WTHA 5D14A 2AQ1B 1AZPA 1CM9A 1RTNA 2E2IH 3KLWA 4XXEA 4B3ML 4DV0L 1IBKQ 4OHJA 2AUJD 3Q0AA 4L5RC 4APVA 1VQKA 2RDHA 4X3KA 2E2IB 3GTJH 1HA6A 1TVXA 2NTSA 2D62A 2DGYA 3IRBA 3MZ5A 1WFQA 4C56C 4A3JB 1IW7C 1XYIA 2F03A 2E2JB 4JI7L 1P8LA 5CBAE 5EJWA 5JEAJ 3AU7A 4ALPA 3KJOA 1LTRD 1Y8NB 3F2BA 5CV4A 4JI1L 4X3UA 1XPOA 4K0KL 2QDBA 3SEBA 1KDCA 1LTSD 2B2VA 1VQ8A 1IKMA 2R7ZH 3CC2A 4U673 5I9OA 1HZ9A 5FK9C 2LXKA 2DJFC 3CAMA 3NENA 1K28A 4LF4Q 3KF8A 3DLLA 2G9HD 4F7XA 1PRTC 1PVOA 1C7YA 1UE7A 4IUPA 4AQYQ 2K5HA 4JI0Q 3GV6A 4BY7H 1SMYC 4M1UB 3P1HA 2NVTB 5LL6S 3RUZA 3CCMA 1ENFA 4BS9A 1KTKA 4P75A 4R8IA 3MTSA 4DV2Q 1GHKA 1O7LA 4DR4L 3MFGA 1SFOH 2VNUD 4KJOA 3RZOH 1VQEA 1QZGA 1S5BD 4A3BH 1B7YB 1MJCA 4RCNA 1QVFA 4FVMA 1YHBA 4FNFA 2PMZE 3D4DA 3TP8A 3HOZB 3BZCA 1K73C 2R6GA 5JAVA 4RWSC 4A3MH 1HZBA 2JA8H 1SSOA 3T1HL 1TWGH 4KKSA 2FXQA 3HOUG 1NMGA 1ZYRD 2Z4HA 2JA6H 5C3EG 1JQYD 1TWHB 4X3SA 5K36G 1I3QH 3LGJA 4DV7Q 4AQYL 4RMFA 3UE1A 3VR5A 2IT1A 2E75C 1W3SA 2F0NA 4MNOA 1HTPA 4LF5L 2NWGA 3RMHA 2PNRC 5AFWA 1D2BA 2WB1B 3AFPA 4K5VA 1YJWA 3CQZH 4X65L 5BR8L 2MJ8A 1LV9A 3MXUA 2JP1A 2WKDA 4HSPA 3S1QB 2KCTA 4LF9L 1JORA 1ILPA 3C3LA 4A3GH 3I73A 1HFNA 2QEJC 2PNHA 2IL8A 4UHVA 2ZXRA 4BA2I 4JI5Q 3QO2A 3SK6A 3I4NG 2A68C 3UDGA 3FDTA 3MXNB 2WACA 3VYUA 1W6JA 2R61A 1SMXA 3CP0A 3EROA 2WP8J 5ELDA 4DR5L 3E6ZX 1TU2B 3Q24A 1PH9A 1AE2A 3TQYA 3N52A 5L37A 4C3JH 1MD2D 1RD9D 1HJPA 3H09A 1Y1WG 2UXCL 3G71A 1SYDA 1FNWA 1AFPA 2WAQE 4X62L 5IGFA 1E2ZA 1DGSA 1E1OA 3H15A 1CKNB 1TWAH 2L11A 3PIP3 5IOCA 3H3VH 5JJZA 1GUOA 3CCUA 5KEEA 4UP9A 4ZUJA 1SLJA 2EOTA 1KNAA 2A8VA 1UE5A 4IFDJ 2PZUA 2A1AA 1CZWA 4C3IB 1YNXA 2QDLA 2G9DA 1L0XB 2R7DA 2E2JH 4YWLA 3PUWA 4JK1C 1Y8PB 4DK0A 3MC0B 2EY2A 3QJYA 5CGKA 1KDBA 1HR0Q 3CKIB 4OL7A 2L55A 3H6MA 2A6HD 1MGSA 4XIGS 5C3XA 3PMFA 1E1TA 4OONA 1NSNS 2NZ1D 2F0HA 2F0GA 3UI2A 4JOIA 2FJ2A 3HKZE 1G51A 2VY3A 2PQAA 4CKBA 1QVCA 1VQHA 3CU7A 3J80L 4LF6Q 2EYHA 2ASBA 1BOSA 3VYSA 2EZVA 2H4OA 4R8NA 4DK6C 1EOVA 3SGIA 3I2ZA 5LMNW 1RTOA 4A4IA 4UP7A 2JA5G 1NR4A 4O1NA 4KY5A 4GNXA 1XMQQ 3MXPA 2KHSA 1IBKL 1EWHA 5TSSA 2XVSA 3QB3A 4LF7Q 2D0PA 3NPPA 5IYCG 1J5EL 3GTLB 1H9KA 3C1EA 3ZYYX 1E2VA 4CKCA 2CKZB 3VYTA 3S9WA 1U9RA 3G48A 4PMCA 4NMZA 2JA7B 2A69D 1VQIA 5IT9L 2ZJPA 2DJGC 4KK7A 2F3WA 4ULLA 1JCKB 5EGTA 1OXVA 1STGA 3HKSA 2K4KA 5FO9B 1WTRA 4HCEA 3H3VI 5LMNL 3CRLC 1P16A 1B50A 3DEOA 4WORA 3A74A 3H3VC 1CHQD 3MVVA 1QVGA 4XT1B 2CWPA 4NXML 3WDNA 3PF5A 2K1BA 2SNMA 5IP7H 3ERQA 3LWEA 1DJRD 5JEAH 1F9PA 4DR3L 1H9RA 2F4VQ 3TP5A 5EPJA 1WTWA 1Q82C 2XGTA 3HKZB 4HJ9A 1E2WA 1PTOD 3NUCA 2YU9B 1VQGA 2JK8A 1XJVA 2NVYH 3DWPA 4DXGA 1O7IA 2OXPA 3I4NH 2ZTCA 4MZ9A 3A7AB 1V9PA 3NSWA 1VQNA 4A3DG 1VCIA 4BXXG 4B3SQ 5C5LA 1X9NA 4KTAA 4YIJA 4K5XA 1JE4A 5LMUL 5JPNC 1LABA 3K0XA 1QE6A 1D1KA 4WJ3M 5HGTA 4B9XA 3GTPB 4C3HG 1WTQA 3GTOH 1I50H 3CCSA 4KV6A 3W1GA 4DV3Q 2D5DA 1PH5A 4DUZQ 3OYYA 3NP8A 2CH4W 2CFMA 2BH2A 4NXNQ 3GTOB 1Z9FA 1G6ZA 5I4DA 4RKBA 5FLXL 4L5SA 3A8KE 2NUCA 2PQAB 2RF4A 2I0QA 1YITA 4RH6A 4WJ4A 3KOJA 3PUXA 1N36L 2SDFA 3CQZB 1XNQL 2MPMA 3SHLA 1L0WA 1D7QA 1Q86C 1CZGA 3A5UA 1TWAB 4MN3A 5E1FA 3DEPA 2B2WC 1FVIA 4ZUIA 1X54A 5CC4A 1SE2A 4A3FH 4A3BG 4KMUC 4C3IH 2AWNA 3SK5A 5I2YA 2JJQA 2AUKA 2Q2TA 1JT8A 1VQ6A 4C2MH 2A69C 3MEHA 1D5ZC 1VQJA 1EQQA 2HT1A 1A3UA 4R4CA 5G3LD 1FL0A 2B8FA 1CKNA 2EPBA 4A75A 1EZ6A 1F9SA 1S5ED 4UPAA 3W1BA 3K7UC 5ELBA 1D5MC 3T56B 2KHIA 3PSIA 4JI4L 4GKKQ 5A2QE 1EOTA 2MUYA 2CCZA 4A3DH 3J7AF 1B9NA 3LX0A 1F77A 2CWAA 3PUYA 2AHOB 1QZHA 5C0XJ 2NN6G 2VZAA 4K0KQ 3K80C 1CSPA 3EIVA 2RCFA 5GAGC 4DV3L 3L9AX 4FXGC 1HNXL 1TWCB 5C6AA 2D2CC 2PYKA 5EAYA 1NUCA 2EDGA 1CI3M 5M5WH 1YI2A 2R7FA 5ELCA 4CDEC 4A3MB 4GNXC 2A5HA 3HGBA 1TS3A 1MJEA 3GTQB 4N9TA 1PFSA 3E5SA 4PMWA 5DM63 5G3LF 1AP0A 4DUYQ 1EQRA 4R4OA 3BS1A 1M4VA 4JI2L 3D6WA 2X6LA 1HNXQ 4DA2A 2B63G 1ASZA 4NW2A 1IBMQ 2LSSA 1Z7TA 4JOIC 4LWCA 4BWGB 4R1JA 1N34L 4BY1H 1YZ6A 2HDLA 2H1EA 3TRZA 3QR8A 5JOBA 4A3CG 4JI3L 1X55A 4CDDC 1CA6A 4A3JG 4BBRH 2ZJQA 4FO2A 4MTNA 2MO0A 5IGCA 4NXNL 4FF4A 2MP1A 1CUKA 3NHHA 1UE6A 2FINB 4YCVA 1CTMA 1H9SA 2K05A 4HIOA 1GUWA 4KI0A 1LTID 2J4XA 3PO3H 1PRTD 3SDZA 4X3TA 4IFDG 2MHVA 2F3IA 4IFDI 2EXZA 3OMGA 3IFDA 1K8MA 4KKTA 3ULLA 4PG3A 5C0XG 3ULPA 3E9IA 4DNTB 1U5KA 1E24A 1HA5A 2RQXA 3PO3B 4H02A 3GTPH 2E74C 4LFAL 1XNRL 4CBVA 2PI2A 3CCJA 3BVMA 2HD3A 2KEEA 5ELOA 2SEBD 4DV5L 4Q5VA 1HPCA 1RCVD 1S4ZA 4OO1H 1EY6A 2A6ED 5LL6X 2B29A 4EQOA 5FLXc 2J0TD 1TWHH 2K5VA 3GO5A 1WVLA 3J7ZC 3E9HA 1PXUA 1MKHA 4A3FG 4DR6Q 4KN4C 1JB3A 1HQMC 4B08A 5CYUA 5LHY1 1PA6A 3J80i 3KUPA 3ND9A 2K32A 2RHQB 1G91A 1JICA 1TS4A 2EYLA 1UE1A 3TEHB 4G7HC 1DOMA 1HCZA 2M00A 2WINB 5IGBA 1VQMA 3R2IA 3S17H 5FLMG 1VF5C 1A15A 1NTGA 3UDXA 4RHSA 4GN4B 2SOBA 1I6HH 1W2BA 1O80A 4HAEA 1EEID 5IY0A 3IKJA 1XXGA 3CCVA 2PZWA 1L1OC 3OHXC 3URYA 1C48A 1WTOA 1I6HB 4RGTA 4XQQA 4DAVA 3T1HQ 2IPKD 1CQVA 4JI2Q 2E2DC 1DXMA 3EFXD 2JYOA 4Y7NB 1IBLQ 4A3KH 2K01A 3FPUB 5KYLA 3BVZA 1V43A 1ZXTA 1PLFA 3KBGA 3L0OA 4DV7L 2PZTA 4RG1A 3CCQA 3KFUA 4RA8A 3OSOA 2EYPA 1BR9A 1SDFA 2KCNA 4H13C 3D8GA 2B39A 1ICFB 1STHA 4TQUS 1VQDA 1WTPA 1Z47A 1SAPA 1EUJA 2LFNA 3I55A 2N3SA 5M5XH 3TN2A 1EU4A 1L0YB 4POGA 2VS1A 4IPCA 5IWAQ 3HZXA 3RZDB 4A3JH 1N33L 1SE4A 4JI5L 1CFMA 4ZYSA 3NQIA 4F8MA 1KAAA 5H1SE 3PO2B 3BZKA 4C3HH 4JV5Q 1I6VC 1QNUA 1A0IA 3MFYA 2VB2X 4FF2A 4KY7A 1EEFD 2OCEA 3M7GA 5DM73 5C4HA 1BCPD 3D31A 3S15H 4DK1A 2I07B 5HY6A 1Y1VH 4CJ1B 1EL0A 4EQNA 3H0GH 2V1CC 2B63B 1JWSD 4IO9A 2NVTH 5I2XA 2VUMH 3S15B 1LM0A 5AJ3Q 1I5FA 1V1OA 1K83B 2AQ3B 2PW5A 3NBHA 5C4XH 4QIWB 2KECA 2DNCA 1Q81C 3FMCA 2F0IA 2L9HA 3BG3A 1PTOH 3HOXB 4ME3A 1TWCH 4NXMQ 2NB0A 2F0OA 3PIOA 5ELFA 1IHZA 3BZDB 2E5LL 5GAEC 3K6OA 3RN5A 2ZT9C 1CT1D 1JJGA 1II3A 3HOYG 3GTQH 1WD0A 3FKIB 4DK3C 1UEAB 2KUMA 1I94Q 4GN3B 4HMIA 3PF4A 1VQ4A 3HP3A 1EYCA 2HCIA 3P20A 4BA1I 4CJ2C 1LYLA 3F1ZA 2HQEA 1SNOA 1JJCB 2Q2IA 4HIMA 1PFBA 3R2TA 1PYWD 2VW9A 2GVBA 4YCUA 4B3SL 4LF7L 3TSSA 2E2HH 4RAUC 3FVQA 2Z6KA 3PQIA 2NVQB 4A3KG 1WOCA 4B3TL 2R92B 2VB3X 1LT4D 2UXDL 4Z9CB 1DM0B 3CPFA 3S24A 2E2HB 1SE3A 3VA7A 1JJ2A 1G8ZD 3FPPA 1GXDC 5IIFA 4BY7G 3I3CA 2NVYB 2C35B 4RGOS 1I4HA 1KQSA 4YY3L 2HDMA 1GUNA 4ZLTF 1E3PA 3A7LA 2Q8TA 2YYZA 3QG1A 2DUDA 2KHJA 3GTKB 1PFNA 1TQOA 3KLSA 1YJ9A 3WOEA 5K5PA 2JA6G 4RKLA 3J7A5 5EQ0A 4EQ5A 1RL2A 5AJ3L 4IUNA 3SK8A 5DNFA 3J81E 3GTKH 4F87A 4FF1A 5J3BA 1VMPA 1NJIC 2JSOA 4R4IA 1S3OA 2NBFA 4BBSG 2Z4IA 4LUZA 1LTAD 3F8TA 2DN8A 1VQ7A 5C4JB 1A3TA 2KEDA 1RODA 3BYYB 2CQAA 1LT6D 3T13A 3L2PA 5I9PA 3DM1A 2F0UA 3NBHB 1L1OB 2LY7A 5C0XI 4KHPL 4B3RQ 2WFWA 3M4OB 4OELB 3QIAA 4X64Q 3J80E 2F0JA 1I94L 5C44B 2IX3A 3SVMA 4B9WA 2GN5A 2O2LD 1X3FA 4DR7L 1QUQA 2NYZD 1SNQA 4BBRG 1SEBD 2I46A 4LF8Q 3PO2H 4C3HB 4IN3A 4DAYB 1Q8KA 2PI2E 5IYBH 1X6OA 1XTCD 2RCNA 1KD1C 3X3MA 2Z6KC 3M3YH 4DN4M 2Z6BA 3PUVA 3Q6SA 3S2DH 1GKHA 1V8QA 2RSOA 1DCZA 1ILQA 2I5LX 4LUVA 4DGZA 3OIPA 1T5EA 3HOUB 3AFQA 4O2DA 1VS0A 1PV4A 4YHHQ 2UUAQ 3EVQA 2EE1A 3WOFA 1FD7D 2F0QA 4DR7Q 4GOPB 2HCCA 1HNWL 3S2HB 3J81i 4P71A 2JXMB 2EYMA 4S3SA 4K6DA 5M3FB 5CORA 1Y8OB 1HNZQ 3H0GB 2NVXH 3M4QA 5M5WB 5IYDH 1CHPD 1SYCA 3KF6A 4JBKA 1R9TB 2ATWA 4GS3A 3PIO3 1UAPA 1G2SA 3K5LA 4QB4A 2F0LA 4JW0A 1IYVA 4DR1L 2R7ZG 1WD1A 3TMEA 1A62A 1ICWA 1R9TH 1N34Q 1X3GA 1SYBA 4PZ8A 4HIKA 1GJXA 2IW3A 4J1MA 3KK7A 1I4RA 2I5HA 4OX9Q 1G6PA 4RGMA 4ILWA 3S16H 2R92H 4UP8A 1WCMH 1IL2A 2J7ZA 4UDUC 4TSSA 3NELA 1R4QB 3IL8A 4EX5A 4NPSA 3VDYA 1QILA 2R93G 2ZM6L 1HH2P 3OTOL 3ZJYC 3HOZG 1HUNA 1K8OA 4WJWA 3OOCA 3ULJA 2B63H 2OWOA 3BDOA 5KGUA 2VUMB 4G4KA 1QJOA 3A54A 2KCCA 3PIPA 3S1RH 1PTOB 3HOXH 3K59A 1C8CA 4B3RL 2XTIA 2JE6I 3EA6A 4KHVA 2WB1G 4FYDA 3BDLA 4FP5D 3OIQA 1STBA 1SYEA 1AEXA 1FNUA 3WWVA 4LF9Q 4OO1I 1GVPA 1SN8A 3H94A 1QOHA 4HCSA 1M1KC 1WTVA 3CD6A 5BN3A 4HN7A 1V1QA 3S14B 4RCOA 1NCVA 1PTOF 4NDXA 3MA2B 4X66Q 1OTCA 1KC8C 1TS5A 2F0MA 3J81c 1QWYA 1ENCA 1CA5A 1JWUD 3S14H 3AQQA 2UU9L 2B2TA 2NVQH 1SNDA 2JEBI 2GVAA 4OIJA 1LT3D 2L0CA 1HR0W 1WJJA 3I56A 4YHHL 3RZDH 4DUYL 1TY0A 1RDPD 1ESRA 4OEMB 1VQCA 1SXTA 2EQSA 4X66L 3MEFA 4G7ZC 1B4OA 3HRZC 3KDFA 4JI0L 1D5XC 4XQJA 2HHHQ 2YTYA 2D9UA 4IUTA 2A6HC 4A3FB 4PMBA 1IL8A 1DZ1A 1PH4A 5KNDA 2E8GA 2CH4A 5DAUA 4DR4Q 1DONA 4X64L 1GUSA 2F0DA 4V0BA 3NQTA 4DV5Q 1EQVA 2VUMG 1PHJA 3R93A 2EYJA 4P74A 2VQEQ 1PZJD 5NUCA 1G2TA 3ONAB 4JI7Q 1YNJD 2QCPX 1GHJA 2LXJA 2BE5D 4WRDA 2L1BA 1N32Q 1ONLA 4A3CH 5CV9A 4R9WA 3J7YW 2C5CA 1BF4A 1U4MA 2ZXOA 4IPHA 2JN4A 4DPGA 4DUZL 1EY0A 5C3EH 1TY2A 4JI8L 1KABA 5CV7A 2M9VA 4GLVB 3FKIH 1STEA 2HIVA 1UEBA 3DWAA 2F1MA 3ICEA 2O5JC 3CHBD 2EJMA 2JA9A 1C9OA 3NWSA 2JA7H 1ET9A 4OWTB 2AMCB 2EYFA 1SNMA 2UUCQ 2CHBD 1STYA 4N9PA 5C4XG 4GN5A 1BVSA 2ICIA 5BN5A 3AB9A 4DV6Q 5FKAC 4AIMA 4B3TQ 1Q90A 4L63B 3VA5A 5IP9H 1ZEQX 4DFAA 4BY1B 1O7YA 3EN2A 4JBJA 3QOJA 5EBDA 3S1MB 4H7BA 3HOWB 1X32A 1A6XA 1XPUA 5JVH3 3IFTA 2WB1E 4XTCS 1B70B 5J22A 2CW0D 4ME5A 5BR8Q 1K83H 5C4XB 1F9QA 2NN6I 1JOOA 2O4XA 1WTXA 3Q8DA 4OGQC 5M3MH 4KHPQ 2K5DA 2HIXA 4LFCL 2RHSB 2OT2A 5T1IA 4KN7C 5D3DA 1C4QA 1A2UA 3Q23A 2E76C 2R93B 4I7ZC 4FDBA 4QMGA 2NVXB 4OXPA 1M90C 4PNYA 5M3MB 4AYBB 1PRTF 2KOLA 3GQBA 5IWAL 4A3LG 4FXDA 1I4XA 3X3NA 3GV3A 4JI8Q 3D4RA 5T1GA 1KHIA 5DEHA 5E3FA 2MGSA 1B2TA 1PMRA 3UE0A 1EIYB 4QJFA 4DR3Q 1CQFA 2JA5B 1KRSA 1EY8A 3J81L 3S16B 3D0FA 5D65A 1HTLD 4P72A 1GO3E 2ZJRA 3VR3A 3M4OH 1CKMA 1B3QA 1K0RA 1K3RA 1F2ZA 2X6GA 3RLNA 3MHBA 2L15A 3UDIA 4LF8L 2OF1A 1GD7A 2OQKA 4HJ5A 2ES2A 4YWMA 3CC4A 1ET6A 1FJGQ 4YWKA 3S1RB 2IHFA 1XPRA 2N8NA 1F2LA 2B2YA 2EJFC 4BBSB 1SJHD 3K7AB 5IYDG 1QB5D 4NKLA 4HIDA 1PH3A 2NZOA 3HFZB 4CDCC 4G7OC 5A2QL 3CF5A 3RLOA 5FO7B 3SE0A 3ND8A 3HOUH 1PYBA 1TXYA 1O78A 5IODA 3H0GG 2UUCL 2NN6H 4K14A 2HHHL 1DYQA 3I70A 2EJGC 3F2UA 1V1PA 1STNA 4A3KB 2PPBC 2ID0A 1ASYA 5FJ8G 4A3DB 1OXXK 2BOSA 5KRUA
chains in the Genus database with same CATH topology
3J7AV 1PDQA 3TBIB 1B9MA 3NTIA 5CR3A 4FF3A 3DUZA 3G7LA 4ODGA 4XDXA 3NE5B 5J1ZA 3RLFA 1I4GA 5EKIA 2QKIC 1BDOA 3A56A 3NWTA 4K8IA 1GUTA 5CMDA 1VF7A 1WCMB 4QCLA 3DMUA 3M4YA 5C5MA 4Q0FA 4EQPA 2KA7A 3FRPB 1Q8IA 5KNCA 1I3QB 2X69A 1RJTA 2IWHA 3W2DA 2HUGA 1U4RA 4DU9A 3VR6A 1PZKD 2LS01 1A2TA 3SXHA 2XWJB 5FLXE 1BCPF 3D6CA 3BVGA 2DNEA 4KD4A 3R8BA 4NP5A 3FEWX 2RVLA 2DY7A 1HQRD 3I4LA 1E0BA 3VR4A 2K5WA 4C3JB 5BN4A 4IFDH 4IQZA 1ZYRC 1BNZA 2RDFA 1V1PB 1D1IA 4IUQA 1MSHA 2F0PA 3E0JA 1F2MA 2K6AA 2WAQB 4RHRA 3TZDA 3I8ZA 4RFBA 1S5CD 2O5IC 1J8IA 3GP7A 4XYOA 3T16A 1O7ZA 1PZID 3BDCA 1S5DD 4FXKC 1T5XD 3NBIA 2AQ2B 4ZRZA 2XSCA 2LMCB 4CKEA 4XYQA 1JC7A 2ICEC 1LLRD 1KLGD 2V4DA 2A68D 4C1NI 2R3ZA 3MXNA 2B2WA 3I4MB 3JAML 4J6HA 5IT9E 1U4LA 4K6LA 4GZYC 5C3WA 3MXGA 3NK9A 1HXYD 3I91A 3S1NB 5ISRA 5C3EB 2L4NA 3W3AA 1AZQA 4OO1G 1IW7D 2Q8IB 1H9JA 3OWFA 4F88A 1SFOB 5CBEE 2K03A 4ZAIA 5M5XB 3C46A 2XRQD 2PMZB 2XN9C 4LAAA 4C1NK 1BCPB 2RDGA 1BXTA 1TWGB 3QOLA 3M3YB 2XNAC 1BCPC 2WIIB 3K5OA 4MHEA 4MIUA 1EFID 1SNPA 2RSNA 1RF2D 3OMCA 4ZKCB 5EBCA 1LACA 3GD7A 1EWCA 3H91A 4L8JA 4IUUA 2F0WA 3HS0C 4E6IA 3HG9A 4H0LC 3JAME 3A8JE 4ABNA 4K5WA 3V05A 3PUZA 3L7ZC 3I4NB 2Y0SB 2KJXA 4ID6A 4QUCA 5D3IB 4ZQ3A 3GTGB 4EVOA 3D4WA 4KKUA 3RD4A 1JWMD 2AWOA 4RGNA 1NAPA 3BYTB 3NXWA 4H44C 1IYUA 2C9OA 3TDQA 1I50B 1ESFA 4HTHA 1EU3A 1Q1BA 3V96A 4LK1C 2XIWA 1SBBB 2KQ3A 4ZKBB 2M2LA 2N88A 1BUVT 3TZUA 3T51B 1IKLA 3NTKA 2B2VC 1SJED 1MSGA 1X3PA 3A8IE 5KIXA 3QWNA 3VR2A 4J8QA 2XRSD 1PTOC 1FNVA 1HFGA 1KDAA 2A74C 2K28A 3N6RA 3M85A 1EYAA 5CV8A 4C2MB 3C2PA 3VYRA 3A55A 3GTMB 2WV6D 2PCFB 1B44D 3Q22A 5A35A 1F9RA 1U4PA 4HR7B 1AW7A 5ELEA 2R7ZB 3PV0A 5EPKA 1LTTD 1FYCA 1KLUD 3T4AC 3AMUA 2K7VA 4OIKA 2Z8LA 2LKVA 3MWYW 1FGBD 1ENAA 4IUVA 1Y69U 2CVRA 3KLRA 2EY6A 3P75A 4PV1C 4DAYA 1TT2A 2GA4B 3HEJA 1TIID 5M9OA 4KJNA 1H9SB 2BDNA 2F3VA 3TP7A 4I65A 1HHVA 4A3IB 4KD3A 3SR1A 3P7JA 1I4PA 4K8JA 1RHPA 1LTBD 4WFN3 3HOVB 2EVBA 3S2DB 1EY7A 2B2TC 1B3AA 4PQXA 2BE5C 5IGEA 4CGYB 1JR0D 2QF7A 1PRTB 4BBRB 3LWUA 1G291 1XX8A 1EQTA 4A3EB 2BCOA 5IGDA 1VDZA 5EPLA 3TP6A 2BDOA 1OO9B 1CK1A 5HURA 5KNBA 5I6WA 1Y1WB 4XQNA 4HSVA 4V190 2OEOA 1GUGA 2SNSA 4M8AA 3LNNA 4DAPA 1S5FD 5KYIA 4QF4A 1DD2A 4A3BB 1OXSC 2QILA 2IX1A 2EY1A 3R3OA 2XWBB 3KBXA 1LTGD 1QG7A 2B2UC 2EYOA 4HMJA 1Q1EA 1X3QA 2A6EC 1TKWB 5IGGA 5J39A 5JPMC 1TS2A 5COYA 1JOQA 2K33A 2CW0C 3EQLC 4TKOB 2BA0A 5EKLA 4KY6A 1YNND 4UAIA 1DOLA 4CJ0B 2PQEA 1YNNC 1SNCA 1KNEA 3S17B 1OXTA 5I6YA 1AN8A 4DXFA 1M8AA 4IURA 1VMCA 2B2YC 3K57A 1EY5A 4QUFA 2K04A 1GOZA 2TMPA 3KLSX 1STAA 5JEAG 5F2DA 3I72A 4ZK9B 1EY9A 1ML0D 2FHTA 3C1FA 5FOBB 2F0KA 1RKNA 3K0YA 1JOKA 1SYFA 1XWEA 1DOKA 3HOYB 4C3JG 4DNRB 5EKKA 4CHTB 1EY4A 3L3OC 3DXJC 3RZOB 4G57A 1UNSA 4HEDA 4U68A 3U9SA 4IALA 4C3IG 3GTJB 2F4IA 4K2KA 3D3RA 2VXWA 4IZ8A 2K5QA 2B8GA 1MI2A 3U9OA 2PO4A 3O13A 1YNJC 2PW7A 4DF7A 1PFMA 3ITPA 5CV6A 1SYGA 1J9OA 4BY7B 3V2TA 4A93B 1B1ZA 4XT3B 3K5MA 5E4WC 1Y1VB 1LT5D 4O42A 2F0VA 3OW7A 1A3VA 2ZXPA 4KHZA 1BQQT 2WKCA 1D6EC 1TR5A 3EJIA 1QCBD 3NTHA 3MAQA 1Q3LA 1SMYD 1BBXC 2L5TA 2JA6B 1Q12A 2RA4A 4LMQD 2IJ0A 2FMMA 2F0TA 1R4PB 2EY5A 1EIGA 2ENBA 3K5NA 2RKSA 1H9MA 5E4XA 1EZ8A 1W6KA 2DY8A 2BA1A 5FO8B 1F2YA 1FR3A 2JA8B 2Q8RE 3CRKC 2F0FA 1UUPA 4EGVA 1TWFB 1EYDA 1I4QA 2NTTA 3OPOA 1HUMA 2TSSA 3M7NA 4A3GB 5K36H 1NR2A 4LJZC 1QNKA 3IAYA 3I90A 3SK4A 3G6JB 3T53B 2FMCA 2F0EA 3OWEB 1B53A 1BO0A 2KVMA 4P2CB 1OXUA 1EIHA 4JBWA 2L12A 5CV5A 5C4ZA 4K2LA 2RBMA 2JEAI 2F0SA 1Z6HA 4L6TB 1ZKOA 2N55A 5C0XH 1LO5D 3K58A 1MBYA 2Z1CA 2FFKB 2A73B 2B2UA 3DHQA 3DWQA 1HRJA 5JVG3 2IX0A 5M5YB 4TRDA 5D14A 2AQ1B 1AZPA 1CM9A 1RTNA 4XXEA 4OHJA 2AUJD 3Q0AA 2RDHA 4X3KA 2E2IB 1HA6A 1TVXA 2NTSA 2D62A 3MZ5A 4C56C 4A3JB 1IW7C 1XYIA 2F03A 2E2JB 5CBAE 5EJWA 5JEAJ 3AU7A 1LTRD 1Y8NB 5CV4A 4X3UA 2QDBA 3SEBA 1KDCA 1LTSD 2B2VA 1IKMA 4U673 5I9OA 5FK9C 3KF8A 2G9HD 4F7XA 1PRTC 4IUPA 3GV6A 1SMYC 4M1UB 3P1HA 2NVTB 5LL6S 3RUZA 1ENFA 4BS9A 1KTKA 4R8IA 3MTSA 1GHKA 1O7LA 3MFGA 2VNUD 4KJOA 1S5BD 4RCNA 4FVMA 4FNFA 3D4DA 3HOZB 3TP8A 2R6GA 5JAVA 4RWSC 1SSOA 4KKSA 1ZYRD 2Z4HA 1JQYD 1TWHB 4X3SA 5K36G 3VR5A 2IT1A 2E75C 2F0NA 1HTPA 2NWGA 3RMHA 2PNRC 5AFWA 1D2BA 2WB1B 4K5VA 2MJ8A 1LV9A 3MXUA 2JP1A 2WKDA 4HSPA 3S1QB 1JORA 1ILPA 3C3LA 3I73A 1HFNA 2QEJC 2IL8A 2ZXRA 4BA2I 3QO2A 3SK6A 2A68C 3FDTA 2WACA 3VYUA 1W6JA 2R61A 3EROA 2WP8J 5ELDA 3E6ZX 1TU2B 3Q24A 3N52A 1MD2D 1RD9D 3H09A 1SYDA 1FNWA 1AFPA 5IGFA 1E2ZA 2L11A 3PIP3 5IOCA 5JJZA 1GUOA 5KEEA 4ZUJA 2EOTA 1KNAA 4IFDJ 2PZUA 1CZWA 4C3IB 2G9DA 1L0XB 3PUWA 4JK1C 1Y8PB 4DK0A 3MC0B 2EY2A 3QJYA 5CGKA 1KDBA 3CKIB 4OL7A 2L55A 3H6MA 2A6HD 1MGSA 4XIGS 5C3XA 3PMFA 1NSNS 2NZ1D 2F0HA 2F0GA 3UI2A 2FJ2A 4CKBA 3CU7A 3J80L 2EYHA 1BOSA 3VYSA 2EZVA 2H4OA 4R8NA 1RTOA 1NR4A 4O1NA 4KY5A 3MXPA 2KHSA 1EWHA 5TSSA 2XVSA 3QB3A 3NPPA 3GTLB 1H9KA 3C1EA 3ZYYX 1E2VA 4CKCA 3VYTA 3S9WA 1U9RA 4PMCA 4NMZA 2JA7B 2A69D 5IT9L 4KK7A 2F3WA 4ULLA 1JCKB 5EGTA 1OXVA 1STGA 5FO9B 1WTRA 4HCEA 3CRLC 1B50A 3DEOA 4WORA 3H3VC 1CHQD 3MVVA 4XT1B 3WDNA 2K1BA 2SNMA 3ERQA 3LWEA 1DJRD 5JEAH 1F9PA 1H9RA 3TP5A 5EPJA 1WTWA 3HKZB 1E2WA 1PTOD 3NUCA 2YU9B 3DWPA 4DXGA 2OXPA 3A7AB 3NSWA 1VCIA 5C5LA 4KTAA 4YIJA 4K5XA 1JE4A 5JPNC 1LABA 1QE6A 1D1KA 5HGTA 4B9XA 3GTPB 4C3HG 1WTQA 4KV6A 2D5DA 3NP8A 3GTOB 1G6ZA 5I4DA 4RKBA 5FLXL 3A8KE 2NUCA 4RH6A 3PUXA 2SDFA 3CQZB 2MPMA 3SHLA 1CZGA 1TWAB 4MN3A 5E1FA 3DEPA 2B2WC 4ZUIA 5CC4A 1SE2A 4KMUC 2AWNA 3SK5A 5I2YA 2AUKA 2A69C 3MEHA 1D5ZC 1A3UA 5G3LD 2B8FA 2EPBA 1EZ6A 1F9SA 1S5ED 5ELBA 3T56B 1D5MC 5A2QE 1EOTA 2MUYA 3J7AF 1B9NA 3LX0A 1F77A 3PUYA 5C0XJ 2NN6G 3L9AX 4FXGC 1TWCB 5C6AA 2D2CC 2PYKA 1NUCA 2EDGA 1CI3M 5ELCA 4A3MB 2A5HA 3HGBA 1TS3A 3GTQB 4N9TA 3E5SA 4PMWA 5DM63 5G3LF 1AP0A 3BS1A 1M4VA 3D6WA 2X6LA 4DA2A 4NW2A 1Z7TA 4BWGB 2HDLA 2H1EA 5JOBA 1CA6A 4FO2A 5IGCA 4FF4A 2MP1A 3NHHA 2FINB 1CTMA 1H9SA 2K05A 1GUWA 4KI0A 1LTID 2J4XA 1PRTD 3SDZA 4X3TA 4IFDG 2MHVA 4IFDI 2EXZA 3OMGA 3IFDA 1K8MA 4KKTA 5C0XG 4DNTB 2RQXA 1HA5A 3PO3B 2E74C 4CBVA 3BVMA 2KEEA 2SEBD 4Q5VA 1HPCA 1RCVD 1S4ZA 4OO1H 1EY6A 2A6ED 5LL6X 4EQOA 2J0TD 3GO5A 1WVLA 1PXUA 4KN4C 1JB3A 1HQMC 4B08A 5CYUA 5LHY1 3KUPA 3ND9A 2K32A 1G91A 1JICA 1TS4A 2EYLA 4G7HC 1DOMA 1HCZA 2M00A 2WINB 5IGBA 3R2IA 1VF5C 1A15A 4RHSA 2SOBA 1O80A 4HAEA 1EEID 3IKJA 1XXGA 2PZWA 3OHXC 3URYA 1C48A 1WTOA 1I6HB 4RGTA 4XQQA 4DAVA 2IPKD 1CQVA 2E2DC 1DXMA 3EFXD 2JYOA 4Y7NB 2K01A 3FPUB 5KYLA 3BVZA 1V43A 1ZXTA 1PLFA 3KBGA 2PZTA 4RA8A 2EYPA 3OSOA 1BR9A 1SDFA 2KCNA 4H13C 3D8GA 2B39A 1STHA 4TQUS 1WTPA 1Z47A 1SAPA 2LFNA 3TN2A 1EU4A 1L0YB 3RZDB 3HZXA 1SE4A 1CFMA 4ZYSA 3NQIA 4F8MA 1KAAA 3PO2B 1I6VC 1QNUA 3MFYA 2VB2X 4FF2A 4KY7A 1EEFD 3M7GA 5C4HA 5DM73 1BCPD 3D31A 4DK1A 2I07B 4CJ1B 1EL0A 4EQNA 2B63B 1JWSD 5I2XA 3S15B 1V1OA 2AQ3B 1K83B 2PW5A 3NBHA 4QIWB 2KECA 2DNCA 3FMCA 2F0IA 2L9HA 3BG3A 1PTOH 3HOXB 2NB0A 2F0OA 5ELFA 1IHZA 3BZDB 3K6OA 2ZT9C 1CT1D 1II3A 1WD0A 3FKIB 1UEAB 2KUMA 4HMIA 3HP3A 1EYCA 2HCIA 3P20A 4BA1I 4CJ2C 2HQEA 1SNOA 1PFBA 1PYWD 3R2TA 3TSSA 4RAUC 3FVQA 2NVQB 2R92B 2VB3X 1LT4D 4Z9CB 1DM0B 2E2HB 1SE3A 3VA7A 1G8ZD 3FPPA 1GXDC 5IIFA 3I3CA 2NVYB 4RGOS 1I4HA 2HDMA 1GUNA 4ZLTF 3A7LA 2Q8TA 2YYZA 3QG1A 3GTKB 1PFNA 1TQOA 3KLSA 3WOEA 5K5PA 4RKLA 5EQ0A 4IUNA 3SK8A 5DNFA 3J81E 4F87A 4FF1A 1VMPA 2JSOA 2NBFA 2Z4IA 1LTAD 2DN8A 5C4JB 1A3TA 2KEDA 1RODA 3BYYB 2CQAA 1LT6D 3T13A 5I9PA 3DM1A 2F0UA 2LY7A 5C0XI 3M4OB 3QIAA 3J80E 2F0JA 5C44B 2IX3A 3SVMA 4B9WA 2O2LD 2NYZD 1SNQA 1SEBD 2I46A 4C3HB 4IN3A 1XTCD 3X3MA 4DN4M 3PUVA 3Q6SA 1V8QA 2RSOA 1DCZA 1ILQA 4DGZA 3OIPA 1T5EA 3HOUB 3EVQA 2EE1A 3WOFA 1FD7D 2F0QA 2HCCA 3S2HB 2JXMB 2EYMA 4S3SA 4K6DA 5M3FB 5CORA 1Y8OB 3H0GB 5M5WB 1CHPD 1SYCA 1R9TB 3PIO3 1UAPA 1G2SA 3K5LA 4QB4A 2F0LA 1IYVA 1WD1A 3TMEA 1ICWA 1SYBA 1GJXA 2IW3A 4J1MA 3KK7A 1I4RA 4RGMA 4ILWA 2J7ZA 4UDUC 4TSSA 1R4QB 3IL8A 1QILA 1HUNA 1K8OA 4WJWA 3OOCA 3BDOA 5KGUA 2VUMB 4G4KA 1QJOA 3A54A 2KCCA 3K59A 1PTOB 1C8CA 2JE6I 3EA6A 4KHVA 4FYDA 3BDLA 4FP5D 3OIQA 1STBA 1SYEA 1AEXA 1FNUA 4OO1I 3H94A 1QOHA 4HCSA 1WTVA 5BN3A 4HN7A 3S14B 4RCOA 1NCVA 1PTOF 4NDXA 3MA2B 1TS5A 2F0MA 1QWYA 1ENCA 1CA5A 1JWUD 2B2TA 1SNDA 2JEBI 4OIJA 1LT3D 2L0CA 1TY0A 1RDPD 1ESRA 1SXTA 4G7ZC 1B4OA 3HRZC 1D5XC 4XQJA 2D9UA 4IUTA 2A6HC 4A3FB 4PMBA 1IL8A 1DZ1A 5KNDA 5DAUA 1DONA 1GUSA 2F0DA 4V0BA 3NQTA 1EQVA 3R93A 2EYJA 1PZJD 5NUCA 1G2TA 3ONAB 1YNJD 2QCPX 1GHJA 4WRDA 2BE5D 2L1BA 1ONLA 5CV9A 4R9WA 3J7YW 2C5CA 1BF4A 1U4MA 2ZXOA 1EY0A 1TY2A 1KABA 5CV7A 2M9VA 1STEA 3DWAA 2F1MA 2O5JC 3CHBD 2EJMA 3NWSA 1ET9A 2EYFA 1SNMA 2CHBD 1STYA 4N9PA 5BN5A 2ICIA 3AB9A 5FKAC 1Q90A 4L63B 3VA5A 1ZEQX 4DFAA 4BY1B 1O7YA 3QOJA 5EBDA 3S1MB 4H7BA 3HOWB 1X32A 1A6XA 5JVH3 3IFTA 4XTCS 5J22A 2CW0D 4ME5A 5C4XB 1F9QA 2NN6I 1JOOA 2O4XA 1WTXA 4OGQC 2K5DA 2OT2A 5T1IA 4KN7C 5D3DA 1C4QA 1A2UA 3Q23A 2E76C 2R93B 4I7ZC 2NVXB 4QMGA 4PNYA 5M3MB 4AYBB 1PRTF 2KOLA 3GQBA 4FXDA 1I4XA 3X3NA 3GV3A 3D4RA 5T1GA 5DEHA 5E3FA 2MGSA 1B2TA 1PMRA 1CQFA 2JA5B 1EY8A 3J81L 3S16B 5D65A 1HTLD 3VR3A 1F2ZA 2X6GA 3MHBA 2OF1A 1ET6A 3S1RB 1F2LA 2B2YA 2EJFC 4BBSB 1SJHD 3K7AB 1QB5D 4NKLA 4G7OC 5A2QL 5FO7B 3SE0A 3ND8A 1O78A 5IODA 2NN6H 4K14A 1DYQA 3I70A 2EJGC 4A3KB 2PPBC 1STNA 1V1PA 3F2UA 2ID0A 4A3DB 1OXXK 2BOSA 5KRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X32 A;  5AFW A;  2MP1 A;  3TZD A;  4O42 A;  2FIN B;  4IUV A;  2CVR A;  3I8Z A;  2B2T A;  4IUU A;  2EE1 A;  2K05 A;  2MJ8 A;  1LV9 A;  2MPM A;  1PDQ A;  1RTO A;  2JP1 A;  2SDF A;  4RA8 A;  1SDF A;  4OIJ A;  1GUW A;  1NR4 A;  4X3T A;  1J8I A;  2HCC A;  4X3K A;  4UAI A;  1DOL A;  4CJ0 B;  1WTP A;  1F9Q A;  3IFD A;  1WTX A;  1HA6 A;  3G7L A;  1SAP A;  1O7Z A;  5COR A;  1ILP A;  4XDX A;  1ESR A;  1HFN A;  5T1I A;  4MN3 A;  1TVX A;  1KNE A;  1B4O A;  3TN2 A;  3DEP A;  3I3C A;  2B2W C;  2BDN A;  4QUC A;  1Q3L A;  2IL8 A;  1HHV A;  2D9U A;  2HDM A;  4ZLT F;  1BBX C;  4IUT A;  1M8A A;  1NAP A;  3QO2 A;  4IUR A;  5EKI A;  1IL8 A;  2B2Y C;  1VMC A;  1XYI A;  2KOL A;  3P7J A;  2Q8T A;  1DZ1 A;  3FDT A;  2RA4 A;  5CBA E;  5EJW A;  1G2S A;  2KEE A;  4LMQ D;  1DON A;  1PFN A;  4QUF A;  2FMM A;  5CMD A;  2K04 A;  1WD1 A;  3GV3 A;  5T1G A;  1ICW A;  1RHP A;  2R3Z A;  2MGS A;  5EQ0 A;  4X3U A;  1WTR A;  1S4Z A;  1EIG A;  1B2T A;  2B2W A;  3N52 A;  2XIW A;  2EPB A;  5DNF A;  5E4X A;  1B50 A;  2B2V A;  3DEO A;  1IKM A;  2B2T C;  1F9S A;  2X69 A;  1VMP A;  2DY8 A;  3R93 A;  1B3A A;  4ZKB B;  1RJT A;  1U4L A;  4ZK9 B;  1G2T A;  4XT1 B;  2J7Z A;  2Q8R E;  3ONA B;  5D65 A;  1CA5 A;  1EOT A;  2HUG A;  1WVL A;  1U4R A;  3I91 A;  1ML0 D;  2FHT A;  2K1B A;  2L1B A;  2M2L A;  2N88 A;  3IL8 A;  2L4N A;  1XX8 A;  2KED A;  1EQT A;  3LWE A;  4R9W A;  1ROD A;  1IKL A;  4IUP A;  1F9P A;  4CJ1 B;  2X6G A;  3GV6 A;  1HUM A;  1EL0 A;  1HUN A;  1BF4 A;  1U4M A;  1DOK A;  2L11 A;  3KUP A;  1AZQ A;  3DM1 A;  1NR2 A;  5EPL A;  2B2V C;  5EPJ A;  3MTS A;  5JJZ A;  4R8I A;  1WTW A;  1MSG A;  1QNK A;  1X3P A;  1G91 A;  2EOT A;  2KEC A;  1KNA A;  1JIC A;  3I90 A;  2L9H A;  3SVM A;  1DOM A;  5CBE E;  1C8C A;  1B53 A;  1BO0 A;  2K03 A;  2KVM A;  4HED A;  4U68 A;  4ZAI A;  2NYZ D;  1F2L A;  2B2Y A;  1HFG A;  2RVL A;  1EIH A;  4HSV A;  2L12 A;  2K28 A;  1A15 A;  2DY7 A;  1O80 A;  4HAE A;  1AP0 A;  1WD0 A;  1JE4 A;  2VXW A;  4RWS C;  2N55 A;  1QE6 A;  1MGS A;  3D6W A;  2KUM A;  1WTQ A;  2X6L A;  1MI2 A;  1SSO A;  1E0B A;  1F9R A;  1U4P A;  2NZ1 D;  4DN4 M;  4HCS A;  1WTV A;  3HP3 A;  1WTO A;  3Q6S A;  4NW2 A;  2HCI A;  3KBX A;  4MHE A;  5EPK A;  2FFK B;  3UI2 A;  4CJ2 C;  1PFM A;  2B2U A;  2FJ2 A;  4X3S A;  1QG7 A;  2B2U C;  2JYO A;  2RSO A;  1HRJ A;  1BNZ A;  1J9O A;  1NCV A;  2H1E A;  1ILQ A;  2HDL A;  2K01 A;  1X3Q A;  3FPU B;  1G6Z A;  1O7Y A;  1PFB A;  3F2U A;  5D14 A;  4XT3 B;  2RSN A;  1AZP A;  1ZXT A;  1CM9 A;  1PLF A;  1RTN A;  5E4W C;  4ZKC B;  4OIK A;  1CA6 A;  4IUQ A;  5COY A;  1MSH A;  2NWG A;  3MWY W;  3H91 A;  4RAU C; 
#chains in the Genus database with same CATH topology
 5C4J H;  3J7A V;  2Q2H A;  1PDQ A;  3TBI B;  1B9M A;  3NTI A;  5CR3 A;  4FF3 A;  3KDF B;  3E3X A;  3DUZ A;  3G7L A;  4ODG A;  4DR1 Q;  4XDX A;  3NE5 B;  1CSQ A;  2QA4 A;  4BXX H;  5J1Z A;  5E7N A;  1KRT A;  1L1O A;  3RLF A;  1I4G A;  1J6Q A;  1B8A A;  5EKI A;  2QKI C;  3CCE A;  1S72 A;  1BDO A;  3A56 A;  2MQH A;  3NWT A;  4GKK L;  4K8I A;  1GUT A;  5CMD A;  1VF7 A;  1WCM B;  3FHW A;  4QCL A;  3DMU A;  3M4Y A;  5C5M A;  4Q0F A;  2UUB Q;  4EQP A;  2KA7 A;  3FRP B;  1Q8I A;  5KNC A;  1I3Q B;  1JE5 A;  2X69 A;  1RJT A;  2AKW B;  2D0O A;  5GRO A;  2IWH A;  3W2D A;  2HUG A;  4LF5 Q;  1U4R A;  4DU9 A;  3VR6 A;  1PZK D;  2KCM A;  3PGZ A;  2MNA A;  3JAM c;  2LS0 1;  1A2T A;  3SXH A;  3KF8 B;  1C0A A;  4DV6 L;  4JI6 L;  2XWJ B;  4A3I G;  5FLX E;  1VQ5 A;  1BCP F;  3D6C A;  3BVG A;  2DNE A;  3U4V A;  4KD4 A;  3R8B A;  4NP5 A;  4B3M Q;  3FEW X;  2RVL A;  4JYA Q;  2QGQ A;  3G4S A;  2DY7 A;  1HQR D;  1SE8 A;  4IJH A;  4PZ7 A;  4DR2 L;  3B6Y A;  3I4L A;  1E0B A;  3VR4 A;  2K5W A;  4Y52 H;  1PH8 A;  4C3J B;  5BN4 A;  4IFD H;  4IQZ A;  1ZYR C;  2N49 A;  5M5Y H;  1BNZ A;  1VQO A;  4HJ8 A;  2RDF A;  3OW2 A;  1V1P B;  1D1I A;  4IUQ A;  1MSH A;  2F0P A;  3E0J A;  4QL5 A;  5IP9 G;  5JJL A;  1F2M A;  2K6A A;  2WAQ B;  4RHR A;  3TZD A;  2E5L Q;  3HOX G;  3I8Z A;  1XMQ L;  2A19 A;  4RFB A;  1S5C D;  2O5I C;  1J8I A;  3GP7 A;  3AYH B;  4XYO A;  5LMU Q;  3K7A H;  3T16 A;  3F2D A;  1O7Z A;  1PZI D;  3BDC A;  1NBW A;  1S5D D;  1T5X D;  4FXK C;  3NBI A;  2AQ2 B;  1SRO A;  4ZRZ A;  2YTX A;  3U4Z A;  2R93 H;  2XSC A;  2LMC B;  1EWI A;  1N36 Q;  4CKE A;  3FKI G;  1WCM G;  2K75 A;  3J81 j;  4XYQ A;  1JC7 A;  2ICE C;  2MO1 A;  4AYB E;  1LLR D;  1KLG D;  3STB D;  4LF6 L;  2K14 A;  1CKO A;  2V4D A;  2A68 D;  4HJ7 A;  4C1N I;  2R3Z A;  3MXN A;  2B2W A;  4LW1 A;  3I4M B;  3JAM L;  4J6H A;  5IT9 E;  3GTM H;  4K6L A;  1U4L A;  4A93 H;  4GZY C;  5C3W A;  1YBY A;  3MXG A;  3NK9 A;  1HXY D;  3I91 A;  3S1N B;  2VQF L;  5ISR A;  5C3E B;  4DR2 Q;  2L4N A;  1J5E Q;  3W3A A;  5LMN Q;  1AZQ A;  4OO1 G;  2KBN A;  1IW7 D;  2N78 A;  2Q8I B;  1EYG A;  1H9J A;  1MHW C;  3OWF A;  4F88 A;  4IOC A;  4A3I H;  5IT9 c;  1SFO B;  4GLX A;  1S40 A;  1HNW Q;  5GAH C;  3TS2 A;  2MFI A;  5CBE E;  2K03 A;  4ZAI A;  5M5X B;  1QUQ B;  3C46 A;  1VQB A;  1N9W A;  1XTD A;  2OQ0 A;  2XRQ D;  1K9M C;  1AH9 A;  2PMZ B;  3HOV G;  4QY7 A;  4BBS H;  2XN9 C;  4LAA A;  4C1N K;  1PH6 A;  1KIX A;  1BCP B;  2RDG A;  1BXT A;  1TWG B;  1IBM L;  3QOL A;  3M3Y B;  2XNA C;  4DV2 L;  1BCP C;  2WII B;  3K5O A;  4MHE A;  1IYJ B;  4MIU A;  1EFI D;  4J15 A;  2K50 A;  1NMF A;  4PZ6 A;  1SNP A;  4JVZ A;  2RSN A;  1RF2 D;  3OMC A;  1IBL L;  4ZKC B;  3A0J A;  5EBC A;  1LAC A;  3GD7 A;  1EWC A;  4QQB X;  3H91 A;  3BU2 A;  4L8J A;  4IUU A;  4OWX B;  3J80 c;  1LUZ A;  4IJL A;  3I4M G;  2F0W A;  3HS0 C;  3T1Y L;  4UY8 C;  4E6I A;  3HG9 A;  4H0L C;  5GQO A;  3JAM E;  3A8J E;  4ABN A;  4K5W A;  1VQP A;  3V05 A;  5M3F H;  3PUZ A;  3L7Z C;  1T9H A;  1YHQ A;  3I4N B;  2Y0S B;  2KJX A;  4ID6 A;  3KJP A;  4QUC A;  4R4Q A;  1XMO L;  5D3I B;  4ZQ3 A;  3EBE A;  3GTG B;  4EVO A;  3D4W A;  4KKU A;  1JWM D;  2AWO A;  4RGN A;  3RD4 A;  1NAP A;  3BYT B;  1SR3 A;  3NXW A;  4H44 C;  2ALY B;  1IYU A;  2C9O A;  1LTL A;  4R4T A;  3TDQ A;  4JI3 Q;  1I50 B;  1ESF A;  2YV5 A;  4KLK A;  3GTG H;  3STB C;  4HTH A;  1EU3 A;  1Q1B A;  3V96 A;  4LK1 C;  2H5X A;  2XIW A;  1WYD A;  1SBB B;  2KQ3 A;  3I4O A;  4ZKB B;  4ZCK A;  1L2F A;  4DR6 L;  2UU9 Q;  2IHE A;  2M2L A;  2N88 A;  2Z0S A;  1AE3 A;  1BUV T;  3TZU A;  3S1M H;  3T51 B;  1IKL A;  3NTK A;  3ER0 A;  1Q46 A;  2Y0S G;  1YHA A;  4LFC Q;  2B2V C;  2ZTE A;  1KL9 A;  1SJE D;  1MSG A;  1X3P A;  4I7A A;  3CW2 C;  1TWF H;  3A8I E;  5KIX A;  1K0S A;  4A3M G;  3T1Y Q;  3CCL A;  3QWN A;  3VR2 A;  4J8Q A;  4LF4 L;  4DKA C;  4JBM A;  2EXD A;  2XRS D;  1PTO C;  1FNV A;  1HFG A;  1KDA A;  2A74 C;  2K28 A;  3N6R A;  3M85 A;  4JC0 A;  1EYA A;  3CXC A;  5CV8 A;  2QEX A;  4X62 Q;  4GOP A;  4JYA L;  4C2M B;  3RNU A;  4GKJ Q;  3C2P A;  3VYR A;  3A55 A;  4A3G G;  1IZ6 A;  1YVC A;  3GTM B;  2WV6 D;  5IE8 A;  1EIF A;  1JB7 A;  2PCF B;  1B44 D;  5A35 A;  3Q22 A;  1F9R A;  1U4P A;  1IXR A;  2VQE L;  4HR7 B;  3PO3 G;  1AW7 A;  5ELE A;  2R7Z B;  3PV0 A;  5EPK A;  2JA5 H;  1LTT D;  1FYC A;  1VQL A;  1KLU D;  3T4A C;  3AMU A;  1FGU A;  3HOY H;  1Y14 B;  2K7V A;  4OIK A;  2F52 A;  2I5M X;  3TRE A;  2Z8L A;  2LKV A;  3MWY W;  1FGB D;  1ENA A;  4BY1 G;  4IUV A;  5GAD C;  2CVR A;  4A76 A;  1Y69 U;  3KLR A;  5M3F G;  2EY6 A;  3S1N H;  3P75 A;  3F2C A;  4PV1 C;  4DAY A;  1TT2 A;  2GA4 B;  4DV0 Q;  3HEJ A;  1TII D;  5M9O A;  1HZC A;  5C44 H;  2KEN A;  1PH1 A;  4KJN A;  3A5Z B;  2UXB Q;  1H9S B;  2BDN A;  2F3V A;  3TP7 A;  1N32 L;  4I65 A;  1HHV A;  4X65 Q;  4A3I B;  4KD3 A;  3SR1 A;  3P7J A;  2WAQ G;  1I4P A;  1GM5 A;  4K8J A;  1MIU A;  3GDE A;  1RHP A;  2B3G A;  1LTB D;  3HKZ G;  1A8V A;  4WFN 3;  3HOV B;  2NZH A;  2EVB A;  3S2D B;  1BKB A;  1EY7 A;  2B2T C;  2G5D A;  1B3A A;  4PQX A;  2BE5 C;  5IGE A;  4CGY B;  1JR0 D;  2QF7 A;  3HOV H;  1PRT B;  3JC6 6;  4BBR B;  3LWU A;  1G29 1;  3KYH C;  1XX8 A;  5FLM H;  1EQT A;  4A3E B;  1BBW A;  2BCO A;  3NEM A;  1JMC A;  3W5O A;  2P5Z X;  5IGD A;  1VDZ A;  5EPL A;  3TP6 A;  3S1Q H;  2BDO A;  1OO9 B;  4DV4 L;  3S2H H;  1CK1 A;  4A3E H;  5HUR A;  5KNB A;  2JQO A;  5I6W A;  1Y1W B;  3RR5 A;  4AH6 A;  2BH8 A;  4XQN A;  3CMA A;  4HSV A;  4V19 0;  2OEO A;  3U50 C;  1GUG A;  3CPW A;  1H95 A;  2SNS A;  4M8A A;  1D8L A;  4IOA A;  3LNN A;  2R92 G;  4DAP A;  1S5F D;  5KYI A;  4QF4 A;  1DD2 A;  5DLQ E;  1E7Z A;  1OXS C;  2QIL A;  2VL6 A;  4A3B B;  4HJA A;  1EFW A;  2IX1 A;  2EY1 A;  1X3E A;  3R3O A;  2XWB B;  1RIP A;  3KBX A;  1LTG D;  5JJK A;  1QG7 A;  2B2U C;  2EYO A;  4HMJ A;  1Q1E A;  1X3Q A;  3UDF A;  2A6E C;  3CME A;  1TKW B;  2JA7 G;  5IGG A;  5J39 A;  5IP7 G;  5JPM C;  3DM3 A;  2Z9H A;  1TS2 A;  5COY A;  4DAM A;  1JOQ A;  2K33 A;  2EIF A;  2CW0 C;  2HQL A;  4NB3 A;  2K5N A;  3EQL C;  5C44 G;  4TKO B;  1FJG L;  2BA0 A;  5EKL A;  4KY6 A;  1YNN D;  4UAI A;  1DOL A;  4JPB W;  4CJ0 B;  3AEV A;  4JG2 A;  3ERS X;  3U58 A;  2PQE A;  1E22 A;  1YNN C;  1SNC A;  4POF A;  1KNE A;  3S17 B;  1OXT A;  5I6Y A;  2CQO A;  1AN8 A;  4DXF A;  3TS0 A;  1M8A A;  4IUR A;  1VMC A;  2B2Y C;  5ELN A;  3K57 A;  4A93 G;  1EY5 A;  2UXB L;  1A63 A;  2Q2U A;  4QUF A;  2K04 A;  2K52 A;  4DNI A;  1GOZ A;  4IPD A;  1NNX A;  2F4V L;  2TMP A;  3KLS X;  1K8G A;  4Y7N H;  4DR5 Q;  1STA A;  5JEA G;  1Y1V G;  5F2D A;  3I72 A;  3HOW G;  4ZK9 B;  4A3L H;  3FP9 A;  1EY9 A;  1ML0 D;  3PO2 G;  4TVA B;  2FHT A;  4L5Q A;  3C1F A;  5FOB B;  2F0K A;  1RKN A;  3K0Y A;  4LNQ A;  1JOK A;  1SYF A;  1HR0 L;  1XWE A;  4JV5 L;  2IY5 B;  1DOK A;  3HOY B;  4C3J G;  4LFB L;  4DNR B;  5EKK A;  4CHT B;  1EY4 A;  1BBU A;  4N8F A;  4LUO A;  3L3O C;  4YCW A;  3DXJ C;  3RZO B;  4G57 A;  3PCO B;  1UNS A;  4QIW E;  1YIJ A;  1N8R C;  3M9B A;  4HED A;  4U68 A;  2UUA L;  4GNX B;  3U9S A;  1HZA A;  4IAL A;  4C3I G;  3GTJ B;  4O0A A;  2F4I A;  4K2K A;  1SRU A;  3D3R A;  2VXW A;  4IZ8 A;  2K5Q A;  2B8G A;  4A3E G;  1MI2 A;  3U9O A;  2PO4 A;  1VQA A;  3O13 A;  4X6A H;  1YNJ C;  2PW7 A;  4DF7 A;  4QGU A;  3I4M H;  1PFM A;  4JI6 Q;  3ITP A;  5CV6 A;  1SYG A;  1J9O A;  4BY7 B;  1X56 A;  3V2T A;  5JJI A;  4A93 B;  1B1Z A;  2ZM6 Q;  1PH7 A;  4XT3 B;  2YTV A;  3K5M A;  3OTO Q;  1NE3 A;  5E4W C;  4CDF C;  1Y1V B;  1LT5 D;  4JCV E;  4O42 A;  2F0V A;  3OW7 A;  1Y1W H;  5M3M G;  1A3V A;  2ZXP A;  4KHZ A;  2UUB L;  4OX9 L;  2ZTD A;  1BQQ T;  1HNZ L;  3BJU A;  2WKC A;  2YU9 H;  4LFB Q;  1D6E C;  1TR5 A;  4GOP C;  1NY4 A;  3HOZ H;  5HGQ A;  3EJI A;  1QCB D;  3NTH A;  4GLA C;  3MAQ A;  1Q3L A;  3KF6 B;  1SMY D;  2UXD Q;  1YEZ A;  1BBX C;  4JI4 Q;  5FJ8 H;  4DV1 L;  2L5T A;  2JA6 B;  1XMO Q;  3I7F A;  3RN2 A;  3K81 C;  1Q12 A;  2RA4 A;  1KAW A;  1KXL A;  1VQF A;  4LMQ D;  3GTL H;  3M4P A;  1PYS B;  2IJ0 A;  2FMM A;  3CC7 A;  2F0T A;  1R4P B;  2EY5 A;  1EIG A;  2ENB A;  3K5N A;  2RKS A;  1H9M A;  5E4X A;  1EZ8 A;  1W6K A;  2DY8 A;  2BA1 A;  5FO8 B;  1F2Y A;  1FR3 A;  1WI5 A;  2JA8 B;  2Q8R E;  1YJN A;  3CRK C;  2F0F A;  1UUP A;  4AYB G;  3E0E A;  4EGV A;  3CCR A;  1Q7Y C;  2UXC Q;  4MTK A;  1TWF B;  1EYD A;  1I4Q A;  2NTT A;  3OPO A;  3K8A A;  3HOW H;  4DV4 Q;  1HUM A;  2TSS A;  3M7N A;  4A3G B;  5K36 H;  1NR2 A;  4LJZ C;  1QNK A;  3IAY A;  3I90 A;  3SK4 A;  3G6J B;  3T53 B;  1PH2 A;  1U0L A;  1XNQ Q;  2JA8 G;  2FMC A;  2QW7 A;  2F0E A;  3OWE B;  4DV1 Q;  1B53 A;  1BO0 A;  2KVM A;  4YY3 Q;  1VQ9 A;  4P2C B;  1OXU A;  1X65 A;  4LFA Q;  2OTL A;  1XNR Q;  4GKJ L;  4JBW A;  2Y0S E;  2L12 A;  1EIH A;  5CV5 A;  5C4Z A;  4K2L A;  2RBM A;  1K3B C;  2JEA I;  4N8X 1;  2F0S A;  3G6E A;  1Z6H A;  4P73 A;  4L6T B;  1ZKO A;  2N55 A;  5IYC H;  5C0X H;  2VQF Q;  4OWW B;  1LO5 D;  3K58 A;  1UWV A;  1MBY A;  1K8A C;  3JAM i;  2Z1C A;  4L5T A;  5IYB G;  2FFK B;  2A73 B;  2B2U A;  3DHQ A;  3DWQ A;  1N33 Q;  1HRJ A;  5JVG 3;  2IX0 A;  4IPG A;  4JI1 Q;  2OTJ A;  5M5Y B;  4TRD A;  1WTH A;  5D14 A;  2AQ1 B;  1AZP A;  1CM9 A;  1RTN A;  2E2I H;  3KLW A;  4XXE A;  4B3M L;  4DV0 L;  1IBK Q;  4OHJ A;  2AUJ D;  3Q0A A;  4L5R C;  4APV A;  1VQK A;  2RDH A;  4X3K A;  2E2I B;  3GTJ H;  1HA6 A;  1TVX A;  2NTS A;  2D62 A;  2DGY A;  3IRB A;  3MZ5 A;  1WFQ A;  4C56 C;  4A3J B;  1IW7 C;  1XYI A;  2F03 A;  2E2J B;  4JI7 L;  1P8L A;  5CBA E;  5EJW A;  5JEA J;  3AU7 A;  4ALP A;  3KJO A;  1LTR D;  1Y8N B;  3F2B A;  5CV4 A;  4JI1 L;  4X3U A;  1XPO A;  4K0K L;  2QDB A;  3SEB A;  1KDC A;  1LTS D;  2B2V A;  1VQ8 A;  1IKM A;  2R7Z H;  3CC2 A;  4U67 3;  5I9O A;  1HZ9 A;  5FK9 C;  2LXK A;  2DJF C;  3CAM A;  3NEN A;  1K28 A;  4LF4 Q;  3KF8 A;  3DLL A;  2G9H D;  4F7X A;  1PRT C;  1PVO A;  1C7Y A;  1UE7 A;  4IUP A;  4AQY Q;  2K5H A;  4JI0 Q;  3GV6 A;  4BY7 H;  1SMY C;  4M1U B;  3P1H A;  2NVT B;  5LL6 S;  3RUZ A;  3CCM A;  1ENF A;  4BS9 A;  1KTK A;  4P75 A;  4R8I A;  3MTS A;  4DV2 Q;  1GHK A;  1O7L A;  4DR4 L;  3MFG A;  1SFO H;  2VNU D;  4KJO A;  3RZO H;  1VQE A;  1QZG A;  1S5B D;  4A3B H;  1B7Y B;  1MJC A;  4RCN A;  1QVF A;  4FVM A;  1YHB A;  4FNF A;  2PMZ E;  3D4D A;  3TP8 A;  3HOZ B;  3BZC A;  1K73 C;  2R6G A;  5JAV A;  4RWS C;  4A3M H;  1HZB A;  2JA8 H;  1SSO A;  3T1H L;  1TWG H;  4KKS A;  2FXQ A;  3HOU G;  1NMG A;  1ZYR D;  2Z4H A;  2JA6 H;  5C3E G;  1JQY D;  1TWH B;  4X3S A;  5K36 G;  1I3Q H;  3LGJ A;  4DV7 Q;  4AQY L;  4RMF A;  3UE1 A;  3VR5 A;  2IT1 A;  2E75 C;  1W3S A;  2F0N A;  4MNO A;  1HTP A;  4LF5 L;  2NWG A;  3RMH A;  2PNR C;  5AFW A;  1D2B A;  2WB1 B;  3AFP A;  4K5V A;  1YJW A;  3CQZ H;  4X65 L;  5BR8 L;  2MJ8 A;  1LV9 A;  3MXU A;  2JP1 A;  2WKD A;  4HSP A;  3S1Q B;  2KCT A;  4LF9 L;  1JOR A;  1ILP A;  3C3L A;  4A3G H;  3I73 A;  1HFN A;  2QEJ C;  2PNH A;  2IL8 A;  4UHV A;  2ZXR A;  4BA2 I;  4JI5 Q;  3QO2 A;  3SK6 A;  3I4N G;  2A68 C;  3UDG A;  3FDT A;  3MXN B;  2WAC A;  3VYU A;  1W6J A;  2R61 A;  1SMX A;  3CP0 A;  3ERO A;  2WP8 J;  5ELD A;  4DR5 L;  3E6Z X;  1TU2 B;  3Q24 A;  1PH9 A;  1AE2 A;  3TQY A;  3N52 A;  5L37 A;  4C3J H;  1MD2 D;  1RD9 D;  1HJP A;  3H09 A;  1Y1W G;  2UXC L;  3G71 A;  1SYD A;  1FNW A;  1AFP A;  2WAQ E;  4X62 L;  5IGF A;  1E2Z A;  1DGS A;  1E1O A;  3H15 A;  1CKN B;  1TWA H;  2L11 A;  3PIP 3;  5IOC A;  3H3V H;  5JJZ A;  1GUO A;  3CCU A;  5KEE A;  4UP9 A;  4ZUJ A;  1SLJ A;  2EOT A;  1KNA A;  2A8V A;  1UE5 A;  4IFD J;  2PZU A;  2A1A A;  1CZW A;  4C3I B;  1YNX A;  2QDL A;  2G9D A;  1L0X B;  2R7D A;  2E2J H;  4YWL A;  3PUW A;  4JK1 C;  1Y8P B;  4DK0 A;  3MC0 B;  2EY2 A;  3QJY A;  5CGK A;  1KDB A;  1HR0 Q;  3CKI B;  4OL7 A;  2L55 A;  3H6M A;  2A6H D;  1MGS A;  4XIG S;  5C3X A;  3PMF A;  1E1T A;  4OON A;  1NSN S;  2NZ1 D;  2F0H A;  2F0G A;  3UI2 A;  4JOI A;  2FJ2 A;  3HKZ E;  1G51 A;  2VY3 A;  2PQA A;  4CKB A;  1QVC A;  1VQH A;  3CU7 A;  3J80 L;  4LF6 Q;  2EYH A;  2ASB A;  1BOS A;  3VYS A;  2EZV A;  2H4O A;  4R8N A;  4DK6 C;  1EOV A;  3SGI A;  3I2Z A;  5LMN W;  1RTO A;  4A4I A;  4UP7 A;  2JA5 G;  1NR4 A;  4O1N A;  4KY5 A;  4GNX A;  1XMQ Q;  3MXP A;  2KHS A;  1IBK L;  1EWH A;  5TSS A;  2XVS A;  3QB3 A;  4LF7 Q;  2D0P A;  3NPP A;  5IYC G;  1J5E L;  3GTL B;  1H9K A;  3C1E A;  3ZYY X;  1E2V A;  4CKC A;  2CKZ B;  3VYT A;  3S9W A;  1U9R A;  3G48 A;  4PMC A;  4NMZ A;  2JA7 B;  2A69 D;  1VQI A;  5IT9 L;  2ZJP A;  2DJG C;  4KK7 A;  2F3W A;  4ULL A;  1JCK B;  5EGT A;  1OXV A;  1STG A;  3HKS A;  2K4K A;  5FO9 B;  1WTR A;  4HCE A;  3H3V I;  5LMN L;  3CRL C;  1P16 A;  1B50 A;  3DEO A;  4WOR A;  3A74 A;  3H3V C;  1CHQ D;  3MVV A;  1QVG A;  4XT1 B;  2CWP A;  4NXM L;  3WDN A;  3PF5 A;  2K1B A;  2SNM A;  5IP7 H;  3ERQ A;  3LWE A;  1DJR D;  5JEA H;  1F9P A;  4DR3 L;  1H9R A;  2F4V Q;  3TP5 A;  5EPJ A;  1WTW A;  1Q82 C;  2XGT A;  3HKZ B;  4HJ9 A;  1E2W A;  1PTO D;  3NUC A;  2YU9 B;  1VQG A;  2JK8 A;  1XJV A;  2NVY H;  3DWP A;  4DXG A;  1O7I A;  2OXP A;  3I4N H;  2ZTC A;  4MZ9 A;  3A7A B;  1V9P A;  3NSW A;  1VQN A;  4A3D G;  1VCI A;  4BXX G;  4B3S Q;  5C5L A;  1X9N A;  4KTA A;  4YIJ A;  4K5X A;  1JE4 A;  5LMU L;  5JPN C;  1LAB A;  3K0X A;  1QE6 A;  1D1K A;  4WJ3 M;  5HGT A;  4B9X A;  3GTP B;  4C3H G;  1WTQ A;  3GTO H;  1I50 H;  3CCS A;  4KV6 A;  3W1G A;  4DV3 Q;  2D5D A;  1PH5 A;  4DUZ Q;  3OYY A;  3NP8 A;  2CH4 W;  2CFM A;  2BH2 A;  4NXN Q;  3GTO B;  1Z9F A;  1G6Z A;  5I4D A;  4RKB A;  5FLX L;  4L5S A;  3A8K E;  2NUC A;  2PQA B;  2RF4 A;  2I0Q A;  1YIT A;  4RH6 A;  4WJ4 A;  3KOJ A;  3PUX A;  1N36 L;  2SDF A;  3CQZ B;  1XNQ L;  2MPM A;  3SHL A;  1L0W A;  1D7Q A;  1Q86 C;  1CZG A;  3A5U A;  1TWA B;  4MN3 A;  5E1F A;  3DEP A;  2B2W C;  1FVI A;  4ZUI A;  1X54 A;  5CC4 A;  1SE2 A;  4A3F H;  4A3B G;  4KMU C;  4C3I H;  2AWN A;  3SK5 A;  5I2Y A;  2JJQ A;  2AUK A;  2Q2T A;  1JT8 A;  1VQ6 A;  4C2M H;  2A69 C;  3MEH A;  1D5Z C;  1VQJ A;  1EQQ A;  2HT1 A;  1A3U A;  4R4C A;  5G3L D;  1FL0 A;  2B8F A;  1CKN A;  2EPB A;  4A75 A;  1EZ6 A;  1F9S A;  1S5E D;  4UPA A;  3W1B A;  3K7U C;  5ELB A;  1D5M C;  3T56 B;  2KHI A;  3PSI A;  4JI4 L;  4GKK Q;  5A2Q E;  1EOT A;  2MUY A;  2CCZ A;  4A3D H;  3J7A F;  1B9N A;  3LX0 A;  1F77 A;  2CWA A;  3PUY A;  2AHO B;  1QZH A;  5C0X J;  2NN6 G;  2VZA A;  4K0K Q;  3K80 C;  1CSP A;  3EIV A;  2RCF A;  5GAG C;  4DV3 L;  3L9A X;  4FXG C;  1HNX L;  1TWC B;  5C6A A;  2D2C C;  2PYK A;  5EAY A;  1NUC A;  2EDG A;  1CI3 M;  5M5W H;  1YI2 A;  2R7F A;  5ELC A;  4CDE C;  4A3M B;  4GNX C;  2A5H A;  3HGB A;  1TS3 A;  1MJE A;  3GTQ B;  4N9T A;  1PFS A;  3E5S A;  4PMW A;  5DM6 3;  5G3L F;  1AP0 A;  4DUY Q;  1EQR A;  4R4O A;  3BS1 A;  1M4V A;  4JI2 L;  3D6W A;  2X6L A;  1HNX Q;  4DA2 A;  2B63 G;  1ASZ A;  4NW2 A;  1IBM Q;  2LSS A;  1Z7T A;  4JOI C;  4LWC A;  4BWG B;  4R1J A;  1N34 L;  4BY1 H;  1YZ6 A;  2HDL A;  2H1E A;  3TRZ A;  3QR8 A;  5JOB A;  4A3C G;  4JI3 L;  1X55 A;  4CDD C;  1CA6 A;  4A3J G;  4BBR H;  2ZJQ A;  4FO2 A;  4MTN A;  2MO0 A;  5IGC A;  4NXN L;  4FF4 A;  2MP1 A;  1CUK A;  3NHH A;  1UE6 A;  2FIN B;  4YCV A;  1CTM A;  1H9S A;  2K05 A;  4HIO A;  1GUW A;  4KI0 A;  1LTI D;  2J4X A;  3PO3 H;  1PRT D;  3SDZ A;  4X3T A;  4IFD G;  2MHV A;  2F3I A;  4IFD I;  2EXZ A;  3OMG A;  3IFD A;  1K8M A;  4KKT A;  3ULL A;  4PG3 A;  5C0X G;  3ULP A;  3E9I A;  4DNT B;  1U5K A;  1E24 A;  1HA5 A;  2RQX A;  3PO3 B;  4H02 A;  3GTP H;  2E74 C;  4LFA L;  1XNR L;  4CBV A;  2PI2 A;  3CCJ A;  3BVM A;  2HD3 A;  2KEE A;  5ELO A;  2SEB D;  4DV5 L;  4Q5V A;  1HPC A;  1RCV D;  1S4Z A;  4OO1 H;  1EY6 A;  2A6E D;  5LL6 X;  2B29 A;  4EQO A;  5FLX c;  2J0T D;  1TWH H;  2K5V A;  3GO5 A;  1WVL A;  3J7Z C;  3E9H A;  1PXU A;  1MKH A;  4A3F G;  4DR6 Q;  4KN4 C;  1JB3 A;  1HQM C;  4B08 A;  5CYU A;  5LHY 1;  1PA6 A;  3J80 i;  3KUP A;  3ND9 A;  2K32 A;  2RHQ B;  1G91 A;  1JIC A;  1TS4 A;  2EYL A;  1UE1 A;  3TEH B;  4G7H C;  1DOM A;  1HCZ A;  2M00 A;  2WIN B;  5IGB A;  1VQM A;  3R2I A;  3S17 H;  5FLM G;  1VF5 C;  1A15 A;  1NTG A;  3UDX A;  4RHS A;  4GN4 B;  2SOB A;  1I6H H;  1W2B A;  1O80 A;  4HAE A;  1EEI D;  5IY0 A;  3IKJ A;  1XXG A;  3CCV A;  2PZW A;  1L1O C;  3OHX C;  3URY A;  1C48 A;  1WTO A;  1I6H B;  4RGT A;  4XQQ A;  4DAV A;  3T1H Q;  2IPK D;  1CQV A;  4JI2 Q;  2E2D C;  1DXM A;  3EFX D;  2JYO A;  4Y7N B;  1IBL Q;  4A3K H;  2K01 A;  3FPU B;  5KYL A;  3BVZ A;  1V43 A;  1ZXT A;  1PLF A;  3KBG A;  3L0O A;  4DV7 L;  2PZT A;  4RG1 A;  3CCQ A;  3KFU A;  4RA8 A;  3OSO A;  2EYP A;  1BR9 A;  1SDF A;  2KCN A;  4H13 C;  3D8G A;  2B39 A;  1ICF B;  1STH A;  4TQU S;  1VQD A;  1WTP A;  1Z47 A;  1SAP A;  1EUJ A;  2LFN A;  3I55 A;  2N3S A;  5M5X H;  3TN2 A;  1EU4 A;  1L0Y B;  4POG A;  2VS1 A;  4IPC A;  5IWA Q;  3HZX A;  3RZD B;  4A3J H;  1N33 L;  1SE4 A;  4JI5 L;  1CFM A;  4ZYS A;  3NQI A;  4F8M A;  1KAA A;  5H1S E;  3PO2 B;  3BZK A;  4C3H H;  4JV5 Q;  1I6V C;  1QNU A;  1A0I A;  3MFY A;  2VB2 X;  4FF2 A;  4KY7 A;  1EEF D;  2OCE A;  3M7G A;  5DM7 3;  5C4H A;  1BCP D;  3D31 A;  3S15 H;  4DK1 A;  2I07 B;  5HY6 A;  1Y1V H;  4CJ1 B;  1EL0 A;  4EQN A;  3H0G H;  2V1C C;  2B63 B;  1JWS D;  4IO9 A;  2NVT H;  5I2X A;  2VUM H;  3S15 B;  1LM0 A;  5AJ3 Q;  1I5F A;  1V1O A;  1K83 B;  2AQ3 B;  2PW5 A;  3NBH A;  5C4X H;  4QIW B;  2KEC A;  2DNC A;  1Q81 C;  3FMC A;  2F0I A;  2L9H A;  3BG3 A;  1PTO H;  3HOX B;  4ME3 A;  1TWC H;  4NXM Q;  2NB0 A;  2F0O A;  3PIO A;  5ELF A;  1IHZ A;  3BZD B;  2E5L L;  5GAE C;  3K6O A;  3RN5 A;  2ZT9 C;  1CT1 D;  1JJG A;  1II3 A;  3HOY G;  3GTQ H;  1WD0 A;  3FKI B;  4DK3 C;  1UEA B;  2KUM A;  1I94 Q;  4GN3 B;  4HMI A;  3PF4 A;  1VQ4 A;  3HP3 A;  1EYC A;  2HCI A;  3P20 A;  4BA1 I;  4CJ2 C;  1LYL A;  3F1Z A;  2HQE A;  1SNO A;  1JJC B;  2Q2I A;  4HIM A;  1PFB A;  3R2T A;  1PYW D;  2VW9 A;  2GVB A;  4YCU A;  4B3S L;  4LF7 L;  3TSS A;  2E2H H;  4RAU C;  3FVQ A;  2Z6K A;  3PQI A;  2NVQ B;  4A3K G;  1WOC A;  4B3T L;  2R92 B;  2VB3 X;  1LT4 D;  2UXD L;  4Z9C B;  1DM0 B;  3CPF A;  3S24 A;  2E2H B;  1SE3 A;  3VA7 A;  1JJ2 A;  1G8Z D;  3FPP A;  1GXD C;  5IIF A;  4BY7 G;  3I3C A;  2NVY B;  2C35 B;  4RGO S;  1I4H A;  1KQS A;  4YY3 L;  2HDM A;  1GUN A;  4ZLT F;  1E3P A;  3A7L A;  2Q8T A;  2YYZ A;  3QG1 A;  2DUD A;  2KHJ A;  3GTK B;  1PFN A;  1TQO A;  3KLS A;  1YJ9 A;  3WOE A;  5K5P A;  2JA6 G;  4RKL A;  3J7A 5;  5EQ0 A;  4EQ5 A;  1RL2 A;  5AJ3 L;  4IUN A;  3SK8 A;  5DNF A;  3J81 E;  3GTK H;  4F87 A;  4FF1 A;  5J3B A;  1VMP A;  1NJI C;  2JSO A;  4R4I A;  1S3O A;  2NBF A;  4BBS G;  2Z4I A;  4LUZ A;  1LTA D;  3F8T A;  2DN8 A;  1VQ7 A;  5C4J B;  1A3T A;  2KED A;  1ROD A;  3BYY B;  2CQA A;  1LT6 D;  3T13 A;  3L2P A;  5I9P A;  3DM1 A;  2F0U A;  3NBH B;  1L1O B;  2LY7 A;  5C0X I;  4KHP L;  4B3R Q;  2WFW A;  3M4O B;  4OEL B;  3QIA A;  4X64 Q;  3J80 E;  2F0J A;  1I94 L;  5C44 B;  2IX3 A;  3SVM A;  4B9W A;  2GN5 A;  2O2L D;  1X3F A;  4DR7 L;  1QUQ A;  2NYZ D;  1SNQ A;  4BBR G;  1SEB D;  2I46 A;  4LF8 Q;  3PO2 H;  4C3H B;  4IN3 A;  4DAY B;  1Q8K A;  2PI2 E;  5IYB H;  1X6O A;  1XTC D;  2RCN A;  1KD1 C;  3X3M A;  2Z6K C;  3M3Y H;  4DN4 M;  2Z6B A;  3PUV A;  3Q6S A;  3S2D H;  1GKH A;  1V8Q A;  2RSO A;  1DCZ A;  1ILQ A;  2I5L X;  4LUV A;  4DGZ A;  3OIP A;  1T5E A;  3HOU B;  3AFQ A;  4O2D A;  1VS0 A;  1PV4 A;  4YHH Q;  2UUA Q;  3EVQ A;  2EE1 A;  3WOF A;  1FD7 D;  2F0Q A;  4DR7 Q;  4GOP B;  2HCC A;  1HNW L;  3S2H B;  3J81 i;  4P71 A;  2JXM B;  2EYM A;  4S3S A;  4K6D A;  5M3F B;  5COR A;  1Y8O B;  1HNZ Q;  3H0G B;  2NVX H;  3M4Q A;  5M5W B;  5IYD H;  1CHP D;  1SYC A;  3KF6 A;  4JBK A;  1R9T B;  2ATW A;  4GS3 A;  3PIO 3;  1UAP A;  1G2S A;  3K5L A;  4QB4 A;  2F0L A;  4JW0 A;  1IYV A;  4DR1 L;  2R7Z G;  1WD1 A;  3TME A;  1A62 A;  1ICW A;  1R9T H;  1N34 Q;  1X3G A;  1SYB A;  4PZ8 A;  4HIK A;  1GJX A;  2IW3 A;  4J1M A;  3KK7 A;  1I4R A;  2I5H A;  4OX9 Q;  1G6P A;  4RGM A;  4ILW A;  3S16 H;  2R92 H;  4UP8 A;  1WCM H;  1IL2 A;  2J7Z A;  4UDU C;  4TSS A;  3NEL A;  1R4Q B;  3IL8 A;  4EX5 A;  4NPS A;  3VDY A;  1QIL A;  2R93 G;  2ZM6 L;  1HH2 P;  3OTO L;  3ZJY C;  3HOZ G;  1HUN A;  1K8O A;  4WJW A;  3OOC A;  3ULJ A;  2B63 H;  2OWO A;  3BDO A;  5KGU A;  2VUM B;  4G4K A;  1QJO A;  3A54 A;  2KCC A;  3PIP A;  3S1R H;  1PTO B;  3HOX H;  3K59 A;  1C8C A;  4B3R L;  2XTI A;  2JE6 I;  3EA6 A;  4KHV A;  2WB1 G;  4FYD A;  3BDL A;  4FP5 D;  3OIQ A;  1STB A;  1SYE A;  1AEX A;  1FNU A;  3WWV A;  4LF9 Q;  4OO1 I;  1GVP A;  1SN8 A;  3H94 A;  1QOH A;  4HCS A;  1M1K C;  1WTV A;  3CD6 A;  5BN3 A;  4HN7 A;  1V1Q A;  3S14 B;  4RCO A;  1NCV A;  1PTO F;  4NDX A;  3MA2 B;  4X66 Q;  1OTC A;  1KC8 C;  1TS5 A;  2F0M A;  3J81 c;  1QWY A;  1ENC A;  1CA5 A;  1JWU D;  3S14 H;  3AQQ A;  2UU9 L;  2B2T A;  2NVQ H;  1SND A;  2JEB I;  2GVA A;  4OIJ A;  1LT3 D;  2L0C A;  1HR0 W;  1WJJ A;  3I56 A;  4YHH L;  3RZD H;  4DUY L;  1TY0 A;  1RDP D;  1ESR A;  4OEM B;  1VQC A;  1SXT A;  2EQS A;  4X66 L;  3MEF A;  4G7Z C;  1B4O A;  3HRZ C;  3KDF A;  4JI0 L;  1D5X C;  4XQJ A;  2HHH Q;  2YTY A;  2D9U A;  4IUT A;  2A6H C;  4A3F B;  4PMB A;  1IL8 A;  1DZ1 A;  1PH4 A;  5KND A;  2E8G A;  2CH4 A;  5DAU A;  4DR4 Q;  1DON A;  4X64 L;  1GUS A;  2F0D A;  4V0B A;  3NQT A;  4DV5 Q;  1EQV A;  2VUM G;  1PHJ A;  3R93 A;  2EYJ A;  4P74 A;  2VQE Q;  1PZJ D;  5NUC A;  1G2T A;  3ONA B;  4JI7 Q;  1YNJ D;  2QCP X;  1GHJ A;  2LXJ A;  2BE5 D;  4WRD A;  2L1B A;  1N32 Q;  1ONL A;  4A3C H;  5CV9 A;  4R9W A;  3J7Y W;  2C5C A;  1BF4 A;  1U4M A;  2ZXO A;  4IPH A;  2JN4 A;  4DPG A;  4DUZ L;  1EY0 A;  5C3E H;  1TY2 A;  4JI8 L;  1KAB A;  5CV7 A;  2M9V A;  4GLV B;  3FKI H;  1STE A;  2HIV A;  1UEB A;  3DWA A;  2F1M A;  3ICE A;  2O5J C;  3CHB D;  2EJM A;  2JA9 A;  1C9O A;  3NWS A;  2JA7 H;  1ET9 A;  4OWT B;  2AMC B;  2EYF A;  1SNM A;  2UUC Q;  2CHB D;  1STY A;  4N9P A;  5C4X G;  4GN5 A;  1BVS A;  2ICI A;  5BN5 A;  3AB9 A;  4DV6 Q;  5FKA C;  4AIM A;  4B3T Q;  1Q90 A;  4L63 B;  3VA5 A;  5IP9 H;  1ZEQ X;  4DFA A;  4BY1 B;  1O7Y A;  3EN2 A;  4JBJ A;  3QOJ A;  5EBD A;  3S1M B;  4H7B A;  3HOW B;  1X32 A;  1A6X A;  1XPU A;  5JVH 3;  3IFT A;  2WB1 E;  4XTC S;  1B70 B;  5J22 A;  2CW0 D;  4ME5 A;  5BR8 Q;  1K83 H;  5C4X B;  1F9Q A;  2NN6 I;  1JOO A;  2O4X A;  1WTX A;  3Q8D A;  4OGQ C;  5M3M H;  4KHP Q;  2K5D A;  2HIX A;  4LFC L;  2RHS B;  2OT2 A;  5T1I A;  4KN7 C;  5D3D A;  1C4Q A;  1A2U A;  3Q23 A;  2E76 C;  2R93 B;  4I7Z C;  4FDB A;  4QMG A;  2NVX B;  4OXP A;  1M90 C;  4PNY A;  5M3M B;  4AYB B;  1PRT F;  2KOL A;  3GQB A;  5IWA L;  4A3L G;  4FXD A;  1I4X A;  3X3N A;  3GV3 A;  4JI8 Q;  3D4R A;  5T1G A;  1KHI A;  5DEH A;  5E3F A;  2MGS A;  1B2T A;  1PMR A;  3UE0 A;  1EIY B;  4QJF A;  4DR3 Q;  1CQF A;  2JA5 B;  1KRS A;  1EY8 A;  3J81 L;  3S16 B;  3D0F A;  5D65 A;  1HTL D;  4P72 A;  1GO3 E;  2ZJR A;  3VR3 A;  3M4O H;  1CKM A;  1B3Q A;  1K0R A;  1K3R A;  1F2Z A;  2X6G A;  3RLN A;  3MHB A;  2L15 A;  3UDI A;  4LF8 L;  2OF1 A;  1GD7 A;  2OQK A;  4HJ5 A;  2ES2 A;  4YWM A;  3CC4 A;  1ET6 A;  1FJG Q;  4YWK A;  3S1R B;  2IHF A;  1XPR A;  2N8N A;  1F2L A;  2B2Y A;  2EJF C;  4BBS B;  1SJH D;  3K7A B;  5IYD G;  1QB5 D;  4NKL A;  4HID A;  1PH3 A;  2NZO A;  3HFZ B;  4CDC C;  4G7O C;  5A2Q L;  3CF5 A;  3RLO A;  5FO7 B;  3SE0 A;  3ND8 A;  3HOU H;  1PYB A;  1TXY A;  1O78 A;  5IOD A;  3H0G G;  2UUC L;  2NN6 H;  4K14 A;  2HHH L;  1DYQ A;  3I70 A;  2EJG C;  3F2U A;  1V1P A;  1STN A;  4A3K B;  2PPB C;  2ID0 A;  1ASY A;  5FJ8 G;  4A3D B;  1OXX K;  2BOS A;  5KRU A; 
#chains in the Genus database with same CATH homology
 3J7A V;  1PDQ A;  3TBI B;  1B9M A;  3NTI A;  5CR3 A;  4FF3 A;  3DUZ A;  3G7L A;  4ODG A;  4XDX A;  3NE5 B;  5J1Z A;  3RLF A;  1I4G A;  5EKI A;  2QKI C;  1BDO A;  3A56 A;  3NWT A;  4K8I A;  1GUT A;  5CMD A;  1VF7 A;  1WCM B;  4QCL A;  3DMU A;  3M4Y A;  5C5M A;  4Q0F A;  4EQP A;  2KA7 A;  3FRP B;  1Q8I A;  5KNC A;  1I3Q B;  2X69 A;  1RJT A;  2IWH A;  3W2D A;  2HUG A;  1U4R A;  4DU9 A;  3VR6 A;  1PZK D;  2LS0 1;  1A2T A;  3SXH A;  2XWJ B;  5FLX E;  1BCP F;  3D6C A;  3BVG A;  2DNE A;  4KD4 A;  3R8B A;  4NP5 A;  3FEW X;  2RVL A;  2DY7 A;  1HQR D;  3I4L A;  1E0B A;  3VR4 A;  2K5W A;  4C3J B;  5BN4 A;  4IFD H;  4IQZ A;  1ZYR C;  1BNZ A;  2RDF A;  1V1P B;  1D1I A;  4IUQ A;  1MSH A;  2F0P A;  3E0J A;  1F2M A;  2K6A A;  2WAQ B;  4RHR A;  3TZD A;  3I8Z A;  4RFB A;  1S5C D;  2O5I C;  1J8I A;  3GP7 A;  4XYO A;  3T16 A;  1O7Z A;  1PZI D;  3BDC A;  1S5D D;  4FXK C;  1T5X D;  3NBI A;  2AQ2 B;  4ZRZ A;  2XSC A;  2LMC B;  4CKE A;  4XYQ A;  1JC7 A;  2ICE C;  1LLR D;  1KLG D;  2V4D A;  2A68 D;  4C1N I;  2R3Z A;  3MXN A;  2B2W A;  3I4M B;  3JAM L;  4J6H A;  5IT9 E;  1U4L A;  4K6L A;  4GZY C;  5C3W A;  3MXG A;  3NK9 A;  1HXY D;  3I91 A;  3S1N B;  5ISR A;  5C3E B;  2L4N A;  3W3A A;  1AZQ A;  4OO1 G;  1IW7 D;  2Q8I B;  1H9J A;  3OWF A;  4F88 A;  1SFO B;  5CBE E;  2K03 A;  4ZAI A;  5M5X B;  3C46 A;  2XRQ D;  2PMZ B;  2XN9 C;  4LAA A;  4C1N K;  1BCP B;  2RDG A;  1BXT A;  1TWG B;  3QOL A;  3M3Y B;  2XNA C;  1BCP C;  2WII B;  3K5O A;  4MHE A;  4MIU A;  1EFI D;  1SNP A;  2RSN A;  1RF2 D;  3OMC A;  4ZKC B;  5EBC A;  1LAC A;  3GD7 A;  1EWC A;  3H91 A;  4L8J A;  4IUU A;  2F0W A;  3HS0 C;  4E6I A;  3HG9 A;  4H0L C;  3JAM E;  3A8J E;  4ABN A;  4K5W A;  3V05 A;  3PUZ A;  3L7Z C;  3I4N B;  2Y0S B;  2KJX A;  4ID6 A;  4QUC A;  5D3I B;  4ZQ3 A;  3GTG B;  4EVO A;  3D4W A;  4KKU A;  3RD4 A;  1JWM D;  2AWO A;  4RGN A;  1NAP A;  3BYT B;  3NXW A;  4H44 C;  1IYU A;  2C9O A;  3TDQ A;  1I50 B;  1ESF A;  4HTH A;  1EU3 A;  1Q1B A;  3V96 A;  4LK1 C;  2XIW A;  1SBB B;  2KQ3 A;  4ZKB B;  2M2L A;  2N88 A;  1BUV T;  3TZU A;  3T51 B;  1IKL A;  3NTK A;  2B2V C;  1SJE D;  1MSG A;  1X3P A;  3A8I E;  5KIX A;  3QWN A;  3VR2 A;  4J8Q A;  2XRS D;  1PTO C;  1FNV A;  1HFG A;  1KDA A;  2A74 C;  2K28 A;  3N6R A;  3M85 A;  1EYA A;  5CV8 A;  4C2M B;  3C2P A;  3VYR A;  3A55 A;  3GTM B;  2WV6 D;  2PCF B;  1B44 D;  3Q22 A;  5A35 A;  1F9R A;  1U4P A;  4HR7 B;  1AW7 A;  5ELE A;  2R7Z B;  3PV0 A;  5EPK A;  1LTT D;  1FYC A;  1KLU D;  3T4A C;  3AMU A;  2K7V A;  4OIK A;  2Z8L A;  2LKV A;  3MWY W;  1FGB D;  1ENA A;  4IUV A;  1Y69 U;  2CVR A;  3KLR A;  2EY6 A;  3P75 A;  4PV1 C;  4DAY A;  1TT2 A;  2GA4 B;  3HEJ A;  1TII D;  5M9O A;  4KJN A;  1H9S B;  2BDN A;  2F3V A;  3TP7 A;  4I65 A;  1HHV A;  4A3I B;  4KD3 A;  3SR1 A;  3P7J A;  1I4P A;  4K8J A;  1RHP A;  1LTB D;  4WFN 3;  3HOV B;  2EVB A;  3S2D B;  1EY7 A;  2B2T C;  1B3A A;  4PQX A;  2BE5 C;  5IGE A;  4CGY B;  1JR0 D;  2QF7 A;  1PRT B;  4BBR B;  3LWU A;  1G29 1;  1XX8 A;  1EQT A;  4A3E B;  2BCO A;  5IGD A;  1VDZ A;  5EPL A;  3TP6 A;  2BDO A;  1OO9 B;  1CK1 A;  5HUR A;  5KNB A;  5I6W A;  1Y1W B;  4XQN A;  4HSV A;  4V19 0;  2OEO A;  1GUG A;  2SNS A;  4M8A A;  3LNN A;  4DAP A;  1S5F D;  5KYI A;  4QF4 A;  1DD2 A;  4A3B B;  1OXS C;  2QIL A;  2IX1 A;  2EY1 A;  3R3O A;  2XWB B;  3KBX A;  1LTG D;  1QG7 A;  2B2U C;  2EYO A;  4HMJ A;  1Q1E A;  1X3Q A;  2A6E C;  1TKW B;  5IGG A;  5J39 A;  5JPM C;  1TS2 A;  5COY A;  1JOQ A;  2K33 A;  2CW0 C;  3EQL C;  4TKO B;  2BA0 A;  5EKL A;  4KY6 A;  1YNN D;  4UAI A;  1DOL A;  4CJ0 B;  2PQE A;  1YNN C;  1SNC A;  1KNE A;  3S17 B;  1OXT A;  5I6Y A;  1AN8 A;  4DXF A;  1M8A A;  4IUR A;  1VMC A;  2B2Y C;  3K57 A;  1EY5 A;  4QUF A;  2K04 A;  1GOZ A;  2TMP A;  3KLS X;  1STA A;  5JEA G;  5F2D A;  3I72 A;  4ZK9 B;  1EY9 A;  1ML0 D;  2FHT A;  3C1F A;  5FOB B;  2F0K A;  1RKN A;  3K0Y A;  1JOK A;  1SYF A;  1XWE A;  1DOK A;  3HOY B;  4C3J G;  4DNR B;  5EKK A;  4CHT B;  1EY4 A;  3L3O C;  3DXJ C;  3RZO B;  4G57 A;  1UNS A;  4HED A;  4U68 A;  3U9S A;  4IAL A;  4C3I G;  3GTJ B;  2F4I A;  4K2K A;  3D3R A;  2VXW A;  4IZ8 A;  2K5Q A;  2B8G A;  1MI2 A;  3U9O A;  2PO4 A;  3O13 A;  1YNJ C;  2PW7 A;  4DF7 A;  1PFM A;  3ITP A;  5CV6 A;  1SYG A;  1J9O A;  4BY7 B;  3V2T A;  4A93 B;  1B1Z A;  4XT3 B;  3K5M A;  5E4W C;  1Y1V B;  1LT5 D;  4O42 A;  2F0V A;  3OW7 A;  1A3V A;  2ZXP A;  4KHZ A;  1BQQ T;  2WKC A;  1D6E C;  1TR5 A;  3EJI A;  1QCB D;  3NTH A;  3MAQ A;  1Q3L A;  1SMY D;  1BBX C;  2L5T A;  2JA6 B;  1Q12 A;  2RA4 A;  4LMQ D;  2IJ0 A;  2FMM A;  2F0T A;  1R4P B;  2EY5 A;  1EIG A;  2ENB A;  3K5N A;  2RKS A;  1H9M A;  5E4X A;  1EZ8 A;  1W6K A;  2DY8 A;  2BA1 A;  5FO8 B;  1F2Y A;  1FR3 A;  2JA8 B;  2Q8R E;  3CRK C;  2F0F A;  1UUP A;  4EGV A;  1TWF B;  1EYD A;  1I4Q A;  2NTT A;  3OPO A;  1HUM A;  2TSS A;  3M7N A;  4A3G B;  5K36 H;  1NR2 A;  4LJZ C;  1QNK A;  3IAY A;  3I90 A;  3SK4 A;  3G6J B;  3T53 B;  2FMC A;  2F0E A;  3OWE B;  1B53 A;  1BO0 A;  2KVM A;  4P2C B;  1OXU A;  1EIH A;  4JBW A;  2L12 A;  5CV5 A;  5C4Z A;  4K2L A;  2RBM A;  2JEA I;  2F0S A;  1Z6H A;  4L6T B;  1ZKO A;  2N55 A;  5C0X H;  1LO5 D;  3K58 A;  1MBY A;  2Z1C A;  2FFK B;  2A73 B;  2B2U A;  3DHQ A;  3DWQ A;  1HRJ A;  5JVG 3;  2IX0 A;  5M5Y B;  4TRD A;  5D14 A;  2AQ1 B;  1AZP A;  1CM9 A;  1RTN A;  4XXE A;  4OHJ A;  2AUJ D;  3Q0A A;  2RDH A;  4X3K A;  2E2I B;  1HA6 A;  1TVX A;  2NTS A;  2D62 A;  3MZ5 A;  4C56 C;  4A3J B;  1IW7 C;  1XYI A;  2F03 A;  2E2J B;  5CBA E;  5EJW A;  5JEA J;  3AU7 A;  1LTR D;  1Y8N B;  5CV4 A;  4X3U A;  2QDB A;  3SEB A;  1KDC A;  1LTS D;  2B2V A;  1IKM A;  4U67 3;  5I9O A;  5FK9 C;  3KF8 A;  2G9H D;  4F7X A;  1PRT C;  4IUP A;  3GV6 A;  1SMY C;  4M1U B;  3P1H A;  2NVT B;  5LL6 S;  3RUZ A;  1ENF A;  4BS9 A;  1KTK A;  4R8I A;  3MTS A;  1GHK A;  1O7L A;  3MFG A;  2VNU D;  4KJO A;  1S5B D;  4RCN A;  4FVM A;  4FNF A;  3D4D A;  3HOZ B;  3TP8 A;  2R6G A;  5JAV A;  4RWS C;  1SSO A;  4KKS A;  1ZYR D;  2Z4H A;  1JQY D;  1TWH B;  4X3S A;  5K36 G;  3VR5 A;  2IT1 A;  2E75 C;  2F0N A;  1HTP A;  2NWG A;  3RMH A;  2PNR C;  5AFW A;  1D2B A;  2WB1 B;  4K5V A;  2MJ8 A;  1LV9 A;  3MXU A;  2JP1 A;  2WKD A;  4HSP A;  3S1Q B;  1JOR A;  1ILP A;  3C3L A;  3I73 A;  1HFN A;  2QEJ C;  2IL8 A;  2ZXR A;  4BA2 I;  3QO2 A;  3SK6 A;  2A68 C;  3FDT A;  2WAC A;  3VYU A;  1W6J A;  2R61 A;  3ERO A;  2WP8 J;  5ELD A;  3E6Z X;  1TU2 B;  3Q24 A;  3N52 A;  1MD2 D;  1RD9 D;  3H09 A;  1SYD A;  1FNW A;  1AFP A;  5IGF A;  1E2Z A;  2L11 A;  3PIP 3;  5IOC A;  5JJZ A;  1GUO A;  5KEE A;  4ZUJ A;  2EOT A;  1KNA A;  4IFD J;  2PZU A;  1CZW A;  4C3I B;  2G9D A;  1L0X B;  3PUW A;  4JK1 C;  1Y8P B;  4DK0 A;  3MC0 B;  2EY2 A;  3QJY A;  5CGK A;  1KDB A;  3CKI B;  4OL7 A;  2L55 A;  3H6M A;  2A6H D;  1MGS A;  4XIG S;  5C3X A;  3PMF A;  1NSN S;  2NZ1 D;  2F0H A;  2F0G A;  3UI2 A;  2FJ2 A;  4CKB A;  3CU7 A;  3J80 L;  2EYH A;  1BOS A;  3VYS A;  2EZV A;  2H4O A;  4R8N A;  1RTO A;  1NR4 A;  4O1N A;  4KY5 A;  3MXP A;  2KHS A;  1EWH A;  5TSS A;  2XVS A;  3QB3 A;  3NPP A;  3GTL B;  1H9K A;  3C1E A;  3ZYY X;  1E2V A;  4CKC A;  3VYT A;  3S9W A;  1U9R A;  4PMC A;  4NMZ A;  2JA7 B;  2A69 D;  5IT9 L;  4KK7 A;  2F3W A;  4ULL A;  1JCK B;  5EGT A;  1OXV A;  1STG A;  5FO9 B;  1WTR A;  4HCE A;  3CRL C;  1B50 A;  3DEO A;  4WOR A;  3H3V C;  1CHQ D;  3MVV A;  4XT1 B;  3WDN A;  2K1B A;  2SNM A;  3ERQ A;  3LWE A;  1DJR D;  5JEA H;  1F9P A;  1H9R A;  3TP5 A;  5EPJ A;  1WTW A;  3HKZ B;  1E2W A;  1PTO D;  3NUC A;  2YU9 B;  3DWP A;  4DXG A;  2OXP A;  3A7A B;  3NSW A;  1VCI A;  5C5L A;  4KTA A;  4YIJ A;  4K5X A;  1JE4 A;  5JPN C;  1LAB A;  1QE6 A;  1D1K A;  5HGT A;  4B9X A;  3GTP B;  4C3H G;  1WTQ A;  4KV6 A;  2D5D A;  3NP8 A;  3GTO B;  1G6Z A;  5I4D A;  4RKB A;  5FLX L;  3A8K E;  2NUC A;  4RH6 A;  3PUX A;  2SDF A;  3CQZ B;  2MPM A;  3SHL A;  1CZG A;  1TWA B;  4MN3 A;  5E1F A;  3DEP A;  2B2W C;  4ZUI A;  5CC4 A;  1SE2 A;  4KMU C;  2AWN A;  3SK5 A;  5I2Y A;  2AUK A;  2A69 C;  3MEH A;  1D5Z C;  1A3U A;  5G3L D;  2B8F A;  2EPB A;  1EZ6 A;  1F9S A;  1S5E D;  5ELB A;  3T56 B;  1D5M C;  5A2Q E;  1EOT A;  2MUY A;  3J7A F;  1B9N A;  3LX0 A;  1F77 A;  3PUY A;  5C0X J;  2NN6 G;  3L9A X;  4FXG C;  1TWC B;  5C6A A;  2D2C C;  2PYK A;  1NUC A;  2EDG A;  1CI3 M;  5ELC A;  4A3M B;  2A5H A;  3HGB A;  1TS3 A;  3GTQ B;  4N9T A;  3E5S A;  4PMW A;  5DM6 3;  5G3L F;  1AP0 A;  3BS1 A;  1M4V A;  3D6W A;  2X6L A;  4DA2 A;  4NW2 A;  1Z7T A;  4BWG B;  2HDL A;  2H1E A;  5JOB A;  1CA6 A;  4FO2 A;  5IGC A;  4FF4 A;  2MP1 A;  3NHH A;  2FIN B;  1CTM A;  1H9S A;  2K05 A;  1GUW A;  4KI0 A;  1LTI D;  2J4X A;  1PRT D;  3SDZ A;  4X3T A;  4IFD G;  2MHV A;  4IFD I;  2EXZ A;  3OMG A;  3IFD A;  1K8M A;  4KKT A;  5C0X G;  4DNT B;  2RQX A;  1HA5 A;  3PO3 B;  2E74 C;  4CBV A;  3BVM A;  2KEE A;  2SEB D;  4Q5V A;  1HPC A;  1RCV D;  1S4Z A;  4OO1 H;  1EY6 A;  2A6E D;  5LL6 X;  4EQO A;  2J0T D;  3GO5 A;  1WVL A;  1PXU A;  4KN4 C;  1JB3 A;  1HQM C;  4B08 A;  5CYU A;  5LHY 1;  3KUP A;  3ND9 A;  2K32 A;  1G91 A;  1JIC A;  1TS4 A;  2EYL A;  4G7H C;  1DOM A;  1HCZ A;  2M00 A;  2WIN B;  5IGB A;  3R2I A;  1VF5 C;  1A15 A;  4RHS A;  2SOB A;  1O80 A;  4HAE A;  1EEI D;  3IKJ A;  1XXG A;  2PZW A;  3OHX C;  3URY A;  1C48 A;  1WTO A;  1I6H B;  4RGT A;  4XQQ A;  4DAV A;  2IPK D;  1CQV A;  2E2D C;  1DXM A;  3EFX D;  2JYO A;  4Y7N B;  2K01 A;  3FPU B;  5KYL A;  3BVZ A;  1V43 A;  1ZXT A;  1PLF A;  3KBG A;  2PZT A;  4RA8 A;  2EYP A;  3OSO A;  1BR9 A;  1SDF A;  2KCN A;  4H13 C;  3D8G A;  2B39 A;  1STH A;  4TQU S;  1WTP A;  1Z47 A;  1SAP A;  2LFN A;  3TN2 A;  1EU4 A;  1L0Y B;  3RZD B;  3HZX A;  1SE4 A;  1CFM A;  4ZYS A;  3NQI A;  4F8M A;  1KAA A;  3PO2 B;  1I6V C;  1QNU A;  3MFY A;  2VB2 X;  4FF2 A;  4KY7 A;  1EEF D;  3M7G A;  5C4H A;  5DM7 3;  1BCP D;  3D31 A;  4DK1 A;  2I07 B;  4CJ1 B;  1EL0 A;  4EQN A;  2B63 B;  1JWS D;  5I2X A;  3S15 B;  1V1O A;  2AQ3 B;  1K83 B;  2PW5 A;  3NBH A;  4QIW B;  2KEC A;  2DNC A;  3FMC A;  2F0I A;  2L9H A;  3BG3 A;  1PTO H;  3HOX B;  2NB0 A;  2F0O A;  5ELF A;  1IHZ A;  3BZD B;  3K6O A;  2ZT9 C;  1CT1 D;  1II3 A;  1WD0 A;  3FKI B;  1UEA B;  2KUM A;  4HMI A;  3HP3 A;  1EYC A;  2HCI A;  3P20 A;  4BA1 I;  4CJ2 C;  2HQE A;  1SNO A;  1PFB A;  1PYW D;  3R2T A;  3TSS A;  4RAU C;  3FVQ A;  2NVQ B;  2R92 B;  2VB3 X;  1LT4 D;  4Z9C B;  1DM0 B;  2E2H B;  1SE3 A;  3VA7 A;  1G8Z D;  3FPP A;  1GXD C;  5IIF A;  3I3C A;  2NVY B;  4RGO S;  1I4H A;  2HDM A;  1GUN A;  4ZLT F;  3A7L A;  2Q8T A;  2YYZ A;  3QG1 A;  3GTK B;  1PFN A;  1TQO A;  3KLS A;  3WOE A;  5K5P A;  4RKL A;  5EQ0 A;  4IUN A;  3SK8 A;  5DNF A;  3J81 E;  4F87 A;  4FF1 A;  1VMP A;  2JSO A;  2NBF A;  2Z4I A;  1LTA D;  2DN8 A;  5C4J B;  1A3T A;  2KED A;  1ROD A;  3BYY B;  2CQA A;  1LT6 D;  3T13 A;  5I9P A;  3DM1 A;  2F0U A;  2LY7 A;  5C0X I;  3M4O B;  3QIA A;  3J80 E;  2F0J A;  5C44 B;  2IX3 A;  3SVM A;  4B9W A;  2O2L D;  2NYZ D;  1SNQ A;  1SEB D;  2I46 A;  4C3H B;  4IN3 A;  1XTC D;  3X3M A;  4DN4 M;  3PUV A;  3Q6S A;  1V8Q A;  2RSO A;  1DCZ A;  1ILQ A;  4DGZ A;  3OIP A;  1T5E A;  3HOU B;  3EVQ A;  2EE1 A;  3WOF A;  1FD7 D;  2F0Q A;  2HCC A;  3S2H B;  2JXM B;  2EYM A;  4S3S A;  4K6D A;  5M3F B;  5COR A;  1Y8O B;  3H0G B;  5M5W B;  1CHP D;  1SYC A;  1R9T B;  3PIO 3;  1UAP A;  1G2S A;  3K5L A;  4QB4 A;  2F0L A;  1IYV A;  1WD1 A;  3TME A;  1ICW A;  1SYB A;  1GJX A;  2IW3 A;  4J1M A;  3KK7 A;  1I4R A;  4RGM A;  4ILW A;  2J7Z A;  4UDU C;  4TSS A;  1R4Q B;  3IL8 A;  1QIL A;  1HUN A;  1K8O A;  4WJW A;  3OOC A;  3BDO A;  5KGU A;  2VUM B;  4G4K A;  1QJO A;  3A54 A;  2KCC A;  3K59 A;  1PTO B;  1C8C A;  2JE6 I;  3EA6 A;  4KHV A;  4FYD A;  3BDL A;  4FP5 D;  3OIQ A;  1STB A;  1SYE A;  1AEX A;  1FNU A;  4OO1 I;  3H94 A;  1QOH A;  4HCS A;  1WTV A;  5BN3 A;  4HN7 A;  3S14 B;  4RCO A;  1NCV A;  1PTO F;  4NDX A;  3MA2 B;  1TS5 A;  2F0M A;  1QWY A;  1ENC A;  1CA5 A;  1JWU D;  2B2T A;  1SND A;  2JEB I;  4OIJ A;  1LT3 D;  2L0C A;  1TY0 A;  1RDP D;  1ESR A;  1SXT A;  4G7Z C;  1B4O A;  3HRZ C;  1D5X C;  4XQJ A;  2D9U A;  4IUT A;  2A6H C;  4A3F B;  4PMB A;  1IL8 A;  1DZ1 A;  5KND A;  5DAU A;  1DON A;  1GUS A;  2F0D A;  4V0B A;  3NQT A;  1EQV A;  3R93 A;  2EYJ A;  1PZJ D;  5NUC A;  1G2T A;  3ONA B;  1YNJ D;  2QCP X;  1GHJ A;  4WRD A;  2BE5 D;  2L1B A;  1ONL A;  5CV9 A;  4R9W A;  3J7Y W;  2C5C A;  1BF4 A;  1U4M A;  2ZXO A;  1EY0 A;  1TY2 A;  1KAB A;  5CV7 A;  2M9V A;  1STE A;  3DWA A;  2F1M A;  2O5J C;  3CHB D;  2EJM A;  3NWS A;  1ET9 A;  2EYF A;  1SNM A;  2CHB D;  1STY A;  4N9P A;  5BN5 A;  2ICI A;  3AB9 A;  5FKA C;  1Q90 A;  4L63 B;  3VA5 A;  1ZEQ X;  4DFA A;  4BY1 B;  1O7Y A;  3QOJ A;  5EBD A;  3S1M B;  4H7B A;  3HOW B;  1X32 A;  1A6X A;  5JVH 3;  3IFT A;  4XTC S;  5J22 A;  2CW0 D;  4ME5 A;  5C4X B;  1F9Q A;  2NN6 I;  1JOO A;  2O4X A;  1WTX A;  4OGQ C;  2K5D A;  2OT2 A;  5T1I A;  4KN7 C;  5D3D A;  1C4Q A;  1A2U A;  3Q23 A;  2E76 C;  2R93 B;  4I7Z C;  2NVX B;  4QMG A;  4PNY A;  5M3M B;  4AYB B;  1PRT F;  2KOL A;  3GQB A;  4FXD A;  1I4X A;  3X3N A;  3GV3 A;  3D4R A;  5T1G A;  5DEH A;  5E3F A;  2MGS A;  1B2T A;  1PMR A;  1CQF A;  2JA5 B;  1EY8 A;  3J81 L;  3S16 B;  5D65 A;  1HTL D;  3VR3 A;  1F2Z A;  2X6G A;  3MHB A;  2OF1 A;  1ET6 A;  3S1R B;  1F2L A;  2B2Y A;  2EJF C;  4BBS B;  1SJH D;  3K7A B;  1QB5 D;  4NKL A;  4G7O C;  5A2Q L;  5FO7 B;  3SE0 A;  3ND8 A;  1O78 A;  5IOD A;  2NN6 H;  4K14 A;  1DYQ A;  3I70 A;  2EJG C;  4A3K B;  2PPB C;  1STN A;  1V1P A;  3F2U A;  2ID0 A;  4A3D B;  1OXX K;  2BOS A;  5KRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...